data_1X0O
# 
_entry.id   1X0O 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1X0O         
RCSB  RCSB024231   
WWPDB D_1000024231 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1X0O 
_pdbx_database_status.recvd_initial_deposition_date   2005-03-25 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Card, P.B.'    1 
'Erbel, P.J.'   2 
'Gardner, K.H.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Structural Basis of ARNT PAS-B Dimerization: Use of a Common Beta-sheet Interface for Hetero- and Homodimerization.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            353 
_citation.page_first                664 
_citation.page_last                 677 
_citation.year                      2005 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16181639 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2005.08.043 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Card, P.B.'    1 
primary 'Erbel, P.J.'   2 
primary 'Gardner, K.H.' 3 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 nat 
_entity.pdbx_description           'Aryl hydrocarbon receptor nuclear translocator' 
_entity.formula_weight             13956.701 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'C-TERMINAL PAS DOMAIN' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'ARNT protein, Dioxin receptor, nuclear translocator, Hypoxia-inducible factor 1 beta, HIF-1 beta' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRS
KNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GAMDNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRS
KNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   ASP n 
1 5   ASN n 
1 6   VAL n 
1 7   CYS n 
1 8   GLN n 
1 9   PRO n 
1 10  THR n 
1 11  GLU n 
1 12  PHE n 
1 13  ILE n 
1 14  SER n 
1 15  ARG n 
1 16  HIS n 
1 17  ASN n 
1 18  ILE n 
1 19  GLU n 
1 20  GLY n 
1 21  ILE n 
1 22  PHE n 
1 23  THR n 
1 24  PHE n 
1 25  VAL n 
1 26  ASP n 
1 27  HIS n 
1 28  ARG n 
1 29  CYS n 
1 30  VAL n 
1 31  ALA n 
1 32  THR n 
1 33  VAL n 
1 34  GLY n 
1 35  TYR n 
1 36  GLN n 
1 37  PRO n 
1 38  GLN n 
1 39  GLU n 
1 40  LEU n 
1 41  LEU n 
1 42  GLY n 
1 43  LYS n 
1 44  ASN n 
1 45  ILE n 
1 46  VAL n 
1 47  GLU n 
1 48  PHE n 
1 49  CYS n 
1 50  HIS n 
1 51  PRO n 
1 52  GLU n 
1 53  ASP n 
1 54  GLN n 
1 55  GLN n 
1 56  LEU n 
1 57  LEU n 
1 58  ARG n 
1 59  ASP n 
1 60  SER n 
1 61  PHE n 
1 62  GLN n 
1 63  GLN n 
1 64  VAL n 
1 65  VAL n 
1 66  LYS n 
1 67  LEU n 
1 68  LYS n 
1 69  GLY n 
1 70  GLN n 
1 71  VAL n 
1 72  LEU n 
1 73  SER n 
1 74  VAL n 
1 75  MET n 
1 76  PHE n 
1 77  ARG n 
1 78  PHE n 
1 79  ARG n 
1 80  SER n 
1 81  LYS n 
1 82  ASN n 
1 83  GLN n 
1 84  GLU n 
1 85  TRP n 
1 86  LEU n 
1 87  TRP n 
1 88  MET n 
1 89  ARG n 
1 90  THR n 
1 91  SER n 
1 92  SER n 
1 93  PHE n 
1 94  THR n 
1 95  PHE n 
1 96  GLN n 
1 97  ASN n 
1 98  PRO n 
1 99  TYR n 
1 100 SER n 
1 101 ASP n 
1 102 GLU n 
1 103 ILE n 
1 104 GLU n 
1 105 TYR n 
1 106 ILE n 
1 107 ILE n 
1 108 CYS n 
1 109 THR n 
1 110 ASN n 
1 111 THR n 
1 112 ASN n 
1 113 VAL n 
1 114 LYS n 
1 115 ASN n 
1 116 SER n 
1 117 SER n 
1 118 GLN n 
1 119 GLU n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                human 
_entity_src_nat.pdbx_organism_scientific   'Homo sapiens' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9606 
_entity_src_nat.genus                      Homo 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ARNT_HUMAN 
_struct_ref.pdbx_db_accession          P27540 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;NVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQE
WLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQE
;
_struct_ref.pdbx_align_begin           356 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1X0O 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 5 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 119 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P27540 
_struct_ref_seq.db_align_beg                  356 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  470 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       5 
_struct_ref_seq.pdbx_auth_seq_align_end       119 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1X0O GLY A 1 ? UNP P27540 ? ? 'CLONING ARTIFACT' 1 1 
1 1X0O ALA A 2 ? UNP P27540 ? ? 'CLONING ARTIFACT' 2 2 
1 1X0O MET A 3 ? UNP P27540 ? ? 'CLONING ARTIFACT' 3 3 
1 1X0O ASP A 4 ? UNP P27540 ? ? 'CLONING ARTIFACT' 4 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1  1 '3D_15N_13C-seperated NOESY' 1 
2  1 3D_15N-separated_NOESY       1 
3  1 HNHA                         1 
4  1 '3D HNCACB'                  1 
5  1 '3D CBCA(CO)NH'              1 
6  1 '3D HNCO'                    1 
7  1 '3D_15N-seperated TOCSY'     1 
8  1 '3D HCCH-TOCSY'              1 
9  1 HBCBCGCDHD                   1 
10 2 IPAP_HSQC                    2 
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1 298 ambient 6.5 '17mM NaCl' . K 
2 310 ambient 6.6 '17mM NaCl' . K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '1mM hARNT C-term PAS Domain U-15N,13C; 50mM Tris buffer; 17mM NaCl, 5mM DTT' '90% H2O/10% D2O' 
2 '0.478mM hARNT C-term PAS Domain U-15N; 50mM Tris buffer; 17mM NaCl, 5mM DTT' '93% H2O/7% D2O'  
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 INOVA Varian 500 ? 
2 INOVA Varian 600 ? 
# 
_pdbx_nmr_refine.entry_id           1X0O 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1X0O 
_pdbx_nmr_details.text       'Used standard 2D and 3D homonuclear and heteronuclear-edited techniques' 
# 
_pdbx_nmr_ensemble.entry_id                                      1X0O 
_pdbx_nmr_ensemble.conformers_calculated_total_number            1000 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1X0O 
_pdbx_nmr_representative.conformer_id         5 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
processing           NMRPipe 2.3   Delaglio 1 
'data analysis'      NMRView 5.2.2 Johnson  2 
'structure solution' ARIA    1.2   Nilges   3 
'structure solution' CNS     1.1   Brunger  4 
refinement           CNS     1.1   ?        5 
# 
_exptl.entry_id          1X0O 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1X0O 
_struct.title                     'human ARNT C-terminal PAS domain' 
_struct.pdbx_descriptor           'Aryl hydrocarbon receptor nuclear translocator' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1X0O 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            
'PAS, mixed alpha-beta fold, hypoxia, aryl hydrocarbon receptor nuclear translocator, ARNT, TRANSCRIPTION' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 28 ? GLY A 34 ? ARG A 28 GLY A 34 1 ? 7  
HELX_P HELX_P2 2 GLN A 36 ? LEU A 41 ? GLN A 36 LEU A 41 1 ? 6  
HELX_P HELX_P3 3 ASP A 53 ? LYS A 68 ? ASP A 53 LYS A 68 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 22  ? VAL A 25  ? PHE A 22  VAL A 25  
A 2 GLU A 11  ? HIS A 16  ? GLU A 11  HIS A 16  
A 3 ILE A 103 ? ASN A 112 ? ILE A 103 ASN A 112 
A 4 TRP A 85  ? GLN A 96  ? TRP A 85  GLN A 96  
A 5 LEU A 72  ? ARG A 79  ? LEU A 72  ARG A 79  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE A 24  ? O PHE A 24  N ARG A 15  ? N ARG A 15  
A 2 3 N SER A 14  ? N SER A 14  O CYS A 108 ? O CYS A 108 
A 3 4 O THR A 111 ? O THR A 111 N ARG A 89  ? N ARG A 89  
A 4 5 O THR A 90  ? O THR A 90  N VAL A 74  ? N VAL A 74  
# 
_database_PDB_matrix.entry_id          1X0O 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1X0O 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? -12.566 17.754  5.442   1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? -11.267 17.507  4.773   1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? -11.447 17.091  3.331   1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? -12.162 17.756  2.578   1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? -12.410 18.008  6.443   1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H H2   . GLY A 1 1   ? -13.159 16.899  5.401   1.00 0.00 ? 1   GLY A H2   1  
ATOM 7     H H3   . GLY A 1 1   ? -13.066 18.533  4.973   1.00 0.00 ? 1   GLY A H3   1  
ATOM 8     H HA2  . GLY A 1 1   ? -10.678 18.410  4.805   1.00 0.00 ? 1   GLY A HA2  1  
ATOM 9     H HA3  . GLY A 1 1   ? -10.742 16.724  5.303   1.00 0.00 ? 1   GLY A HA3  1  
ATOM 10    N N    . ALA A 1 2   ? -10.796 15.993  2.953   1.00 0.00 ? 2   ALA A N    1  
ATOM 11    C CA   . ALA A 1 2   ? -10.908 15.429  1.608   1.00 0.00 ? 2   ALA A CA   1  
ATOM 12    C C    . ALA A 1 2   ? -10.448 16.421  0.541   1.00 0.00 ? 2   ALA A C    1  
ATOM 13    O O    . ALA A 1 2   ? -11.240 16.886  -0.283  1.00 0.00 ? 2   ALA A O    1  
ATOM 14    C CB   . ALA A 1 2   ? -12.333 14.964  1.335   1.00 0.00 ? 2   ALA A CB   1  
ATOM 15    H H    . ALA A 1 2   ? -10.208 15.547  3.607   1.00 0.00 ? 2   ALA A H    1  
ATOM 16    H HA   . ALA A 1 2   ? -10.265 14.561  1.568   1.00 0.00 ? 2   ALA A HA   1  
ATOM 17    H HB1  . ALA A 1 2   ? -12.996 15.817  1.340   1.00 0.00 ? 2   ALA A HB1  1  
ATOM 18    H HB2  . ALA A 1 2   ? -12.639 14.267  2.101   1.00 0.00 ? 2   ALA A HB2  1  
ATOM 19    H HB3  . ALA A 1 2   ? -12.376 14.482  0.370   1.00 0.00 ? 2   ALA A HB3  1  
ATOM 20    N N    . MET A 1 3   ? -9.166  16.746  0.566   1.00 0.00 ? 3   MET A N    1  
ATOM 21    C CA   . MET A 1 3   ? -8.580  17.632  -0.430  1.00 0.00 ? 3   MET A CA   1  
ATOM 22    C C    . MET A 1 3   ? -7.901  16.822  -1.521  1.00 0.00 ? 3   MET A C    1  
ATOM 23    O O    . MET A 1 3   ? -7.351  15.752  -1.271  1.00 0.00 ? 3   MET A O    1  
ATOM 24    C CB   . MET A 1 3   ? -7.570  18.585  0.216   1.00 0.00 ? 3   MET A CB   1  
ATOM 25    C CG   . MET A 1 3   ? -8.215  19.726  0.982   1.00 0.00 ? 3   MET A CG   1  
ATOM 26    S SD   . MET A 1 3   ? -9.227  20.780  -0.078  1.00 0.00 ? 3   MET A SD   1  
ATOM 27    C CE   . MET A 1 3   ? -9.866  21.949  1.116   1.00 0.00 ? 3   MET A CE   1  
ATOM 28    H H    . MET A 1 3   ? -8.590  16.374  1.269   1.00 0.00 ? 3   MET A H    1  
ATOM 29    H HA   . MET A 1 3   ? -9.378  18.208  -0.872  1.00 0.00 ? 3   MET A HA   1  
ATOM 30    H HB2  . MET A 1 3   ? -6.951  18.025  0.900   1.00 0.00 ? 3   MET A HB2  1  
ATOM 31    H HB3  . MET A 1 3   ? -6.946  19.007  -0.558  1.00 0.00 ? 3   MET A HB3  1  
ATOM 32    H HG2  . MET A 1 3   ? -8.841  19.313  1.761   1.00 0.00 ? 3   MET A HG2  1  
ATOM 33    H HG3  . MET A 1 3   ? -7.436  20.328  1.427   1.00 0.00 ? 3   MET A HG3  1  
ATOM 34    H HE1  . MET A 1 3   ? -9.046  22.463  1.592   1.00 0.00 ? 3   MET A HE1  1  
ATOM 35    H HE2  . MET A 1 3   ? -10.441 21.421  1.862   1.00 0.00 ? 3   MET A HE2  1  
ATOM 36    H HE3  . MET A 1 3   ? -10.500 22.667  0.615   1.00 0.00 ? 3   MET A HE3  1  
ATOM 37    N N    . ASP A 1 4   ? -7.952  17.346  -2.734  1.00 0.00 ? 4   ASP A N    1  
ATOM 38    C CA   . ASP A 1 4   ? -7.379  16.679  -3.896  1.00 0.00 ? 4   ASP A CA   1  
ATOM 39    C C    . ASP A 1 4   ? -5.860  16.702  -3.851  1.00 0.00 ? 4   ASP A C    1  
ATOM 40    O O    . ASP A 1 4   ? -5.208  15.815  -4.397  1.00 0.00 ? 4   ASP A O    1  
ATOM 41    C CB   . ASP A 1 4   ? -7.874  17.346  -5.182  1.00 0.00 ? 4   ASP A CB   1  
ATOM 42    C CG   . ASP A 1 4   ? -7.560  18.829  -5.218  1.00 0.00 ? 4   ASP A CG   1  
ATOM 43    O OD1  . ASP A 1 4   ? -8.224  19.597  -4.490  1.00 0.00 ? 4   ASP A OD1  1  
ATOM 44    O OD2  . ASP A 1 4   ? -6.634  19.234  -5.947  1.00 0.00 ? 4   ASP A OD2  1  
ATOM 45    H H    . ASP A 1 4   ? -8.393  18.216  -2.860  1.00 0.00 ? 4   ASP A H    1  
ATOM 46    H HA   . ASP A 1 4   ? -7.704  15.650  -3.887  1.00 0.00 ? 4   ASP A HA   1  
ATOM 47    H HB2  . ASP A 1 4   ? -7.398  16.877  -6.031  1.00 0.00 ? 4   ASP A HB2  1  
ATOM 48    H HB3  . ASP A 1 4   ? -8.944  17.220  -5.260  1.00 0.00 ? 4   ASP A HB3  1  
ATOM 49    N N    . ASN A 1 5   ? -5.312  17.722  -3.180  1.00 0.00 ? 5   ASN A N    1  
ATOM 50    C CA   . ASN A 1 5   ? -3.863  17.904  -3.073  1.00 0.00 ? 5   ASN A CA   1  
ATOM 51    C C    . ASN A 1 5   ? -3.236  17.996  -4.462  1.00 0.00 ? 5   ASN A C    1  
ATOM 52    O O    . ASN A 1 5   ? -2.089  17.587  -4.660  1.00 0.00 ? 5   ASN A O    1  
ATOM 53    C CB   . ASN A 1 5   ? -3.214  16.755  -2.279  1.00 0.00 ? 5   ASN A CB   1  
ATOM 54    C CG   . ASN A 1 5   ? -3.467  16.839  -0.779  1.00 0.00 ? 5   ASN A CG   1  
ATOM 55    O OD1  . ASN A 1 5   ? -2.697  17.458  -0.041  1.00 0.00 ? 5   ASN A OD1  1  
ATOM 56    N ND2  . ASN A 1 5   ? -4.537  16.214  -0.309  1.00 0.00 ? 5   ASN A ND2  1  
ATOM 57    H H    . ASN A 1 5   ? -5.904  18.374  -2.750  1.00 0.00 ? 5   ASN A H    1  
ATOM 58    H HA   . ASN A 1 5   ? -3.687  18.834  -2.552  1.00 0.00 ? 5   ASN A HA   1  
ATOM 59    H HB2  . ASN A 1 5   ? -3.606  15.816  -2.635  1.00 0.00 ? 5   ASN A HB2  1  
ATOM 60    H HB3  . ASN A 1 5   ? -2.146  16.776  -2.444  1.00 0.00 ? 5   ASN A HB3  1  
ATOM 61    H HD21 . ASN A 1 5   ? -5.114  15.737  -0.943  1.00 0.00 ? 5   ASN A HD21 1  
ATOM 62    H HD22 . ASN A 1 5   ? -4.707  16.246  0.663   1.00 0.00 ? 5   ASN A HD22 1  
ATOM 63    N N    . VAL A 1 6   ? -3.999  18.572  -5.396  1.00 0.00 ? 6   VAL A N    1  
ATOM 64    C CA   . VAL A 1 6   ? -3.652  18.602  -6.819  1.00 0.00 ? 6   VAL A CA   1  
ATOM 65    C C    . VAL A 1 6   ? -3.873  17.226  -7.438  1.00 0.00 ? 6   VAL A C    1  
ATOM 66    O O    . VAL A 1 6   ? -3.316  16.234  -6.976  1.00 0.00 ? 6   VAL A O    1  
ATOM 67    C CB   . VAL A 1 6   ? -2.202  19.072  -7.084  1.00 0.00 ? 6   VAL A CB   1  
ATOM 68    C CG1  . VAL A 1 6   ? -1.881  18.998  -8.571  1.00 0.00 ? 6   VAL A CG1  1  
ATOM 69    C CG2  . VAL A 1 6   ? -1.991  20.486  -6.559  1.00 0.00 ? 6   VAL A CG2  1  
ATOM 70    H H    . VAL A 1 6   ? -4.848  18.981  -5.121  1.00 0.00 ? 6   VAL A H    1  
ATOM 71    H HA   . VAL A 1 6   ? -4.323  19.302  -7.299  1.00 0.00 ? 6   VAL A HA   1  
ATOM 72    H HB   . VAL A 1 6   ? -1.528  18.410  -6.559  1.00 0.00 ? 6   VAL A HB   1  
ATOM 73    H HG11 . VAL A 1 6   ? -2.545  19.655  -9.116  1.00 0.00 ? 6   VAL A HG11 1  
ATOM 74    H HG12 . VAL A 1 6   ? -2.017  17.984  -8.919  1.00 0.00 ? 6   VAL A HG12 1  
ATOM 75    H HG13 . VAL A 1 6   ? -0.858  19.302  -8.737  1.00 0.00 ? 6   VAL A HG13 1  
ATOM 76    H HG21 . VAL A 1 6   ? -2.169  20.505  -5.493  1.00 0.00 ? 6   VAL A HG21 1  
ATOM 77    H HG22 . VAL A 1 6   ? -2.678  21.160  -7.050  1.00 0.00 ? 6   VAL A HG22 1  
ATOM 78    H HG23 . VAL A 1 6   ? -0.977  20.797  -6.757  1.00 0.00 ? 6   VAL A HG23 1  
ATOM 79    N N    . CYS A 1 7   ? -4.705  17.181  -8.478  1.00 0.00 ? 7   CYS A N    1  
ATOM 80    C CA   . CYS A 1 7   ? -5.075  15.930  -9.133  1.00 0.00 ? 7   CYS A CA   1  
ATOM 81    C C    . CYS A 1 7   ? -3.849  15.087  -9.474  1.00 0.00 ? 7   CYS A C    1  
ATOM 82    O O    . CYS A 1 7   ? -2.888  15.563  -10.080 1.00 0.00 ? 7   CYS A O    1  
ATOM 83    C CB   . CYS A 1 7   ? -5.903  16.215  -10.388 1.00 0.00 ? 7   CYS A CB   1  
ATOM 84    S SG   . CYS A 1 7   ? -5.090  17.280  -11.600 1.00 0.00 ? 7   CYS A SG   1  
ATOM 85    H H    . CYS A 1 7   ? -5.096  18.019  -8.806  1.00 0.00 ? 7   CYS A H    1  
ATOM 86    H HA   . CYS A 1 7   ? -5.687  15.373  -8.437  1.00 0.00 ? 7   CYS A HA   1  
ATOM 87    H HB2  . CYS A 1 7   ? -6.133  15.280  -10.878 1.00 0.00 ? 7   CYS A HB2  1  
ATOM 88    H HB3  . CYS A 1 7   ? -6.824  16.696  -10.097 1.00 0.00 ? 7   CYS A HB3  1  
ATOM 89    H HG   . CYS A 1 7   ? -5.291  16.740  -12.799 1.00 0.00 ? 7   CYS A HG   1  
ATOM 90    N N    . GLN A 1 8   ? -3.898  13.828  -9.064  1.00 0.00 ? 8   GLN A N    1  
ATOM 91    C CA   . GLN A 1 8   ? -2.759  12.930  -9.167  1.00 0.00 ? 8   GLN A CA   1  
ATOM 92    C C    . GLN A 1 8   ? -3.077  11.736  -10.067 1.00 0.00 ? 8   GLN A C    1  
ATOM 93    O O    . GLN A 1 8   ? -4.240  11.479  -10.379 1.00 0.00 ? 8   GLN A O    1  
ATOM 94    C CB   . GLN A 1 8   ? -2.386  12.432  -7.767  1.00 0.00 ? 8   GLN A CB   1  
ATOM 95    C CG   . GLN A 1 8   ? -1.934  13.530  -6.814  1.00 0.00 ? 8   GLN A CG   1  
ATOM 96    C CD   . GLN A 1 8   ? -0.627  14.168  -7.245  1.00 0.00 ? 8   GLN A CD   1  
ATOM 97    O OE1  . GLN A 1 8   ? 0.454   13.715  -6.863  1.00 0.00 ? 8   GLN A OE1  1  
ATOM 98    N NE2  . GLN A 1 8   ? -0.713  15.223  -8.036  1.00 0.00 ? 8   GLN A NE2  1  
ATOM 99    H H    . GLN A 1 8   ? -4.734  13.486  -8.687  1.00 0.00 ? 8   GLN A H    1  
ATOM 100   H HA   . GLN A 1 8   ? -1.926  13.476  -9.582  1.00 0.00 ? 8   GLN A HA   1  
ATOM 101   H HB2  . GLN A 1 8   ? -3.245  11.943  -7.335  1.00 0.00 ? 8   GLN A HB2  1  
ATOM 102   H HB3  . GLN A 1 8   ? -1.585  11.715  -7.860  1.00 0.00 ? 8   GLN A HB3  1  
ATOM 103   H HG2  . GLN A 1 8   ? -2.698  14.297  -6.777  1.00 0.00 ? 8   GLN A HG2  1  
ATOM 104   H HG3  . GLN A 1 8   ? -1.806  13.106  -5.828  1.00 0.00 ? 8   GLN A HG3  1  
ATOM 105   H HE21 . GLN A 1 8   ? -1.608  15.537  -8.293  1.00 0.00 ? 8   GLN A HE21 1  
ATOM 106   H HE22 . GLN A 1 8   ? 0.119   15.638  -8.348  1.00 0.00 ? 8   GLN A HE22 1  
ATOM 107   N N    . PRO A 1 9   ? -2.038  11.030  -10.539 1.00 0.00 ? 9   PRO A N    1  
ATOM 108   C CA   . PRO A 1 9   ? -2.189  9.729   -11.204 1.00 0.00 ? 9   PRO A CA   1  
ATOM 109   C C    . PRO A 1 9   ? -2.808  8.681   -10.272 1.00 0.00 ? 9   PRO A C    1  
ATOM 110   O O    . PRO A 1 9   ? -2.825  8.857   -9.051  1.00 0.00 ? 9   PRO A O    1  
ATOM 111   C CB   . PRO A 1 9   ? -0.750  9.329   -11.553 1.00 0.00 ? 9   PRO A CB   1  
ATOM 112   C CG   . PRO A 1 9   ? 0.034   10.595  -11.518 1.00 0.00 ? 9   PRO A CG   1  
ATOM 113   C CD   . PRO A 1 9   ? -0.637  11.476  -10.504 1.00 0.00 ? 9   PRO A CD   1  
ATOM 114   H HA   . PRO A 1 9   ? -2.780  9.807   -12.104 1.00 0.00 ? 9   PRO A HA   1  
ATOM 115   H HB2  . PRO A 1 9   ? -0.389  8.621   -10.822 1.00 0.00 ? 9   PRO A HB2  1  
ATOM 116   H HB3  . PRO A 1 9   ? -0.728  8.879   -12.536 1.00 0.00 ? 9   PRO A HB3  1  
ATOM 117   H HG2  . PRO A 1 9   ? 1.049   10.388  -11.218 1.00 0.00 ? 9   PRO A HG2  1  
ATOM 118   H HG3  . PRO A 1 9   ? 0.018   11.065  -12.491 1.00 0.00 ? 9   PRO A HG3  1  
ATOM 119   H HD2  . PRO A 1 9   ? -0.210  11.326  -9.525  1.00 0.00 ? 9   PRO A HD2  1  
ATOM 120   H HD3  . PRO A 1 9   ? -0.558  12.513  -10.796 1.00 0.00 ? 9   PRO A HD3  1  
ATOM 121   N N    . THR A 1 10  ? -3.280  7.582   -10.849 1.00 0.00 ? 10  THR A N    1  
ATOM 122   C CA   . THR A 1 10  ? -3.980  6.547   -10.091 1.00 0.00 ? 10  THR A CA   1  
ATOM 123   C C    . THR A 1 10  ? -3.007  5.482   -9.559  1.00 0.00 ? 10  THR A C    1  
ATOM 124   O O    . THR A 1 10  ? -3.375  4.323   -9.349  1.00 0.00 ? 10  THR A O    1  
ATOM 125   C CB   . THR A 1 10  ? -5.062  5.883   -10.967 1.00 0.00 ? 10  THR A CB   1  
ATOM 126   O OG1  . THR A 1 10  ? -5.651  6.872   -11.822 1.00 0.00 ? 10  THR A OG1  1  
ATOM 127   C CG2  . THR A 1 10  ? -6.154  5.262   -10.108 1.00 0.00 ? 10  THR A CG2  1  
ATOM 128   H H    . THR A 1 10  ? -3.158  7.458   -11.820 1.00 0.00 ? 10  THR A H    1  
ATOM 129   H HA   . THR A 1 10  ? -4.470  7.022   -9.253  1.00 0.00 ? 10  THR A HA   1  
ATOM 130   H HB   . THR A 1 10  ? -4.604  5.110   -11.570 1.00 0.00 ? 10  THR A HB   1  
ATOM 131   H HG1  . THR A 1 10  ? -5.937  7.630   -11.277 1.00 0.00 ? 10  THR A HG1  1  
ATOM 132   H HG21 . THR A 1 10  ? -5.713  4.563   -9.414  1.00 0.00 ? 10  THR A HG21 1  
ATOM 133   H HG22 . THR A 1 10  ? -6.860  4.745   -10.740 1.00 0.00 ? 10  THR A HG22 1  
ATOM 134   H HG23 . THR A 1 10  ? -6.665  6.040   -9.560  1.00 0.00 ? 10  THR A HG23 1  
ATOM 135   N N    . GLU A 1 11  ? -1.760  5.884   -9.375  1.00 0.00 ? 11  GLU A N    1  
ATOM 136   C CA   . GLU A 1 11  ? -0.761  5.050   -8.725  1.00 0.00 ? 11  GLU A CA   1  
ATOM 137   C C    . GLU A 1 11  ? 0.010   5.895   -7.721  1.00 0.00 ? 11  GLU A C    1  
ATOM 138   O O    . GLU A 1 11  ? 0.410   7.012   -8.042  1.00 0.00 ? 11  GLU A O    1  
ATOM 139   C CB   . GLU A 1 11  ? 0.204   4.461   -9.761  1.00 0.00 ? 11  GLU A CB   1  
ATOM 140   C CG   . GLU A 1 11  ? 1.320   3.622   -9.155  1.00 0.00 ? 11  GLU A CG   1  
ATOM 141   C CD   . GLU A 1 11  ? 2.293   3.106   -10.191 1.00 0.00 ? 11  GLU A CD   1  
ATOM 142   O OE1  . GLU A 1 11  ? 1.979   2.097   -10.852 1.00 0.00 ? 11  GLU A OE1  1  
ATOM 143   O OE2  . GLU A 1 11  ? 3.376   3.705   -10.347 1.00 0.00 ? 11  GLU A OE2  1  
ATOM 144   H H    . GLU A 1 11  ? -1.495  6.766   -9.702  1.00 0.00 ? 11  GLU A H    1  
ATOM 145   H HA   . GLU A 1 11  ? -1.269  4.250   -8.205  1.00 0.00 ? 11  GLU A HA   1  
ATOM 146   H HB2  . GLU A 1 11  ? -0.354  3.840   -10.444 1.00 0.00 ? 11  GLU A HB2  1  
ATOM 147   H HB3  . GLU A 1 11  ? 0.657   5.272   -10.312 1.00 0.00 ? 11  GLU A HB3  1  
ATOM 148   H HG2  . GLU A 1 11  ? 1.865   4.229   -8.446  1.00 0.00 ? 11  GLU A HG2  1  
ATOM 149   H HG3  . GLU A 1 11  ? 0.882   2.779   -8.640  1.00 0.00 ? 11  GLU A HG3  1  
ATOM 150   N N    . PHE A 1 12  ? 0.229   5.377   -6.520  1.00 0.00 ? 12  PHE A N    1  
ATOM 151   C CA   . PHE A 1 12  ? 0.933   6.141   -5.499  1.00 0.00 ? 12  PHE A CA   1  
ATOM 152   C C    . PHE A 1 12  ? 2.035   5.321   -4.845  1.00 0.00 ? 12  PHE A C    1  
ATOM 153   O O    . PHE A 1 12  ? 2.032   4.091   -4.899  1.00 0.00 ? 12  PHE A O    1  
ATOM 154   C CB   . PHE A 1 12  ? -0.032  6.695   -4.438  1.00 0.00 ? 12  PHE A CB   1  
ATOM 155   C CG   . PHE A 1 12  ? -0.685  5.675   -3.538  1.00 0.00 ? 12  PHE A CG   1  
ATOM 156   C CD1  . PHE A 1 12  ? -1.899  5.103   -3.878  1.00 0.00 ? 12  PHE A CD1  1  
ATOM 157   C CD2  . PHE A 1 12  ? -0.095  5.317   -2.336  1.00 0.00 ? 12  PHE A CD2  1  
ATOM 158   C CE1  . PHE A 1 12  ? -2.509  4.190   -3.038  1.00 0.00 ? 12  PHE A CE1  1  
ATOM 159   C CE2  . PHE A 1 12  ? -0.704  4.408   -1.491  1.00 0.00 ? 12  PHE A CE2  1  
ATOM 160   C CZ   . PHE A 1 12  ? -1.913  3.843   -1.842  1.00 0.00 ? 12  PHE A CZ   1  
ATOM 161   H H    . PHE A 1 12  ? -0.071  4.462   -6.324  1.00 0.00 ? 12  PHE A H    1  
ATOM 162   H HA   . PHE A 1 12  ? 1.398   6.978   -6.001  1.00 0.00 ? 12  PHE A HA   1  
ATOM 163   H HB2  . PHE A 1 12  ? 0.511   7.380   -3.804  1.00 0.00 ? 12  PHE A HB2  1  
ATOM 164   H HB3  . PHE A 1 12  ? -0.819  7.242   -4.940  1.00 0.00 ? 12  PHE A HB3  1  
ATOM 165   H HD1  . PHE A 1 12  ? -2.367  5.372   -4.811  1.00 0.00 ? 12  PHE A HD1  1  
ATOM 166   H HD2  . PHE A 1 12  ? 0.852   5.756   -2.058  1.00 0.00 ? 12  PHE A HD2  1  
ATOM 167   H HE1  . PHE A 1 12  ? -3.454  3.750   -3.316  1.00 0.00 ? 12  PHE A HE1  1  
ATOM 168   H HE2  . PHE A 1 12  ? -0.233  4.137   -0.558  1.00 0.00 ? 12  PHE A HE2  1  
ATOM 169   H HZ   . PHE A 1 12  ? -2.392  3.132   -1.181  1.00 0.00 ? 12  PHE A HZ   1  
ATOM 170   N N    . ILE A 1 13  ? 2.979   6.030   -4.237  1.00 0.00 ? 13  ILE A N    1  
ATOM 171   C CA   . ILE A 1 13  ? 4.105   5.411   -3.555  1.00 0.00 ? 13  ILE A CA   1  
ATOM 172   C C    . ILE A 1 13  ? 4.063   5.772   -2.076  1.00 0.00 ? 13  ILE A C    1  
ATOM 173   O O    . ILE A 1 13  ? 3.797   6.921   -1.717  1.00 0.00 ? 13  ILE A O    1  
ATOM 174   C CB   . ILE A 1 13  ? 5.455   5.883   -4.150  1.00 0.00 ? 13  ILE A CB   1  
ATOM 175   C CG1  . ILE A 1 13  ? 5.502   5.628   -5.660  1.00 0.00 ? 13  ILE A CG1  1  
ATOM 176   C CG2  . ILE A 1 13  ? 6.623   5.191   -3.457  1.00 0.00 ? 13  ILE A CG2  1  
ATOM 177   C CD1  . ILE A 1 13  ? 5.410   4.165   -6.041  1.00 0.00 ? 13  ILE A CD1  1  
ATOM 178   H H    . ILE A 1 13  ? 2.910   7.005   -4.237  1.00 0.00 ? 13  ILE A H    1  
ATOM 179   H HA   . ILE A 1 13  ? 4.029   4.340   -3.667  1.00 0.00 ? 13  ILE A HA   1  
ATOM 180   H HB   . ILE A 1 13  ? 5.546   6.945   -3.973  1.00 0.00 ? 13  ILE A HB   1  
ATOM 181   H HG12 . ILE A 1 13  ? 4.677   6.142   -6.130  1.00 0.00 ? 13  ILE A HG12 1  
ATOM 182   H HG13 . ILE A 1 13  ? 6.431   6.016   -6.053  1.00 0.00 ? 13  ILE A HG13 1  
ATOM 183   H HG21 . ILE A 1 13  ? 7.550   5.515   -3.903  1.00 0.00 ? 13  ILE A HG21 1  
ATOM 184   H HG22 . ILE A 1 13  ? 6.523   4.121   -3.567  1.00 0.00 ? 13  ILE A HG22 1  
ATOM 185   H HG23 . ILE A 1 13  ? 6.621   5.447   -2.407  1.00 0.00 ? 13  ILE A HG23 1  
ATOM 186   H HD11 . ILE A 1 13  ? 4.485   3.753   -5.666  1.00 0.00 ? 13  ILE A HD11 1  
ATOM 187   H HD12 . ILE A 1 13  ? 6.243   3.628   -5.614  1.00 0.00 ? 13  ILE A HD12 1  
ATOM 188   H HD13 . ILE A 1 13  ? 5.434   4.071   -7.117  1.00 0.00 ? 13  ILE A HD13 1  
ATOM 189   N N    . SER A 1 14  ? 4.294   4.794   -1.221  1.00 0.00 ? 14  SER A N    1  
ATOM 190   C CA   . SER A 1 14  ? 4.302   5.039   0.211   1.00 0.00 ? 14  SER A CA   1  
ATOM 191   C C    . SER A 1 14  ? 5.406   4.252   0.904   1.00 0.00 ? 14  SER A C    1  
ATOM 192   O O    . SER A 1 14  ? 5.704   3.116   0.532   1.00 0.00 ? 14  SER A O    1  
ATOM 193   C CB   . SER A 1 14  ? 2.943   4.680   0.812   1.00 0.00 ? 14  SER A CB   1  
ATOM 194   O OG   . SER A 1 14  ? 1.913   5.452   0.223   1.00 0.00 ? 14  SER A OG   1  
ATOM 195   H H    . SER A 1 14  ? 4.450   3.887   -1.565  1.00 0.00 ? 14  SER A H    1  
ATOM 196   H HA   . SER A 1 14  ? 4.483   6.093   0.364   1.00 0.00 ? 14  SER A HA   1  
ATOM 197   H HB2  . SER A 1 14  ? 2.737   3.633   0.636   1.00 0.00 ? 14  SER A HB2  1  
ATOM 198   H HB3  . SER A 1 14  ? 2.958   4.874   1.876   1.00 0.00 ? 14  SER A HB3  1  
ATOM 199   H HG   . SER A 1 14  ? 2.280   5.970   -0.502  1.00 0.00 ? 14  SER A HG   1  
ATOM 200   N N    . ARG A 1 15  ? 6.010   4.866   1.908   1.00 0.00 ? 15  ARG A N    1  
ATOM 201   C CA   . ARG A 1 15  ? 6.993   4.201   2.745   1.00 0.00 ? 15  ARG A CA   1  
ATOM 202   C C    . ARG A 1 15  ? 6.305   3.768   4.023   1.00 0.00 ? 15  ARG A C    1  
ATOM 203   O O    . ARG A 1 15  ? 5.677   4.590   4.693   1.00 0.00 ? 15  ARG A O    1  
ATOM 204   C CB   . ARG A 1 15  ? 8.144   5.148   3.087   1.00 0.00 ? 15  ARG A CB   1  
ATOM 205   C CG   . ARG A 1 15  ? 9.025   5.520   1.909   1.00 0.00 ? 15  ARG A CG   1  
ATOM 206   C CD   . ARG A 1 15  ? 10.046  6.570   2.308   1.00 0.00 ? 15  ARG A CD   1  
ATOM 207   N NE   . ARG A 1 15  ? 11.120  6.697   1.328   1.00 0.00 ? 15  ARG A NE   1  
ATOM 208   C CZ   . ARG A 1 15  ? 11.821  7.808   1.128   1.00 0.00 ? 15  ARG A CZ   1  
ATOM 209   N NH1  . ARG A 1 15  ? 11.537  8.913   1.808   1.00 0.00 ? 15  ARG A NH1  1  
ATOM 210   N NH2  . ARG A 1 15  ? 12.816  7.817   0.258   1.00 0.00 ? 15  ARG A NH2  1  
ATOM 211   H H    . ARG A 1 15  ? 5.759   5.792   2.130   1.00 0.00 ? 15  ARG A H    1  
ATOM 212   H HA   . ARG A 1 15  ? 7.369   3.335   2.221   1.00 0.00 ? 15  ARG A HA   1  
ATOM 213   H HB2  . ARG A 1 15  ? 7.734   6.058   3.497   1.00 0.00 ? 15  ARG A HB2  1  
ATOM 214   H HB3  . ARG A 1 15  ? 8.766   4.680   3.835   1.00 0.00 ? 15  ARG A HB3  1  
ATOM 215   H HG2  . ARG A 1 15  ? 9.544   4.638   1.561   1.00 0.00 ? 15  ARG A HG2  1  
ATOM 216   H HG3  . ARG A 1 15  ? 8.405   5.914   1.118   1.00 0.00 ? 15  ARG A HG3  1  
ATOM 217   H HD2  . ARG A 1 15  ? 9.544   7.523   2.404   1.00 0.00 ? 15  ARG A HD2  1  
ATOM 218   H HD3  . ARG A 1 15  ? 10.474  6.294   3.263   1.00 0.00 ? 15  ARG A HD3  1  
ATOM 219   H HE   . ARG A 1 15  ? 11.347  5.896   0.807   1.00 0.00 ? 15  ARG A HE   1  
ATOM 220   H HH11 . ARG A 1 15  ? 10.786  8.920   2.479   1.00 0.00 ? 15  ARG A HH11 1  
ATOM 221   H HH12 . ARG A 1 15  ? 12.070  9.749   1.651   1.00 0.00 ? 15  ARG A HH12 1  
ATOM 222   H HH21 . ARG A 1 15  ? 13.046  6.989   -0.258  1.00 0.00 ? 15  ARG A HH21 1  
ATOM 223   H HH22 . ARG A 1 15  ? 13.350  8.658   0.109   1.00 0.00 ? 15  ARG A HH22 1  
ATOM 224   N N    . HIS A 1 16  ? 6.398   2.496   4.369   1.00 0.00 ? 16  HIS A N    1  
ATOM 225   C CA   . HIS A 1 16  ? 5.680   2.020   5.533   1.00 0.00 ? 16  HIS A CA   1  
ATOM 226   C C    . HIS A 1 16  ? 6.477   1.014   6.348   1.00 0.00 ? 16  HIS A C    1  
ATOM 227   O O    . HIS A 1 16  ? 7.297   0.256   5.824   1.00 0.00 ? 16  HIS A O    1  
ATOM 228   C CB   . HIS A 1 16  ? 4.304   1.446   5.136   1.00 0.00 ? 16  HIS A CB   1  
ATOM 229   C CG   . HIS A 1 16  ? 4.306   0.099   4.485   1.00 0.00 ? 16  HIS A CG   1  
ATOM 230   N ND1  . HIS A 1 16  ? 3.322   -0.832  4.731   1.00 0.00 ? 16  HIS A ND1  1  
ATOM 231   C CD2  . HIS A 1 16  ? 5.142   -0.468  3.594   1.00 0.00 ? 16  HIS A CD2  1  
ATOM 232   C CE1  . HIS A 1 16  ? 3.557   -1.918  4.024   1.00 0.00 ? 16  HIS A CE1  1  
ATOM 233   N NE2  . HIS A 1 16  ? 4.655   -1.725  3.321   1.00 0.00 ? 16  HIS A NE2  1  
ATOM 234   H H    . HIS A 1 16  ? 6.961   1.880   3.844   1.00 0.00 ? 16  HIS A H    1  
ATOM 235   H HA   . HIS A 1 16  ? 5.507   2.880   6.160   1.00 0.00 ? 16  HIS A HA   1  
ATOM 236   H HB2  . HIS A 1 16  ? 3.708   1.357   6.023   1.00 0.00 ? 16  HIS A HB2  1  
ATOM 237   H HB3  . HIS A 1 16  ? 3.822   2.137   4.460   1.00 0.00 ? 16  HIS A HB3  1  
ATOM 238   H HD1  . HIS A 1 16  ? 2.552   -0.704  5.325   1.00 0.00 ? 16  HIS A HD1  1  
ATOM 239   H HD2  . HIS A 1 16  ? 6.031   -0.020  3.173   1.00 0.00 ? 16  HIS A HD2  1  
ATOM 240   H HE1  . HIS A 1 16  ? 2.951   -2.811  4.018   1.00 0.00 ? 16  HIS A HE1  1  
ATOM 241   H HE2  . HIS A 1 16  ? 4.935   -2.283  2.565   1.00 0.00 ? 16  HIS A HE2  1  
ATOM 242   N N    . ASN A 1 17  ? 6.202   1.039   7.639   1.00 0.00 ? 17  ASN A N    1  
ATOM 243   C CA   . ASN A 1 17  ? 6.731   0.092   8.600   1.00 0.00 ? 17  ASN A CA   1  
ATOM 244   C C    . ASN A 1 17  ? 6.236   -1.305  8.255   1.00 0.00 ? 17  ASN A C    1  
ATOM 245   O O    . ASN A 1 17  ? 5.112   -1.466  7.767   1.00 0.00 ? 17  ASN A O    1  
ATOM 246   C CB   . ASN A 1 17  ? 6.267   0.503   10.003  1.00 0.00 ? 17  ASN A CB   1  
ATOM 247   C CG   . ASN A 1 17  ? 6.291   -0.632  11.006  1.00 0.00 ? 17  ASN A CG   1  
ATOM 248   O OD1  . ASN A 1 17  ? 5.347   -1.413  11.089  1.00 0.00 ? 17  ASN A OD1  1  
ATOM 249   N ND2  . ASN A 1 17  ? 7.349   -0.722  11.788  1.00 0.00 ? 17  ASN A ND2  1  
ATOM 250   H H    . ASN A 1 17  ? 5.565   1.718   7.959   1.00 0.00 ? 17  ASN A H    1  
ATOM 251   H HA   . ASN A 1 17  ? 7.808   0.116   8.551   1.00 0.00 ? 17  ASN A HA   1  
ATOM 252   H HB2  . ASN A 1 17  ? 6.915   1.286   10.368  1.00 0.00 ? 17  ASN A HB2  1  
ATOM 253   H HB3  . ASN A 1 17  ? 5.257   0.880   9.941   1.00 0.00 ? 17  ASN A HB3  1  
ATOM 254   H HD21 . ASN A 1 17  ? 8.062   -0.058  11.686  1.00 0.00 ? 17  ASN A HD21 1  
ATOM 255   H HD22 . ASN A 1 17  ? 7.367   -1.446  12.454  1.00 0.00 ? 17  ASN A HD22 1  
ATOM 256   N N    . ILE A 1 18  ? 7.081   -2.295  8.533   1.00 0.00 ? 18  ILE A N    1  
ATOM 257   C CA   . ILE A 1 18  ? 6.879   -3.676  8.092   1.00 0.00 ? 18  ILE A CA   1  
ATOM 258   C C    . ILE A 1 18  ? 5.547   -4.277  8.543   1.00 0.00 ? 18  ILE A C    1  
ATOM 259   O O    . ILE A 1 18  ? 5.064   -5.233  7.936   1.00 0.00 ? 18  ILE A O    1  
ATOM 260   C CB   . ILE A 1 18  ? 8.028   -4.580  8.585   1.00 0.00 ? 18  ILE A CB   1  
ATOM 261   C CG1  . ILE A 1 18  ? 8.159   -4.494  10.110  1.00 0.00 ? 18  ILE A CG1  1  
ATOM 262   C CG2  . ILE A 1 18  ? 9.335   -4.187  7.909   1.00 0.00 ? 18  ILE A CG2  1  
ATOM 263   C CD1  . ILE A 1 18  ? 9.250   -5.369  10.681  1.00 0.00 ? 18  ILE A CD1  1  
ATOM 264   H H    . ILE A 1 18  ? 7.875   -2.088  9.068   1.00 0.00 ? 18  ILE A H    1  
ATOM 265   H HA   . ILE A 1 18  ? 6.904   -3.677  7.013   1.00 0.00 ? 18  ILE A HA   1  
ATOM 266   H HB   . ILE A 1 18  ? 7.799   -5.599  8.308   1.00 0.00 ? 18  ILE A HB   1  
ATOM 267   H HG12 . ILE A 1 18  ? 8.378   -3.474  10.384  1.00 0.00 ? 18  ILE A HG12 1  
ATOM 268   H HG13 . ILE A 1 18  ? 7.222   -4.790  10.562  1.00 0.00 ? 18  ILE A HG13 1  
ATOM 269   H HG21 . ILE A 1 18  ? 10.133  -4.816  8.273   1.00 0.00 ? 18  ILE A HG21 1  
ATOM 270   H HG22 . ILE A 1 18  ? 9.560   -3.154  8.133   1.00 0.00 ? 18  ILE A HG22 1  
ATOM 271   H HG23 . ILE A 1 18  ? 9.239   -4.311  6.839   1.00 0.00 ? 18  ILE A HG23 1  
ATOM 272   H HD11 . ILE A 1 18  ? 9.034   -6.405  10.460  1.00 0.00 ? 18  ILE A HD11 1  
ATOM 273   H HD12 . ILE A 1 18  ? 9.299   -5.231  11.751  1.00 0.00 ? 18  ILE A HD12 1  
ATOM 274   H HD13 . ILE A 1 18  ? 10.198  -5.099  10.239  1.00 0.00 ? 18  ILE A HD13 1  
ATOM 275   N N    . GLU A 1 19  ? 4.954   -3.721  9.590   1.00 0.00 ? 19  GLU A N    1  
ATOM 276   C CA   . GLU A 1 19  ? 3.670   -4.205  10.083  1.00 0.00 ? 19  GLU A CA   1  
ATOM 277   C C    . GLU A 1 19  ? 2.527   -3.565  9.303   1.00 0.00 ? 19  GLU A C    1  
ATOM 278   O O    . GLU A 1 19  ? 1.351   -3.796  9.586   1.00 0.00 ? 19  GLU A O    1  
ATOM 279   C CB   . GLU A 1 19  ? 3.536   -3.910  11.576  1.00 0.00 ? 19  GLU A CB   1  
ATOM 280   C CG   . GLU A 1 19  ? 4.666   -4.504  12.396  1.00 0.00 ? 19  GLU A CG   1  
ATOM 281   C CD   . GLU A 1 19  ? 4.634   -4.086  13.848  1.00 0.00 ? 19  GLU A CD   1  
ATOM 282   O OE1  . GLU A 1 19  ? 5.045   -2.949  14.154  1.00 0.00 ? 19  GLU A OE1  1  
ATOM 283   O OE2  . GLU A 1 19  ? 4.234   -4.909  14.699  1.00 0.00 ? 19  GLU A OE2  1  
ATOM 284   H H    . GLU A 1 19  ? 5.391   -2.968  10.049  1.00 0.00 ? 19  GLU A H    1  
ATOM 285   H HA   . GLU A 1 19  ? 3.641   -5.273  9.932   1.00 0.00 ? 19  GLU A HA   1  
ATOM 286   H HB2  . GLU A 1 19  ? 3.528   -2.840  11.725  1.00 0.00 ? 19  GLU A HB2  1  
ATOM 287   H HB3  . GLU A 1 19  ? 2.603   -4.325  11.932  1.00 0.00 ? 19  GLU A HB3  1  
ATOM 288   H HG2  . GLU A 1 19  ? 4.598   -5.581  12.348  1.00 0.00 ? 19  GLU A HG2  1  
ATOM 289   H HG3  . GLU A 1 19  ? 5.604   -4.186  11.966  1.00 0.00 ? 19  GLU A HG3  1  
ATOM 290   N N    . GLY A 1 20  ? 2.881   -2.748  8.323   1.00 0.00 ? 20  GLY A N    1  
ATOM 291   C CA   . GLY A 1 20  ? 1.892   -2.143  7.467   1.00 0.00 ? 20  GLY A CA   1  
ATOM 292   C C    . GLY A 1 20  ? 1.643   -0.689  7.796   1.00 0.00 ? 20  GLY A C    1  
ATOM 293   O O    . GLY A 1 20  ? 0.783   -0.063  7.180   1.00 0.00 ? 20  GLY A O    1  
ATOM 294   H H    . GLY A 1 20  ? 3.836   -2.548  8.179   1.00 0.00 ? 20  GLY A H    1  
ATOM 295   H HA2  . GLY A 1 20  ? 2.228   -2.216  6.442   1.00 0.00 ? 20  GLY A HA2  1  
ATOM 296   H HA3  . GLY A 1 20  ? 0.965   -2.685  7.569   1.00 0.00 ? 20  GLY A HA3  1  
ATOM 297   N N    . ILE A 1 21  ? 2.418   -0.142  8.731   1.00 0.00 ? 21  ILE A N    1  
ATOM 298   C CA   . ILE A 1 21  ? 2.180   1.213   9.234   1.00 0.00 ? 21  ILE A CA   1  
ATOM 299   C C    . ILE A 1 21  ? 2.711   2.256   8.262   1.00 0.00 ? 21  ILE A C    1  
ATOM 300   O O    . ILE A 1 21  ? 3.910   2.339   8.047   1.00 0.00 ? 21  ILE A O    1  
ATOM 301   C CB   . ILE A 1 21  ? 2.868   1.452   10.600  1.00 0.00 ? 21  ILE A CB   1  
ATOM 302   C CG1  . ILE A 1 21  ? 2.483   0.371   11.616  1.00 0.00 ? 21  ILE A CG1  1  
ATOM 303   C CG2  . ILE A 1 21  ? 2.507   2.832   11.135  1.00 0.00 ? 21  ILE A CG2  1  
ATOM 304   C CD1  . ILE A 1 21  ? 0.994   0.275   11.859  1.00 0.00 ? 21  ILE A CD1  1  
ATOM 305   H H    . ILE A 1 21  ? 3.183   -0.650  9.088   1.00 0.00 ? 21  ILE A H    1  
ATOM 306   H HA   . ILE A 1 21  ? 1.115   1.350   9.356   1.00 0.00 ? 21  ILE A HA   1  
ATOM 307   H HB   . ILE A 1 21  ? 3.936   1.425   10.444  1.00 0.00 ? 21  ILE A HB   1  
ATOM 308   H HG12 . ILE A 1 21  ? 2.833   -0.589  11.265  1.00 0.00 ? 21  ILE A HG12 1  
ATOM 309   H HG13 . ILE A 1 21  ? 2.959   0.594   12.561  1.00 0.00 ? 21  ILE A HG13 1  
ATOM 310   H HG21 . ILE A 1 21  ? 1.438   2.895   11.271  1.00 0.00 ? 21  ILE A HG21 1  
ATOM 311   H HG22 . ILE A 1 21  ? 2.825   3.585   10.431  1.00 0.00 ? 21  ILE A HG22 1  
ATOM 312   H HG23 . ILE A 1 21  ? 3.000   2.991   12.083  1.00 0.00 ? 21  ILE A HG23 1  
ATOM 313   H HD11 . ILE A 1 21  ? 0.630   1.217   12.240  1.00 0.00 ? 21  ILE A HD11 1  
ATOM 314   H HD12 . ILE A 1 21  ? 0.797   -0.506  12.579  1.00 0.00 ? 21  ILE A HD12 1  
ATOM 315   H HD13 . ILE A 1 21  ? 0.492   0.044   10.930  1.00 0.00 ? 21  ILE A HD13 1  
ATOM 316   N N    . PHE A 1 22  ? 1.836   3.057   7.681   1.00 0.00 ? 22  PHE A N    1  
ATOM 317   C CA   . PHE A 1 22  ? 2.278   4.082   6.746   1.00 0.00 ? 22  PHE A CA   1  
ATOM 318   C C    . PHE A 1 22  ? 3.033   5.193   7.466   1.00 0.00 ? 22  PHE A C    1  
ATOM 319   O O    . PHE A 1 22  ? 2.505   5.830   8.378   1.00 0.00 ? 22  PHE A O    1  
ATOM 320   C CB   . PHE A 1 22  ? 1.101   4.646   5.965   1.00 0.00 ? 22  PHE A CB   1  
ATOM 321   C CG   . PHE A 1 22  ? 0.505   3.655   5.014   1.00 0.00 ? 22  PHE A CG   1  
ATOM 322   C CD1  . PHE A 1 22  ? 1.041   3.486   3.748   1.00 0.00 ? 22  PHE A CD1  1  
ATOM 323   C CD2  . PHE A 1 22  ? -0.582  2.887   5.388   1.00 0.00 ? 22  PHE A CD2  1  
ATOM 324   C CE1  . PHE A 1 22  ? 0.502   2.569   2.872   1.00 0.00 ? 22  PHE A CE1  1  
ATOM 325   C CE2  . PHE A 1 22  ? -1.125  1.968   4.516   1.00 0.00 ? 22  PHE A CE2  1  
ATOM 326   C CZ   . PHE A 1 22  ? -0.583  1.807   3.255   1.00 0.00 ? 22  PHE A CZ   1  
ATOM 327   H H    . PHE A 1 22  ? 0.879   2.969   7.890   1.00 0.00 ? 22  PHE A H    1  
ATOM 328   H HA   . PHE A 1 22  ? 2.957   3.610   6.050   1.00 0.00 ? 22  PHE A HA   1  
ATOM 329   H HB2  . PHE A 1 22  ? 0.330   4.953   6.657   1.00 0.00 ? 22  PHE A HB2  1  
ATOM 330   H HB3  . PHE A 1 22  ? 1.429   5.502   5.393   1.00 0.00 ? 22  PHE A HB3  1  
ATOM 331   H HD1  . PHE A 1 22  ? 1.889   4.081   3.448   1.00 0.00 ? 22  PHE A HD1  1  
ATOM 332   H HD2  . PHE A 1 22  ? -1.006  3.012   6.374   1.00 0.00 ? 22  PHE A HD2  1  
ATOM 333   H HE1  . PHE A 1 22  ? 0.930   2.446   1.887   1.00 0.00 ? 22  PHE A HE1  1  
ATOM 334   H HE2  . PHE A 1 22  ? -1.972  1.370   4.819   1.00 0.00 ? 22  PHE A HE2  1  
ATOM 335   H HZ   . PHE A 1 22  ? -1.005  1.086   2.574   1.00 0.00 ? 22  PHE A HZ   1  
ATOM 336   N N    . THR A 1 23  ? 4.273   5.402   7.048   1.00 0.00 ? 23  THR A N    1  
ATOM 337   C CA   . THR A 1 23  ? 5.140   6.399   7.652   1.00 0.00 ? 23  THR A CA   1  
ATOM 338   C C    . THR A 1 23  ? 5.176   7.666   6.793   1.00 0.00 ? 23  THR A C    1  
ATOM 339   O O    . THR A 1 23  ? 5.197   8.785   7.310   1.00 0.00 ? 23  THR A O    1  
ATOM 340   C CB   . THR A 1 23  ? 6.572   5.845   7.814   1.00 0.00 ? 23  THR A CB   1  
ATOM 341   O OG1  . THR A 1 23  ? 6.524   4.515   8.356   1.00 0.00 ? 23  THR A OG1  1  
ATOM 342   C CG2  . THR A 1 23  ? 7.399   6.734   8.731   1.00 0.00 ? 23  THR A CG2  1  
ATOM 343   H H    . THR A 1 23  ? 4.620   4.863   6.310   1.00 0.00 ? 23  THR A H    1  
ATOM 344   H HA   . THR A 1 23  ? 4.750   6.640   8.630   1.00 0.00 ? 23  THR A HA   1  
ATOM 345   H HB   . THR A 1 23  ? 7.044   5.813   6.844   1.00 0.00 ? 23  THR A HB   1  
ATOM 346   H HG1  . THR A 1 23  ? 6.032   4.527   9.194   1.00 0.00 ? 23  THR A HG1  1  
ATOM 347   H HG21 . THR A 1 23  ? 6.932   6.779   9.704   1.00 0.00 ? 23  THR A HG21 1  
ATOM 348   H HG22 . THR A 1 23  ? 7.458   7.727   8.311   1.00 0.00 ? 23  THR A HG22 1  
ATOM 349   H HG23 . THR A 1 23  ? 8.394   6.325   8.827   1.00 0.00 ? 23  THR A HG23 1  
ATOM 350   N N    . PHE A 1 24  ? 5.176   7.477   5.475   1.00 0.00 ? 24  PHE A N    1  
ATOM 351   C CA   . PHE A 1 24  ? 5.160   8.591   4.534   1.00 0.00 ? 24  PHE A CA   1  
ATOM 352   C C    . PHE A 1 24  ? 4.382   8.209   3.279   1.00 0.00 ? 24  PHE A C    1  
ATOM 353   O O    . PHE A 1 24  ? 4.648   7.176   2.666   1.00 0.00 ? 24  PHE A O    1  
ATOM 354   C CB   . PHE A 1 24  ? 6.590   9.005   4.167   1.00 0.00 ? 24  PHE A CB   1  
ATOM 355   C CG   . PHE A 1 24  ? 6.659   10.071  3.110   1.00 0.00 ? 24  PHE A CG   1  
ATOM 356   C CD1  . PHE A 1 24  ? 6.268   11.370  3.391   1.00 0.00 ? 24  PHE A CD1  1  
ATOM 357   C CD2  . PHE A 1 24  ? 7.113   9.773   1.833   1.00 0.00 ? 24  PHE A CD2  1  
ATOM 358   C CE1  . PHE A 1 24  ? 6.324   12.351  2.422   1.00 0.00 ? 24  PHE A CE1  1  
ATOM 359   C CE2  . PHE A 1 24  ? 7.173   10.752  0.859   1.00 0.00 ? 24  PHE A CE2  1  
ATOM 360   C CZ   . PHE A 1 24  ? 6.777   12.043  1.154   1.00 0.00 ? 24  PHE A CZ   1  
ATOM 361   H H    . PHE A 1 24  ? 5.194   6.560   5.125   1.00 0.00 ? 24  PHE A H    1  
ATOM 362   H HA   . PHE A 1 24  ? 4.662   9.422   5.011   1.00 0.00 ? 24  PHE A HA   1  
ATOM 363   H HB2  . PHE A 1 24  ? 7.084   9.383   5.050   1.00 0.00 ? 24  PHE A HB2  1  
ATOM 364   H HB3  . PHE A 1 24  ? 7.126   8.142   3.804   1.00 0.00 ? 24  PHE A HB3  1  
ATOM 365   H HD1  . PHE A 1 24  ? 5.916   11.614  4.384   1.00 0.00 ? 24  PHE A HD1  1  
ATOM 366   H HD2  . PHE A 1 24  ? 7.422   8.765   1.603   1.00 0.00 ? 24  PHE A HD2  1  
ATOM 367   H HE1  . PHE A 1 24  ? 6.016   13.359  2.655   1.00 0.00 ? 24  PHE A HE1  1  
ATOM 368   H HE2  . PHE A 1 24  ? 7.526   10.508  -0.130  1.00 0.00 ? 24  PHE A HE2  1  
ATOM 369   H HZ   . PHE A 1 24  ? 6.821   12.808  0.394   1.00 0.00 ? 24  PHE A HZ   1  
ATOM 370   N N    . VAL A 1 25  ? 3.426   9.047   2.903   1.00 0.00 ? 25  VAL A N    1  
ATOM 371   C CA   . VAL A 1 25  ? 2.580   8.779   1.748   1.00 0.00 ? 25  VAL A CA   1  
ATOM 372   C C    . VAL A 1 25  ? 2.633   9.941   0.764   1.00 0.00 ? 25  VAL A C    1  
ATOM 373   O O    . VAL A 1 25  ? 2.599   11.107  1.164   1.00 0.00 ? 25  VAL A O    1  
ATOM 374   C CB   . VAL A 1 25  ? 1.113   8.548   2.172   1.00 0.00 ? 25  VAL A CB   1  
ATOM 375   C CG1  . VAL A 1 25  ? 0.217   8.331   0.958   1.00 0.00 ? 25  VAL A CG1  1  
ATOM 376   C CG2  . VAL A 1 25  ? 1.008   7.366   3.125   1.00 0.00 ? 25  VAL A CG2  1  
ATOM 377   H H    . VAL A 1 25  ? 3.292   9.876   3.409   1.00 0.00 ? 25  VAL A H    1  
ATOM 378   H HA   . VAL A 1 25  ? 2.942   7.884   1.262   1.00 0.00 ? 25  VAL A HA   1  
ATOM 379   H HB   . VAL A 1 25  ? 0.767   9.430   2.691   1.00 0.00 ? 25  VAL A HB   1  
ATOM 380   H HG11 . VAL A 1 25  ? 0.272   9.197   0.309   1.00 0.00 ? 25  VAL A HG11 1  
ATOM 381   H HG12 . VAL A 1 25  ? -0.803  8.189   1.282   1.00 0.00 ? 25  VAL A HG12 1  
ATOM 382   H HG13 . VAL A 1 25  ? 0.548   7.456   0.417   1.00 0.00 ? 25  VAL A HG13 1  
ATOM 383   H HG21 . VAL A 1 25  ? 1.605   7.555   4.004   1.00 0.00 ? 25  VAL A HG21 1  
ATOM 384   H HG22 . VAL A 1 25  ? 1.367   6.473   2.632   1.00 0.00 ? 25  VAL A HG22 1  
ATOM 385   H HG23 . VAL A 1 25  ? -0.024  7.226   3.415   1.00 0.00 ? 25  VAL A HG23 1  
ATOM 386   N N    . ASP A 1 26  ? 2.732   9.623   -0.522  1.00 0.00 ? 26  ASP A N    1  
ATOM 387   C CA   . ASP A 1 26  ? 2.693   10.627  -1.575  1.00 0.00 ? 26  ASP A CA   1  
ATOM 388   C C    . ASP A 1 26  ? 1.243   10.984  -1.907  1.00 0.00 ? 26  ASP A C    1  
ATOM 389   O O    . ASP A 1 26  ? 0.351   10.144  -1.807  1.00 0.00 ? 26  ASP A O    1  
ATOM 390   C CB   . ASP A 1 26  ? 3.415   10.102  -2.821  1.00 0.00 ? 26  ASP A CB   1  
ATOM 391   C CG   . ASP A 1 26  ? 3.377   11.075  -3.980  1.00 0.00 ? 26  ASP A CG   1  
ATOM 392   O OD1  . ASP A 1 26  ? 4.267   11.943  -4.071  1.00 0.00 ? 26  ASP A OD1  1  
ATOM 393   O OD2  . ASP A 1 26  ? 2.460   10.971  -4.816  1.00 0.00 ? 26  ASP A OD2  1  
ATOM 394   H H    . ASP A 1 26  ? 2.836   8.685   -0.788  1.00 0.00 ? 26  ASP A H    1  
ATOM 395   H HA   . ASP A 1 26  ? 3.200   11.511  -1.216  1.00 0.00 ? 26  ASP A HA   1  
ATOM 396   H HB2  . ASP A 1 26  ? 4.448   9.912   -2.575  1.00 0.00 ? 26  ASP A HB2  1  
ATOM 397   H HB3  . ASP A 1 26  ? 2.949   9.179   -3.134  1.00 0.00 ? 26  ASP A HB3  1  
ATOM 398   N N    . HIS A 1 27  ? 1.035   12.242  -2.301  1.00 0.00 ? 27  HIS A N    1  
ATOM 399   C CA   . HIS A 1 27  ? -0.303  12.821  -2.497  1.00 0.00 ? 27  HIS A CA   1  
ATOM 400   C C    . HIS A 1 27  ? -1.169  12.039  -3.487  1.00 0.00 ? 27  HIS A C    1  
ATOM 401   O O    . HIS A 1 27  ? -2.383  12.235  -3.529  1.00 0.00 ? 27  HIS A O    1  
ATOM 402   C CB   . HIS A 1 27  ? -0.182  14.264  -2.980  1.00 0.00 ? 27  HIS A CB   1  
ATOM 403   C CG   . HIS A 1 27  ? 0.481   15.187  -2.001  1.00 0.00 ? 27  HIS A CG   1  
ATOM 404   N ND1  . HIS A 1 27  ? 1.766   15.645  -2.162  1.00 0.00 ? 27  HIS A ND1  1  
ATOM 405   C CD2  . HIS A 1 27  ? 0.025   15.747  -0.856  1.00 0.00 ? 27  HIS A CD2  1  
ATOM 406   C CE1  . HIS A 1 27  ? 2.077   16.444  -1.160  1.00 0.00 ? 27  HIS A CE1  1  
ATOM 407   N NE2  . HIS A 1 27  ? 1.038   16.524  -0.352  1.00 0.00 ? 27  HIS A NE2  1  
ATOM 408   H H    . HIS A 1 27  ? 1.818   12.807  -2.475  1.00 0.00 ? 27  HIS A H    1  
ATOM 409   H HA   . HIS A 1 27  ? -0.801  12.823  -1.539  1.00 0.00 ? 27  HIS A HA   1  
ATOM 410   H HB2  . HIS A 1 27  ? 0.400   14.274  -3.887  1.00 0.00 ? 27  HIS A HB2  1  
ATOM 411   H HB3  . HIS A 1 27  ? -1.170  14.651  -3.188  1.00 0.00 ? 27  HIS A HB3  1  
ATOM 412   H HD1  . HIS A 1 27  ? 2.370   15.411  -2.909  1.00 0.00 ? 27  HIS A HD1  1  
ATOM 413   H HD2  . HIS A 1 27  ? -0.952  15.605  -0.417  1.00 0.00 ? 27  HIS A HD2  1  
ATOM 414   H HE1  . HIS A 1 27  ? 3.023   16.943  -1.022  1.00 0.00 ? 27  HIS A HE1  1  
ATOM 415   H HE2  . HIS A 1 27  ? 0.937   17.191  0.371   1.00 0.00 ? 27  HIS A HE2  1  
ATOM 416   N N    . ARG A 1 28  ? -0.556  11.165  -4.277  1.00 0.00 ? 28  ARG A N    1  
ATOM 417   C CA   . ARG A 1 28  ? -1.292  10.363  -5.257  1.00 0.00 ? 28  ARG A CA   1  
ATOM 418   C C    . ARG A 1 28  ? -2.272  9.393   -4.585  1.00 0.00 ? 28  ARG A C    1  
ATOM 419   O O    . ARG A 1 28  ? -3.058  8.722   -5.260  1.00 0.00 ? 28  ARG A O    1  
ATOM 420   C CB   . ARG A 1 28  ? -0.313  9.602   -6.155  1.00 0.00 ? 28  ARG A CB   1  
ATOM 421   C CG   . ARG A 1 28  ? 0.377   10.489  -7.177  1.00 0.00 ? 28  ARG A CG   1  
ATOM 422   C CD   . ARG A 1 28  ? 1.497   9.761   -7.903  1.00 0.00 ? 28  ARG A CD   1  
ATOM 423   N NE   . ARG A 1 28  ? 2.684   9.616   -7.067  1.00 0.00 ? 28  ARG A NE   1  
ATOM 424   C CZ   . ARG A 1 28  ? 3.718   8.836   -7.373  1.00 0.00 ? 28  ARG A CZ   1  
ATOM 425   N NH1  . ARG A 1 28  ? 3.656   8.017   -8.413  1.00 0.00 ? 28  ARG A NH1  1  
ATOM 426   N NH2  . ARG A 1 28  ? 4.805   8.854   -6.614  1.00 0.00 ? 28  ARG A NH2  1  
ATOM 427   H H    . ARG A 1 28  ? 0.419   11.055  -4.203  1.00 0.00 ? 28  ARG A H    1  
ATOM 428   H HA   . ARG A 1 28  ? -1.858  11.046  -5.871  1.00 0.00 ? 28  ARG A HA   1  
ATOM 429   H HB2  . ARG A 1 28  ? 0.445   9.144   -5.535  1.00 0.00 ? 28  ARG A HB2  1  
ATOM 430   H HB3  . ARG A 1 28  ? -0.852  8.829   -6.684  1.00 0.00 ? 28  ARG A HB3  1  
ATOM 431   H HG2  . ARG A 1 28  ? -0.351  10.818  -7.903  1.00 0.00 ? 28  ARG A HG2  1  
ATOM 432   H HG3  . ARG A 1 28  ? 0.791   11.348  -6.669  1.00 0.00 ? 28  ARG A HG3  1  
ATOM 433   H HD2  . ARG A 1 28  ? 1.148   8.780   -8.186  1.00 0.00 ? 28  ARG A HD2  1  
ATOM 434   H HD3  . ARG A 1 28  ? 1.758   10.321  -8.789  1.00 0.00 ? 28  ARG A HD3  1  
ATOM 435   H HE   . ARG A 1 28  ? 2.725   10.170  -6.243  1.00 0.00 ? 28  ARG A HE   1  
ATOM 436   H HH11 . ARG A 1 28  ? 2.826   7.973   -8.973  1.00 0.00 ? 28  ARG A HH11 1  
ATOM 437   H HH12 . ARG A 1 28  ? 4.449   7.436   -8.649  1.00 0.00 ? 28  ARG A HH12 1  
ATOM 438   H HH21 . ARG A 1 28  ? 4.851   9.455   -5.812  1.00 0.00 ? 28  ARG A HH21 1  
ATOM 439   H HH22 . ARG A 1 28  ? 5.589   8.274   -6.845  1.00 0.00 ? 28  ARG A HH22 1  
ATOM 440   N N    . CYS A 1 29  ? -2.226  9.332   -3.260  1.00 0.00 ? 29  CYS A N    1  
ATOM 441   C CA   . CYS A 1 29  ? -3.152  8.519   -2.481  1.00 0.00 ? 29  CYS A CA   1  
ATOM 442   C C    . CYS A 1 29  ? -4.599  8.966   -2.689  1.00 0.00 ? 29  CYS A C    1  
ATOM 443   O O    . CYS A 1 29  ? -5.517  8.142   -2.729  1.00 0.00 ? 29  CYS A O    1  
ATOM 444   C CB   . CYS A 1 29  ? -2.774  8.603   -1.006  1.00 0.00 ? 29  CYS A CB   1  
ATOM 445   S SG   . CYS A 1 29  ? -2.583  10.295  -0.413  1.00 0.00 ? 29  CYS A SG   1  
ATOM 446   H H    . CYS A 1 29  ? -1.541  9.851   -2.785  1.00 0.00 ? 29  CYS A H    1  
ATOM 447   H HA   . CYS A 1 29  ? -3.058  7.506   -2.802  1.00 0.00 ? 29  CYS A HA   1  
ATOM 448   H HB2  . CYS A 1 29  ? -3.542  8.129   -0.413  1.00 0.00 ? 29  CYS A HB2  1  
ATOM 449   H HB3  . CYS A 1 29  ? -1.836  8.089   -0.850  1.00 0.00 ? 29  CYS A HB3  1  
ATOM 450   H HG   . CYS A 1 29  ? -3.800  10.763  -0.155  1.00 0.00 ? 29  CYS A HG   1  
ATOM 451   N N    . VAL A 1 30  ? -4.789  10.269  -2.851  1.00 0.00 ? 30  VAL A N    1  
ATOM 452   C CA   . VAL A 1 30  ? -6.123  10.846  -2.982  1.00 0.00 ? 30  VAL A CA   1  
ATOM 453   C C    . VAL A 1 30  ? -6.768  10.425  -4.294  1.00 0.00 ? 30  VAL A C    1  
ATOM 454   O O    . VAL A 1 30  ? -7.953  10.095  -4.344  1.00 0.00 ? 30  VAL A O    1  
ATOM 455   C CB   . VAL A 1 30  ? -6.067  12.381  -2.937  1.00 0.00 ? 30  VAL A CB   1  
ATOM 456   C CG1  . VAL A 1 30  ? -7.467  12.972  -2.862  1.00 0.00 ? 30  VAL A CG1  1  
ATOM 457   C CG2  . VAL A 1 30  ? -5.208  12.860  -1.777  1.00 0.00 ? 30  VAL A CG2  1  
ATOM 458   H H    . VAL A 1 30  ? -4.007  10.863  -2.885  1.00 0.00 ? 30  VAL A H    1  
ATOM 459   H HA   . VAL A 1 30  ? -6.729  10.498  -2.157  1.00 0.00 ? 30  VAL A HA   1  
ATOM 460   H HB   . VAL A 1 30  ? -5.612  12.719  -3.852  1.00 0.00 ? 30  VAL A HB   1  
ATOM 461   H HG11 . VAL A 1 30  ? -8.031  12.669  -3.730  1.00 0.00 ? 30  VAL A HG11 1  
ATOM 462   H HG12 . VAL A 1 30  ? -7.401  14.049  -2.832  1.00 0.00 ? 30  VAL A HG12 1  
ATOM 463   H HG13 . VAL A 1 30  ? -7.959  12.616  -1.969  1.00 0.00 ? 30  VAL A HG13 1  
ATOM 464   H HG21 . VAL A 1 30  ? -4.200  12.498  -1.901  1.00 0.00 ? 30  VAL A HG21 1  
ATOM 465   H HG22 . VAL A 1 30  ? -5.614  12.482  -0.848  1.00 0.00 ? 30  VAL A HG22 1  
ATOM 466   H HG23 . VAL A 1 30  ? -5.205  13.939  -1.755  1.00 0.00 ? 30  VAL A HG23 1  
ATOM 467   N N    . ALA A 1 31  ? -5.982  10.429  -5.355  1.00 0.00 ? 31  ALA A N    1  
ATOM 468   C CA   . ALA A 1 31  ? -6.492  10.076  -6.667  1.00 0.00 ? 31  ALA A CA   1  
ATOM 469   C C    . ALA A 1 31  ? -6.798  8.587   -6.735  1.00 0.00 ? 31  ALA A C    1  
ATOM 470   O O    . ALA A 1 31  ? -7.884  8.186   -7.156  1.00 0.00 ? 31  ALA A O    1  
ATOM 471   C CB   . ALA A 1 31  ? -5.495  10.464  -7.740  1.00 0.00 ? 31  ALA A CB   1  
ATOM 472   H H    . ALA A 1 31  ? -5.037  10.668  -5.253  1.00 0.00 ? 31  ALA A H    1  
ATOM 473   H HA   . ALA A 1 31  ? -7.403  10.631  -6.834  1.00 0.00 ? 31  ALA A HA   1  
ATOM 474   H HB1  . ALA A 1 31  ? -5.301  11.526  -7.684  1.00 0.00 ? 31  ALA A HB1  1  
ATOM 475   H HB2  . ALA A 1 31  ? -5.901  10.224  -8.713  1.00 0.00 ? 31  ALA A HB2  1  
ATOM 476   H HB3  . ALA A 1 31  ? -4.574  9.922   -7.589  1.00 0.00 ? 31  ALA A HB3  1  
ATOM 477   N N    . THR A 1 32  ? -5.830  7.779   -6.329  1.00 0.00 ? 32  THR A N    1  
ATOM 478   C CA   . THR A 1 32  ? -5.987  6.334   -6.310  1.00 0.00 ? 32  THR A CA   1  
ATOM 479   C C    . THR A 1 32  ? -7.136  5.874   -5.407  1.00 0.00 ? 32  THR A C    1  
ATOM 480   O O    . THR A 1 32  ? -8.043  5.174   -5.861  1.00 0.00 ? 32  THR A O    1  
ATOM 481   C CB   . THR A 1 32  ? -4.683  5.658   -5.847  1.00 0.00 ? 32  THR A CB   1  
ATOM 482   O OG1  . THR A 1 32  ? -3.557  6.277   -6.489  1.00 0.00 ? 32  THR A OG1  1  
ATOM 483   C CG2  . THR A 1 32  ? -4.696  4.175   -6.176  1.00 0.00 ? 32  THR A CG2  1  
ATOM 484   H H    . THR A 1 32  ? -4.951  8.150   -6.108  1.00 0.00 ? 32  THR A H    1  
ATOM 485   H HA   . THR A 1 32  ? -6.190  6.007   -7.321  1.00 0.00 ? 32  THR A HA   1  
ATOM 486   H HB   . THR A 1 32  ? -4.593  5.773   -4.776  1.00 0.00 ? 32  THR A HB   1  
ATOM 487   H HG1  . THR A 1 32  ? -3.284  7.055   -5.989  1.00 0.00 ? 32  THR A HG1  1  
ATOM 488   H HG21 . THR A 1 32  ? -4.777  4.043   -7.246  1.00 0.00 ? 32  THR A HG21 1  
ATOM 489   H HG22 . THR A 1 32  ? -5.540  3.707   -5.691  1.00 0.00 ? 32  THR A HG22 1  
ATOM 490   H HG23 . THR A 1 32  ? -3.782  3.718   -5.825  1.00 0.00 ? 32  THR A HG23 1  
ATOM 491   N N    . VAL A 1 33  ? -7.121  6.277   -4.135  1.00 0.00 ? 33  VAL A N    1  
ATOM 492   C CA   . VAL A 1 33  ? -8.056  5.707   -3.163  1.00 0.00 ? 33  VAL A CA   1  
ATOM 493   C C    . VAL A 1 33  ? -8.659  6.753   -2.232  1.00 0.00 ? 33  VAL A C    1  
ATOM 494   O O    . VAL A 1 33  ? -9.039  6.436   -1.110  1.00 0.00 ? 33  VAL A O    1  
ATOM 495   C CB   . VAL A 1 33  ? -7.388  4.609   -2.310  1.00 0.00 ? 33  VAL A CB   1  
ATOM 496   C CG1  . VAL A 1 33  ? -7.158  3.362   -3.143  1.00 0.00 ? 33  VAL A CG1  1  
ATOM 497   C CG2  . VAL A 1 33  ? -6.074  5.107   -1.723  1.00 0.00 ? 33  VAL A CG2  1  
ATOM 498   H H    . VAL A 1 33  ? -6.498  6.982   -3.848  1.00 0.00 ? 33  VAL A H    1  
ATOM 499   H HA   . VAL A 1 33  ? -8.858  5.246   -3.721  1.00 0.00 ? 33  VAL A HA   1  
ATOM 500   H HB   . VAL A 1 33  ? -8.050  4.357   -1.495  1.00 0.00 ? 33  VAL A HB   1  
ATOM 501   H HG11 . VAL A 1 33  ? -6.472  3.587   -3.945  1.00 0.00 ? 33  VAL A HG11 1  
ATOM 502   H HG12 . VAL A 1 33  ? -8.097  3.026   -3.557  1.00 0.00 ? 33  VAL A HG12 1  
ATOM 503   H HG13 . VAL A 1 33  ? -6.740  2.585   -2.520  1.00 0.00 ? 33  VAL A HG13 1  
ATOM 504   H HG21 . VAL A 1 33  ? -5.418  5.416   -2.521  1.00 0.00 ? 33  VAL A HG21 1  
ATOM 505   H HG22 . VAL A 1 33  ? -5.607  4.310   -1.162  1.00 0.00 ? 33  VAL A HG22 1  
ATOM 506   H HG23 . VAL A 1 33  ? -6.264  5.944   -1.067  1.00 0.00 ? 33  VAL A HG23 1  
ATOM 507   N N    . GLY A 1 34  ? -8.738  7.992   -2.690  1.00 0.00 ? 34  GLY A N    1  
ATOM 508   C CA   . GLY A 1 34  ? -9.428  9.033   -1.933  1.00 0.00 ? 34  GLY A CA   1  
ATOM 509   C C    . GLY A 1 34  ? -8.708  9.478   -0.666  1.00 0.00 ? 34  GLY A C    1  
ATOM 510   O O    . GLY A 1 34  ? -8.925  10.592  -0.185  1.00 0.00 ? 34  GLY A O    1  
ATOM 511   H H    . GLY A 1 34  ? -8.340  8.197   -3.563  1.00 0.00 ? 34  GLY A H    1  
ATOM 512   H HA2  . GLY A 1 34  ? -9.563  9.893   -2.568  1.00 0.00 ? 34  GLY A HA2  1  
ATOM 513   H HA3  . GLY A 1 34  ? -10.402 8.656   -1.651  1.00 0.00 ? 34  GLY A HA3  1  
ATOM 514   N N    . TYR A 1 35  ? -7.854  8.623   -0.128  1.00 0.00 ? 35  TYR A N    1  
ATOM 515   C CA   . TYR A 1 35  ? -7.231  8.880   1.157   1.00 0.00 ? 35  TYR A CA   1  
ATOM 516   C C    . TYR A 1 35  ? -6.172  9.951   1.036   1.00 0.00 ? 35  TYR A C    1  
ATOM 517   O O    . TYR A 1 35  ? -5.510  10.079  0.015   1.00 0.00 ? 35  TYR A O    1  
ATOM 518   C CB   . TYR A 1 35  ? -6.609  7.610   1.745   1.00 0.00 ? 35  TYR A CB   1  
ATOM 519   C CG   . TYR A 1 35  ? -7.614  6.633   2.316   1.00 0.00 ? 35  TYR A CG   1  
ATOM 520   C CD1  . TYR A 1 35  ? -8.875  7.058   2.695   1.00 0.00 ? 35  TYR A CD1  1  
ATOM 521   C CD2  . TYR A 1 35  ? -7.293  5.294   2.493   1.00 0.00 ? 35  TYR A CD2  1  
ATOM 522   C CE1  . TYR A 1 35  ? -9.798  6.183   3.230   1.00 0.00 ? 35  TYR A CE1  1  
ATOM 523   C CE2  . TYR A 1 35  ? -8.209  4.406   3.028   1.00 0.00 ? 35  TYR A CE2  1  
ATOM 524   C CZ   . TYR A 1 35  ? -9.464  4.857   3.397   1.00 0.00 ? 35  TYR A CZ   1  
ATOM 525   O OH   . TYR A 1 35  ? -10.392 3.985   3.930   1.00 0.00 ? 35  TYR A OH   1  
ATOM 526   H H    . TYR A 1 35  ? -7.627  7.808   -0.618  1.00 0.00 ? 35  TYR A H    1  
ATOM 527   H HA   . TYR A 1 35  ? -8.000  9.231   1.829   1.00 0.00 ? 35  TYR A HA   1  
ATOM 528   H HB2  . TYR A 1 35  ? -6.047  7.100   0.980   1.00 0.00 ? 35  TYR A HB2  1  
ATOM 529   H HB3  . TYR A 1 35  ? -5.938  7.891   2.543   1.00 0.00 ? 35  TYR A HB3  1  
ATOM 530   H HD1  . TYR A 1 35  ? -9.135  8.097   2.559   1.00 0.00 ? 35  TYR A HD1  1  
ATOM 531   H HD2  . TYR A 1 35  ? -6.314  4.947   2.204   1.00 0.00 ? 35  TYR A HD2  1  
ATOM 532   H HE1  . TYR A 1 35  ? -10.776 6.543   3.519   1.00 0.00 ? 35  TYR A HE1  1  
ATOM 533   H HE2  . TYR A 1 35  ? -7.938  3.365   3.159   1.00 0.00 ? 35  TYR A HE2  1  
ATOM 534   H HH   . TYR A 1 35  ? -11.249 4.141   3.514   1.00 0.00 ? 35  TYR A HH   1  
ATOM 535   N N    . GLN A 1 36  ? -6.028  10.722  2.086   1.00 0.00 ? 36  GLN A N    1  
ATOM 536   C CA   . GLN A 1 36  ? -4.996  11.734  2.140   1.00 0.00 ? 36  GLN A CA   1  
ATOM 537   C C    . GLN A 1 36  ? -3.744  11.102  2.722   1.00 0.00 ? 36  GLN A C    1  
ATOM 538   O O    . GLN A 1 36  ? -3.847  10.078  3.392   1.00 0.00 ? 36  GLN A O    1  
ATOM 539   C CB   . GLN A 1 36  ? -5.432  12.901  3.034   1.00 0.00 ? 36  GLN A CB   1  
ATOM 540   C CG   . GLN A 1 36  ? -6.861  13.377  2.819   1.00 0.00 ? 36  GLN A CG   1  
ATOM 541   C CD   . GLN A 1 36  ? -7.029  14.205  1.566   1.00 0.00 ? 36  GLN A CD   1  
ATOM 542   O OE1  . GLN A 1 36  ? -6.844  15.420  1.590   1.00 0.00 ? 36  GLN A OE1  1  
ATOM 543   N NE2  . GLN A 1 36  ? -7.409  13.570  0.473   1.00 0.00 ? 36  GLN A NE2  1  
ATOM 544   H H    . GLN A 1 36  ? -6.614  10.587  2.859   1.00 0.00 ? 36  GLN A H    1  
ATOM 545   H HA   . GLN A 1 36  ? -4.793  12.076  1.131   1.00 0.00 ? 36  GLN A HA   1  
ATOM 546   H HB2  . GLN A 1 36  ? -5.337  12.596  4.065   1.00 0.00 ? 36  GLN A HB2  1  
ATOM 547   H HB3  . GLN A 1 36  ? -4.770  13.737  2.857   1.00 0.00 ? 36  GLN A HB3  1  
ATOM 548   H HG2  . GLN A 1 36  ? -7.504  12.513  2.746   1.00 0.00 ? 36  GLN A HG2  1  
ATOM 549   H HG3  . GLN A 1 36  ? -7.159  13.971  3.670   1.00 0.00 ? 36  GLN A HG3  1  
ATOM 550   H HE21 . GLN A 1 36  ? -7.560  12.603  0.524   1.00 0.00 ? 36  GLN A HE21 1  
ATOM 551   H HE22 . GLN A 1 36  ? -7.525  14.098  -0.350  1.00 0.00 ? 36  GLN A HE22 1  
ATOM 552   N N    . PRO A 1 37  ? -2.554  11.681  2.493   1.00 0.00 ? 37  PRO A N    1  
ATOM 553   C CA   . PRO A 1 37  ? -1.314  11.134  3.050   1.00 0.00 ? 37  PRO A CA   1  
ATOM 554   C C    . PRO A 1 37  ? -1.452  10.918  4.553   1.00 0.00 ? 37  PRO A C    1  
ATOM 555   O O    . PRO A 1 37  ? -1.149  9.845   5.080   1.00 0.00 ? 37  PRO A O    1  
ATOM 556   C CB   . PRO A 1 37  ? -0.283  12.227  2.753   1.00 0.00 ? 37  PRO A CB   1  
ATOM 557   C CG   . PRO A 1 37  ? -0.825  12.956  1.573   1.00 0.00 ? 37  PRO A CG   1  
ATOM 558   C CD   . PRO A 1 37  ? -2.323  12.896  1.693   1.00 0.00 ? 37  PRO A CD   1  
ATOM 559   H HA   . PRO A 1 37  ? -1.029  10.210  2.571   1.00 0.00 ? 37  PRO A HA   1  
ATOM 560   H HB2  . PRO A 1 37  ? -0.189  12.877  3.610   1.00 0.00 ? 37  PRO A HB2  1  
ATOM 561   H HB3  . PRO A 1 37  ? 0.670   11.775  2.533   1.00 0.00 ? 37  PRO A HB3  1  
ATOM 562   H HG2  . PRO A 1 37  ? -0.491  13.983  1.589   1.00 0.00 ? 37  PRO A HG2  1  
ATOM 563   H HG3  . PRO A 1 37  ? -0.504  12.471  0.662   1.00 0.00 ? 37  PRO A HG3  1  
ATOM 564   H HD2  . PRO A 1 37  ? -2.694  13.772  2.204   1.00 0.00 ? 37  PRO A HD2  1  
ATOM 565   H HD3  . PRO A 1 37  ? -2.776  12.807  0.717   1.00 0.00 ? 37  PRO A HD3  1  
ATOM 566   N N    . GLN A 1 38  ? -1.987  11.942  5.203   1.00 0.00 ? 38  GLN A N    1  
ATOM 567   C CA   . GLN A 1 38  ? -2.213  11.943  6.638   1.00 0.00 ? 38  GLN A CA   1  
ATOM 568   C C    . GLN A 1 38  ? -3.076  10.755  7.071   1.00 0.00 ? 38  GLN A C    1  
ATOM 569   O O    . GLN A 1 38  ? -2.825  10.146  8.114   1.00 0.00 ? 38  GLN A O    1  
ATOM 570   C CB   . GLN A 1 38  ? -2.893  13.252  7.060   1.00 0.00 ? 38  GLN A CB   1  
ATOM 571   C CG   . GLN A 1 38  ? -2.092  14.511  6.750   1.00 0.00 ? 38  GLN A CG   1  
ATOM 572   C CD   . GLN A 1 38  ? -2.134  14.908  5.283   1.00 0.00 ? 38  GLN A CD   1  
ATOM 573   O OE1  . GLN A 1 38  ? -3.093  14.607  4.575   1.00 0.00 ? 38  GLN A OE1  1  
ATOM 574   N NE2  . GLN A 1 38  ? -1.106  15.602  4.820   1.00 0.00 ? 38  GLN A NE2  1  
ATOM 575   H H    . GLN A 1 38  ? -2.238  12.737  4.683   1.00 0.00 ? 38  GLN A H    1  
ATOM 576   H HA   . GLN A 1 38  ? -1.253  11.874  7.125   1.00 0.00 ? 38  GLN A HA   1  
ATOM 577   H HB2  . GLN A 1 38  ? -3.843  13.329  6.546   1.00 0.00 ? 38  GLN A HB2  1  
ATOM 578   H HB3  . GLN A 1 38  ? -3.073  13.217  8.126   1.00 0.00 ? 38  GLN A HB3  1  
ATOM 579   H HG2  . GLN A 1 38  ? -2.483  15.326  7.338   1.00 0.00 ? 38  GLN A HG2  1  
ATOM 580   H HG3  . GLN A 1 38  ? -1.064  14.333  7.024   1.00 0.00 ? 38  GLN A HG3  1  
ATOM 581   H HE21 . GLN A 1 38  ? -0.374  15.821  5.441   1.00 0.00 ? 38  GLN A HE21 1  
ATOM 582   H HE22 . GLN A 1 38  ? -1.117  15.878  3.872   1.00 0.00 ? 38  GLN A HE22 1  
ATOM 583   N N    . GLU A 1 39  ? -4.059  10.400  6.237   1.00 0.00 ? 39  GLU A N    1  
ATOM 584   C CA   . GLU A 1 39  ? -5.054  9.391   6.598   1.00 0.00 ? 39  GLU A CA   1  
ATOM 585   C C    . GLU A 1 39  ? -4.401  8.037   6.815   1.00 0.00 ? 39  GLU A C    1  
ATOM 586   O O    . GLU A 1 39  ? -4.854  7.248   7.643   1.00 0.00 ? 39  GLU A O    1  
ATOM 587   C CB   . GLU A 1 39  ? -6.137  9.271   5.518   1.00 0.00 ? 39  GLU A CB   1  
ATOM 588   C CG   . GLU A 1 39  ? -7.087  10.460  5.450   1.00 0.00 ? 39  GLU A CG   1  
ATOM 589   C CD   . GLU A 1 39  ? -8.042  10.525  6.625   1.00 0.00 ? 39  GLU A CD   1  
ATOM 590   O OE1  . GLU A 1 39  ? -7.648  11.050  7.689   1.00 0.00 ? 39  GLU A OE1  1  
ATOM 591   O OE2  . GLU A 1 39  ? -9.197  10.068  6.484   1.00 0.00 ? 39  GLU A OE2  1  
ATOM 592   H H    . GLU A 1 39  ? -4.092  10.808  5.347   1.00 0.00 ? 39  GLU A H    1  
ATOM 593   H HA   . GLU A 1 39  ? -5.517  9.705   7.522   1.00 0.00 ? 39  GLU A HA   1  
ATOM 594   H HB2  . GLU A 1 39  ? -5.657  9.168   4.556   1.00 0.00 ? 39  GLU A HB2  1  
ATOM 595   H HB3  . GLU A 1 39  ? -6.721  8.384   5.714   1.00 0.00 ? 39  GLU A HB3  1  
ATOM 596   H HG2  . GLU A 1 39  ? -6.505  11.369  5.435   1.00 0.00 ? 39  GLU A HG2  1  
ATOM 597   H HG3  . GLU A 1 39  ? -7.666  10.389  4.541   1.00 0.00 ? 39  GLU A HG3  1  
ATOM 598   N N    . LEU A 1 40  ? -3.339  7.777   6.068   1.00 0.00 ? 40  LEU A N    1  
ATOM 599   C CA   . LEU A 1 40  ? -2.646  6.502   6.150   1.00 0.00 ? 40  LEU A CA   1  
ATOM 600   C C    . LEU A 1 40  ? -1.612  6.501   7.269   1.00 0.00 ? 40  LEU A C    1  
ATOM 601   O O    . LEU A 1 40  ? -1.328  5.459   7.857   1.00 0.00 ? 40  LEU A O    1  
ATOM 602   C CB   . LEU A 1 40  ? -1.943  6.185   4.825   1.00 0.00 ? 40  LEU A CB   1  
ATOM 603   C CG   . LEU A 1 40  ? -2.839  5.769   3.651   1.00 0.00 ? 40  LEU A CG   1  
ATOM 604   C CD1  . LEU A 1 40  ? -3.863  4.732   4.087   1.00 0.00 ? 40  LEU A CD1  1  
ATOM 605   C CD2  . LEU A 1 40  ? -3.517  6.975   3.031   1.00 0.00 ? 40  LEU A CD2  1  
ATOM 606   H H    . LEU A 1 40  ? -3.016  8.454   5.433   1.00 0.00 ? 40  LEU A H    1  
ATOM 607   H HA   . LEU A 1 40  ? -3.380  5.735   6.350   1.00 0.00 ? 40  LEU A HA   1  
ATOM 608   H HB2  . LEU A 1 40  ? -1.390  7.064   4.523   1.00 0.00 ? 40  LEU A HB2  1  
ATOM 609   H HB3  . LEU A 1 40  ? -1.239  5.393   5.006   1.00 0.00 ? 40  LEU A HB3  1  
ATOM 610   H HG   . LEU A 1 40  ? -2.220  5.313   2.891   1.00 0.00 ? 40  LEU A HG   1  
ATOM 611   H HD11 . LEU A 1 40  ? -3.352  3.861   4.471   1.00 0.00 ? 40  LEU A HD11 1  
ATOM 612   H HD12 . LEU A 1 40  ? -4.473  4.449   3.242   1.00 0.00 ? 40  LEU A HD12 1  
ATOM 613   H HD13 . LEU A 1 40  ? -4.492  5.150   4.860   1.00 0.00 ? 40  LEU A HD13 1  
ATOM 614   H HD21 . LEU A 1 40  ? -2.769  7.680   2.703   1.00 0.00 ? 40  LEU A HD21 1  
ATOM 615   H HD22 . LEU A 1 40  ? -4.159  7.443   3.762   1.00 0.00 ? 40  LEU A HD22 1  
ATOM 616   H HD23 . LEU A 1 40  ? -4.109  6.658   2.183   1.00 0.00 ? 40  LEU A HD23 1  
ATOM 617   N N    . LEU A 1 41  ? -1.046  7.672   7.553   1.00 0.00 ? 41  LEU A N    1  
ATOM 618   C CA   . LEU A 1 41  ? 0.074   7.772   8.488   1.00 0.00 ? 41  LEU A CA   1  
ATOM 619   C C    . LEU A 1 41  ? -0.318  7.302   9.885   1.00 0.00 ? 41  LEU A C    1  
ATOM 620   O O    . LEU A 1 41  ? -1.045  7.988   10.606  1.00 0.00 ? 41  LEU A O    1  
ATOM 621   C CB   . LEU A 1 41  ? 0.609   9.203   8.552   1.00 0.00 ? 41  LEU A CB   1  
ATOM 622   C CG   . LEU A 1 41  ? 0.973   9.823   7.204   1.00 0.00 ? 41  LEU A CG   1  
ATOM 623   C CD1  . LEU A 1 41  ? 1.534   11.220  7.399   1.00 0.00 ? 41  LEU A CD1  1  
ATOM 624   C CD2  . LEU A 1 41  ? 1.962   8.943   6.460   1.00 0.00 ? 41  LEU A CD2  1  
ATOM 625   H H    . LEU A 1 41  ? -1.384  8.481   7.109   1.00 0.00 ? 41  LEU A H    1  
ATOM 626   H HA   . LEU A 1 41  ? 0.859   7.127   8.121   1.00 0.00 ? 41  LEU A HA   1  
ATOM 627   H HB2  . LEU A 1 41  ? -0.135  9.826   9.024   1.00 0.00 ? 41  LEU A HB2  1  
ATOM 628   H HB3  . LEU A 1 41  ? 1.497   9.199   9.167   1.00 0.00 ? 41  LEU A HB3  1  
ATOM 629   H HG   . LEU A 1 41  ? 0.080   9.904   6.602   1.00 0.00 ? 41  LEU A HG   1  
ATOM 630   H HD11 . LEU A 1 41  ? 2.415   11.172  8.022   1.00 0.00 ? 41  LEU A HD11 1  
ATOM 631   H HD12 . LEU A 1 41  ? 0.791   11.844  7.874   1.00 0.00 ? 41  LEU A HD12 1  
ATOM 632   H HD13 . LEU A 1 41  ? 1.795   11.640  6.438   1.00 0.00 ? 41  LEU A HD13 1  
ATOM 633   H HD21 . LEU A 1 41  ? 2.860   8.827   7.050   1.00 0.00 ? 41  LEU A HD21 1  
ATOM 634   H HD22 . LEU A 1 41  ? 2.210   9.399   5.512   1.00 0.00 ? 41  LEU A HD22 1  
ATOM 635   H HD23 . LEU A 1 41  ? 1.520   7.973   6.286   1.00 0.00 ? 41  LEU A HD23 1  
ATOM 636   N N    . GLY A 1 42  ? 0.176   6.129   10.260  1.00 0.00 ? 42  GLY A N    1  
ATOM 637   C CA   . GLY A 1 42  ? -0.120  5.573   11.567  1.00 0.00 ? 42  GLY A CA   1  
ATOM 638   C C    . GLY A 1 42  ? -1.063  4.391   11.484  1.00 0.00 ? 42  GLY A C    1  
ATOM 639   O O    . GLY A 1 42  ? -1.348  3.740   12.486  1.00 0.00 ? 42  GLY A O    1  
ATOM 640   H H    . GLY A 1 42  ? 0.749   5.630   9.636   1.00 0.00 ? 42  GLY A H    1  
ATOM 641   H HA2  . GLY A 1 42  ? 0.802   5.253   12.029  1.00 0.00 ? 42  GLY A HA2  1  
ATOM 642   H HA3  . GLY A 1 42  ? -0.573  6.339   12.180  1.00 0.00 ? 42  GLY A HA3  1  
ATOM 643   N N    . LYS A 1 43  ? -1.554  4.120   10.285  1.00 0.00 ? 43  LYS A N    1  
ATOM 644   C CA   . LYS A 1 43  ? -2.483  3.027   10.064  1.00 0.00 ? 43  LYS A CA   1  
ATOM 645   C C    . LYS A 1 43  ? -1.801  1.875   9.344   1.00 0.00 ? 43  LYS A C    1  
ATOM 646   O O    . LYS A 1 43  ? -0.812  2.075   8.633   1.00 0.00 ? 43  LYS A O    1  
ATOM 647   C CB   . LYS A 1 43  ? -3.657  3.514   9.217   1.00 0.00 ? 43  LYS A CB   1  
ATOM 648   C CG   . LYS A 1 43  ? -4.465  4.639   9.845   1.00 0.00 ? 43  LYS A CG   1  
ATOM 649   C CD   . LYS A 1 43  ? -5.460  4.126   10.874  1.00 0.00 ? 43  LYS A CD   1  
ATOM 650   C CE   . LYS A 1 43  ? -4.779  3.659   12.150  1.00 0.00 ? 43  LYS A CE   1  
ATOM 651   N NZ   . LYS A 1 43  ? -5.723  2.952   13.050  1.00 0.00 ? 43  LYS A NZ   1  
ATOM 652   H H    . LYS A 1 43  ? -1.287  4.676   9.519   1.00 0.00 ? 43  LYS A H    1  
ATOM 653   H HA   . LYS A 1 43  ? -2.850  2.689   11.020  1.00 0.00 ? 43  LYS A HA   1  
ATOM 654   H HB2  . LYS A 1 43  ? -3.279  3.863   8.267   1.00 0.00 ? 43  LYS A HB2  1  
ATOM 655   H HB3  . LYS A 1 43  ? -4.323  2.680   9.042   1.00 0.00 ? 43  LYS A HB3  1  
ATOM 656   H HG2  . LYS A 1 43  ? -3.789  5.328   10.329  1.00 0.00 ? 43  LYS A HG2  1  
ATOM 657   H HG3  . LYS A 1 43  ? -5.002  5.149   9.066   1.00 0.00 ? 43  LYS A HG3  1  
ATOM 658   H HD2  . LYS A 1 43  ? -6.150  4.919   11.117  1.00 0.00 ? 43  LYS A HD2  1  
ATOM 659   H HD3  . LYS A 1 43  ? -6.001  3.297   10.442  1.00 0.00 ? 43  LYS A HD3  1  
ATOM 660   H HE2  . LYS A 1 43  ? -3.975  2.988   11.889  1.00 0.00 ? 43  LYS A HE2  1  
ATOM 661   H HE3  . LYS A 1 43  ? -4.378  4.521   12.665  1.00 0.00 ? 43  LYS A HE3  1  
ATOM 662   H HZ1  . LYS A 1 43  ? -6.502  3.589   13.326  1.00 0.00 ? 43  LYS A HZ1  1  
ATOM 663   H HZ2  . LYS A 1 43  ? -5.233  2.635   13.911  1.00 0.00 ? 43  LYS A HZ2  1  
ATOM 664   H HZ3  . LYS A 1 43  ? -6.124  2.119   12.563  1.00 0.00 ? 43  LYS A HZ3  1  
ATOM 665   N N    . ASN A 1 44  ? -2.319  0.673   9.543   1.00 0.00 ? 44  ASN A N    1  
ATOM 666   C CA   . ASN A 1 44  ? -1.900  -0.476  8.783   1.00 0.00 ? 44  ASN A CA   1  
ATOM 667   C C    . ASN A 1 44  ? -2.670  -0.509  7.475   1.00 0.00 ? 44  ASN A C    1  
ATOM 668   O O    . ASN A 1 44  ? -3.878  -0.275  7.452   1.00 0.00 ? 44  ASN A O    1  
ATOM 669   C CB   . ASN A 1 44  ? -2.209  -1.765  9.544   1.00 0.00 ? 44  ASN A CB   1  
ATOM 670   C CG   . ASN A 1 44  ? -1.665  -1.797  10.963  1.00 0.00 ? 44  ASN A CG   1  
ATOM 671   O OD1  . ASN A 1 44  ? -2.308  -1.318  11.894  1.00 0.00 ? 44  ASN A OD1  1  
ATOM 672   N ND2  . ASN A 1 44  ? -0.500  -2.402  11.148  1.00 0.00 ? 44  ASN A ND2  1  
ATOM 673   H H    . ASN A 1 44  ? -3.010  0.541   10.230  1.00 0.00 ? 44  ASN A H    1  
ATOM 674   H HA   . ASN A 1 44  ? -0.840  -0.406  8.587   1.00 0.00 ? 44  ASN A HA   1  
ATOM 675   H HB2  . ASN A 1 44  ? -3.281  -1.903  9.581   1.00 0.00 ? 44  ASN A HB2  1  
ATOM 676   H HB3  . ASN A 1 44  ? -1.781  -2.580  9.006   1.00 0.00 ? 44  ASN A HB3  1  
ATOM 677   H HD21 . ASN A 1 44  ? -0.046  -2.800  10.369  1.00 0.00 ? 44  ASN A HD21 1  
ATOM 678   H HD22 . ASN A 1 44  ? -0.134  -2.431  12.058  1.00 0.00 ? 44  ASN A HD22 1  
ATOM 679   N N    . ILE A 1 45  ? -1.974  -0.808  6.388   1.00 0.00 ? 45  ILE A N    1  
ATOM 680   C CA   . ILE A 1 45  ? -2.621  -1.025  5.098   1.00 0.00 ? 45  ILE A CA   1  
ATOM 681   C C    . ILE A 1 45  ? -3.625  -2.178  5.198   1.00 0.00 ? 45  ILE A C    1  
ATOM 682   O O    . ILE A 1 45  ? -4.549  -2.287  4.397   1.00 0.00 ? 45  ILE A O    1  
ATOM 683   C CB   . ILE A 1 45  ? -1.575  -1.334  3.995   1.00 0.00 ? 45  ILE A CB   1  
ATOM 684   C CG1  . ILE A 1 45  ? -2.251  -1.492  2.628   1.00 0.00 ? 45  ILE A CG1  1  
ATOM 685   C CG2  . ILE A 1 45  ? -0.775  -2.580  4.351   1.00 0.00 ? 45  ILE A CG2  1  
ATOM 686   C CD1  . ILE A 1 45  ? -1.280  -1.728  1.489   1.00 0.00 ? 45  ILE A CD1  1  
ATOM 687   H H    . ILE A 1 45  ? -0.996  -0.854  6.449   1.00 0.00 ? 45  ILE A H    1  
ATOM 688   H HA   . ILE A 1 45  ? -3.151  -0.118  4.827   1.00 0.00 ? 45  ILE A HA   1  
ATOM 689   H HB   . ILE A 1 45  ? -0.886  -0.504  3.949   1.00 0.00 ? 45  ILE A HB   1  
ATOM 690   H HG12 . ILE A 1 45  ? -2.926  -2.332  2.667   1.00 0.00 ? 45  ILE A HG12 1  
ATOM 691   H HG13 . ILE A 1 45  ? -2.812  -0.595  2.405   1.00 0.00 ? 45  ILE A HG13 1  
ATOM 692   H HG21 . ILE A 1 45  ? -1.443  -3.424  4.438   1.00 0.00 ? 45  ILE A HG21 1  
ATOM 693   H HG22 . ILE A 1 45  ? -0.268  -2.426  5.291   1.00 0.00 ? 45  ILE A HG22 1  
ATOM 694   H HG23 . ILE A 1 45  ? -0.047  -2.773  3.576   1.00 0.00 ? 45  ILE A HG23 1  
ATOM 695   H HD11 . ILE A 1 45  ? -0.626  -0.876  1.393   1.00 0.00 ? 45  ILE A HD11 1  
ATOM 696   H HD12 . ILE A 1 45  ? -1.831  -1.865  0.570   1.00 0.00 ? 45  ILE A HD12 1  
ATOM 697   H HD13 . ILE A 1 45  ? -0.694  -2.612  1.692   1.00 0.00 ? 45  ILE A HD13 1  
ATOM 698   N N    . VAL A 1 46  ? -3.448  -3.020  6.212   1.00 0.00 ? 46  VAL A N    1  
ATOM 699   C CA   . VAL A 1 46  ? -4.323  -4.155  6.429   1.00 0.00 ? 46  VAL A CA   1  
ATOM 700   C C    . VAL A 1 46  ? -5.659  -3.711  7.043   1.00 0.00 ? 46  VAL A C    1  
ATOM 701   O O    . VAL A 1 46  ? -6.635  -4.459  7.035   1.00 0.00 ? 46  VAL A O    1  
ATOM 702   C CB   . VAL A 1 46  ? -3.637  -5.209  7.330   1.00 0.00 ? 46  VAL A CB   1  
ATOM 703   C CG1  . VAL A 1 46  ? -3.573  -4.747  8.774   1.00 0.00 ? 46  VAL A CG1  1  
ATOM 704   C CG2  . VAL A 1 46  ? -4.334  -6.555  7.221   1.00 0.00 ? 46  VAL A CG2  1  
ATOM 705   H H    . VAL A 1 46  ? -2.702  -2.872  6.829   1.00 0.00 ? 46  VAL A H    1  
ATOM 706   H HA   . VAL A 1 46  ? -4.518  -4.609  5.469   1.00 0.00 ? 46  VAL A HA   1  
ATOM 707   H HB   . VAL A 1 46  ? -2.622  -5.328  6.981   1.00 0.00 ? 46  VAL A HB   1  
ATOM 708   H HG11 . VAL A 1 46  ? -3.007  -3.831  8.833   1.00 0.00 ? 46  VAL A HG11 1  
ATOM 709   H HG12 . VAL A 1 46  ? -3.093  -5.508  9.373   1.00 0.00 ? 46  VAL A HG12 1  
ATOM 710   H HG13 . VAL A 1 46  ? -4.575  -4.578  9.141   1.00 0.00 ? 46  VAL A HG13 1  
ATOM 711   H HG21 . VAL A 1 46  ? -3.849  -7.264  7.876   1.00 0.00 ? 46  VAL A HG21 1  
ATOM 712   H HG22 . VAL A 1 46  ? -4.278  -6.908  6.204   1.00 0.00 ? 46  VAL A HG22 1  
ATOM 713   H HG23 . VAL A 1 46  ? -5.369  -6.447  7.511   1.00 0.00 ? 46  VAL A HG23 1  
ATOM 714   N N    . GLU A 1 47  ? -5.702  -2.485  7.567   1.00 0.00 ? 47  GLU A N    1  
ATOM 715   C CA   . GLU A 1 47  ? -6.944  -1.928  8.101   1.00 0.00 ? 47  GLU A CA   1  
ATOM 716   C C    . GLU A 1 47  ? -7.869  -1.541  6.962   1.00 0.00 ? 47  GLU A C    1  
ATOM 717   O O    . GLU A 1 47  ? -9.089  -1.662  7.060   1.00 0.00 ? 47  GLU A O    1  
ATOM 718   C CB   . GLU A 1 47  ? -6.674  -0.694  8.965   1.00 0.00 ? 47  GLU A CB   1  
ATOM 719   C CG   . GLU A 1 47  ? -5.878  -0.982  10.222  1.00 0.00 ? 47  GLU A CG   1  
ATOM 720   C CD   . GLU A 1 47  ? -5.662  0.250   11.076  1.00 0.00 ? 47  GLU A CD   1  
ATOM 721   O OE1  . GLU A 1 47  ? -6.629  0.726   11.707  1.00 0.00 ? 47  GLU A OE1  1  
ATOM 722   O OE2  . GLU A 1 47  ? -4.518  0.741   11.136  1.00 0.00 ? 47  GLU A OE2  1  
ATOM 723   H H    . GLU A 1 47  ? -4.887  -1.938  7.591   1.00 0.00 ? 47  GLU A H    1  
ATOM 724   H HA   . GLU A 1 47  ? -7.419  -2.687  8.702   1.00 0.00 ? 47  GLU A HA   1  
ATOM 725   H HB2  . GLU A 1 47  ? -6.124  0.025   8.379   1.00 0.00 ? 47  GLU A HB2  1  
ATOM 726   H HB3  . GLU A 1 47  ? -7.620  -0.262  9.254   1.00 0.00 ? 47  GLU A HB3  1  
ATOM 727   H HG2  . GLU A 1 47  ? -6.405  -1.718  10.807  1.00 0.00 ? 47  GLU A HG2  1  
ATOM 728   H HG3  . GLU A 1 47  ? -4.917  -1.371  9.935   1.00 0.00 ? 47  GLU A HG3  1  
ATOM 729   N N    . PHE A 1 48  ? -7.270  -1.077  5.876   1.00 0.00 ? 48  PHE A N    1  
ATOM 730   C CA   . PHE A 1 48  ? -8.020  -0.635  4.712   1.00 0.00 ? 48  PHE A CA   1  
ATOM 731   C C    . PHE A 1 48  ? -8.000  -1.707  3.636   1.00 0.00 ? 48  PHE A C    1  
ATOM 732   O O    . PHE A 1 48  ? -8.374  -1.464  2.489   1.00 0.00 ? 48  PHE A O    1  
ATOM 733   C CB   . PHE A 1 48  ? -7.438  0.671   4.175   1.00 0.00 ? 48  PHE A CB   1  
ATOM 734   C CG   . PHE A 1 48  ? -7.300  1.733   5.230   1.00 0.00 ? 48  PHE A CG   1  
ATOM 735   C CD1  . PHE A 1 48  ? -8.423  2.302   5.808   1.00 0.00 ? 48  PHE A CD1  1  
ATOM 736   C CD2  . PHE A 1 48  ? -6.050  2.157   5.646   1.00 0.00 ? 48  PHE A CD2  1  
ATOM 737   C CE1  . PHE A 1 48  ? -8.302  3.274   6.781   1.00 0.00 ? 48  PHE A CE1  1  
ATOM 738   C CE2  . PHE A 1 48  ? -5.924  3.130   6.618   1.00 0.00 ? 48  PHE A CE2  1  
ATOM 739   C CZ   . PHE A 1 48  ? -7.052  3.687   7.185   1.00 0.00 ? 48  PHE A CZ   1  
ATOM 740   H H    . PHE A 1 48  ? -6.291  -1.030  5.857   1.00 0.00 ? 48  PHE A H    1  
ATOM 741   H HA   . PHE A 1 48  ? -9.042  -0.467  5.019   1.00 0.00 ? 48  PHE A HA   1  
ATOM 742   H HB2  . PHE A 1 48  ? -6.459  0.482   3.761   1.00 0.00 ? 48  PHE A HB2  1  
ATOM 743   H HB3  . PHE A 1 48  ? -8.086  1.054   3.399   1.00 0.00 ? 48  PHE A HB3  1  
ATOM 744   H HD1  . PHE A 1 48  ? -9.403  1.979   5.491   1.00 0.00 ? 48  PHE A HD1  1  
ATOM 745   H HD2  . PHE A 1 48  ? -5.168  1.721   5.203   1.00 0.00 ? 48  PHE A HD2  1  
ATOM 746   H HE1  . PHE A 1 48  ? -9.186  3.709   7.225   1.00 0.00 ? 48  PHE A HE1  1  
ATOM 747   H HE2  . PHE A 1 48  ? -4.942  3.454   6.934   1.00 0.00 ? 48  PHE A HE2  1  
ATOM 748   H HZ   . PHE A 1 48  ? -6.956  4.446   7.947   1.00 0.00 ? 48  PHE A HZ   1  
ATOM 749   N N    . CYS A 1 49  ? -7.548  -2.892  4.012   1.00 0.00 ? 49  CYS A N    1  
ATOM 750   C CA   . CYS A 1 49  ? -7.524  -4.017  3.094   1.00 0.00 ? 49  CYS A CA   1  
ATOM 751   C C    . CYS A 1 49  ? -8.834  -4.790  3.167   1.00 0.00 ? 49  CYS A C    1  
ATOM 752   O O    . CYS A 1 49  ? -9.402  -4.963  4.247   1.00 0.00 ? 49  CYS A O    1  
ATOM 753   C CB   . CYS A 1 49  ? -6.355  -4.945  3.418   1.00 0.00 ? 49  CYS A CB   1  
ATOM 754   S SG   . CYS A 1 49  ? -6.238  -6.380  2.325   1.00 0.00 ? 49  CYS A SG   1  
ATOM 755   H H    . CYS A 1 49  ? -7.218  -3.013  4.932   1.00 0.00 ? 49  CYS A H    1  
ATOM 756   H HA   . CYS A 1 49  ? -7.400  -3.626  2.095   1.00 0.00 ? 49  CYS A HA   1  
ATOM 757   H HB2  . CYS A 1 49  ? -5.431  -4.392  3.339   1.00 0.00 ? 49  CYS A HB2  1  
ATOM 758   H HB3  . CYS A 1 49  ? -6.465  -5.311  4.427   1.00 0.00 ? 49  CYS A HB3  1  
ATOM 759   H HG   . CYS A 1 49  ? -5.119  -6.275  1.624   1.00 0.00 ? 49  CYS A HG   1  
ATOM 760   N N    . HIS A 1 50  ? -9.323  -5.207  2.002   1.00 0.00 ? 50  HIS A N    1  
ATOM 761   C CA   . HIS A 1 50  ? -10.505 -6.061  1.902   1.00 0.00 ? 50  HIS A CA   1  
ATOM 762   C C    . HIS A 1 50  ? -10.387 -7.249  2.855   1.00 0.00 ? 50  HIS A C    1  
ATOM 763   O O    . HIS A 1 50  ? -9.422  -8.001  2.788   1.00 0.00 ? 50  HIS A O    1  
ATOM 764   C CB   . HIS A 1 50  ? -10.660 -6.547  0.457   1.00 0.00 ? 50  HIS A CB   1  
ATOM 765   C CG   . HIS A 1 50  ? -11.944 -7.264  0.173   1.00 0.00 ? 50  HIS A CG   1  
ATOM 766   N ND1  . HIS A 1 50  ? -11.987 -8.542  -0.332  1.00 0.00 ? 50  HIS A ND1  1  
ATOM 767   C CD2  . HIS A 1 50  ? -13.231 -6.863  0.283   1.00 0.00 ? 50  HIS A CD2  1  
ATOM 768   C CE1  . HIS A 1 50  ? -13.240 -8.901  -0.518  1.00 0.00 ? 50  HIS A CE1  1  
ATOM 769   N NE2  . HIS A 1 50  ? -14.016 -7.898  -0.153  1.00 0.00 ? 50  HIS A NE2  1  
ATOM 770   H H    . HIS A 1 50  ? -8.891  -4.895  1.176   1.00 0.00 ? 50  HIS A H    1  
ATOM 771   H HA   . HIS A 1 50  ? -11.370 -5.473  2.174   1.00 0.00 ? 50  HIS A HA   1  
ATOM 772   H HB2  . HIS A 1 50  ? -10.607 -5.696  -0.205  1.00 0.00 ? 50  HIS A HB2  1  
ATOM 773   H HB3  . HIS A 1 50  ? -9.848  -7.222  0.227   1.00 0.00 ? 50  HIS A HB3  1  
ATOM 774   H HD1  . HIS A 1 50  ? -11.195 -9.101  -0.558  1.00 0.00 ? 50  HIS A HD1  1  
ATOM 775   H HD2  . HIS A 1 50  ? -13.572 -5.901  0.637   1.00 0.00 ? 50  HIS A HD2  1  
ATOM 776   H HE1  . HIS A 1 50  ? -13.575 -9.853  -0.900  1.00 0.00 ? 50  HIS A HE1  1  
ATOM 777   H HE2  . HIS A 1 50  ? -14.999 -7.960  -0.035  1.00 0.00 ? 50  HIS A HE2  1  
ATOM 778   N N    . PRO A 1 51  ? -11.378 -7.424  3.752   1.00 0.00 ? 51  PRO A N    1  
ATOM 779   C CA   . PRO A 1 51  ? -11.344 -8.434  4.830   1.00 0.00 ? 51  PRO A CA   1  
ATOM 780   C C    . PRO A 1 51  ? -11.046 -9.863  4.359   1.00 0.00 ? 51  PRO A C    1  
ATOM 781   O O    . PRO A 1 51  ? -10.643 -10.707 5.156   1.00 0.00 ? 51  PRO A O    1  
ATOM 782   C CB   . PRO A 1 51  ? -12.747 -8.363  5.453   1.00 0.00 ? 51  PRO A CB   1  
ATOM 783   C CG   . PRO A 1 51  ? -13.569 -7.533  4.526   1.00 0.00 ? 51  PRO A CG   1  
ATOM 784   C CD   . PRO A 1 51  ? -12.613 -6.628  3.808   1.00 0.00 ? 51  PRO A CD   1  
ATOM 785   H HA   . PRO A 1 51  ? -10.617 -8.163  5.581   1.00 0.00 ? 51  PRO A HA   1  
ATOM 786   H HB2  . PRO A 1 51  ? -13.150 -9.360  5.546   1.00 0.00 ? 51  PRO A HB2  1  
ATOM 787   H HB3  . PRO A 1 51  ? -12.683 -7.908  6.431   1.00 0.00 ? 51  PRO A HB3  1  
ATOM 788   H HG2  . PRO A 1 51  ? -14.083 -8.168  3.820   1.00 0.00 ? 51  PRO A HG2  1  
ATOM 789   H HG3  . PRO A 1 51  ? -14.282 -6.950  5.091   1.00 0.00 ? 51  PRO A HG3  1  
ATOM 790   H HD2  . PRO A 1 51  ? -12.974 -6.404  2.814   1.00 0.00 ? 51  PRO A HD2  1  
ATOM 791   H HD3  . PRO A 1 51  ? -12.458 -5.719  4.369   1.00 0.00 ? 51  PRO A HD3  1  
ATOM 792   N N    . GLU A 1 52  ? -11.230 -10.136 3.077   1.00 0.00 ? 52  GLU A N    1  
ATOM 793   C CA   . GLU A 1 52  ? -10.957 -11.465 2.539   1.00 0.00 ? 52  GLU A CA   1  
ATOM 794   C C    . GLU A 1 52  ? -9.549  -11.553 1.964   1.00 0.00 ? 52  GLU A C    1  
ATOM 795   O O    . GLU A 1 52  ? -9.089  -12.630 1.590   1.00 0.00 ? 52  GLU A O    1  
ATOM 796   C CB   . GLU A 1 52  ? -11.976 -11.821 1.464   1.00 0.00 ? 52  GLU A CB   1  
ATOM 797   C CG   . GLU A 1 52  ? -13.379 -12.025 2.000   1.00 0.00 ? 52  GLU A CG   1  
ATOM 798   C CD   . GLU A 1 52  ? -14.392 -12.250 0.900   1.00 0.00 ? 52  GLU A CD   1  
ATOM 799   O OE1  . GLU A 1 52  ? -14.383 -13.337 0.290   1.00 0.00 ? 52  GLU A OE1  1  
ATOM 800   O OE2  . GLU A 1 52  ? -15.212 -11.343 0.649   1.00 0.00 ? 52  GLU A OE2  1  
ATOM 801   H H    . GLU A 1 52  ? -11.547 -9.437  2.473   1.00 0.00 ? 52  GLU A H    1  
ATOM 802   H HA   . GLU A 1 52  ? -11.046 -12.172 3.346   1.00 0.00 ? 52  GLU A HA   1  
ATOM 803   H HB2  . GLU A 1 52  ? -12.001 -11.027 0.740   1.00 0.00 ? 52  GLU A HB2  1  
ATOM 804   H HB3  . GLU A 1 52  ? -11.665 -12.733 0.977   1.00 0.00 ? 52  GLU A HB3  1  
ATOM 805   H HG2  . GLU A 1 52  ? -13.379 -12.887 2.651   1.00 0.00 ? 52  GLU A HG2  1  
ATOM 806   H HG3  . GLU A 1 52  ? -13.666 -11.149 2.563   1.00 0.00 ? 52  GLU A HG3  1  
ATOM 807   N N    . ASP A 1 53  ? -8.854  -10.424 1.913   1.00 0.00 ? 53  ASP A N    1  
ATOM 808   C CA   . ASP A 1 53  ? -7.538  -10.365 1.290   1.00 0.00 ? 53  ASP A CA   1  
ATOM 809   C C    . ASP A 1 53  ? -6.513  -9.824  2.273   1.00 0.00 ? 53  ASP A C    1  
ATOM 810   O O    . ASP A 1 53  ? -5.343  -9.638  1.929   1.00 0.00 ? 53  ASP A O    1  
ATOM 811   C CB   . ASP A 1 53  ? -7.563  -9.472  0.044   1.00 0.00 ? 53  ASP A CB   1  
ATOM 812   C CG   . ASP A 1 53  ? -8.566  -9.930  -0.992  1.00 0.00 ? 53  ASP A CG   1  
ATOM 813   O OD1  . ASP A 1 53  ? -8.235  -10.819 -1.797  1.00 0.00 ? 53  ASP A OD1  1  
ATOM 814   O OD2  . ASP A 1 53  ? -9.695  -9.395  -1.001  1.00 0.00 ? 53  ASP A OD2  1  
ATOM 815   H H    . ASP A 1 53  ? -9.213  -9.609  2.334   1.00 0.00 ? 53  ASP A H    1  
ATOM 816   H HA   . ASP A 1 53  ? -7.257  -11.368 1.002   1.00 0.00 ? 53  ASP A HA   1  
ATOM 817   H HB2  . ASP A 1 53  ? -7.819  -8.464  0.340   1.00 0.00 ? 53  ASP A HB2  1  
ATOM 818   H HB3  . ASP A 1 53  ? -6.582  -9.468  -0.408  1.00 0.00 ? 53  ASP A HB3  1  
ATOM 819   N N    . GLN A 1 54  ? -6.952  -9.580  3.506   1.00 0.00 ? 54  GLN A N    1  
ATOM 820   C CA   . GLN A 1 54  ? -6.082  -9.003  4.524   1.00 0.00 ? 54  GLN A CA   1  
ATOM 821   C C    . GLN A 1 54  ? -4.925  -9.948  4.841   1.00 0.00 ? 54  GLN A C    1  
ATOM 822   O O    . GLN A 1 54  ? -3.783  -9.520  5.007   1.00 0.00 ? 54  GLN A O    1  
ATOM 823   C CB   . GLN A 1 54  ? -6.876  -8.672  5.796   1.00 0.00 ? 54  GLN A CB   1  
ATOM 824   C CG   . GLN A 1 54  ? -8.029  -7.701  5.564   1.00 0.00 ? 54  GLN A CG   1  
ATOM 825   C CD   . GLN A 1 54  ? -8.665  -7.215  6.836   1.00 0.00 ? 54  GLN A CD   1  
ATOM 826   O OE1  . GLN A 1 54  ? -8.661  -7.902  7.858   1.00 0.00 ? 54  GLN A OE1  1  
ATOM 827   N NE2  . GLN A 1 54  ? -9.234  -6.025  6.773   1.00 0.00 ? 54  GLN A NE2  1  
ATOM 828   H H    . GLN A 1 54  ? -7.879  -9.791  3.732   1.00 0.00 ? 54  GLN A H    1  
ATOM 829   H HA   . GLN A 1 54  ? -5.674  -8.086  4.122   1.00 0.00 ? 54  GLN A HA   1  
ATOM 830   H HB2  . GLN A 1 54  ? -7.283  -9.587  6.202   1.00 0.00 ? 54  GLN A HB2  1  
ATOM 831   H HB3  . GLN A 1 54  ? -6.207  -8.235  6.523   1.00 0.00 ? 54  GLN A HB3  1  
ATOM 832   H HG2  . GLN A 1 54  ? -7.664  -6.836  5.042   1.00 0.00 ? 54  GLN A HG2  1  
ATOM 833   H HG3  . GLN A 1 54  ? -8.785  -8.191  4.966   1.00 0.00 ? 54  GLN A HG3  1  
ATOM 834   H HE21 . GLN A 1 54  ? -9.219  -5.538  5.911   1.00 0.00 ? 54  GLN A HE21 1  
ATOM 835   H HE22 . GLN A 1 54  ? -9.626  -5.667  7.581   1.00 0.00 ? 54  GLN A HE22 1  
ATOM 836   N N    . GLN A 1 55  ? -5.227  -11.240 4.893   1.00 0.00 ? 55  GLN A N    1  
ATOM 837   C CA   . GLN A 1 55  ? -4.207  -12.260 5.117   1.00 0.00 ? 55  GLN A CA   1  
ATOM 838   C C    . GLN A 1 55  ? -3.334  -12.423 3.876   1.00 0.00 ? 55  GLN A C    1  
ATOM 839   O O    . GLN A 1 55  ? -2.142  -12.709 3.977   1.00 0.00 ? 55  GLN A O    1  
ATOM 840   C CB   . GLN A 1 55  ? -4.870  -13.588 5.482   1.00 0.00 ? 55  GLN A CB   1  
ATOM 841   C CG   . GLN A 1 55  ? -3.901  -14.749 5.672   1.00 0.00 ? 55  GLN A CG   1  
ATOM 842   C CD   . GLN A 1 55  ? -2.858  -14.496 6.748   1.00 0.00 ? 55  GLN A CD   1  
ATOM 843   O OE1  . GLN A 1 55  ? -3.092  -13.762 7.707   1.00 0.00 ? 55  GLN A OE1  1  
ATOM 844   N NE2  . GLN A 1 55  ? -1.701  -15.118 6.595   1.00 0.00 ? 55  GLN A NE2  1  
ATOM 845   H H    . GLN A 1 55  ? -6.161  -11.516 4.787   1.00 0.00 ? 55  GLN A H    1  
ATOM 846   H HA   . GLN A 1 55  ? -3.587  -11.938 5.940   1.00 0.00 ? 55  GLN A HA   1  
ATOM 847   H HB2  . GLN A 1 55  ? -5.417  -13.456 6.402   1.00 0.00 ? 55  GLN A HB2  1  
ATOM 848   H HB3  . GLN A 1 55  ? -5.564  -13.852 4.698   1.00 0.00 ? 55  GLN A HB3  1  
ATOM 849   H HG2  . GLN A 1 55  ? -4.468  -15.628 5.945   1.00 0.00 ? 55  GLN A HG2  1  
ATOM 850   H HG3  . GLN A 1 55  ? -3.392  -14.930 4.736   1.00 0.00 ? 55  GLN A HG3  1  
ATOM 851   H HE21 . GLN A 1 55  ? -1.585  -15.696 5.810   1.00 0.00 ? 55  GLN A HE21 1  
ATOM 852   H HE22 . GLN A 1 55  ? -1.006  -14.987 7.281   1.00 0.00 ? 55  GLN A HE22 1  
ATOM 853   N N    . LEU A 1 56  ? -3.940  -12.228 2.709   1.00 0.00 ? 56  LEU A N    1  
ATOM 854   C CA   . LEU A 1 56  ? -3.223  -12.308 1.440   1.00 0.00 ? 56  LEU A CA   1  
ATOM 855   C C    . LEU A 1 56  ? -2.093  -11.288 1.407   1.00 0.00 ? 56  LEU A C    1  
ATOM 856   O O    . LEU A 1 56  ? -0.969  -11.598 0.997   1.00 0.00 ? 56  LEU A O    1  
ATOM 857   C CB   . LEU A 1 56  ? -4.190  -12.074 0.276   1.00 0.00 ? 56  LEU A CB   1  
ATOM 858   C CG   . LEU A 1 56  ? -3.562  -12.086 -1.120  1.00 0.00 ? 56  LEU A CG   1  
ATOM 859   C CD1  . LEU A 1 56  ? -2.925  -13.432 -1.420  1.00 0.00 ? 56  LEU A CD1  1  
ATOM 860   C CD2  . LEU A 1 56  ? -4.609  -11.749 -2.170  1.00 0.00 ? 56  LEU A CD2  1  
ATOM 861   H H    . LEU A 1 56  ? -4.897  -12.026 2.701   1.00 0.00 ? 56  LEU A H    1  
ATOM 862   H HA   . LEU A 1 56  ? -2.802  -13.297 1.358   1.00 0.00 ? 56  LEU A HA   1  
ATOM 863   H HB2  . LEU A 1 56  ? -4.950  -12.842 0.311   1.00 0.00 ? 56  LEU A HB2  1  
ATOM 864   H HB3  . LEU A 1 56  ? -4.667  -11.117 0.421   1.00 0.00 ? 56  LEU A HB3  1  
ATOM 865   H HG   . LEU A 1 56  ? -2.790  -11.334 -1.166  1.00 0.00 ? 56  LEU A HG   1  
ATOM 866   H HD11 . LEU A 1 56  ? -3.675  -14.207 -1.360  1.00 0.00 ? 56  LEU A HD11 1  
ATOM 867   H HD12 . LEU A 1 56  ? -2.146  -13.629 -0.700  1.00 0.00 ? 56  LEU A HD12 1  
ATOM 868   H HD13 . LEU A 1 56  ? -2.503  -13.418 -2.414  1.00 0.00 ? 56  LEU A HD13 1  
ATOM 869   H HD21 . LEU A 1 56  ? -5.020  -10.770 -1.968  1.00 0.00 ? 56  LEU A HD21 1  
ATOM 870   H HD22 . LEU A 1 56  ? -5.399  -12.485 -2.140  1.00 0.00 ? 56  LEU A HD22 1  
ATOM 871   H HD23 . LEU A 1 56  ? -4.151  -11.752 -3.147  1.00 0.00 ? 56  LEU A HD23 1  
ATOM 872   N N    . LEU A 1 57  ? -2.394  -10.073 1.852   1.00 0.00 ? 57  LEU A N    1  
ATOM 873   C CA   . LEU A 1 57  ? -1.379  -9.037  1.977   1.00 0.00 ? 57  LEU A CA   1  
ATOM 874   C C    . LEU A 1 57  ? -0.307  -9.458  2.965   1.00 0.00 ? 57  LEU A C    1  
ATOM 875   O O    . LEU A 1 57  ? 0.879   -9.343  2.678   1.00 0.00 ? 57  LEU A O    1  
ATOM 876   C CB   . LEU A 1 57  ? -1.981  -7.704  2.423   1.00 0.00 ? 57  LEU A CB   1  
ATOM 877   C CG   . LEU A 1 57  ? -2.605  -6.856  1.316   1.00 0.00 ? 57  LEU A CG   1  
ATOM 878   C CD1  . LEU A 1 57  ? -3.040  -5.511  1.871   1.00 0.00 ? 57  LEU A CD1  1  
ATOM 879   C CD2  . LEU A 1 57  ? -1.622  -6.656  0.178   1.00 0.00 ? 57  LEU A CD2  1  
ATOM 880   H H    . LEU A 1 57  ? -3.324  -9.873  2.098   1.00 0.00 ? 57  LEU A H    1  
ATOM 881   H HA   . LEU A 1 57  ? -0.923  -8.907  1.006   1.00 0.00 ? 57  LEU A HA   1  
ATOM 882   H HB2  . LEU A 1 57  ? -2.742  -7.908  3.162   1.00 0.00 ? 57  LEU A HB2  1  
ATOM 883   H HB3  . LEU A 1 57  ? -1.202  -7.123  2.891   1.00 0.00 ? 57  LEU A HB3  1  
ATOM 884   H HG   . LEU A 1 57  ? -3.477  -7.361  0.924   1.00 0.00 ? 57  LEU A HG   1  
ATOM 885   H HD11 . LEU A 1 57  ? -3.496  -4.930  1.084   1.00 0.00 ? 57  LEU A HD11 1  
ATOM 886   H HD12 . LEU A 1 57  ? -2.178  -4.985  2.254   1.00 0.00 ? 57  LEU A HD12 1  
ATOM 887   H HD13 . LEU A 1 57  ? -3.752  -5.662  2.668   1.00 0.00 ? 57  LEU A HD13 1  
ATOM 888   H HD21 . LEU A 1 57  ? -1.345  -7.614  -0.232  1.00 0.00 ? 57  LEU A HD21 1  
ATOM 889   H HD22 . LEU A 1 57  ? -0.741  -6.153  0.549   1.00 0.00 ? 57  LEU A HD22 1  
ATOM 890   H HD23 . LEU A 1 57  ? -2.080  -6.054  -0.594  1.00 0.00 ? 57  LEU A HD23 1  
ATOM 891   N N    . ARG A 1 58  ? -0.733  -9.969  4.116   1.00 0.00 ? 58  ARG A N    1  
ATOM 892   C CA   . ARG A 1 58  ? 0.197   -10.368 5.166   1.00 0.00 ? 58  ARG A CA   1  
ATOM 893   C C    . ARG A 1 58  ? 1.193   -11.394 4.635   1.00 0.00 ? 58  ARG A C    1  
ATOM 894   O O    . ARG A 1 58  ? 2.404   -11.196 4.715   1.00 0.00 ? 58  ARG A O    1  
ATOM 895   C CB   . ARG A 1 58  ? -0.564  -10.958 6.355   1.00 0.00 ? 58  ARG A CB   1  
ATOM 896   C CG   . ARG A 1 58  ? 0.324   -11.283 7.546   1.00 0.00 ? 58  ARG A CG   1  
ATOM 897   C CD   . ARG A 1 58  ? -0.472  -11.903 8.681   1.00 0.00 ? 58  ARG A CD   1  
ATOM 898   N NE   . ARG A 1 58  ? 0.366   -12.177 9.846   1.00 0.00 ? 58  ARG A NE   1  
ATOM 899   C CZ   . ARG A 1 58  ? 0.071   -13.086 10.776  1.00 0.00 ? 58  ARG A CZ   1  
ATOM 900   N NH1  . ARG A 1 58  ? -1.032  -13.819 10.662  1.00 0.00 ? 58  ARG A NH1  1  
ATOM 901   N NH2  . ARG A 1 58  ? 0.884   -13.271 11.815  1.00 0.00 ? 58  ARG A NH2  1  
ATOM 902   H H    . ARG A 1 58  ? -1.699  -10.092 4.261   1.00 0.00 ? 58  ARG A H    1  
ATOM 903   H HA   . ARG A 1 58  ? 0.734   -9.489  5.489   1.00 0.00 ? 58  ARG A HA   1  
ATOM 904   H HB2  . ARG A 1 58  ? -1.316  -10.251 6.676   1.00 0.00 ? 58  ARG A HB2  1  
ATOM 905   H HB3  . ARG A 1 58  ? -1.049  -11.869 6.036   1.00 0.00 ? 58  ARG A HB3  1  
ATOM 906   H HG2  . ARG A 1 58  ? 1.086   -11.981 7.233   1.00 0.00 ? 58  ARG A HG2  1  
ATOM 907   H HG3  . ARG A 1 58  ? 0.788   -10.372 7.897   1.00 0.00 ? 58  ARG A HG3  1  
ATOM 908   H HD2  . ARG A 1 58  ? -1.258  -11.221 8.966   1.00 0.00 ? 58  ARG A HD2  1  
ATOM 909   H HD3  . ARG A 1 58  ? -0.907  -12.830 8.337   1.00 0.00 ? 58  ARG A HD3  1  
ATOM 910   H HE   . ARG A 1 58  ? 1.196   -11.646 9.941   1.00 0.00 ? 58  ARG A HE   1  
ATOM 911   H HH11 . ARG A 1 58  ? -1.644  -13.692 9.878   1.00 0.00 ? 58  ARG A HH11 1  
ATOM 912   H HH12 . ARG A 1 58  ? -1.250  -14.518 11.359  1.00 0.00 ? 58  ARG A HH12 1  
ATOM 913   H HH21 . ARG A 1 58  ? 1.729   -12.729 11.900  1.00 0.00 ? 58  ARG A HH21 1  
ATOM 914   H HH22 . ARG A 1 58  ? 0.654   -13.946 12.524  1.00 0.00 ? 58  ARG A HH22 1  
ATOM 915   N N    . ASP A 1 59  ? 0.665   -12.467 4.062   1.00 0.00 ? 59  ASP A N    1  
ATOM 916   C CA   . ASP A 1 59  ? 1.480   -13.564 3.538   1.00 0.00 ? 59  ASP A CA   1  
ATOM 917   C C    . ASP A 1 59  ? 2.504   -13.059 2.528   1.00 0.00 ? 59  ASP A C    1  
ATOM 918   O O    . ASP A 1 59  ? 3.680   -13.426 2.575   1.00 0.00 ? 59  ASP A O    1  
ATOM 919   C CB   . ASP A 1 59  ? 0.576   -14.603 2.875   1.00 0.00 ? 59  ASP A CB   1  
ATOM 920   C CG   . ASP A 1 59  ? 1.325   -15.854 2.454   1.00 0.00 ? 59  ASP A CG   1  
ATOM 921   O OD1  . ASP A 1 59  ? 1.904   -16.530 3.334   1.00 0.00 ? 59  ASP A OD1  1  
ATOM 922   O OD2  . ASP A 1 59  ? 1.318   -16.186 1.247   1.00 0.00 ? 59  ASP A OD2  1  
ATOM 923   H H    . ASP A 1 59  ? -0.316  -12.531 3.988   1.00 0.00 ? 59  ASP A H    1  
ATOM 924   H HA   . ASP A 1 59  ? 1.997   -14.023 4.367   1.00 0.00 ? 59  ASP A HA   1  
ATOM 925   H HB2  . ASP A 1 59  ? -0.200  -14.884 3.566   1.00 0.00 ? 59  ASP A HB2  1  
ATOM 926   H HB3  . ASP A 1 59  ? 0.125   -14.165 1.998   1.00 0.00 ? 59  ASP A HB3  1  
ATOM 927   N N    . SER A 1 60  ? 2.057   -12.200 1.632   1.00 0.00 ? 60  SER A N    1  
ATOM 928   C CA   . SER A 1 60  ? 2.905   -11.698 0.561   1.00 0.00 ? 60  SER A CA   1  
ATOM 929   C C    . SER A 1 60  ? 3.929   -10.694 1.088   1.00 0.00 ? 60  SER A C    1  
ATOM 930   O O    . SER A 1 60  ? 5.068   -10.655 0.621   1.00 0.00 ? 60  SER A O    1  
ATOM 931   C CB   . SER A 1 60  ? 2.040   -11.072 -0.529  1.00 0.00 ? 60  SER A CB   1  
ATOM 932   O OG   . SER A 1 60  ? 1.189   -12.039 -1.124  1.00 0.00 ? 60  SER A OG   1  
ATOM 933   H H    . SER A 1 60  ? 1.130   -11.889 1.695   1.00 0.00 ? 60  SER A H    1  
ATOM 934   H HA   . SER A 1 60  ? 3.432   -12.541 0.143   1.00 0.00 ? 60  SER A HA   1  
ATOM 935   H HB2  . SER A 1 60  ? 1.427   -10.303 -0.093  1.00 0.00 ? 60  SER A HB2  1  
ATOM 936   H HB3  . SER A 1 60  ? 2.673   -10.644 -1.292  1.00 0.00 ? 60  SER A HB3  1  
ATOM 937   H HG   . SER A 1 60  ? 0.465   -12.243 -0.520  1.00 0.00 ? 60  SER A HG   1  
ATOM 938   N N    . PHE A 1 61  ? 3.535   -9.900  2.077   1.00 0.00 ? 61  PHE A N    1  
ATOM 939   C CA   . PHE A 1 61  ? 4.444   -8.939  2.689   1.00 0.00 ? 61  PHE A CA   1  
ATOM 940   C C    . PHE A 1 61  ? 5.552   -9.675  3.425   1.00 0.00 ? 61  PHE A C    1  
ATOM 941   O O    . PHE A 1 61  ? 6.699   -9.237  3.454   1.00 0.00 ? 61  PHE A O    1  
ATOM 942   C CB   . PHE A 1 61  ? 3.694   -8.011  3.652   1.00 0.00 ? 61  PHE A CB   1  
ATOM 943   C CG   . PHE A 1 61  ? 2.887   -6.930  2.976   1.00 0.00 ? 61  PHE A CG   1  
ATOM 944   C CD1  . PHE A 1 61  ? 2.579   -6.999  1.624   1.00 0.00 ? 61  PHE A CD1  1  
ATOM 945   C CD2  . PHE A 1 61  ? 2.438   -5.838  3.703   1.00 0.00 ? 61  PHE A CD2  1  
ATOM 946   C CE1  . PHE A 1 61  ? 1.841   -6.003  1.014   1.00 0.00 ? 61  PHE A CE1  1  
ATOM 947   C CE2  . PHE A 1 61  ? 1.701   -4.841  3.096   1.00 0.00 ? 61  PHE A CE2  1  
ATOM 948   C CZ   . PHE A 1 61  ? 1.402   -4.924  1.752   1.00 0.00 ? 61  PHE A CZ   1  
ATOM 949   H H    . PHE A 1 61  ? 2.611   -9.964  2.408   1.00 0.00 ? 61  PHE A H    1  
ATOM 950   H HA   . PHE A 1 61  ? 4.883   -8.349  1.898   1.00 0.00 ? 61  PHE A HA   1  
ATOM 951   H HB2  . PHE A 1 61  ? 3.014   -8.600  4.249   1.00 0.00 ? 61  PHE A HB2  1  
ATOM 952   H HB3  . PHE A 1 61  ? 4.409   -7.532  4.305   1.00 0.00 ? 61  PHE A HB3  1  
ATOM 953   H HD1  . PHE A 1 61  ? 2.920   -7.845  1.046   1.00 0.00 ? 61  PHE A HD1  1  
ATOM 954   H HD2  . PHE A 1 61  ? 2.671   -5.770  4.755   1.00 0.00 ? 61  PHE A HD2  1  
ATOM 955   H HE1  . PHE A 1 61  ? 1.607   -6.070  -0.039  1.00 0.00 ? 61  PHE A HE1  1  
ATOM 956   H HE2  . PHE A 1 61  ? 1.355   -3.998  3.676   1.00 0.00 ? 61  PHE A HE2  1  
ATOM 957   H HZ   . PHE A 1 61  ? 0.827   -4.143  1.277   1.00 0.00 ? 61  PHE A HZ   1  
ATOM 958   N N    . GLN A 1 62  ? 5.200   -10.812 3.997   1.00 0.00 ? 62  GLN A N    1  
ATOM 959   C CA   . GLN A 1 62  ? 6.170   -11.659 4.666   1.00 0.00 ? 62  GLN A CA   1  
ATOM 960   C C    . GLN A 1 62  ? 7.162   -12.203 3.652   1.00 0.00 ? 62  GLN A C    1  
ATOM 961   O O    . GLN A 1 62  ? 8.352   -12.328 3.932   1.00 0.00 ? 62  GLN A O    1  
ATOM 962   C CB   . GLN A 1 62  ? 5.461   -12.810 5.384   1.00 0.00 ? 62  GLN A CB   1  
ATOM 963   C CG   . GLN A 1 62  ? 4.516   -12.350 6.483   1.00 0.00 ? 62  GLN A CG   1  
ATOM 964   C CD   . GLN A 1 62  ? 5.238   -11.670 7.634   1.00 0.00 ? 62  GLN A CD   1  
ATOM 965   O OE1  . GLN A 1 62  ? 4.705   -10.755 8.263   1.00 0.00 ? 62  GLN A OE1  1  
ATOM 966   N NE2  . GLN A 1 62  ? 6.446   -12.126 7.934   1.00 0.00 ? 62  GLN A NE2  1  
ATOM 967   H H    . GLN A 1 62  ? 4.259   -11.092 3.970   1.00 0.00 ? 62  GLN A H    1  
ATOM 968   H HA   . GLN A 1 62  ? 6.700   -11.059 5.389   1.00 0.00 ? 62  GLN A HA   1  
ATOM 969   H HB2  . GLN A 1 62  ? 4.890   -13.373 4.660   1.00 0.00 ? 62  GLN A HB2  1  
ATOM 970   H HB3  . GLN A 1 62  ? 6.203   -13.456 5.824   1.00 0.00 ? 62  GLN A HB3  1  
ATOM 971   H HG2  . GLN A 1 62  ? 3.806   -11.654 6.061   1.00 0.00 ? 62  GLN A HG2  1  
ATOM 972   H HG3  . GLN A 1 62  ? 3.986   -13.209 6.865   1.00 0.00 ? 62  GLN A HG3  1  
ATOM 973   H HE21 . GLN A 1 62  ? 6.810   -12.873 7.401   1.00 0.00 ? 62  GLN A HE21 1  
ATOM 974   H HE22 . GLN A 1 62  ? 6.928   -11.711 8.685   1.00 0.00 ? 62  GLN A HE22 1  
ATOM 975   N N    . GLN A 1 63  ? 6.664   -12.494 2.462   1.00 0.00 ? 63  GLN A N    1  
ATOM 976   C CA   . GLN A 1 63  ? 7.480   -13.063 1.403   1.00 0.00 ? 63  GLN A CA   1  
ATOM 977   C C    . GLN A 1 63  ? 8.426   -12.044 0.781   1.00 0.00 ? 63  GLN A C    1  
ATOM 978   O O    . GLN A 1 63  ? 9.514   -12.406 0.356   1.00 0.00 ? 63  GLN A O    1  
ATOM 979   C CB   . GLN A 1 63  ? 6.590   -13.672 0.336   1.00 0.00 ? 63  GLN A CB   1  
ATOM 980   C CG   . GLN A 1 63  ? 5.964   -14.982 0.759   1.00 0.00 ? 63  GLN A CG   1  
ATOM 981   C CD   . GLN A 1 63  ? 4.840   -15.391 -0.149  1.00 0.00 ? 63  GLN A CD   1  
ATOM 982   O OE1  . GLN A 1 63  ? 5.040   -16.057 -1.163  1.00 0.00 ? 63  GLN A OE1  1  
ATOM 983   N NE2  . GLN A 1 63  ? 3.644   -14.999 0.221   1.00 0.00 ? 63  GLN A NE2  1  
ATOM 984   H H    . GLN A 1 63  ? 5.709   -12.334 2.294   1.00 0.00 ? 63  GLN A H    1  
ATOM 985   H HA   . GLN A 1 63  ? 8.073   -13.851 1.843   1.00 0.00 ? 63  GLN A HA   1  
ATOM 986   H HB2  . GLN A 1 63  ? 5.798   -12.977 0.104   1.00 0.00 ? 63  GLN A HB2  1  
ATOM 987   H HB3  . GLN A 1 63  ? 7.177   -13.847 -0.552  1.00 0.00 ? 63  GLN A HB3  1  
ATOM 988   H HG2  . GLN A 1 63  ? 6.719   -15.752 0.748   1.00 0.00 ? 63  GLN A HG2  1  
ATOM 989   H HG3  . GLN A 1 63  ? 5.572   -14.869 1.762   1.00 0.00 ? 63  GLN A HG3  1  
ATOM 990   H HE21 . GLN A 1 63  ? 3.569   -14.477 1.053   1.00 0.00 ? 63  GLN A HE21 1  
ATOM 991   H HE22 . GLN A 1 63  ? 2.876   -15.248 -0.334  1.00 0.00 ? 63  GLN A HE22 1  
ATOM 992   N N    . VAL A 1 64  ? 8.031   -10.777 0.709   1.00 0.00 ? 64  VAL A N    1  
ATOM 993   C CA   . VAL A 1 64  ? 8.951   -9.763  0.204   1.00 0.00 ? 64  VAL A CA   1  
ATOM 994   C C    . VAL A 1 64  ? 10.077  -9.550  1.210   1.00 0.00 ? 64  VAL A C    1  
ATOM 995   O O    . VAL A 1 64  ? 11.203  -9.230  0.837   1.00 0.00 ? 64  VAL A O    1  
ATOM 996   C CB   . VAL A 1 64  ? 8.273   -8.414  -0.142  1.00 0.00 ? 64  VAL A CB   1  
ATOM 997   C CG1  . VAL A 1 64  ? 7.752   -7.697  1.093   1.00 0.00 ? 64  VAL A CG1  1  
ATOM 998   C CG2  . VAL A 1 64  ? 9.244   -7.523  -0.903  1.00 0.00 ? 64  VAL A CG2  1  
ATOM 999   H H    . VAL A 1 64  ? 7.117   -10.532 0.974   1.00 0.00 ? 64  VAL A H    1  
ATOM 1000  H HA   . VAL A 1 64  ? 9.387   -10.159 -0.707  1.00 0.00 ? 64  VAL A HA   1  
ATOM 1001  H HB   . VAL A 1 64  ? 7.431   -8.616  -0.789  1.00 0.00 ? 64  VAL A HB   1  
ATOM 1002  H HG11 . VAL A 1 64  ? 7.011   -8.312  1.581   1.00 0.00 ? 64  VAL A HG11 1  
ATOM 1003  H HG12 . VAL A 1 64  ? 7.306   -6.757  0.801   1.00 0.00 ? 64  VAL A HG12 1  
ATOM 1004  H HG13 . VAL A 1 64  ? 8.569   -7.509  1.773   1.00 0.00 ? 64  VAL A HG13 1  
ATOM 1005  H HG21 . VAL A 1 64  ? 10.123  -7.348  -0.298  1.00 0.00 ? 64  VAL A HG21 1  
ATOM 1006  H HG22 . VAL A 1 64  ? 8.766   -6.579  -1.127  1.00 0.00 ? 64  VAL A HG22 1  
ATOM 1007  H HG23 . VAL A 1 64  ? 9.532   -8.008  -1.823  1.00 0.00 ? 64  VAL A HG23 1  
ATOM 1008  N N    . VAL A 1 65  ? 9.772   -9.770  2.485   1.00 0.00 ? 65  VAL A N    1  
ATOM 1009  C CA   . VAL A 1 65  ? 10.796  -9.741  3.523   1.00 0.00 ? 65  VAL A CA   1  
ATOM 1010  C C    . VAL A 1 65  ? 11.645  -11.013 3.449   1.00 0.00 ? 65  VAL A C    1  
ATOM 1011  O O    . VAL A 1 65  ? 12.773  -11.058 3.933   1.00 0.00 ? 65  VAL A O    1  
ATOM 1012  C CB   . VAL A 1 65  ? 10.180  -9.600  4.936   1.00 0.00 ? 65  VAL A CB   1  
ATOM 1013  C CG1  . VAL A 1 65  ? 11.261  -9.521  6.003   1.00 0.00 ? 65  VAL A CG1  1  
ATOM 1014  C CG2  . VAL A 1 65  ? 9.284   -8.374  5.004   1.00 0.00 ? 65  VAL A CG2  1  
ATOM 1015  H H    . VAL A 1 65  ? 8.835   -9.953  2.734   1.00 0.00 ? 65  VAL A H    1  
ATOM 1016  H HA   . VAL A 1 65  ? 11.430  -8.885  3.339   1.00 0.00 ? 65  VAL A HA   1  
ATOM 1017  H HB   . VAL A 1 65  ? 9.575   -10.472 5.133   1.00 0.00 ? 65  VAL A HB   1  
ATOM 1018  H HG11 . VAL A 1 65  ? 11.852  -10.427 5.983   1.00 0.00 ? 65  VAL A HG11 1  
ATOM 1019  H HG12 . VAL A 1 65  ? 10.802  -9.414  6.973   1.00 0.00 ? 65  VAL A HG12 1  
ATOM 1020  H HG13 . VAL A 1 65  ? 11.898  -8.670  5.811   1.00 0.00 ? 65  VAL A HG13 1  
ATOM 1021  H HG21 . VAL A 1 65  ? 8.883   -8.273  6.003   1.00 0.00 ? 65  VAL A HG21 1  
ATOM 1022  H HG22 . VAL A 1 65  ? 8.470   -8.485  4.302   1.00 0.00 ? 65  VAL A HG22 1  
ATOM 1023  H HG23 . VAL A 1 65  ? 9.857   -7.494  4.754   1.00 0.00 ? 65  VAL A HG23 1  
ATOM 1024  N N    . LYS A 1 66  ? 11.088  -12.050 2.839   1.00 0.00 ? 66  LYS A N    1  
ATOM 1025  C CA   . LYS A 1 66  ? 11.827  -13.282 2.595   1.00 0.00 ? 66  LYS A CA   1  
ATOM 1026  C C    . LYS A 1 66  ? 12.738  -13.129 1.375   1.00 0.00 ? 66  LYS A C    1  
ATOM 1027  O O    . LYS A 1 66  ? 13.909  -13.516 1.408   1.00 0.00 ? 66  LYS A O    1  
ATOM 1028  C CB   . LYS A 1 66  ? 10.863  -14.457 2.384   1.00 0.00 ? 66  LYS A CB   1  
ATOM 1029  C CG   . LYS A 1 66  ? 10.074  -14.847 3.626   1.00 0.00 ? 66  LYS A CG   1  
ATOM 1030  C CD   . LYS A 1 66  ? 9.197   -16.064 3.368   1.00 0.00 ? 66  LYS A CD   1  
ATOM 1031  C CE   . LYS A 1 66  ? 10.037  -17.279 2.996   1.00 0.00 ? 66  LYS A CE   1  
ATOM 1032  N NZ   . LYS A 1 66  ? 9.206   -18.488 2.774   1.00 0.00 ? 66  LYS A NZ   1  
ATOM 1033  H H    . LYS A 1 66  ? 10.151  -11.988 2.553   1.00 0.00 ? 66  LYS A H    1  
ATOM 1034  H HA   . LYS A 1 66  ? 12.436  -13.480 3.461   1.00 0.00 ? 66  LYS A HA   1  
ATOM 1035  H HB2  . LYS A 1 66  ? 10.153  -14.192 1.612   1.00 0.00 ? 66  LYS A HB2  1  
ATOM 1036  H HB3  . LYS A 1 66  ? 11.431  -15.316 2.060   1.00 0.00 ? 66  LYS A HB3  1  
ATOM 1037  H HG2  . LYS A 1 66  ? 10.766  -15.075 4.421   1.00 0.00 ? 66  LYS A HG2  1  
ATOM 1038  H HG3  . LYS A 1 66  ? 9.447   -14.017 3.919   1.00 0.00 ? 66  LYS A HG3  1  
ATOM 1039  H HD2  . LYS A 1 66  ? 8.630   -16.287 4.260   1.00 0.00 ? 66  LYS A HD2  1  
ATOM 1040  H HD3  . LYS A 1 66  ? 8.518   -15.843 2.554   1.00 0.00 ? 66  LYS A HD3  1  
ATOM 1041  H HE2  . LYS A 1 66  ? 10.583  -17.059 2.090   1.00 0.00 ? 66  LYS A HE2  1  
ATOM 1042  H HE3  . LYS A 1 66  ? 10.733  -17.473 3.797   1.00 0.00 ? 66  LYS A HE3  1  
ATOM 1043  H HZ1  . LYS A 1 66  ? 8.525   -18.322 1.998   1.00 0.00 ? 66  LYS A HZ1  1  
ATOM 1044  H HZ2  . LYS A 1 66  ? 8.672   -18.723 3.641   1.00 0.00 ? 66  LYS A HZ2  1  
ATOM 1045  H HZ3  . LYS A 1 66  ? 9.812   -19.296 2.523   1.00 0.00 ? 66  LYS A HZ3  1  
ATOM 1046  N N    . LEU A 1 67  ? 12.189  -12.560 0.308   1.00 0.00 ? 67  LEU A N    1  
ATOM 1047  C CA   . LEU A 1 67  ? 12.928  -12.340 -0.931  1.00 0.00 ? 67  LEU A CA   1  
ATOM 1048  C C    . LEU A 1 67  ? 14.012  -11.283 -0.741  1.00 0.00 ? 67  LEU A C    1  
ATOM 1049  O O    . LEU A 1 67  ? 15.174  -11.515 -1.080  1.00 0.00 ? 67  LEU A O    1  
ATOM 1050  C CB   . LEU A 1 67  ? 11.968  -11.913 -2.047  1.00 0.00 ? 67  LEU A CB   1  
ATOM 1051  C CG   . LEU A 1 67  ? 10.965  -12.983 -2.479  1.00 0.00 ? 67  LEU A CG   1  
ATOM 1052  C CD1  . LEU A 1 67  ? 10.096  -12.465 -3.612  1.00 0.00 ? 67  LEU A CD1  1  
ATOM 1053  C CD2  . LEU A 1 67  ? 11.686  -14.256 -2.896  1.00 0.00 ? 67  LEU A CD2  1  
ATOM 1054  H H    . LEU A 1 67  ? 11.245  -12.285 0.353   1.00 0.00 ? 67  LEU A H    1  
ATOM 1055  H HA   . LEU A 1 67  ? 13.396  -13.273 -1.208  1.00 0.00 ? 67  LEU A HA   1  
ATOM 1056  H HB2  . LEU A 1 67  ? 11.408  -11.042 -1.710  1.00 0.00 ? 67  LEU A HB2  1  
ATOM 1057  H HB3  . LEU A 1 67  ? 12.553  -11.631 -2.910  1.00 0.00 ? 67  LEU A HB3  1  
ATOM 1058  H HG   . LEU A 1 67  ? 10.319  -13.221 -1.647  1.00 0.00 ? 67  LEU A HG   1  
ATOM 1059  H HD11 . LEU A 1 67  ? 10.721  -12.187 -4.448  1.00 0.00 ? 67  LEU A HD11 1  
ATOM 1060  H HD12 . LEU A 1 67  ? 9.543   -11.600 -3.275  1.00 0.00 ? 67  LEU A HD12 1  
ATOM 1061  H HD13 . LEU A 1 67  ? 9.406   -13.237 -3.920  1.00 0.00 ? 67  LEU A HD13 1  
ATOM 1062  H HD21 . LEU A 1 67  ? 12.342  -14.043 -3.728  1.00 0.00 ? 67  LEU A HD21 1  
ATOM 1063  H HD22 . LEU A 1 67  ? 10.962  -15.003 -3.189  1.00 0.00 ? 67  LEU A HD22 1  
ATOM 1064  H HD23 . LEU A 1 67  ? 12.269  -14.626 -2.066  1.00 0.00 ? 67  LEU A HD23 1  
ATOM 1065  N N    . LYS A 1 68  ? 13.613  -10.142 -0.188  1.00 0.00 ? 68  LYS A N    1  
ATOM 1066  C CA   . LYS A 1 68  ? 14.524  -9.029  0.080   1.00 0.00 ? 68  LYS A CA   1  
ATOM 1067  C C    . LYS A 1 68  ? 15.152  -8.476  -1.194  1.00 0.00 ? 68  LYS A C    1  
ATOM 1068  O O    . LYS A 1 68  ? 16.127  -9.020  -1.725  1.00 0.00 ? 68  LYS A O    1  
ATOM 1069  C CB   . LYS A 1 68  ? 15.606  -9.437  1.079   1.00 0.00 ? 68  LYS A CB   1  
ATOM 1070  C CG   . LYS A 1 68  ? 15.090  -9.534  2.498   1.00 0.00 ? 68  LYS A CG   1  
ATOM 1071  C CD   . LYS A 1 68  ? 16.166  -9.990  3.463   1.00 0.00 ? 68  LYS A CD   1  
ATOM 1072  C CE   . LYS A 1 68  ? 15.646  -9.989  4.886   1.00 0.00 ? 68  LYS A CE   1  
ATOM 1073  N NZ   . LYS A 1 68  ? 16.634  -10.554 5.844   1.00 0.00 ? 68  LYS A NZ   1  
ATOM 1074  H H    . LYS A 1 68  ? 12.668  -10.055 0.061   1.00 0.00 ? 68  LYS A H    1  
ATOM 1075  H HA   . LYS A 1 68  ? 13.934  -8.242  0.528   1.00 0.00 ? 68  LYS A HA   1  
ATOM 1076  H HB2  . LYS A 1 68  ? 16.003  -10.400 0.792   1.00 0.00 ? 68  LYS A HB2  1  
ATOM 1077  H HB3  . LYS A 1 68  ? 16.400  -8.707  1.053   1.00 0.00 ? 68  LYS A HB3  1  
ATOM 1078  H HG2  . LYS A 1 68  ? 14.738  -8.561  2.806   1.00 0.00 ? 68  LYS A HG2  1  
ATOM 1079  H HG3  . LYS A 1 68  ? 14.272  -10.237 2.524   1.00 0.00 ? 68  LYS A HG3  1  
ATOM 1080  H HD2  . LYS A 1 68  ? 16.472  -10.992 3.199   1.00 0.00 ? 68  LYS A HD2  1  
ATOM 1081  H HD3  . LYS A 1 68  ? 17.008  -9.320  3.393   1.00 0.00 ? 68  LYS A HD3  1  
ATOM 1082  H HE2  . LYS A 1 68  ? 15.422  -8.969  5.167   1.00 0.00 ? 68  LYS A HE2  1  
ATOM 1083  H HE3  . LYS A 1 68  ? 14.740  -10.577 4.921   1.00 0.00 ? 68  LYS A HE3  1  
ATOM 1084  H HZ1  . LYS A 1 68  ? 17.457  -9.917  5.938   1.00 0.00 ? 68  LYS A HZ1  1  
ATOM 1085  H HZ2  . LYS A 1 68  ? 16.967  -11.484 5.507   1.00 0.00 ? 68  LYS A HZ2  1  
ATOM 1086  H HZ3  . LYS A 1 68  ? 16.192  -10.678 6.783   1.00 0.00 ? 68  LYS A HZ3  1  
ATOM 1087  N N    . GLY A 1 69  ? 14.576  -7.391  -1.683  1.00 0.00 ? 69  GLY A N    1  
ATOM 1088  C CA   . GLY A 1 69  ? 15.120  -6.718  -2.842  1.00 0.00 ? 69  GLY A CA   1  
ATOM 1089  C C    . GLY A 1 69  ? 14.350  -7.035  -4.102  1.00 0.00 ? 69  GLY A C    1  
ATOM 1090  O O    . GLY A 1 69  ? 14.447  -6.316  -5.095  1.00 0.00 ? 69  GLY A O    1  
ATOM 1091  H H    . GLY A 1 69  ? 13.771  -7.040  -1.248  1.00 0.00 ? 69  GLY A H    1  
ATOM 1092  H HA2  . GLY A 1 69  ? 15.092  -5.650  -2.673  1.00 0.00 ? 69  GLY A HA2  1  
ATOM 1093  H HA3  . GLY A 1 69  ? 16.146  -7.024  -2.973  1.00 0.00 ? 69  GLY A HA3  1  
ATOM 1094  N N    . GLN A 1 70  ? 13.576  -8.106  -4.064  1.00 0.00 ? 70  GLN A N    1  
ATOM 1095  C CA   . GLN A 1 70  ? 12.798  -8.509  -5.216  1.00 0.00 ? 70  GLN A CA   1  
ATOM 1096  C C    . GLN A 1 70  ? 11.417  -7.883  -5.146  1.00 0.00 ? 70  GLN A C    1  
ATOM 1097  O O    . GLN A 1 70  ? 10.801  -7.840  -4.081  1.00 0.00 ? 70  GLN A O    1  
ATOM 1098  C CB   . GLN A 1 70  ? 12.689  -10.034 -5.283  1.00 0.00 ? 70  GLN A CB   1  
ATOM 1099  C CG   . GLN A 1 70  ? 11.826  -10.529 -6.431  1.00 0.00 ? 70  GLN A CG   1  
ATOM 1100  C CD   . GLN A 1 70  ? 12.393  -10.157 -7.789  1.00 0.00 ? 70  GLN A CD   1  
ATOM 1101  O OE1  . GLN A 1 70  ? 12.115  -9.078  -8.316  1.00 0.00 ? 70  GLN A OE1  1  
ATOM 1102  N NE2  . GLN A 1 70  ? 13.171  -11.051 -8.372  1.00 0.00 ? 70  GLN A NE2  1  
ATOM 1103  H H    . GLN A 1 70  ? 13.502  -8.625  -3.236  1.00 0.00 ? 70  GLN A H    1  
ATOM 1104  H HA   . GLN A 1 70  ? 13.303  -8.151  -6.101  1.00 0.00 ? 70  GLN A HA   1  
ATOM 1105  H HB2  . GLN A 1 70  ? 13.678  -10.449 -5.400  1.00 0.00 ? 70  GLN A HB2  1  
ATOM 1106  H HB3  . GLN A 1 70  ? 12.262  -10.395 -4.358  1.00 0.00 ? 70  GLN A HB3  1  
ATOM 1107  H HG2  . GLN A 1 70  ? 11.751  -11.602 -6.369  1.00 0.00 ? 70  GLN A HG2  1  
ATOM 1108  H HG3  . GLN A 1 70  ? 10.843  -10.093 -6.333  1.00 0.00 ? 70  GLN A HG3  1  
ATOM 1109  H HE21 . GLN A 1 70  ? 13.340  -11.901 -7.903  1.00 0.00 ? 70  GLN A HE21 1  
ATOM 1110  H HE22 . GLN A 1 70  ? 13.548  -10.836 -9.256  1.00 0.00 ? 70  GLN A HE22 1  
ATOM 1111  N N    . VAL A 1 71  ? 10.941  -7.395  -6.280  1.00 0.00 ? 71  VAL A N    1  
ATOM 1112  C CA   . VAL A 1 71  ? 9.627   -6.792  -6.347  1.00 0.00 ? 71  VAL A CA   1  
ATOM 1113  C C    . VAL A 1 71  ? 8.558   -7.882  -6.351  1.00 0.00 ? 71  VAL A C    1  
ATOM 1114  O O    . VAL A 1 71  ? 8.541   -8.763  -7.213  1.00 0.00 ? 71  VAL A O    1  
ATOM 1115  C CB   . VAL A 1 71  ? 9.483   -5.878  -7.591  1.00 0.00 ? 71  VAL A CB   1  
ATOM 1116  C CG1  . VAL A 1 71  ? 9.843   -6.622  -8.870  1.00 0.00 ? 71  VAL A CG1  1  
ATOM 1117  C CG2  . VAL A 1 71  ? 8.078   -5.301  -7.679  1.00 0.00 ? 71  VAL A CG2  1  
ATOM 1118  H H    . VAL A 1 71  ? 11.486  -7.450  -7.094  1.00 0.00 ? 71  VAL A H    1  
ATOM 1119  H HA   . VAL A 1 71  ? 9.498   -6.183  -5.462  1.00 0.00 ? 71  VAL A HA   1  
ATOM 1120  H HB   . VAL A 1 71  ? 10.174  -5.055  -7.481  1.00 0.00 ? 71  VAL A HB   1  
ATOM 1121  H HG11 . VAL A 1 71  ? 9.736   -5.959  -9.716  1.00 0.00 ? 71  VAL A HG11 1  
ATOM 1122  H HG12 . VAL A 1 71  ? 9.184   -7.470  -8.989  1.00 0.00 ? 71  VAL A HG12 1  
ATOM 1123  H HG13 . VAL A 1 71  ? 10.864  -6.965  -8.809  1.00 0.00 ? 71  VAL A HG13 1  
ATOM 1124  H HG21 . VAL A 1 71  ? 7.982   -4.721  -8.584  1.00 0.00 ? 71  VAL A HG21 1  
ATOM 1125  H HG22 . VAL A 1 71  ? 7.897   -4.668  -6.824  1.00 0.00 ? 71  VAL A HG22 1  
ATOM 1126  H HG23 . VAL A 1 71  ? 7.359   -6.106  -7.688  1.00 0.00 ? 71  VAL A HG23 1  
ATOM 1127  N N    . LEU A 1 72  ? 7.687   -7.837  -5.358  1.00 0.00 ? 72  LEU A N    1  
ATOM 1128  C CA   . LEU A 1 72  ? 6.686   -8.880  -5.191  1.00 0.00 ? 72  LEU A CA   1  
ATOM 1129  C C    . LEU A 1 72  ? 5.286   -8.300  -5.331  1.00 0.00 ? 72  LEU A C    1  
ATOM 1130  O O    . LEU A 1 72  ? 4.866   -7.476  -4.524  1.00 0.00 ? 72  LEU A O    1  
ATOM 1131  C CB   . LEU A 1 72  ? 6.844   -9.547  -3.825  1.00 0.00 ? 72  LEU A CB   1  
ATOM 1132  C CG   . LEU A 1 72  ? 6.149   -10.897 -3.691  1.00 0.00 ? 72  LEU A CG   1  
ATOM 1133  C CD1  . LEU A 1 72  ? 6.810   -11.912 -4.606  1.00 0.00 ? 72  LEU A CD1  1  
ATOM 1134  C CD2  . LEU A 1 72  ? 6.179   -11.373 -2.253  1.00 0.00 ? 72  LEU A CD2  1  
ATOM 1135  H H    . LEU A 1 72  ? 7.712   -7.079  -4.730  1.00 0.00 ? 72  LEU A H    1  
ATOM 1136  H HA   . LEU A 1 72  ? 6.839   -9.617  -5.964  1.00 0.00 ? 72  LEU A HA   1  
ATOM 1137  H HB2  . LEU A 1 72  ? 7.899   -9.689  -3.638  1.00 0.00 ? 72  LEU A HB2  1  
ATOM 1138  H HB3  . LEU A 1 72  ? 6.448   -8.887  -3.067  1.00 0.00 ? 72  LEU A HB3  1  
ATOM 1139  H HG   . LEU A 1 72  ? 5.116   -10.797 -3.994  1.00 0.00 ? 72  LEU A HG   1  
ATOM 1140  H HD11 . LEU A 1 72  ? 7.867   -11.962 -4.377  1.00 0.00 ? 72  LEU A HD11 1  
ATOM 1141  H HD12 . LEU A 1 72  ? 6.680   -11.609 -5.634  1.00 0.00 ? 72  LEU A HD12 1  
ATOM 1142  H HD13 . LEU A 1 72  ? 6.361   -12.882 -4.454  1.00 0.00 ? 72  LEU A HD13 1  
ATOM 1143  H HD21 . LEU A 1 72  ? 7.205   -11.471 -1.927  1.00 0.00 ? 72  LEU A HD21 1  
ATOM 1144  H HD22 . LEU A 1 72  ? 5.687   -12.331 -2.181  1.00 0.00 ? 72  LEU A HD22 1  
ATOM 1145  H HD23 . LEU A 1 72  ? 5.670   -10.658 -1.626  1.00 0.00 ? 72  LEU A HD23 1  
ATOM 1146  N N    . SER A 1 73  ? 4.560   -8.733  -6.347  1.00 0.00 ? 73  SER A N    1  
ATOM 1147  C CA   . SER A 1 73  ? 3.255   -8.166  -6.633  1.00 0.00 ? 73  SER A CA   1  
ATOM 1148  C C    . SER A 1 73  ? 2.155   -8.912  -5.882  1.00 0.00 ? 73  SER A C    1  
ATOM 1149  O O    . SER A 1 73  ? 2.046   -10.137 -5.965  1.00 0.00 ? 73  SER A O    1  
ATOM 1150  C CB   . SER A 1 73  ? 2.992   -8.194  -8.140  1.00 0.00 ? 73  SER A CB   1  
ATOM 1151  O OG   . SER A 1 73  ? 3.113   -9.508  -8.660  1.00 0.00 ? 73  SER A OG   1  
ATOM 1152  H H    . SER A 1 73  ? 4.891   -9.469  -6.902  1.00 0.00 ? 73  SER A H    1  
ATOM 1153  H HA   . SER A 1 73  ? 3.263   -7.138  -6.300  1.00 0.00 ? 73  SER A HA   1  
ATOM 1154  H HB2  . SER A 1 73  ? 1.994   -7.835  -8.336  1.00 0.00 ? 73  SER A HB2  1  
ATOM 1155  H HB3  . SER A 1 73  ? 3.707   -7.556  -8.641  1.00 0.00 ? 73  SER A HB3  1  
ATOM 1156  H HG   . SER A 1 73  ? 2.251   -9.957  -8.588  1.00 0.00 ? 73  SER A HG   1  
ATOM 1157  N N    . VAL A 1 74  ? 1.365   -8.174  -5.120  1.00 0.00 ? 74  VAL A N    1  
ATOM 1158  C CA   . VAL A 1 74  ? 0.207   -8.739  -4.449  1.00 0.00 ? 74  VAL A CA   1  
ATOM 1159  C C    . VAL A 1 74  ? -1.029  -7.944  -4.798  1.00 0.00 ? 74  VAL A C    1  
ATOM 1160  O O    . VAL A 1 74  ? -1.027  -6.714  -4.787  1.00 0.00 ? 74  VAL A O    1  
ATOM 1161  C CB   . VAL A 1 74  ? 0.405   -8.810  -2.916  1.00 0.00 ? 74  VAL A CB   1  
ATOM 1162  C CG1  . VAL A 1 74  ? 0.768   -7.447  -2.345  1.00 0.00 ? 74  VAL A CG1  1  
ATOM 1163  C CG2  . VAL A 1 74  ? -0.836  -9.369  -2.227  1.00 0.00 ? 74  VAL A CG2  1  
ATOM 1164  H H    . VAL A 1 74  ? 1.570   -7.218  -4.992  1.00 0.00 ? 74  VAL A H    1  
ATOM 1165  H HA   . VAL A 1 74  ? 0.058   -9.739  -4.825  1.00 0.00 ? 74  VAL A HA   1  
ATOM 1166  H HB   . VAL A 1 74  ? 1.227   -9.482  -2.718  1.00 0.00 ? 74  VAL A HB   1  
ATOM 1167  H HG11 . VAL A 1 74  ? 0.880   -7.526  -1.274  1.00 0.00 ? 74  VAL A HG11 1  
ATOM 1168  H HG12 . VAL A 1 74  ? -0.016  -6.740  -2.575  1.00 0.00 ? 74  VAL A HG12 1  
ATOM 1169  H HG13 . VAL A 1 74  ? 1.696   -7.109  -2.782  1.00 0.00 ? 74  VAL A HG13 1  
ATOM 1170  H HG21 . VAL A 1 74  ? -0.668  -9.410  -1.160  1.00 0.00 ? 74  VAL A HG21 1  
ATOM 1171  H HG22 . VAL A 1 74  ? -1.038  -10.363 -2.597  1.00 0.00 ? 74  VAL A HG22 1  
ATOM 1172  H HG23 . VAL A 1 74  ? -1.682  -8.729  -2.432  1.00 0.00 ? 74  VAL A HG23 1  
ATOM 1173  N N    . MET A 1 75  ? -2.074  -8.660  -5.137  1.00 0.00 ? 75  MET A N    1  
ATOM 1174  C CA   . MET A 1 75  ? -3.269  -8.038  -5.634  1.00 0.00 ? 75  MET A CA   1  
ATOM 1175  C C    . MET A 1 75  ? -4.408  -8.212  -4.640  1.00 0.00 ? 75  MET A C    1  
ATOM 1176  O O    . MET A 1 75  ? -4.713  -9.325  -4.218  1.00 0.00 ? 75  MET A O    1  
ATOM 1177  C CB   . MET A 1 75  ? -3.639  -8.629  -6.987  1.00 0.00 ? 75  MET A CB   1  
ATOM 1178  C CG   . MET A 1 75  ? -4.586  -7.745  -7.753  1.00 0.00 ? 75  MET A CG   1  
ATOM 1179  S SD   . MET A 1 75  ? -5.274  -8.539  -9.220  1.00 0.00 ? 75  MET A SD   1  
ATOM 1180  C CE   . MET A 1 75  ? -6.296  -7.216  -9.871  1.00 0.00 ? 75  MET A CE   1  
ATOM 1181  H H    . MET A 1 75  ? -2.044  -9.636  -5.031  1.00 0.00 ? 75  MET A H    1  
ATOM 1182  H HA   . MET A 1 75  ? -3.072  -6.983  -5.754  1.00 0.00 ? 75  MET A HA   1  
ATOM 1183  H HB2  . MET A 1 75  ? -2.740  -8.762  -7.571  1.00 0.00 ? 75  MET A HB2  1  
ATOM 1184  H HB3  . MET A 1 75  ? -4.112  -9.588  -6.836  1.00 0.00 ? 75  MET A HB3  1  
ATOM 1185  H HG2  . MET A 1 75  ? -5.380  -7.472  -7.094  1.00 0.00 ? 75  MET A HG2  1  
ATOM 1186  H HG3  . MET A 1 75  ? -4.055  -6.855  -8.058  1.00 0.00 ? 75  MET A HG3  1  
ATOM 1187  H HE1  . MET A 1 75  ? -7.073  -6.980  -9.159  1.00 0.00 ? 75  MET A HE1  1  
ATOM 1188  H HE2  . MET A 1 75  ? -6.745  -7.534  -10.801 1.00 0.00 ? 75  MET A HE2  1  
ATOM 1189  H HE3  . MET A 1 75  ? -5.687  -6.342  -10.046 1.00 0.00 ? 75  MET A HE3  1  
ATOM 1190  N N    . PHE A 1 76  ? -5.033  -7.104  -4.289  1.00 0.00 ? 76  PHE A N    1  
ATOM 1191  C CA   . PHE A 1 76  ? -6.046  -7.082  -3.245  1.00 0.00 ? 76  PHE A CA   1  
ATOM 1192  C C    . PHE A 1 76  ? -7.024  -5.945  -3.516  1.00 0.00 ? 76  PHE A C    1  
ATOM 1193  O O    . PHE A 1 76  ? -6.870  -5.211  -4.496  1.00 0.00 ? 76  PHE A O    1  
ATOM 1194  C CB   . PHE A 1 76  ? -5.391  -6.900  -1.871  1.00 0.00 ? 76  PHE A CB   1  
ATOM 1195  C CG   . PHE A 1 76  ? -4.765  -5.547  -1.668  1.00 0.00 ? 76  PHE A CG   1  
ATOM 1196  C CD1  . PHE A 1 76  ? -3.618  -5.187  -2.355  1.00 0.00 ? 76  PHE A CD1  1  
ATOM 1197  C CD2  . PHE A 1 76  ? -5.332  -4.633  -0.793  1.00 0.00 ? 76  PHE A CD2  1  
ATOM 1198  C CE1  . PHE A 1 76  ? -3.047  -3.944  -2.173  1.00 0.00 ? 76  PHE A CE1  1  
ATOM 1199  C CE2  . PHE A 1 76  ? -4.767  -3.388  -0.608  1.00 0.00 ? 76  PHE A CE2  1  
ATOM 1200  C CZ   . PHE A 1 76  ? -3.623  -3.044  -1.299  1.00 0.00 ? 76  PHE A CZ   1  
ATOM 1201  H H    . PHE A 1 76  ? -4.823  -6.273  -4.771  1.00 0.00 ? 76  PHE A H    1  
ATOM 1202  H HA   . PHE A 1 76  ? -6.574  -8.023  -3.265  1.00 0.00 ? 76  PHE A HA   1  
ATOM 1203  H HB2  . PHE A 1 76  ? -6.138  -7.036  -1.103  1.00 0.00 ? 76  PHE A HB2  1  
ATOM 1204  H HB3  . PHE A 1 76  ? -4.619  -7.645  -1.748  1.00 0.00 ? 76  PHE A HB3  1  
ATOM 1205  H HD1  . PHE A 1 76  ? -3.167  -5.890  -3.040  1.00 0.00 ? 76  PHE A HD1  1  
ATOM 1206  H HD2  . PHE A 1 76  ? -6.227  -4.904  -0.254  1.00 0.00 ? 76  PHE A HD2  1  
ATOM 1207  H HE1  . PHE A 1 76  ? -2.153  -3.676  -2.713  1.00 0.00 ? 76  PHE A HE1  1  
ATOM 1208  H HE2  . PHE A 1 76  ? -5.219  -2.685  0.075   1.00 0.00 ? 76  PHE A HE2  1  
ATOM 1209  H HZ   . PHE A 1 76  ? -3.177  -2.069  -1.156  1.00 0.00 ? 76  PHE A HZ   1  
ATOM 1210  N N    . ARG A 1 77  ? -8.024  -5.796  -2.661  1.00 0.00 ? 77  ARG A N    1  
ATOM 1211  C CA   . ARG A 1 77  ? -8.966  -4.698  -2.794  1.00 0.00 ? 77  ARG A CA   1  
ATOM 1212  C C    . ARG A 1 77  ? -8.675  -3.642  -1.737  1.00 0.00 ? 77  ARG A C    1  
ATOM 1213  O O    . ARG A 1 77  ? -8.786  -3.911  -0.539  1.00 0.00 ? 77  ARG A O    1  
ATOM 1214  C CB   . ARG A 1 77  ? -10.411 -5.183  -2.652  1.00 0.00 ? 77  ARG A CB   1  
ATOM 1215  C CG   . ARG A 1 77  ? -10.780 -6.339  -3.562  1.00 0.00 ? 77  ARG A CG   1  
ATOM 1216  C CD   . ARG A 1 77  ? -12.265 -6.640  -3.473  1.00 0.00 ? 77  ARG A CD   1  
ATOM 1217  N NE   . ARG A 1 77  ? -12.608 -7.938  -4.041  1.00 0.00 ? 77  ARG A NE   1  
ATOM 1218  C CZ   . ARG A 1 77  ? -13.845 -8.292  -4.386  1.00 0.00 ? 77  ARG A CZ   1  
ATOM 1219  N NH1  . ARG A 1 77  ? -14.846 -7.430  -4.249  1.00 0.00 ? 77  ARG A NH1  1  
ATOM 1220  N NH2  . ARG A 1 77  ? -14.079 -9.503  -4.873  1.00 0.00 ? 77  ARG A NH2  1  
ATOM 1221  H H    . ARG A 1 77  ? -8.117  -6.418  -1.909  1.00 0.00 ? 77  ARG A H    1  
ATOM 1222  H HA   . ARG A 1 77  ? -8.831  -4.260  -3.774  1.00 0.00 ? 77  ARG A HA   1  
ATOM 1223  H HB2  . ARG A 1 77  ? -10.570 -5.496  -1.632  1.00 0.00 ? 77  ARG A HB2  1  
ATOM 1224  H HB3  . ARG A 1 77  ? -11.075 -4.358  -2.871  1.00 0.00 ? 77  ARG A HB3  1  
ATOM 1225  H HG2  . ARG A 1 77  ? -10.530 -6.079  -4.582  1.00 0.00 ? 77  ARG A HG2  1  
ATOM 1226  H HG3  . ARG A 1 77  ? -10.225 -7.215  -3.259  1.00 0.00 ? 77  ARG A HG3  1  
ATOM 1227  H HD2  . ARG A 1 77  ? -12.560 -6.627  -2.434  1.00 0.00 ? 77  ARG A HD2  1  
ATOM 1228  H HD3  . ARG A 1 77  ? -12.807 -5.872  -4.006  1.00 0.00 ? 77  ARG A HD3  1  
ATOM 1229  H HE   . ARG A 1 77  ? -11.874 -8.594  -4.150  1.00 0.00 ? 77  ARG A HE   1  
ATOM 1230  H HH11 . ARG A 1 77  ? -14.676 -6.513  -3.888  1.00 0.00 ? 77  ARG A HH11 1  
ATOM 1231  H HH12 . ARG A 1 77  ? -15.788 -7.695  -4.507  1.00 0.00 ? 77  ARG A HH12 1  
ATOM 1232  H HH21 . ARG A 1 77  ? -13.323 -10.160 -4.990  1.00 0.00 ? 77  ARG A HH21 1  
ATOM 1233  H HH22 . ARG A 1 77  ? -15.019 -9.780  -5.108  1.00 0.00 ? 77  ARG A HH22 1  
ATOM 1234  N N    . PHE A 1 78  ? -8.298  -2.453  -2.184  1.00 0.00 ? 78  PHE A N    1  
ATOM 1235  C CA   . PHE A 1 78  ? -7.987  -1.355  -1.281  1.00 0.00 ? 78  PHE A CA   1  
ATOM 1236  C C    . PHE A 1 78  ? -9.250  -0.551  -1.016  1.00 0.00 ? 78  PHE A C    1  
ATOM 1237  O O    . PHE A 1 78  ? -10.022 -0.284  -1.939  1.00 0.00 ? 78  PHE A O    1  
ATOM 1238  C CB   . PHE A 1 78  ? -6.921  -0.450  -1.911  1.00 0.00 ? 78  PHE A CB   1  
ATOM 1239  C CG   . PHE A 1 78  ? -6.155  0.401   -0.931  1.00 0.00 ? 78  PHE A CG   1  
ATOM 1240  C CD1  . PHE A 1 78  ? -6.715  1.540   -0.372  1.00 0.00 ? 78  PHE A CD1  1  
ATOM 1241  C CD2  . PHE A 1 78  ? -4.856  0.062   -0.583  1.00 0.00 ? 78  PHE A CD2  1  
ATOM 1242  C CE1  . PHE A 1 78  ? -5.995  2.321   0.515   1.00 0.00 ? 78  PHE A CE1  1  
ATOM 1243  C CE2  . PHE A 1 78  ? -4.135  0.837   0.302   1.00 0.00 ? 78  PHE A CE2  1  
ATOM 1244  C CZ   . PHE A 1 78  ? -4.702  1.968   0.851   1.00 0.00 ? 78  PHE A CZ   1  
ATOM 1245  H H    . PHE A 1 78  ? -8.245  -2.298  -3.152  1.00 0.00 ? 78  PHE A H    1  
ATOM 1246  H HA   . PHE A 1 78  ? -7.615  -1.763  -0.354  1.00 0.00 ? 78  PHE A HA   1  
ATOM 1247  H HB2  . PHE A 1 78  ? -6.212  -1.065  -2.437  1.00 0.00 ? 78  PHE A HB2  1  
ATOM 1248  H HB3  . PHE A 1 78  ? -7.404  0.212   -2.620  1.00 0.00 ? 78  PHE A HB3  1  
ATOM 1249  H HD1  . PHE A 1 78  ? -7.725  1.822   -0.634  1.00 0.00 ? 78  PHE A HD1  1  
ATOM 1250  H HD2  . PHE A 1 78  ? -4.407  -0.821  -1.014  1.00 0.00 ? 78  PHE A HD2  1  
ATOM 1251  H HE1  . PHE A 1 78  ? -6.442  3.206   0.944   1.00 0.00 ? 78  PHE A HE1  1  
ATOM 1252  H HE2  . PHE A 1 78  ? -3.123  0.559   0.564   1.00 0.00 ? 78  PHE A HE2  1  
ATOM 1253  H HZ   . PHE A 1 78  ? -4.136  2.577   1.538   1.00 0.00 ? 78  PHE A HZ   1  
ATOM 1254  N N    . ARG A 1 79  ? -9.473  -0.185  0.232   1.00 0.00 ? 79  ARG A N    1  
ATOM 1255  C CA   . ARG A 1 79  ? -10.639 0.602   0.570   1.00 0.00 ? 79  ARG A CA   1  
ATOM 1256  C C    . ARG A 1 79  ? -10.387 2.080   0.312   1.00 0.00 ? 79  ARG A C    1  
ATOM 1257  O O    . ARG A 1 79  ? -9.692  2.747   1.071   1.00 0.00 ? 79  ARG A O    1  
ATOM 1258  C CB   . ARG A 1 79  ? -11.041 0.386   2.023   1.00 0.00 ? 79  ARG A CB   1  
ATOM 1259  C CG   . ARG A 1 79  ? -12.484 0.763   2.301   1.00 0.00 ? 79  ARG A CG   1  
ATOM 1260  C CD   . ARG A 1 79  ? -12.837 0.569   3.760   1.00 0.00 ? 79  ARG A CD   1  
ATOM 1261  N NE   . ARG A 1 79  ? -12.101 1.480   4.636   1.00 0.00 ? 79  ARG A NE   1  
ATOM 1262  C CZ   . ARG A 1 79  ? -12.245 1.514   5.959   1.00 0.00 ? 79  ARG A CZ   1  
ATOM 1263  N NH1  . ARG A 1 79  ? -13.043 0.643   6.567   1.00 0.00 ? 79  ARG A NH1  1  
ATOM 1264  N NH2  . ARG A 1 79  ? -11.580 2.416   6.670   1.00 0.00 ? 79  ARG A NH2  1  
ATOM 1265  H H    . ARG A 1 79  ? -8.855  -0.468  0.942   1.00 0.00 ? 79  ARG A H    1  
ATOM 1266  H HA   . ARG A 1 79  ? -11.449 0.277   -0.066  1.00 0.00 ? 79  ARG A HA   1  
ATOM 1267  H HB2  . ARG A 1 79  ? -10.906 -0.656  2.273   1.00 0.00 ? 79  ARG A HB2  1  
ATOM 1268  H HB3  . ARG A 1 79  ? -10.404 0.986   2.658   1.00 0.00 ? 79  ARG A HB3  1  
ATOM 1269  H HG2  . ARG A 1 79  ? -12.637 1.797   2.035   1.00 0.00 ? 79  ARG A HG2  1  
ATOM 1270  H HG3  . ARG A 1 79  ? -13.125 0.137   1.699   1.00 0.00 ? 79  ARG A HG3  1  
ATOM 1271  H HD2  . ARG A 1 79  ? -13.896 0.742   3.887   1.00 0.00 ? 79  ARG A HD2  1  
ATOM 1272  H HD3  . ARG A 1 79  ? -12.602 -0.449  4.033   1.00 0.00 ? 79  ARG A HD3  1  
ATOM 1273  H HE   . ARG A 1 79  ? -11.481 2.115   4.208   1.00 0.00 ? 79  ARG A HE   1  
ATOM 1274  H HH11 . ARG A 1 79  ? -13.541 -0.041  6.034   1.00 0.00 ? 79  ARG A HH11 1  
ATOM 1275  H HH12 . ARG A 1 79  ? -13.147 0.658   7.574   1.00 0.00 ? 79  ARG A HH12 1  
ATOM 1276  H HH21 . ARG A 1 79  ? -10.973 3.070   6.211   1.00 0.00 ? 79  ARG A HH21 1  
ATOM 1277  H HH22 . ARG A 1 79  ? -11.682 2.451   7.676   1.00 0.00 ? 79  ARG A HH22 1  
ATOM 1278  N N    . SER A 1 80  ? -10.930 2.569   -0.790  1.00 0.00 ? 80  SER A N    1  
ATOM 1279  C CA   . SER A 1 80  ? -10.887 3.988   -1.119  1.00 0.00 ? 80  SER A CA   1  
ATOM 1280  C C    . SER A 1 80  ? -11.638 4.818   -0.064  1.00 0.00 ? 80  SER A C    1  
ATOM 1281  O O    . SER A 1 80  ? -12.277 4.266   0.837   1.00 0.00 ? 80  SER A O    1  
ATOM 1282  C CB   . SER A 1 80  ? -11.503 4.192   -2.506  1.00 0.00 ? 80  SER A CB   1  
ATOM 1283  O OG   . SER A 1 80  ? -11.510 5.552   -2.897  1.00 0.00 ? 80  SER A OG   1  
ATOM 1284  H H    . SER A 1 80  ? -11.348 1.944   -1.421  1.00 0.00 ? 80  SER A H    1  
ATOM 1285  H HA   . SER A 1 80  ? -9.853  4.297   -1.143  1.00 0.00 ? 80  SER A HA   1  
ATOM 1286  H HB2  . SER A 1 80  ? -10.936 3.632   -3.233  1.00 0.00 ? 80  SER A HB2  1  
ATOM 1287  H HB3  . SER A 1 80  ? -12.520 3.828   -2.493  1.00 0.00 ? 80  SER A HB3  1  
ATOM 1288  H HG   . SER A 1 80  ? -12.109 5.667   -3.643  1.00 0.00 ? 80  SER A HG   1  
ATOM 1289  N N    . LYS A 1 81  ? -11.585 6.148   -0.201  1.00 0.00 ? 81  LYS A N    1  
ATOM 1290  C CA   . LYS A 1 81  ? -12.222 7.071   0.743   1.00 0.00 ? 81  LYS A CA   1  
ATOM 1291  C C    . LYS A 1 81  ? -13.740 7.017   0.611   1.00 0.00 ? 81  LYS A C    1  
ATOM 1292  O O    . LYS A 1 81  ? -14.468 7.746   1.281   1.00 0.00 ? 81  LYS A O    1  
ATOM 1293  C CB   . LYS A 1 81  ? -11.737 8.505   0.493   1.00 0.00 ? 81  LYS A CB   1  
ATOM 1294  C CG   . LYS A 1 81  ? -12.111 9.489   1.595   1.00 0.00 ? 81  LYS A CG   1  
ATOM 1295  C CD   . LYS A 1 81  ? -11.675 8.990   2.966   1.00 0.00 ? 81  LYS A CD   1  
ATOM 1296  C CE   . LYS A 1 81  ? -12.131 9.918   4.076   1.00 0.00 ? 81  LYS A CE   1  
ATOM 1297  N NZ   . LYS A 1 81  ? -11.731 9.425   5.424   1.00 0.00 ? 81  LYS A NZ   1  
ATOM 1298  H H    . LYS A 1 81  ? -11.093 6.525   -0.966  1.00 0.00 ? 81  LYS A H    1  
ATOM 1299  H HA   . LYS A 1 81  ? -11.945 6.772   1.743   1.00 0.00 ? 81  LYS A HA   1  
ATOM 1300  H HB2  . LYS A 1 81  ? -10.664 8.498   0.386   1.00 0.00 ? 81  LYS A HB2  1  
ATOM 1301  H HB3  . LYS A 1 81  ? -12.173 8.858   -0.431  1.00 0.00 ? 81  LYS A HB3  1  
ATOM 1302  H HG2  . LYS A 1 81  ? -11.628 10.435  1.399   1.00 0.00 ? 81  LYS A HG2  1  
ATOM 1303  H HG3  . LYS A 1 81  ? -13.184 9.622   1.595   1.00 0.00 ? 81  LYS A HG3  1  
ATOM 1304  H HD2  . LYS A 1 81  ? -12.096 8.014   3.132   1.00 0.00 ? 81  LYS A HD2  1  
ATOM 1305  H HD3  . LYS A 1 81  ? -10.605 8.920   2.988   1.00 0.00 ? 81  LYS A HD3  1  
ATOM 1306  H HE2  . LYS A 1 81  ? -11.694 10.891  3.916   1.00 0.00 ? 81  LYS A HE2  1  
ATOM 1307  H HE3  . LYS A 1 81  ? -13.205 9.996   4.037   1.00 0.00 ? 81  LYS A HE3  1  
ATOM 1308  H HZ1  . LYS A 1 81  ? -10.712 9.588   5.588   1.00 0.00 ? 81  LYS A HZ1  1  
ATOM 1309  H HZ2  . LYS A 1 81  ? -11.920 8.401   5.502   1.00 0.00 ? 81  LYS A HZ2  1  
ATOM 1310  H HZ3  . LYS A 1 81  ? -12.274 9.921   6.160   1.00 0.00 ? 81  LYS A HZ3  1  
ATOM 1311  N N    . ASN A 1 82  ? -14.205 6.136   -0.250  1.00 0.00 ? 82  ASN A N    1  
ATOM 1312  C CA   . ASN A 1 82  ? -15.624 5.947   -0.467  1.00 0.00 ? 82  ASN A CA   1  
ATOM 1313  C C    . ASN A 1 82  ? -16.023 4.638   0.167   1.00 0.00 ? 82  ASN A C    1  
ATOM 1314  O O    . ASN A 1 82  ? -17.147 4.162   0.007   1.00 0.00 ? 82  ASN A O    1  
ATOM 1315  C CB   . ASN A 1 82  ? -15.933 5.932   -1.966  1.00 0.00 ? 82  ASN A CB   1  
ATOM 1316  C CG   . ASN A 1 82  ? -15.444 7.182   -2.671  1.00 0.00 ? 82  ASN A CG   1  
ATOM 1317  O OD1  . ASN A 1 82  ? -15.576 8.295   -2.165  1.00 0.00 ? 82  ASN A OD1  1  
ATOM 1318  N ND2  . ASN A 1 82  ? -14.838 7.005   -3.834  1.00 0.00 ? 82  ASN A ND2  1  
ATOM 1319  H H    . ASN A 1 82  ? -13.576 5.568   -0.735  1.00 0.00 ? 82  ASN A H    1  
ATOM 1320  H HA   . ASN A 1 82  ? -16.156 6.750   0.014   1.00 0.00 ? 82  ASN A HA   1  
ATOM 1321  H HB2  . ASN A 1 82  ? -15.453 5.077   -2.418  1.00 0.00 ? 82  ASN A HB2  1  
ATOM 1322  H HB3  . ASN A 1 82  ? -17.001 5.855   -2.105  1.00 0.00 ? 82  ASN A HB3  1  
ATOM 1323  H HD21 . ASN A 1 82  ? -14.744 6.076   -4.176  1.00 0.00 ? 82  ASN A HD21 1  
ATOM 1324  H HD22 . ASN A 1 82  ? -14.496 7.791   -4.298  1.00 0.00 ? 82  ASN A HD22 1  
ATOM 1325  N N    . GLN A 1 83  ? -15.055 4.060   0.881   1.00 0.00 ? 83  GLN A N    1  
ATOM 1326  C CA   . GLN A 1 83  ? -15.253 2.834   1.623   1.00 0.00 ? 83  GLN A CA   1  
ATOM 1327  C C    . GLN A 1 83  ? -15.622 1.710   0.671   1.00 0.00 ? 83  GLN A C    1  
ATOM 1328  O O    . GLN A 1 83  ? -16.361 0.786   1.007   1.00 0.00 ? 83  GLN A O    1  
ATOM 1329  C CB   . GLN A 1 83  ? -16.291 3.061   2.720   1.00 0.00 ? 83  GLN A CB   1  
ATOM 1330  C CG   . GLN A 1 83  ? -15.720 3.776   3.946   1.00 0.00 ? 83  GLN A CG   1  
ATOM 1331  C CD   . GLN A 1 83  ? -14.691 4.852   3.616   1.00 0.00 ? 83  GLN A CD   1  
ATOM 1332  O OE1  . GLN A 1 83  ? -13.490 4.579   3.554   1.00 0.00 ? 83  GLN A OE1  1  
ATOM 1333  N NE2  . GLN A 1 83  ? -15.140 6.080   3.416   1.00 0.00 ? 83  GLN A NE2  1  
ATOM 1334  H H    . GLN A 1 83  ? -14.170 4.486   0.914   1.00 0.00 ? 83  GLN A H    1  
ATOM 1335  H HA   . GLN A 1 83  ? -14.312 2.589   2.090   1.00 0.00 ? 83  GLN A HA   1  
ATOM 1336  H HB2  . GLN A 1 83  ? -17.101 3.656   2.321   1.00 0.00 ? 83  GLN A HB2  1  
ATOM 1337  H HB3  . GLN A 1 83  ? -16.683 2.106   3.038   1.00 0.00 ? 83  GLN A HB3  1  
ATOM 1338  H HG2  . GLN A 1 83  ? -16.527 4.233   4.490   1.00 0.00 ? 83  GLN A HG2  1  
ATOM 1339  H HG3  . GLN A 1 83  ? -15.245 3.043   4.566   1.00 0.00 ? 83  GLN A HG3  1  
ATOM 1340  H HE21 . GLN A 1 83  ? -16.098 6.240   3.494   1.00 0.00 ? 83  GLN A HE21 1  
ATOM 1341  H HE22 . GLN A 1 83  ? -14.491 6.781   3.179   1.00 0.00 ? 83  GLN A HE22 1  
ATOM 1342  N N    . GLU A 1 84  ? -15.074 1.826   -0.529  1.00 0.00 ? 84  GLU A N    1  
ATOM 1343  C CA   . GLU A 1 84  ? -15.251 0.854   -1.579  1.00 0.00 ? 84  GLU A CA   1  
ATOM 1344  C C    . GLU A 1 84  ? -14.026 -0.045  -1.645  1.00 0.00 ? 84  GLU A C    1  
ATOM 1345  O O    . GLU A 1 84  ? -12.958 0.328   -1.158  1.00 0.00 ? 84  GLU A O    1  
ATOM 1346  C CB   . GLU A 1 84  ? -15.433 1.589   -2.905  1.00 0.00 ? 84  GLU A CB   1  
ATOM 1347  C CG   . GLU A 1 84  ? -14.215 2.415   -3.295  1.00 0.00 ? 84  GLU A CG   1  
ATOM 1348  C CD   . GLU A 1 84  ? -14.395 3.192   -4.584  1.00 0.00 ? 84  GLU A CD   1  
ATOM 1349  O OE1  . GLU A 1 84  ? -14.486 2.562   -5.655  1.00 0.00 ? 84  GLU A OE1  1  
ATOM 1350  O OE2  . GLU A 1 84  ? -14.416 4.439   -4.528  1.00 0.00 ? 84  GLU A OE2  1  
ATOM 1351  H H    . GLU A 1 84  ? -14.521 2.607   -0.717  1.00 0.00 ? 84  GLU A H    1  
ATOM 1352  H HA   . GLU A 1 84  ? -16.124 0.263   -1.359  1.00 0.00 ? 84  GLU A HA   1  
ATOM 1353  H HB2  . GLU A 1 84  ? -15.616 0.868   -3.681  1.00 0.00 ? 84  GLU A HB2  1  
ATOM 1354  H HB3  . GLU A 1 84  ? -16.282 2.254   -2.826  1.00 0.00 ? 84  GLU A HB3  1  
ATOM 1355  H HG2  . GLU A 1 84  ? -14.008 3.115   -2.502  1.00 0.00 ? 84  GLU A HG2  1  
ATOM 1356  H HG3  . GLU A 1 84  ? -13.372 1.750   -3.409  1.00 0.00 ? 84  GLU A HG3  1  
ATOM 1357  N N    . TRP A 1 85  ? -14.162 -1.213  -2.247  1.00 0.00 ? 85  TRP A N    1  
ATOM 1358  C CA   . TRP A 1 85  ? -13.071 -2.157  -2.296  1.00 0.00 ? 85  TRP A CA   1  
ATOM 1359  C C    . TRP A 1 85  ? -12.641 -2.396  -3.743  1.00 0.00 ? 85  TRP A C    1  
ATOM 1360  O O    . TRP A 1 85  ? -13.070 -3.354  -4.390  1.00 0.00 ? 85  TRP A O    1  
ATOM 1361  C CB   . TRP A 1 85  ? -13.507 -3.456  -1.628  1.00 0.00 ? 85  TRP A CB   1  
ATOM 1362  C CG   . TRP A 1 85  ? -14.066 -3.236  -0.250  1.00 0.00 ? 85  TRP A CG   1  
ATOM 1363  C CD1  . TRP A 1 85  ? -15.382 -3.090  0.083   1.00 0.00 ? 85  TRP A CD1  1  
ATOM 1364  C CD2  . TRP A 1 85  ? -13.327 -3.114  0.971   1.00 0.00 ? 85  TRP A CD2  1  
ATOM 1365  N NE1  . TRP A 1 85  ? -15.503 -2.887  1.436   1.00 0.00 ? 85  TRP A NE1  1  
ATOM 1366  C CE2  . TRP A 1 85  ? -14.261 -2.903  2.003   1.00 0.00 ? 85  TRP A CE2  1  
ATOM 1367  C CE3  . TRP A 1 85  ? -11.971 -3.164  1.298   1.00 0.00 ? 85  TRP A CE3  1  
ATOM 1368  C CZ2  . TRP A 1 85  ? -13.886 -2.745  3.332   1.00 0.00 ? 85  TRP A CZ2  1  
ATOM 1369  C CZ3  . TRP A 1 85  ? -11.599 -3.007  2.619   1.00 0.00 ? 85  TRP A CZ3  1  
ATOM 1370  C CH2  . TRP A 1 85  ? -12.553 -2.801  3.622   1.00 0.00 ? 85  TRP A CH2  1  
ATOM 1371  H H    . TRP A 1 85  ? -15.013 -1.461  -2.670  1.00 0.00 ? 85  TRP A H    1  
ATOM 1372  H HA   . TRP A 1 85  ? -12.240 -1.738  -1.749  1.00 0.00 ? 85  TRP A HA   1  
ATOM 1373  H HB2  . TRP A 1 85  ? -14.273 -3.925  -2.230  1.00 0.00 ? 85  TRP A HB2  1  
ATOM 1374  H HB3  . TRP A 1 85  ? -12.663 -4.113  -1.548  1.00 0.00 ? 85  TRP A HB3  1  
ATOM 1375  H HD1  . TRP A 1 85  ? -16.197 -3.129  -0.623  1.00 0.00 ? 85  TRP A HD1  1  
ATOM 1376  H HE1  . TRP A 1 85  ? -16.351 -2.751  1.920   1.00 0.00 ? 85  TRP A HE1  1  
ATOM 1377  H HE3  . TRP A 1 85  ? -11.219 -3.321  0.538   1.00 0.00 ? 85  TRP A HE3  1  
ATOM 1378  H HZ2  . TRP A 1 85  ? -14.611 -2.586  4.116   1.00 0.00 ? 85  TRP A HZ2  1  
ATOM 1379  H HZ3  . TRP A 1 85  ? -10.555 -3.044  2.892   1.00 0.00 ? 85  TRP A HZ3  1  
ATOM 1380  H HH2  . TRP A 1 85  ? -12.214 -2.683  4.642   1.00 0.00 ? 85  TRP A HH2  1  
ATOM 1381  N N    . LEU A 1 86  ? -11.785 -1.511  -4.236  1.00 0.00 ? 86  LEU A N    1  
ATOM 1382  C CA   . LEU A 1 86  ? -11.337 -1.542  -5.625  1.00 0.00 ? 86  LEU A CA   1  
ATOM 1383  C C    . LEU A 1 86  ? -10.075 -2.390  -5.779  1.00 0.00 ? 86  LEU A C    1  
ATOM 1384  O O    . LEU A 1 86  ? -9.358  -2.633  -4.810  1.00 0.00 ? 86  LEU A O    1  
ATOM 1385  C CB   . LEU A 1 86  ? -11.107 -0.109  -6.131  1.00 0.00 ? 86  LEU A CB   1  
ATOM 1386  C CG   . LEU A 1 86  ? -10.511 0.877   -5.112  1.00 0.00 ? 86  LEU A CG   1  
ATOM 1387  C CD1  . LEU A 1 86  ? -9.049  0.569   -4.831  1.00 0.00 ? 86  LEU A CD1  1  
ATOM 1388  C CD2  . LEU A 1 86  ? -10.665 2.307   -5.605  1.00 0.00 ? 86  LEU A CD2  1  
ATOM 1389  H H    . LEU A 1 86  ? -11.423 -0.821  -3.638  1.00 0.00 ? 86  LEU A H    1  
ATOM 1390  H HA   . LEU A 1 86  ? -12.125 -1.995  -6.210  1.00 0.00 ? 86  LEU A HA   1  
ATOM 1391  H HB2  . LEU A 1 86  ? -10.444 -0.154  -6.984  1.00 0.00 ? 86  LEU A HB2  1  
ATOM 1392  H HB3  . LEU A 1 86  ? -12.056 0.285   -6.460  1.00 0.00 ? 86  LEU A HB3  1  
ATOM 1393  H HG   . LEU A 1 86  ? -11.052 0.788   -4.182  1.00 0.00 ? 86  LEU A HG   1  
ATOM 1394  H HD11 . LEU A 1 86  ? -8.678  1.246   -4.076  1.00 0.00 ? 86  LEU A HD11 1  
ATOM 1395  H HD12 . LEU A 1 86  ? -8.477  0.694   -5.735  1.00 0.00 ? 86  LEU A HD12 1  
ATOM 1396  H HD13 . LEU A 1 86  ? -8.956  -0.447  -4.479  1.00 0.00 ? 86  LEU A HD13 1  
ATOM 1397  H HD21 . LEU A 1 86  ? -10.232 2.987   -4.886  1.00 0.00 ? 86  LEU A HD21 1  
ATOM 1398  H HD22 . LEU A 1 86  ? -11.715 2.532   -5.728  1.00 0.00 ? 86  LEU A HD22 1  
ATOM 1399  H HD23 . LEU A 1 86  ? -10.161 2.416   -6.554  1.00 0.00 ? 86  LEU A HD23 1  
ATOM 1400  N N    . TRP A 1 87  ? -9.797  -2.821  -7.002  1.00 0.00 ? 87  TRP A N    1  
ATOM 1401  C CA   . TRP A 1 87  ? -8.699  -3.744  -7.254  1.00 0.00 ? 87  TRP A CA   1  
ATOM 1402  C C    . TRP A 1 87  ? -7.383  -3.014  -7.436  1.00 0.00 ? 87  TRP A C    1  
ATOM 1403  O O    . TRP A 1 87  ? -7.178  -2.302  -8.418  1.00 0.00 ? 87  TRP A O    1  
ATOM 1404  C CB   . TRP A 1 87  ? -8.988  -4.603  -8.482  1.00 0.00 ? 87  TRP A CB   1  
ATOM 1405  C CG   . TRP A 1 87  ? -10.011 -5.658  -8.225  1.00 0.00 ? 87  TRP A CG   1  
ATOM 1406  C CD1  . TRP A 1 87  ? -11.321 -5.644  -8.601  1.00 0.00 ? 87  TRP A CD1  1  
ATOM 1407  C CD2  . TRP A 1 87  ? -9.807  -6.886  -7.519  1.00 0.00 ? 87  TRP A CD2  1  
ATOM 1408  N NE1  . TRP A 1 87  ? -11.943 -6.793  -8.180  1.00 0.00 ? 87  TRP A NE1  1  
ATOM 1409  C CE2  . TRP A 1 87  ? -11.033 -7.572  -7.511  1.00 0.00 ? 87  TRP A CE2  1  
ATOM 1410  C CE3  . TRP A 1 87  ? -8.699  -7.472  -6.895  1.00 0.00 ? 87  TRP A CE3  1  
ATOM 1411  C CZ2  . TRP A 1 87  ? -11.183 -8.817  -6.905  1.00 0.00 ? 87  TRP A CZ2  1  
ATOM 1412  C CZ3  . TRP A 1 87  ? -8.852  -8.704  -6.292  1.00 0.00 ? 87  TRP A CZ3  1  
ATOM 1413  C CH2  . TRP A 1 87  ? -10.083 -9.365  -6.301  1.00 0.00 ? 87  TRP A CH2  1  
ATOM 1414  H H    . TRP A 1 87  ? -10.324 -2.491  -7.761  1.00 0.00 ? 87  TRP A H    1  
ATOM 1415  H HA   . TRP A 1 87  ? -8.614  -4.390  -6.394  1.00 0.00 ? 87  TRP A HA   1  
ATOM 1416  H HB2  . TRP A 1 87  ? -9.351  -3.971  -9.279  1.00 0.00 ? 87  TRP A HB2  1  
ATOM 1417  H HB3  . TRP A 1 87  ? -8.075  -5.087  -8.800  1.00 0.00 ? 87  TRP A HB3  1  
ATOM 1418  H HD1  . TRP A 1 87  ? -11.786 -4.841  -9.153  1.00 0.00 ? 87  TRP A HD1  1  
ATOM 1419  H HE1  . TRP A 1 87  ? -12.893 -7.020  -8.333  1.00 0.00 ? 87  TRP A HE1  1  
ATOM 1420  H HE3  . TRP A 1 87  ? -7.741  -6.974  -6.878  1.00 0.00 ? 87  TRP A HE3  1  
ATOM 1421  H HZ2  . TRP A 1 87  ? -12.127 -9.342  -6.902  1.00 0.00 ? 87  TRP A HZ2  1  
ATOM 1422  H HZ3  . TRP A 1 87  ? -8.008  -9.169  -5.803  1.00 0.00 ? 87  TRP A HZ3  1  
ATOM 1423  H HH2  . TRP A 1 87  ? -10.157 -10.327 -5.816  1.00 0.00 ? 87  TRP A HH2  1  
ATOM 1424  N N    . MET A 1 88  ? -6.490  -3.206  -6.484  1.00 0.00 ? 88  MET A N    1  
ATOM 1425  C CA   . MET A 1 88  ? -5.176  -2.595  -6.527  1.00 0.00 ? 88  MET A CA   1  
ATOM 1426  C C    . MET A 1 88  ? -4.091  -3.652  -6.383  1.00 0.00 ? 88  MET A C    1  
ATOM 1427  O O    . MET A 1 88  ? -4.224  -4.596  -5.603  1.00 0.00 ? 88  MET A O    1  
ATOM 1428  C CB   . MET A 1 88  ? -5.047  -1.548  -5.419  1.00 0.00 ? 88  MET A CB   1  
ATOM 1429  C CG   . MET A 1 88  ? -3.638  -0.998  -5.257  1.00 0.00 ? 88  MET A CG   1  
ATOM 1430  S SD   . MET A 1 88  ? -3.575  0.794   -5.424  1.00 0.00 ? 88  MET A SD   1  
ATOM 1431  C CE   . MET A 1 88  ? -4.571  1.290   -4.027  1.00 0.00 ? 88  MET A CE   1  
ATOM 1432  H H    . MET A 1 88  ? -6.723  -3.783  -5.720  1.00 0.00 ? 88  MET A H    1  
ATOM 1433  H HA   . MET A 1 88  ? -5.068  -2.109  -7.484  1.00 0.00 ? 88  MET A HA   1  
ATOM 1434  H HB2  . MET A 1 88  ? -5.707  -0.723  -5.641  1.00 0.00 ? 88  MET A HB2  1  
ATOM 1435  H HB3  . MET A 1 88  ? -5.346  -1.994  -4.485  1.00 0.00 ? 88  MET A HB3  1  
ATOM 1436  H HG2  . MET A 1 88  ? -3.272  -1.266  -4.277  1.00 0.00 ? 88  MET A HG2  1  
ATOM 1437  H HG3  . MET A 1 88  ? -3.006  -1.440  -6.008  1.00 0.00 ? 88  MET A HG3  1  
ATOM 1438  H HE1  . MET A 1 88  ? -5.562  0.872   -4.126  1.00 0.00 ? 88  MET A HE1  1  
ATOM 1439  H HE2  . MET A 1 88  ? -4.635  2.367   -3.994  1.00 0.00 ? 88  MET A HE2  1  
ATOM 1440  H HE3  . MET A 1 88  ? -4.118  0.929   -3.115  1.00 0.00 ? 88  MET A HE3  1  
ATOM 1441  N N    . ARG A 1 89  ? -3.033  -3.502  -7.157  1.00 0.00 ? 89  ARG A N    1  
ATOM 1442  C CA   . ARG A 1 89  ? -1.882  -4.376  -7.051  1.00 0.00 ? 89  ARG A CA   1  
ATOM 1443  C C    . ARG A 1 89  ? -0.719  -3.624  -6.427  1.00 0.00 ? 89  ARG A C    1  
ATOM 1444  O O    . ARG A 1 89  ? -0.251  -2.620  -6.971  1.00 0.00 ? 89  ARG A O    1  
ATOM 1445  C CB   . ARG A 1 89  ? -1.472  -4.906  -8.424  1.00 0.00 ? 89  ARG A CB   1  
ATOM 1446  C CG   . ARG A 1 89  ? -0.349  -5.929  -8.363  1.00 0.00 ? 89  ARG A CG   1  
ATOM 1447  C CD   . ARG A 1 89  ? 0.296   -6.131  -9.722  1.00 0.00 ? 89  ARG A CD   1  
ATOM 1448  N NE   . ARG A 1 89  ? 1.135   -4.993  -10.110 1.00 0.00 ? 89  ARG A NE   1  
ATOM 1449  C CZ   . ARG A 1 89  ? 1.703   -4.862  -11.311 1.00 0.00 ? 89  ARG A CZ   1  
ATOM 1450  N NH1  . ARG A 1 89  ? 1.466   -5.762  -12.261 1.00 0.00 ? 89  ARG A NH1  1  
ATOM 1451  N NH2  . ARG A 1 89  ? 2.502   -3.832  -11.562 1.00 0.00 ? 89  ARG A NH2  1  
ATOM 1452  H H    . ARG A 1 89  ? -3.022  -2.776  -7.823  1.00 0.00 ? 89  ARG A H    1  
ATOM 1453  H HA   . ARG A 1 89  ? -2.148  -5.206  -6.414  1.00 0.00 ? 89  ARG A HA   1  
ATOM 1454  H HB2  . ARG A 1 89  ? -2.332  -5.373  -8.889  1.00 0.00 ? 89  ARG A HB2  1  
ATOM 1455  H HB3  . ARG A 1 89  ? -1.145  -4.079  -9.037  1.00 0.00 ? 89  ARG A HB3  1  
ATOM 1456  H HG2  . ARG A 1 89  ? 0.403   -5.584  -7.667  1.00 0.00 ? 89  ARG A HG2  1  
ATOM 1457  H HG3  . ARG A 1 89  ? -0.752  -6.870  -8.022  1.00 0.00 ? 89  ARG A HG3  1  
ATOM 1458  H HD2  . ARG A 1 89  ? 0.906   -7.022  -9.687  1.00 0.00 ? 89  ARG A HD2  1  
ATOM 1459  H HD3  . ARG A 1 89  ? -0.482  -6.260  -10.460 1.00 0.00 ? 89  ARG A HD3  1  
ATOM 1460  H HE   . ARG A 1 89  ? 1.304   -4.298  -9.428  1.00 0.00 ? 89  ARG A HE   1  
ATOM 1461  H HH11 . ARG A 1 89  ? 0.856   -6.546  -12.081 1.00 0.00 ? 89  ARG A HH11 1  
ATOM 1462  H HH12 . ARG A 1 89  ? 1.893   -5.667  -13.165 1.00 0.00 ? 89  ARG A HH12 1  
ATOM 1463  H HH21 . ARG A 1 89  ? 2.684   -3.144  -10.849 1.00 0.00 ? 89  ARG A HH21 1  
ATOM 1464  H HH22 . ARG A 1 89  ? 2.937   -3.733  -12.466 1.00 0.00 ? 89  ARG A HH22 1  
ATOM 1465  N N    . THR A 1 90  ? -0.272  -4.096  -5.284  1.00 0.00 ? 90  THR A N    1  
ATOM 1466  C CA   . THR A 1 90  ? 0.883   -3.524  -4.626  1.00 0.00 ? 90  THR A CA   1  
ATOM 1467  C C    . THR A 1 90  ? 2.144   -4.297  -4.994  1.00 0.00 ? 90  THR A C    1  
ATOM 1468  O O    . THR A 1 90  ? 2.210   -5.518  -4.841  1.00 0.00 ? 90  THR A O    1  
ATOM 1469  C CB   . THR A 1 90  ? 0.707   -3.509  -3.093  1.00 0.00 ? 90  THR A CB   1  
ATOM 1470  O OG1  . THR A 1 90  ? -0.370  -2.632  -2.738  1.00 0.00 ? 90  THR A OG1  1  
ATOM 1471  C CG2  . THR A 1 90  ? 1.981   -3.054  -2.390  1.00 0.00 ? 90  THR A CG2  1  
ATOM 1472  H H    . THR A 1 90  ? -0.738  -4.852  -4.863  1.00 0.00 ? 90  THR A H    1  
ATOM 1473  H HA   . THR A 1 90  ? 0.988   -2.505  -4.966  1.00 0.00 ? 90  THR A HA   1  
ATOM 1474  H HB   . THR A 1 90  ? 0.470   -4.511  -2.763  1.00 0.00 ? 90  THR A HB   1  
ATOM 1475  H HG1  . THR A 1 90  ? -0.057  -1.718  -2.771  1.00 0.00 ? 90  THR A HG1  1  
ATOM 1476  H HG21 . THR A 1 90  ? 2.794   -3.717  -2.650  1.00 0.00 ? 90  THR A HG21 1  
ATOM 1477  H HG22 . THR A 1 90  ? 1.830   -3.075  -1.321  1.00 0.00 ? 90  THR A HG22 1  
ATOM 1478  H HG23 . THR A 1 90  ? 2.224   -2.048  -2.700  1.00 0.00 ? 90  THR A HG23 1  
ATOM 1479  N N    . SER A 1 91  ? 3.124   -3.581  -5.510  1.00 0.00 ? 91  SER A N    1  
ATOM 1480  C CA   . SER A 1 91  ? 4.430   -4.149  -5.757  1.00 0.00 ? 91  SER A CA   1  
ATOM 1481  C C    . SER A 1 91  ? 5.301   -3.910  -4.529  1.00 0.00 ? 91  SER A C    1  
ATOM 1482  O O    . SER A 1 91  ? 5.539   -2.765  -4.135  1.00 0.00 ? 91  SER A O    1  
ATOM 1483  C CB   . SER A 1 91  ? 5.058   -3.539  -7.014  1.00 0.00 ? 91  SER A CB   1  
ATOM 1484  O OG   . SER A 1 91  ? 4.272   -3.819  -8.164  1.00 0.00 ? 91  SER A OG   1  
ATOM 1485  H H    . SER A 1 91  ? 2.970   -2.629  -5.705  1.00 0.00 ? 91  SER A H    1  
ATOM 1486  H HA   . SER A 1 91  ? 4.310   -5.214  -5.898  1.00 0.00 ? 91  SER A HA   1  
ATOM 1487  H HB2  . SER A 1 91  ? 5.131   -2.472  -6.895  1.00 0.00 ? 91  SER A HB2  1  
ATOM 1488  H HB3  . SER A 1 91  ? 6.044   -3.952  -7.159  1.00 0.00 ? 91  SER A HB3  1  
ATOM 1489  H HG   . SER A 1 91  ? 3.597   -3.134  -8.272  1.00 0.00 ? 91  SER A HG   1  
ATOM 1490  N N    . SER A 1 92  ? 5.746   -4.994  -3.920  1.00 0.00 ? 92  SER A N    1  
ATOM 1491  C CA   . SER A 1 92  ? 6.437   -4.936  -2.647  1.00 0.00 ? 92  SER A CA   1  
ATOM 1492  C C    . SER A 1 92  ? 7.937   -4.824  -2.850  1.00 0.00 ? 92  SER A C    1  
ATOM 1493  O O    . SER A 1 92  ? 8.521   -5.549  -3.656  1.00 0.00 ? 92  SER A O    1  
ATOM 1494  C CB   . SER A 1 92  ? 6.120   -6.186  -1.820  1.00 0.00 ? 92  SER A CB   1  
ATOM 1495  O OG   . SER A 1 92  ? 4.728   -6.458  -1.828  1.00 0.00 ? 92  SER A OG   1  
ATOM 1496  H H    . SER A 1 92  ? 5.621   -5.866  -4.351  1.00 0.00 ? 92  SER A H    1  
ATOM 1497  H HA   . SER A 1 92  ? 6.087   -4.063  -2.115  1.00 0.00 ? 92  SER A HA   1  
ATOM 1498  H HB2  . SER A 1 92  ? 6.652   -7.040  -2.232  1.00 0.00 ? 92  SER A HB2  1  
ATOM 1499  H HB3  . SER A 1 92  ? 6.436   -6.027  -0.799  1.00 0.00 ? 92  SER A HB3  1  
ATOM 1500  H HG   . SER A 1 92  ? 4.455   -6.706  -2.720  1.00 0.00 ? 92  SER A HG   1  
ATOM 1501  N N    . PHE A 1 93  ? 8.544   -3.902  -2.129  1.00 0.00 ? 93  PHE A N    1  
ATOM 1502  C CA   . PHE A 1 93  ? 9.985   -3.745  -2.130  1.00 0.00 ? 93  PHE A CA   1  
ATOM 1503  C C    . PHE A 1 93  ? 10.464  -3.479  -0.712  1.00 0.00 ? 93  PHE A C    1  
ATOM 1504  O O    . PHE A 1 93  ? 9.860   -2.694  0.015   1.00 0.00 ? 93  PHE A O    1  
ATOM 1505  C CB   . PHE A 1 93  ? 10.392  -2.592  -3.051  1.00 0.00 ? 93  PHE A CB   1  
ATOM 1506  C CG   . PHE A 1 93  ? 11.849  -2.212  -2.952  1.00 0.00 ? 93  PHE A CG   1  
ATOM 1507  C CD1  . PHE A 1 93  ? 12.793  -2.825  -3.758  1.00 0.00 ? 93  PHE A CD1  1  
ATOM 1508  C CD2  . PHE A 1 93  ? 12.270  -1.246  -2.047  1.00 0.00 ? 93  PHE A CD2  1  
ATOM 1509  C CE1  . PHE A 1 93  ? 14.129  -2.483  -3.667  1.00 0.00 ? 93  PHE A CE1  1  
ATOM 1510  C CE2  . PHE A 1 93  ? 13.605  -0.899  -1.949  1.00 0.00 ? 93  PHE A CE2  1  
ATOM 1511  C CZ   . PHE A 1 93  ? 14.536  -1.520  -2.761  1.00 0.00 ? 93  PHE A CZ   1  
ATOM 1512  H H    . PHE A 1 93  ? 8.005   -3.295  -1.581  1.00 0.00 ? 93  PHE A H    1  
ATOM 1513  H HA   . PHE A 1 93  ? 10.427  -4.664  -2.487  1.00 0.00 ? 93  PHE A HA   1  
ATOM 1514  H HB2  . PHE A 1 93  ? 10.191  -2.873  -4.074  1.00 0.00 ? 93  PHE A HB2  1  
ATOM 1515  H HB3  . PHE A 1 93  ? 9.801   -1.728  -2.800  1.00 0.00 ? 93  PHE A HB3  1  
ATOM 1516  H HD1  . PHE A 1 93  ? 12.479  -3.578  -4.465  1.00 0.00 ? 93  PHE A HD1  1  
ATOM 1517  H HD2  . PHE A 1 93  ? 11.541  -0.762  -1.411  1.00 0.00 ? 93  PHE A HD2  1  
ATOM 1518  H HE1  . PHE A 1 93  ? 14.855  -2.967  -4.300  1.00 0.00 ? 93  PHE A HE1  1  
ATOM 1519  H HE2  . PHE A 1 93  ? 13.922  -0.147  -1.232  1.00 0.00 ? 93  PHE A HE2  1  
ATOM 1520  H HZ   . PHE A 1 93  ? 15.579  -1.253  -2.691  1.00 0.00 ? 93  PHE A HZ   1  
ATOM 1521  N N    . THR A 1 94  ? 11.532  -4.141  -0.320  1.00 0.00 ? 94  THR A N    1  
ATOM 1522  C CA   . THR A 1 94  ? 12.121  -3.922  0.983   1.00 0.00 ? 94  THR A CA   1  
ATOM 1523  C C    . THR A 1 94  ? 13.407  -3.119  0.844   1.00 0.00 ? 94  THR A C    1  
ATOM 1524  O O    . THR A 1 94  ? 14.365  -3.582  0.222   1.00 0.00 ? 94  THR A O    1  
ATOM 1525  C CB   . THR A 1 94  ? 12.420  -5.262  1.670   1.00 0.00 ? 94  THR A CB   1  
ATOM 1526  O OG1  . THR A 1 94  ? 13.176  -6.101  0.787   1.00 0.00 ? 94  THR A OG1  1  
ATOM 1527  C CG2  . THR A 1 94  ? 11.135  -5.965  2.078   1.00 0.00 ? 94  THR A CG2  1  
ATOM 1528  H H    . THR A 1 94  ? 11.938  -4.796  -0.923  1.00 0.00 ? 94  THR A H    1  
ATOM 1529  H HA   . THR A 1 94  ? 11.418  -3.371  1.589   1.00 0.00 ? 94  THR A HA   1  
ATOM 1530  H HB   . THR A 1 94  ? 13.001  -5.067  2.559   1.00 0.00 ? 94  THR A HB   1  
ATOM 1531  H HG1  . THR A 1 94  ? 14.031  -5.685  0.613   1.00 0.00 ? 94  THR A HG1  1  
ATOM 1532  H HG21 . THR A 1 94  ? 10.539  -6.167  1.199   1.00 0.00 ? 94  THR A HG21 1  
ATOM 1533  H HG22 . THR A 1 94  ? 10.577  -5.332  2.752   1.00 0.00 ? 94  THR A HG22 1  
ATOM 1534  H HG23 . THR A 1 94  ? 11.374  -6.894  2.572   1.00 0.00 ? 94  THR A HG23 1  
ATOM 1535  N N    . PHE A 1 95  ? 13.424  -1.913  1.397   1.00 0.00 ? 95  PHE A N    1  
ATOM 1536  C CA   . PHE A 1 95  ? 14.590  -1.054  1.269   1.00 0.00 ? 95  PHE A CA   1  
ATOM 1537  C C    . PHE A 1 95  ? 15.676  -1.505  2.236   1.00 0.00 ? 95  PHE A C    1  
ATOM 1538  O O    . PHE A 1 95  ? 15.578  -1.291  3.446   1.00 0.00 ? 95  PHE A O    1  
ATOM 1539  C CB   . PHE A 1 95  ? 14.228  0.412   1.520   1.00 0.00 ? 95  PHE A CB   1  
ATOM 1540  C CG   . PHE A 1 95  ? 15.212  1.376   0.916   1.00 0.00 ? 95  PHE A CG   1  
ATOM 1541  C CD1  . PHE A 1 95  ? 16.494  1.499   1.428   1.00 0.00 ? 95  PHE A CD1  1  
ATOM 1542  C CD2  . PHE A 1 95  ? 14.854  2.154   -0.173  1.00 0.00 ? 95  PHE A CD2  1  
ATOM 1543  C CE1  . PHE A 1 95  ? 17.399  2.381   0.865   1.00 0.00 ? 95  PHE A CE1  1  
ATOM 1544  C CE2  . PHE A 1 95  ? 15.753  3.038   -0.738  1.00 0.00 ? 95  PHE A CE2  1  
ATOM 1545  C CZ   . PHE A 1 95  ? 17.029  3.151   -0.219  1.00 0.00 ? 95  PHE A CZ   1  
ATOM 1546  H H    . PHE A 1 95  ? 12.646  -1.601  1.908   1.00 0.00 ? 95  PHE A H    1  
ATOM 1547  H HA   . PHE A 1 95  ? 14.961  -1.155  0.260   1.00 0.00 ? 95  PHE A HA   1  
ATOM 1548  H HB2  . PHE A 1 95  ? 13.257  0.617   1.092   1.00 0.00 ? 95  PHE A HB2  1  
ATOM 1549  H HB3  . PHE A 1 95  ? 14.194  0.593   2.584   1.00 0.00 ? 95  PHE A HB3  1  
ATOM 1550  H HD1  . PHE A 1 95  ? 16.785  0.897   2.276   1.00 0.00 ? 95  PHE A HD1  1  
ATOM 1551  H HD2  . PHE A 1 95  ? 13.858  2.065   -0.580  1.00 0.00 ? 95  PHE A HD2  1  
ATOM 1552  H HE1  . PHE A 1 95  ? 18.396  2.467   1.274   1.00 0.00 ? 95  PHE A HE1  1  
ATOM 1553  H HE2  . PHE A 1 95  ? 15.459  3.638   -1.585  1.00 0.00 ? 95  PHE A HE2  1  
ATOM 1554  H HZ   . PHE A 1 95  ? 17.733  3.840   -0.660  1.00 0.00 ? 95  PHE A HZ   1  
ATOM 1555  N N    . GLN A 1 96  ? 16.697  -2.145  1.689   1.00 0.00 ? 96  GLN A N    1  
ATOM 1556  C CA   . GLN A 1 96  ? 17.792  -2.669  2.482   1.00 0.00 ? 96  GLN A CA   1  
ATOM 1557  C C    . GLN A 1 96  ? 19.020  -1.788  2.368   1.00 0.00 ? 96  GLN A C    1  
ATOM 1558  O O    . GLN A 1 96  ? 19.305  -1.236  1.305   1.00 0.00 ? 96  GLN A O    1  
ATOM 1559  C CB   . GLN A 1 96  ? 18.159  -4.078  2.026   1.00 0.00 ? 96  GLN A CB   1  
ATOM 1560  C CG   . GLN A 1 96  ? 17.065  -5.103  2.237   1.00 0.00 ? 96  GLN A CG   1  
ATOM 1561  C CD   . GLN A 1 96  ? 17.493  -6.476  1.784   1.00 0.00 ? 96  GLN A CD   1  
ATOM 1562  O OE1  . GLN A 1 96  ? 17.290  -6.852  0.633   1.00 0.00 ? 96  GLN A OE1  1  
ATOM 1563  N NE2  . GLN A 1 96  ? 18.092  -7.230  2.690   1.00 0.00 ? 96  GLN A NE2  1  
ATOM 1564  H H    . GLN A 1 96  ? 16.719  -2.261  0.717   1.00 0.00 ? 96  GLN A H    1  
ATOM 1565  H HA   . GLN A 1 96  ? 17.477  -2.702  3.514   1.00 0.00 ? 96  GLN A HA   1  
ATOM 1566  H HB2  . GLN A 1 96  ? 18.394  -4.050  0.972   1.00 0.00 ? 96  GLN A HB2  1  
ATOM 1567  H HB3  . GLN A 1 96  ? 19.034  -4.402  2.570   1.00 0.00 ? 96  GLN A HB3  1  
ATOM 1568  H HG2  . GLN A 1 96  ? 16.827  -5.146  3.291   1.00 0.00 ? 96  GLN A HG2  1  
ATOM 1569  H HG3  . GLN A 1 96  ? 16.191  -4.807  1.678   1.00 0.00 ? 96  GLN A HG3  1  
ATOM 1570  H HE21 . GLN A 1 96  ? 18.218  -6.859  3.589   1.00 0.00 ? 96  GLN A HE21 1  
ATOM 1571  H HE22 . GLN A 1 96  ? 18.406  -8.123  2.421   1.00 0.00 ? 96  GLN A HE22 1  
ATOM 1572  N N    . ASN A 1 97  ? 19.735  -1.660  3.468   1.00 0.00 ? 97  ASN A N    1  
ATOM 1573  C CA   . ASN A 1 97  ? 21.038  -1.022  3.454   1.00 0.00 ? 97  ASN A CA   1  
ATOM 1574  C C    . ASN A 1 97  ? 22.115  -2.090  3.398   1.00 0.00 ? 97  ASN A C    1  
ATOM 1575  O O    . ASN A 1 97  ? 22.310  -2.832  4.362   1.00 0.00 ? 97  ASN A O    1  
ATOM 1576  C CB   . ASN A 1 97  ? 21.228  -0.122  4.677   1.00 0.00 ? 97  ASN A CB   1  
ATOM 1577  C CG   . ASN A 1 97  ? 20.402  1.141   4.576   1.00 0.00 ? 97  ASN A CG   1  
ATOM 1578  O OD1  . ASN A 1 97  ? 20.836  2.140   4.000   1.00 0.00 ? 97  ASN A OD1  1  
ATOM 1579  N ND2  . ASN A 1 97  ? 19.216  1.115   5.153   1.00 0.00 ? 97  ASN A ND2  1  
ATOM 1580  H H    . ASN A 1 97  ? 19.375  -2.006  4.317   1.00 0.00 ? 97  ASN A H    1  
ATOM 1581  H HA   . ASN A 1 97  ? 21.100  -0.420  2.560   1.00 0.00 ? 97  ASN A HA   1  
ATOM 1582  H HB2  . ASN A 1 97  ? 20.927  -0.660  5.565   1.00 0.00 ? 97  ASN A HB2  1  
ATOM 1583  H HB3  . ASN A 1 97  ? 22.268  0.152   4.759   1.00 0.00 ? 97  ASN A HB3  1  
ATOM 1584  H HD21 . ASN A 1 97  ? 18.942  0.287   5.623   1.00 0.00 ? 97  ASN A HD21 1  
ATOM 1585  H HD22 . ASN A 1 97  ? 18.639  1.911   5.076   1.00 0.00 ? 97  ASN A HD22 1  
ATOM 1586  N N    . PRO A 1 98  ? 22.822  -2.180  2.260   1.00 0.00 ? 98  PRO A N    1  
ATOM 1587  C CA   . PRO A 1 98  ? 23.802  -3.247  1.983   1.00 0.00 ? 98  PRO A CA   1  
ATOM 1588  C C    . PRO A 1 98  ? 25.072  -3.160  2.831   1.00 0.00 ? 98  PRO A C    1  
ATOM 1589  O O    . PRO A 1 98  ? 26.159  -3.522  2.378   1.00 0.00 ? 98  PRO A O    1  
ATOM 1590  C CB   . PRO A 1 98  ? 24.137  -3.013  0.508   1.00 0.00 ? 98  PRO A CB   1  
ATOM 1591  C CG   . PRO A 1 98  ? 23.929  -1.560  0.314   1.00 0.00 ? 98  PRO A CG   1  
ATOM 1592  C CD   . PRO A 1 98  ? 22.715  -1.245  1.122   1.00 0.00 ? 98  PRO A CD   1  
ATOM 1593  H HA   . PRO A 1 98  ? 23.361  -4.227  2.097   1.00 0.00 ? 98  PRO A HA   1  
ATOM 1594  H HB2  . PRO A 1 98  ? 25.152  -3.294  0.316   1.00 0.00 ? 98  PRO A HB2  1  
ATOM 1595  H HB3  . PRO A 1 98  ? 23.471  -3.590  -0.108  1.00 0.00 ? 98  PRO A HB3  1  
ATOM 1596  H HG2  . PRO A 1 98  ? 24.782  -1.008  0.680   1.00 0.00 ? 98  PRO A HG2  1  
ATOM 1597  H HG3  . PRO A 1 98  ? 23.754  -1.346  -0.728  1.00 0.00 ? 98  PRO A HG3  1  
ATOM 1598  H HD2  . PRO A 1 98  ? 22.731  -0.219  1.456   1.00 0.00 ? 98  PRO A HD2  1  
ATOM 1599  H HD3  . PRO A 1 98  ? 21.831  -1.449  0.545   1.00 0.00 ? 98  PRO A HD3  1  
ATOM 1600  N N    . TYR A 1 99  ? 24.928  -2.670  4.048   1.00 0.00 ? 99  TYR A N    1  
ATOM 1601  C CA   . TYR A 1 99  ? 26.038  -2.571  4.977   1.00 0.00 ? 99  TYR A CA   1  
ATOM 1602  C C    . TYR A 1 99  ? 25.773  -3.478  6.174   1.00 0.00 ? 99  TYR A C    1  
ATOM 1603  O O    . TYR A 1 99  ? 26.666  -4.166  6.663   1.00 0.00 ? 99  TYR A O    1  
ATOM 1604  C CB   . TYR A 1 99  ? 26.207  -1.124  5.448   1.00 0.00 ? 99  TYR A CB   1  
ATOM 1605  C CG   . TYR A 1 99  ? 26.184  -0.097  4.331   1.00 0.00 ? 99  TYR A CG   1  
ATOM 1606  C CD1  . TYR A 1 99  ? 24.984  0.296   3.746   1.00 0.00 ? 99  TYR A CD1  1  
ATOM 1607  C CD2  . TYR A 1 99  ? 27.354  0.493   3.880   1.00 0.00 ? 99  TYR A CD2  1  
ATOM 1608  C CE1  . TYR A 1 99  ? 24.957  1.244   2.745   1.00 0.00 ? 99  TYR A CE1  1  
ATOM 1609  C CE2  . TYR A 1 99  ? 27.335  1.440   2.874   1.00 0.00 ? 99  TYR A CE2  1  
ATOM 1610  C CZ   . TYR A 1 99  ? 26.131  1.813   2.313   1.00 0.00 ? 99  TYR A CZ   1  
ATOM 1611  O OH   . TYR A 1 99  ? 26.098  2.765   1.319   1.00 0.00 ? 99  TYR A OH   1  
ATOM 1612  H H    . TYR A 1 99  ? 24.044  -2.351  4.330   1.00 0.00 ? 99  TYR A H    1  
ATOM 1613  H HA   . TYR A 1 99  ? 26.937  -2.895  4.471   1.00 0.00 ? 99  TYR A HA   1  
ATOM 1614  H HB2  . TYR A 1 99  ? 25.407  -0.883  6.133   1.00 0.00 ? 99  TYR A HB2  1  
ATOM 1615  H HB3  . TYR A 1 99  ? 27.151  -1.032  5.962   1.00 0.00 ? 99  TYR A HB3  1  
ATOM 1616  H HD1  . TYR A 1 99  ? 24.063  -0.159  4.077   1.00 0.00 ? 99  TYR A HD1  1  
ATOM 1617  H HD2  . TYR A 1 99  ? 28.293  0.196   4.321   1.00 0.00 ? 99  TYR A HD2  1  
ATOM 1618  H HE1  . TYR A 1 99  ? 24.015  1.534   2.302   1.00 0.00 ? 99  TYR A HE1  1  
ATOM 1619  H HE2  . TYR A 1 99  ? 28.257  1.888   2.534   1.00 0.00 ? 99  TYR A HE2  1  
ATOM 1620  H HH   . TYR A 1 99  ? 26.677  2.493   0.590   1.00 0.00 ? 99  TYR A HH   1  
ATOM 1621  N N    . SER A 1 100 ? 24.531  -3.455  6.644   1.00 0.00 ? 100 SER A N    1  
ATOM 1622  C CA   . SER A 1 100 ? 24.099  -4.314  7.736   1.00 0.00 ? 100 SER A CA   1  
ATOM 1623  C C    . SER A 1 100 ? 23.008  -5.263  7.250   1.00 0.00 ? 100 SER A C    1  
ATOM 1624  O O    . SER A 1 100 ? 22.474  -6.065  8.021   1.00 0.00 ? 100 SER A O    1  
ATOM 1625  C CB   . SER A 1 100 ? 23.581  -3.455  8.900   1.00 0.00 ? 100 SER A CB   1  
ATOM 1626  O OG   . SER A 1 100 ? 23.271  -4.240  10.041  1.00 0.00 ? 100 SER A OG   1  
ATOM 1627  H H    . SER A 1 100 ? 23.889  -2.824  6.258   1.00 0.00 ? 100 SER A H    1  
ATOM 1628  H HA   . SER A 1 100 ? 24.947  -4.892  8.070   1.00 0.00 ? 100 SER A HA   1  
ATOM 1629  H HB2  . SER A 1 100 ? 24.337  -2.735  9.173   1.00 0.00 ? 100 SER A HB2  1  
ATOM 1630  H HB3  . SER A 1 100 ? 22.687  -2.934  8.587   1.00 0.00 ? 100 SER A HB3  1  
ATOM 1631  H HG   . SER A 1 100 ? 23.210  -5.175  9.787   1.00 0.00 ? 100 SER A HG   1  
ATOM 1632  N N    . ASP A 1 101 ? 22.686  -5.155  5.956   1.00 0.00 ? 101 ASP A N    1  
ATOM 1633  C CA   . ASP A 1 101 ? 21.641  -5.966  5.323   1.00 0.00 ? 101 ASP A CA   1  
ATOM 1634  C C    . ASP A 1 101 ? 20.291  -5.746  5.996   1.00 0.00 ? 101 ASP A C    1  
ATOM 1635  O O    . ASP A 1 101 ? 19.417  -6.615  5.964   1.00 0.00 ? 101 ASP A O    1  
ATOM 1636  C CB   . ASP A 1 101 ? 22.004  -7.459  5.350   1.00 0.00 ? 101 ASP A CB   1  
ATOM 1637  C CG   . ASP A 1 101 ? 23.195  -7.795  4.475   1.00 0.00 ? 101 ASP A CG   1  
ATOM 1638  O OD1  . ASP A 1 101 ? 23.061  -7.757  3.234   1.00 0.00 ? 101 ASP A OD1  1  
ATOM 1639  O OD2  . ASP A 1 101 ? 24.271  -8.122  5.019   1.00 0.00 ? 101 ASP A OD2  1  
ATOM 1640  H H    . ASP A 1 101 ? 23.176  -4.515  5.399   1.00 0.00 ? 101 ASP A H    1  
ATOM 1641  H HA   . ASP A 1 101 ? 21.564  -5.648  4.295   1.00 0.00 ? 101 ASP A HA   1  
ATOM 1642  H HB2  . ASP A 1 101 ? 22.238  -7.745  6.364   1.00 0.00 ? 101 ASP A HB2  1  
ATOM 1643  H HB3  . ASP A 1 101 ? 21.156  -8.032  5.007   1.00 0.00 ? 101 ASP A HB3  1  
ATOM 1644  N N    . GLU A 1 102 ? 20.114  -4.575  6.596   1.00 0.00 ? 102 GLU A N    1  
ATOM 1645  C CA   . GLU A 1 102 ? 18.910  -4.287  7.357   1.00 0.00 ? 102 GLU A CA   1  
ATOM 1646  C C    . GLU A 1 102 ? 17.896  -3.545  6.502   1.00 0.00 ? 102 GLU A C    1  
ATOM 1647  O O    . GLU A 1 102 ? 18.255  -2.915  5.506   1.00 0.00 ? 102 GLU A O    1  
ATOM 1648  C CB   . GLU A 1 102 ? 19.263  -3.480  8.617   1.00 0.00 ? 102 GLU A CB   1  
ATOM 1649  C CG   . GLU A 1 102 ? 19.925  -2.134  8.349   1.00 0.00 ? 102 GLU A CG   1  
ATOM 1650  C CD   . GLU A 1 102 ? 18.943  -0.976  8.334   1.00 0.00 ? 102 GLU A CD   1  
ATOM 1651  O OE1  . GLU A 1 102 ? 18.489  -0.565  9.424   1.00 0.00 ? 102 GLU A OE1  1  
ATOM 1652  O OE2  . GLU A 1 102 ? 18.625  -0.470  7.242   1.00 0.00 ? 102 GLU A OE2  1  
ATOM 1653  H H    . GLU A 1 102 ? 20.804  -3.881  6.523   1.00 0.00 ? 102 GLU A H    1  
ATOM 1654  H HA   . GLU A 1 102 ? 18.480  -5.230  7.657   1.00 0.00 ? 102 GLU A HA   1  
ATOM 1655  H HB2  . GLU A 1 102 ? 18.356  -3.302  9.177   1.00 0.00 ? 102 GLU A HB2  1  
ATOM 1656  H HB3  . GLU A 1 102 ? 19.935  -4.070  9.226   1.00 0.00 ? 102 GLU A HB3  1  
ATOM 1657  H HG2  . GLU A 1 102 ? 20.659  -1.948  9.118   1.00 0.00 ? 102 GLU A HG2  1  
ATOM 1658  H HG3  . GLU A 1 102 ? 20.419  -2.179  7.389   1.00 0.00 ? 102 GLU A HG3  1  
ATOM 1659  N N    . ILE A 1 103 ? 16.633  -3.646  6.885   1.00 0.00 ? 103 ILE A N    1  
ATOM 1660  C CA   . ILE A 1 103 ? 15.558  -2.959  6.190   1.00 0.00 ? 103 ILE A CA   1  
ATOM 1661  C C    . ILE A 1 103 ? 15.045  -1.811  7.034   1.00 0.00 ? 103 ILE A C    1  
ATOM 1662  O O    . ILE A 1 103 ? 14.697  -1.996  8.204   1.00 0.00 ? 103 ILE A O    1  
ATOM 1663  C CB   . ILE A 1 103 ? 14.388  -3.909  5.870   1.00 0.00 ? 103 ILE A CB   1  
ATOM 1664  C CG1  . ILE A 1 103 ? 14.844  -4.989  4.899   1.00 0.00 ? 103 ILE A CG1  1  
ATOM 1665  C CG2  . ILE A 1 103 ? 13.203  -3.144  5.296   1.00 0.00 ? 103 ILE A CG2  1  
ATOM 1666  C CD1  . ILE A 1 103 ? 13.798  -6.045  4.641   1.00 0.00 ? 103 ILE A CD1  1  
ATOM 1667  H H    . ILE A 1 103 ? 16.414  -4.194  7.672   1.00 0.00 ? 103 ILE A H    1  
ATOM 1668  H HA   . ILE A 1 103 ? 15.950  -2.572  5.261   1.00 0.00 ? 103 ILE A HA   1  
ATOM 1669  H HB   . ILE A 1 103 ? 14.071  -4.376  6.791   1.00 0.00 ? 103 ILE A HB   1  
ATOM 1670  H HG12 . ILE A 1 103 ? 15.088  -4.529  3.954   1.00 0.00 ? 103 ILE A HG12 1  
ATOM 1671  H HG13 . ILE A 1 103 ? 15.718  -5.471  5.296   1.00 0.00 ? 103 ILE A HG13 1  
ATOM 1672  H HG21 . ILE A 1 103 ? 13.512  -2.627  4.400   1.00 0.00 ? 103 ILE A HG21 1  
ATOM 1673  H HG22 . ILE A 1 103 ? 12.851  -2.427  6.022   1.00 0.00 ? 103 ILE A HG22 1  
ATOM 1674  H HG23 . ILE A 1 103 ? 12.409  -3.836  5.058   1.00 0.00 ? 103 ILE A HG23 1  
ATOM 1675  H HD11 . ILE A 1 103 ? 14.187  -6.772  3.945   1.00 0.00 ? 103 ILE A HD11 1  
ATOM 1676  H HD12 . ILE A 1 103 ? 12.921  -5.575  4.221   1.00 0.00 ? 103 ILE A HD12 1  
ATOM 1677  H HD13 . ILE A 1 103 ? 13.540  -6.530  5.570   1.00 0.00 ? 103 ILE A HD13 1  
ATOM 1678  N N    . GLU A 1 104 ? 15.011  -0.632  6.443   1.00 0.00 ? 104 GLU A N    1  
ATOM 1679  C CA   . GLU A 1 104 ? 14.489  0.535   7.118   1.00 0.00 ? 104 GLU A CA   1  
ATOM 1680  C C    . GLU A 1 104 ? 12.973  0.591   7.015   1.00 0.00 ? 104 GLU A C    1  
ATOM 1681  O O    . GLU A 1 104 ? 12.286  0.922   7.980   1.00 0.00 ? 104 GLU A O    1  
ATOM 1682  C CB   . GLU A 1 104 ? 15.117  1.806   6.559   1.00 0.00 ? 104 GLU A CB   1  
ATOM 1683  C CG   . GLU A 1 104 ? 15.181  1.845   5.050   1.00 0.00 ? 104 GLU A CG   1  
ATOM 1684  C CD   . GLU A 1 104 ? 16.145  2.911   4.565   1.00 0.00 ? 104 GLU A CD   1  
ATOM 1685  O OE1  . GLU A 1 104 ? 17.292  2.946   5.062   1.00 0.00 ? 104 GLU A OE1  1  
ATOM 1686  O OE2  . GLU A 1 104 ? 15.757  3.738   3.710   1.00 0.00 ? 104 GLU A OE2  1  
ATOM 1687  H H    . GLU A 1 104 ? 15.353  -0.547  5.529   1.00 0.00 ? 104 GLU A H    1  
ATOM 1688  H HA   . GLU A 1 104 ? 14.762  0.449   8.148   1.00 0.00 ? 104 GLU A HA   1  
ATOM 1689  H HB2  . GLU A 1 104 ? 14.535  2.649   6.888   1.00 0.00 ? 104 GLU A HB2  1  
ATOM 1690  H HB3  . GLU A 1 104 ? 16.122  1.901   6.944   1.00 0.00 ? 104 GLU A HB3  1  
ATOM 1691  H HG2  . GLU A 1 104 ? 15.499  0.874   4.693   1.00 0.00 ? 104 GLU A HG2  1  
ATOM 1692  H HG3  . GLU A 1 104 ? 14.197  2.066   4.664   1.00 0.00 ? 104 GLU A HG3  1  
ATOM 1693  N N    . TYR A 1 105 ? 12.457  0.261   5.841   1.00 0.00 ? 105 TYR A N    1  
ATOM 1694  C CA   . TYR A 1 105 ? 11.021  0.281   5.608   1.00 0.00 ? 105 TYR A CA   1  
ATOM 1695  C C    . TYR A 1 105 ? 10.671  -0.489  4.345   1.00 0.00 ? 105 TYR A C    1  
ATOM 1696  O O    . TYR A 1 105 ? 11.548  -0.845  3.553   1.00 0.00 ? 105 TYR A O    1  
ATOM 1697  C CB   . TYR A 1 105 ? 10.509  1.728   5.492   1.00 0.00 ? 105 TYR A CB   1  
ATOM 1698  C CG   . TYR A 1 105 ? 11.250  2.566   4.468   1.00 0.00 ? 105 TYR A CG   1  
ATOM 1699  C CD1  . TYR A 1 105 ? 11.083  2.348   3.107   1.00 0.00 ? 105 TYR A CD1  1  
ATOM 1700  C CD2  . TYR A 1 105 ? 12.118  3.571   4.869   1.00 0.00 ? 105 TYR A CD2  1  
ATOM 1701  C CE1  . TYR A 1 105 ? 11.768  3.100   2.176   1.00 0.00 ? 105 TYR A CE1  1  
ATOM 1702  C CE2  . TYR A 1 105 ? 12.803  4.330   3.942   1.00 0.00 ? 105 TYR A CE2  1  
ATOM 1703  C CZ   . TYR A 1 105 ? 12.624  4.090   2.597   1.00 0.00 ? 105 TYR A CZ   1  
ATOM 1704  O OH   . TYR A 1 105 ? 13.317  4.834   1.671   1.00 0.00 ? 105 TYR A OH   1  
ATOM 1705  H H    . TYR A 1 105 ? 13.060  0.011   5.108   1.00 0.00 ? 105 TYR A H    1  
ATOM 1706  H HA   . TYR A 1 105 ? 10.542  -0.194  6.450   1.00 0.00 ? 105 TYR A HA   1  
ATOM 1707  H HB2  . TYR A 1 105 ? 9.467   1.710   5.210   1.00 0.00 ? 105 TYR A HB2  1  
ATOM 1708  H HB3  . TYR A 1 105 ? 10.607  2.213   6.452   1.00 0.00 ? 105 TYR A HB3  1  
ATOM 1709  H HD1  . TYR A 1 105 ? 10.411  1.570   2.778   1.00 0.00 ? 105 TYR A HD1  1  
ATOM 1710  H HD2  . TYR A 1 105 ? 12.257  3.757   5.924   1.00 0.00 ? 105 TYR A HD2  1  
ATOM 1711  H HE1  . TYR A 1 105 ? 11.626  2.917   1.120   1.00 0.00 ? 105 TYR A HE1  1  
ATOM 1712  H HE2  . TYR A 1 105 ? 13.475  5.109   4.272   1.00 0.00 ? 105 TYR A HE2  1  
ATOM 1713  H HH   . TYR A 1 105 ? 14.253  4.839   1.906   1.00 0.00 ? 105 TYR A HH   1  
ATOM 1714  N N    . ILE A 1 106 ? 9.389   -0.738  4.170   1.00 0.00 ? 106 ILE A N    1  
ATOM 1715  C CA   . ILE A 1 106 ? 8.885   -1.354  2.958   1.00 0.00 ? 106 ILE A CA   1  
ATOM 1716  C C    . ILE A 1 106 ? 8.327   -0.262  2.055   1.00 0.00 ? 106 ILE A C    1  
ATOM 1717  O O    . ILE A 1 106 ? 7.790   0.733   2.547   1.00 0.00 ? 106 ILE A O    1  
ATOM 1718  C CB   . ILE A 1 106 ? 7.771   -2.380  3.272   1.00 0.00 ? 106 ILE A CB   1  
ATOM 1719  C CG1  . ILE A 1 106 ? 8.255   -3.406  4.300   1.00 0.00 ? 106 ILE A CG1  1  
ATOM 1720  C CG2  . ILE A 1 106 ? 7.309   -3.084  2.002   1.00 0.00 ? 106 ILE A CG2  1  
ATOM 1721  C CD1  . ILE A 1 106 ? 7.186   -4.400  4.703   1.00 0.00 ? 106 ILE A CD1  1  
ATOM 1722  H H    . ILE A 1 106 ? 8.752   -0.486  4.875   1.00 0.00 ? 106 ILE A H    1  
ATOM 1723  H HA   . ILE A 1 106 ? 9.700   -1.858  2.458   1.00 0.00 ? 106 ILE A HA   1  
ATOM 1724  H HB   . ILE A 1 106 ? 6.925   -1.838  3.685   1.00 0.00 ? 106 ILE A HB   1  
ATOM 1725  H HG12 . ILE A 1 106 ? 9.083   -3.957  3.883   1.00 0.00 ? 106 ILE A HG12 1  
ATOM 1726  H HG13 . ILE A 1 106 ? 8.581   -2.889  5.189   1.00 0.00 ? 106 ILE A HG13 1  
ATOM 1727  H HG21 . ILE A 1 106 ? 6.533   -3.792  2.246   1.00 0.00 ? 106 ILE A HG21 1  
ATOM 1728  H HG22 . ILE A 1 106 ? 8.144   -3.604  1.557   1.00 0.00 ? 106 ILE A HG22 1  
ATOM 1729  H HG23 . ILE A 1 106 ? 6.926   -2.353  1.306   1.00 0.00 ? 106 ILE A HG23 1  
ATOM 1730  H HD11 . ILE A 1 106 ? 6.347   -3.871  5.132   1.00 0.00 ? 106 ILE A HD11 1  
ATOM 1731  H HD12 . ILE A 1 106 ? 7.590   -5.085  5.434   1.00 0.00 ? 106 ILE A HD12 1  
ATOM 1732  H HD13 . ILE A 1 106 ? 6.859   -4.950  3.835   1.00 0.00 ? 106 ILE A HD13 1  
ATOM 1733  N N    . ILE A 1 107 ? 8.429   -0.444  0.752   1.00 0.00 ? 107 ILE A N    1  
ATOM 1734  C CA   . ILE A 1 107 ? 7.932   0.542   -0.189  1.00 0.00 ? 107 ILE A CA   1  
ATOM 1735  C C    . ILE A 1 107 ? 6.704   -0.003  -0.902  1.00 0.00 ? 107 ILE A C    1  
ATOM 1736  O O    . ILE A 1 107 ? 6.779   -1.003  -1.617  1.00 0.00 ? 107 ILE A O    1  
ATOM 1737  C CB   . ILE A 1 107 ? 9.002   0.945   -1.227  1.00 0.00 ? 107 ILE A CB   1  
ATOM 1738  C CG1  . ILE A 1 107 ? 10.184  1.622   -0.528  1.00 0.00 ? 107 ILE A CG1  1  
ATOM 1739  C CG2  . ILE A 1 107 ? 8.406   1.866   -2.287  1.00 0.00 ? 107 ILE A CG2  1  
ATOM 1740  C CD1  . ILE A 1 107 ? 11.252  2.125   -1.475  1.00 0.00 ? 107 ILE A CD1  1  
ATOM 1741  H H    . ILE A 1 107 ? 8.790   -1.292  0.399   1.00 0.00 ? 107 ILE A H    1  
ATOM 1742  H HA   . ILE A 1 107 ? 7.648   1.423   0.370   1.00 0.00 ? 107 ILE A HA   1  
ATOM 1743  H HB   . ILE A 1 107 ? 9.349   0.048   -1.719  1.00 0.00 ? 107 ILE A HB   1  
ATOM 1744  H HG12 . ILE A 1 107 ? 9.823   2.467   0.039   1.00 0.00 ? 107 ILE A HG12 1  
ATOM 1745  H HG13 . ILE A 1 107 ? 10.646  0.916   0.147   1.00 0.00 ? 107 ILE A HG13 1  
ATOM 1746  H HG21 . ILE A 1 107 ? 9.154   2.089   -3.032  1.00 0.00 ? 107 ILE A HG21 1  
ATOM 1747  H HG22 . ILE A 1 107 ? 8.077   2.784   -1.822  1.00 0.00 ? 107 ILE A HG22 1  
ATOM 1748  H HG23 . ILE A 1 107 ? 7.564   1.377   -2.756  1.00 0.00 ? 107 ILE A HG23 1  
ATOM 1749  H HD11 . ILE A 1 107 ? 11.679  1.291   -2.013  1.00 0.00 ? 107 ILE A HD11 1  
ATOM 1750  H HD12 . ILE A 1 107 ? 12.026  2.627   -0.914  1.00 0.00 ? 107 ILE A HD12 1  
ATOM 1751  H HD13 . ILE A 1 107 ? 10.810  2.815   -2.178  1.00 0.00 ? 107 ILE A HD13 1  
ATOM 1752  N N    . CYS A 1 108 ? 5.574   0.639   -0.676  1.00 0.00 ? 108 CYS A N    1  
ATOM 1753  C CA   . CYS A 1 108 ? 4.337   0.247   -1.317  1.00 0.00 ? 108 CYS A CA   1  
ATOM 1754  C C    . CYS A 1 108 ? 4.158   0.976   -2.633  1.00 0.00 ? 108 CYS A C    1  
ATOM 1755  O O    . CYS A 1 108 ? 3.831   2.165   -2.659  1.00 0.00 ? 108 CYS A O    1  
ATOM 1756  C CB   . CYS A 1 108 ? 3.136   0.520   -0.412  1.00 0.00 ? 108 CYS A CB   1  
ATOM 1757  S SG   . CYS A 1 108 ? 2.945   -0.664  0.939   1.00 0.00 ? 108 CYS A SG   1  
ATOM 1758  H H    . CYS A 1 108 ? 5.575   1.412   -0.068  1.00 0.00 ? 108 CYS A H    1  
ATOM 1759  H HA   . CYS A 1 108 ? 4.390   -0.813  -1.515  1.00 0.00 ? 108 CYS A HA   1  
ATOM 1760  H HB2  . CYS A 1 108 ? 3.242   1.501   0.026   1.00 0.00 ? 108 CYS A HB2  1  
ATOM 1761  H HB3  . CYS A 1 108 ? 2.235   0.491   -1.005  1.00 0.00 ? 108 CYS A HB3  1  
ATOM 1762  H HG   . CYS A 1 108 ? 2.172   -1.650  0.498   1.00 0.00 ? 108 CYS A HG   1  
ATOM 1763  N N    . THR A 1 109 ? 4.417   0.273   -3.721  1.00 0.00 ? 109 THR A N    1  
ATOM 1764  C CA   . THR A 1 109 ? 4.059   0.767   -5.032  1.00 0.00 ? 109 THR A CA   1  
ATOM 1765  C C    . THR A 1 109 ? 2.652   0.281   -5.351  1.00 0.00 ? 109 THR A C    1  
ATOM 1766  O O    . THR A 1 109 ? 2.431   -0.908  -5.577  1.00 0.00 ? 109 THR A O    1  
ATOM 1767  C CB   . THR A 1 109 ? 5.053   0.278   -6.102  1.00 0.00 ? 109 THR A CB   1  
ATOM 1768  O OG1  . THR A 1 109 ? 6.388   0.643   -5.719  1.00 0.00 ? 109 THR A OG1  1  
ATOM 1769  C CG2  . THR A 1 109 ? 4.730   0.871   -7.468  1.00 0.00 ? 109 THR A CG2  1  
ATOM 1770  H H    . THR A 1 109 ? 4.854   -0.605  -3.637  1.00 0.00 ? 109 THR A H    1  
ATOM 1771  H HA   . THR A 1 109 ? 4.069   1.847   -5.007  1.00 0.00 ? 109 THR A HA   1  
ATOM 1772  H HB   . THR A 1 109 ? 4.987   -0.796  -6.165  1.00 0.00 ? 109 THR A HB   1  
ATOM 1773  H HG1  . THR A 1 109 ? 6.443   0.671   -4.759  1.00 0.00 ? 109 THR A HG1  1  
ATOM 1774  H HG21 . THR A 1 109 ? 5.445   0.514   -8.196  1.00 0.00 ? 109 THR A HG21 1  
ATOM 1775  H HG22 . THR A 1 109 ? 4.779   1.947   -7.414  1.00 0.00 ? 109 THR A HG22 1  
ATOM 1776  H HG23 . THR A 1 109 ? 3.735   0.571   -7.765  1.00 0.00 ? 109 THR A HG23 1  
ATOM 1777  N N    . ASN A 1 110 ? 1.703   1.200   -5.363  1.00 0.00 ? 110 ASN A N    1  
ATOM 1778  C CA   . ASN A 1 110 ? 0.304   0.823   -5.423  1.00 0.00 ? 110 ASN A CA   1  
ATOM 1779  C C    . ASN A 1 110 ? -0.310  1.240   -6.740  1.00 0.00 ? 110 ASN A C    1  
ATOM 1780  O O    . ASN A 1 110 ? -0.512  2.424   -6.997  1.00 0.00 ? 110 ASN A O    1  
ATOM 1781  C CB   . ASN A 1 110 ? -0.474  1.435   -4.256  1.00 0.00 ? 110 ASN A CB   1  
ATOM 1782  C CG   . ASN A 1 110 ? -0.318  0.648   -2.968  1.00 0.00 ? 110 ASN A CG   1  
ATOM 1783  O OD1  . ASN A 1 110 ? 0.701   0.001   -2.732  1.00 0.00 ? 110 ASN A OD1  1  
ATOM 1784  N ND2  . ASN A 1 110 ? -1.336  0.688   -2.125  1.00 0.00 ? 110 ASN A ND2  1  
ATOM 1785  H H    . ASN A 1 110 ? 1.955   2.150   -5.409  1.00 0.00 ? 110 ASN A H    1  
ATOM 1786  H HA   . ASN A 1 110 ? 0.252   -0.252  -5.346  1.00 0.00 ? 110 ASN A HA   1  
ATOM 1787  H HB2  . ASN A 1 110 ? -0.121  2.441   -4.086  1.00 0.00 ? 110 ASN A HB2  1  
ATOM 1788  H HB3  . ASN A 1 110 ? -1.525  1.468   -4.511  1.00 0.00 ? 110 ASN A HB3  1  
ATOM 1789  H HD21 . ASN A 1 110 ? -2.121  1.216   -2.374  1.00 0.00 ? 110 ASN A HD21 1  
ATOM 1790  H HD22 . ASN A 1 110 ? -1.263  0.187   -1.288  1.00 0.00 ? 110 ASN A HD22 1  
ATOM 1791  N N    . THR A 1 111 ? -0.625  0.249   -7.556  1.00 0.00 ? 111 THR A N    1  
ATOM 1792  C CA   . THR A 1 111 ? -1.178  0.476   -8.868  1.00 0.00 ? 111 THR A CA   1  
ATOM 1793  C C    . THR A 1 111 ? -2.608  -0.030  -8.894  1.00 0.00 ? 111 THR A C    1  
ATOM 1794  O O    . THR A 1 111 ? -2.861  -1.225  -8.731  1.00 0.00 ? 111 THR A O    1  
ATOM 1795  C CB   . THR A 1 111 ? -0.357  -0.260  -9.950  1.00 0.00 ? 111 THR A CB   1  
ATOM 1796  O OG1  . THR A 1 111 ? 1.048   -0.081  -9.715  1.00 0.00 ? 111 THR A OG1  1  
ATOM 1797  C CG2  . THR A 1 111 ? -0.712  0.245   -11.341 1.00 0.00 ? 111 THR A CG2  1  
ATOM 1798  H H    . THR A 1 111 ? -0.500  -0.672  -7.263  1.00 0.00 ? 111 THR A H    1  
ATOM 1799  H HA   . THR A 1 111 ? -1.161  1.535   -9.073  1.00 0.00 ? 111 THR A HA   1  
ATOM 1800  H HB   . THR A 1 111 ? -0.588  -1.315  -9.900  1.00 0.00 ? 111 THR A HB   1  
ATOM 1801  H HG1  . THR A 1 111 ? 1.333   0.772   -10.092 1.00 0.00 ? 111 THR A HG1  1  
ATOM 1802  H HG21 . THR A 1 111 ? -0.499  1.302   -11.404 1.00 0.00 ? 111 THR A HG21 1  
ATOM 1803  H HG22 . THR A 1 111 ? -1.762  0.078   -11.528 1.00 0.00 ? 111 THR A HG22 1  
ATOM 1804  H HG23 . THR A 1 111 ? -0.126  -0.284  -12.078 1.00 0.00 ? 111 THR A HG23 1  
ATOM 1805  N N    . ASN A 1 112 ? -3.539  0.877   -9.079  1.00 0.00 ? 112 ASN A N    1  
ATOM 1806  C CA   . ASN A 1 112 ? -4.942  0.523   -9.080  1.00 0.00 ? 112 ASN A CA   1  
ATOM 1807  C C    . ASN A 1 112 ? -5.352  0.063   -10.470 1.00 0.00 ? 112 ASN A C    1  
ATOM 1808  O O    . ASN A 1 112 ? -5.131  0.763   -11.458 1.00 0.00 ? 112 ASN A O    1  
ATOM 1809  C CB   . ASN A 1 112 ? -5.777  1.715   -8.628  1.00 0.00 ? 112 ASN A CB   1  
ATOM 1810  C CG   . ASN A 1 112 ? -7.259  1.545   -8.922  1.00 0.00 ? 112 ASN A CG   1  
ATOM 1811  O OD1  . ASN A 1 112 ? -7.767  2.025   -9.936  1.00 0.00 ? 112 ASN A OD1  1  
ATOM 1812  N ND2  . ASN A 1 112 ? -7.959  0.839   -8.052  1.00 0.00 ? 112 ASN A ND2  1  
ATOM 1813  H H    . ASN A 1 112 ? -3.274  1.803   -9.272  1.00 0.00 ? 112 ASN A H    1  
ATOM 1814  H HA   . ASN A 1 112 ? -5.083  -0.291  -8.382  1.00 0.00 ? 112 ASN A HA   1  
ATOM 1815  H HB2  . ASN A 1 112 ? -5.654  1.846   -7.562  1.00 0.00 ? 112 ASN A HB2  1  
ATOM 1816  H HB3  . ASN A 1 112 ? -5.418  2.595   -9.134  1.00 0.00 ? 112 ASN A HB3  1  
ATOM 1817  H HD21 . ASN A 1 112 ? -7.494  0.469   -7.277  1.00 0.00 ? 112 ASN A HD21 1  
ATOM 1818  H HD22 . ASN A 1 112 ? -8.919  0.717   -8.222  1.00 0.00 ? 112 ASN A HD22 1  
ATOM 1819  N N    . VAL A 1 113 ? -5.930  -1.125  -10.539 1.00 0.00 ? 113 VAL A N    1  
ATOM 1820  C CA   . VAL A 1 113 ? -6.290  -1.720  -11.809 1.00 0.00 ? 113 VAL A CA   1  
ATOM 1821  C C    . VAL A 1 113 ? -7.784  -1.562  -12.061 1.00 0.00 ? 113 VAL A C    1  
ATOM 1822  O O    . VAL A 1 113 ? -8.227  -0.568  -12.633 1.00 0.00 ? 113 VAL A O    1  
ATOM 1823  C CB   . VAL A 1 113 ? -5.924  -3.222  -11.857 1.00 0.00 ? 113 VAL A CB   1  
ATOM 1824  C CG1  . VAL A 1 113 ? -6.015  -3.757  -13.279 1.00 0.00 ? 113 VAL A CG1  1  
ATOM 1825  C CG2  . VAL A 1 113 ? -4.539  -3.473  -11.272 1.00 0.00 ? 113 VAL A CG2  1  
ATOM 1826  H H    . VAL A 1 113 ? -6.136  -1.609  -9.707  1.00 0.00 ? 113 VAL A H    1  
ATOM 1827  H HA   . VAL A 1 113 ? -5.744  -1.207  -12.588 1.00 0.00 ? 113 VAL A HA   1  
ATOM 1828  H HB   . VAL A 1 113 ? -6.647  -3.759  -11.256 1.00 0.00 ? 113 VAL A HB   1  
ATOM 1829  H HG11 . VAL A 1 113 ? -5.298  -3.247  -13.903 1.00 0.00 ? 113 VAL A HG11 1  
ATOM 1830  H HG12 . VAL A 1 113 ? -7.011  -3.588  -13.663 1.00 0.00 ? 113 VAL A HG12 1  
ATOM 1831  H HG13 . VAL A 1 113 ? -5.807  -4.816  -13.279 1.00 0.00 ? 113 VAL A HG13 1  
ATOM 1832  H HG21 . VAL A 1 113 ? -4.530  -3.182  -10.231 1.00 0.00 ? 113 VAL A HG21 1  
ATOM 1833  H HG22 . VAL A 1 113 ? -3.805  -2.891  -11.813 1.00 0.00 ? 113 VAL A HG22 1  
ATOM 1834  H HG23 . VAL A 1 113 ? -4.298  -4.521  -11.354 1.00 0.00 ? 113 VAL A HG23 1  
ATOM 1835  N N    . LYS A 1 114 ? -8.553  -2.546  -11.618 1.00 0.00 ? 114 LYS A N    1  
ATOM 1836  C CA   . LYS A 1 114 ? -9.994  -2.531  -11.802 1.00 0.00 ? 114 LYS A CA   1  
ATOM 1837  C C    . LYS A 1 114 ? -10.696 -1.825  -10.658 1.00 0.00 ? 114 LYS A C    1  
ATOM 1838  O O    . LYS A 1 114 ? -10.091 -1.484  -9.641  1.00 0.00 ? 114 LYS A O    1  
ATOM 1839  C CB   . LYS A 1 114 ? -10.533 -3.955  -11.893 1.00 0.00 ? 114 LYS A CB   1  
ATOM 1840  C CG   . LYS A 1 114 ? -9.917  -4.780  -13.006 1.00 0.00 ? 114 LYS A CG   1  
ATOM 1841  C CD   . LYS A 1 114 ? -10.411 -6.218  -12.973 1.00 0.00 ? 114 LYS A CD   1  
ATOM 1842  C CE   . LYS A 1 114 ? -11.908 -6.304  -13.228 1.00 0.00 ? 114 LYS A CE   1  
ATOM 1843  N NZ   . LYS A 1 114 ? -12.380 -7.712  -13.276 1.00 0.00 ? 114 LYS A NZ   1  
ATOM 1844  H H    . LYS A 1 114 ? -8.137  -3.321  -11.196 1.00 0.00 ? 114 LYS A H    1  
ATOM 1845  H HA   . LYS A 1 114 ? -10.211 -2.014  -12.725 1.00 0.00 ? 114 LYS A HA   1  
ATOM 1846  H HB2  . LYS A 1 114 ? -10.343 -4.455  -10.956 1.00 0.00 ? 114 LYS A HB2  1  
ATOM 1847  H HB3  . LYS A 1 114 ? -11.602 -3.908  -12.053 1.00 0.00 ? 114 LYS A HB3  1  
ATOM 1848  H HG2  . LYS A 1 114 ? -10.182 -4.340  -13.955 1.00 0.00 ? 114 LYS A HG2  1  
ATOM 1849  H HG3  . LYS A 1 114 ? -8.842  -4.776  -12.892 1.00 0.00 ? 114 LYS A HG3  1  
ATOM 1850  H HD2  . LYS A 1 114 ? -9.893  -6.784  -13.732 1.00 0.00 ? 114 LYS A HD2  1  
ATOM 1851  H HD3  . LYS A 1 114 ? -10.197 -6.635  -12.001 1.00 0.00 ? 114 LYS A HD3  1  
ATOM 1852  H HE2  . LYS A 1 114 ? -12.426 -5.787  -12.436 1.00 0.00 ? 114 LYS A HE2  1  
ATOM 1853  H HE3  . LYS A 1 114 ? -12.128 -5.827  -14.172 1.00 0.00 ? 114 LYS A HE3  1  
ATOM 1854  H HZ1  . LYS A 1 114 ? -12.251 -8.170  -12.344 1.00 0.00 ? 114 LYS A HZ1  1  
ATOM 1855  H HZ2  . LYS A 1 114 ? -11.838 -8.247  -13.988 1.00 0.00 ? 114 LYS A HZ2  1  
ATOM 1856  H HZ3  . LYS A 1 114 ? -13.386 -7.743  -13.535 1.00 0.00 ? 114 LYS A HZ3  1  
ATOM 1857  N N    . ASN A 1 115 ? -11.987 -1.640  -10.836 1.00 0.00 ? 115 ASN A N    1  
ATOM 1858  C CA   . ASN A 1 115 ? -12.840 -1.065  -9.817  1.00 0.00 ? 115 ASN A CA   1  
ATOM 1859  C C    . ASN A 1 115 ? -14.116 -1.893  -9.723  1.00 0.00 ? 115 ASN A C    1  
ATOM 1860  O O    . ASN A 1 115 ? -14.505 -2.544  -10.695 1.00 0.00 ? 115 ASN A O    1  
ATOM 1861  C CB   . ASN A 1 115 ? -13.170 0.386   -10.159 1.00 0.00 ? 115 ASN A CB   1  
ATOM 1862  C CG   . ASN A 1 115 ? -13.975 1.069   -9.072  1.00 0.00 ? 115 ASN A CG   1  
ATOM 1863  O OD1  . ASN A 1 115 ? -15.202 1.004   -9.059  1.00 0.00 ? 115 ASN A OD1  1  
ATOM 1864  N ND2  . ASN A 1 115 ? -13.288 1.731   -8.154  1.00 0.00 ? 115 ASN A ND2  1  
ATOM 1865  H H    . ASN A 1 115 ? -12.388 -1.909  -11.689 1.00 0.00 ? 115 ASN A H    1  
ATOM 1866  H HA   . ASN A 1 115 ? -12.318 -1.106  -8.873  1.00 0.00 ? 115 ASN A HA   1  
ATOM 1867  H HB2  . ASN A 1 115 ? -12.249 0.935   -10.299 1.00 0.00 ? 115 ASN A HB2  1  
ATOM 1868  H HB3  . ASN A 1 115 ? -13.739 0.407   -11.076 1.00 0.00 ? 115 ASN A HB3  1  
ATOM 1869  H HD21 . ASN A 1 115 ? -12.306 1.746   -8.230  1.00 0.00 ? 115 ASN A HD21 1  
ATOM 1870  H HD22 . ASN A 1 115 ? -13.786 2.171   -7.422  1.00 0.00 ? 115 ASN A HD22 1  
ATOM 1871  N N    . SER A 1 116 ? -14.755 -1.882  -8.568  1.00 0.00 ? 116 SER A N    1  
ATOM 1872  C CA   . SER A 1 116 ? -15.921 -2.716  -8.343  1.00 0.00 ? 116 SER A CA   1  
ATOM 1873  C C    . SER A 1 116 ? -16.910 -1.995  -7.430  1.00 0.00 ? 116 SER A C    1  
ATOM 1874  O O    . SER A 1 116 ? -17.476 -2.588  -6.507  1.00 0.00 ? 116 SER A O    1  
ATOM 1875  C CB   . SER A 1 116 ? -15.468 -4.046  -7.720  1.00 0.00 ? 116 SER A CB   1  
ATOM 1876  O OG   . SER A 1 116 ? -16.483 -5.035  -7.778  1.00 0.00 ? 116 SER A OG   1  
ATOM 1877  H H    . SER A 1 116 ? -14.447 -1.290  -7.850  1.00 0.00 ? 116 SER A H    1  
ATOM 1878  H HA   . SER A 1 116 ? -16.389 -2.909  -9.296  1.00 0.00 ? 116 SER A HA   1  
ATOM 1879  H HB2  . SER A 1 116 ? -14.601 -4.410  -8.253  1.00 0.00 ? 116 SER A HB2  1  
ATOM 1880  H HB3  . SER A 1 116 ? -15.203 -3.878  -6.686  1.00 0.00 ? 116 SER A HB3  1  
ATOM 1881  H HG   . SER A 1 116 ? -17.296 -4.647  -8.145  1.00 0.00 ? 116 SER A HG   1  
ATOM 1882  N N    . SER A 1 117 ? -17.122 -0.708  -7.689  1.00 0.00 ? 117 SER A N    1  
ATOM 1883  C CA   . SER A 1 117 ? -17.949 0.111   -6.813  1.00 0.00 ? 117 SER A CA   1  
ATOM 1884  C C    . SER A 1 117 ? -18.381 1.424   -7.471  1.00 0.00 ? 117 SER A C    1  
ATOM 1885  O O    . SER A 1 117 ? -19.540 1.827   -7.358  1.00 0.00 ? 117 SER A O    1  
ATOM 1886  C CB   . SER A 1 117 ? -17.177 0.389   -5.525  1.00 0.00 ? 117 SER A CB   1  
ATOM 1887  O OG   . SER A 1 117 ? -15.776 0.318   -5.756  1.00 0.00 ? 117 SER A OG   1  
ATOM 1888  H H    . SER A 1 117 ? -16.713 -0.301  -8.485  1.00 0.00 ? 117 SER A H    1  
ATOM 1889  H HA   . SER A 1 117 ? -18.832 -0.459  -6.570  1.00 0.00 ? 117 SER A HA   1  
ATOM 1890  H HB2  . SER A 1 117 ? -17.425 1.376   -5.163  1.00 0.00 ? 117 SER A HB2  1  
ATOM 1891  H HB3  . SER A 1 117 ? -17.445 -0.347  -4.781  1.00 0.00 ? 117 SER A HB3  1  
ATOM 1892  H HG   . SER A 1 117 ? -15.389 1.212   -5.698  1.00 0.00 ? 117 SER A HG   1  
ATOM 1893  N N    . GLN A 1 118 ? -17.457 2.090   -8.149  1.00 0.00 ? 118 GLN A N    1  
ATOM 1894  C CA   . GLN A 1 118 ? -17.741 3.378   -8.778  1.00 0.00 ? 118 GLN A CA   1  
ATOM 1895  C C    . GLN A 1 118 ? -18.481 3.197   -10.097 1.00 0.00 ? 118 GLN A C    1  
ATOM 1896  O O    . GLN A 1 118 ? -17.883 3.291   -11.173 1.00 0.00 ? 118 GLN A O    1  
ATOM 1897  C CB   . GLN A 1 118 ? -16.453 4.165   -9.011  1.00 0.00 ? 118 GLN A CB   1  
ATOM 1898  C CG   . GLN A 1 118 ? -15.814 4.684   -7.737  1.00 0.00 ? 118 GLN A CG   1  
ATOM 1899  C CD   . GLN A 1 118 ? -14.526 5.436   -7.999  1.00 0.00 ? 118 GLN A CD   1  
ATOM 1900  O OE1  . GLN A 1 118 ? -14.345 6.040   -9.057  1.00 0.00 ? 118 GLN A OE1  1  
ATOM 1901  N NE2  . GLN A 1 118 ? -13.626 5.413   -7.032  1.00 0.00 ? 118 GLN A NE2  1  
ATOM 1902  H H    . GLN A 1 118 ? -16.554 1.704   -8.240  1.00 0.00 ? 118 GLN A H    1  
ATOM 1903  H HA   . GLN A 1 118 ? -18.374 3.937   -8.105  1.00 0.00 ? 118 GLN A HA   1  
ATOM 1904  H HB2  . GLN A 1 118 ? -15.739 3.526   -9.510  1.00 0.00 ? 118 GLN A HB2  1  
ATOM 1905  H HB3  . GLN A 1 118 ? -16.670 5.011   -9.649  1.00 0.00 ? 118 GLN A HB3  1  
ATOM 1906  H HG2  . GLN A 1 118 ? -16.509 5.348   -7.243  1.00 0.00 ? 118 GLN A HG2  1  
ATOM 1907  H HG3  . GLN A 1 118 ? -15.597 3.846   -7.093  1.00 0.00 ? 118 GLN A HG3  1  
ATOM 1908  H HE21 . GLN A 1 118 ? -13.844 4.913   -6.206  1.00 0.00 ? 118 GLN A HE21 1  
ATOM 1909  H HE22 . GLN A 1 118 ? -12.787 5.895   -7.170  1.00 0.00 ? 118 GLN A HE22 1  
ATOM 1910  N N    . GLU A 1 119 ? -19.785 2.953   -9.994  1.00 0.00 ? 119 GLU A N    1  
ATOM 1911  C CA   . GLU A 1 119 ? -20.646 2.751   -11.151 1.00 0.00 ? 119 GLU A CA   1  
ATOM 1912  C C    . GLU A 1 119 ? -20.248 1.483   -11.899 1.00 0.00 ? 119 GLU A C    1  
ATOM 1913  O O    . GLU A 1 119 ? -20.727 0.400   -11.511 1.00 0.00 ? 119 GLU A O    1  
ATOM 1914  C CB   . GLU A 1 119 ? -20.607 3.971   -12.080 1.00 0.00 ? 119 GLU A CB   1  
ATOM 1915  C CG   . GLU A 1 119 ? -21.042 5.261   -11.402 1.00 0.00 ? 119 GLU A CG   1  
ATOM 1916  C CD   . GLU A 1 119 ? -20.994 6.454   -12.332 1.00 0.00 ? 119 GLU A CD   1  
ATOM 1917  O OE1  . GLU A 1 119 ? -21.987 6.692   -13.047 1.00 0.00 ? 119 GLU A OE1  1  
ATOM 1918  O OE2  . GLU A 1 119 ? -19.962 7.160   -12.352 1.00 0.00 ? 119 GLU A OE2  1  
ATOM 1919  O OXT  . GLU A 1 119 ? -19.448 1.563   -12.852 1.00 0.00 ? 119 GLU A OXT  1  
ATOM 1920  H H    . GLU A 1 119 ? -20.179 2.894   -9.100  1.00 0.00 ? 119 GLU A H    1  
ATOM 1921  H HA   . GLU A 1 119 ? -21.652 2.627   -10.784 1.00 0.00 ? 119 GLU A HA   1  
ATOM 1922  H HB2  . GLU A 1 119 ? -19.598 4.101   -12.443 1.00 0.00 ? 119 GLU A HB2  1  
ATOM 1923  H HB3  . GLU A 1 119 ? -21.262 3.790   -12.919 1.00 0.00 ? 119 GLU A HB3  1  
ATOM 1924  H HG2  . GLU A 1 119 ? -22.054 5.143   -11.046 1.00 0.00 ? 119 GLU A HG2  1  
ATOM 1925  H HG3  . GLU A 1 119 ? -20.386 5.450   -10.565 1.00 0.00 ? 119 GLU A HG3  1  
ATOM 1926  N N    . GLY A 1 1   ? 0.864   20.215  6.196   1.00 0.00 ? 1   GLY A N    2  
ATOM 1927  C CA   . GLY A 1 1   ? -0.073  19.079  6.048   1.00 0.00 ? 1   GLY A CA   2  
ATOM 1928  C C    . GLY A 1 1   ? -0.325  18.746  4.596   1.00 0.00 ? 1   GLY A C    2  
ATOM 1929  O O    . GLY A 1 1   ? 0.406   19.199  3.712   1.00 0.00 ? 1   GLY A O    2  
ATOM 1930  H H1   . GLY A 1 1   ? 1.789   19.969  5.781   1.00 0.00 ? 1   GLY A H1   2  
ATOM 1931  H H2   . GLY A 1 1   ? 0.999   20.444  7.203   1.00 0.00 ? 1   GLY A H2   2  
ATOM 1932  H H3   . GLY A 1 1   ? 0.490   21.056  5.706   1.00 0.00 ? 1   GLY A H3   2  
ATOM 1933  H HA2  . GLY A 1 1   ? 0.343   18.213  6.537   1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1934  H HA3  . GLY A 1 1   ? -1.012  19.333  6.518   1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1935  N N    . ALA A 1 2   ? -1.361  17.958  4.340   1.00 0.00 ? 2   ALA A N    2  
ATOM 1936  C CA   . ALA A 1 2   ? -1.719  17.578  2.984   1.00 0.00 ? 2   ALA A CA   2  
ATOM 1937  C C    . ALA A 1 2   ? -3.221  17.659  2.789   1.00 0.00 ? 2   ALA A C    2  
ATOM 1938  O O    . ALA A 1 2   ? -3.989  17.350  3.703   1.00 0.00 ? 2   ALA A O    2  
ATOM 1939  C CB   . ALA A 1 2   ? -1.219  16.177  2.670   1.00 0.00 ? 2   ALA A CB   2  
ATOM 1940  H H    . ALA A 1 2   ? -1.912  17.632  5.087   1.00 0.00 ? 2   ALA A H    2  
ATOM 1941  H HA   . ALA A 1 2   ? -1.239  18.268  2.305   1.00 0.00 ? 2   ALA A HA   2  
ATOM 1942  H HB1  . ALA A 1 2   ? -0.146  16.146  2.778   1.00 0.00 ? 2   ALA A HB1  2  
ATOM 1943  H HB2  . ALA A 1 2   ? -1.490  15.917  1.659   1.00 0.00 ? 2   ALA A HB2  2  
ATOM 1944  H HB3  . ALA A 1 2   ? -1.671  15.475  3.356   1.00 0.00 ? 2   ALA A HB3  2  
ATOM 1945  N N    . MET A 1 3   ? -3.622  18.054  1.590   1.00 0.00 ? 3   MET A N    2  
ATOM 1946  C CA   . MET A 1 3   ? -5.025  18.249  1.246   1.00 0.00 ? 3   MET A CA   2  
ATOM 1947  C C    . MET A 1 3   ? -5.125  18.805  -0.171  1.00 0.00 ? 3   MET A C    2  
ATOM 1948  O O    . MET A 1 3   ? -6.073  18.515  -0.904  1.00 0.00 ? 3   MET A O    2  
ATOM 1949  C CB   . MET A 1 3   ? -5.735  19.202  2.223   1.00 0.00 ? 3   MET A CB   2  
ATOM 1950  C CG   . MET A 1 3   ? -5.197  20.619  2.220   1.00 0.00 ? 3   MET A CG   2  
ATOM 1951  S SD   . MET A 1 3   ? -6.133  21.729  3.292   1.00 0.00 ? 3   MET A SD   2  
ATOM 1952  C CE   . MET A 1 3   ? -7.750  21.657  2.523   1.00 0.00 ? 3   MET A CE   2  
ATOM 1953  H H    . MET A 1 3   ? -2.951  18.180  0.891   1.00 0.00 ? 3   MET A H    2  
ATOM 1954  H HA   . MET A 1 3   ? -5.507  17.281  1.284   1.00 0.00 ? 3   MET A HA   2  
ATOM 1955  H HB2  . MET A 1 3   ? -6.782  19.241  1.972   1.00 0.00 ? 3   MET A HB2  2  
ATOM 1956  H HB3  . MET A 1 3   ? -5.633  18.813  3.218   1.00 0.00 ? 3   MET A HB3  2  
ATOM 1957  H HG2  . MET A 1 3   ? -4.170  20.603  2.552   1.00 0.00 ? 3   MET A HG2  2  
ATOM 1958  H HG3  . MET A 1 3   ? -5.240  20.991  1.215   1.00 0.00 ? 3   MET A HG3  2  
ATOM 1959  H HE1  . MET A 1 3   ? -8.101  20.637  2.517   1.00 0.00 ? 3   MET A HE1  2  
ATOM 1960  H HE2  . MET A 1 3   ? -7.685  22.020  1.507   1.00 0.00 ? 3   MET A HE2  2  
ATOM 1961  H HE3  . MET A 1 3   ? -8.442  22.272  3.081   1.00 0.00 ? 3   MET A HE3  2  
ATOM 1962  N N    . ASP A 1 4   ? -4.131  19.610  -0.547  1.00 0.00 ? 4   ASP A N    2  
ATOM 1963  C CA   . ASP A 1 4   ? -4.060  20.197  -1.883  1.00 0.00 ? 4   ASP A CA   2  
ATOM 1964  C C    . ASP A 1 4   ? -3.435  19.201  -2.845  1.00 0.00 ? 4   ASP A C    2  
ATOM 1965  O O    . ASP A 1 4   ? -2.271  19.333  -3.233  1.00 0.00 ? 4   ASP A O    2  
ATOM 1966  C CB   . ASP A 1 4   ? -3.230  21.485  -1.879  1.00 0.00 ? 4   ASP A CB   2  
ATOM 1967  C CG   . ASP A 1 4   ? -3.815  22.570  -1.000  1.00 0.00 ? 4   ASP A CG   2  
ATOM 1968  O OD1  . ASP A 1 4   ? -3.523  22.585  0.214   1.00 0.00 ? 4   ASP A OD1  2  
ATOM 1969  O OD2  . ASP A 1 4   ? -4.553  23.428  -1.523  1.00 0.00 ? 4   ASP A OD2  2  
ATOM 1970  H H    . ASP A 1 4   ? -3.419  19.818  0.098   1.00 0.00 ? 4   ASP A H    2  
ATOM 1971  H HA   . ASP A 1 4   ? -5.066  20.420  -2.209  1.00 0.00 ? 4   ASP A HA   2  
ATOM 1972  H HB2  . ASP A 1 4   ? -2.236  21.261  -1.524  1.00 0.00 ? 4   ASP A HB2  2  
ATOM 1973  H HB3  . ASP A 1 4   ? -3.166  21.862  -2.891  1.00 0.00 ? 4   ASP A HB3  2  
ATOM 1974  N N    . ASN A 1 5   ? -4.210  18.201  -3.216  1.00 0.00 ? 5   ASN A N    2  
ATOM 1975  C CA   . ASN A 1 5   ? -3.706  17.106  -4.028  1.00 0.00 ? 5   ASN A CA   2  
ATOM 1976  C C    . ASN A 1 5   ? -4.281  17.176  -5.433  1.00 0.00 ? 5   ASN A C    2  
ATOM 1977  O O    . ASN A 1 5   ? -5.487  17.013  -5.630  1.00 0.00 ? 5   ASN A O    2  
ATOM 1978  C CB   . ASN A 1 5   ? -4.061  15.765  -3.381  1.00 0.00 ? 5   ASN A CB   2  
ATOM 1979  C CG   . ASN A 1 5   ? -3.410  15.556  -2.022  1.00 0.00 ? 5   ASN A CG   2  
ATOM 1980  O OD1  . ASN A 1 5   ? -3.083  16.504  -1.309  1.00 0.00 ? 5   ASN A OD1  2  
ATOM 1981  N ND2  . ASN A 1 5   ? -3.218  14.304  -1.645  1.00 0.00 ? 5   ASN A ND2  2  
ATOM 1982  H H    . ASN A 1 5   ? -5.152  18.197  -2.942  1.00 0.00 ? 5   ASN A H    2  
ATOM 1983  H HA   . ASN A 1 5   ? -2.632  17.198  -4.084  1.00 0.00 ? 5   ASN A HA   2  
ATOM 1984  H HB2  . ASN A 1 5   ? -5.131  15.713  -3.252  1.00 0.00 ? 5   ASN A HB2  2  
ATOM 1985  H HB3  . ASN A 1 5   ? -3.747  14.967  -4.038  1.00 0.00 ? 5   ASN A HB3  2  
ATOM 1986  H HD21 . ASN A 1 5   ? -3.487  13.589  -2.261  1.00 0.00 ? 5   ASN A HD21 2  
ATOM 1987  H HD22 . ASN A 1 5   ? -2.854  14.143  -0.752  1.00 0.00 ? 5   ASN A HD22 2  
ATOM 1988  N N    . VAL A 1 6   ? -3.416  17.428  -6.400  1.00 0.00 ? 6   VAL A N    2  
ATOM 1989  C CA   . VAL A 1 6   ? -3.825  17.540  -7.789  1.00 0.00 ? 6   VAL A CA   2  
ATOM 1990  C C    . VAL A 1 6   ? -2.697  17.071  -8.712  1.00 0.00 ? 6   VAL A C    2  
ATOM 1991  O O    . VAL A 1 6   ? -1.521  17.133  -8.339  1.00 0.00 ? 6   VAL A O    2  
ATOM 1992  C CB   . VAL A 1 6   ? -4.226  18.997  -8.133  1.00 0.00 ? 6   VAL A CB   2  
ATOM 1993  C CG1  . VAL A 1 6   ? -3.028  19.933  -8.037  1.00 0.00 ? 6   VAL A CG1  2  
ATOM 1994  C CG2  . VAL A 1 6   ? -4.872  19.084  -9.509  1.00 0.00 ? 6   VAL A CG2  2  
ATOM 1995  H H    . VAL A 1 6   ? -2.469  17.535  -6.175  1.00 0.00 ? 6   VAL A H    2  
ATOM 1996  H HA   . VAL A 1 6   ? -4.686  16.904  -7.938  1.00 0.00 ? 6   VAL A HA   2  
ATOM 1997  H HB   . VAL A 1 6   ? -4.954  19.320  -7.403  1.00 0.00 ? 6   VAL A HB   2  
ATOM 1998  H HG11 . VAL A 1 6   ? -2.602  19.873  -7.045  1.00 0.00 ? 6   VAL A HG11 2  
ATOM 1999  H HG12 . VAL A 1 6   ? -3.347  20.945  -8.230  1.00 0.00 ? 6   VAL A HG12 2  
ATOM 2000  H HG13 . VAL A 1 6   ? -2.287  19.643  -8.765  1.00 0.00 ? 6   VAL A HG13 2  
ATOM 2001  H HG21 . VAL A 1 6   ? -5.770  18.484  -9.524  1.00 0.00 ? 6   VAL A HG21 2  
ATOM 2002  H HG22 . VAL A 1 6   ? -4.181  18.719  -10.254 1.00 0.00 ? 6   VAL A HG22 2  
ATOM 2003  H HG23 . VAL A 1 6   ? -5.123  20.112  -9.723  1.00 0.00 ? 6   VAL A HG23 2  
ATOM 2004  N N    . CYS A 1 7   ? -3.070  16.576  -9.892  1.00 0.00 ? 7   CYS A N    2  
ATOM 2005  C CA   . CYS A 1 7   ? -2.110  16.158  -10.917 1.00 0.00 ? 7   CYS A CA   2  
ATOM 2006  C C    . CYS A 1 7   ? -1.301  14.945  -10.475 1.00 0.00 ? 7   CYS A C    2  
ATOM 2007  O O    . CYS A 1 7   ? -0.082  14.900  -10.639 1.00 0.00 ? 7   CYS A O    2  
ATOM 2008  C CB   . CYS A 1 7   ? -1.170  17.314  -11.285 1.00 0.00 ? 7   CYS A CB   2  
ATOM 2009  S SG   . CYS A 1 7   ? -2.009  18.770  -11.951 1.00 0.00 ? 7   CYS A SG   2  
ATOM 2010  H H    . CYS A 1 7   ? -4.029  16.483  -10.079 1.00 0.00 ? 7   CYS A H    2  
ATOM 2011  H HA   . CYS A 1 7   ? -2.675  15.881  -11.790 1.00 0.00 ? 7   CYS A HA   2  
ATOM 2012  H HB2  . CYS A 1 7   ? -0.632  17.624  -10.402 1.00 0.00 ? 7   CYS A HB2  2  
ATOM 2013  H HB3  . CYS A 1 7   ? -0.468  16.972  -12.028 1.00 0.00 ? 7   CYS A HB3  2  
ATOM 2014  H HG   . CYS A 1 7   ? -2.164  18.580  -13.260 1.00 0.00 ? 7   CYS A HG   2  
ATOM 2015  N N    . GLN A 1 8   ? -1.980  13.956  -9.926  1.00 0.00 ? 8   GLN A N    2  
ATOM 2016  C CA   . GLN A 1 8   ? -1.311  12.752  -9.471  1.00 0.00 ? 8   GLN A CA   2  
ATOM 2017  C C    . GLN A 1 8   ? -1.817  11.518  -10.224 1.00 0.00 ? 8   GLN A C    2  
ATOM 2018  O O    . GLN A 1 8   ? -2.999  11.432  -10.567 1.00 0.00 ? 8   GLN A O    2  
ATOM 2019  C CB   . GLN A 1 8   ? -1.491  12.570  -7.960  1.00 0.00 ? 8   GLN A CB   2  
ATOM 2020  C CG   . GLN A 1 8   ? -2.886  12.135  -7.530  1.00 0.00 ? 8   GLN A CG   2  
ATOM 2021  C CD   . GLN A 1 8   ? -3.902  13.256  -7.560  1.00 0.00 ? 8   GLN A CD   2  
ATOM 2022  O OE1  . GLN A 1 8   ? -3.571  14.416  -7.341  1.00 0.00 ? 8   GLN A OE1  2  
ATOM 2023  N NE2  . GLN A 1 8   ? -5.150  12.915  -7.837  1.00 0.00 ? 8   GLN A NE2  2  
ATOM 2024  H H    . GLN A 1 8   ? -2.952  14.036  -9.828  1.00 0.00 ? 8   GLN A H    2  
ATOM 2025  H HA   . GLN A 1 8   ? -0.259  12.868  -9.680  1.00 0.00 ? 8   GLN A HA   2  
ATOM 2026  H HB2  . GLN A 1 8   ? -0.791  11.825  -7.625  1.00 0.00 ? 8   GLN A HB2  2  
ATOM 2027  H HB3  . GLN A 1 8   ? -1.263  13.505  -7.472  1.00 0.00 ? 8   GLN A HB3  2  
ATOM 2028  H HG2  . GLN A 1 8   ? -3.220  11.356  -8.194  1.00 0.00 ? 8   GLN A HG2  2  
ATOM 2029  H HG3  . GLN A 1 8   ? -2.829  11.746  -6.523  1.00 0.00 ? 8   GLN A HG3  2  
ATOM 2030  H HE21 . GLN A 1 8   ? -5.346  11.971  -8.010  1.00 0.00 ? 8   GLN A HE21 2  
ATOM 2031  H HE22 . GLN A 1 8   ? -5.837  13.622  -7.840  1.00 0.00 ? 8   GLN A HE22 2  
ATOM 2032  N N    . PRO A 1 9   ? -0.909  10.570  -10.523 1.00 0.00 ? 9   PRO A N    2  
ATOM 2033  C CA   . PRO A 1 9   ? -1.253  9.288   -11.153 1.00 0.00 ? 9   PRO A CA   2  
ATOM 2034  C C    . PRO A 1 9   ? -2.104  8.406   -10.237 1.00 0.00 ? 9   PRO A C    2  
ATOM 2035  O O    . PRO A 1 9   ? -2.166  8.629   -9.029  1.00 0.00 ? 9   PRO A O    2  
ATOM 2036  C CB   . PRO A 1 9   ? 0.110   8.623   -11.400 1.00 0.00 ? 9   PRO A CB   2  
ATOM 2037  C CG   . PRO A 1 9   ? 1.113   9.716   -11.278 1.00 0.00 ? 9   PRO A CG   2  
ATOM 2038  C CD   . PRO A 1 9   ? 0.538   10.688  -10.292 1.00 0.00 ? 9   PRO A CD   2  
ATOM 2039  H HA   . PRO A 1 9   ? -1.766  9.430   -12.091 1.00 0.00 ? 9   PRO A HA   2  
ATOM 2040  H HB2  . PRO A 1 9   ? 0.277   7.854   -10.660 1.00 0.00 ? 9   PRO A HB2  2  
ATOM 2041  H HB3  . PRO A 1 9   ? 0.125   8.185   -12.388 1.00 0.00 ? 9   PRO A HB3  2  
ATOM 2042  H HG2  . PRO A 1 9   ? 2.047   9.318   -10.910 1.00 0.00 ? 9   PRO A HG2  2  
ATOM 2043  H HG3  . PRO A 1 9   ? 1.257   10.193  -12.235 1.00 0.00 ? 9   PRO A HG3  2  
ATOM 2044  H HD2  . PRO A 1 9   ? 0.793   10.401  -9.284  1.00 0.00 ? 9   PRO A HD2  2  
ATOM 2045  H HD3  . PRO A 1 9   ? 0.881   11.690  -10.501 1.00 0.00 ? 9   PRO A HD3  2  
ATOM 2046  N N    . THR A 1 10  ? -2.737  7.393   -10.823 1.00 0.00 ? 10  THR A N    2  
ATOM 2047  C CA   . THR A 1 10  ? -3.645  6.519   -10.097 1.00 0.00 ? 10  THR A CA   2  
ATOM 2048  C C    . THR A 1 10  ? -2.890  5.468   -9.288  1.00 0.00 ? 10  THR A C    2  
ATOM 2049  O O    . THR A 1 10  ? -3.487  4.568   -8.700  1.00 0.00 ? 10  THR A O    2  
ATOM 2050  C CB   . THR A 1 10  ? -4.608  5.825   -11.072 1.00 0.00 ? 10  THR A CB   2  
ATOM 2051  O OG1  . THR A 1 10  ? -4.499  6.442   -12.365 1.00 0.00 ? 10  THR A OG1  2  
ATOM 2052  C CG2  . THR A 1 10  ? -6.040  5.930   -10.575 1.00 0.00 ? 10  THR A CG2  2  
ATOM 2053  H H    . THR A 1 10  ? -2.605  7.231   -11.779 1.00 0.00 ? 10  THR A H    2  
ATOM 2054  H HA   . THR A 1 10  ? -4.223  7.127   -9.423  1.00 0.00 ? 10  THR A HA   2  
ATOM 2055  H HB   . THR A 1 10  ? -4.338  4.783   -11.147 1.00 0.00 ? 10  THR A HB   2  
ATOM 2056  H HG1  . THR A 1 10  ? -5.320  6.310   -12.860 1.00 0.00 ? 10  THR A HG1  2  
ATOM 2057  H HG21 . THR A 1 10  ? -6.319  6.972   -10.501 1.00 0.00 ? 10  THR A HG21 2  
ATOM 2058  H HG22 . THR A 1 10  ? -6.117  5.468   -9.602  1.00 0.00 ? 10  THR A HG22 2  
ATOM 2059  H HG23 . THR A 1 10  ? -6.699  5.428   -11.268 1.00 0.00 ? 10  THR A HG23 2  
ATOM 2060  N N    . GLU A 1 11  ? -1.578  5.594   -9.258  1.00 0.00 ? 11  GLU A N    2  
ATOM 2061  C CA   . GLU A 1 11  ? -0.746  4.754   -8.416  1.00 0.00 ? 11  GLU A CA   2  
ATOM 2062  C C    . GLU A 1 11  ? -0.166  5.606   -7.307  1.00 0.00 ? 11  GLU A C    2  
ATOM 2063  O O    . GLU A 1 11  ? 0.320   6.708   -7.566  1.00 0.00 ? 11  GLU A O    2  
ATOM 2064  C CB   . GLU A 1 11  ? 0.400   4.128   -9.214  1.00 0.00 ? 11  GLU A CB   2  
ATOM 2065  C CG   . GLU A 1 11  ? -0.039  3.236   -10.361 1.00 0.00 ? 11  GLU A CG   2  
ATOM 2066  C CD   . GLU A 1 11  ? 1.143   2.600   -11.063 1.00 0.00 ? 11  GLU A CD   2  
ATOM 2067  O OE1  . GLU A 1 11  ? 1.719   3.236   -11.966 1.00 0.00 ? 11  GLU A OE1  2  
ATOM 2068  O OE2  . GLU A 1 11  ? 1.517   1.469   -10.696 1.00 0.00 ? 11  GLU A OE2  2  
ATOM 2069  H H    . GLU A 1 11  ? -1.162  6.294   -9.798  1.00 0.00 ? 11  GLU A H    2  
ATOM 2070  H HA   . GLU A 1 11  ? -1.361  3.975   -7.989  1.00 0.00 ? 11  GLU A HA   2  
ATOM 2071  H HB2  . GLU A 1 11  ? 1.010   4.919   -9.622  1.00 0.00 ? 11  GLU A HB2  2  
ATOM 2072  H HB3  . GLU A 1 11  ? 1.003   3.537   -8.539  1.00 0.00 ? 11  GLU A HB3  2  
ATOM 2073  H HG2  . GLU A 1 11  ? -0.676  2.454   -9.975  1.00 0.00 ? 11  GLU A HG2  2  
ATOM 2074  H HG3  . GLU A 1 11  ? -0.587  3.830   -11.076 1.00 0.00 ? 11  GLU A HG3  2  
ATOM 2075  N N    . PHE A 1 12  ? -0.195  5.122   -6.080  1.00 0.00 ? 12  PHE A N    2  
ATOM 2076  C CA   . PHE A 1 12  ? 0.381   5.889   -4.992  1.00 0.00 ? 12  PHE A CA   2  
ATOM 2077  C C    . PHE A 1 12  ? 1.559   5.152   -4.391  1.00 0.00 ? 12  PHE A C    2  
ATOM 2078  O O    . PHE A 1 12  ? 1.514   3.940   -4.173  1.00 0.00 ? 12  PHE A O    2  
ATOM 2079  C CB   . PHE A 1 12  ? -0.660  6.273   -3.923  1.00 0.00 ? 12  PHE A CB   2  
ATOM 2080  C CG   . PHE A 1 12  ? -1.051  5.197   -2.941  1.00 0.00 ? 12  PHE A CG   2  
ATOM 2081  C CD1  . PHE A 1 12  ? -1.993  4.242   -3.271  1.00 0.00 ? 12  PHE A CD1  2  
ATOM 2082  C CD2  . PHE A 1 12  ? -0.504  5.178   -1.667  1.00 0.00 ? 12  PHE A CD2  2  
ATOM 2083  C CE1  . PHE A 1 12  ? -2.384  3.286   -2.351  1.00 0.00 ? 12  PHE A CE1  2  
ATOM 2084  C CE2  . PHE A 1 12  ? -0.884  4.219   -0.745  1.00 0.00 ? 12  PHE A CE2  2  
ATOM 2085  C CZ   . PHE A 1 12  ? -1.828  3.272   -1.087  1.00 0.00 ? 12  PHE A CZ   2  
ATOM 2086  H H    . PHE A 1 12  ? -0.601  4.241   -5.907  1.00 0.00 ? 12  PHE A H    2  
ATOM 2087  H HA   . PHE A 1 12  ? 0.761   6.802   -5.428  1.00 0.00 ? 12  PHE A HA   2  
ATOM 2088  H HB2  . PHE A 1 12  ? -0.274  7.101   -3.350  1.00 0.00 ? 12  PHE A HB2  2  
ATOM 2089  H HB3  . PHE A 1 12  ? -1.559  6.597   -4.428  1.00 0.00 ? 12  PHE A HB3  2  
ATOM 2090  H HD1  . PHE A 1 12  ? -2.427  4.245   -4.260  1.00 0.00 ? 12  PHE A HD1  2  
ATOM 2091  H HD2  . PHE A 1 12  ? 0.235   5.918   -1.396  1.00 0.00 ? 12  PHE A HD2  2  
ATOM 2092  H HE1  . PHE A 1 12  ? -3.121  2.545   -2.623  1.00 0.00 ? 12  PHE A HE1  2  
ATOM 2093  H HE2  . PHE A 1 12  ? -0.446  4.212   0.242   1.00 0.00 ? 12  PHE A HE2  2  
ATOM 2094  H HZ   . PHE A 1 12  ? -2.138  2.525   -0.364  1.00 0.00 ? 12  PHE A HZ   2  
ATOM 2095  N N    . ILE A 1 13  ? 2.631   5.891   -4.169  1.00 0.00 ? 13  ILE A N    2  
ATOM 2096  C CA   . ILE A 1 13  ? 3.840   5.334   -3.604  1.00 0.00 ? 13  ILE A CA   2  
ATOM 2097  C C    . ILE A 1 13  ? 3.969   5.783   -2.161  1.00 0.00 ? 13  ILE A C    2  
ATOM 2098  O O    . ILE A 1 13  ? 3.868   6.972   -1.857  1.00 0.00 ? 13  ILE A O    2  
ATOM 2099  C CB   . ILE A 1 13  ? 5.110   5.748   -4.395  1.00 0.00 ? 13  ILE A CB   2  
ATOM 2100  C CG1  . ILE A 1 13  ? 5.027   5.280   -5.854  1.00 0.00 ? 13  ILE A CG1  2  
ATOM 2101  C CG2  . ILE A 1 13  ? 6.364   5.185   -3.737  1.00 0.00 ? 13  ILE A CG2  2  
ATOM 2102  C CD1  . ILE A 1 13  ? 4.212   6.188   -6.752  1.00 0.00 ? 13  ILE A CD1  2  
ATOM 2103  H H    . ILE A 1 13  ? 2.604   6.845   -4.383  1.00 0.00 ? 13  ILE A H    2  
ATOM 2104  H HA   . ILE A 1 13  ? 3.754   4.256   -3.630  1.00 0.00 ? 13  ILE A HA   2  
ATOM 2105  H HB   . ILE A 1 13  ? 5.181   6.827   -4.375  1.00 0.00 ? 13  ILE A HB   2  
ATOM 2106  H HG12 . ILE A 1 13  ? 6.023   5.223   -6.262  1.00 0.00 ? 13  ILE A HG12 2  
ATOM 2107  H HG13 . ILE A 1 13  ? 4.577   4.300   -5.880  1.00 0.00 ? 13  ILE A HG13 2  
ATOM 2108  H HG21 . ILE A 1 13  ? 6.448   5.569   -2.731  1.00 0.00 ? 13  ILE A HG21 2  
ATOM 2109  H HG22 . ILE A 1 13  ? 7.232   5.479   -4.307  1.00 0.00 ? 13  ILE A HG22 2  
ATOM 2110  H HG23 . ILE A 1 13  ? 6.303   4.107   -3.706  1.00 0.00 ? 13  ILE A HG23 2  
ATOM 2111  H HD11 . ILE A 1 13  ? 4.659   7.171   -6.774  1.00 0.00 ? 13  ILE A HD11 2  
ATOM 2112  H HD12 . ILE A 1 13  ? 3.205   6.259   -6.370  1.00 0.00 ? 13  ILE A HD12 2  
ATOM 2113  H HD13 . ILE A 1 13  ? 4.190   5.781   -7.752  1.00 0.00 ? 13  ILE A HD13 2  
ATOM 2114  N N    . SER A 1 14  ? 4.158   4.829   -1.276  1.00 0.00 ? 14  SER A N    2  
ATOM 2115  C CA   . SER A 1 14  ? 4.289   5.122   0.133   1.00 0.00 ? 14  SER A CA   2  
ATOM 2116  C C    . SER A 1 14  ? 5.362   4.253   0.759   1.00 0.00 ? 14  SER A C    2  
ATOM 2117  O O    . SER A 1 14  ? 5.580   3.119   0.337   1.00 0.00 ? 14  SER A O    2  
ATOM 2118  C CB   . SER A 1 14  ? 2.954   4.900   0.842   1.00 0.00 ? 14  SER A CB   2  
ATOM 2119  O OG   . SER A 1 14  ? 1.940   5.697   0.262   1.00 0.00 ? 14  SER A OG   2  
ATOM 2120  H H    . SER A 1 14  ? 4.220   3.898   -1.589  1.00 0.00 ? 14  SER A H    2  
ATOM 2121  H HA   . SER A 1 14  ? 4.574   6.157   0.235   1.00 0.00 ? 14  SER A HA   2  
ATOM 2122  H HB2  . SER A 1 14  ? 2.673   3.860   0.756   1.00 0.00 ? 14  SER A HB2  2  
ATOM 2123  H HB3  . SER A 1 14  ? 3.054   5.166   1.883   1.00 0.00 ? 14  SER A HB3  2  
ATOM 2124  H HG   . SER A 1 14  ? 2.051   5.709   -0.693  1.00 0.00 ? 14  SER A HG   2  
ATOM 2125  N N    . ARG A 1 15  ? 6.031   4.786   1.759   1.00 0.00 ? 15  ARG A N    2  
ATOM 2126  C CA   . ARG A 1 15  ? 7.025   4.036   2.495   1.00 0.00 ? 15  ARG A CA   2  
ATOM 2127  C C    . ARG A 1 15  ? 6.419   3.675   3.839   1.00 0.00 ? 15  ARG A C    2  
ATOM 2128  O O    . ARG A 1 15  ? 5.961   4.554   4.572   1.00 0.00 ? 15  ARG A O    2  
ATOM 2129  C CB   . ARG A 1 15  ? 8.301   4.865   2.668   1.00 0.00 ? 15  ARG A CB   2  
ATOM 2130  C CG   . ARG A 1 15  ? 8.837   5.430   1.359   1.00 0.00 ? 15  ARG A CG   2  
ATOM 2131  C CD   . ARG A 1 15  ? 10.079  6.282   1.572   1.00 0.00 ? 15  ARG A CD   2  
ATOM 2132  N NE   . ARG A 1 15  ? 10.499  6.953   0.342   1.00 0.00 ? 15  ARG A NE   2  
ATOM 2133  C CZ   . ARG A 1 15  ? 11.688  7.529   0.170   1.00 0.00 ? 15  ARG A CZ   2  
ATOM 2134  N NH1  . ARG A 1 15  ? 12.609  7.463   1.123   1.00 0.00 ? 15  ARG A NH1  2  
ATOM 2135  N NH2  . ARG A 1 15  ? 11.959  8.157   -0.968  1.00 0.00 ? 15  ARG A NH2  2  
ATOM 2136  H H    . ARG A 1 15  ? 5.827   5.706   2.047   1.00 0.00 ? 15  ARG A H    2  
ATOM 2137  H HA   . ARG A 1 15  ? 7.247   3.132   1.946   1.00 0.00 ? 15  ARG A HA   2  
ATOM 2138  H HB2  . ARG A 1 15  ? 8.095   5.688   3.335   1.00 0.00 ? 15  ARG A HB2  2  
ATOM 2139  H HB3  . ARG A 1 15  ? 9.066   4.240   3.106   1.00 0.00 ? 15  ARG A HB3  2  
ATOM 2140  H HG2  . ARG A 1 15  ? 9.086   4.611   0.701   1.00 0.00 ? 15  ARG A HG2  2  
ATOM 2141  H HG3  . ARG A 1 15  ? 8.069   6.039   0.902   1.00 0.00 ? 15  ARG A HG3  2  
ATOM 2142  H HD2  . ARG A 1 15  ? 9.864   7.029   2.322   1.00 0.00 ? 15  ARG A HD2  2  
ATOM 2143  H HD3  . ARG A 1 15  ? 10.882  5.647   1.917   1.00 0.00 ? 15  ARG A HD3  2  
ATOM 2144  H HE   . ARG A 1 15  ? 9.850   6.985   -0.399  1.00 0.00 ? 15  ARG A HE   2  
ATOM 2145  H HH11 . ARG A 1 15  ? 12.417  6.976   1.976   1.00 0.00 ? 15  ARG A HH11 2  
ATOM 2146  H HH12 . ARG A 1 15  ? 13.512  7.897   0.985   1.00 0.00 ? 15  ARG A HH12 2  
ATOM 2147  H HH21 . ARG A 1 15  ? 11.266  8.199   -1.700  1.00 0.00 ? 15  ARG A HH21 2  
ATOM 2148  H HH22 . ARG A 1 15  ? 12.851  8.594   -1.105  1.00 0.00 ? 15  ARG A HH22 2  
ATOM 2149  N N    . HIS A 1 16  ? 6.362   2.393   4.151   1.00 0.00 ? 16  HIS A N    2  
ATOM 2150  C CA   . HIS A 1 16  ? 5.656   1.971   5.349   1.00 0.00 ? 16  HIS A CA   2  
ATOM 2151  C C    . HIS A 1 16  ? 6.476   1.015   6.200   1.00 0.00 ? 16  HIS A C    2  
ATOM 2152  O O    . HIS A 1 16  ? 7.328   0.275   5.705   1.00 0.00 ? 16  HIS A O    2  
ATOM 2153  C CB   . HIS A 1 16  ? 4.275   1.367   5.012   1.00 0.00 ? 16  HIS A CB   2  
ATOM 2154  C CG   . HIS A 1 16  ? 4.274   0.080   4.238   1.00 0.00 ? 16  HIS A CG   2  
ATOM 2155  N ND1  . HIS A 1 16  ? 3.228   -0.820  4.301   1.00 0.00 ? 16  HIS A ND1  2  
ATOM 2156  C CD2  . HIS A 1 16  ? 5.158   -0.441  3.359   1.00 0.00 ? 16  HIS A CD2  2  
ATOM 2157  C CE1  . HIS A 1 16  ? 3.473   -1.837  3.496   1.00 0.00 ? 16  HIS A CE1  2  
ATOM 2158  N NE2  . HIS A 1 16  ? 4.636   -1.630  2.910   1.00 0.00 ? 16  HIS A NE2  2  
ATOM 2159  H H    . HIS A 1 16  ? 6.820   1.730   3.587   1.00 0.00 ? 16  HIS A H    2  
ATOM 2160  H HA   . HIS A 1 16  ? 5.489   2.862   5.937   1.00 0.00 ? 16  HIS A HA   2  
ATOM 2161  H HB2  . HIS A 1 16  ? 3.757   1.176   5.935   1.00 0.00 ? 16  HIS A HB2  2  
ATOM 2162  H HB3  . HIS A 1 16  ? 3.711   2.091   4.444   1.00 0.00 ? 16  HIS A HB3  2  
ATOM 2163  H HD1  . HIS A 1 16  ? 2.424   -0.726  4.858   1.00 0.00 ? 16  HIS A HD1  2  
ATOM 2164  H HD2  . HIS A 1 16  ? 6.104   -0.011  3.074   1.00 0.00 ? 16  HIS A HD2  2  
ATOM 2165  H HE1  . HIS A 1 16  ? 2.829   -2.690  3.339   1.00 0.00 ? 16  HIS A HE1  2  
ATOM 2166  H HE2  . HIS A 1 16  ? 5.005   -2.174  2.181   1.00 0.00 ? 16  HIS A HE2  2  
ATOM 2167  N N    . ASN A 1 17  ? 6.171   1.056   7.484   1.00 0.00 ? 17  ASN A N    2  
ATOM 2168  C CA   . ASN A 1 17  ? 6.796   0.218   8.489   1.00 0.00 ? 17  ASN A CA   2  
ATOM 2169  C C    . ASN A 1 17  ? 6.435   -1.240  8.237   1.00 0.00 ? 17  ASN A C    2  
ATOM 2170  O O    . ASN A 1 17  ? 5.344   -1.533  7.734   1.00 0.00 ? 17  ASN A O    2  
ATOM 2171  C CB   . ASN A 1 17  ? 6.317   0.688   9.875   1.00 0.00 ? 17  ASN A CB   2  
ATOM 2172  C CG   . ASN A 1 17  ? 5.969   -0.445  10.819  1.00 0.00 ? 17  ASN A CG   2  
ATOM 2173  O OD1  . ASN A 1 17  ? 4.865   -0.977  10.776  1.00 0.00 ? 17  ASN A OD1  2  
ATOM 2174  N ND2  . ASN A 1 17  ? 6.888   -0.795  11.699  1.00 0.00 ? 17  ASN A ND2  2  
ATOM 2175  H H    . ASN A 1 17  ? 5.450   1.662   7.771   1.00 0.00 ? 17  ASN A H    2  
ATOM 2176  H HA   . ASN A 1 17  ? 7.866   0.341   8.417   1.00 0.00 ? 17  ASN A HA   2  
ATOM 2177  H HB2  . ASN A 1 17  ? 7.097   1.279   10.331  1.00 0.00 ? 17  ASN A HB2  2  
ATOM 2178  H HB3  . ASN A 1 17  ? 5.440   1.306   9.746   1.00 0.00 ? 17  ASN A HB3  2  
ATOM 2179  H HD21 . ASN A 1 17  ? 7.748   -0.312  11.697  1.00 0.00 ? 17  ASN A HD21 2  
ATOM 2180  H HD22 . ASN A 1 17  ? 6.666   -1.512  12.340  1.00 0.00 ? 17  ASN A HD22 2  
ATOM 2181  N N    . ILE A 1 18  ? 7.362   -2.130  8.598   1.00 0.00 ? 18  ILE A N    2  
ATOM 2182  C CA   . ILE A 1 18  ? 7.299   -3.561  8.269   1.00 0.00 ? 18  ILE A CA   2  
ATOM 2183  C C    . ILE A 1 18  ? 5.987   -4.236  8.669   1.00 0.00 ? 18  ILE A C    2  
ATOM 2184  O O    . ILE A 1 18  ? 5.632   -5.280  8.123   1.00 0.00 ? 18  ILE A O    2  
ATOM 2185  C CB   . ILE A 1 18  ? 8.469   -4.320  8.929   1.00 0.00 ? 18  ILE A CB   2  
ATOM 2186  C CG1  . ILE A 1 18  ? 8.451   -4.113  10.449  1.00 0.00 ? 18  ILE A CG1  2  
ATOM 2187  C CG2  . ILE A 1 18  ? 9.794   -3.856  8.338   1.00 0.00 ? 18  ILE A CG2  2  
ATOM 2188  C CD1  . ILE A 1 18  ? 9.550   -4.854  11.181  1.00 0.00 ? 18  ILE A CD1  2  
ATOM 2189  H H    . ILE A 1 18  ? 8.136   -1.807  9.111   1.00 0.00 ? 18  ILE A H    2  
ATOM 2190  H HA   . ILE A 1 18  ? 7.413   -3.657  7.204   1.00 0.00 ? 18  ILE A HA   2  
ATOM 2191  H HB   . ILE A 1 18  ? 8.355   -5.372  8.713   1.00 0.00 ? 18  ILE A HB   2  
ATOM 2192  H HG12 . ILE A 1 18  ? 8.567   -3.063  10.661  1.00 0.00 ? 18  ILE A HG12 2  
ATOM 2193  H HG13 . ILE A 1 18  ? 7.503   -4.454  10.841  1.00 0.00 ? 18  ILE A HG13 2  
ATOM 2194  H HG21 . ILE A 1 18  ? 9.808   -4.064  7.278   1.00 0.00 ? 18  ILE A HG21 2  
ATOM 2195  H HG22 . ILE A 1 18  ? 10.605  -4.378  8.820   1.00 0.00 ? 18  ILE A HG22 2  
ATOM 2196  H HG23 . ILE A 1 18  ? 9.905   -2.794  8.498   1.00 0.00 ? 18  ILE A HG23 2  
ATOM 2197  H HD11 . ILE A 1 18  ? 9.438   -5.915  11.019  1.00 0.00 ? 18  ILE A HD11 2  
ATOM 2198  H HD12 . ILE A 1 18  ? 9.483   -4.643  12.238  1.00 0.00 ? 18  ILE A HD12 2  
ATOM 2199  H HD13 . ILE A 1 18  ? 10.512  -4.532  10.809  1.00 0.00 ? 18  ILE A HD13 2  
ATOM 2200  N N    . GLU A 1 19  ? 5.274   -3.643  9.607   1.00 0.00 ? 19  GLU A N    2  
ATOM 2201  C CA   . GLU A 1 19  ? 4.024   -4.204  10.093  1.00 0.00 ? 19  GLU A CA   2  
ATOM 2202  C C    . GLU A 1 19  ? 2.853   -3.745  9.230   1.00 0.00 ? 19  GLU A C    2  
ATOM 2203  O O    . GLU A 1 19  ? 1.715   -4.168  9.431   1.00 0.00 ? 19  GLU A O    2  
ATOM 2204  C CB   . GLU A 1 19  ? 3.818   -3.786  11.545  1.00 0.00 ? 19  GLU A CB   2  
ATOM 2205  C CG   . GLU A 1 19  ? 5.032   -4.071  12.410  1.00 0.00 ? 19  GLU A CG   2  
ATOM 2206  C CD   . GLU A 1 19  ? 5.162   -5.533  12.788  1.00 0.00 ? 19  GLU A CD   2  
ATOM 2207  O OE1  . GLU A 1 19  ? 5.610   -6.337  11.946  1.00 0.00 ? 19  GLU A OE1  2  
ATOM 2208  O OE2  . GLU A 1 19  ? 4.815   -5.885  13.938  1.00 0.00 ? 19  GLU A OE2  2  
ATOM 2209  H H    . GLU A 1 19  ? 5.596   -2.799  9.991   1.00 0.00 ? 19  GLU A H    2  
ATOM 2210  H HA   . GLU A 1 19  ? 4.098   -5.280  10.042  1.00 0.00 ? 19  GLU A HA   2  
ATOM 2211  H HB2  . GLU A 1 19  ? 3.613   -2.727  11.578  1.00 0.00 ? 19  GLU A HB2  2  
ATOM 2212  H HB3  . GLU A 1 19  ? 2.975   -4.325  11.952  1.00 0.00 ? 19  GLU A HB3  2  
ATOM 2213  H HG2  . GLU A 1 19  ? 5.915   -3.781  11.862  1.00 0.00 ? 19  GLU A HG2  2  
ATOM 2214  H HG3  . GLU A 1 19  ? 4.965   -3.482  13.307  1.00 0.00 ? 19  GLU A HG3  2  
ATOM 2215  N N    . GLY A 1 20  ? 3.140   -2.881  8.260   1.00 0.00 ? 20  GLY A N    2  
ATOM 2216  C CA   . GLY A 1 20  ? 2.111   -2.396  7.368   1.00 0.00 ? 20  GLY A CA   2  
ATOM 2217  C C    . GLY A 1 20  ? 1.653   -0.992  7.704   1.00 0.00 ? 20  GLY A C    2  
ATOM 2218  O O    . GLY A 1 20  ? 0.638   -0.530  7.184   1.00 0.00 ? 20  GLY A O    2  
ATOM 2219  H H    . GLY A 1 20  ? 4.072   -2.578  8.139   1.00 0.00 ? 20  GLY A H    2  
ATOM 2220  H HA2  . GLY A 1 20  ? 2.494   -2.405  6.359   1.00 0.00 ? 20  GLY A HA2  2  
ATOM 2221  H HA3  . GLY A 1 20  ? 1.262   -3.062  7.425   1.00 0.00 ? 20  GLY A HA3  2  
ATOM 2222  N N    . ILE A 1 21  ? 2.411   -0.296  8.545   1.00 0.00 ? 21  ILE A N    2  
ATOM 2223  C CA   . ILE A 1 21  ? 2.009   1.034   9.014   1.00 0.00 ? 21  ILE A CA   2  
ATOM 2224  C C    . ILE A 1 21  ? 2.559   2.123   8.105   1.00 0.00 ? 21  ILE A C    2  
ATOM 2225  O O    . ILE A 1 21  ? 3.762   2.208   7.901   1.00 0.00 ? 21  ILE A O    2  
ATOM 2226  C CB   . ILE A 1 21  ? 2.501   1.302   10.457  1.00 0.00 ? 21  ILE A CB   2  
ATOM 2227  C CG1  . ILE A 1 21  ? 1.917   0.275   11.430  1.00 0.00 ? 21  ILE A CG1  2  
ATOM 2228  C CG2  . ILE A 1 21  ? 2.138   2.716   10.894  1.00 0.00 ? 21  ILE A CG2  2  
ATOM 2229  C CD1  . ILE A 1 21  ? 0.408   0.332   11.546  1.00 0.00 ? 21  ILE A CD1  2  
ATOM 2230  H H    . ILE A 1 21  ? 3.273   -0.675  8.854   1.00 0.00 ? 21  ILE A H    2  
ATOM 2231  H HA   . ILE A 1 21  ? 0.931   1.080   9.008   1.00 0.00 ? 21  ILE A HA   2  
ATOM 2232  H HB   . ILE A 1 21  ? 3.578   1.219   10.462  1.00 0.00 ? 21  ILE A HB   2  
ATOM 2233  H HG12 . ILE A 1 21  ? 2.190   -0.717  11.101  1.00 0.00 ? 21  ILE A HG12 2  
ATOM 2234  H HG13 . ILE A 1 21  ? 2.332   0.447   12.414  1.00 0.00 ? 21  ILE A HG13 2  
ATOM 2235  H HG21 . ILE A 1 21  ? 2.565   3.427   10.202  1.00 0.00 ? 21  ILE A HG21 2  
ATOM 2236  H HG22 . ILE A 1 21  ? 2.530   2.897   11.883  1.00 0.00 ? 21  ILE A HG22 2  
ATOM 2237  H HG23 . ILE A 1 21  ? 1.064   2.824   10.907  1.00 0.00 ? 21  ILE A HG23 2  
ATOM 2238  H HD11 . ILE A 1 21  ? 0.072   -0.416  12.251  1.00 0.00 ? 21  ILE A HD11 2  
ATOM 2239  H HD12 . ILE A 1 21  ? -0.037  0.138   10.580  1.00 0.00 ? 21  ILE A HD12 2  
ATOM 2240  H HD13 . ILE A 1 21  ? 0.109   1.311   11.891  1.00 0.00 ? 21  ILE A HD13 2  
ATOM 2241  N N    . PHE A 1 22  ? 1.688   2.962   7.568   1.00 0.00 ? 22  PHE A N    2  
ATOM 2242  C CA   . PHE A 1 22  ? 2.124   4.029   6.677   1.00 0.00 ? 22  PHE A CA   2  
ATOM 2243  C C    . PHE A 1 22  ? 2.789   5.154   7.460   1.00 0.00 ? 22  PHE A C    2  
ATOM 2244  O O    . PHE A 1 22  ? 2.180   5.752   8.349   1.00 0.00 ? 22  PHE A O    2  
ATOM 2245  C CB   . PHE A 1 22  ? 0.948   4.569   5.873   1.00 0.00 ? 22  PHE A CB   2  
ATOM 2246  C CG   . PHE A 1 22  ? 0.393   3.577   4.891   1.00 0.00 ? 22  PHE A CG   2  
ATOM 2247  C CD1  . PHE A 1 22  ? 0.974   3.422   3.642   1.00 0.00 ? 22  PHE A CD1  2  
ATOM 2248  C CD2  . PHE A 1 22  ? -0.702  2.799   5.217   1.00 0.00 ? 22  PHE A CD2  2  
ATOM 2249  C CE1  . PHE A 1 22  ? 0.467   2.510   2.736   1.00 0.00 ? 22  PHE A CE1  2  
ATOM 2250  C CE2  . PHE A 1 22  ? -1.211  1.886   4.317   1.00 0.00 ? 22  PHE A CE2  2  
ATOM 2251  C CZ   . PHE A 1 22  ? -0.628  1.741   3.075   1.00 0.00 ? 22  PHE A CZ   2  
ATOM 2252  H H    . PHE A 1 22  ? 0.733   2.875   7.783   1.00 0.00 ? 22  PHE A H    2  
ATOM 2253  H HA   . PHE A 1 22  ? 2.849   3.609   5.996   1.00 0.00 ? 22  PHE A HA   2  
ATOM 2254  H HB2  . PHE A 1 22  ? 0.153   4.848   6.549   1.00 0.00 ? 22  PHE A HB2  2  
ATOM 2255  H HB3  . PHE A 1 22  ? 1.268   5.441   5.321   1.00 0.00 ? 22  PHE A HB3  2  
ATOM 2256  H HD1  . PHE A 1 22  ? 1.831   4.024   3.378   1.00 0.00 ? 22  PHE A HD1  2  
ATOM 2257  H HD2  . PHE A 1 22  ? -1.162  2.911   6.188   1.00 0.00 ? 22  PHE A HD2  2  
ATOM 2258  H HE1  . PHE A 1 22  ? 0.926   2.399   1.764   1.00 0.00 ? 22  PHE A HE1  2  
ATOM 2259  H HE2  . PHE A 1 22  ? -2.067  1.283   4.584   1.00 0.00 ? 22  PHE A HE2  2  
ATOM 2260  H HZ   . PHE A 1 22  ? -1.027  1.024   2.372   1.00 0.00 ? 22  PHE A HZ   2  
ATOM 2261  N N    . THR A 1 23  ? 4.047   5.419   7.135   1.00 0.00 ? 23  THR A N    2  
ATOM 2262  C CA   . THR A 1 23  ? 4.807   6.469   7.790   1.00 0.00 ? 23  THR A CA   2  
ATOM 2263  C C    . THR A 1 23  ? 5.060   7.640   6.839   1.00 0.00 ? 23  THR A C    2  
ATOM 2264  O O    . THR A 1 23  ? 5.161   8.789   7.270   1.00 0.00 ? 23  THR A O    2  
ATOM 2265  C CB   . THR A 1 23  ? 6.150   5.925   8.313   1.00 0.00 ? 23  THR A CB   2  
ATOM 2266  O OG1  . THR A 1 23  ? 6.775   5.122   7.304   1.00 0.00 ? 23  THR A OG1  2  
ATOM 2267  C CG2  . THR A 1 23  ? 5.944   5.097   9.571   1.00 0.00 ? 23  THR A CG2  2  
ATOM 2268  H H    . THR A 1 23  ? 4.484   4.887   6.439   1.00 0.00 ? 23  THR A H    2  
ATOM 2269  H HA   . THR A 1 23  ? 4.232   6.820   8.632   1.00 0.00 ? 23  THR A HA   2  
ATOM 2270  H HB   . THR A 1 23  ? 6.792   6.762   8.549   1.00 0.00 ? 23  THR A HB   2  
ATOM 2271  H HG1  . THR A 1 23  ? 7.701   5.367   7.229   1.00 0.00 ? 23  THR A HG1  2  
ATOM 2272  H HG21 . THR A 1 23  ? 5.464   5.702   10.327  1.00 0.00 ? 23  THR A HG21 2  
ATOM 2273  H HG22 . THR A 1 23  ? 6.900   4.756   9.938   1.00 0.00 ? 23  THR A HG22 2  
ATOM 2274  H HG23 . THR A 1 23  ? 5.322   4.244   9.343   1.00 0.00 ? 23  THR A HG23 2  
ATOM 2275  N N    . PHE A 1 24  ? 5.161   7.344   5.547   1.00 0.00 ? 24  PHE A N    2  
ATOM 2276  C CA   . PHE A 1 24  ? 5.343   8.375   4.533   1.00 0.00 ? 24  PHE A CA   2  
ATOM 2277  C C    . PHE A 1 24  ? 4.492   8.064   3.308   1.00 0.00 ? 24  PHE A C    2  
ATOM 2278  O O    . PHE A 1 24  ? 4.660   7.022   2.679   1.00 0.00 ? 24  PHE A O    2  
ATOM 2279  C CB   . PHE A 1 24  ? 6.822   8.479   4.139   1.00 0.00 ? 24  PHE A CB   2  
ATOM 2280  C CG   . PHE A 1 24  ? 7.098   9.501   3.071   1.00 0.00 ? 24  PHE A CG   2  
ATOM 2281  C CD1  . PHE A 1 24  ? 7.152   10.851  3.382   1.00 0.00 ? 24  PHE A CD1  2  
ATOM 2282  C CD2  . PHE A 1 24  ? 7.303   9.110   1.755   1.00 0.00 ? 24  PHE A CD2  2  
ATOM 2283  C CE1  . PHE A 1 24  ? 7.407   11.791  2.402   1.00 0.00 ? 24  PHE A CE1  2  
ATOM 2284  C CE2  . PHE A 1 24  ? 7.558   10.048  0.773   1.00 0.00 ? 24  PHE A CE2  2  
ATOM 2285  C CZ   . PHE A 1 24  ? 7.610   11.390  1.097   1.00 0.00 ? 24  PHE A CZ   2  
ATOM 2286  H H    . PHE A 1 24  ? 5.129   6.406   5.265   1.00 0.00 ? 24  PHE A H    2  
ATOM 2287  H HA   . PHE A 1 24  ? 5.022   9.317   4.953   1.00 0.00 ? 24  PHE A HA   2  
ATOM 2288  H HB2  . PHE A 1 24  ? 7.398   8.749   5.010   1.00 0.00 ? 24  PHE A HB2  2  
ATOM 2289  H HB3  . PHE A 1 24  ? 7.158   7.519   3.776   1.00 0.00 ? 24  PHE A HB3  2  
ATOM 2290  H HD1  . PHE A 1 24  ? 6.993   11.167  4.403   1.00 0.00 ? 24  PHE A HD1  2  
ATOM 2291  H HD2  . PHE A 1 24  ? 7.261   8.062   1.501   1.00 0.00 ? 24  PHE A HD2  2  
ATOM 2292  H HE1  . PHE A 1 24  ? 7.449   12.840  2.657   1.00 0.00 ? 24  PHE A HE1  2  
ATOM 2293  H HE2  . PHE A 1 24  ? 7.717   9.729   -0.249  1.00 0.00 ? 24  PHE A HE2  2  
ATOM 2294  H HZ   . PHE A 1 24  ? 7.810   12.124  0.331   1.00 0.00 ? 24  PHE A HZ   2  
ATOM 2295  N N    . VAL A 1 25  ? 3.582   8.968   2.974   1.00 0.00 ? 25  VAL A N    2  
ATOM 2296  C CA   . VAL A 1 25  ? 2.687   8.773   1.840   1.00 0.00 ? 25  VAL A CA   2  
ATOM 2297  C C    . VAL A 1 25  ? 2.735   9.974   0.901   1.00 0.00 ? 25  VAL A C    2  
ATOM 2298  O O    . VAL A 1 25  ? 2.727   11.120  1.352   1.00 0.00 ? 25  VAL A O    2  
ATOM 2299  C CB   . VAL A 1 25  ? 1.225   8.562   2.298   1.00 0.00 ? 25  VAL A CB   2  
ATOM 2300  C CG1  . VAL A 1 25  ? 0.296   8.431   1.098   1.00 0.00 ? 25  VAL A CG1  2  
ATOM 2301  C CG2  . VAL A 1 25  ? 1.113   7.342   3.199   1.00 0.00 ? 25  VAL A CG2  2  
ATOM 2302  H H    . VAL A 1 25  ? 3.515   9.796   3.494   1.00 0.00 ? 25  VAL A H    2  
ATOM 2303  H HA   . VAL A 1 25  ? 3.009   7.890   1.305   1.00 0.00 ? 25  VAL A HA   2  
ATOM 2304  H HB   . VAL A 1 25  ? 0.920   9.428   2.864   1.00 0.00 ? 25  VAL A HB   2  
ATOM 2305  H HG11 . VAL A 1 25  ? 0.616   7.605   0.482   1.00 0.00 ? 25  VAL A HG11 2  
ATOM 2306  H HG12 . VAL A 1 25  ? 0.324   9.346   0.519   1.00 0.00 ? 25  VAL A HG12 2  
ATOM 2307  H HG13 . VAL A 1 25  ? -0.712  8.253   1.441   1.00 0.00 ? 25  VAL A HG13 2  
ATOM 2308  H HG21 . VAL A 1 25  ? 1.441   6.465   2.660   1.00 0.00 ? 25  VAL A HG21 2  
ATOM 2309  H HG22 . VAL A 1 25  ? 0.086   7.214   3.502   1.00 0.00 ? 25  VAL A HG22 2  
ATOM 2310  H HG23 . VAL A 1 25  ? 1.732   7.483   4.073   1.00 0.00 ? 25  VAL A HG23 2  
ATOM 2311  N N    . ASP A 1 26  ? 2.797   9.708   -0.399  1.00 0.00 ? 26  ASP A N    2  
ATOM 2312  C CA   . ASP A 1 26  ? 2.771   10.760  -1.407  1.00 0.00 ? 26  ASP A CA   2  
ATOM 2313  C C    . ASP A 1 26  ? 1.332   11.078  -1.816  1.00 0.00 ? 26  ASP A C    2  
ATOM 2314  O O    . ASP A 1 26  ? 0.449   10.222  -1.757  1.00 0.00 ? 26  ASP A O    2  
ATOM 2315  C CB   . ASP A 1 26  ? 3.597   10.353  -2.633  1.00 0.00 ? 26  ASP A CB   2  
ATOM 2316  C CG   . ASP A 1 26  ? 3.693   11.464  -3.666  1.00 0.00 ? 26  ASP A CG   2  
ATOM 2317  O OD1  . ASP A 1 26  ? 3.800   12.642  -3.272  1.00 0.00 ? 26  ASP A OD1  2  
ATOM 2318  O OD2  . ASP A 1 26  ? 3.644   11.165  -4.877  1.00 0.00 ? 26  ASP A OD2  2  
ATOM 2319  H H    . ASP A 1 26  ? 2.866   8.777   -0.703  1.00 0.00 ? 26  ASP A H    2  
ATOM 2320  H HA   . ASP A 1 26  ? 3.206   11.648  -0.970  1.00 0.00 ? 26  ASP A HA   2  
ATOM 2321  H HB2  . ASP A 1 26  ? 4.595   10.095  -2.317  1.00 0.00 ? 26  ASP A HB2  2  
ATOM 2322  H HB3  . ASP A 1 26  ? 3.138   9.493   -3.098  1.00 0.00 ? 26  ASP A HB3  2  
ATOM 2323  N N    . HIS A 1 27  ? 1.123   12.330  -2.217  1.00 0.00 ? 27  HIS A N    2  
ATOM 2324  C CA   . HIS A 1 27  ? -0.204  12.904  -2.490  1.00 0.00 ? 27  HIS A CA   2  
ATOM 2325  C C    . HIS A 1 27  ? -1.029  12.106  -3.498  1.00 0.00 ? 27  HIS A C    2  
ATOM 2326  O O    . HIS A 1 27  ? -2.239  12.309  -3.596  1.00 0.00 ? 27  HIS A O    2  
ATOM 2327  C CB   . HIS A 1 27  ? -0.040  14.335  -2.996  1.00 0.00 ? 27  HIS A CB   2  
ATOM 2328  C CG   . HIS A 1 27  ? 0.572   15.274  -2.001  1.00 0.00 ? 27  HIS A CG   2  
ATOM 2329  N ND1  . HIS A 1 27  ? 1.913   15.590  -1.990  1.00 0.00 ? 27  HIS A ND1  2  
ATOM 2330  C CD2  . HIS A 1 27  ? 0.018   15.978  -0.987  1.00 0.00 ? 27  HIS A CD2  2  
ATOM 2331  C CE1  . HIS A 1 27  ? 2.153   16.443  -1.011  1.00 0.00 ? 27  HIS A CE1  2  
ATOM 2332  N NE2  . HIS A 1 27  ? 1.021   16.697  -0.388  1.00 0.00 ? 27  HIS A NE2  2  
ATOM 2333  H H    . HIS A 1 27  ? 1.912   12.901  -2.357  1.00 0.00 ? 27  HIS A H    2  
ATOM 2334  H HA   . HIS A 1 27  ? -0.753  12.928  -1.565  1.00 0.00 ? 27  HIS A HA   2  
ATOM 2335  H HB2  . HIS A 1 27  ? 0.598   14.319  -3.862  1.00 0.00 ? 27  HIS A HB2  2  
ATOM 2336  H HB3  . HIS A 1 27  ? -1.008  14.726  -3.273  1.00 0.00 ? 27  HIS A HB3  2  
ATOM 2337  H HD1  . HIS A 1 27  ? 2.591   15.240  -2.608  1.00 0.00 ? 27  HIS A HD1  2  
ATOM 2338  H HD2  . HIS A 1 27  ? -1.022  15.968  -0.697  1.00 0.00 ? 27  HIS A HD2  2  
ATOM 2339  H HE1  . HIS A 1 27  ? 3.117   16.865  -0.766  1.00 0.00 ? 27  HIS A HE1  2  
ATOM 2340  H HE2  . HIS A 1 27  ? 0.878   17.473  0.210   1.00 0.00 ? 27  HIS A HE2  2  
ATOM 2341  N N    . ARG A 1 28  ? -0.389  11.206  -4.233  1.00 0.00 ? 28  ARG A N    2  
ATOM 2342  C CA   . ARG A 1 28  ? -1.090  10.343  -5.184  1.00 0.00 ? 28  ARG A CA   2  
ATOM 2343  C C    . ARG A 1 28  ? -2.101  9.447   -4.463  1.00 0.00 ? 28  ARG A C    2  
ATOM 2344  O O    . ARG A 1 28  ? -2.952  8.819   -5.092  1.00 0.00 ? 28  ARG A O    2  
ATOM 2345  C CB   . ARG A 1 28  ? -0.079  9.494   -5.950  1.00 0.00 ? 28  ARG A CB   2  
ATOM 2346  C CG   . ARG A 1 28  ? 1.028   10.326  -6.569  1.00 0.00 ? 28  ARG A CG   2  
ATOM 2347  C CD   . ARG A 1 28  ? 2.094   9.472   -7.227  1.00 0.00 ? 28  ARG A CD   2  
ATOM 2348  N NE   . ARG A 1 28  ? 3.302   10.252  -7.481  1.00 0.00 ? 28  ARG A NE   2  
ATOM 2349  C CZ   . ARG A 1 28  ? 4.135   10.057  -8.503  1.00 0.00 ? 28  ARG A CZ   2  
ATOM 2350  N NH1  . ARG A 1 28  ? 3.931   9.068   -9.362  1.00 0.00 ? 28  ARG A NH1  2  
ATOM 2351  N NH2  . ARG A 1 28  ? 5.189   10.849  -8.647  1.00 0.00 ? 28  ARG A NH2  2  
ATOM 2352  H H    . ARG A 1 28  ? 0.582   11.121  -4.137  1.00 0.00 ? 28  ARG A H    2  
ATOM 2353  H HA   . ARG A 1 28  ? -1.618  10.976  -5.883  1.00 0.00 ? 28  ARG A HA   2  
ATOM 2354  H HB2  . ARG A 1 28  ? 0.367   8.780   -5.272  1.00 0.00 ? 28  ARG A HB2  2  
ATOM 2355  H HB3  . ARG A 1 28  ? -0.590  8.962   -6.739  1.00 0.00 ? 28  ARG A HB3  2  
ATOM 2356  H HG2  . ARG A 1 28  ? 0.598   10.978  -7.317  1.00 0.00 ? 28  ARG A HG2  2  
ATOM 2357  H HG3  . ARG A 1 28  ? 1.487   10.924  -5.795  1.00 0.00 ? 28  ARG A HG3  2  
ATOM 2358  H HD2  . ARG A 1 28  ? 2.336   8.648   -6.574  1.00 0.00 ? 28  ARG A HD2  2  
ATOM 2359  H HD3  . ARG A 1 28  ? 1.714   9.095   -8.163  1.00 0.00 ? 28  ARG A HD3  2  
ATOM 2360  H HE   . ARG A 1 28  ? 3.502   10.981  -6.839  1.00 0.00 ? 28  ARG A HE   2  
ATOM 2361  H HH11 . ARG A 1 28  ? 3.143   8.445   -9.251  1.00 0.00 ? 28  ARG A HH11 2  
ATOM 2362  H HH12 . ARG A 1 28  ? 4.558   8.939   -10.143 1.00 0.00 ? 28  ARG A HH12 2  
ATOM 2363  H HH21 . ARG A 1 28  ? 5.353   11.596  -7.993  1.00 0.00 ? 28  ARG A HH21 2  
ATOM 2364  H HH22 . ARG A 1 28  ? 5.832   10.709  -9.411  1.00 0.00 ? 28  ARG A HH22 2  
ATOM 2365  N N    . CYS A 1 29  ? -1.995  9.416   -3.136  1.00 0.00 ? 29  CYS A N    2  
ATOM 2366  C CA   . CYS A 1 29  ? -2.887  8.645   -2.278  1.00 0.00 ? 29  CYS A CA   2  
ATOM 2367  C C    . CYS A 1 29  ? -4.359  8.916   -2.593  1.00 0.00 ? 29  CYS A C    2  
ATOM 2368  O O    . CYS A 1 29  ? -5.175  7.991   -2.625  1.00 0.00 ? 29  CYS A O    2  
ATOM 2369  C CB   . CYS A 1 29  ? -2.586  8.980   -0.816  1.00 0.00 ? 29  CYS A CB   2  
ATOM 2370  S SG   . CYS A 1 29  ? -3.413  7.911   0.382   1.00 0.00 ? 29  CYS A SG   2  
ATOM 2371  H H    . CYS A 1 29  ? -1.270  9.930   -2.715  1.00 0.00 ? 29  CYS A H    2  
ATOM 2372  H HA   . CYS A 1 29  ? -2.687  7.604   -2.439  1.00 0.00 ? 29  CYS A HA   2  
ATOM 2373  H HB2  . CYS A 1 29  ? -1.523  8.896   -0.649  1.00 0.00 ? 29  CYS A HB2  2  
ATOM 2374  H HB3  . CYS A 1 29  ? -2.894  9.998   -0.620  1.00 0.00 ? 29  CYS A HB3  2  
ATOM 2375  H HG   . CYS A 1 29  ? -4.602  8.441   0.630   1.00 0.00 ? 29  CYS A HG   2  
ATOM 2376  N N    . VAL A 1 30  ? -4.693  10.174  -2.860  1.00 0.00 ? 30  VAL A N    2  
ATOM 2377  C CA   . VAL A 1 30  ? -6.083  10.560  -3.088  1.00 0.00 ? 30  VAL A CA   2  
ATOM 2378  C C    . VAL A 1 30  ? -6.629  9.956   -4.375  1.00 0.00 ? 30  VAL A C    2  
ATOM 2379  O O    . VAL A 1 30  ? -7.805  9.602   -4.457  1.00 0.00 ? 30  VAL A O    2  
ATOM 2380  C CB   . VAL A 1 30  ? -6.259  12.086  -3.140  1.00 0.00 ? 30  VAL A CB   2  
ATOM 2381  C CG1  . VAL A 1 30  ? -5.997  12.695  -1.777  1.00 0.00 ? 30  VAL A CG1  2  
ATOM 2382  C CG2  . VAL A 1 30  ? -5.351  12.707  -4.188  1.00 0.00 ? 30  VAL A CG2  2  
ATOM 2383  H H    . VAL A 1 30  ? -3.990  10.854  -2.916  1.00 0.00 ? 30  VAL A H    2  
ATOM 2384  H HA   . VAL A 1 30  ? -6.666  10.184  -2.260  1.00 0.00 ? 30  VAL A HA   2  
ATOM 2385  H HB   . VAL A 1 30  ? -7.280  12.296  -3.414  1.00 0.00 ? 30  VAL A HB   2  
ATOM 2386  H HG11 . VAL A 1 30  ? -4.986  12.467  -1.469  1.00 0.00 ? 30  VAL A HG11 2  
ATOM 2387  H HG12 . VAL A 1 30  ? -6.693  12.287  -1.058  1.00 0.00 ? 30  VAL A HG12 2  
ATOM 2388  H HG13 . VAL A 1 30  ? -6.121  13.767  -1.829  1.00 0.00 ? 30  VAL A HG13 2  
ATOM 2389  H HG21 . VAL A 1 30  ? -5.601  12.309  -5.161  1.00 0.00 ? 30  VAL A HG21 2  
ATOM 2390  H HG22 . VAL A 1 30  ? -4.323  12.473  -3.957  1.00 0.00 ? 30  VAL A HG22 2  
ATOM 2391  H HG23 . VAL A 1 30  ? -5.483  13.779  -4.191  1.00 0.00 ? 30  VAL A HG23 2  
ATOM 2392  N N    . ALA A 1 31  ? -5.771  9.831   -5.372  1.00 0.00 ? 31  ALA A N    2  
ATOM 2393  C CA   . ALA A 1 31  ? -6.190  9.287   -6.656  1.00 0.00 ? 31  ALA A CA   2  
ATOM 2394  C C    . ALA A 1 31  ? -6.492  7.800   -6.537  1.00 0.00 ? 31  ALA A C    2  
ATOM 2395  O O    . ALA A 1 31  ? -7.560  7.337   -6.945  1.00 0.00 ? 31  ALA A O    2  
ATOM 2396  C CB   . ALA A 1 31  ? -5.126  9.523   -7.714  1.00 0.00 ? 31  ALA A CB   2  
ATOM 2397  H H    . ALA A 1 31  ? -4.833  10.106  -5.237  1.00 0.00 ? 31  ALA A H    2  
ATOM 2398  H HA   . ALA A 1 31  ? -7.088  9.805   -6.959  1.00 0.00 ? 31  ALA A HA   2  
ATOM 2399  H HB1  . ALA A 1 31  ? -4.223  8.993   -7.443  1.00 0.00 ? 31  ALA A HB1  2  
ATOM 2400  H HB2  . ALA A 1 31  ? -4.914  10.581  -7.784  1.00 0.00 ? 31  ALA A HB2  2  
ATOM 2401  H HB3  . ALA A 1 31  ? -5.480  9.164   -8.670  1.00 0.00 ? 31  ALA A HB3  2  
ATOM 2402  N N    . THR A 1 32  ? -5.545  7.056   -5.985  1.00 0.00 ? 32  THR A N    2  
ATOM 2403  C CA   . THR A 1 32  ? -5.697  5.622   -5.821  1.00 0.00 ? 32  THR A CA   2  
ATOM 2404  C C    . THR A 1 32  ? -6.754  5.245   -4.779  1.00 0.00 ? 32  THR A C    2  
ATOM 2405  O O    . THR A 1 32  ? -7.679  4.490   -5.082  1.00 0.00 ? 32  THR A O    2  
ATOM 2406  C CB   . THR A 1 32  ? -4.354  4.990   -5.422  1.00 0.00 ? 32  THR A CB   2  
ATOM 2407  O OG1  . THR A 1 32  ? -3.299  5.599   -6.171  1.00 0.00 ? 32  THR A OG1  2  
ATOM 2408  C CG2  . THR A 1 32  ? -4.353  3.495   -5.691  1.00 0.00 ? 32  THR A CG2  2  
ATOM 2409  H H    . THR A 1 32  ? -4.677  7.461   -5.762  1.00 0.00 ? 32  THR A H    2  
ATOM 2410  H HA   . THR A 1 32  ? -5.986  5.209   -6.776  1.00 0.00 ? 32  THR A HA   2  
ATOM 2411  H HB   . THR A 1 32  ? -4.188  5.157   -4.366  1.00 0.00 ? 32  THR A HB   2  
ATOM 2412  H HG1  . THR A 1 32  ? -3.314  5.257   -7.075  1.00 0.00 ? 32  THR A HG1  2  
ATOM 2413  H HG21 . THR A 1 32  ? -4.472  3.320   -6.747  1.00 0.00 ? 32  THR A HG21 2  
ATOM 2414  H HG22 . THR A 1 32  ? -5.170  3.032   -5.156  1.00 0.00 ? 32  THR A HG22 2  
ATOM 2415  H HG23 . THR A 1 32  ? -3.417  3.069   -5.359  1.00 0.00 ? 32  THR A HG23 2  
ATOM 2416  N N    . VAL A 1 33  ? -6.641  5.773   -3.561  1.00 0.00 ? 33  VAL A N    2  
ATOM 2417  C CA   . VAL A 1 33  ? -7.454  5.269   -2.453  1.00 0.00 ? 33  VAL A CA   2  
ATOM 2418  C C    . VAL A 1 33  ? -8.285  6.363   -1.784  1.00 0.00 ? 33  VAL A C    2  
ATOM 2419  O O    . VAL A 1 33  ? -8.871  6.144   -0.730  1.00 0.00 ? 33  VAL A O    2  
ATOM 2420  C CB   . VAL A 1 33  ? -6.580  4.578   -1.385  1.00 0.00 ? 33  VAL A CB   2  
ATOM 2421  C CG1  . VAL A 1 33  ? -5.752  3.474   -2.014  1.00 0.00 ? 33  VAL A CG1  2  
ATOM 2422  C CG2  . VAL A 1 33  ? -5.681  5.576   -0.676  1.00 0.00 ? 33  VAL A CG2  2  
ATOM 2423  H H    . VAL A 1 33  ? -6.027  6.526   -3.402  1.00 0.00 ? 33  VAL A H    2  
ATOM 2424  H HA   . VAL A 1 33  ? -8.126  4.528   -2.856  1.00 0.00 ? 33  VAL A HA   2  
ATOM 2425  H HB   . VAL A 1 33  ? -7.235  4.131   -0.651  1.00 0.00 ? 33  VAL A HB   2  
ATOM 2426  H HG11 . VAL A 1 33  ? -5.091  3.897   -2.755  1.00 0.00 ? 33  VAL A HG11 2  
ATOM 2427  H HG12 . VAL A 1 33  ? -6.409  2.758   -2.483  1.00 0.00 ? 33  VAL A HG12 2  
ATOM 2428  H HG13 . VAL A 1 33  ? -5.169  2.983   -1.250  1.00 0.00 ? 33  VAL A HG13 2  
ATOM 2429  H HG21 . VAL A 1 33  ? -5.000  6.021   -1.388  1.00 0.00 ? 33  VAL A HG21 2  
ATOM 2430  H HG22 . VAL A 1 33  ? -5.116  5.069   0.094   1.00 0.00 ? 33  VAL A HG22 2  
ATOM 2431  H HG23 . VAL A 1 33  ? -6.287  6.351   -0.226  1.00 0.00 ? 33  VAL A HG23 2  
ATOM 2432  N N    . GLY A 1 34  ? -8.327  7.539   -2.388  1.00 0.00 ? 34  GLY A N    2  
ATOM 2433  C CA   . GLY A 1 34  ? -9.157  8.617   -1.861  1.00 0.00 ? 34  GLY A CA   2  
ATOM 2434  C C    . GLY A 1 34  ? -8.562  9.318   -0.647  1.00 0.00 ? 34  GLY A C    2  
ATOM 2435  O O    . GLY A 1 34  ? -8.800  10.508  -0.437  1.00 0.00 ? 34  GLY A O    2  
ATOM 2436  H H    . GLY A 1 34  ? -7.815  7.664   -3.215  1.00 0.00 ? 34  GLY A H    2  
ATOM 2437  H HA2  . GLY A 1 34  ? -9.314  9.347   -2.640  1.00 0.00 ? 34  GLY A HA2  2  
ATOM 2438  H HA3  . GLY A 1 34  ? -10.116 8.197   -1.578  1.00 0.00 ? 34  GLY A HA3  2  
ATOM 2439  N N    . TYR A 1 35  ? -7.793  8.582   0.145   1.00 0.00 ? 35  TYR A N    2  
ATOM 2440  C CA   . TYR A 1 35  ? -7.256  9.102   1.397   1.00 0.00 ? 35  TYR A CA   2  
ATOM 2441  C C    . TYR A 1 35  ? -6.179  10.140  1.145   1.00 0.00 ? 35  TYR A C    2  
ATOM 2442  O O    . TYR A 1 35  ? -5.437  10.066  0.166   1.00 0.00 ? 35  TYR A O    2  
ATOM 2443  C CB   . TYR A 1 35  ? -6.648  7.973   2.243   1.00 0.00 ? 35  TYR A CB   2  
ATOM 2444  C CG   . TYR A 1 35  ? -7.623  6.891   2.659   1.00 0.00 ? 35  TYR A CG   2  
ATOM 2445  C CD1  . TYR A 1 35  ? -8.924  7.206   3.019   1.00 0.00 ? 35  TYR A CD1  2  
ATOM 2446  C CD2  . TYR A 1 35  ? -7.238  5.558   2.694   1.00 0.00 ? 35  TYR A CD2  2  
ATOM 2447  C CE1  . TYR A 1 35  ? -9.816  6.229   3.402   1.00 0.00 ? 35  TYR A CE1  2  
ATOM 2448  C CE2  . TYR A 1 35  ? -8.124  4.570   3.076   1.00 0.00 ? 35  TYR A CE2  2  
ATOM 2449  C CZ   . TYR A 1 35  ? -9.415  4.913   3.429   1.00 0.00 ? 35  TYR A CZ   2  
ATOM 2450  O OH   . TYR A 1 35  ? -10.312 3.939   3.799   1.00 0.00 ? 35  TYR A OH   2  
ATOM 2451  H H    . TYR A 1 35  ? -7.580  7.666   -0.123  1.00 0.00 ? 35  TYR A H    2  
ATOM 2452  H HA   . TYR A 1 35  ? -8.062  9.559   1.949   1.00 0.00 ? 35  TYR A HA   2  
ATOM 2453  H HB2  . TYR A 1 35  ? -5.857  7.500   1.681   1.00 0.00 ? 35  TYR A HB2  2  
ATOM 2454  H HB3  . TYR A 1 35  ? -6.229  8.399   3.145   1.00 0.00 ? 35  TYR A HB3  2  
ATOM 2455  H HD1  . TYR A 1 35  ? -9.235  8.236   2.997   1.00 0.00 ? 35  TYR A HD1  2  
ATOM 2456  H HD2  . TYR A 1 35  ? -6.230  5.294   2.413   1.00 0.00 ? 35  TYR A HD2  2  
ATOM 2457  H HE1  . TYR A 1 35  ? -10.825 6.498   3.678   1.00 0.00 ? 35  TYR A HE1  2  
ATOM 2458  H HE2  . TYR A 1 35  ? -7.802  3.536   3.101   1.00 0.00 ? 35  TYR A HE2  2  
ATOM 2459  H HH   . TYR A 1 35  ? -11.076 3.974   3.213   1.00 0.00 ? 35  TYR A HH   2  
ATOM 2460  N N    . GLN A 1 36  ? -6.099  11.102  2.044   1.00 0.00 ? 36  GLN A N    2  
ATOM 2461  C CA   . GLN A 1 36  ? -4.993  12.038  2.059   1.00 0.00 ? 36  GLN A CA   2  
ATOM 2462  C C    . GLN A 1 36  ? -3.812  11.359  2.723   1.00 0.00 ? 36  GLN A C    2  
ATOM 2463  O O    . GLN A 1 36  ? -4.017  10.533  3.614   1.00 0.00 ? 36  GLN A O    2  
ATOM 2464  C CB   . GLN A 1 36  ? -5.350  13.307  2.838   1.00 0.00 ? 36  GLN A CB   2  
ATOM 2465  C CG   . GLN A 1 36  ? -6.443  14.152  2.209   1.00 0.00 ? 36  GLN A CG   2  
ATOM 2466  C CD   . GLN A 1 36  ? -5.982  14.839  0.944   1.00 0.00 ? 36  GLN A CD   2  
ATOM 2467  O OE1  . GLN A 1 36  ? -4.790  15.089  0.763   1.00 0.00 ? 36  GLN A OE1  2  
ATOM 2468  N NE2  . GLN A 1 36  ? -6.922  15.176  0.075   1.00 0.00 ? 36  GLN A NE2  2  
ATOM 2469  H H    . GLN A 1 36  ? -6.796  11.156  2.739   1.00 0.00 ? 36  GLN A H    2  
ATOM 2470  H HA   . GLN A 1 36  ? -4.733  12.293  1.035   1.00 0.00 ? 36  GLN A HA   2  
ATOM 2471  H HB2  . GLN A 1 36  ? -5.674  13.025  3.828   1.00 0.00 ? 36  GLN A HB2  2  
ATOM 2472  H HB3  . GLN A 1 36  ? -4.463  13.917  2.924   1.00 0.00 ? 36  GLN A HB3  2  
ATOM 2473  H HG2  . GLN A 1 36  ? -7.279  13.510  1.971   1.00 0.00 ? 36  GLN A HG2  2  
ATOM 2474  H HG3  . GLN A 1 36  ? -6.754  14.904  2.919   1.00 0.00 ? 36  GLN A HG3  2  
ATOM 2475  H HE21 . GLN A 1 36  ? -7.854  14.969  0.300   1.00 0.00 ? 36  GLN A HE21 2  
ATOM 2476  H HE22 . GLN A 1 36  ? -6.650  15.622  -0.753  1.00 0.00 ? 36  GLN A HE22 2  
ATOM 2477  N N    . PRO A 1 37  ? -2.576  11.663  2.306   1.00 0.00 ? 37  PRO A N    2  
ATOM 2478  C CA   . PRO A 1 37  ? -1.383  11.064  2.911   1.00 0.00 ? 37  PRO A CA   2  
ATOM 2479  C C    . PRO A 1 37  ? -1.457  11.096  4.435   1.00 0.00 ? 37  PRO A C    2  
ATOM 2480  O O    . PRO A 1 37  ? -1.234  10.088  5.104   1.00 0.00 ? 37  PRO A O    2  
ATOM 2481  C CB   . PRO A 1 37  ? -0.256  11.958  2.402   1.00 0.00 ? 37  PRO A CB   2  
ATOM 2482  C CG   . PRO A 1 37  ? -0.745  12.471  1.092   1.00 0.00 ? 37  PRO A CG   2  
ATOM 2483  C CD   . PRO A 1 37  ? -2.240  12.599  1.220   1.00 0.00 ? 37  PRO A CD   2  
ATOM 2484  H HA   . PRO A 1 37  ? -1.230  10.048  2.576   1.00 0.00 ? 37  PRO A HA   2  
ATOM 2485  H HB2  . PRO A 1 37  ? -0.083  12.760  3.104   1.00 0.00 ? 37  PRO A HB2  2  
ATOM 2486  H HB3  . PRO A 1 37  ? 0.644   11.375  2.283   1.00 0.00 ? 37  PRO A HB3  2  
ATOM 2487  H HG2  . PRO A 1 37  ? -0.303  13.437  0.893   1.00 0.00 ? 37  PRO A HG2  2  
ATOM 2488  H HG3  . PRO A 1 37  ? -0.494  11.773  0.308   1.00 0.00 ? 37  PRO A HG3  2  
ATOM 2489  H HD2  . PRO A 1 37  ? -2.513  13.609  1.489   1.00 0.00 ? 37  PRO A HD2  2  
ATOM 2490  H HD3  . PRO A 1 37  ? -2.723  12.309  0.299   1.00 0.00 ? 37  PRO A HD3  2  
ATOM 2491  N N    . GLN A 1 38  ? -1.838  12.262  4.949   1.00 0.00 ? 38  GLN A N    2  
ATOM 2492  C CA   . GLN A 1 38  ? -1.970  12.497  6.384   1.00 0.00 ? 38  GLN A CA   2  
ATOM 2493  C C    . GLN A 1 38  ? -2.900  11.475  7.033   1.00 0.00 ? 38  GLN A C    2  
ATOM 2494  O O    . GLN A 1 38  ? -2.546  10.845  8.025   1.00 0.00 ? 38  GLN A O    2  
ATOM 2495  C CB   . GLN A 1 38  ? -2.525  13.900  6.623   1.00 0.00 ? 38  GLN A CB   2  
ATOM 2496  C CG   . GLN A 1 38  ? -1.787  14.990  5.865   1.00 0.00 ? 38  GLN A CG   2  
ATOM 2497  C CD   . GLN A 1 38  ? -0.409  15.274  6.431   1.00 0.00 ? 38  GLN A CD   2  
ATOM 2498  O OE1  . GLN A 1 38  ? -0.251  16.102  7.328   1.00 0.00 ? 38  GLN A OE1  2  
ATOM 2499  N NE2  . GLN A 1 38  ? 0.600   14.609  5.896   1.00 0.00 ? 38  GLN A NE2  2  
ATOM 2500  H H    . GLN A 1 38  ? -2.043  12.990  4.330   1.00 0.00 ? 38  GLN A H    2  
ATOM 2501  H HA   . GLN A 1 38  ? -0.991  12.421  6.832   1.00 0.00 ? 38  GLN A HA   2  
ATOM 2502  H HB2  . GLN A 1 38  ? -3.562  13.921  6.319   1.00 0.00 ? 38  GLN A HB2  2  
ATOM 2503  H HB3  . GLN A 1 38  ? -2.465  14.123  7.678   1.00 0.00 ? 38  GLN A HB3  2  
ATOM 2504  H HG2  . GLN A 1 38  ? -1.675  14.674  4.839   1.00 0.00 ? 38  GLN A HG2  2  
ATOM 2505  H HG3  . GLN A 1 38  ? -2.375  15.899  5.894   1.00 0.00 ? 38  GLN A HG3  2  
ATOM 2506  H HE21 . GLN A 1 38  ? 0.412   13.975  5.175   1.00 0.00 ? 38  GLN A HE21 2  
ATOM 2507  H HE22 . GLN A 1 38  ? 1.512   14.788  6.236   1.00 0.00 ? 38  GLN A HE22 2  
ATOM 2508  N N    . GLU A 1 39  ? -4.078  11.301  6.437   1.00 0.00 ? 39  GLU A N    2  
ATOM 2509  C CA   . GLU A 1 39  ? -5.108  10.425  6.992   1.00 0.00 ? 39  GLU A CA   2  
ATOM 2510  C C    . GLU A 1 39  ? -4.620  8.984   7.057   1.00 0.00 ? 39  GLU A C    2  
ATOM 2511  O O    . GLU A 1 39  ? -5.045  8.205   7.911   1.00 0.00 ? 39  GLU A O    2  
ATOM 2512  C CB   . GLU A 1 39  ? -6.379  10.486  6.141   1.00 0.00 ? 39  GLU A CB   2  
ATOM 2513  C CG   . GLU A 1 39  ? -6.910  11.891  5.917   1.00 0.00 ? 39  GLU A CG   2  
ATOM 2514  C CD   . GLU A 1 39  ? -8.240  11.899  5.193   1.00 0.00 ? 39  GLU A CD   2  
ATOM 2515  O OE1  . GLU A 1 39  ? -8.277  11.582  3.984   1.00 0.00 ? 39  GLU A OE1  2  
ATOM 2516  O OE2  . GLU A 1 39  ? -9.265  12.214  5.836   1.00 0.00 ? 39  GLU A OE2  2  
ATOM 2517  H H    . GLU A 1 39  ? -4.254  11.764  5.594   1.00 0.00 ? 39  GLU A H    2  
ATOM 2518  H HA   . GLU A 1 39  ? -5.334  10.766  7.992   1.00 0.00 ? 39  GLU A HA   2  
ATOM 2519  H HB2  . GLU A 1 39  ? -6.171  10.049  5.176   1.00 0.00 ? 39  GLU A HB2  2  
ATOM 2520  H HB3  . GLU A 1 39  ? -7.150  9.907   6.628   1.00 0.00 ? 39  GLU A HB3  2  
ATOM 2521  H HG2  . GLU A 1 39  ? -7.038  12.371  6.875   1.00 0.00 ? 39  GLU A HG2  2  
ATOM 2522  H HG3  . GLU A 1 39  ? -6.192  12.444  5.330   1.00 0.00 ? 39  GLU A HG3  2  
ATOM 2523  N N    . LEU A 1 40  ? -3.731  8.636   6.140   1.00 0.00 ? 40  LEU A N    2  
ATOM 2524  C CA   . LEU A 1 40  ? -3.220  7.283   6.047   1.00 0.00 ? 40  LEU A CA   2  
ATOM 2525  C C    . LEU A 1 40  ? -2.063  7.079   7.026   1.00 0.00 ? 40  LEU A C    2  
ATOM 2526  O O    . LEU A 1 40  ? -1.833  5.967   7.510   1.00 0.00 ? 40  LEU A O    2  
ATOM 2527  C CB   . LEU A 1 40  ? -2.779  7.011   4.606   1.00 0.00 ? 40  LEU A CB   2  
ATOM 2528  C CG   . LEU A 1 40  ? -2.578  5.542   4.240   1.00 0.00 ? 40  LEU A CG   2  
ATOM 2529  C CD1  . LEU A 1 40  ? -3.846  4.744   4.502   1.00 0.00 ? 40  LEU A CD1  2  
ATOM 2530  C CD2  . LEU A 1 40  ? -2.168  5.420   2.779   1.00 0.00 ? 40  LEU A CD2  2  
ATOM 2531  H H    . LEU A 1 40  ? -3.411  9.307   5.498   1.00 0.00 ? 40  LEU A H    2  
ATOM 2532  H HA   . LEU A 1 40  ? -4.022  6.606   6.305   1.00 0.00 ? 40  LEU A HA   2  
ATOM 2533  H HB2  . LEU A 1 40  ? -3.523  7.427   3.944   1.00 0.00 ? 40  LEU A HB2  2  
ATOM 2534  H HB3  . LEU A 1 40  ? -1.847  7.530   4.439   1.00 0.00 ? 40  LEU A HB3  2  
ATOM 2535  H HG   . LEU A 1 40  ? -1.787  5.127   4.848   1.00 0.00 ? 40  LEU A HG   2  
ATOM 2536  H HD11 . LEU A 1 40  ? -4.117  4.833   5.544   1.00 0.00 ? 40  LEU A HD11 2  
ATOM 2537  H HD12 . LEU A 1 40  ? -3.674  3.704   4.264   1.00 0.00 ? 40  LEU A HD12 2  
ATOM 2538  H HD13 . LEU A 1 40  ? -4.648  5.126   3.888   1.00 0.00 ? 40  LEU A HD13 2  
ATOM 2539  H HD21 . LEU A 1 40  ? -2.920  5.881   2.155   1.00 0.00 ? 40  LEU A HD21 2  
ATOM 2540  H HD22 . LEU A 1 40  ? -2.072  4.376   2.517   1.00 0.00 ? 40  LEU A HD22 2  
ATOM 2541  H HD23 . LEU A 1 40  ? -1.221  5.916   2.629   1.00 0.00 ? 40  LEU A HD23 2  
ATOM 2542  N N    . LEU A 1 41  ? -1.341  8.160   7.318   1.00 0.00 ? 41  LEU A N    2  
ATOM 2543  C CA   . LEU A 1 41  ? -0.227  8.113   8.262   1.00 0.00 ? 41  LEU A CA   2  
ATOM 2544  C C    . LEU A 1 41  ? -0.710  7.729   9.654   1.00 0.00 ? 41  LEU A C    2  
ATOM 2545  O O    . LEU A 1 41  ? -1.341  8.527   10.351  1.00 0.00 ? 41  LEU A O    2  
ATOM 2546  C CB   . LEU A 1 41  ? 0.500   9.460   8.325   1.00 0.00 ? 41  LEU A CB   2  
ATOM 2547  C CG   . LEU A 1 41  ? 1.032   9.984   6.990   1.00 0.00 ? 41  LEU A CG   2  
ATOM 2548  C CD1  . LEU A 1 41  ? 1.741   11.314  7.186   1.00 0.00 ? 41  LEU A CD1  2  
ATOM 2549  C CD2  . LEU A 1 41  ? 1.964   8.970   6.352   1.00 0.00 ? 41  LEU A CD2  2  
ATOM 2550  H H    . LEU A 1 41  ? -1.551  9.007   6.861   1.00 0.00 ? 41  LEU A H    2  
ATOM 2551  H HA   . LEU A 1 41  ? 0.466   7.358   7.916   1.00 0.00 ? 41  LEU A HA   2  
ATOM 2552  H HB2  . LEU A 1 41  ? -0.181  10.194  8.729   1.00 0.00 ? 41  LEU A HB2  2  
ATOM 2553  H HB3  . LEU A 1 41  ? 1.336   9.356   9.000   1.00 0.00 ? 41  LEU A HB3  2  
ATOM 2554  H HG   . LEU A 1 41  ? 0.200   10.144  6.318   1.00 0.00 ? 41  LEU A HG   2  
ATOM 2555  H HD11 . LEU A 1 41  ? 1.056   12.028  7.620   1.00 0.00 ? 41  LEU A HD11 2  
ATOM 2556  H HD12 . LEU A 1 41  ? 2.085   11.682  6.229   1.00 0.00 ? 41  LEU A HD12 2  
ATOM 2557  H HD13 . LEU A 1 41  ? 2.586   11.179  7.844   1.00 0.00 ? 41  LEU A HD13 2  
ATOM 2558  H HD21 . LEU A 1 41  ? 1.450   8.027   6.243   1.00 0.00 ? 41  LEU A HD21 2  
ATOM 2559  H HD22 . LEU A 1 41  ? 2.832   8.836   6.981   1.00 0.00 ? 41  LEU A HD22 2  
ATOM 2560  H HD23 . LEU A 1 41  ? 2.274   9.327   5.382   1.00 0.00 ? 41  LEU A HD23 2  
ATOM 2561  N N    . GLY A 1 42  ? -0.412  6.502   10.055  1.00 0.00 ? 42  GLY A N    2  
ATOM 2562  C CA   . GLY A 1 42  ? -0.832  6.025   11.356  1.00 0.00 ? 42  GLY A CA   2  
ATOM 2563  C C    . GLY A 1 42  ? -1.768  4.841   11.256  1.00 0.00 ? 42  GLY A C    2  
ATOM 2564  O O    . GLY A 1 42  ? -2.044  4.172   12.252  1.00 0.00 ? 42  GLY A O    2  
ATOM 2565  H H    . GLY A 1 42  ? 0.100   5.917   9.458   1.00 0.00 ? 42  GLY A H    2  
ATOM 2566  H HA2  . GLY A 1 42  ? 0.043   5.734   11.919  1.00 0.00 ? 42  GLY A HA2  2  
ATOM 2567  H HA3  . GLY A 1 42  ? -1.335  6.827   11.878  1.00 0.00 ? 42  GLY A HA3  2  
ATOM 2568  N N    . LYS A 1 43  ? -2.275  4.588   10.058  1.00 0.00 ? 43  LYS A N    2  
ATOM 2569  C CA   . LYS A 1 43  ? -3.140  3.446   9.818   1.00 0.00 ? 43  LYS A CA   2  
ATOM 2570  C C    . LYS A 1 43  ? -2.347  2.305   9.197   1.00 0.00 ? 43  LYS A C    2  
ATOM 2571  O O    . LYS A 1 43  ? -1.329  2.528   8.538   1.00 0.00 ? 43  LYS A O    2  
ATOM 2572  C CB   . LYS A 1 43  ? -4.280  3.842   8.883   1.00 0.00 ? 43  LYS A CB   2  
ATOM 2573  C CG   . LYS A 1 43  ? -5.181  4.952   9.411   1.00 0.00 ? 43  LYS A CG   2  
ATOM 2574  C CD   . LYS A 1 43  ? -6.156  4.456   10.470  1.00 0.00 ? 43  LYS A CD   2  
ATOM 2575  C CE   . LYS A 1 43  ? -5.508  4.325   11.839  1.00 0.00 ? 43  LYS A CE   2  
ATOM 2576  N NZ   . LYS A 1 43  ? -5.125  5.646   12.410  1.00 0.00 ? 43  LYS A NZ   2  
ATOM 2577  H H    . LYS A 1 43  ? -2.063  5.182   9.303   1.00 0.00 ? 43  LYS A H    2  
ATOM 2578  H HA   . LYS A 1 43  ? -3.548  3.126   10.764  1.00 0.00 ? 43  LYS A HA   2  
ATOM 2579  H HB2  . LYS A 1 43  ? -3.860  4.169   7.945   1.00 0.00 ? 43  LYS A HB2  2  
ATOM 2580  H HB3  . LYS A 1 43  ? -4.894  2.971   8.701   1.00 0.00 ? 43  LYS A HB3  2  
ATOM 2581  H HG2  . LYS A 1 43  ? -4.564  5.726   9.840   1.00 0.00 ? 43  LYS A HG2  2  
ATOM 2582  H HG3  . LYS A 1 43  ? -5.741  5.358   8.585   1.00 0.00 ? 43  LYS A HG3  2  
ATOM 2583  H HD2  . LYS A 1 43  ? -6.977  5.155   10.542  1.00 0.00 ? 43  LYS A HD2  2  
ATOM 2584  H HD3  . LYS A 1 43  ? -6.535  3.490   10.169  1.00 0.00 ? 43  LYS A HD3  2  
ATOM 2585  H HE2  . LYS A 1 43  ? -6.206  3.843   12.510  1.00 0.00 ? 43  LYS A HE2  2  
ATOM 2586  H HE3  . LYS A 1 43  ? -4.624  3.714   11.745  1.00 0.00 ? 43  LYS A HE3  2  
ATOM 2587  H HZ1  . LYS A 1 43  ? -4.784  5.531   13.382  1.00 0.00 ? 43  LYS A HZ1  2  
ATOM 2588  H HZ2  . LYS A 1 43  ? -5.952  6.289   12.416  1.00 0.00 ? 43  LYS A HZ2  2  
ATOM 2589  H HZ3  . LYS A 1 43  ? -4.375  6.080   11.838  1.00 0.00 ? 43  LYS A HZ3  2  
ATOM 2590  N N    . ASN A 1 44  ? -2.802  1.085   9.429   1.00 0.00 ? 44  ASN A N    2  
ATOM 2591  C CA   . ASN A 1 44  ? -2.220  -0.079  8.782   1.00 0.00 ? 44  ASN A CA   2  
ATOM 2592  C C    . ASN A 1 44  ? -2.891  -0.296  7.436   1.00 0.00 ? 44  ASN A C    2  
ATOM 2593  O O    . ASN A 1 44  ? -4.102  -0.109  7.308   1.00 0.00 ? 44  ASN A O    2  
ATOM 2594  C CB   . ASN A 1 44  ? -2.427  -1.329  9.637   1.00 0.00 ? 44  ASN A CB   2  
ATOM 2595  C CG   . ASN A 1 44  ? -1.470  -2.444  9.270   1.00 0.00 ? 44  ASN A CG   2  
ATOM 2596  O OD1  . ASN A 1 44  ? -1.714  -3.196  8.328   1.00 0.00 ? 44  ASN A OD1  2  
ATOM 2597  N ND2  . ASN A 1 44  ? -0.389  -2.576  10.024  1.00 0.00 ? 44  ASN A ND2  2  
ATOM 2598  H H    . ASN A 1 44  ? -3.544  0.956   10.061  1.00 0.00 ? 44  ASN A H    2  
ATOM 2599  H HA   . ASN A 1 44  ? -1.165  0.094   8.640   1.00 0.00 ? 44  ASN A HA   2  
ATOM 2600  H HB2  . ASN A 1 44  ? -2.287  -1.080  10.679  1.00 0.00 ? 44  ASN A HB2  2  
ATOM 2601  H HB3  . ASN A 1 44  ? -3.438  -1.688  9.482   1.00 0.00 ? 44  ASN A HB3  2  
ATOM 2602  H HD21 . ASN A 1 44  ? -0.267  -1.956  10.774  1.00 0.00 ? 44  ASN A HD21 2  
ATOM 2603  H HD22 . ASN A 1 44  ? 0.253   -3.295  9.801   1.00 0.00 ? 44  ASN A HD22 2  
ATOM 2604  N N    . ILE A 1 45  ? -2.112  -0.695  6.438   1.00 0.00 ? 45  ILE A N    2  
ATOM 2605  C CA   . ILE A 1 45  ? -2.659  -1.005  5.124   1.00 0.00 ? 45  ILE A CA   2  
ATOM 2606  C C    . ILE A 1 45  ? -3.751  -2.070  5.234   1.00 0.00 ? 45  ILE A C    2  
ATOM 2607  O O    . ILE A 1 45  ? -4.815  -1.934  4.637   1.00 0.00 ? 45  ILE A O    2  
ATOM 2608  C CB   . ILE A 1 45  ? -1.553  -1.467  4.136   1.00 0.00 ? 45  ILE A CB   2  
ATOM 2609  C CG1  . ILE A 1 45  ? -2.158  -1.786  2.765   1.00 0.00 ? 45  ILE A CG1  2  
ATOM 2610  C CG2  . ILE A 1 45  ? -0.787  -2.669  4.681   1.00 0.00 ? 45  ILE A CG2  2  
ATOM 2611  C CD1  . ILE A 1 45  ? -1.132  -2.150  1.713   1.00 0.00 ? 45  ILE A CD1  2  
ATOM 2612  H H    . ILE A 1 45  ? -1.143  -0.769  6.587   1.00 0.00 ? 45  ILE A H    2  
ATOM 2613  H HA   . ILE A 1 45  ? -3.106  -0.100  4.728   1.00 0.00 ? 45  ILE A HA   2  
ATOM 2614  H HB   . ILE A 1 45  ? -0.850  -0.655  4.024   1.00 0.00 ? 45  ILE A HB   2  
ATOM 2615  H HG12 . ILE A 1 45  ? -2.836  -2.621  2.867   1.00 0.00 ? 45  ILE A HG12 2  
ATOM 2616  H HG13 . ILE A 1 45  ? -2.706  -0.925  2.412   1.00 0.00 ? 45  ILE A HG13 2  
ATOM 2617  H HG21 . ILE A 1 45  ? -1.476  -3.484  4.855   1.00 0.00 ? 45  ILE A HG21 2  
ATOM 2618  H HG22 . ILE A 1 45  ? -0.306  -2.400  5.608   1.00 0.00 ? 45  ILE A HG22 2  
ATOM 2619  H HG23 . ILE A 1 45  ? -0.041  -2.976  3.963   1.00 0.00 ? 45  ILE A HG23 2  
ATOM 2620  H HD11 . ILE A 1 45  ? -1.633  -2.343  0.775   1.00 0.00 ? 45  ILE A HD11 2  
ATOM 2621  H HD12 . ILE A 1 45  ? -0.594  -3.035  2.022   1.00 0.00 ? 45  ILE A HD12 2  
ATOM 2622  H HD13 . ILE A 1 45  ? -0.440  -1.331  1.588   1.00 0.00 ? 45  ILE A HD13 2  
ATOM 2623  N N    . VAL A 1 46  ? -3.503  -3.084  6.062   1.00 0.00 ? 46  VAL A N    2  
ATOM 2624  C CA   . VAL A 1 46  ? -4.402  -4.220  6.211   1.00 0.00 ? 46  VAL A CA   2  
ATOM 2625  C C    . VAL A 1 46  ? -5.767  -3.794  6.764   1.00 0.00 ? 46  VAL A C    2  
ATOM 2626  O O    . VAL A 1 46  ? -6.774  -4.447  6.505   1.00 0.00 ? 46  VAL A O    2  
ATOM 2627  C CB   . VAL A 1 46  ? -3.764  -5.291  7.129   1.00 0.00 ? 46  VAL A CB   2  
ATOM 2628  C CG1  . VAL A 1 46  ? -4.710  -6.459  7.373   1.00 0.00 ? 46  VAL A CG1  2  
ATOM 2629  C CG2  . VAL A 1 46  ? -2.459  -5.789  6.525   1.00 0.00 ? 46  VAL A CG2  2  
ATOM 2630  H H    . VAL A 1 46  ? -2.687  -3.063  6.603   1.00 0.00 ? 46  VAL A H    2  
ATOM 2631  H HA   . VAL A 1 46  ? -4.543  -4.657  5.233   1.00 0.00 ? 46  VAL A HA   2  
ATOM 2632  H HB   . VAL A 1 46  ? -3.539  -4.831  8.078   1.00 0.00 ? 46  VAL A HB   2  
ATOM 2633  H HG11 . VAL A 1 46  ? -5.603  -6.103  7.863   1.00 0.00 ? 46  VAL A HG11 2  
ATOM 2634  H HG12 . VAL A 1 46  ? -4.222  -7.191  7.999   1.00 0.00 ? 46  VAL A HG12 2  
ATOM 2635  H HG13 . VAL A 1 46  ? -4.975  -6.913  6.429   1.00 0.00 ? 46  VAL A HG13 2  
ATOM 2636  H HG21 . VAL A 1 46  ? -2.650  -6.206  5.548   1.00 0.00 ? 46  VAL A HG21 2  
ATOM 2637  H HG22 . VAL A 1 46  ? -2.035  -6.550  7.163   1.00 0.00 ? 46  VAL A HG22 2  
ATOM 2638  H HG23 . VAL A 1 46  ? -1.767  -4.965  6.436   1.00 0.00 ? 46  VAL A HG23 2  
ATOM 2639  N N    . GLU A 1 47  ? -5.809  -2.678  7.485   1.00 0.00 ? 47  GLU A N    2  
ATOM 2640  C CA   . GLU A 1 47  ? -7.069  -2.187  8.039   1.00 0.00 ? 47  GLU A CA   2  
ATOM 2641  C C    . GLU A 1 47  ? -7.988  -1.708  6.921   1.00 0.00 ? 47  GLU A C    2  
ATOM 2642  O O    . GLU A 1 47  ? -9.214  -1.770  7.025   1.00 0.00 ? 47  GLU A O    2  
ATOM 2643  C CB   . GLU A 1 47  ? -6.826  -1.057  9.034   1.00 0.00 ? 47  GLU A CB   2  
ATOM 2644  C CG   . GLU A 1 47  ? -6.095  -1.508  10.280  1.00 0.00 ? 47  GLU A CG   2  
ATOM 2645  C CD   . GLU A 1 47  ? -6.835  -2.597  11.031  1.00 0.00 ? 47  GLU A CD   2  
ATOM 2646  O OE1  . GLU A 1 47  ? -7.815  -2.278  11.733  1.00 0.00 ? 47  GLU A OE1  2  
ATOM 2647  O OE2  . GLU A 1 47  ? -6.439  -3.778  10.919  1.00 0.00 ? 47  GLU A OE2  2  
ATOM 2648  H H    . GLU A 1 47  ? -4.986  -2.169  7.638   1.00 0.00 ? 47  GLU A H    2  
ATOM 2649  H HA   . GLU A 1 47  ? -7.542  -3.008  8.555   1.00 0.00 ? 47  GLU A HA   2  
ATOM 2650  H HB2  . GLU A 1 47  ? -6.239  -0.289  8.553   1.00 0.00 ? 47  GLU A HB2  2  
ATOM 2651  H HB3  . GLU A 1 47  ? -7.778  -0.638  9.331   1.00 0.00 ? 47  GLU A HB3  2  
ATOM 2652  H HG2  . GLU A 1 47  ? -5.131  -1.890  9.990   1.00 0.00 ? 47  GLU A HG2  2  
ATOM 2653  H HG3  . GLU A 1 47  ? -5.966  -0.657  10.935  1.00 0.00 ? 47  GLU A HG3  2  
ATOM 2654  N N    . PHE A 1 48  ? -7.383  -1.238  5.843   1.00 0.00 ? 48  PHE A N    2  
ATOM 2655  C CA   . PHE A 1 48  ? -8.135  -0.806  4.680   1.00 0.00 ? 48  PHE A CA   2  
ATOM 2656  C C    . PHE A 1 48  ? -8.107  -1.882  3.613   1.00 0.00 ? 48  PHE A C    2  
ATOM 2657  O O    . PHE A 1 48  ? -8.452  -1.643  2.459   1.00 0.00 ? 48  PHE A O    2  
ATOM 2658  C CB   . PHE A 1 48  ? -7.587  0.508   4.141   1.00 0.00 ? 48  PHE A CB   2  
ATOM 2659  C CG   . PHE A 1 48  ? -7.661  1.621   5.142   1.00 0.00 ? 48  PHE A CG   2  
ATOM 2660  C CD1  . PHE A 1 48  ? -8.871  1.962   5.724   1.00 0.00 ? 48  PHE A CD1  2  
ATOM 2661  C CD2  . PHE A 1 48  ? -6.526  2.326   5.501   1.00 0.00 ? 48  PHE A CD2  2  
ATOM 2662  C CE1  . PHE A 1 48  ? -8.948  2.984   6.647   1.00 0.00 ? 48  PHE A CE1  2  
ATOM 2663  C CE2  . PHE A 1 48  ? -6.597  3.350   6.424   1.00 0.00 ? 48  PHE A CE2  2  
ATOM 2664  C CZ   . PHE A 1 48  ? -7.809  3.679   6.997   1.00 0.00 ? 48  PHE A CZ   2  
ATOM 2665  H H    . PHE A 1 48  ? -6.401  -1.188  5.827   1.00 0.00 ? 48  PHE A H    2  
ATOM 2666  H HA   . PHE A 1 48  ? -9.156  -0.655  4.987   1.00 0.00 ? 48  PHE A HA   2  
ATOM 2667  H HB2  . PHE A 1 48  ? -6.554  0.376   3.860   1.00 0.00 ? 48  PHE A HB2  2  
ATOM 2668  H HB3  . PHE A 1 48  ? -8.162  0.798   3.276   1.00 0.00 ? 48  PHE A HB3  2  
ATOM 2669  H HD1  . PHE A 1 48  ? -9.763  1.418   5.450   1.00 0.00 ? 48  PHE A HD1  2  
ATOM 2670  H HD2  . PHE A 1 48  ? -5.578  2.067   5.053   1.00 0.00 ? 48  PHE A HD2  2  
ATOM 2671  H HE1  . PHE A 1 48  ? -9.898  3.241   7.095   1.00 0.00 ? 48  PHE A HE1  2  
ATOM 2672  H HE2  . PHE A 1 48  ? -5.704  3.893   6.696   1.00 0.00 ? 48  PHE A HE2  2  
ATOM 2673  H HZ   . PHE A 1 48  ? -7.867  4.478   7.718   1.00 0.00 ? 48  PHE A HZ   2  
ATOM 2674  N N    . CYS A 1 49  ? -7.674  -3.064  4.013   1.00 0.00 ? 49  CYS A N    2  
ATOM 2675  C CA   . CYS A 1 49  ? -7.727  -4.229  3.177   1.00 0.00 ? 49  CYS A CA   2  
ATOM 2676  C C    . CYS A 1 49  ? -8.839  -5.144  3.663   1.00 0.00 ? 49  CYS A C    2  
ATOM 2677  O O    . CYS A 1 49  ? -8.841  -5.560  4.820   1.00 0.00 ? 49  CYS A O    2  
ATOM 2678  C CB   . CYS A 1 49  ? -6.384  -4.924  3.247   1.00 0.00 ? 49  CYS A CB   2  
ATOM 2679  S SG   . CYS A 1 49  ? -5.030  -3.894  2.650   1.00 0.00 ? 49  CYS A SG   2  
ATOM 2680  H H    . CYS A 1 49  ? -7.283  -3.159  4.909   1.00 0.00 ? 49  CYS A H    2  
ATOM 2681  H HA   . CYS A 1 49  ? -7.924  -3.918  2.163   1.00 0.00 ? 49  CYS A HA   2  
ATOM 2682  H HB2  . CYS A 1 49  ? -6.178  -5.188  4.274   1.00 0.00 ? 49  CYS A HB2  2  
ATOM 2683  H HB3  . CYS A 1 49  ? -6.412  -5.808  2.657   1.00 0.00 ? 49  CYS A HB3  2  
ATOM 2684  H HG   . CYS A 1 49  ? -5.101  -2.728  3.277   1.00 0.00 ? 49  CYS A HG   2  
ATOM 2685  N N    . HIS A 1 50  ? -9.800  -5.425  2.792   1.00 0.00 ? 50  HIS A N    2  
ATOM 2686  C CA   . HIS A 1 50  ? -10.987 -6.158  3.204   1.00 0.00 ? 50  HIS A CA   2  
ATOM 2687  C C    . HIS A 1 50  ? -10.627 -7.561  3.699   1.00 0.00 ? 50  HIS A C    2  
ATOM 2688  O O    . HIS A 1 50  ? -9.641  -8.156  3.259   1.00 0.00 ? 50  HIS A O    2  
ATOM 2689  C CB   . HIS A 1 50  ? -12.056 -6.178  2.097   1.00 0.00 ? 50  HIS A CB   2  
ATOM 2690  C CG   . HIS A 1 50  ? -11.853 -7.190  1.025   1.00 0.00 ? 50  HIS A CG   2  
ATOM 2691  N ND1  . HIS A 1 50  ? -12.495 -8.399  1.021   1.00 0.00 ? 50  HIS A ND1  2  
ATOM 2692  C CD2  . HIS A 1 50  ? -11.110 -7.155  -0.096  1.00 0.00 ? 50  HIS A CD2  2  
ATOM 2693  C CE1  . HIS A 1 50  ? -12.154 -9.070  -0.052  1.00 0.00 ? 50  HIS A CE1  2  
ATOM 2694  N NE2  . HIS A 1 50  ? -11.313 -8.340  -0.756  1.00 0.00 ? 50  HIS A NE2  2  
ATOM 2695  H H    . HIS A 1 50  ? -9.721  -5.097  1.872   1.00 0.00 ? 50  HIS A H    2  
ATOM 2696  H HA   . HIS A 1 50  ? -11.398 -5.619  4.049   1.00 0.00 ? 50  HIS A HA   2  
ATOM 2697  H HB2  . HIS A 1 50  ? -13.017 -6.376  2.548   1.00 0.00 ? 50  HIS A HB2  2  
ATOM 2698  H HB3  . HIS A 1 50  ? -12.086 -5.203  1.631   1.00 0.00 ? 50  HIS A HB3  2  
ATOM 2699  H HD1  . HIS A 1 50  ? -13.102 -8.739  1.725   1.00 0.00 ? 50  HIS A HD1  2  
ATOM 2700  H HD2  . HIS A 1 50  ? -10.471 -6.345  -0.416  1.00 0.00 ? 50  HIS A HD2  2  
ATOM 2701  H HE1  . HIS A 1 50  ? -12.504 -10.056 -0.304  1.00 0.00 ? 50  HIS A HE1  2  
ATOM 2702  H HE2  . HIS A 1 50  ? -10.668 -8.720  -1.406  1.00 0.00 ? 50  HIS A HE2  2  
ATOM 2703  N N    . PRO A 1 51  ? -11.474 -8.101  4.583   1.00 0.00 ? 51  PRO A N    2  
ATOM 2704  C CA   . PRO A 1 51  ? -11.139 -9.220  5.475   1.00 0.00 ? 51  PRO A CA   2  
ATOM 2705  C C    . PRO A 1 51  ? -10.435 -10.403 4.801   1.00 0.00 ? 51  PRO A C    2  
ATOM 2706  O O    . PRO A 1 51  ? -9.354  -10.810 5.232   1.00 0.00 ? 51  PRO A O    2  
ATOM 2707  C CB   . PRO A 1 51  ? -12.498 -9.671  6.013   1.00 0.00 ? 51  PRO A CB   2  
ATOM 2708  C CG   . PRO A 1 51  ? -13.421 -8.508  5.845   1.00 0.00 ? 51  PRO A CG   2  
ATOM 2709  C CD   . PRO A 1 51  ? -12.850 -7.622  4.786   1.00 0.00 ? 51  PRO A CD   2  
ATOM 2710  H HA   . PRO A 1 51  ? -10.530 -8.881  6.299   1.00 0.00 ? 51  PRO A HA   2  
ATOM 2711  H HB2  . PRO A 1 51  ? -12.840 -10.524 5.447   1.00 0.00 ? 51  PRO A HB2  2  
ATOM 2712  H HB3  . PRO A 1 51  ? -12.399 -9.944  7.052   1.00 0.00 ? 51  PRO A HB3  2  
ATOM 2713  H HG2  . PRO A 1 51  ? -14.391 -8.858  5.530   1.00 0.00 ? 51  PRO A HG2  2  
ATOM 2714  H HG3  . PRO A 1 51  ? -13.503 -7.962  6.774   1.00 0.00 ? 51  PRO A HG3  2  
ATOM 2715  H HD2  . PRO A 1 51  ? -13.421 -7.715  3.874   1.00 0.00 ? 51  PRO A HD2  2  
ATOM 2716  H HD3  . PRO A 1 51  ? -12.850 -6.596  5.121   1.00 0.00 ? 51  PRO A HD3  2  
ATOM 2717  N N    . GLU A 1 52  ? -11.021 -10.946 3.747   1.00 0.00 ? 52  GLU A N    2  
ATOM 2718  C CA   . GLU A 1 52  ? -10.525 -12.191 3.166   1.00 0.00 ? 52  GLU A CA   2  
ATOM 2719  C C    . GLU A 1 52  ? -9.292  -11.995 2.280   1.00 0.00 ? 52  GLU A C    2  
ATOM 2720  O O    . GLU A 1 52  ? -8.701  -12.973 1.826   1.00 0.00 ? 52  GLU A O    2  
ATOM 2721  C CB   . GLU A 1 52  ? -11.625 -12.938 2.408   1.00 0.00 ? 52  GLU A CB   2  
ATOM 2722  C CG   . GLU A 1 52  ? -12.480 -12.050 1.538   1.00 0.00 ? 52  GLU A CG   2  
ATOM 2723  C CD   . GLU A 1 52  ? -13.590 -11.363 2.312   1.00 0.00 ? 52  GLU A CD   2  
ATOM 2724  O OE1  . GLU A 1 52  ? -14.626 -12.005 2.574   1.00 0.00 ? 52  GLU A OE1  2  
ATOM 2725  O OE2  . GLU A 1 52  ? -13.424 -10.180 2.666   1.00 0.00 ? 52  GLU A OE2  2  
ATOM 2726  H H    . GLU A 1 52  ? -11.802 -10.504 3.338   1.00 0.00 ? 52  GLU A H    2  
ATOM 2727  H HA   . GLU A 1 52  ? -10.233 -12.808 3.987   1.00 0.00 ? 52  GLU A HA   2  
ATOM 2728  H HB2  . GLU A 1 52  ? -11.166 -13.686 1.777   1.00 0.00 ? 52  GLU A HB2  2  
ATOM 2729  H HB3  . GLU A 1 52  ? -12.268 -13.432 3.123   1.00 0.00 ? 52  GLU A HB3  2  
ATOM 2730  H HG2  . GLU A 1 52  ? -11.840 -11.294 1.116   1.00 0.00 ? 52  GLU A HG2  2  
ATOM 2731  H HG3  . GLU A 1 52  ? -12.914 -12.643 0.753   1.00 0.00 ? 52  GLU A HG3  2  
ATOM 2732  N N    . ASP A 1 53  ? -8.879  -10.749 2.056   1.00 0.00 ? 53  ASP A N    2  
ATOM 2733  C CA   . ASP A 1 53  ? -7.699  -10.487 1.227   1.00 0.00 ? 53  ASP A CA   2  
ATOM 2734  C C    . ASP A 1 53  ? -6.505  -10.161 2.112   1.00 0.00 ? 53  ASP A C    2  
ATOM 2735  O O    . ASP A 1 53  ? -5.375  -10.037 1.635   1.00 0.00 ? 53  ASP A O    2  
ATOM 2736  C CB   . ASP A 1 53  ? -7.934  -9.330  0.247   1.00 0.00 ? 53  ASP A CB   2  
ATOM 2737  C CG   . ASP A 1 53  ? -8.723  -9.727  -0.986  1.00 0.00 ? 53  ASP A CG   2  
ATOM 2738  O OD1  . ASP A 1 53  ? -9.079  -10.912 -1.130  1.00 0.00 ? 53  ASP A OD1  2  
ATOM 2739  O OD2  . ASP A 1 53  ? -9.018  -8.833  -1.811  1.00 0.00 ? 53  ASP A OD2  2  
ATOM 2740  H H    . ASP A 1 53  ? -9.322  -9.994  2.503   1.00 0.00 ? 53  ASP A H    2  
ATOM 2741  H HA   . ASP A 1 53  ? -7.481  -11.386 0.668   1.00 0.00 ? 53  ASP A HA   2  
ATOM 2742  H HB2  . ASP A 1 53  ? -8.475  -8.544  0.752   1.00 0.00 ? 53  ASP A HB2  2  
ATOM 2743  H HB3  . ASP A 1 53  ? -6.978  -8.947  -0.072  1.00 0.00 ? 53  ASP A HB3  2  
ATOM 2744  N N    . GLN A 1 54  ? -6.761  -10.045 3.412   1.00 0.00 ? 54  GLN A N    2  
ATOM 2745  C CA   . GLN A 1 54  ? -5.724  -9.677  4.368   1.00 0.00 ? 54  GLN A CA   2  
ATOM 2746  C C    . GLN A 1 54  ? -4.664  -10.765 4.460   1.00 0.00 ? 54  GLN A C    2  
ATOM 2747  O O    . GLN A 1 54  ? -3.482  -10.478 4.638   1.00 0.00 ? 54  GLN A O    2  
ATOM 2748  C CB   . GLN A 1 54  ? -6.330  -9.426  5.750   1.00 0.00 ? 54  GLN A CB   2  
ATOM 2749  C CG   . GLN A 1 54  ? -7.361  -8.311  5.770   1.00 0.00 ? 54  GLN A CG   2  
ATOM 2750  C CD   . GLN A 1 54  ? -7.880  -8.014  7.164   1.00 0.00 ? 54  GLN A CD   2  
ATOM 2751  O OE1  . GLN A 1 54  ? -7.942  -8.896  8.023   1.00 0.00 ? 54  GLN A OE1  2  
ATOM 2752  N NE2  . GLN A 1 54  ? -8.258  -6.771  7.397   1.00 0.00 ? 54  GLN A NE2  2  
ATOM 2753  H H    . GLN A 1 54  ? -7.669  -10.226 3.737   1.00 0.00 ? 54  GLN A H    2  
ATOM 2754  H HA   . GLN A 1 54  ? -5.260  -8.768  4.018   1.00 0.00 ? 54  GLN A HA   2  
ATOM 2755  H HB2  . GLN A 1 54  ? -6.807  -10.333 6.094   1.00 0.00 ? 54  GLN A HB2  2  
ATOM 2756  H HB3  . GLN A 1 54  ? -5.537  -9.165  6.436   1.00 0.00 ? 54  GLN A HB3  2  
ATOM 2757  H HG2  . GLN A 1 54  ? -6.911  -7.415  5.373   1.00 0.00 ? 54  GLN A HG2  2  
ATOM 2758  H HG3  . GLN A 1 54  ? -8.196  -8.598  5.147   1.00 0.00 ? 54  GLN A HG3  2  
ATOM 2759  H HE21 . GLN A 1 54  ? -8.188  -6.119  6.661   1.00 0.00 ? 54  GLN A HE21 2  
ATOM 2760  H HE22 . GLN A 1 54  ? -8.581  -6.540  8.296   1.00 0.00 ? 54  GLN A HE22 2  
ATOM 2761  N N    . GLN A 1 55  ? -5.093  -12.016 4.326   1.00 0.00 ? 55  GLN A N    2  
ATOM 2762  C CA   . GLN A 1 55  ? -4.184  -13.149 4.434   1.00 0.00 ? 55  GLN A CA   2  
ATOM 2763  C C    . GLN A 1 55  ? -3.186  -13.154 3.278   1.00 0.00 ? 55  GLN A C    2  
ATOM 2764  O O    . GLN A 1 55  ? -2.005  -13.440 3.473   1.00 0.00 ? 55  GLN A O    2  
ATOM 2765  C CB   . GLN A 1 55  ? -4.966  -14.457 4.456   1.00 0.00 ? 55  GLN A CB   2  
ATOM 2766  C CG   . GLN A 1 55  ? -4.161  -15.634 4.980   1.00 0.00 ? 55  GLN A CG   2  
ATOM 2767  C CD   . GLN A 1 55  ? -3.685  -15.415 6.403   1.00 0.00 ? 55  GLN A CD   2  
ATOM 2768  O OE1  . GLN A 1 55  ? -4.342  -14.734 7.197   1.00 0.00 ? 55  GLN A OE1  2  
ATOM 2769  N NE2  . GLN A 1 55  ? -2.538  -15.976 6.737   1.00 0.00 ? 55  GLN A NE2  2  
ATOM 2770  H H    . GLN A 1 55  ? -6.044  -12.179 4.155   1.00 0.00 ? 55  GLN A H    2  
ATOM 2771  H HA   . GLN A 1 55  ? -3.642  -13.050 5.361   1.00 0.00 ? 55  GLN A HA   2  
ATOM 2772  H HB2  . GLN A 1 55  ? -5.837  -14.334 5.084   1.00 0.00 ? 55  GLN A HB2  2  
ATOM 2773  H HB3  . GLN A 1 55  ? -5.287  -14.686 3.453   1.00 0.00 ? 55  GLN A HB3  2  
ATOM 2774  H HG2  . GLN A 1 55  ? -4.782  -16.520 4.955   1.00 0.00 ? 55  GLN A HG2  2  
ATOM 2775  H HG3  . GLN A 1 55  ? -3.301  -15.781 4.346   1.00 0.00 ? 55  GLN A HG3  2  
ATOM 2776  H HE21 . GLN A 1 55  ? -2.056  -16.502 6.052   1.00 0.00 ? 55  GLN A HE21 2  
ATOM 2777  H HE22 . GLN A 1 55  ? -2.211  -15.858 7.658   1.00 0.00 ? 55  GLN A HE22 2  
ATOM 2778  N N    . LEU A 1 56  ? -3.674  -12.824 2.083   1.00 0.00 ? 56  LEU A N    2  
ATOM 2779  C CA   . LEU A 1 56  ? -2.813  -12.696 0.912   1.00 0.00 ? 56  LEU A CA   2  
ATOM 2780  C C    . LEU A 1 56  ? -1.722  -11.679 1.167   1.00 0.00 ? 56  LEU A C    2  
ATOM 2781  O O    . LEU A 1 56  ? -0.540  -11.950 0.960   1.00 0.00 ? 56  LEU A O    2  
ATOM 2782  C CB   . LEU A 1 56  ? -3.624  -12.271 -0.312  1.00 0.00 ? 56  LEU A CB   2  
ATOM 2783  C CG   . LEU A 1 56  ? -4.397  -13.395 -0.993  1.00 0.00 ? 56  LEU A CG   2  
ATOM 2784  C CD1  . LEU A 1 56  ? -5.340  -12.833 -2.046  1.00 0.00 ? 56  LEU A CD1  2  
ATOM 2785  C CD2  . LEU A 1 56  ? -3.431  -14.384 -1.624  1.00 0.00 ? 56  LEU A CD2  2  
ATOM 2786  H H    . LEU A 1 56  ? -4.634  -12.660 1.988   1.00 0.00 ? 56  LEU A H    2  
ATOM 2787  H HA   . LEU A 1 56  ? -2.359  -13.656 0.721   1.00 0.00 ? 56  LEU A HA   2  
ATOM 2788  H HB2  . LEU A 1 56  ? -4.330  -11.514 -0.002  1.00 0.00 ? 56  LEU A HB2  2  
ATOM 2789  H HB3  . LEU A 1 56  ? -2.949  -11.838 -1.033  1.00 0.00 ? 56  LEU A HB3  2  
ATOM 2790  H HG   . LEU A 1 56  ? -4.981  -13.918 -0.255  1.00 0.00 ? 56  LEU A HG   2  
ATOM 2791  H HD11 . LEU A 1 56  ? -4.769  -12.309 -2.797  1.00 0.00 ? 56  LEU A HD11 2  
ATOM 2792  H HD12 . LEU A 1 56  ? -6.034  -12.149 -1.579  1.00 0.00 ? 56  LEU A HD12 2  
ATOM 2793  H HD13 . LEU A 1 56  ? -5.888  -13.642 -2.506  1.00 0.00 ? 56  LEU A HD13 2  
ATOM 2794  H HD21 . LEU A 1 56  ? -3.988  -15.172 -2.110  1.00 0.00 ? 56  LEU A HD21 2  
ATOM 2795  H HD22 . LEU A 1 56  ? -2.797  -14.808 -0.860  1.00 0.00 ? 56  LEU A HD22 2  
ATOM 2796  H HD23 . LEU A 1 56  ? -2.819  -13.872 -2.355  1.00 0.00 ? 56  LEU A HD23 2  
ATOM 2797  N N    . LEU A 1 57  ? -2.133  -10.510 1.631   1.00 0.00 ? 57  LEU A N    2  
ATOM 2798  C CA   . LEU A 1 57  ? -1.201  -9.440  1.935   1.00 0.00 ? 57  LEU A CA   2  
ATOM 2799  C C    . LEU A 1 57  ? -0.240  -9.832  3.047   1.00 0.00 ? 57  LEU A C    2  
ATOM 2800  O O    . LEU A 1 57  ? 0.940   -9.503  2.986   1.00 0.00 ? 57  LEU A O    2  
ATOM 2801  C CB   . LEU A 1 57  ? -1.954  -8.166  2.288   1.00 0.00 ? 57  LEU A CB   2  
ATOM 2802  C CG   . LEU A 1 57  ? -2.538  -7.428  1.084   1.00 0.00 ? 57  LEU A CG   2  
ATOM 2803  C CD1  . LEU A 1 57  ? -3.343  -6.239  1.545   1.00 0.00 ? 57  LEU A CD1  2  
ATOM 2804  C CD2  . LEU A 1 57  ? -1.428  -6.977  0.151   1.00 0.00 ? 57  LEU A CD2  2  
ATOM 2805  H H    . LEU A 1 57  ? -3.095  -10.363 1.767   1.00 0.00 ? 57  LEU A H    2  
ATOM 2806  H HA   . LEU A 1 57  ? -0.624  -9.255  1.045   1.00 0.00 ? 57  LEU A HA   2  
ATOM 2807  H HB2  . LEU A 1 57  ? -2.762  -8.423  2.960   1.00 0.00 ? 57  LEU A HB2  2  
ATOM 2808  H HB3  . LEU A 1 57  ? -1.277  -7.499  2.800   1.00 0.00 ? 57  LEU A HB3  2  
ATOM 2809  H HG   . LEU A 1 57  ? -3.197  -8.092  0.532   1.00 0.00 ? 57  LEU A HG   2  
ATOM 2810  H HD11 . LEU A 1 57  ? -2.705  -5.565  2.096   1.00 0.00 ? 57  LEU A HD11 2  
ATOM 2811  H HD12 . LEU A 1 57  ? -4.151  -6.574  2.179   1.00 0.00 ? 57  LEU A HD12 2  
ATOM 2812  H HD13 . LEU A 1 57  ? -3.749  -5.726  0.684   1.00 0.00 ? 57  LEU A HD13 2  
ATOM 2813  H HD21 . LEU A 1 57  ? -1.855  -6.450  -0.688  1.00 0.00 ? 57  LEU A HD21 2  
ATOM 2814  H HD22 . LEU A 1 57  ? -0.883  -7.839  -0.205  1.00 0.00 ? 57  LEU A HD22 2  
ATOM 2815  H HD23 . LEU A 1 57  ? -0.755  -6.321  0.686   1.00 0.00 ? 57  LEU A HD23 2  
ATOM 2816  N N    . ARG A 1 58  ? -0.735  -10.543 4.050   1.00 0.00 ? 58  ARG A N    2  
ATOM 2817  C CA   . ARG A 1 58  ? 0.128   -11.028 5.120   1.00 0.00 ? 58  ARG A CA   2  
ATOM 2818  C C    . ARG A 1 58  ? 1.253   -11.889 4.559   1.00 0.00 ? 58  ARG A C    2  
ATOM 2819  O O    . ARG A 1 58  ? 2.429   -11.570 4.721   1.00 0.00 ? 58  ARG A O    2  
ATOM 2820  C CB   . ARG A 1 58  ? -0.671  -11.830 6.147   1.00 0.00 ? 58  ARG A CB   2  
ATOM 2821  C CG   . ARG A 1 58  ? -1.468  -10.975 7.117   1.00 0.00 ? 58  ARG A CG   2  
ATOM 2822  C CD   . ARG A 1 58  ? -2.274  -11.843 8.066   1.00 0.00 ? 58  ARG A CD   2  
ATOM 2823  N NE   . ARG A 1 58  ? -2.877  -11.073 9.153   1.00 0.00 ? 58  ARG A NE   2  
ATOM 2824  C CZ   . ARG A 1 58  ? -3.833  -11.544 9.952   1.00 0.00 ? 58  ARG A CZ   2  
ATOM 2825  N NH1  . ARG A 1 58  ? -4.348  -12.749 9.737   1.00 0.00 ? 58  ARG A NH1  2  
ATOM 2826  N NH2  . ARG A 1 58  ? -4.277  -10.806 10.959  1.00 0.00 ? 58  ARG A NH2  2  
ATOM 2827  H H    . ARG A 1 58  ? -1.701  -10.743 4.076   1.00 0.00 ? 58  ARG A H    2  
ATOM 2828  H HA   . ARG A 1 58  ? 0.563   -10.168 5.606   1.00 0.00 ? 58  ARG A HA   2  
ATOM 2829  H HB2  . ARG A 1 58  ? -1.361  -12.475 5.624   1.00 0.00 ? 58  ARG A HB2  2  
ATOM 2830  H HB3  . ARG A 1 58  ? 0.013   -12.439 6.718   1.00 0.00 ? 58  ARG A HB3  2  
ATOM 2831  H HG2  . ARG A 1 58  ? -0.786  -10.362 7.690   1.00 0.00 ? 58  ARG A HG2  2  
ATOM 2832  H HG3  . ARG A 1 58  ? -2.142  -10.343 6.557   1.00 0.00 ? 58  ARG A HG3  2  
ATOM 2833  H HD2  . ARG A 1 58  ? -3.060  -12.331 7.507   1.00 0.00 ? 58  ARG A HD2  2  
ATOM 2834  H HD3  . ARG A 1 58  ? -1.619  -12.592 8.489   1.00 0.00 ? 58  ARG A HD3  2  
ATOM 2835  H HE   . ARG A 1 58  ? -2.525  -10.161 9.316   1.00 0.00 ? 58  ARG A HE   2  
ATOM 2836  H HH11 . ARG A 1 58  ? -4.022  -13.309 8.972   1.00 0.00 ? 58  ARG A HH11 2  
ATOM 2837  H HH12 . ARG A 1 58  ? -5.062  -13.113 10.347  1.00 0.00 ? 58  ARG A HH12 2  
ATOM 2838  H HH21 . ARG A 1 58  ? -3.894  -9.894  11.121  1.00 0.00 ? 58  ARG A HH21 2  
ATOM 2839  H HH22 . ARG A 1 58  ? -4.994  -11.159 11.574  1.00 0.00 ? 58  ARG A HH22 2  
ATOM 2840  N N    . ASP A 1 59  ? 0.881   -12.960 3.871   1.00 0.00 ? 59  ASP A N    2  
ATOM 2841  C CA   . ASP A 1 59  ? 1.849   -13.917 3.338   1.00 0.00 ? 59  ASP A CA   2  
ATOM 2842  C C    . ASP A 1 59  ? 2.797   -13.263 2.334   1.00 0.00 ? 59  ASP A C    2  
ATOM 2843  O O    . ASP A 1 59  ? 4.005   -13.482 2.379   1.00 0.00 ? 59  ASP A O    2  
ATOM 2844  C CB   . ASP A 1 59  ? 1.117   -15.089 2.680   1.00 0.00 ? 59  ASP A CB   2  
ATOM 2845  C CG   . ASP A 1 59  ? 2.047   -16.065 1.984   1.00 0.00 ? 59  ASP A CG   2  
ATOM 2846  O OD1  . ASP A 1 59  ? 2.365   -15.844 0.799   1.00 0.00 ? 59  ASP A OD1  2  
ATOM 2847  O OD2  . ASP A 1 59  ? 2.441   -17.067 2.619   1.00 0.00 ? 59  ASP A OD2  2  
ATOM 2848  H H    . ASP A 1 59  ? -0.076  -13.112 3.711   1.00 0.00 ? 59  ASP A H    2  
ATOM 2849  H HA   . ASP A 1 59  ? 2.429   -14.293 4.167   1.00 0.00 ? 59  ASP A HA   2  
ATOM 2850  H HB2  . ASP A 1 59  ? 0.577   -15.630 3.441   1.00 0.00 ? 59  ASP A HB2  2  
ATOM 2851  H HB3  . ASP A 1 59  ? 0.418   -14.705 1.953   1.00 0.00 ? 59  ASP A HB3  2  
ATOM 2852  N N    . SER A 1 60  ? 2.246   -12.435 1.457   1.00 0.00 ? 60  SER A N    2  
ATOM 2853  C CA   . SER A 1 60  ? 3.012   -11.836 0.366   1.00 0.00 ? 60  SER A CA   2  
ATOM 2854  C C    . SER A 1 60  ? 3.997   -10.799 0.884   1.00 0.00 ? 60  SER A C    2  
ATOM 2855  O O    . SER A 1 60  ? 5.138   -10.716 0.425   1.00 0.00 ? 60  SER A O    2  
ATOM 2856  C CB   . SER A 1 60  ? 2.060   -11.196 -0.630  1.00 0.00 ? 60  SER A CB   2  
ATOM 2857  O OG   . SER A 1 60  ? 1.281   -10.198 -0.013  1.00 0.00 ? 60  SER A OG   2  
ATOM 2858  H H    . SER A 1 60  ? 1.297   -12.209 1.550   1.00 0.00 ? 60  SER A H    2  
ATOM 2859  H HA   . SER A 1 60  ? 3.561   -12.623 -0.128  1.00 0.00 ? 60  SER A HA   2  
ATOM 2860  H HB2  . SER A 1 60  ? 2.616   -10.760 -1.446  1.00 0.00 ? 60  SER A HB2  2  
ATOM 2861  H HB3  . SER A 1 60  ? 1.400   -11.951 -1.003  1.00 0.00 ? 60  SER A HB3  2  
ATOM 2862  H HG   . SER A 1 60  ? 0.456   -10.592 0.282   1.00 0.00 ? 60  SER A HG   2  
ATOM 2863  N N    . PHE A 1 61  ? 3.542   -10.003 1.829   1.00 0.00 ? 61  PHE A N    2  
ATOM 2864  C CA   . PHE A 1 61  ? 4.420   -9.046  2.497   1.00 0.00 ? 61  PHE A CA   2  
ATOM 2865  C C    . PHE A 1 61  ? 5.535   -9.784  3.224   1.00 0.00 ? 61  PHE A C    2  
ATOM 2866  O O    . PHE A 1 61  ? 6.674   -9.324  3.274   1.00 0.00 ? 61  PHE A O    2  
ATOM 2867  C CB   . PHE A 1 61  ? 3.652   -8.148  3.472   1.00 0.00 ? 61  PHE A CB   2  
ATOM 2868  C CG   . PHE A 1 61  ? 2.922   -7.004  2.812   1.00 0.00 ? 61  PHE A CG   2  
ATOM 2869  C CD1  . PHE A 1 61  ? 3.424   -6.412  1.663   1.00 0.00 ? 61  PHE A CD1  2  
ATOM 2870  C CD2  . PHE A 1 61  ? 1.744   -6.511  3.354   1.00 0.00 ? 61  PHE A CD2  2  
ATOM 2871  C CE1  . PHE A 1 61  ? 2.764   -5.354  1.066   1.00 0.00 ? 61  PHE A CE1  2  
ATOM 2872  C CE2  . PHE A 1 61  ? 1.079   -5.454  2.759   1.00 0.00 ? 61  PHE A CE2  2  
ATOM 2873  C CZ   . PHE A 1 61  ? 1.590   -4.874  1.613   1.00 0.00 ? 61  PHE A CZ   2  
ATOM 2874  H H    . PHE A 1 61  ? 2.587   -10.052 2.070   1.00 0.00 ? 61  PHE A H    2  
ATOM 2875  H HA   . PHE A 1 61  ? 4.865   -8.428  1.731   1.00 0.00 ? 61  PHE A HA   2  
ATOM 2876  H HB2  . PHE A 1 61  ? 2.922   -8.746  3.996   1.00 0.00 ? 61  PHE A HB2  2  
ATOM 2877  H HB3  . PHE A 1 61  ? 4.345   -7.733  4.187   1.00 0.00 ? 61  PHE A HB3  2  
ATOM 2878  H HD1  . PHE A 1 61  ? 4.341   -6.787  1.231   1.00 0.00 ? 61  PHE A HD1  2  
ATOM 2879  H HD2  . PHE A 1 61  ? 1.342   -6.961  4.250   1.00 0.00 ? 61  PHE A HD2  2  
ATOM 2880  H HE1  . PHE A 1 61  ? 3.168   -4.901  0.173   1.00 0.00 ? 61  PHE A HE1  2  
ATOM 2881  H HE2  . PHE A 1 61  ? 0.159   -5.078  3.189   1.00 0.00 ? 61  PHE A HE2  2  
ATOM 2882  H HZ   . PHE A 1 61  ? 1.074   -4.049  1.148   1.00 0.00 ? 61  PHE A HZ   2  
ATOM 2883  N N    . GLN A 1 62  ? 5.207   -10.950 3.761   1.00 0.00 ? 62  GLN A N    2  
ATOM 2884  C CA   . GLN A 1 62  ? 6.206   -11.805 4.377   1.00 0.00 ? 62  GLN A CA   2  
ATOM 2885  C C    . GLN A 1 62  ? 7.184   -12.289 3.318   1.00 0.00 ? 62  GLN A C    2  
ATOM 2886  O O    . GLN A 1 62  ? 8.389   -12.376 3.556   1.00 0.00 ? 62  GLN A O    2  
ATOM 2887  C CB   . GLN A 1 62  ? 5.542   -13.001 5.060   1.00 0.00 ? 62  GLN A CB   2  
ATOM 2888  C CG   . GLN A 1 62  ? 4.707   -12.637 6.279   1.00 0.00 ? 62  GLN A CG   2  
ATOM 2889  C CD   . GLN A 1 62  ? 5.524   -11.997 7.387   1.00 0.00 ? 62  GLN A CD   2  
ATOM 2890  O OE1  . GLN A 1 62  ? 6.076   -12.684 8.241   1.00 0.00 ? 62  GLN A OE1  2  
ATOM 2891  N NE2  . GLN A 1 62  ? 5.592   -10.675 7.386   1.00 0.00 ? 62  GLN A NE2  2  
ATOM 2892  H H    . GLN A 1 62  ? 4.273   -11.249 3.730   1.00 0.00 ? 62  GLN A H    2  
ATOM 2893  H HA   . GLN A 1 62  ? 6.741   -11.223 5.113   1.00 0.00 ? 62  GLN A HA   2  
ATOM 2894  H HB2  . GLN A 1 62  ? 4.899   -13.492 4.345   1.00 0.00 ? 62  GLN A HB2  2  
ATOM 2895  H HB3  . GLN A 1 62  ? 6.304   -13.689 5.367   1.00 0.00 ? 62  GLN A HB3  2  
ATOM 2896  H HG2  . GLN A 1 62  ? 3.938   -11.945 5.975   1.00 0.00 ? 62  GLN A HG2  2  
ATOM 2897  H HG3  . GLN A 1 62  ? 4.245   -13.536 6.662   1.00 0.00 ? 62  GLN A HG3  2  
ATOM 2898  H HE21 . GLN A 1 62  ? 5.122   -10.185 6.679   1.00 0.00 ? 62  GLN A HE21 2  
ATOM 2899  H HE22 . GLN A 1 62  ? 6.106   -10.238 8.098   1.00 0.00 ? 62  GLN A HE22 2  
ATOM 2900  N N    . GLN A 1 63  ? 6.646   -12.583 2.137   1.00 0.00 ? 63  GLN A N    2  
ATOM 2901  C CA   . GLN A 1 63  ? 7.448   -13.043 1.014   1.00 0.00 ? 63  GLN A CA   2  
ATOM 2902  C C    . GLN A 1 63  ? 8.521   -12.029 0.648   1.00 0.00 ? 63  GLN A C    2  
ATOM 2903  O O    . GLN A 1 63  ? 9.686   -12.376 0.501   1.00 0.00 ? 63  GLN A O    2  
ATOM 2904  C CB   . GLN A 1 63  ? 6.583   -13.315 -0.212  1.00 0.00 ? 63  GLN A CB   2  
ATOM 2905  C CG   . GLN A 1 63  ? 5.546   -14.399 -0.009  1.00 0.00 ? 63  GLN A CG   2  
ATOM 2906  C CD   . GLN A 1 63  ? 6.121   -15.702 0.500   1.00 0.00 ? 63  GLN A CD   2  
ATOM 2907  O OE1  . GLN A 1 63  ? 6.579   -16.541 -0.272  1.00 0.00 ? 63  GLN A OE1  2  
ATOM 2908  N NE2  . GLN A 1 63  ? 6.055   -15.894 1.807   1.00 0.00 ? 63  GLN A NE2  2  
ATOM 2909  H H    . GLN A 1 63  ? 5.673   -12.497 2.024   1.00 0.00 ? 63  GLN A H    2  
ATOM 2910  H HA   . GLN A 1 63  ? 7.914   -13.965 1.309   1.00 0.00 ? 63  GLN A HA   2  
ATOM 2911  H HB2  . GLN A 1 63  ? 6.070   -12.405 -0.482  1.00 0.00 ? 63  GLN A HB2  2  
ATOM 2912  H HB3  . GLN A 1 63  ? 7.224   -13.609 -1.025  1.00 0.00 ? 63  GLN A HB3  2  
ATOM 2913  H HG2  . GLN A 1 63  ? 4.837   -14.045 0.718   1.00 0.00 ? 63  GLN A HG2  2  
ATOM 2914  H HG3  . GLN A 1 63  ? 5.046   -14.582 -0.945  1.00 0.00 ? 63  GLN A HG3  2  
ATOM 2915  H HE21 . GLN A 1 63  ? 5.645   -15.193 2.357   1.00 0.00 ? 63  GLN A HE21 2  
ATOM 2916  H HE22 . GLN A 1 63  ? 6.407   -16.734 2.172   1.00 0.00 ? 63  GLN A HE22 2  
ATOM 2917  N N    . VAL A 1 64  ? 8.129   -10.768 0.511   1.00 0.00 ? 64  VAL A N    2  
ATOM 2918  C CA   . VAL A 1 64  ? 9.068   -9.730  0.101   1.00 0.00 ? 64  VAL A CA   2  
ATOM 2919  C C    . VAL A 1 64  ? 10.097  -9.448  1.201   1.00 0.00 ? 64  VAL A C    2  
ATOM 2920  O O    . VAL A 1 64  ? 11.213  -9.001  0.917   1.00 0.00 ? 64  VAL A O    2  
ATOM 2921  C CB   . VAL A 1 64  ? 8.350   -8.424  -0.307  1.00 0.00 ? 64  VAL A CB   2  
ATOM 2922  C CG1  . VAL A 1 64  ? 7.688   -7.758  0.883   1.00 0.00 ? 64  VAL A CG1  2  
ATOM 2923  C CG2  . VAL A 1 64  ? 9.318   -7.471  -0.992  1.00 0.00 ? 64  VAL A CG2  2  
ATOM 2924  H H    . VAL A 1 64  ? 7.189   -10.538 0.677   1.00 0.00 ? 64  VAL A H    2  
ATOM 2925  H HA   . VAL A 1 64  ? 9.595   -10.100 -0.767  1.00 0.00 ? 64  VAL A HA   2  
ATOM 2926  H HB   . VAL A 1 64  ? 7.576   -8.679  -1.018  1.00 0.00 ? 64  VAL A HB   2  
ATOM 2927  H HG11 . VAL A 1 64  ? 8.440   -7.474  1.604   1.00 0.00 ? 64  VAL A HG11 2  
ATOM 2928  H HG12 . VAL A 1 64  ? 6.993   -8.447  1.340   1.00 0.00 ? 64  VAL A HG12 2  
ATOM 2929  H HG13 . VAL A 1 64  ? 7.156   -6.876  0.550   1.00 0.00 ? 64  VAL A HG13 2  
ATOM 2930  H HG21 . VAL A 1 64  ? 8.800   -6.560  -1.256  1.00 0.00 ? 64  VAL A HG21 2  
ATOM 2931  H HG22 . VAL A 1 64  ? 9.706   -7.935  -1.886  1.00 0.00 ? 64  VAL A HG22 2  
ATOM 2932  H HG23 . VAL A 1 64  ? 10.132  -7.241  -0.322  1.00 0.00 ? 64  VAL A HG23 2  
ATOM 2933  N N    . VAL A 1 65  ? 9.734   -9.725  2.450   1.00 0.00 ? 65  VAL A N    2  
ATOM 2934  C CA   . VAL A 1 65  ? 10.656  -9.540  3.561   1.00 0.00 ? 65  VAL A CA   2  
ATOM 2935  C C    . VAL A 1 65  ? 11.745  -10.603 3.523   1.00 0.00 ? 65  VAL A C    2  
ATOM 2936  O O    . VAL A 1 65  ? 12.917  -10.309 3.727   1.00 0.00 ? 65  VAL A O    2  
ATOM 2937  C CB   . VAL A 1 65  ? 9.932   -9.578  4.924   1.00 0.00 ? 65  VAL A CB   2  
ATOM 2938  C CG1  . VAL A 1 65  ? 10.926  -9.610  6.073   1.00 0.00 ? 65  VAL A CG1  2  
ATOM 2939  C CG2  . VAL A 1 65  ? 9.007   -8.383  5.073   1.00 0.00 ? 65  VAL A CG2  2  
ATOM 2940  H H    . VAL A 1 65  ? 8.829   -10.063 2.631   1.00 0.00 ? 65  VAL A H    2  
ATOM 2941  H HA   . VAL A 1 65  ? 11.116  -8.568  3.447   1.00 0.00 ? 65  VAL A HA   2  
ATOM 2942  H HB   . VAL A 1 65  ? 9.333   -10.476 4.967   1.00 0.00 ? 65  VAL A HB   2  
ATOM 2943  H HG11 . VAL A 1 65  ? 11.530  -8.715  6.048   1.00 0.00 ? 65  VAL A HG11 2  
ATOM 2944  H HG12 . VAL A 1 65  ? 11.562  -10.478 5.974   1.00 0.00 ? 65  VAL A HG12 2  
ATOM 2945  H HG13 . VAL A 1 65  ? 10.392  -9.659  7.011   1.00 0.00 ? 65  VAL A HG13 2  
ATOM 2946  H HG21 . VAL A 1 65  ? 8.514   -8.428  6.031   1.00 0.00 ? 65  VAL A HG21 2  
ATOM 2947  H HG22 . VAL A 1 65  ? 8.270   -8.396  4.285   1.00 0.00 ? 65  VAL A HG22 2  
ATOM 2948  H HG23 . VAL A 1 65  ? 9.586   -7.472  5.009   1.00 0.00 ? 65  VAL A HG23 2  
ATOM 2949  N N    . LYS A 1 66  ? 11.349  -11.838 3.252   1.00 0.00 ? 66  LYS A N    2  
ATOM 2950  C CA   . LYS A 1 66  ? 12.299  -12.924 3.122   1.00 0.00 ? 66  LYS A CA   2  
ATOM 2951  C C    . LYS A 1 66  ? 13.014  -12.890 1.767   1.00 0.00 ? 66  LYS A C    2  
ATOM 2952  O O    . LYS A 1 66  ? 14.073  -13.493 1.599   1.00 0.00 ? 66  LYS A O    2  
ATOM 2953  C CB   . LYS A 1 66  ? 11.597  -14.244 3.357   1.00 0.00 ? 66  LYS A CB   2  
ATOM 2954  C CG   . LYS A 1 66  ? 10.486  -14.471 2.394   1.00 0.00 ? 66  LYS A CG   2  
ATOM 2955  C CD   . LYS A 1 66  ? 9.667   -15.707 2.727   1.00 0.00 ? 66  LYS A CD   2  
ATOM 2956  C CE   . LYS A 1 66  ? 10.437  -17.000 2.502   1.00 0.00 ? 66  LYS A CE   2  
ATOM 2957  N NZ   . LYS A 1 66  ? 10.755  -17.218 1.064   1.00 0.00 ? 66  LYS A NZ   2  
ATOM 2958  H H    . LYS A 1 66  ? 10.390  -12.032 3.174   1.00 0.00 ? 66  LYS A H    2  
ATOM 2959  H HA   . LYS A 1 66  ? 13.017  -12.807 3.877   1.00 0.00 ? 66  LYS A HA   2  
ATOM 2960  H HB2  . LYS A 1 66  ? 12.306  -15.044 3.260   1.00 0.00 ? 66  LYS A HB2  2  
ATOM 2961  H HB3  . LYS A 1 66  ? 11.186  -14.242 4.353   1.00 0.00 ? 66  LYS A HB3  2  
ATOM 2962  H HG2  . LYS A 1 66  ? 9.848   -13.608 2.419   1.00 0.00 ? 66  LYS A HG2  2  
ATOM 2963  H HG3  . LYS A 1 66  ? 10.915  -14.568 1.422   1.00 0.00 ? 66  LYS A HG3  2  
ATOM 2964  H HD2  . LYS A 1 66  ? 9.379   -15.655 3.766   1.00 0.00 ? 66  LYS A HD2  2  
ATOM 2965  H HD3  . LYS A 1 66  ? 8.783   -15.714 2.108   1.00 0.00 ? 66  LYS A HD3  2  
ATOM 2966  H HE2  . LYS A 1 66  ? 11.359  -16.958 3.062   1.00 0.00 ? 66  LYS A HE2  2  
ATOM 2967  H HE3  . LYS A 1 66  ? 9.838   -17.824 2.857   1.00 0.00 ? 66  LYS A HE3  2  
ATOM 2968  H HZ1  . LYS A 1 66  ? 10.049  -16.741 0.460   1.00 0.00 ? 66  LYS A HZ1  2  
ATOM 2969  H HZ2  . LYS A 1 66  ? 10.735  -18.238 0.847   1.00 0.00 ? 66  LYS A HZ2  2  
ATOM 2970  H HZ3  . LYS A 1 66  ? 11.704  -16.846 0.838   1.00 0.00 ? 66  LYS A HZ3  2  
ATOM 2971  N N    . LEU A 1 67  ? 12.427  -12.181 0.806   1.00 0.00 ? 67  LEU A N    2  
ATOM 2972  C CA   . LEU A 1 67  ? 13.065  -11.960 -0.491  1.00 0.00 ? 67  LEU A CA   2  
ATOM 2973  C C    . LEU A 1 67  ? 14.203  -10.956 -0.373  1.00 0.00 ? 67  LEU A C    2  
ATOM 2974  O O    . LEU A 1 67  ? 15.346  -11.260 -0.719  1.00 0.00 ? 67  LEU A O    2  
ATOM 2975  C CB   . LEU A 1 67  ? 12.049  -11.467 -1.533  1.00 0.00 ? 67  LEU A CB   2  
ATOM 2976  C CG   . LEU A 1 67  ? 11.119  -12.545 -2.091  1.00 0.00 ? 67  LEU A CG   2  
ATOM 2977  C CD1  . LEU A 1 67  ? 10.151  -11.941 -3.089  1.00 0.00 ? 67  LEU A CD1  2  
ATOM 2978  C CD2  . LEU A 1 67  ? 11.923  -13.663 -2.738  1.00 0.00 ? 67  LEU A CD2  2  
ATOM 2979  H H    . LEU A 1 67  ? 11.530  -11.817 0.965   1.00 0.00 ? 67  LEU A H    2  
ATOM 2980  H HA   . LEU A 1 67  ? 13.473  -12.902 -0.822  1.00 0.00 ? 67  LEU A HA   2  
ATOM 2981  H HB2  . LEU A 1 67  ? 11.435  -10.686 -1.086  1.00 0.00 ? 67  LEU A HB2  2  
ATOM 2982  H HB3  . LEU A 1 67  ? 12.596  -11.038 -2.357  1.00 0.00 ? 67  LEU A HB3  2  
ATOM 2983  H HG   . LEU A 1 67  ? 10.543  -12.969 -1.281  1.00 0.00 ? 67  LEU A HG   2  
ATOM 2984  H HD11 . LEU A 1 67  ? 9.493   -12.710 -3.463  1.00 0.00 ? 67  LEU A HD11 2  
ATOM 2985  H HD12 . LEU A 1 67  ? 10.703  -11.506 -3.910  1.00 0.00 ? 67  LEU A HD12 2  
ATOM 2986  H HD13 . LEU A 1 67  ? 9.565   -11.172 -2.603  1.00 0.00 ? 67  LEU A HD13 2  
ATOM 2987  H HD21 . LEU A 1 67  ? 12.557  -14.128 -1.997  1.00 0.00 ? 67  LEU A HD21 2  
ATOM 2988  H HD22 . LEU A 1 67  ? 12.535  -13.255 -3.530  1.00 0.00 ? 67  LEU A HD22 2  
ATOM 2989  H HD23 . LEU A 1 67  ? 11.248  -14.401 -3.149  1.00 0.00 ? 67  LEU A HD23 2  
ATOM 2990  N N    . LYS A 1 68  ? 13.873  -9.770  0.124   1.00 0.00 ? 68  LYS A N    2  
ATOM 2991  C CA   . LYS A 1 68  ? 14.843  -8.687  0.297   1.00 0.00 ? 68  LYS A CA   2  
ATOM 2992  C C    . LYS A 1 68  ? 15.447  -8.236  -1.027  1.00 0.00 ? 68  LYS A C    2  
ATOM 2993  O O    . LYS A 1 68  ? 16.404  -8.827  -1.533  1.00 0.00 ? 68  LYS A O    2  
ATOM 2994  C CB   . LYS A 1 68  ? 15.947  -9.088  1.270   1.00 0.00 ? 68  LYS A CB   2  
ATOM 2995  C CG   . LYS A 1 68  ? 15.449  -9.220  2.689   1.00 0.00 ? 68  LYS A CG   2  
ATOM 2996  C CD   . LYS A 1 68  ? 16.536  -9.678  3.633   1.00 0.00 ? 68  LYS A CD   2  
ATOM 2997  C CE   . LYS A 1 68  ? 16.024  -9.686  5.058   1.00 0.00 ? 68  LYS A CE   2  
ATOM 2998  N NZ   . LYS A 1 68  ? 17.064  -10.116 6.031   1.00 0.00 ? 68  LYS A NZ   2  
ATOM 2999  H H    . LYS A 1 68  ? 12.938  -9.629  0.393   1.00 0.00 ? 68  LYS A H    2  
ATOM 3000  H HA   . LYS A 1 68  ? 14.308  -7.849  0.719   1.00 0.00 ? 68  LYS A HA   2  
ATOM 3001  H HB2  . LYS A 1 68  ? 16.359  -10.040 0.964   1.00 0.00 ? 68  LYS A HB2  2  
ATOM 3002  H HB3  . LYS A 1 68  ? 16.725  -8.340  1.249   1.00 0.00 ? 68  LYS A HB3  2  
ATOM 3003  H HG2  . LYS A 1 68  ? 15.087  -8.257  3.018   1.00 0.00 ? 68  LYS A HG2  2  
ATOM 3004  H HG3  . LYS A 1 68  ? 14.639  -9.936  2.710   1.00 0.00 ? 68  LYS A HG3  2  
ATOM 3005  H HD2  . LYS A 1 68  ? 16.843  -10.677 3.360   1.00 0.00 ? 68  LYS A HD2  2  
ATOM 3006  H HD3  . LYS A 1 68  ? 17.375  -9.003  3.560   1.00 0.00 ? 68  LYS A HD3  2  
ATOM 3007  H HE2  . LYS A 1 68  ? 15.698  -8.688  5.307   1.00 0.00 ? 68  LYS A HE2  2  
ATOM 3008  H HE3  . LYS A 1 68  ? 15.181  -10.361 5.116   1.00 0.00 ? 68  LYS A HE3  2  
ATOM 3009  H HZ1  . LYS A 1 68  ? 17.364  -11.096 5.836   1.00 0.00 ? 68  LYS A HZ1  2  
ATOM 3010  H HZ2  . LYS A 1 68  ? 16.683  -10.072 7.001   1.00 0.00 ? 68  LYS A HZ2  2  
ATOM 3011  H HZ3  . LYS A 1 68  ? 17.897  -9.492  5.972   1.00 0.00 ? 68  LYS A HZ3  2  
ATOM 3012  N N    . GLY A 1 69  ? 14.875  -7.180  -1.579  1.00 0.00 ? 69  GLY A N    2  
ATOM 3013  C CA   . GLY A 1 69  ? 15.400  -6.600  -2.800  1.00 0.00 ? 69  GLY A CA   2  
ATOM 3014  C C    . GLY A 1 69  ? 14.622  -7.014  -4.032  1.00 0.00 ? 69  GLY A C    2  
ATOM 3015  O O    . GLY A 1 69  ? 14.879  -6.521  -5.127  1.00 0.00 ? 69  GLY A O    2  
ATOM 3016  H H    . GLY A 1 69  ? 14.095  -6.781  -1.142  1.00 0.00 ? 69  GLY A H    2  
ATOM 3017  H HA2  . GLY A 1 69  ? 15.371  -5.523  -2.716  1.00 0.00 ? 69  GLY A HA2  2  
ATOM 3018  H HA3  . GLY A 1 69  ? 16.427  -6.912  -2.919  1.00 0.00 ? 69  GLY A HA3  2  
ATOM 3019  N N    . GLN A 1 70  ? 13.676  -7.928  -3.859  1.00 0.00 ? 70  GLN A N    2  
ATOM 3020  C CA   . GLN A 1 70  ? 12.874  -8.406  -4.972  1.00 0.00 ? 70  GLN A CA   2  
ATOM 3021  C C    . GLN A 1 70  ? 11.492  -7.775  -4.947  1.00 0.00 ? 70  GLN A C    2  
ATOM 3022  O O    . GLN A 1 70  ? 10.883  -7.643  -3.886  1.00 0.00 ? 70  GLN A O    2  
ATOM 3023  C CB   . GLN A 1 70  ? 12.753  -9.927  -4.911  1.00 0.00 ? 70  GLN A CB   2  
ATOM 3024  C CG   . GLN A 1 70  ? 14.083  -10.647 -5.044  1.00 0.00 ? 70  GLN A CG   2  
ATOM 3025  C CD   . GLN A 1 70  ? 14.701  -10.467 -6.418  1.00 0.00 ? 70  GLN A CD   2  
ATOM 3026  O OE1  . GLN A 1 70  ? 14.465  -11.266 -7.323  1.00 0.00 ? 70  GLN A OE1  2  
ATOM 3027  N NE2  . GLN A 1 70  ? 15.494  -9.418  -6.588  1.00 0.00 ? 70  GLN A NE2  2  
ATOM 3028  H H    . GLN A 1 70  ? 13.514  -8.296  -2.969  1.00 0.00 ? 70  GLN A H    2  
ATOM 3029  H HA   . GLN A 1 70  ? 13.372  -8.127  -5.887  1.00 0.00 ? 70  GLN A HA   2  
ATOM 3030  H HB2  . GLN A 1 70  ? 12.309  -10.201 -3.968  1.00 0.00 ? 70  GLN A HB2  2  
ATOM 3031  H HB3  . GLN A 1 70  ? 12.108  -10.255 -5.709  1.00 0.00 ? 70  GLN A HB3  2  
ATOM 3032  H HG2  . GLN A 1 70  ? 14.765  -10.258 -4.302  1.00 0.00 ? 70  GLN A HG2  2  
ATOM 3033  H HG3  . GLN A 1 70  ? 13.925  -11.701 -4.871  1.00 0.00 ? 70  GLN A HG3  2  
ATOM 3034  H HE21 . GLN A 1 70  ? 15.642  -8.817  -5.825  1.00 0.00 ? 70  GLN A HE21 2  
ATOM 3035  H HE22 . GLN A 1 70  ? 15.898  -9.279  -7.472  1.00 0.00 ? 70  GLN A HE22 2  
ATOM 3036  N N    . VAL A 1 71  ? 11.011  -7.382  -6.117  1.00 0.00 ? 71  VAL A N    2  
ATOM 3037  C CA   . VAL A 1 71  ? 9.686   -6.795  -6.244  1.00 0.00 ? 71  VAL A CA   2  
ATOM 3038  C C    . VAL A 1 71  ? 8.620   -7.884  -6.184  1.00 0.00 ? 71  VAL A C    2  
ATOM 3039  O O    . VAL A 1 71  ? 8.645   -8.834  -6.967  1.00 0.00 ? 71  VAL A O    2  
ATOM 3040  C CB   . VAL A 1 71  ? 9.540   -6.009  -7.565  1.00 0.00 ? 71  VAL A CB   2  
ATOM 3041  C CG1  . VAL A 1 71  ? 8.165   -5.367  -7.668  1.00 0.00 ? 71  VAL A CG1  2  
ATOM 3042  C CG2  . VAL A 1 71  ? 10.633  -4.959  -7.686  1.00 0.00 ? 71  VAL A CG2  2  
ATOM 3043  H H    . VAL A 1 71  ? 11.566  -7.479  -6.919  1.00 0.00 ? 71  VAL A H    2  
ATOM 3044  H HA   . VAL A 1 71  ? 9.540   -6.112  -5.420  1.00 0.00 ? 71  VAL A HA   2  
ATOM 3045  H HB   . VAL A 1 71  ? 9.648   -6.703  -8.385  1.00 0.00 ? 71  VAL A HB   2  
ATOM 3046  H HG11 . VAL A 1 71  ? 7.406   -6.131  -7.617  1.00 0.00 ? 71  VAL A HG11 2  
ATOM 3047  H HG12 . VAL A 1 71  ? 8.083   -4.842  -8.608  1.00 0.00 ? 71  VAL A HG12 2  
ATOM 3048  H HG13 . VAL A 1 71  ? 8.031   -4.670  -6.854  1.00 0.00 ? 71  VAL A HG13 2  
ATOM 3049  H HG21 . VAL A 1 71  ? 10.560  -4.266  -6.859  1.00 0.00 ? 71  VAL A HG21 2  
ATOM 3050  H HG22 . VAL A 1 71  ? 10.518  -4.421  -8.615  1.00 0.00 ? 71  VAL A HG22 2  
ATOM 3051  H HG23 . VAL A 1 71  ? 11.599  -5.441  -7.666  1.00 0.00 ? 71  VAL A HG23 2  
ATOM 3052  N N    . LEU A 1 72  ? 7.691   -7.742  -5.252  1.00 0.00 ? 72  LEU A N    2  
ATOM 3053  C CA   . LEU A 1 72  ? 6.640   -8.732  -5.058  1.00 0.00 ? 72  LEU A CA   2  
ATOM 3054  C C    . LEU A 1 72  ? 5.290   -8.116  -5.417  1.00 0.00 ? 72  LEU A C    2  
ATOM 3055  O O    . LEU A 1 72  ? 4.894   -7.113  -4.834  1.00 0.00 ? 72  LEU A O    2  
ATOM 3056  C CB   . LEU A 1 72  ? 6.643   -9.213  -3.597  1.00 0.00 ? 72  LEU A CB   2  
ATOM 3057  C CG   . LEU A 1 72  ? 6.111   -10.633 -3.345  1.00 0.00 ? 72  LEU A CG   2  
ATOM 3058  C CD1  . LEU A 1 72  ? 4.612   -10.726 -3.603  1.00 0.00 ? 72  LEU A CD1  2  
ATOM 3059  C CD2  . LEU A 1 72  ? 6.858   -11.638 -4.210  1.00 0.00 ? 72  LEU A CD2  2  
ATOM 3060  H H    . LEU A 1 72  ? 7.708   -6.941  -4.683  1.00 0.00 ? 72  LEU A H    2  
ATOM 3061  H HA   . LEU A 1 72  ? 6.836   -9.567  -5.712  1.00 0.00 ? 72  LEU A HA   2  
ATOM 3062  H HB2  . LEU A 1 72  ? 7.659   -9.168  -3.233  1.00 0.00 ? 72  LEU A HB2  2  
ATOM 3063  H HB3  . LEU A 1 72  ? 6.046   -8.524  -3.019  1.00 0.00 ? 72  LEU A HB3  2  
ATOM 3064  H HG   . LEU A 1 72  ? 6.285   -10.894 -2.310  1.00 0.00 ? 72  LEU A HG   2  
ATOM 3065  H HD11 . LEU A 1 72  ? 4.408   -10.486 -4.635  1.00 0.00 ? 72  LEU A HD11 2  
ATOM 3066  H HD12 . LEU A 1 72  ? 4.094   -10.028 -2.962  1.00 0.00 ? 72  LEU A HD12 2  
ATOM 3067  H HD13 . LEU A 1 72  ? 4.272   -11.729 -3.392  1.00 0.00 ? 72  LEU A HD13 2  
ATOM 3068  H HD21 . LEU A 1 72  ? 7.917   -11.577 -3.999  1.00 0.00 ? 72  LEU A HD21 2  
ATOM 3069  H HD22 . LEU A 1 72  ? 6.684   -11.417 -5.252  1.00 0.00 ? 72  LEU A HD22 2  
ATOM 3070  H HD23 . LEU A 1 72  ? 6.503   -12.635 -3.990  1.00 0.00 ? 72  LEU A HD23 2  
ATOM 3071  N N    . SER A 1 73  ? 4.593   -8.707  -6.376  1.00 0.00 ? 73  SER A N    2  
ATOM 3072  C CA   . SER A 1 73  ? 3.300   -8.188  -6.797  1.00 0.00 ? 73  SER A CA   2  
ATOM 3073  C C    . SER A 1 73  ? 2.163   -8.981  -6.163  1.00 0.00 ? 73  SER A C    2  
ATOM 3074  O O    . SER A 1 73  ? 2.064   -10.196 -6.336  1.00 0.00 ? 73  SER A O    2  
ATOM 3075  C CB   . SER A 1 73  ? 3.184   -8.236  -8.322  1.00 0.00 ? 73  SER A CB   2  
ATOM 3076  O OG   . SER A 1 73  ? 4.230   -7.502  -8.938  1.00 0.00 ? 73  SER A OG   2  
ATOM 3077  H H    . SER A 1 73  ? 4.939   -9.521  -6.799  1.00 0.00 ? 73  SER A H    2  
ATOM 3078  H HA   . SER A 1 73  ? 3.227   -7.162  -6.470  1.00 0.00 ? 73  SER A HA   2  
ATOM 3079  H HB2  . SER A 1 73  ? 3.239   -9.262  -8.653  1.00 0.00 ? 73  SER A HB2  2  
ATOM 3080  H HB3  . SER A 1 73  ? 2.238   -7.812  -8.623  1.00 0.00 ? 73  SER A HB3  2  
ATOM 3081  H HG   . SER A 1 73  ? 4.921   -7.326  -8.291  1.00 0.00 ? 73  SER A HG   2  
ATOM 3082  N N    . VAL A 1 74  ? 1.315   -8.284  -5.427  1.00 0.00 ? 74  VAL A N    2  
ATOM 3083  C CA   . VAL A 1 74  ? 0.156   -8.896  -4.800  1.00 0.00 ? 74  VAL A CA   2  
ATOM 3084  C C    . VAL A 1 74  ? -1.065  -8.043  -5.019  1.00 0.00 ? 74  VAL A C    2  
ATOM 3085  O O    . VAL A 1 74  ? -1.020  -6.819  -4.918  1.00 0.00 ? 74  VAL A O    2  
ATOM 3086  C CB   . VAL A 1 74  ? 0.389   -9.145  -3.289  1.00 0.00 ? 74  VAL A CB   2  
ATOM 3087  C CG1  . VAL A 1 74  ? 0.763   -7.852  -2.575  1.00 0.00 ? 74  VAL A CG1  2  
ATOM 3088  C CG2  . VAL A 1 74  ? -0.834  -9.786  -2.641  1.00 0.00 ? 74  VAL A CG2  2  
ATOM 3089  H H    . VAL A 1 74  ? 1.479   -7.324  -5.285  1.00 0.00 ? 74  VAL A H    2  
ATOM 3090  H HA   . VAL A 1 74  ? -0.030  -9.843  -5.281  1.00 0.00 ? 74  VAL A HA   2  
ATOM 3091  H HB   . VAL A 1 74  ? 1.216   -9.830  -3.190  1.00 0.00 ? 74  VAL A HB   2  
ATOM 3092  H HG11 . VAL A 1 74  ? 0.936   -8.058  -1.531  1.00 0.00 ? 74  VAL A HG11 2  
ATOM 3093  H HG12 . VAL A 1 74  ? -0.042  -7.139  -2.673  1.00 0.00 ? 74  VAL A HG12 2  
ATOM 3094  H HG13 . VAL A 1 74  ? 1.661   -7.447  -3.017  1.00 0.00 ? 74  VAL A HG13 2  
ATOM 3095  H HG21 . VAL A 1 74  ? -1.676  -9.114  -2.716  1.00 0.00 ? 74  VAL A HG21 2  
ATOM 3096  H HG22 . VAL A 1 74  ? -0.624  -9.990  -1.601  1.00 0.00 ? 74  VAL A HG22 2  
ATOM 3097  H HG23 . VAL A 1 74  ? -1.064  -10.710 -3.149  1.00 0.00 ? 74  VAL A HG23 2  
ATOM 3098  N N    . MET A 1 75  ? -2.149  -8.702  -5.345  1.00 0.00 ? 75  MET A N    2  
ATOM 3099  C CA   . MET A 1 75  ? -3.346  -8.015  -5.741  1.00 0.00 ? 75  MET A CA   2  
ATOM 3100  C C    . MET A 1 75  ? -4.451  -8.215  -4.708  1.00 0.00 ? 75  MET A C    2  
ATOM 3101  O O    . MET A 1 75  ? -4.696  -9.330  -4.253  1.00 0.00 ? 75  MET A O    2  
ATOM 3102  C CB   . MET A 1 75  ? -3.782  -8.509  -7.112  1.00 0.00 ? 75  MET A CB   2  
ATOM 3103  C CG   . MET A 1 75  ? -4.675  -7.524  -7.821  1.00 0.00 ? 75  MET A CG   2  
ATOM 3104  S SD   . MET A 1 75  ? -5.346  -8.164  -9.367  1.00 0.00 ? 75  MET A SD   2  
ATOM 3105  C CE   . MET A 1 75  ? -6.347  -6.777  -9.899  1.00 0.00 ? 75  MET A CE   2  
ATOM 3106  H H    . MET A 1 75  ? -2.145  -9.685  -5.301  1.00 0.00 ? 75  MET A H    2  
ATOM 3107  H HA   . MET A 1 75  ? -3.117  -6.964  -5.807  1.00 0.00 ? 75  MET A HA   2  
ATOM 3108  H HB2  . MET A 1 75  ? -2.906  -8.677  -7.722  1.00 0.00 ? 75  MET A HB2  2  
ATOM 3109  H HB3  . MET A 1 75  ? -4.320  -9.439  -7.000  1.00 0.00 ? 75  MET A HB3  2  
ATOM 3110  H HG2  . MET A 1 75  ? -5.477  -7.279  -7.161  1.00 0.00 ? 75  MET A HG2  2  
ATOM 3111  H HG3  . MET A 1 75  ? -4.101  -6.633  -8.033  1.00 0.00 ? 75  MET A HG3  2  
ATOM 3112  H HE1  . MET A 1 75  ? -7.099  -6.567  -9.153  1.00 0.00 ? 75  MET A HE1  2  
ATOM 3113  H HE2  . MET A 1 75  ? -6.828  -7.020  -10.835 1.00 0.00 ? 75  MET A HE2  2  
ATOM 3114  H HE3  . MET A 1 75  ? -5.720  -5.909  -10.033 1.00 0.00 ? 75  MET A HE3  2  
ATOM 3115  N N    . PHE A 1 76  ? -5.115  -7.126  -4.359  1.00 0.00 ? 76  PHE A N    2  
ATOM 3116  C CA   . PHE A 1 76  ? -6.123  -7.127  -3.303  1.00 0.00 ? 76  PHE A CA   2  
ATOM 3117  C C    . PHE A 1 76  ? -7.098  -5.975  -3.529  1.00 0.00 ? 76  PHE A C    2  
ATOM 3118  O O    . PHE A 1 76  ? -6.955  -5.219  -4.496  1.00 0.00 ? 76  PHE A O    2  
ATOM 3119  C CB   . PHE A 1 76  ? -5.458  -6.987  -1.932  1.00 0.00 ? 76  PHE A CB   2  
ATOM 3120  C CG   . PHE A 1 76  ? -4.781  -5.662  -1.721  1.00 0.00 ? 76  PHE A CG   2  
ATOM 3121  C CD1  . PHE A 1 76  ? -3.546  -5.400  -2.288  1.00 0.00 ? 76  PHE A CD1  2  
ATOM 3122  C CD2  . PHE A 1 76  ? -5.384  -4.678  -0.956  1.00 0.00 ? 76  PHE A CD2  2  
ATOM 3123  C CE1  . PHE A 1 76  ? -2.928  -4.184  -2.096  1.00 0.00 ? 76  PHE A CE1  2  
ATOM 3124  C CE2  . PHE A 1 76  ? -4.767  -3.460  -0.760  1.00 0.00 ? 76  PHE A CE2  2  
ATOM 3125  C CZ   . PHE A 1 76  ? -3.539  -3.211  -1.330  1.00 0.00 ? 76  PHE A CZ   2  
ATOM 3126  H H    . PHE A 1 76  ? -4.930  -6.291  -4.842  1.00 0.00 ? 76  PHE A H    2  
ATOM 3127  H HA   . PHE A 1 76  ? -6.655  -8.064  -3.344  1.00 0.00 ? 76  PHE A HA   2  
ATOM 3128  H HB2  . PHE A 1 76  ? -6.207  -7.104  -1.164  1.00 0.00 ? 76  PHE A HB2  2  
ATOM 3129  H HB3  . PHE A 1 76  ? -4.715  -7.763  -1.823  1.00 0.00 ? 76  PHE A HB3  2  
ATOM 3130  H HD1  . PHE A 1 76  ? -3.068  -6.160  -2.890  1.00 0.00 ? 76  PHE A HD1  2  
ATOM 3131  H HD2  . PHE A 1 76  ? -6.347  -4.872  -0.507  1.00 0.00 ? 76  PHE A HD2  2  
ATOM 3132  H HE1  . PHE A 1 76  ? -1.964  -3.991  -2.542  1.00 0.00 ? 76  PHE A HE1  2  
ATOM 3133  H HE2  . PHE A 1 76  ? -5.249  -2.701  -0.161  1.00 0.00 ? 76  PHE A HE2  2  
ATOM 3134  H HZ   . PHE A 1 76  ? -3.054  -2.256  -1.179  1.00 0.00 ? 76  PHE A HZ   2  
ATOM 3135  N N    . ARG A 1 77  ? -8.086  -5.836  -2.654  1.00 0.00 ? 77  ARG A N    2  
ATOM 3136  C CA   . ARG A 1 77  ? -9.038  -4.739  -2.759  1.00 0.00 ? 77  ARG A CA   2  
ATOM 3137  C C    . ARG A 1 77  ? -8.868  -3.774  -1.583  1.00 0.00 ? 77  ARG A C    2  
ATOM 3138  O O    . ARG A 1 77  ? -8.977  -4.174  -0.420  1.00 0.00 ? 77  ARG A O    2  
ATOM 3139  C CB   . ARG A 1 77  ? -10.470 -5.269  -2.804  1.00 0.00 ? 77  ARG A CB   2  
ATOM 3140  C CG   . ARG A 1 77  ? -10.670 -6.397  -3.801  1.00 0.00 ? 77  ARG A CG   2  
ATOM 3141  C CD   . ARG A 1 77  ? -12.089 -6.933  -3.757  1.00 0.00 ? 77  ARG A CD   2  
ATOM 3142  N NE   . ARG A 1 77  ? -12.115 -8.392  -3.845  1.00 0.00 ? 77  ARG A NE   2  
ATOM 3143  C CZ   . ARG A 1 77  ? -13.194 -9.113  -4.146  1.00 0.00 ? 77  ARG A CZ   2  
ATOM 3144  N NH1  . ARG A 1 77  ? -14.335 -8.522  -4.481  1.00 0.00 ? 77  ARG A NH1  2  
ATOM 3145  N NH2  . ARG A 1 77  ? -13.116 -10.436 -4.127  1.00 0.00 ? 77  ARG A NH2  2  
ATOM 3146  H H    . ARG A 1 77  ? -8.167  -6.470  -1.910  1.00 0.00 ? 77  ARG A H    2  
ATOM 3147  H HA   . ARG A 1 77  ? -8.829  -4.206  -3.676  1.00 0.00 ? 77  ARG A HA   2  
ATOM 3148  H HB2  . ARG A 1 77  ? -10.736 -5.635  -1.824  1.00 0.00 ? 77  ARG A HB2  2  
ATOM 3149  H HB3  . ARG A 1 77  ? -11.135 -4.461  -3.070  1.00 0.00 ? 77  ARG A HB3  2  
ATOM 3150  H HG2  . ARG A 1 77  ? -10.465 -6.028  -4.796  1.00 0.00 ? 77  ARG A HG2  2  
ATOM 3151  H HG3  . ARG A 1 77  ? -9.984  -7.202  -3.564  1.00 0.00 ? 77  ARG A HG3  2  
ATOM 3152  H HD2  . ARG A 1 77  ? -12.547 -6.629  -2.828  1.00 0.00 ? 77  ARG A HD2  2  
ATOM 3153  H HD3  . ARG A 1 77  ? -12.645 -6.521  -4.586  1.00 0.00 ? 77  ARG A HD3  2  
ATOM 3154  H HE   . ARG A 1 77  ? -11.273 -8.869  -3.642  1.00 0.00 ? 77  ARG A HE   2  
ATOM 3155  H HH11 . ARG A 1 77  ? -14.399 -7.520  -4.513  1.00 0.00 ? 77  ARG A HH11 2  
ATOM 3156  H HH12 . ARG A 1 77  ? -15.143 -9.080  -4.712  1.00 0.00 ? 77  ARG A HH12 2  
ATOM 3157  H HH21 . ARG A 1 77  ? -12.245 -10.887 -3.886  1.00 0.00 ? 77  ARG A HH21 2  
ATOM 3158  H HH22 . ARG A 1 77  ? -13.919 -10.997 -4.356  1.00 0.00 ? 77  ARG A HH22 2  
ATOM 3159  N N    . PHE A 1 78  ? -8.615  -2.515  -1.905  1.00 0.00 ? 78  PHE A N    2  
ATOM 3160  C CA   . PHE A 1 78  ? -8.332  -1.479  -0.913  1.00 0.00 ? 78  PHE A CA   2  
ATOM 3161  C C    . PHE A 1 78  ? -9.583  -0.639  -0.670  1.00 0.00 ? 78  PHE A C    2  
ATOM 3162  O O    . PHE A 1 78  ? -10.425 -0.507  -1.558  1.00 0.00 ? 78  PHE A O    2  
ATOM 3163  C CB   . PHE A 1 78  ? -7.205  -0.585  -1.442  1.00 0.00 ? 78  PHE A CB   2  
ATOM 3164  C CG   . PHE A 1 78  ? -6.409  0.159   -0.401  1.00 0.00 ? 78  PHE A CG   2  
ATOM 3165  C CD1  . PHE A 1 78  ? -6.903  1.303   0.205   1.00 0.00 ? 78  PHE A CD1  2  
ATOM 3166  C CD2  . PHE A 1 78  ? -5.138  -0.275  -0.060  1.00 0.00 ? 78  PHE A CD2  2  
ATOM 3167  C CE1  . PHE A 1 78  ? -6.145  1.993   1.136   1.00 0.00 ? 78  PHE A CE1  2  
ATOM 3168  C CE2  . PHE A 1 78  ? -4.375  0.414   0.860   1.00 0.00 ? 78  PHE A CE2  2  
ATOM 3169  C CZ   . PHE A 1 78  ? -4.877  1.547   1.460   1.00 0.00 ? 78  PHE A CZ   2  
ATOM 3170  H H    . PHE A 1 78  ? -8.633  -2.258  -2.854  1.00 0.00 ? 78  PHE A H    2  
ATOM 3171  H HA   . PHE A 1 78  ? -8.022  -1.950  0.008   1.00 0.00 ? 78  PHE A HA   2  
ATOM 3172  H HB2  . PHE A 1 78  ? -6.512  -1.198  -1.999  1.00 0.00 ? 78  PHE A HB2  2  
ATOM 3173  H HB3  . PHE A 1 78  ? -7.634  0.147   -2.111  1.00 0.00 ? 78  PHE A HB3  2  
ATOM 3174  H HD1  . PHE A 1 78  ? -7.895  1.655   -0.049  1.00 0.00 ? 78  PHE A HD1  2  
ATOM 3175  H HD2  . PHE A 1 78  ? -4.740  -1.165  -0.526  1.00 0.00 ? 78  PHE A HD2  2  
ATOM 3176  H HE1  . PHE A 1 78  ? -6.542  2.880   1.604   1.00 0.00 ? 78  PHE A HE1  2  
ATOM 3177  H HE2  . PHE A 1 78  ? -3.386  0.062   1.113   1.00 0.00 ? 78  PHE A HE2  2  
ATOM 3178  H HZ   . PHE A 1 78  ? -4.274  2.090   2.174   1.00 0.00 ? 78  PHE A HZ   2  
ATOM 3179  N N    . ARG A 1 79  ? -9.707  -0.087  0.528   1.00 0.00 ? 79  ARG A N    2  
ATOM 3180  C CA   . ARG A 1 79  ? -10.843 0.760   0.863   1.00 0.00 ? 79  ARG A CA   2  
ATOM 3181  C C    . ARG A 1 79  ? -10.540 2.221   0.540   1.00 0.00 ? 79  ARG A C    2  
ATOM 3182  O O    . ARG A 1 79  ? -9.641  2.816   1.123   1.00 0.00 ? 79  ARG A O    2  
ATOM 3183  C CB   . ARG A 1 79  ? -11.181 0.634   2.348   1.00 0.00 ? 79  ARG A CB   2  
ATOM 3184  C CG   . ARG A 1 79  ? -12.644 0.904   2.660   1.00 0.00 ? 79  ARG A CG   2  
ATOM 3185  C CD   . ARG A 1 79  ? -12.871 1.138   4.143   1.00 0.00 ? 79  ARG A CD   2  
ATOM 3186  N NE   . ARG A 1 79  ? -12.170 0.164   4.984   1.00 0.00 ? 79  ARG A NE   2  
ATOM 3187  C CZ   . ARG A 1 79  ? -12.655 -0.323  6.130   1.00 0.00 ? 79  ARG A CZ   2  
ATOM 3188  N NH1  . ARG A 1 79  ? -13.867 0.022   6.548   1.00 0.00 ? 79  ARG A NH1  2  
ATOM 3189  N NH2  . ARG A 1 79  ? -11.931 -1.161  6.861   1.00 0.00 ? 79  ARG A NH2  2  
ATOM 3190  H H    . ARG A 1 79  ? -9.025  -0.270  1.210   1.00 0.00 ? 79  ARG A H    2  
ATOM 3191  H HA   . ARG A 1 79  ? -11.689 0.436   0.276   1.00 0.00 ? 79  ARG A HA   2  
ATOM 3192  H HB2  . ARG A 1 79  ? -10.944 -0.367  2.676   1.00 0.00 ? 79  ARG A HB2  2  
ATOM 3193  H HB3  . ARG A 1 79  ? -10.582 1.338   2.905   1.00 0.00 ? 79  ARG A HB3  2  
ATOM 3194  H HG2  . ARG A 1 79  ? -12.963 1.779   2.113   1.00 0.00 ? 79  ARG A HG2  2  
ATOM 3195  H HG3  . ARG A 1 79  ? -13.228 0.050   2.348   1.00 0.00 ? 79  ARG A HG3  2  
ATOM 3196  H HD2  . ARG A 1 79  ? -12.521 2.124   4.390   1.00 0.00 ? 79  ARG A HD2  2  
ATOM 3197  H HD3  . ARG A 1 79  ? -13.930 1.074   4.346   1.00 0.00 ? 79  ARG A HD3  2  
ATOM 3198  H HE   . ARG A 1 79  ? -11.280 -0.126  4.685   1.00 0.00 ? 79  ARG A HE   2  
ATOM 3199  H HH11 . ARG A 1 79  ? -14.430 0.652   6.010   1.00 0.00 ? 79  ARG A HH11 2  
ATOM 3200  H HH12 . ARG A 1 79  ? -14.229 -0.358  7.408   1.00 0.00 ? 79  ARG A HH12 2  
ATOM 3201  H HH21 . ARG A 1 79  ? -11.008 -1.437  6.567   1.00 0.00 ? 79  ARG A HH21 2  
ATOM 3202  H HH22 . ARG A 1 79  ? -12.306 -1.530  7.719   1.00 0.00 ? 79  ARG A HH22 2  
ATOM 3203  N N    . SER A 1 80  ? -11.280 2.782   -0.403  1.00 0.00 ? 80  SER A N    2  
ATOM 3204  C CA   . SER A 1 80  ? -11.133 4.183   -0.760  1.00 0.00 ? 80  SER A CA   2  
ATOM 3205  C C    . SER A 1 80  ? -11.741 5.093   0.317   1.00 0.00 ? 80  SER A C    2  
ATOM 3206  O O    . SER A 1 80  ? -12.298 4.616   1.312   1.00 0.00 ? 80  SER A O    2  
ATOM 3207  C CB   . SER A 1 80  ? -11.794 4.435   -2.115  1.00 0.00 ? 80  SER A CB   2  
ATOM 3208  O OG   . SER A 1 80  ? -11.598 5.767   -2.560  1.00 0.00 ? 80  SER A OG   2  
ATOM 3209  H H    . SER A 1 80  ? -11.909 2.220   -0.906  1.00 0.00 ? 80  SER A H    2  
ATOM 3210  H HA   . SER A 1 80  ? -10.078 4.397   -0.839  1.00 0.00 ? 80  SER A HA   2  
ATOM 3211  H HB2  . SER A 1 80  ? -11.374 3.761   -2.848  1.00 0.00 ? 80  SER A HB2  2  
ATOM 3212  H HB3  . SER A 1 80  ? -12.855 4.249   -2.028  1.00 0.00 ? 80  SER A HB3  2  
ATOM 3213  H HG   . SER A 1 80  ? -11.585 5.784   -3.523  1.00 0.00 ? 80  SER A HG   2  
ATOM 3214  N N    . LYS A 1 81  ? -11.652 6.404   0.099   1.00 0.00 ? 81  LYS A N    2  
ATOM 3215  C CA   . LYS A 1 81  ? -12.189 7.396   1.030   1.00 0.00 ? 81  LYS A CA   2  
ATOM 3216  C C    . LYS A 1 81  ? -13.713 7.340   1.042   1.00 0.00 ? 81  LYS A C    2  
ATOM 3217  O O    . LYS A 1 81  ? -14.369 7.929   1.902   1.00 0.00 ? 81  LYS A O    2  
ATOM 3218  C CB   . LYS A 1 81  ? -11.724 8.802   0.623   1.00 0.00 ? 81  LYS A CB   2  
ATOM 3219  C CG   . LYS A 1 81  ? -12.029 9.887   1.648   1.00 0.00 ? 81  LYS A CG   2  
ATOM 3220  C CD   . LYS A 1 81  ? -11.306 9.628   2.960   1.00 0.00 ? 81  LYS A CD   2  
ATOM 3221  C CE   . LYS A 1 81  ? -11.604 10.694  4.000   1.00 0.00 ? 81  LYS A CE   2  
ATOM 3222  N NZ   . LYS A 1 81  ? -10.991 12.004  3.652   1.00 0.00 ? 81  LYS A NZ   2  
ATOM 3223  H H    . LYS A 1 81  ? -11.210 6.721   -0.721  1.00 0.00 ? 81  LYS A H    2  
ATOM 3224  H HA   . LYS A 1 81  ? -11.816 7.170   2.018   1.00 0.00 ? 81  LYS A HA   2  
ATOM 3225  H HB2  . LYS A 1 81  ? -10.657 8.781   0.458   1.00 0.00 ? 81  LYS A HB2  2  
ATOM 3226  H HB3  . LYS A 1 81  ? -12.211 9.069   -0.304  1.00 0.00 ? 81  LYS A HB3  2  
ATOM 3227  H HG2  . LYS A 1 81  ? -11.712 10.841  1.254   1.00 0.00 ? 81  LYS A HG2  2  
ATOM 3228  H HG3  . LYS A 1 81  ? -13.094 9.908   1.832   1.00 0.00 ? 81  LYS A HG3  2  
ATOM 3229  H HD2  . LYS A 1 81  ? -11.614 8.668   3.344   1.00 0.00 ? 81  LYS A HD2  2  
ATOM 3230  H HD3  . LYS A 1 81  ? -10.246 9.616   2.769   1.00 0.00 ? 81  LYS A HD3  2  
ATOM 3231  H HE2  . LYS A 1 81  ? -12.673 10.816  4.077   1.00 0.00 ? 81  LYS A HE2  2  
ATOM 3232  H HE3  . LYS A 1 81  ? -11.210 10.366  4.951   1.00 0.00 ? 81  LYS A HE3  2  
ATOM 3233  H HZ1  . LYS A 1 81  ? -11.255 12.720  4.362   1.00 0.00 ? 81  LYS A HZ1  2  
ATOM 3234  H HZ2  . LYS A 1 81  ? -11.319 12.325  2.715   1.00 0.00 ? 81  LYS A HZ2  2  
ATOM 3235  H HZ3  . LYS A 1 81  ? -9.948  11.918  3.636   1.00 0.00 ? 81  LYS A HZ3  2  
ATOM 3236  N N    . ASN A 1 82  ? -14.265 6.607   0.091   1.00 0.00 ? 82  ASN A N    2  
ATOM 3237  C CA   . ASN A 1 82  ? -15.707 6.496   -0.062  1.00 0.00 ? 82  ASN A CA   2  
ATOM 3238  C C    . ASN A 1 82  ? -16.190 5.204   0.571   1.00 0.00 ? 82  ASN A C    2  
ATOM 3239  O O    . ASN A 1 82  ? -17.353 4.830   0.434   1.00 0.00 ? 82  ASN A O    2  
ATOM 3240  C CB   . ASN A 1 82  ? -16.077 6.502   -1.542  1.00 0.00 ? 82  ASN A CB   2  
ATOM 3241  C CG   . ASN A 1 82  ? -15.411 7.627   -2.303  1.00 0.00 ? 82  ASN A CG   2  
ATOM 3242  O OD1  . ASN A 1 82  ? -15.234 8.729   -1.787  1.00 0.00 ? 82  ASN A OD1  2  
ATOM 3243  N ND2  . ASN A 1 82  ? -15.003 7.339   -3.525  1.00 0.00 ? 82  ASN A ND2  2  
ATOM 3244  H H    . ASN A 1 82  ? -13.687 6.106   -0.520  1.00 0.00 ? 82  ASN A H    2  
ATOM 3245  H HA   . ASN A 1 82  ? -16.172 7.337   0.432   1.00 0.00 ? 82  ASN A HA   2  
ATOM 3246  H HB2  . ASN A 1 82  ? -15.775 5.566   -1.984  1.00 0.00 ? 82  ASN A HB2  2  
ATOM 3247  H HB3  . ASN A 1 82  ? -17.148 6.612   -1.637  1.00 0.00 ? 82  ASN A HB3  2  
ATOM 3248  H HD21 . ASN A 1 82  ? -15.156 6.418   -3.862  1.00 0.00 ? 82  ASN A HD21 2  
ATOM 3249  H HD22 . ASN A 1 82  ? -14.568 8.044   -4.051  1.00 0.00 ? 82  ASN A HD22 2  
ATOM 3250  N N    . GLN A 1 83  ? -15.265 4.519   1.244   1.00 0.00 ? 83  GLN A N    2  
ATOM 3251  C CA   . GLN A 1 83  ? -15.537 3.233   1.883   1.00 0.00 ? 83  GLN A CA   2  
ATOM 3252  C C    . GLN A 1 83  ? -15.881 2.171   0.839   1.00 0.00 ? 83  GLN A C    2  
ATOM 3253  O O    . GLN A 1 83  ? -16.512 1.159   1.141   1.00 0.00 ? 83  GLN A O    2  
ATOM 3254  C CB   . GLN A 1 83  ? -16.650 3.347   2.932   1.00 0.00 ? 83  GLN A CB   2  
ATOM 3255  C CG   . GLN A 1 83  ? -16.225 4.059   4.214   1.00 0.00 ? 83  GLN A CG   2  
ATOM 3256  C CD   . GLN A 1 83  ? -15.815 5.507   3.997   1.00 0.00 ? 83  GLN A CD   2  
ATOM 3257  O OE1  . GLN A 1 83  ? -16.651 6.409   4.005   1.00 0.00 ? 83  GLN A OE1  2  
ATOM 3258  N NE2  . GLN A 1 83  ? -14.519 5.744   3.847   1.00 0.00 ? 83  GLN A NE2  2  
ATOM 3259  H H    . GLN A 1 83  ? -14.363 4.897   1.318   1.00 0.00 ? 83  GLN A H    2  
ATOM 3260  H HA   . GLN A 1 83  ? -14.629 2.929   2.385   1.00 0.00 ? 83  GLN A HA   2  
ATOM 3261  H HB2  . GLN A 1 83  ? -17.477 3.893   2.500   1.00 0.00 ? 83  GLN A HB2  2  
ATOM 3262  H HB3  . GLN A 1 83  ? -16.983 2.354   3.193   1.00 0.00 ? 83  GLN A HB3  2  
ATOM 3263  H HG2  . GLN A 1 83  ? -17.046 4.037   4.909   1.00 0.00 ? 83  GLN A HG2  2  
ATOM 3264  H HG3  . GLN A 1 83  ? -15.384 3.526   4.637   1.00 0.00 ? 83  GLN A HG3  2  
ATOM 3265  H HE21 . GLN A 1 83  ? -13.899 4.982   3.896   1.00 0.00 ? 83  GLN A HE21 2  
ATOM 3266  H HE22 . GLN A 1 83  ? -14.233 6.669   3.680   1.00 0.00 ? 83  GLN A HE22 2  
ATOM 3267  N N    . GLU A 1 84  ? -15.457 2.419   -0.393  1.00 0.00 ? 84  GLU A N    2  
ATOM 3268  C CA   . GLU A 1 84  ? -15.609 1.464   -1.473  1.00 0.00 ? 84  GLU A CA   2  
ATOM 3269  C C    . GLU A 1 84  ? -14.360 0.597   -1.561  1.00 0.00 ? 84  GLU A C    2  
ATOM 3270  O O    . GLU A 1 84  ? -13.295 0.996   -1.090  1.00 0.00 ? 84  GLU A O    2  
ATOM 3271  C CB   . GLU A 1 84  ? -15.837 2.204   -2.788  1.00 0.00 ? 84  GLU A CB   2  
ATOM 3272  C CG   . GLU A 1 84  ? -14.763 3.234   -3.091  1.00 0.00 ? 84  GLU A CG   2  
ATOM 3273  C CD   . GLU A 1 84  ? -14.999 3.978   -4.386  1.00 0.00 ? 84  GLU A CD   2  
ATOM 3274  O OE1  . GLU A 1 84  ? -15.827 4.914   -4.395  1.00 0.00 ? 84  GLU A OE1  2  
ATOM 3275  O OE2  . GLU A 1 84  ? -14.344 3.646   -5.392  1.00 0.00 ? 84  GLU A OE2  2  
ATOM 3276  H H    . GLU A 1 84  ? -15.033 3.276   -0.586  1.00 0.00 ? 84  GLU A H    2  
ATOM 3277  H HA   . GLU A 1 84  ? -16.458 0.841   -1.256  1.00 0.00 ? 84  GLU A HA   2  
ATOM 3278  H HB2  . GLU A 1 84  ? -15.854 1.487   -3.590  1.00 0.00 ? 84  GLU A HB2  2  
ATOM 3279  H HB3  . GLU A 1 84  ? -16.789 2.710   -2.746  1.00 0.00 ? 84  GLU A HB3  2  
ATOM 3280  H HG2  . GLU A 1 84  ? -14.735 3.951   -2.284  1.00 0.00 ? 84  GLU A HG2  2  
ATOM 3281  H HG3  . GLU A 1 84  ? -13.812 2.730   -3.153  1.00 0.00 ? 84  GLU A HG3  2  
ATOM 3282  N N    . TRP A 1 85  ? -14.483 -0.577  -2.157  1.00 0.00 ? 85  TRP A N    2  
ATOM 3283  C CA   . TRP A 1 85  ? -13.372 -1.503  -2.236  1.00 0.00 ? 85  TRP A CA   2  
ATOM 3284  C C    . TRP A 1 85  ? -12.948 -1.702  -3.687  1.00 0.00 ? 85  TRP A C    2  
ATOM 3285  O O    . TRP A 1 85  ? -13.647 -2.350  -4.465  1.00 0.00 ? 85  TRP A O    2  
ATOM 3286  C CB   . TRP A 1 85  ? -13.769 -2.839  -1.615  1.00 0.00 ? 85  TRP A CB   2  
ATOM 3287  C CG   . TRP A 1 85  ? -14.108 -2.758  -0.153  1.00 0.00 ? 85  TRP A CG   2  
ATOM 3288  C CD1  . TRP A 1 85  ? -15.352 -2.646  0.400   1.00 0.00 ? 85  TRP A CD1  2  
ATOM 3289  C CD2  . TRP A 1 85  ? -13.187 -2.785  0.940   1.00 0.00 ? 85  TRP A CD2  2  
ATOM 3290  N NE1  . TRP A 1 85  ? -15.257 -2.615  1.772   1.00 0.00 ? 85  TRP A NE1  2  
ATOM 3291  C CE2  . TRP A 1 85  ? -13.941 -2.705  2.130   1.00 0.00 ? 85  TRP A CE2  2  
ATOM 3292  C CE3  . TRP A 1 85  ? -11.801 -2.876  1.031   1.00 0.00 ? 85  TRP A CE3  2  
ATOM 3293  C CZ2  . TRP A 1 85  ? -13.347 -2.718  3.391   1.00 0.00 ? 85  TRP A CZ2  2  
ATOM 3294  C CZ3  . TRP A 1 85  ? -11.216 -2.882  2.279   1.00 0.00 ? 85  TRP A CZ3  2  
ATOM 3295  C CH2  . TRP A 1 85  ? -11.986 -2.809  3.445   1.00 0.00 ? 85  TRP A CH2  2  
ATOM 3296  H H    . TRP A 1 85  ? -15.331 -0.833  -2.571  1.00 0.00 ? 85  TRP A H    2  
ATOM 3297  H HA   . TRP A 1 85  ? -12.548 -1.084  -1.680  1.00 0.00 ? 85  TRP A HA   2  
ATOM 3298  H HB2  . TRP A 1 85  ? -14.634 -3.225  -2.135  1.00 0.00 ? 85  TRP A HB2  2  
ATOM 3299  H HB3  . TRP A 1 85  ? -12.955 -3.531  -1.731  1.00 0.00 ? 85  TRP A HB3  2  
ATOM 3300  H HD1  . TRP A 1 85  ? -16.268 -2.593  -0.169  1.00 0.00 ? 85  TRP A HD1  2  
ATOM 3301  H HE1  . TRP A 1 85  ? -16.015 -2.537  2.397   1.00 0.00 ? 85  TRP A HE1  2  
ATOM 3302  H HE3  . TRP A 1 85  ? -11.185 -2.932  0.145   1.00 0.00 ? 85  TRP A HE3  2  
ATOM 3303  H HZ2  . TRP A 1 85  ? -13.928 -2.680  4.304   1.00 0.00 ? 85  TRP A HZ2  2  
ATOM 3304  H HZ3  . TRP A 1 85  ? -10.141 -2.952  2.366   1.00 0.00 ? 85  TRP A HZ3  2  
ATOM 3305  H HH2  . TRP A 1 85  ? -11.481 -2.817  4.401   1.00 0.00 ? 85  TRP A HH2  2  
ATOM 3306  N N    . LEU A 1 86  ? -11.807 -1.139  -4.048  1.00 0.00 ? 86  LEU A N    2  
ATOM 3307  C CA   . LEU A 1 86  ? -11.315 -1.222  -5.418  1.00 0.00 ? 86  LEU A CA   2  
ATOM 3308  C C    . LEU A 1 86  ? -10.094 -2.134  -5.530  1.00 0.00 ? 86  LEU A C    2  
ATOM 3309  O O    . LEU A 1 86  ? -9.359  -2.329  -4.565  1.00 0.00 ? 86  LEU A O    2  
ATOM 3310  C CB   . LEU A 1 86  ? -10.999 0.183   -5.951  1.00 0.00 ? 86  LEU A CB   2  
ATOM 3311  C CG   . LEU A 1 86  ? -10.712 1.250   -4.887  1.00 0.00 ? 86  LEU A CG   2  
ATOM 3312  C CD1  . LEU A 1 86  ? -9.331  1.063   -4.282  1.00 0.00 ? 86  LEU A CD1  2  
ATOM 3313  C CD2  . LEU A 1 86  ? -10.857 2.642   -5.479  1.00 0.00 ? 86  LEU A CD2  2  
ATOM 3314  H H    . LEU A 1 86  ? -11.287 -0.642  -3.379  1.00 0.00 ? 86  LEU A H    2  
ATOM 3315  H HA   . LEU A 1 86  ? -12.106 -1.642  -6.018  1.00 0.00 ? 86  LEU A HA   2  
ATOM 3316  H HB2  . LEU A 1 86  ? -10.136 0.112   -6.596  1.00 0.00 ? 86  LEU A HB2  2  
ATOM 3317  H HB3  . LEU A 1 86  ? -11.838 0.513   -6.544  1.00 0.00 ? 86  LEU A HB3  2  
ATOM 3318  H HG   . LEU A 1 86  ? -11.437 1.153   -4.092  1.00 0.00 ? 86  LEU A HG   2  
ATOM 3319  H HD11 . LEU A 1 86  ? -9.163  1.818   -3.529  1.00 0.00 ? 86  LEU A HD11 2  
ATOM 3320  H HD12 . LEU A 1 86  ? -8.583  1.155   -5.057  1.00 0.00 ? 86  LEU A HD12 2  
ATOM 3321  H HD13 . LEU A 1 86  ? -9.265  0.083   -3.833  1.00 0.00 ? 86  LEU A HD13 2  
ATOM 3322  H HD21 . LEU A 1 86  ? -10.155 2.764   -6.290  1.00 0.00 ? 86  LEU A HD21 2  
ATOM 3323  H HD22 . LEU A 1 86  ? -10.656 3.378   -4.716  1.00 0.00 ? 86  LEU A HD22 2  
ATOM 3324  H HD23 . LEU A 1 86  ? -11.863 2.771   -5.848  1.00 0.00 ? 86  LEU A HD23 2  
ATOM 3325  N N    . TRP A 1 87  ? -9.884  -2.674  -6.726  1.00 0.00 ? 87  TRP A N    2  
ATOM 3326  C CA   . TRP A 1 87  ? -8.807  -3.629  -6.973  1.00 0.00 ? 87  TRP A CA   2  
ATOM 3327  C C    . TRP A 1 87  ? -7.500  -2.911  -7.259  1.00 0.00 ? 87  TRP A C    2  
ATOM 3328  O O    . TRP A 1 87  ? -7.434  -2.047  -8.134  1.00 0.00 ? 87  TRP A O    2  
ATOM 3329  C CB   . TRP A 1 87  ? -9.131  -4.526  -8.172  1.00 0.00 ? 87  TRP A CB   2  
ATOM 3330  C CG   . TRP A 1 87  ? -10.091 -5.641  -7.892  1.00 0.00 ? 87  TRP A CG   2  
ATOM 3331  C CD1  . TRP A 1 87  ? -11.436 -5.650  -8.118  1.00 0.00 ? 87  TRP A CD1  2  
ATOM 3332  C CD2  . TRP A 1 87  ? -9.761  -6.925  -7.359  1.00 0.00 ? 87  TRP A CD2  2  
ATOM 3333  N NE1  . TRP A 1 87  ? -11.965 -6.867  -7.757  1.00 0.00 ? 87  TRP A NE1  2  
ATOM 3334  C CE2  . TRP A 1 87  ? -10.954 -7.667  -7.286  1.00 0.00 ? 87  TRP A CE2  2  
ATOM 3335  C CE3  . TRP A 1 87  ? -8.568  -7.520  -6.937  1.00 0.00 ? 87  TRP A CE3  2  
ATOM 3336  C CZ2  . TRP A 1 87  ? -10.988 -8.975  -6.806  1.00 0.00 ? 87  TRP A CZ2  2  
ATOM 3337  C CZ3  . TRP A 1 87  ? -8.603  -8.815  -6.459  1.00 0.00 ? 87  TRP A CZ3  2  
ATOM 3338  C CH2  . TRP A 1 87  ? -9.805  -9.532  -6.398  1.00 0.00 ? 87  TRP A CH2  2  
ATOM 3339  H H    . TRP A 1 87  ? -10.442 -2.383  -7.480  1.00 0.00 ? 87  TRP A H    2  
ATOM 3340  H HA   . TRP A 1 87  ? -8.688  -4.242  -6.092  1.00 0.00 ? 87  TRP A HA   2  
ATOM 3341  H HB2  . TRP A 1 87  ? -9.554  -3.919  -8.955  1.00 0.00 ? 87  TRP A HB2  2  
ATOM 3342  H HB3  . TRP A 1 87  ? -8.211  -4.967  -8.533  1.00 0.00 ? 87  TRP A HB3  2  
ATOM 3343  H HD1  . TRP A 1 87  ? -11.990 -4.818  -8.523  1.00 0.00 ? 87  TRP A HD1  2  
ATOM 3344  H HE1  . TRP A 1 87  ? -12.915 -7.122  -7.824  1.00 0.00 ? 87  TRP A HE1  2  
ATOM 3345  H HE3  . TRP A 1 87  ? -7.631  -6.983  -6.976  1.00 0.00 ? 87  TRP A HE3  2  
ATOM 3346  H HZ2  . TRP A 1 87  ? -11.905 -9.541  -6.753  1.00 0.00 ? 87  TRP A HZ2  2  
ATOM 3347  H HZ3  . TRP A 1 87  ? -7.692  -9.289  -6.124  1.00 0.00 ? 87  TRP A HZ3  2  
ATOM 3348  H HH2  . TRP A 1 87  ? -9.787  -10.541 -6.016  1.00 0.00 ? 87  TRP A HH2  2  
ATOM 3349  N N    . MET A 1 88  ? -6.460  -3.262  -6.530  1.00 0.00 ? 88  MET A N    2  
ATOM 3350  C CA   . MET A 1 88  ? -5.147  -2.719  -6.808  1.00 0.00 ? 88  MET A CA   2  
ATOM 3351  C C    . MET A 1 88  ? -4.064  -3.743  -6.534  1.00 0.00 ? 88  MET A C    2  
ATOM 3352  O O    . MET A 1 88  ? -4.224  -4.634  -5.698  1.00 0.00 ? 88  MET A O    2  
ATOM 3353  C CB   . MET A 1 88  ? -4.896  -1.451  -5.993  1.00 0.00 ? 88  MET A CB   2  
ATOM 3354  C CG   . MET A 1 88  ? -4.812  -1.669  -4.495  1.00 0.00 ? 88  MET A CG   2  
ATOM 3355  S SD   . MET A 1 88  ? -4.531  -0.125  -3.613  1.00 0.00 ? 88  MET A SD   2  
ATOM 3356  C CE   . MET A 1 88  ? -5.891  0.852   -4.242  1.00 0.00 ? 88  MET A CE   2  
ATOM 3357  H H    . MET A 1 88  ? -6.578  -3.890  -5.777  1.00 0.00 ? 88  MET A H    2  
ATOM 3358  H HA   . MET A 1 88  ? -5.117  -2.466  -7.858  1.00 0.00 ? 88  MET A HA   2  
ATOM 3359  H HB2  . MET A 1 88  ? -3.970  -1.009  -6.318  1.00 0.00 ? 88  MET A HB2  2  
ATOM 3360  H HB3  . MET A 1 88  ? -5.700  -0.754  -6.185  1.00 0.00 ? 88  MET A HB3  2  
ATOM 3361  H HG2  . MET A 1 88  ? -5.736  -2.107  -4.152  1.00 0.00 ? 88  MET A HG2  2  
ATOM 3362  H HG3  . MET A 1 88  ? -3.994  -2.344  -4.285  1.00 0.00 ? 88  MET A HG3  2  
ATOM 3363  H HE1  . MET A 1 88  ? -5.855  1.840   -3.808  1.00 0.00 ? 88  MET A HE1  2  
ATOM 3364  H HE2  . MET A 1 88  ? -6.826  0.377   -3.980  1.00 0.00 ? 88  MET A HE2  2  
ATOM 3365  H HE3  . MET A 1 88  ? -5.816  0.929   -5.318  1.00 0.00 ? 88  MET A HE3  2  
ATOM 3366  N N    . ARG A 1 89  ? -2.981  -3.625  -7.272  1.00 0.00 ? 89  ARG A N    2  
ATOM 3367  C CA   . ARG A 1 89  ? -1.826  -4.477  -7.080  1.00 0.00 ? 89  ARG A CA   2  
ATOM 3368  C C    . ARG A 1 89  ? -0.711  -3.698  -6.404  1.00 0.00 ? 89  ARG A C    2  
ATOM 3369  O O    . ARG A 1 89  ? -0.288  -2.652  -6.899  1.00 0.00 ? 89  ARG A O    2  
ATOM 3370  C CB   . ARG A 1 89  ? -1.332  -5.020  -8.419  1.00 0.00 ? 89  ARG A CB   2  
ATOM 3371  C CG   . ARG A 1 89  ? 0.009   -5.738  -8.326  1.00 0.00 ? 89  ARG A CG   2  
ATOM 3372  C CD   . ARG A 1 89  ? 0.735   -5.724  -9.661  1.00 0.00 ? 89  ARG A CD   2  
ATOM 3373  N NE   . ARG A 1 89  ? 0.920   -4.359  -10.160 1.00 0.00 ? 89  ARG A NE   2  
ATOM 3374  C CZ   . ARG A 1 89  ? 1.000   -4.046  -11.451 1.00 0.00 ? 89  ARG A CZ   2  
ATOM 3375  N NH1  . ARG A 1 89  ? 1.012   -5.005  -12.368 1.00 0.00 ? 89  ARG A NH1  2  
ATOM 3376  N NH2  . ARG A 1 89  ? 1.091   -2.774  -11.825 1.00 0.00 ? 89  ARG A NH2  2  
ATOM 3377  H H    . ARG A 1 89  ? -2.954  -2.936  -7.971  1.00 0.00 ? 89  ARG A H    2  
ATOM 3378  H HA   . ARG A 1 89  ? -2.119  -5.302  -6.447  1.00 0.00 ? 89  ARG A HA   2  
ATOM 3379  H HB2  . ARG A 1 89  ? -2.066  -5.717  -8.800  1.00 0.00 ? 89  ARG A HB2  2  
ATOM 3380  H HB3  . ARG A 1 89  ? -1.231  -4.201  -9.115  1.00 0.00 ? 89  ARG A HB3  2  
ATOM 3381  H HG2  . ARG A 1 89  ? 0.621   -5.242  -7.589  1.00 0.00 ? 89  ARG A HG2  2  
ATOM 3382  H HG3  . ARG A 1 89  ? -0.162  -6.762  -8.029  1.00 0.00 ? 89  ARG A HG3  2  
ATOM 3383  H HD2  . ARG A 1 89  ? 1.703   -6.187  -9.535  1.00 0.00 ? 89  ARG A HD2  2  
ATOM 3384  H HD3  . ARG A 1 89  ? 0.156   -6.286  -10.378 1.00 0.00 ? 89  ARG A HD3  2  
ATOM 3385  H HE   . ARG A 1 89  ? 0.962   -3.639  -9.493  1.00 0.00 ? 89  ARG A HE   2  
ATOM 3386  H HH11 . ARG A 1 89  ? 0.969   -5.971  -12.090 1.00 0.00 ? 89  ARG A HH11 2  
ATOM 3387  H HH12 . ARG A 1 89  ? 1.041   -4.771  -13.347 1.00 0.00 ? 89  ARG A HH12 2  
ATOM 3388  H HH21 . ARG A 1 89  ? 1.100   -2.039  -11.134 1.00 0.00 ? 89  ARG A HH21 2  
ATOM 3389  H HH22 . ARG A 1 89  ? 1.142   -2.540  -12.798 1.00 0.00 ? 89  ARG A HH22 2  
ATOM 3390  N N    . THR A 1 90  ? -0.251  -4.202  -5.279  1.00 0.00 ? 90  THR A N    2  
ATOM 3391  C CA   . THR A 1 90  ? 0.874   -3.610  -4.591  1.00 0.00 ? 90  THR A CA   2  
ATOM 3392  C C    . THR A 1 90  ? 2.170   -4.293  -4.994  1.00 0.00 ? 90  THR A C    2  
ATOM 3393  O O    . THR A 1 90  ? 2.297   -5.518  -4.924  1.00 0.00 ? 90  THR A O    2  
ATOM 3394  C CB   . THR A 1 90  ? 0.703   -3.681  -3.059  1.00 0.00 ? 90  THR A CB   2  
ATOM 3395  O OG1  . THR A 1 90  ? -0.397  -2.862  -2.664  1.00 0.00 ? 90  THR A OG1  2  
ATOM 3396  C CG2  . THR A 1 90  ? 1.961   -3.224  -2.334  1.00 0.00 ? 90  THR A CG2  2  
ATOM 3397  H H    . THR A 1 90  ? -0.689  -4.993  -4.891  1.00 0.00 ? 90  THR A H    2  
ATOM 3398  H HA   . THR A 1 90  ? 0.924   -2.571  -4.877  1.00 0.00 ? 90  THR A HA   2  
ATOM 3399  H HB   . THR A 1 90  ? 0.495   -4.705  -2.784  1.00 0.00 ? 90  THR A HB   2  
ATOM 3400  H HG1  . THR A 1 90  ? -0.129  -1.936  -2.685  1.00 0.00 ? 90  THR A HG1  2  
ATOM 3401  H HG21 . THR A 1 90  ? 2.220   -2.226  -2.655  1.00 0.00 ? 90  THR A HG21 2  
ATOM 3402  H HG22 . THR A 1 90  ? 2.774   -3.899  -2.563  1.00 0.00 ? 90  THR A HG22 2  
ATOM 3403  H HG23 . THR A 1 90  ? 1.782   -3.225  -1.269  1.00 0.00 ? 90  THR A HG23 2  
ATOM 3404  N N    . SER A 1 91  ? 3.108   -3.489  -5.447  1.00 0.00 ? 91  SER A N    2  
ATOM 3405  C CA   . SER A 1 91  ? 4.446   -3.948  -5.729  1.00 0.00 ? 91  SER A CA   2  
ATOM 3406  C C    . SER A 1 91  ? 5.315   -3.652  -4.515  1.00 0.00 ? 91  SER A C    2  
ATOM 3407  O O    . SER A 1 91  ? 5.551   -2.484  -4.183  1.00 0.00 ? 91  SER A O    2  
ATOM 3408  C CB   . SER A 1 91  ? 4.991   -3.237  -6.969  1.00 0.00 ? 91  SER A CB   2  
ATOM 3409  O OG   . SER A 1 91  ? 4.068   -3.314  -8.043  1.00 0.00 ? 91  SER A OG   2  
ATOM 3410  H H    . SER A 1 91  ? 2.893   -2.538  -5.583  1.00 0.00 ? 91  SER A H    2  
ATOM 3411  H HA   . SER A 1 91  ? 4.416   -5.014  -5.900  1.00 0.00 ? 91  SER A HA   2  
ATOM 3412  H HB2  . SER A 1 91  ? 5.169   -2.197  -6.739  1.00 0.00 ? 91  SER A HB2  2  
ATOM 3413  H HB3  . SER A 1 91  ? 5.918   -3.704  -7.271  1.00 0.00 ? 91  SER A HB3  2  
ATOM 3414  H HG   . SER A 1 91  ? 3.592   -2.481  -8.115  1.00 0.00 ? 91  SER A HG   2  
ATOM 3415  N N    . SER A 1 92  ? 5.757   -4.698  -3.837  1.00 0.00 ? 92  SER A N    2  
ATOM 3416  C CA   . SER A 1 92  ? 6.503   -4.527  -2.611  1.00 0.00 ? 92  SER A CA   2  
ATOM 3417  C C    . SER A 1 92  ? 7.989   -4.548  -2.885  1.00 0.00 ? 92  SER A C    2  
ATOM 3418  O O    . SER A 1 92  ? 8.455   -5.115  -3.875  1.00 0.00 ? 92  SER A O    2  
ATOM 3419  C CB   . SER A 1 92  ? 6.169   -5.612  -1.584  1.00 0.00 ? 92  SER A CB   2  
ATOM 3420  O OG   . SER A 1 92  ? 6.591   -5.227  -0.291  1.00 0.00 ? 92  SER A OG   2  
ATOM 3421  H H    . SER A 1 92  ? 5.603   -5.602  -4.191  1.00 0.00 ? 92  SER A H    2  
ATOM 3422  H HA   . SER A 1 92  ? 6.241   -3.563  -2.197  1.00 0.00 ? 92  SER A HA   2  
ATOM 3423  H HB2  . SER A 1 92  ? 5.110   -5.768  -1.556  1.00 0.00 ? 92  SER A HB2  2  
ATOM 3424  H HB3  . SER A 1 92  ? 6.679   -6.539  -1.851  1.00 0.00 ? 92  SER A HB3  2  
ATOM 3425  H HG   . SER A 1 92  ? 6.277   -5.871  0.349   1.00 0.00 ? 92  SER A HG   2  
ATOM 3426  N N    . PHE A 1 93  ? 8.710   -3.933  -1.982  1.00 0.00 ? 93  PHE A N    2  
ATOM 3427  C CA   . PHE A 1 93  ? 10.151  -3.908  -2.007  1.00 0.00 ? 93  PHE A CA   2  
ATOM 3428  C C    . PHE A 1 93  ? 10.636  -3.667  -0.594  1.00 0.00 ? 93  PHE A C    2  
ATOM 3429  O O    . PHE A 1 93  ? 10.111  -2.810  0.102   1.00 0.00 ? 93  PHE A O    2  
ATOM 3430  C CB   . PHE A 1 93  ? 10.649  -2.804  -2.945  1.00 0.00 ? 93  PHE A CB   2  
ATOM 3431  C CG   . PHE A 1 93  ? 12.146  -2.632  -2.953  1.00 0.00 ? 93  PHE A CG   2  
ATOM 3432  C CD1  . PHE A 1 93  ? 12.761  -1.758  -2.067  1.00 0.00 ? 93  PHE A CD1  2  
ATOM 3433  C CD2  . PHE A 1 93  ? 12.935  -3.338  -3.847  1.00 0.00 ? 93  PHE A CD2  2  
ATOM 3434  C CE1  . PHE A 1 93  ? 14.131  -1.593  -2.070  1.00 0.00 ? 93  PHE A CE1  2  
ATOM 3435  C CE2  . PHE A 1 93  ? 14.309  -3.176  -3.855  1.00 0.00 ? 93  PHE A CE2  2  
ATOM 3436  C CZ   . PHE A 1 93  ? 14.907  -2.303  -2.966  1.00 0.00 ? 93  PHE A CZ   2  
ATOM 3437  H H    . PHE A 1 93  ? 8.244   -3.481  -1.245  1.00 0.00 ? 93  PHE A H    2  
ATOM 3438  H HA   . PHE A 1 93  ? 10.507  -4.868  -2.353  1.00 0.00 ? 93  PHE A HA   2  
ATOM 3439  H HB2  . PHE A 1 93  ? 10.338  -3.037  -3.949  1.00 0.00 ? 93  PHE A HB2  2  
ATOM 3440  H HB3  . PHE A 1 93  ? 10.206  -1.865  -2.646  1.00 0.00 ? 93  PHE A HB3  2  
ATOM 3441  H HD1  . PHE A 1 93  ? 12.156  -1.204  -1.365  1.00 0.00 ? 93  PHE A HD1  2  
ATOM 3442  H HD2  . PHE A 1 93  ? 12.468  -4.020  -4.541  1.00 0.00 ? 93  PHE A HD2  2  
ATOM 3443  H HE1  . PHE A 1 93  ? 14.596  -0.909  -1.367  1.00 0.00 ? 93  PHE A HE1  2  
ATOM 3444  H HE2  . PHE A 1 93  ? 14.914  -3.732  -4.555  1.00 0.00 ? 93  PHE A HE2  2  
ATOM 3445  H HZ   . PHE A 1 93  ? 15.980  -2.175  -2.973  1.00 0.00 ? 93  PHE A HZ   2  
ATOM 3446  N N    . THR A 1 94  ? 11.611  -4.422  -0.160  1.00 0.00 ? 94  THR A N    2  
ATOM 3447  C CA   . THR A 1 94  ? 12.160  -4.227  1.159   1.00 0.00 ? 94  THR A CA   2  
ATOM 3448  C C    . THR A 1 94  ? 13.505  -3.525  1.068   1.00 0.00 ? 94  THR A C    2  
ATOM 3449  O O    . THR A 1 94  ? 14.492  -4.103  0.610   1.00 0.00 ? 94  THR A O    2  
ATOM 3450  C CB   . THR A 1 94  ? 12.282  -5.563  1.898   1.00 0.00 ? 94  THR A CB   2  
ATOM 3451  O OG1  . THR A 1 94  ? 12.707  -6.591  0.990   1.00 0.00 ? 94  THR A OG1  2  
ATOM 3452  C CG2  . THR A 1 94  ? 10.952  -5.953  2.530   1.00 0.00 ? 94  THR A CG2  2  
ATOM 3453  H H    . THR A 1 94  ? 11.973  -5.127  -0.732  1.00 0.00 ? 94  THR A H    2  
ATOM 3454  H HA   . THR A 1 94  ? 11.476  -3.596  1.711   1.00 0.00 ? 94  THR A HA   2  
ATOM 3455  H HB   . THR A 1 94  ? 13.013  -5.451  2.681   1.00 0.00 ? 94  THR A HB   2  
ATOM 3456  H HG1  . THR A 1 94  ? 12.146  -7.370  1.106   1.00 0.00 ? 94  THR A HG1  2  
ATOM 3457  H HG21 . THR A 1 94  ? 10.643  -5.185  3.224   1.00 0.00 ? 94  THR A HG21 2  
ATOM 3458  H HG22 . THR A 1 94  ? 11.063  -6.890  3.056   1.00 0.00 ? 94  THR A HG22 2  
ATOM 3459  H HG23 . THR A 1 94  ? 10.204  -6.062  1.758   1.00 0.00 ? 94  THR A HG23 2  
ATOM 3460  N N    . PHE A 1 95  ? 13.524  -2.264  1.478   1.00 0.00 ? 95  PHE A N    2  
ATOM 3461  C CA   . PHE A 1 95  ? 14.691  -1.419  1.292   1.00 0.00 ? 95  PHE A CA   2  
ATOM 3462  C C    . PHE A 1 95  ? 15.776  -1.761  2.302   1.00 0.00 ? 95  PHE A C    2  
ATOM 3463  O O    . PHE A 1 95  ? 15.629  -1.524  3.503   1.00 0.00 ? 95  PHE A O    2  
ATOM 3464  C CB   . PHE A 1 95  ? 14.302  0.059   1.403   1.00 0.00 ? 95  PHE A CB   2  
ATOM 3465  C CG   . PHE A 1 95  ? 15.262  0.990   0.711   1.00 0.00 ? 95  PHE A CG   2  
ATOM 3466  C CD1  . PHE A 1 95  ? 16.476  1.321   1.291   1.00 0.00 ? 95  PHE A CD1  2  
ATOM 3467  C CD2  . PHE A 1 95  ? 14.946  1.534   -0.525  1.00 0.00 ? 95  PHE A CD2  2  
ATOM 3468  C CE1  . PHE A 1 95  ? 17.358  2.174   0.654   1.00 0.00 ? 95  PHE A CE1  2  
ATOM 3469  C CE2  . PHE A 1 95  ? 15.822  2.389   -1.165  1.00 0.00 ? 95  PHE A CE2  2  
ATOM 3470  C CZ   . PHE A 1 95  ? 17.030  2.710   -0.575  1.00 0.00 ? 95  PHE A CZ   2  
ATOM 3471  H H    . PHE A 1 95  ? 12.734  -1.893  1.928   1.00 0.00 ? 95  PHE A H    2  
ATOM 3472  H HA   . PHE A 1 95  ? 15.076  -1.607  0.301   1.00 0.00 ? 95  PHE A HA   2  
ATOM 3473  H HB2  . PHE A 1 95  ? 13.325  0.199   0.961   1.00 0.00 ? 95  PHE A HB2  2  
ATOM 3474  H HB3  . PHE A 1 95  ? 14.263  0.335   2.446   1.00 0.00 ? 95  PHE A HB3  2  
ATOM 3475  H HD1  . PHE A 1 95  ? 16.735  0.902   2.252   1.00 0.00 ? 95  PHE A HD1  2  
ATOM 3476  H HD2  . PHE A 1 95  ? 14.004  1.285   -0.989  1.00 0.00 ? 95  PHE A HD2  2  
ATOM 3477  H HE1  . PHE A 1 95  ? 18.300  2.423   1.119   1.00 0.00 ? 95  PHE A HE1  2  
ATOM 3478  H HE2  . PHE A 1 95  ? 15.566  2.805   -2.129  1.00 0.00 ? 95  PHE A HE2  2  
ATOM 3479  H HZ   . PHE A 1 95  ? 17.715  3.378   -1.074  1.00 0.00 ? 95  PHE A HZ   2  
ATOM 3480  N N    . GLN A 1 96  ? 16.854  -2.340  1.801   1.00 0.00 ? 96  GLN A N    2  
ATOM 3481  C CA   . GLN A 1 96  ? 18.002  -2.657  2.622   1.00 0.00 ? 96  GLN A CA   2  
ATOM 3482  C C    . GLN A 1 96  ? 19.018  -1.530  2.578   1.00 0.00 ? 96  GLN A C    2  
ATOM 3483  O O    . GLN A 1 96  ? 19.431  -1.097  1.500   1.00 0.00 ? 96  GLN A O    2  
ATOM 3484  C CB   . GLN A 1 96  ? 18.659  -3.950  2.152   1.00 0.00 ? 96  GLN A CB   2  
ATOM 3485  C CG   . GLN A 1 96  ? 18.017  -5.203  2.711   1.00 0.00 ? 96  GLN A CG   2  
ATOM 3486  C CD   . GLN A 1 96  ? 18.676  -6.466  2.199   1.00 0.00 ? 96  GLN A CD   2  
ATOM 3487  O OE1  . GLN A 1 96  ? 19.119  -6.534  1.051   1.00 0.00 ? 96  GLN A OE1  2  
ATOM 3488  N NE2  . GLN A 1 96  ? 18.782  -7.462  3.059   1.00 0.00 ? 96  GLN A NE2  2  
ATOM 3489  H H    . GLN A 1 96  ? 16.878  -2.565  0.842   1.00 0.00 ? 96  GLN A H    2  
ATOM 3490  H HA   . GLN A 1 96  ? 17.663  -2.783  3.639   1.00 0.00 ? 96  GLN A HA   2  
ATOM 3491  H HB2  . GLN A 1 96  ? 18.604  -3.996  1.073   1.00 0.00 ? 96  GLN A HB2  2  
ATOM 3492  H HB3  . GLN A 1 96  ? 19.698  -3.941  2.448   1.00 0.00 ? 96  GLN A HB3  2  
ATOM 3493  H HG2  . GLN A 1 96  ? 18.098  -5.186  3.789   1.00 0.00 ? 96  GLN A HG2  2  
ATOM 3494  H HG3  . GLN A 1 96  ? 16.975  -5.216  2.429   1.00 0.00 ? 96  GLN A HG3  2  
ATOM 3495  H HE21 . GLN A 1 96  ? 18.439  -7.329  3.967   1.00 0.00 ? 96  GLN A HE21 2  
ATOM 3496  H HE22 . GLN A 1 96  ? 19.213  -8.292  2.759   1.00 0.00 ? 96  GLN A HE22 2  
ATOM 3497  N N    . ASN A 1 97  ? 19.401  -1.053  3.751   1.00 0.00 ? 97  ASN A N    2  
ATOM 3498  C CA   . ASN A 1 97  ? 20.469  -0.072  3.866   1.00 0.00 ? 97  ASN A CA   2  
ATOM 3499  C C    . ASN A 1 97  ? 21.759  -0.700  3.356   1.00 0.00 ? 97  ASN A C    2  
ATOM 3500  O O    . ASN A 1 97  ? 22.228  -1.688  3.915   1.00 0.00 ? 97  ASN A O    2  
ATOM 3501  C CB   . ASN A 1 97  ? 20.639  0.362   5.329   1.00 0.00 ? 97  ASN A CB   2  
ATOM 3502  C CG   . ASN A 1 97  ? 21.607  1.525   5.501   1.00 0.00 ? 97  ASN A CG   2  
ATOM 3503  O OD1  . ASN A 1 97  ? 22.553  1.693   4.732   1.00 0.00 ? 97  ASN A OD1  2  
ATOM 3504  N ND2  . ASN A 1 97  ? 21.378  2.339   6.518   1.00 0.00 ? 97  ASN A ND2  2  
ATOM 3505  H H    . ASN A 1 97  ? 18.949  -1.371  4.563   1.00 0.00 ? 97  ASN A H    2  
ATOM 3506  H HA   . ASN A 1 97  ? 20.218  0.783   3.257   1.00 0.00 ? 97  ASN A HA   2  
ATOM 3507  H HB2  . ASN A 1 97  ? 19.680  0.656   5.727   1.00 0.00 ? 97  ASN A HB2  2  
ATOM 3508  H HB3  . ASN A 1 97  ? 21.013  -0.477  5.898   1.00 0.00 ? 97  ASN A HB3  2  
ATOM 3509  H HD21 . ASN A 1 97  ? 20.606  2.155   7.099   1.00 0.00 ? 97  ASN A HD21 2  
ATOM 3510  H HD22 . ASN A 1 97  ? 21.992  3.091   6.658   1.00 0.00 ? 97  ASN A HD22 2  
ATOM 3511  N N    . PRO A 1 98  ? 22.347  -0.143  2.288   1.00 0.00 ? 98  PRO A N    2  
ATOM 3512  C CA   . PRO A 1 98  ? 23.536  -0.716  1.643   1.00 0.00 ? 98  PRO A CA   2  
ATOM 3513  C C    . PRO A 1 98  ? 24.740  -0.827  2.581   1.00 0.00 ? 98  PRO A C    2  
ATOM 3514  O O    . PRO A 1 98  ? 25.712  -1.512  2.274   1.00 0.00 ? 98  PRO A O    2  
ATOM 3515  C CB   . PRO A 1 98  ? 23.844  0.263   0.506   1.00 0.00 ? 98  PRO A CB   2  
ATOM 3516  C CG   . PRO A 1 98  ? 23.108  1.514   0.845   1.00 0.00 ? 98  PRO A CG   2  
ATOM 3517  C CD   . PRO A 1 98  ? 21.896  1.087   1.616   1.00 0.00 ? 98  PRO A CD   2  
ATOM 3518  H HA   . PRO A 1 98  ? 23.322  -1.689  1.231   1.00 0.00 ? 98  PRO A HA   2  
ATOM 3519  H HB2  . PRO A 1 98  ? 24.910  0.435   0.458   1.00 0.00 ? 98  PRO A HB2  2  
ATOM 3520  H HB3  . PRO A 1 98  ? 23.501  -0.153  -0.431  1.00 0.00 ? 98  PRO A HB3  2  
ATOM 3521  H HG2  . PRO A 1 98  ? 23.734  2.155   1.451   1.00 0.00 ? 98  PRO A HG2  2  
ATOM 3522  H HG3  . PRO A 1 98  ? 22.816  2.025   -0.060  1.00 0.00 ? 98  PRO A HG3  2  
ATOM 3523  H HD2  . PRO A 1 98  ? 21.618  1.843   2.338   1.00 0.00 ? 98  PRO A HD2  2  
ATOM 3524  H HD3  . PRO A 1 98  ? 21.073  0.880   0.947   1.00 0.00 ? 98  PRO A HD3  2  
ATOM 3525  N N    . TYR A 1 99  ? 24.665  -0.158  3.724   1.00 0.00 ? 99  TYR A N    2  
ATOM 3526  C CA   . TYR A 1 99  ? 25.765  -0.151  4.677   1.00 0.00 ? 99  TYR A CA   2  
ATOM 3527  C C    . TYR A 1 99  ? 25.431  -0.967  5.925   1.00 0.00 ? 99  TYR A C    2  
ATOM 3528  O O    . TYR A 1 99  ? 26.173  -0.942  6.908   1.00 0.00 ? 99  TYR A O    2  
ATOM 3529  C CB   . TYR A 1 99  ? 26.098  1.286   5.085   1.00 0.00 ? 99  TYR A CB   2  
ATOM 3530  C CG   . TYR A 1 99  ? 26.453  2.190   3.926   1.00 0.00 ? 99  TYR A CG   2  
ATOM 3531  C CD1  . TYR A 1 99  ? 25.464  2.833   3.196   1.00 0.00 ? 99  TYR A CD1  2  
ATOM 3532  C CD2  . TYR A 1 99  ? 27.777  2.407   3.569   1.00 0.00 ? 99  TYR A CD2  2  
ATOM 3533  C CE1  . TYR A 1 99  ? 25.783  3.661   2.140   1.00 0.00 ? 99  TYR A CE1  2  
ATOM 3534  C CE2  . TYR A 1 99  ? 28.103  3.235   2.513   1.00 0.00 ? 99  TYR A CE2  2  
ATOM 3535  C CZ   . TYR A 1 99  ? 27.101  3.859   1.803   1.00 0.00 ? 99  TYR A CZ   2  
ATOM 3536  O OH   . TYR A 1 99  ? 27.416  4.690   0.754   1.00 0.00 ? 99  TYR A OH   2  
ATOM 3537  H H    . TYR A 1 99  ? 23.852  0.355   3.928   1.00 0.00 ? 99  TYR A H    2  
ATOM 3538  H HA   . TYR A 1 99  ? 26.628  -0.586  4.195   1.00 0.00 ? 99  TYR A HA   2  
ATOM 3539  H HB2  . TYR A 1 99  ? 25.246  1.714   5.588   1.00 0.00 ? 99  TYR A HB2  2  
ATOM 3540  H HB3  . TYR A 1 99  ? 26.938  1.272   5.764   1.00 0.00 ? 99  TYR A HB3  2  
ATOM 3541  H HD1  . TYR A 1 99  ? 24.428  2.674   3.460   1.00 0.00 ? 99  TYR A HD1  2  
ATOM 3542  H HD2  . TYR A 1 99  ? 28.559  1.915   4.128   1.00 0.00 ? 99  TYR A HD2  2  
ATOM 3543  H HE1  . TYR A 1 99  ? 24.997  4.152   1.585   1.00 0.00 ? 99  TYR A HE1  2  
ATOM 3544  H HE2  . TYR A 1 99  ? 29.139  3.390   2.248   1.00 0.00 ? 99  TYR A HE2  2  
ATOM 3545  H HH   . TYR A 1 99  ? 26.836  5.466   0.777   1.00 0.00 ? 99  TYR A HH   2  
ATOM 3546  N N    . SER A 1 100 ? 24.313  -1.685  5.899   1.00 0.00 ? 100 SER A N    2  
ATOM 3547  C CA   . SER A 1 100 ? 23.886  -2.453  7.068   1.00 0.00 ? 100 SER A CA   2  
ATOM 3548  C C    . SER A 1 100 ? 23.171  -3.750  6.678   1.00 0.00 ? 100 SER A C    2  
ATOM 3549  O O    . SER A 1 100 ? 23.081  -4.684  7.476   1.00 0.00 ? 100 SER A O    2  
ATOM 3550  C CB   . SER A 1 100 ? 22.969  -1.598  7.935   1.00 0.00 ? 100 SER A CB   2  
ATOM 3551  O OG   . SER A 1 100 ? 23.581  -0.359  8.257   1.00 0.00 ? 100 SER A OG   2  
ATOM 3552  H H    . SER A 1 100 ? 23.764  -1.695  5.087   1.00 0.00 ? 100 SER A H    2  
ATOM 3553  H HA   . SER A 1 100 ? 24.769  -2.702  7.637   1.00 0.00 ? 100 SER A HA   2  
ATOM 3554  H HB2  . SER A 1 100 ? 22.051  -1.404  7.400   1.00 0.00 ? 100 SER A HB2  2  
ATOM 3555  H HB3  . SER A 1 100 ? 22.748  -2.126  8.850   1.00 0.00 ? 100 SER A HB3  2  
ATOM 3556  H HG   . SER A 1 100 ? 24.543  -0.459  8.232   1.00 0.00 ? 100 SER A HG   2  
ATOM 3557  N N    . ASP A 1 101 ? 22.657  -3.783  5.448   1.00 0.00 ? 101 ASP A N    2  
ATOM 3558  C CA   . ASP A 1 101 ? 21.931  -4.937  4.903   1.00 0.00 ? 101 ASP A CA   2  
ATOM 3559  C C    . ASP A 1 101 ? 20.632  -5.194  5.665   1.00 0.00 ? 101 ASP A C    2  
ATOM 3560  O O    . ASP A 1 101 ? 20.015  -6.252  5.532   1.00 0.00 ? 101 ASP A O    2  
ATOM 3561  C CB   . ASP A 1 101 ? 22.809  -6.192  4.906   1.00 0.00 ? 101 ASP A CB   2  
ATOM 3562  C CG   . ASP A 1 101 ? 22.520  -7.093  3.724   1.00 0.00 ? 101 ASP A CG   2  
ATOM 3563  O OD1  . ASP A 1 101 ? 22.954  -6.752  2.603   1.00 0.00 ? 101 ASP A OD1  2  
ATOM 3564  O OD2  . ASP A 1 101 ? 21.874  -8.146  3.903   1.00 0.00 ? 101 ASP A OD2  2  
ATOM 3565  H H    . ASP A 1 101 ? 22.782  -3.006  4.860   1.00 0.00 ? 101 ASP A H    2  
ATOM 3566  H HA   . ASP A 1 101 ? 21.678  -4.701  3.881   1.00 0.00 ? 101 ASP A HA   2  
ATOM 3567  H HB2  . ASP A 1 101 ? 23.847  -5.900  4.865   1.00 0.00 ? 101 ASP A HB2  2  
ATOM 3568  H HB3  . ASP A 1 101 ? 22.629  -6.750  5.812   1.00 0.00 ? 101 ASP A HB3  2  
ATOM 3569  N N    . GLU A 1 102 ? 20.213  -4.217  6.454   1.00 0.00 ? 102 GLU A N    2  
ATOM 3570  C CA   . GLU A 1 102 ? 18.976  -4.317  7.209   1.00 0.00 ? 102 GLU A CA   2  
ATOM 3571  C C    . GLU A 1 102 ? 17.864  -3.576  6.478   1.00 0.00 ? 102 GLU A C    2  
ATOM 3572  O O    . GLU A 1 102 ? 18.131  -2.681  5.675   1.00 0.00 ? 102 GLU A O    2  
ATOM 3573  C CB   . GLU A 1 102 ? 19.173  -3.736  8.613   1.00 0.00 ? 102 GLU A CB   2  
ATOM 3574  C CG   . GLU A 1 102 ? 19.618  -2.284  8.606   1.00 0.00 ? 102 GLU A CG   2  
ATOM 3575  C CD   . GLU A 1 102 ? 19.851  -1.733  9.997   1.00 0.00 ? 102 GLU A CD   2  
ATOM 3576  O OE1  . GLU A 1 102 ? 20.957  -1.922  10.537  1.00 0.00 ? 102 GLU A OE1  2  
ATOM 3577  O OE2  . GLU A 1 102 ? 18.936  -1.093  10.547  1.00 0.00 ? 102 GLU A OE2  2  
ATOM 3578  H H    . GLU A 1 102 ? 20.748  -3.404  6.531   1.00 0.00 ? 102 GLU A H    2  
ATOM 3579  H HA   . GLU A 1 102 ? 18.712  -5.362  7.289   1.00 0.00 ? 102 GLU A HA   2  
ATOM 3580  H HB2  . GLU A 1 102 ? 18.240  -3.803  9.155   1.00 0.00 ? 102 GLU A HB2  2  
ATOM 3581  H HB3  . GLU A 1 102 ? 19.921  -4.317  9.128   1.00 0.00 ? 102 GLU A HB3  2  
ATOM 3582  H HG2  . GLU A 1 102 ? 20.540  -2.207  8.048   1.00 0.00 ? 102 GLU A HG2  2  
ATOM 3583  H HG3  . GLU A 1 102 ? 18.857  -1.690  8.124   1.00 0.00 ? 102 GLU A HG3  2  
ATOM 3584  N N    . ILE A 1 103 ? 16.625  -3.939  6.765   1.00 0.00 ? 103 ILE A N    2  
ATOM 3585  C CA   . ILE A 1 103 ? 15.485  -3.338  6.097   1.00 0.00 ? 103 ILE A CA   2  
ATOM 3586  C C    . ILE A 1 103 ? 14.922  -2.212  6.933   1.00 0.00 ? 103 ILE A C    2  
ATOM 3587  O O    . ILE A 1 103 ? 14.400  -2.424  8.029   1.00 0.00 ? 103 ILE A O    2  
ATOM 3588  C CB   . ILE A 1 103 ? 14.375  -4.365  5.822   1.00 0.00 ? 103 ILE A CB   2  
ATOM 3589  C CG1  . ILE A 1 103 ? 14.895  -5.445  4.887   1.00 0.00 ? 103 ILE A CG1  2  
ATOM 3590  C CG2  . ILE A 1 103 ? 13.148  -3.685  5.228   1.00 0.00 ? 103 ILE A CG2  2  
ATOM 3591  C CD1  . ILE A 1 103 ? 13.908  -6.562  4.663   1.00 0.00 ? 103 ILE A CD1  2  
ATOM 3592  H H    . ILE A 1 103 ? 16.469  -4.604  7.478   1.00 0.00 ? 103 ILE A H    2  
ATOM 3593  H HA   . ILE A 1 103 ? 15.822  -2.940  5.151   1.00 0.00 ? 103 ILE A HA   2  
ATOM 3594  H HB   . ILE A 1 103 ? 14.089  -4.817  6.761   1.00 0.00 ? 103 ILE A HB   2  
ATOM 3595  H HG12 . ILE A 1 103 ? 15.119  -5.005  3.927   1.00 0.00 ? 103 ILE A HG12 2  
ATOM 3596  H HG13 . ILE A 1 103 ? 15.792  -5.866  5.303   1.00 0.00 ? 103 ILE A HG13 2  
ATOM 3597  H HG21 . ILE A 1 103 ? 12.772  -2.948  5.923   1.00 0.00 ? 103 ILE A HG21 2  
ATOM 3598  H HG22 . ILE A 1 103 ? 12.381  -4.423  5.038   1.00 0.00 ? 103 ILE A HG22 2  
ATOM 3599  H HG23 . ILE A 1 103 ? 13.417  -3.200  4.301   1.00 0.00 ? 103 ILE A HG23 2  
ATOM 3600  H HD11 . ILE A 1 103 ? 13.691  -7.041  5.604   1.00 0.00 ? 103 ILE A HD11 2  
ATOM 3601  H HD12 . ILE A 1 103 ? 14.329  -7.281  3.977   1.00 0.00 ? 103 ILE A HD12 2  
ATOM 3602  H HD13 . ILE A 1 103 ? 12.999  -6.153  4.247   1.00 0.00 ? 103 ILE A HD13 2  
ATOM 3603  N N    . GLU A 1 104 ? 15.036  -1.015  6.409   1.00 0.00 ? 104 GLU A N    2  
ATOM 3604  C CA   . GLU A 1 104 ? 14.540  0.159   7.088   1.00 0.00 ? 104 GLU A CA   2  
ATOM 3605  C C    . GLU A 1 104 ? 13.027  0.259   6.973   1.00 0.00 ? 104 GLU A C    2  
ATOM 3606  O O    . GLU A 1 104 ? 12.343  0.620   7.933   1.00 0.00 ? 104 GLU A O    2  
ATOM 3607  C CB   . GLU A 1 104 ? 15.213  1.402   6.527   1.00 0.00 ? 104 GLU A CB   2  
ATOM 3608  C CG   . GLU A 1 104 ? 15.276  1.427   5.015   1.00 0.00 ? 104 GLU A CG   2  
ATOM 3609  C CD   . GLU A 1 104 ? 16.425  2.281   4.525   1.00 0.00 ? 104 GLU A CD   2  
ATOM 3610  O OE1  . GLU A 1 104 ? 17.554  1.761   4.440   1.00 0.00 ? 104 GLU A OE1  2  
ATOM 3611  O OE2  . GLU A 1 104 ? 16.211  3.484   4.268   1.00 0.00 ? 104 GLU A OE2  2  
ATOM 3612  H H    . GLU A 1 104 ? 15.473  -0.918  5.537   1.00 0.00 ? 104 GLU A H    2  
ATOM 3613  H HA   . GLU A 1 104 ? 14.804  0.066   8.120   1.00 0.00 ? 104 GLU A HA   2  
ATOM 3614  H HB2  . GLU A 1 104 ? 14.663  2.269   6.856   1.00 0.00 ? 104 GLU A HB2  2  
ATOM 3615  H HB3  . GLU A 1 104 ? 16.221  1.458   6.911   1.00 0.00 ? 104 GLU A HB3  2  
ATOM 3616  H HG2  . GLU A 1 104 ? 15.398  0.413   4.652   1.00 0.00 ? 104 GLU A HG2  2  
ATOM 3617  H HG3  . GLU A 1 104 ? 14.352  1.837   4.635   1.00 0.00 ? 104 GLU A HG3  2  
ATOM 3618  N N    . TYR A 1 105 ? 12.511  -0.073  5.800   1.00 0.00 ? 105 TYR A N    2  
ATOM 3619  C CA   . TYR A 1 105 ? 11.078  -0.020  5.553   1.00 0.00 ? 105 TYR A CA   2  
ATOM 3620  C C    . TYR A 1 105 ? 10.719  -0.759  4.279   1.00 0.00 ? 105 TYR A C    2  
ATOM 3621  O O    . TYR A 1 105 ? 11.589  -1.123  3.484   1.00 0.00 ? 105 TYR A O    2  
ATOM 3622  C CB   . TYR A 1 105 ? 10.593  1.437   5.463   1.00 0.00 ? 105 TYR A CB   2  
ATOM 3623  C CG   . TYR A 1 105 ? 11.350  2.291   4.464   1.00 0.00 ? 105 TYR A CG   2  
ATOM 3624  C CD1  . TYR A 1 105 ? 11.105  2.190   3.098   1.00 0.00 ? 105 TYR A CD1  2  
ATOM 3625  C CD2  . TYR A 1 105 ? 12.303  3.203   4.889   1.00 0.00 ? 105 TYR A CD2  2  
ATOM 3626  C CE1  . TYR A 1 105 ? 11.793  2.970   2.190   1.00 0.00 ? 105 TYR A CE1  2  
ATOM 3627  C CE2  . TYR A 1 105 ? 12.992  3.987   3.987   1.00 0.00 ? 105 TYR A CE2  2  
ATOM 3628  C CZ   . TYR A 1 105 ? 12.735  3.867   2.642   1.00 0.00 ? 105 TYR A CZ   2  
ATOM 3629  O OH   . TYR A 1 105 ? 13.424  4.650   1.745   1.00 0.00 ? 105 TYR A OH   2  
ATOM 3630  H H    . TYR A 1 105 ? 13.116  -0.346  5.073   1.00 0.00 ? 105 TYR A H    2  
ATOM 3631  H HA   . TYR A 1 105 ? 10.580  -0.501  6.383   1.00 0.00 ? 105 TYR A HA   2  
ATOM 3632  H HB2  . TYR A 1 105 ? 9.553   1.440   5.172   1.00 0.00 ? 105 TYR A HB2  2  
ATOM 3633  H HB3  . TYR A 1 105 ? 10.690  1.898   6.434   1.00 0.00 ? 105 TYR A HB3  2  
ATOM 3634  H HD1  . TYR A 1 105 ? 10.368  1.483   2.749   1.00 0.00 ? 105 TYR A HD1  2  
ATOM 3635  H HD2  . TYR A 1 105 ? 12.504  3.296   5.945   1.00 0.00 ? 105 TYR A HD2  2  
ATOM 3636  H HE1  . TYR A 1 105 ? 11.589  2.879   1.134   1.00 0.00 ? 105 TYR A HE1  2  
ATOM 3637  H HE2  . TYR A 1 105 ? 13.733  4.691   4.339   1.00 0.00 ? 105 TYR A HE2  2  
ATOM 3638  H HH   . TYR A 1 105 ? 14.356  4.668   1.987   1.00 0.00 ? 105 TYR A HH   2  
ATOM 3639  N N    . ILE A 1 106 ? 9.430   -0.976  4.098   1.00 0.00 ? 106 ILE A N    2  
ATOM 3640  C CA   . ILE A 1 106 ? 8.918   -1.583  2.886   1.00 0.00 ? 106 ILE A CA   2  
ATOM 3641  C C    . ILE A 1 106 ? 8.404   -0.485  1.968   1.00 0.00 ? 106 ILE A C    2  
ATOM 3642  O O    . ILE A 1 106 ? 7.858   0.517   2.436   1.00 0.00 ? 106 ILE A O    2  
ATOM 3643  C CB   . ILE A 1 106 ? 7.765   -2.571  3.187   1.00 0.00 ? 106 ILE A CB   2  
ATOM 3644  C CG1  . ILE A 1 106 ? 8.181   -3.567  4.272   1.00 0.00 ? 106 ILE A CG1  2  
ATOM 3645  C CG2  . ILE A 1 106 ? 7.345   -3.316  1.922   1.00 0.00 ? 106 ILE A CG2  2  
ATOM 3646  C CD1  . ILE A 1 106 ? 7.057   -4.476  4.719   1.00 0.00 ? 106 ILE A CD1  2  
ATOM 3647  H H    . ILE A 1 106 ? 8.798   -0.707  4.802   1.00 0.00 ? 106 ILE A H    2  
ATOM 3648  H HA   . ILE A 1 106 ? 9.721   -2.115  2.401   1.00 0.00 ? 106 ILE A HA   2  
ATOM 3649  H HB   . ILE A 1 106 ? 6.916   -2.002  3.540   1.00 0.00 ? 106 ILE A HB   2  
ATOM 3650  H HG12 . ILE A 1 106 ? 8.979   -4.189  3.894   1.00 0.00 ? 106 ILE A HG12 2  
ATOM 3651  H HG13 . ILE A 1 106 ? 8.534   -3.022  5.135   1.00 0.00 ? 106 ILE A HG13 2  
ATOM 3652  H HG21 . ILE A 1 106 ? 6.552   -4.013  2.154   1.00 0.00 ? 106 ILE A HG21 2  
ATOM 3653  H HG22 . ILE A 1 106 ? 8.191   -3.857  1.524   1.00 0.00 ? 106 ILE A HG22 2  
ATOM 3654  H HG23 . ILE A 1 106 ? 6.993   -2.609  1.183   1.00 0.00 ? 106 ILE A HG23 2  
ATOM 3655  H HD11 . ILE A 1 106 ? 6.692   -5.040  3.874   1.00 0.00 ? 106 ILE A HD11 2  
ATOM 3656  H HD12 . ILE A 1 106 ? 6.253   -3.881  5.129   1.00 0.00 ? 106 ILE A HD12 2  
ATOM 3657  H HD13 . ILE A 1 106 ? 7.423   -5.156  5.475   1.00 0.00 ? 106 ILE A HD13 2  
ATOM 3658  N N    . ILE A 1 107 ? 8.554   -0.677  0.676   1.00 0.00 ? 107 ILE A N    2  
ATOM 3659  C CA   . ILE A 1 107 ? 8.063   0.282   -0.291  1.00 0.00 ? 107 ILE A CA   2  
ATOM 3660  C C    . ILE A 1 107 ? 6.744   -0.220  -0.848  1.00 0.00 ? 107 ILE A C    2  
ATOM 3661  O O    . ILE A 1 107 ? 6.657   -1.335  -1.359  1.00 0.00 ? 107 ILE A O    2  
ATOM 3662  C CB   . ILE A 1 107 ? 9.069   0.519   -1.441  1.00 0.00 ? 107 ILE A CB   2  
ATOM 3663  C CG1  . ILE A 1 107 ? 10.360  1.131   -0.887  1.00 0.00 ? 107 ILE A CG1  2  
ATOM 3664  C CG2  . ILE A 1 107 ? 8.464   1.420   -2.513  1.00 0.00 ? 107 ILE A CG2  2  
ATOM 3665  C CD1  . ILE A 1 107 ? 11.386  1.460   -1.950  1.00 0.00 ? 107 ILE A CD1  2  
ATOM 3666  H H    . ILE A 1 107 ? 8.943   -1.523  0.349   1.00 0.00 ? 107 ILE A H    2  
ATOM 3667  H HA   . ILE A 1 107 ? 7.897   1.218   0.222   1.00 0.00 ? 107 ILE A HA   2  
ATOM 3668  H HB   . ILE A 1 107 ? 9.297   -0.434  -1.892  1.00 0.00 ? 107 ILE A HB   2  
ATOM 3669  H HG12 . ILE A 1 107 ? 10.121  2.045   -0.367  1.00 0.00 ? 107 ILE A HG12 2  
ATOM 3670  H HG13 . ILE A 1 107 ? 10.811  0.437   -0.193  1.00 0.00 ? 107 ILE A HG13 2  
ATOM 3671  H HG21 . ILE A 1 107 ? 8.193   2.370   -2.075  1.00 0.00 ? 107 ILE A HG21 2  
ATOM 3672  H HG22 . ILE A 1 107 ? 7.583   0.951   -2.926  1.00 0.00 ? 107 ILE A HG22 2  
ATOM 3673  H HG23 . ILE A 1 107 ? 9.189   1.580   -3.295  1.00 0.00 ? 107 ILE A HG23 2  
ATOM 3674  H HD11 . ILE A 1 107 ? 10.958  2.151   -2.662  1.00 0.00 ? 107 ILE A HD11 2  
ATOM 3675  H HD12 . ILE A 1 107 ? 11.683  0.555   -2.459  1.00 0.00 ? 107 ILE A HD12 2  
ATOM 3676  H HD13 . ILE A 1 107 ? 12.251  1.913   -1.488  1.00 0.00 ? 107 ILE A HD13 2  
ATOM 3677  N N    . CYS A 1 108 ? 5.715   0.590   -0.713  1.00 0.00 ? 108 CYS A N    2  
ATOM 3678  C CA   . CYS A 1 108 ? 4.376   0.198   -1.095  1.00 0.00 ? 108 CYS A CA   2  
ATOM 3679  C C    . CYS A 1 108 ? 3.934   0.981   -2.320  1.00 0.00 ? 108 CYS A C    2  
ATOM 3680  O O    . CYS A 1 108 ? 3.553   2.147   -2.218  1.00 0.00 ? 108 CYS A O    2  
ATOM 3681  C CB   . CYS A 1 108 ? 3.419   0.442   0.077   1.00 0.00 ? 108 CYS A CB   2  
ATOM 3682  S SG   . CYS A 1 108 ? 1.826   -0.399  -0.059  1.00 0.00 ? 108 CYS A SG   2  
ATOM 3683  H H    . CYS A 1 108 ? 5.861   1.495   -0.354  1.00 0.00 ? 108 CYS A H    2  
ATOM 3684  H HA   . CYS A 1 108 ? 4.387   -0.856  -1.331  1.00 0.00 ? 108 CYS A HA   2  
ATOM 3685  H HB2  . CYS A 1 108 ? 3.887   0.103   0.988   1.00 0.00 ? 108 CYS A HB2  2  
ATOM 3686  H HB3  . CYS A 1 108 ? 3.225   1.503   0.153   1.00 0.00 ? 108 CYS A HB3  2  
ATOM 3687  H HG   . CYS A 1 108 ? 1.312   -0.121  -1.255  1.00 0.00 ? 108 CYS A HG   2  
ATOM 3688  N N    . THR A 1 109 ? 4.039   0.359   -3.481  1.00 0.00 ? 109 THR A N    2  
ATOM 3689  C CA   . THR A 1 109 ? 3.541   0.953   -4.709  1.00 0.00 ? 109 THR A CA   2  
ATOM 3690  C C    . THR A 1 109 ? 2.226   0.289   -5.090  1.00 0.00 ? 109 THR A C    2  
ATOM 3691  O O    . THR A 1 109 ? 2.177   -0.923  -5.279  1.00 0.00 ? 109 THR A O    2  
ATOM 3692  C CB   . THR A 1 109 ? 4.554   0.792   -5.856  1.00 0.00 ? 109 THR A CB   2  
ATOM 3693  O OG1  . THR A 1 109 ? 5.842   1.260   -5.425  1.00 0.00 ? 109 THR A OG1  2  
ATOM 3694  C CG2  . THR A 1 109 ? 4.119   1.568   -7.091  1.00 0.00 ? 109 THR A CG2  2  
ATOM 3695  H H    . THR A 1 109 ? 4.456   -0.533  -3.514  1.00 0.00 ? 109 THR A H    2  
ATOM 3696  H HA   . THR A 1 109 ? 3.372   2.005   -4.535  1.00 0.00 ? 109 THR A HA   2  
ATOM 3697  H HB   . THR A 1 109 ? 4.626   -0.256  -6.110  1.00 0.00 ? 109 THR A HB   2  
ATOM 3698  H HG1  . THR A 1 109 ? 5.964   1.037   -4.496  1.00 0.00 ? 109 THR A HG1  2  
ATOM 3699  H HG21 . THR A 1 109 ? 3.153   1.212   -7.418  1.00 0.00 ? 109 THR A HG21 2  
ATOM 3700  H HG22 . THR A 1 109 ? 4.841   1.421   -7.881  1.00 0.00 ? 109 THR A HG22 2  
ATOM 3701  H HG23 . THR A 1 109 ? 4.054   2.619   -6.853  1.00 0.00 ? 109 THR A HG23 2  
ATOM 3702  N N    . ASN A 1 110 ? 1.169   1.070   -5.222  1.00 0.00 ? 110 ASN A N    2  
ATOM 3703  C CA   . ASN A 1 110 ? -0.157  0.501   -5.417  1.00 0.00 ? 110 ASN A CA   2  
ATOM 3704  C C    . ASN A 1 110 ? -0.734  0.942   -6.749  1.00 0.00 ? 110 ASN A C    2  
ATOM 3705  O O    . ASN A 1 110 ? -0.976  2.131   -6.965  1.00 0.00 ? 110 ASN A O    2  
ATOM 3706  C CB   . ASN A 1 110 ? -1.104  0.887   -4.277  1.00 0.00 ? 110 ASN A CB   2  
ATOM 3707  C CG   . ASN A 1 110 ? -0.772  0.199   -2.961  1.00 0.00 ? 110 ASN A CG   2  
ATOM 3708  O OD1  . ASN A 1 110 ? 0.386   -0.095  -2.664  1.00 0.00 ? 110 ASN A OD1  2  
ATOM 3709  N ND2  . ASN A 1 110 ? -1.792  -0.079  -2.165  1.00 0.00 ? 110 ASN A ND2  2  
ATOM 3710  H H    . ASN A 1 110 ? 1.293   2.042   -5.269  1.00 0.00 ? 110 ASN A H    2  
ATOM 3711  H HA   . ASN A 1 110 ? -0.048  -0.574  -5.430  1.00 0.00 ? 110 ASN A HA   2  
ATOM 3712  H HB2  . ASN A 1 110 ? -1.053  1.954   -4.123  1.00 0.00 ? 110 ASN A HB2  2  
ATOM 3713  H HB3  . ASN A 1 110 ? -2.113  0.617   -4.555  1.00 0.00 ? 110 ASN A HB3  2  
ATOM 3714  H HD21 . ASN A 1 110 ? -2.696  0.168   -2.464  1.00 0.00 ? 110 ASN A HD21 2  
ATOM 3715  H HD22 . ASN A 1 110 ? -1.606  -0.525  -1.314  1.00 0.00 ? 110 ASN A HD22 2  
ATOM 3716  N N    . THR A 1 111 ? -0.948  -0.026  -7.627  1.00 0.00 ? 111 THR A N    2  
ATOM 3717  C CA   . THR A 1 111 ? -1.461  0.225   -8.961  1.00 0.00 ? 111 THR A CA   2  
ATOM 3718  C C    . THR A 1 111 ? -2.973  0.049   -8.977  1.00 0.00 ? 111 THR A C    2  
ATOM 3719  O O    . THR A 1 111 ? -3.475  -1.036  -8.684  1.00 0.00 ? 111 THR A O    2  
ATOM 3720  C CB   . THR A 1 111 ? -0.846  -0.754  -9.987  1.00 0.00 ? 111 THR A CB   2  
ATOM 3721  O OG1  . THR A 1 111 ? 0.585   -0.774  -9.869  1.00 0.00 ? 111 THR A OG1  2  
ATOM 3722  C CG2  . THR A 1 111 ? -1.235  -0.371  -11.408 1.00 0.00 ? 111 THR A CG2  2  
ATOM 3723  H H    . THR A 1 111 ? -0.760  -0.953  -7.369  1.00 0.00 ? 111 THR A H    2  
ATOM 3724  H HA   . THR A 1 111 ? -1.208  1.235   -9.245  1.00 0.00 ? 111 THR A HA   2  
ATOM 3725  H HB   . THR A 1 111 ? -1.224  -1.744  -9.785  1.00 0.00 ? 111 THR A HB   2  
ATOM 3726  H HG1  . THR A 1 111 ? 0.941   0.111   -10.102 1.00 0.00 ? 111 THR A HG1  2  
ATOM 3727  H HG21 . THR A 1 111 ? -0.778  -1.059  -12.104 1.00 0.00 ? 111 THR A HG21 2  
ATOM 3728  H HG22 . THR A 1 111 ? -0.896  0.632   -11.620 1.00 0.00 ? 111 THR A HG22 2  
ATOM 3729  H HG23 . THR A 1 111 ? -2.310  -0.416  -11.511 1.00 0.00 ? 111 THR A HG23 2  
ATOM 3730  N N    . ASN A 1 112 ? -3.696  1.105   -9.317  1.00 0.00 ? 112 ASN A N    2  
ATOM 3731  C CA   . ASN A 1 112 ? -5.146  1.031   -9.372  1.00 0.00 ? 112 ASN A CA   2  
ATOM 3732  C C    . ASN A 1 112 ? -5.578  0.363   -10.665 1.00 0.00 ? 112 ASN A C    2  
ATOM 3733  O O    . ASN A 1 112 ? -5.416  0.925   -11.746 1.00 0.00 ? 112 ASN A O    2  
ATOM 3734  C CB   . ASN A 1 112 ? -5.762  2.426   -9.280  1.00 0.00 ? 112 ASN A CB   2  
ATOM 3735  C CG   . ASN A 1 112 ? -7.279  2.391   -9.149  1.00 0.00 ? 112 ASN A CG   2  
ATOM 3736  O OD1  . ASN A 1 112 ? -7.975  3.286   -9.625  1.00 0.00 ? 112 ASN A OD1  2  
ATOM 3737  N ND2  . ASN A 1 112 ? -7.808  1.362   -8.493  1.00 0.00 ? 112 ASN A ND2  2  
ATOM 3738  H H    . ASN A 1 112 ? -3.244  1.940   -9.558  1.00 0.00 ? 112 ASN A H    2  
ATOM 3739  H HA   . ASN A 1 112 ? -5.485  0.435   -8.536  1.00 0.00 ? 112 ASN A HA   2  
ATOM 3740  H HB2  . ASN A 1 112 ? -5.349  2.937   -8.426  1.00 0.00 ? 112 ASN A HB2  2  
ATOM 3741  H HB3  . ASN A 1 112 ? -5.513  2.976   -10.173 1.00 0.00 ? 112 ASN A HB3  2  
ATOM 3742  H HD21 . ASN A 1 112 ? -7.205  0.684   -8.128  1.00 0.00 ? 112 ASN A HD21 2  
ATOM 3743  H HD22 . ASN A 1 112 ? -8.783  1.322   -8.406  1.00 0.00 ? 112 ASN A HD22 2  
ATOM 3744  N N    . VAL A 1 113 ? -6.110  -0.843  -10.554 1.00 0.00 ? 113 VAL A N    2  
ATOM 3745  C CA   . VAL A 1 113 ? -6.528  -1.591  -11.723 1.00 0.00 ? 113 VAL A CA   2  
ATOM 3746  C C    . VAL A 1 113 ? -8.033  -1.451  -11.924 1.00 0.00 ? 113 VAL A C    2  
ATOM 3747  O O    . VAL A 1 113 ? -8.506  -0.513  -12.565 1.00 0.00 ? 113 VAL A O    2  
ATOM 3748  C CB   . VAL A 1 113 ? -6.160  -3.088  -11.599 1.00 0.00 ? 113 VAL A CB   2  
ATOM 3749  C CG1  . VAL A 1 113 ? -6.355  -3.811  -12.928 1.00 0.00 ? 113 VAL A CG1  2  
ATOM 3750  C CG2  . VAL A 1 113 ? -4.731  -3.259  -11.092 1.00 0.00 ? 113 VAL A CG2  2  
ATOM 3751  H H    . VAL A 1 113 ? -6.231  -1.243  -9.665  1.00 0.00 ? 113 VAL A H    2  
ATOM 3752  H HA   . VAL A 1 113 ? -6.017  -1.183  -12.584 1.00 0.00 ? 113 VAL A HA   2  
ATOM 3753  H HB   . VAL A 1 113 ? -6.828  -3.538  -10.877 1.00 0.00 ? 113 VAL A HB   2  
ATOM 3754  H HG11 . VAL A 1 113 ? -5.739  -3.347  -13.684 1.00 0.00 ? 113 VAL A HG11 2  
ATOM 3755  H HG12 . VAL A 1 113 ? -7.393  -3.748  -13.221 1.00 0.00 ? 113 VAL A HG12 2  
ATOM 3756  H HG13 . VAL A 1 113 ? -6.074  -4.847  -12.819 1.00 0.00 ? 113 VAL A HG13 2  
ATOM 3757  H HG21 . VAL A 1 113 ? -4.502  -4.311  -11.005 1.00 0.00 ? 113 VAL A HG21 2  
ATOM 3758  H HG22 . VAL A 1 113 ? -4.631  -2.789  -10.125 1.00 0.00 ? 113 VAL A HG22 2  
ATOM 3759  H HG23 . VAL A 1 113 ? -4.043  -2.800  -11.786 1.00 0.00 ? 113 VAL A HG23 2  
ATOM 3760  N N    . LYS A 1 114 ? -8.781  -2.388  -11.363 1.00 0.00 ? 114 LYS A N    2  
ATOM 3761  C CA   . LYS A 1 114 ? -10.233 -2.363  -11.434 1.00 0.00 ? 114 LYS A CA   2  
ATOM 3762  C C    . LYS A 1 114 ? -10.832 -1.858  -10.132 1.00 0.00 ? 114 LYS A C    2  
ATOM 3763  O O    . LYS A 1 114 ? -10.118 -1.528  -9.188  1.00 0.00 ? 114 LYS A O    2  
ATOM 3764  C CB   . LYS A 1 114 ? -10.764 -3.767  -11.719 1.00 0.00 ? 114 LYS A CB   2  
ATOM 3765  C CG   . LYS A 1 114 ? -10.400 -4.298  -13.092 1.00 0.00 ? 114 LYS A CG   2  
ATOM 3766  C CD   . LYS A 1 114 ? -10.868 -5.734  -13.271 1.00 0.00 ? 114 LYS A CD   2  
ATOM 3767  C CE   . LYS A 1 114 ? -12.372 -5.877  -13.068 1.00 0.00 ? 114 LYS A CE   2  
ATOM 3768  N NZ   . LYS A 1 114 ? -13.158 -5.074  -14.042 1.00 0.00 ? 114 LYS A NZ   2  
ATOM 3769  H H    . LYS A 1 114 ? -8.343  -3.142  -10.922 1.00 0.00 ? 114 LYS A H    2  
ATOM 3770  H HA   . LYS A 1 114 ? -10.522 -1.703  -12.239 1.00 0.00 ? 114 LYS A HA   2  
ATOM 3771  H HB2  . LYS A 1 114 ? -10.365 -4.445  -10.979 1.00 0.00 ? 114 LYS A HB2  2  
ATOM 3772  H HB3  . LYS A 1 114 ? -11.839 -3.752  -11.636 1.00 0.00 ? 114 LYS A HB3  2  
ATOM 3773  H HG2  . LYS A 1 114 ? -10.869 -3.679  -13.843 1.00 0.00 ? 114 LYS A HG2  2  
ATOM 3774  H HG3  . LYS A 1 114 ? -9.325  -4.259  -13.211 1.00 0.00 ? 114 LYS A HG3  2  
ATOM 3775  H HD2  . LYS A 1 114 ? -10.619 -6.062  -14.269 1.00 0.00 ? 114 LYS A HD2  2  
ATOM 3776  H HD3  . LYS A 1 114 ? -10.360 -6.354  -12.550 1.00 0.00 ? 114 LYS A HD3  2  
ATOM 3777  H HE2  . LYS A 1 114 ? -12.637 -6.916  -13.183 1.00 0.00 ? 114 LYS A HE2  2  
ATOM 3778  H HE3  . LYS A 1 114 ? -12.617 -5.556  -12.066 1.00 0.00 ? 114 LYS A HE3  2  
ATOM 3779  H HZ1  . LYS A 1 114 ? -14.167 -5.100  -13.789 1.00 0.00 ? 114 LYS A HZ1  2  
ATOM 3780  H HZ2  . LYS A 1 114 ? -13.044 -5.461  -15.004 1.00 0.00 ? 114 LYS A HZ2  2  
ATOM 3781  H HZ3  . LYS A 1 114 ? -12.837 -4.081  -14.039 1.00 0.00 ? 114 LYS A HZ3  2  
ATOM 3782  N N    . ASN A 1 115 ? -12.147 -1.797  -10.097 1.00 0.00 ? 115 ASN A N    2  
ATOM 3783  C CA   . ASN A 1 115 ? -12.876 -1.481  -8.882  1.00 0.00 ? 115 ASN A CA   2  
ATOM 3784  C C    . ASN A 1 115 ? -13.922 -2.561  -8.658  1.00 0.00 ? 115 ASN A C    2  
ATOM 3785  O O    . ASN A 1 115 ? -14.615 -2.962  -9.595  1.00 0.00 ? 115 ASN A O    2  
ATOM 3786  C CB   . ASN A 1 115 ? -13.529 -0.101  -8.994  1.00 0.00 ? 115 ASN A CB   2  
ATOM 3787  C CG   . ASN A 1 115 ? -14.035 0.429   -7.663  1.00 0.00 ? 115 ASN A CG   2  
ATOM 3788  O OD1  . ASN A 1 115 ? -14.456 -0.331  -6.788  1.00 0.00 ? 115 ASN A OD1  2  
ATOM 3789  N ND2  . ASN A 1 115 ? -13.975 1.738   -7.493  1.00 0.00 ? 115 ASN A ND2  2  
ATOM 3790  H H    . ASN A 1 115 ? -12.651 -1.953  -10.926 1.00 0.00 ? 115 ASN A H    2  
ATOM 3791  H HA   . ASN A 1 115 ? -12.178 -1.486  -8.057  1.00 0.00 ? 115 ASN A HA   2  
ATOM 3792  H HB2  . ASN A 1 115 ? -12.806 0.599   -9.387  1.00 0.00 ? 115 ASN A HB2  2  
ATOM 3793  H HB3  . ASN A 1 115 ? -14.365 -0.165  -9.678  1.00 0.00 ? 115 ASN A HB3  2  
ATOM 3794  H HD21 . ASN A 1 115 ? -13.615 2.284   -8.223  1.00 0.00 ? 115 ASN A HD21 2  
ATOM 3795  H HD22 . ASN A 1 115 ? -14.296 2.117   -6.639  1.00 0.00 ? 115 ASN A HD22 2  
ATOM 3796  N N    . SER A 1 116 ? -14.021 -3.041  -7.431  1.00 0.00 ? 116 SER A N    2  
ATOM 3797  C CA   . SER A 1 116 ? -14.874 -4.175  -7.131  1.00 0.00 ? 116 SER A CA   2  
ATOM 3798  C C    . SER A 1 116 ? -16.327 -3.735  -6.977  1.00 0.00 ? 116 SER A C    2  
ATOM 3799  O O    . SER A 1 116 ? -17.242 -4.516  -7.241  1.00 0.00 ? 116 SER A O    2  
ATOM 3800  C CB   . SER A 1 116 ? -14.385 -4.878  -5.860  1.00 0.00 ? 116 SER A CB   2  
ATOM 3801  O OG   . SER A 1 116 ? -15.001 -6.143  -5.691  1.00 0.00 ? 116 SER A OG   2  
ATOM 3802  H H    . SER A 1 116 ? -13.526 -2.608  -6.702  1.00 0.00 ? 116 SER A H    2  
ATOM 3803  H HA   . SER A 1 116 ? -14.808 -4.865  -7.960  1.00 0.00 ? 116 SER A HA   2  
ATOM 3804  H HB2  . SER A 1 116 ? -13.316 -5.021  -5.920  1.00 0.00 ? 116 SER A HB2  2  
ATOM 3805  H HB3  . SER A 1 116 ? -14.615 -4.261  -5.002  1.00 0.00 ? 116 SER A HB3  2  
ATOM 3806  H HG   . SER A 1 116 ? -15.116 -6.563  -6.558  1.00 0.00 ? 116 SER A HG   2  
ATOM 3807  N N    . SER A 1 117 ? -16.534 -2.485  -6.559  1.00 0.00 ? 117 SER A N    2  
ATOM 3808  C CA   . SER A 1 117 ? -17.879 -1.957  -6.380  1.00 0.00 ? 117 SER A CA   2  
ATOM 3809  C C    . SER A 1 117 ? -17.837 -0.495  -5.943  1.00 0.00 ? 117 SER A C    2  
ATOM 3810  O O    . SER A 1 117 ? -17.106 -0.136  -5.018  1.00 0.00 ? 117 SER A O    2  
ATOM 3811  C CB   . SER A 1 117 ? -18.637 -2.784  -5.334  1.00 0.00 ? 117 SER A CB   2  
ATOM 3812  O OG   . SER A 1 117 ? -20.013 -2.454  -5.312  1.00 0.00 ? 117 SER A OG   2  
ATOM 3813  H H    . SER A 1 117 ? -15.761 -1.902  -6.368  1.00 0.00 ? 117 SER A H    2  
ATOM 3814  H HA   . SER A 1 117 ? -18.395 -2.025  -7.327  1.00 0.00 ? 117 SER A HA   2  
ATOM 3815  H HB2  . SER A 1 117 ? -18.536 -3.833  -5.567  1.00 0.00 ? 117 SER A HB2  2  
ATOM 3816  H HB3  . SER A 1 117 ? -18.217 -2.593  -4.357  1.00 0.00 ? 117 SER A HB3  2  
ATOM 3817  H HG   . SER A 1 117 ? -20.273 -2.218  -4.402  1.00 0.00 ? 117 SER A HG   2  
ATOM 3818  N N    . GLN A 1 118 ? -18.627 0.338   -6.614  1.00 0.00 ? 118 GLN A N    2  
ATOM 3819  C CA   . GLN A 1 118 ? -18.809 1.731   -6.212  1.00 0.00 ? 118 GLN A CA   2  
ATOM 3820  C C    . GLN A 1 118 ? -19.710 1.805   -4.984  1.00 0.00 ? 118 GLN A C    2  
ATOM 3821  O O    . GLN A 1 118 ? -19.849 2.858   -4.360  1.00 0.00 ? 118 GLN A O    2  
ATOM 3822  C CB   . GLN A 1 118 ? -19.451 2.540   -7.344  1.00 0.00 ? 118 GLN A CB   2  
ATOM 3823  C CG   . GLN A 1 118 ? -18.532 2.836   -8.521  1.00 0.00 ? 118 GLN A CG   2  
ATOM 3824  C CD   . GLN A 1 118 ? -17.408 3.785   -8.155  1.00 0.00 ? 118 GLN A CD   2  
ATOM 3825  O OE1  . GLN A 1 118 ? -16.313 3.364   -7.794  1.00 0.00 ? 118 GLN A OE1  2  
ATOM 3826  N NE2  . GLN A 1 118 ? -17.681 5.078   -8.229  1.00 0.00 ? 118 GLN A NE2  2  
ATOM 3827  H H    . GLN A 1 118 ? -19.101 0.005   -7.415  1.00 0.00 ? 118 GLN A H    2  
ATOM 3828  H HA   . GLN A 1 118 ? -17.843 2.146   -5.974  1.00 0.00 ? 118 GLN A HA   2  
ATOM 3829  H HB2  . GLN A 1 118 ? -20.305 1.994   -7.718  1.00 0.00 ? 118 GLN A HB2  2  
ATOM 3830  H HB3  . GLN A 1 118 ? -19.791 3.481   -6.940  1.00 0.00 ? 118 GLN A HB3  2  
ATOM 3831  H HG2  . GLN A 1 118 ? -18.101 1.909   -8.868  1.00 0.00 ? 118 GLN A HG2  2  
ATOM 3832  H HG3  . GLN A 1 118 ? -19.116 3.280   -9.312  1.00 0.00 ? 118 GLN A HG3  2  
ATOM 3833  H HE21 . GLN A 1 118 ? -18.581 5.347   -8.514  1.00 0.00 ? 118 GLN A HE21 2  
ATOM 3834  H HE22 . GLN A 1 118 ? -16.975 5.716   -7.984  1.00 0.00 ? 118 GLN A HE22 2  
ATOM 3835  N N    . GLU A 1 119 ? -20.327 0.678   -4.656  1.00 0.00 ? 119 GLU A N    2  
ATOM 3836  C CA   . GLU A 1 119 ? -21.285 0.604   -3.564  1.00 0.00 ? 119 GLU A CA   2  
ATOM 3837  C C    . GLU A 1 119 ? -20.859 -0.448  -2.542  1.00 0.00 ? 119 GLU A C    2  
ATOM 3838  O O    . GLU A 1 119 ? -20.621 -0.081  -1.373  1.00 0.00 ? 119 GLU A O    2  
ATOM 3839  C CB   . GLU A 1 119 ? -22.684 0.305   -4.125  1.00 0.00 ? 119 GLU A CB   2  
ATOM 3840  C CG   . GLU A 1 119 ? -22.710 -0.838  -5.131  1.00 0.00 ? 119 GLU A CG   2  
ATOM 3841  C CD   . GLU A 1 119 ? -24.018 -0.931  -5.885  1.00 0.00 ? 119 GLU A CD   2  
ATOM 3842  O OE1  . GLU A 1 119 ? -24.238 -0.108  -6.800  1.00 0.00 ? 119 GLU A OE1  2  
ATOM 3843  O OE2  . GLU A 1 119 ? -24.822 -1.838  -5.589  1.00 0.00 ? 119 GLU A OE2  2  
ATOM 3844  O OXT  . GLU A 1 119 ? -20.733 -1.633  -2.918  1.00 0.00 ? 119 GLU A OXT  2  
ATOM 3845  H H    . GLU A 1 119 ? -20.123 -0.135  -5.160  1.00 0.00 ? 119 GLU A H    2  
ATOM 3846  H HA   . GLU A 1 119 ? -21.306 1.568   -3.076  1.00 0.00 ? 119 GLU A HA   2  
ATOM 3847  H HB2  . GLU A 1 119 ? -23.342 0.053   -3.308  1.00 0.00 ? 119 GLU A HB2  2  
ATOM 3848  H HB3  . GLU A 1 119 ? -23.058 1.193   -4.614  1.00 0.00 ? 119 GLU A HB3  2  
ATOM 3849  H HG2  . GLU A 1 119 ? -21.915 -0.687  -5.847  1.00 0.00 ? 119 GLU A HG2  2  
ATOM 3850  H HG3  . GLU A 1 119 ? -22.545 -1.767  -4.606  1.00 0.00 ? 119 GLU A HG3  2  
ATOM 3851  N N    . GLY A 1 1   ? -4.931  17.725  8.593   1.00 0.00 ? 1   GLY A N    3  
ATOM 3852  C CA   . GLY A 1 1   ? -5.131  17.234  7.210   1.00 0.00 ? 1   GLY A CA   3  
ATOM 3853  C C    . GLY A 1 1   ? -5.192  18.364  6.206   1.00 0.00 ? 1   GLY A C    3  
ATOM 3854  O O    . GLY A 1 1   ? -4.364  19.278  6.248   1.00 0.00 ? 1   GLY A O    3  
ATOM 3855  H H1   . GLY A 1 1   ? -4.906  16.921  9.256   1.00 0.00 ? 1   GLY A H1   3  
ATOM 3856  H H2   . GLY A 1 1   ? -5.713  18.361  8.861   1.00 0.00 ? 1   GLY A H2   3  
ATOM 3857  H H3   . GLY A 1 1   ? -4.033  18.252  8.661   1.00 0.00 ? 1   GLY A H3   3  
ATOM 3858  H HA2  . GLY A 1 1   ? -4.314  16.579  6.948   1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3859  H HA3  . GLY A 1 1   ? -6.056  16.677  7.166   1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3860  N N    . ALA A 1 2   ? -6.184  18.308  5.317   1.00 0.00 ? 2   ALA A N    3  
ATOM 3861  C CA   . ALA A 1 2   ? -6.354  19.301  4.260   1.00 0.00 ? 2   ALA A CA   3  
ATOM 3862  C C    . ALA A 1 2   ? -5.079  19.447  3.434   1.00 0.00 ? 2   ALA A C    3  
ATOM 3863  O O    . ALA A 1 2   ? -4.514  20.540  3.318   1.00 0.00 ? 2   ALA A O    3  
ATOM 3864  C CB   . ALA A 1 2   ? -6.782  20.638  4.847   1.00 0.00 ? 2   ALA A CB   3  
ATOM 3865  H H    . ALA A 1 2   ? -6.843  17.575  5.386   1.00 0.00 ? 2   ALA A H    3  
ATOM 3866  H HA   . ALA A 1 2   ? -7.144  18.954  3.610   1.00 0.00 ? 2   ALA A HA   3  
ATOM 3867  H HB1  . ALA A 1 2   ? -7.685  20.505  5.423   1.00 0.00 ? 2   ALA A HB1  3  
ATOM 3868  H HB2  . ALA A 1 2   ? -6.965  21.340  4.047   1.00 0.00 ? 2   ALA A HB2  3  
ATOM 3869  H HB3  . ALA A 1 2   ? -5.999  21.018  5.487   1.00 0.00 ? 2   ALA A HB3  3  
ATOM 3870  N N    . MET A 1 3   ? -4.626  18.335  2.868   1.00 0.00 ? 3   MET A N    3  
ATOM 3871  C CA   . MET A 1 3   ? -3.412  18.325  2.058   1.00 0.00 ? 3   MET A CA   3  
ATOM 3872  C C    . MET A 1 3   ? -3.697  18.853  0.656   1.00 0.00 ? 3   MET A C    3  
ATOM 3873  O O    . MET A 1 3   ? -4.847  18.884  0.217   1.00 0.00 ? 3   MET A O    3  
ATOM 3874  C CB   . MET A 1 3   ? -2.837  16.906  1.968   1.00 0.00 ? 3   MET A CB   3  
ATOM 3875  C CG   . MET A 1 3   ? -2.391  16.329  3.302   1.00 0.00 ? 3   MET A CG   3  
ATOM 3876  S SD   . MET A 1 3   ? -1.040  17.253  4.063   1.00 0.00 ? 3   MET A SD   3  
ATOM 3877  C CE   . MET A 1 3   ? 0.237   17.120  2.812   1.00 0.00 ? 3   MET A CE   3  
ATOM 3878  H H    . MET A 1 3   ? -5.125  17.502  2.994   1.00 0.00 ? 3   MET A H    3  
ATOM 3879  H HA   . MET A 1 3   ? -2.687  18.970  2.534   1.00 0.00 ? 3   MET A HA   3  
ATOM 3880  H HB2  . MET A 1 3   ? -3.591  16.254  1.554   1.00 0.00 ? 3   MET A HB2  3  
ATOM 3881  H HB3  . MET A 1 3   ? -1.985  16.921  1.304   1.00 0.00 ? 3   MET A HB3  3  
ATOM 3882  H HG2  . MET A 1 3   ? -3.232  16.333  3.979   1.00 0.00 ? 3   MET A HG2  3  
ATOM 3883  H HG3  . MET A 1 3   ? -2.066  15.309  3.145   1.00 0.00 ? 3   MET A HG3  3  
ATOM 3884  H HE1  . MET A 1 3   ? 0.464   16.080  2.636   1.00 0.00 ? 3   MET A HE1  3  
ATOM 3885  H HE2  . MET A 1 3   ? 1.125   17.630  3.152   1.00 0.00 ? 3   MET A HE2  3  
ATOM 3886  H HE3  . MET A 1 3   ? -0.109  17.574  1.895   1.00 0.00 ? 3   MET A HE3  3  
ATOM 3887  N N    . ASP A 1 4   ? -2.645  19.257  -0.039  1.00 0.00 ? 4   ASP A N    3  
ATOM 3888  C CA   . ASP A 1 4   ? -2.770  19.791  -1.391  1.00 0.00 ? 4   ASP A CA   3  
ATOM 3889  C C    . ASP A 1 4   ? -2.758  18.664  -2.425  1.00 0.00 ? 4   ASP A C    3  
ATOM 3890  O O    . ASP A 1 4   ? -1.721  18.063  -2.705  1.00 0.00 ? 4   ASP A O    3  
ATOM 3891  C CB   . ASP A 1 4   ? -1.648  20.802  -1.672  1.00 0.00 ? 4   ASP A CB   3  
ATOM 3892  C CG   . ASP A 1 4   ? -0.253  20.195  -1.620  1.00 0.00 ? 4   ASP A CG   3  
ATOM 3893  O OD1  . ASP A 1 4   ? 0.101   19.568  -0.593  1.00 0.00 ? 4   ASP A OD1  3  
ATOM 3894  O OD2  . ASP A 1 4   ? 0.500   20.350  -2.609  1.00 0.00 ? 4   ASP A OD2  3  
ATOM 3895  H H    . ASP A 1 4   ? -1.750  19.200  0.364   1.00 0.00 ? 4   ASP A H    3  
ATOM 3896  H HA   . ASP A 1 4   ? -3.720  20.301  -1.453  1.00 0.00 ? 4   ASP A HA   3  
ATOM 3897  H HB2  . ASP A 1 4   ? -1.794  21.222  -2.655  1.00 0.00 ? 4   ASP A HB2  3  
ATOM 3898  H HB3  . ASP A 1 4   ? -1.700  21.594  -0.940  1.00 0.00 ? 4   ASP A HB3  3  
ATOM 3899  N N    . ASN A 1 5   ? -3.922  18.365  -2.978  1.00 0.00 ? 5   ASN A N    3  
ATOM 3900  C CA   . ASN A 1 5   ? -4.045  17.298  -3.965  1.00 0.00 ? 5   ASN A CA   3  
ATOM 3901  C C    . ASN A 1 5   ? -5.005  17.715  -5.069  1.00 0.00 ? 5   ASN A C    3  
ATOM 3902  O O    . ASN A 1 5   ? -6.056  18.291  -4.790  1.00 0.00 ? 5   ASN A O    3  
ATOM 3903  C CB   . ASN A 1 5   ? -4.566  16.009  -3.320  1.00 0.00 ? 5   ASN A CB   3  
ATOM 3904  C CG   . ASN A 1 5   ? -3.831  15.613  -2.050  1.00 0.00 ? 5   ASN A CG   3  
ATOM 3905  O OD1  . ASN A 1 5   ? -2.812  14.934  -2.089  1.00 0.00 ? 5   ASN A OD1  3  
ATOM 3906  N ND2  . ASN A 1 5   ? -4.358  16.021  -0.907  1.00 0.00 ? 5   ASN A ND2  3  
ATOM 3907  H H    . ASN A 1 5   ? -4.723  18.871  -2.722  1.00 0.00 ? 5   ASN A H    3  
ATOM 3908  H HA   . ASN A 1 5   ? -3.070  17.118  -4.391  1.00 0.00 ? 5   ASN A HA   3  
ATOM 3909  H HB2  . ASN A 1 5   ? -5.609  16.139  -3.077  1.00 0.00 ? 5   ASN A HB2  3  
ATOM 3910  H HB3  . ASN A 1 5   ? -4.470  15.202  -4.031  1.00 0.00 ? 5   ASN A HB3  3  
ATOM 3911  H HD21 . ASN A 1 5   ? -5.191  16.555  -0.943  1.00 0.00 ? 5   ASN A HD21 3  
ATOM 3912  H HD22 . ASN A 1 5   ? -3.903  15.780  -0.077  1.00 0.00 ? 5   ASN A HD22 3  
ATOM 3913  N N    . VAL A 1 6   ? -4.642  17.440  -6.317  1.00 0.00 ? 6   VAL A N    3  
ATOM 3914  C CA   . VAL A 1 6   ? -5.522  17.707  -7.449  1.00 0.00 ? 6   VAL A CA   3  
ATOM 3915  C C    . VAL A 1 6   ? -4.966  17.083  -8.727  1.00 0.00 ? 6   VAL A C    3  
ATOM 3916  O O    . VAL A 1 6   ? -3.777  17.213  -9.021  1.00 0.00 ? 6   VAL A O    3  
ATOM 3917  C CB   . VAL A 1 6   ? -5.754  19.226  -7.661  1.00 0.00 ? 6   VAL A CB   3  
ATOM 3918  C CG1  . VAL A 1 6   ? -4.454  19.948  -7.986  1.00 0.00 ? 6   VAL A CG1  3  
ATOM 3919  C CG2  . VAL A 1 6   ? -6.793  19.465  -8.746  1.00 0.00 ? 6   VAL A CG2  3  
ATOM 3920  H H    . VAL A 1 6   ? -3.758  17.048  -6.485  1.00 0.00 ? 6   VAL A H    3  
ATOM 3921  H HA   . VAL A 1 6   ? -6.478  17.250  -7.233  1.00 0.00 ? 6   VAL A HA   3  
ATOM 3922  H HB   . VAL A 1 6   ? -6.139  19.637  -6.738  1.00 0.00 ? 6   VAL A HB   3  
ATOM 3923  H HG11 . VAL A 1 6   ? -4.022  19.525  -8.882  1.00 0.00 ? 6   VAL A HG11 3  
ATOM 3924  H HG12 . VAL A 1 6   ? -3.763  19.832  -7.163  1.00 0.00 ? 6   VAL A HG12 3  
ATOM 3925  H HG13 . VAL A 1 6   ? -4.654  20.998  -8.144  1.00 0.00 ? 6   VAL A HG13 3  
ATOM 3926  H HG21 . VAL A 1 6   ? -7.728  19.007  -8.458  1.00 0.00 ? 6   VAL A HG21 3  
ATOM 3927  H HG22 . VAL A 1 6   ? -6.451  19.030  -9.675  1.00 0.00 ? 6   VAL A HG22 3  
ATOM 3928  H HG23 . VAL A 1 6   ? -6.938  20.527  -8.878  1.00 0.00 ? 6   VAL A HG23 3  
ATOM 3929  N N    . CYS A 1 7   ? -5.833  16.390  -9.465  1.00 0.00 ? 7   CYS A N    3  
ATOM 3930  C CA   . CYS A 1 7   ? -5.453  15.730  -10.713 1.00 0.00 ? 7   CYS A CA   3  
ATOM 3931  C C    . CYS A 1 7   ? -4.273  14.789  -10.484 1.00 0.00 ? 7   CYS A C    3  
ATOM 3932  O O    . CYS A 1 7   ? -3.219  14.915  -11.114 1.00 0.00 ? 7   CYS A O    3  
ATOM 3933  C CB   . CYS A 1 7   ? -5.121  16.766  -11.794 1.00 0.00 ? 7   CYS A CB   3  
ATOM 3934  S SG   . CYS A 1 7   ? -4.806  16.059  -13.430 1.00 0.00 ? 7   CYS A SG   3  
ATOM 3935  H H    . CYS A 1 7   ? -6.763  16.318  -9.158  1.00 0.00 ? 7   CYS A H    3  
ATOM 3936  H HA   . CYS A 1 7   ? -6.297  15.141  -11.041 1.00 0.00 ? 7   CYS A HA   3  
ATOM 3937  H HB2  . CYS A 1 7   ? -5.949  17.454  -11.889 1.00 0.00 ? 7   CYS A HB2  3  
ATOM 3938  H HB3  . CYS A 1 7   ? -4.238  17.314  -11.497 1.00 0.00 ? 7   CYS A HB3  3  
ATOM 3939  H HG   . CYS A 1 7   ? -3.590  15.529  -13.410 1.00 0.00 ? 7   CYS A HG   3  
ATOM 3940  N N    . GLN A 1 8   ? -4.454  13.852  -9.570  1.00 0.00 ? 8   GLN A N    3  
ATOM 3941  C CA   . GLN A 1 8   ? -3.409  12.901  -9.242  1.00 0.00 ? 8   GLN A CA   3  
ATOM 3942  C C    . GLN A 1 8   ? -3.600  11.611  -10.030 1.00 0.00 ? 8   GLN A C    3  
ATOM 3943  O O    . GLN A 1 8   ? -4.732  11.180  -10.269 1.00 0.00 ? 8   GLN A O    3  
ATOM 3944  C CB   . GLN A 1 8   ? -3.422  12.596  -7.742  1.00 0.00 ? 8   GLN A CB   3  
ATOM 3945  C CG   . GLN A 1 8   ? -3.236  13.819  -6.858  1.00 0.00 ? 8   GLN A CG   3  
ATOM 3946  C CD   . GLN A 1 8   ? -1.926  14.530  -7.117  1.00 0.00 ? 8   GLN A CD   3  
ATOM 3947  O OE1  . GLN A 1 8   ? -1.853  15.443  -7.934  1.00 0.00 ? 8   GLN A OE1  3  
ATOM 3948  N NE2  . GLN A 1 8   ? -0.882  14.117  -6.424  1.00 0.00 ? 8   GLN A NE2  3  
ATOM 3949  H H    . GLN A 1 8   ? -5.322  13.797  -9.103  1.00 0.00 ? 8   GLN A H    3  
ATOM 3950  H HA   . GLN A 1 8   ? -2.461  13.339  -9.509  1.00 0.00 ? 8   GLN A HA   3  
ATOM 3951  H HB2  . GLN A 1 8   ? -4.366  12.136  -7.488  1.00 0.00 ? 8   GLN A HB2  3  
ATOM 3952  H HB3  . GLN A 1 8   ? -2.626  11.899  -7.528  1.00 0.00 ? 8   GLN A HB3  3  
ATOM 3953  H HG2  . GLN A 1 8   ? -4.045  14.507  -7.044  1.00 0.00 ? 8   GLN A HG2  3  
ATOM 3954  H HG3  . GLN A 1 8   ? -3.261  13.506  -5.824  1.00 0.00 ? 8   GLN A HG3  3  
ATOM 3955  H HE21 . GLN A 1 8   ? -1.008  13.384  -5.787  1.00 0.00 ? 8   GLN A HE21 3  
ATOM 3956  H HE22 . GLN A 1 8   ? -0.014  14.557  -6.586  1.00 0.00 ? 8   GLN A HE22 3  
ATOM 3957  N N    . PRO A 1 9   ? -2.495  10.998  -10.479 1.00 0.00 ? 9   PRO A N    3  
ATOM 3958  C CA   . PRO A 1 9   ? -2.524  9.678   -11.112 1.00 0.00 ? 9   PRO A CA   3  
ATOM 3959  C C    . PRO A 1 9   ? -2.978  8.609   -10.121 1.00 0.00 ? 9   PRO A C    3  
ATOM 3960  O O    . PRO A 1 9   ? -2.780  8.757   -8.915  1.00 0.00 ? 9   PRO A O    3  
ATOM 3961  C CB   . PRO A 1 9   ? -1.065  9.437   -11.533 1.00 0.00 ? 9   PRO A CB   3  
ATOM 3962  C CG   . PRO A 1 9   ? -0.415  10.777  -11.489 1.00 0.00 ? 9   PRO A CG   3  
ATOM 3963  C CD   . PRO A 1 9   ? -1.131  11.545  -10.418 1.00 0.00 ? 9   PRO A CD   3  
ATOM 3964  H HA   . PRO A 1 9   ? -3.167  9.666   -11.980 1.00 0.00 ? 9   PRO A HA   3  
ATOM 3965  H HB2  . PRO A 1 9   ? -0.600  8.751   -10.842 1.00 0.00 ? 9   PRO A HB2  3  
ATOM 3966  H HB3  . PRO A 1 9   ? -1.042  9.021   -12.529 1.00 0.00 ? 9   PRO A HB3  3  
ATOM 3967  H HG2  . PRO A 1 9   ? 0.631   10.670  -11.238 1.00 0.00 ? 9   PRO A HG2  3  
ATOM 3968  H HG3  . PRO A 1 9   ? -0.524  11.274  -12.444 1.00 0.00 ? 9   PRO A HG3  3  
ATOM 3969  H HD2  . PRO A 1 9   ? -0.683  11.358  -9.452  1.00 0.00 ? 9   PRO A HD2  3  
ATOM 3970  H HD3  . PRO A 1 9   ? -1.129  12.601  -10.641 1.00 0.00 ? 9   PRO A HD3  3  
ATOM 3971  N N    . THR A 1 10  ? -3.570  7.531   -10.621 1.00 0.00 ? 10  THR A N    3  
ATOM 3972  C CA   . THR A 1 10  ? -4.133  6.510   -9.751  1.00 0.00 ? 10  THR A CA   3  
ATOM 3973  C C    . THR A 1 10  ? -3.096  5.464   -9.356  1.00 0.00 ? 10  THR A C    3  
ATOM 3974  O O    . THR A 1 10  ? -3.409  4.285   -9.170  1.00 0.00 ? 10  THR A O    3  
ATOM 3975  C CB   . THR A 1 10  ? -5.344  5.832   -10.404 1.00 0.00 ? 10  THR A CB   3  
ATOM 3976  O OG1  . THR A 1 10  ? -5.055  5.508   -11.771 1.00 0.00 ? 10  THR A OG1  3  
ATOM 3977  C CG2  . THR A 1 10  ? -6.564  6.733   -10.326 1.00 0.00 ? 10  THR A CG2  3  
ATOM 3978  H H    . THR A 1 10  ? -3.619  7.407   -11.597 1.00 0.00 ? 10  THR A H    3  
ATOM 3979  H HA   . THR A 1 10  ? -4.476  7.005   -8.854  1.00 0.00 ? 10  THR A HA   3  
ATOM 3980  H HB   . THR A 1 10  ? -5.556  4.924   -9.865  1.00 0.00 ? 10  THR A HB   3  
ATOM 3981  H HG1  . THR A 1 10  ? -4.415  4.775   -11.799 1.00 0.00 ? 10  THR A HG1  3  
ATOM 3982  H HG21 . THR A 1 10  ? -6.776  6.963   -9.292  1.00 0.00 ? 10  THR A HG21 3  
ATOM 3983  H HG22 . THR A 1 10  ? -7.410  6.228   -10.763 1.00 0.00 ? 10  THR A HG22 3  
ATOM 3984  H HG23 . THR A 1 10  ? -6.371  7.647   -10.867 1.00 0.00 ? 10  THR A HG23 3  
ATOM 3985  N N    . GLU A 1 11  ? -1.856  5.902   -9.261  1.00 0.00 ? 11  GLU A N    3  
ATOM 3986  C CA   . GLU A 1 11  ? -0.807  5.105   -8.671  1.00 0.00 ? 11  GLU A CA   3  
ATOM 3987  C C    . GLU A 1 11  ? -0.059  5.964   -7.666  1.00 0.00 ? 11  GLU A C    3  
ATOM 3988  O O    . GLU A 1 11  ? 0.298   7.102   -7.968  1.00 0.00 ? 11  GLU A O    3  
ATOM 3989  C CB   . GLU A 1 11  ? 0.153   4.600   -9.751  1.00 0.00 ? 11  GLU A CB   3  
ATOM 3990  C CG   . GLU A 1 11  ? 1.315   3.787   -9.207  1.00 0.00 ? 11  GLU A CG   3  
ATOM 3991  C CD   . GLU A 1 11  ? 2.301   3.396   -10.282 1.00 0.00 ? 11  GLU A CD   3  
ATOM 3992  O OE1  . GLU A 1 11  ? 3.163   4.229   -10.636 1.00 0.00 ? 11  GLU A OE1  3  
ATOM 3993  O OE2  . GLU A 1 11  ? 2.223   2.256   -10.782 1.00 0.00 ? 11  GLU A OE2  3  
ATOM 3994  H H    . GLU A 1 11  ? -1.639  6.791   -9.605  1.00 0.00 ? 11  GLU A H    3  
ATOM 3995  H HA   . GLU A 1 11  ? -1.257  4.265   -8.165  1.00 0.00 ? 11  GLU A HA   3  
ATOM 3996  H HB2  . GLU A 1 11  ? -0.398  3.980   -10.443 1.00 0.00 ? 11  GLU A HB2  3  
ATOM 3997  H HB3  . GLU A 1 11  ? 0.554   5.449   -10.283 1.00 0.00 ? 11  GLU A HB3  3  
ATOM 3998  H HG2  . GLU A 1 11  ? 1.832   4.374   -8.463  1.00 0.00 ? 11  GLU A HG2  3  
ATOM 3999  H HG3  . GLU A 1 11  ? 0.927   2.889   -8.748  1.00 0.00 ? 11  GLU A HG3  3  
ATOM 4000  N N    . PHE A 1 12  ? 0.177   5.430   -6.479  1.00 0.00 ? 12  PHE A N    3  
ATOM 4001  C CA   . PHE A 1 12  ? 0.903   6.171   -5.464  1.00 0.00 ? 12  PHE A CA   3  
ATOM 4002  C C    . PHE A 1 12  ? 1.897   5.273   -4.761  1.00 0.00 ? 12  PHE A C    3  
ATOM 4003  O O    . PHE A 1 12  ? 1.630   4.094   -4.523  1.00 0.00 ? 12  PHE A O    3  
ATOM 4004  C CB   . PHE A 1 12  ? -0.055  6.810   -4.444  1.00 0.00 ? 12  PHE A CB   3  
ATOM 4005  C CG   . PHE A 1 12  ? -0.648  5.868   -3.426  1.00 0.00 ? 12  PHE A CG   3  
ATOM 4006  C CD1  . PHE A 1 12  ? -1.745  5.084   -3.739  1.00 0.00 ? 12  PHE A CD1  3  
ATOM 4007  C CD2  . PHE A 1 12  ? -0.123  5.793   -2.141  1.00 0.00 ? 12  PHE A CD2  3  
ATOM 4008  C CE1  . PHE A 1 12  ? -2.307  4.242   -2.795  1.00 0.00 ? 12  PHE A CE1  3  
ATOM 4009  C CE2  . PHE A 1 12  ? -0.680  4.948   -1.194  1.00 0.00 ? 12  PHE A CE2  3  
ATOM 4010  C CZ   . PHE A 1 12  ? -1.775  4.174   -1.520  1.00 0.00 ? 12  PHE A CZ   3  
ATOM 4011  H H    . PHE A 1 12  ? -0.144  4.523   -6.284  1.00 0.00 ? 12  PHE A H    3  
ATOM 4012  H HA   . PHE A 1 12  ? 1.449   6.957   -5.965  1.00 0.00 ? 12  PHE A HA   3  
ATOM 4013  H HB2  . PHE A 1 12  ? 0.476   7.579   -3.904  1.00 0.00 ? 12  PHE A HB2  3  
ATOM 4014  H HB3  . PHE A 1 12  ? -0.872  7.268   -4.983  1.00 0.00 ? 12  PHE A HB3  3  
ATOM 4015  H HD1  . PHE A 1 12  ? -2.165  5.133   -4.736  1.00 0.00 ? 12  PHE A HD1  3  
ATOM 4016  H HD2  . PHE A 1 12  ? 0.733   6.397   -1.883  1.00 0.00 ? 12  PHE A HD2  3  
ATOM 4017  H HE1  . PHE A 1 12  ? -3.161  3.635   -3.055  1.00 0.00 ? 12  PHE A HE1  3  
ATOM 4018  H HE2  . PHE A 1 12  ? -0.259  4.899   -0.201  1.00 0.00 ? 12  PHE A HE2  3  
ATOM 4019  H HZ   . PHE A 1 12  ? -2.218  3.517   -0.780  1.00 0.00 ? 12  PHE A HZ   3  
ATOM 4020  N N    . ILE A 1 13  ? 3.052   5.828   -4.452  1.00 0.00 ? 13  ILE A N    3  
ATOM 4021  C CA   . ILE A 1 13  ? 4.054   5.099   -3.714  1.00 0.00 ? 13  ILE A CA   3  
ATOM 4022  C C    . ILE A 1 13  ? 3.918   5.414   -2.229  1.00 0.00 ? 13  ILE A C    3  
ATOM 4023  O O    . ILE A 1 13  ? 3.667   6.557   -1.838  1.00 0.00 ? 13  ILE A O    3  
ATOM 4024  C CB   . ILE A 1 13  ? 5.484   5.424   -4.205  1.00 0.00 ? 13  ILE A CB   3  
ATOM 4025  C CG1  . ILE A 1 13  ? 6.480   4.416   -3.634  1.00 0.00 ? 13  ILE A CG1  3  
ATOM 4026  C CG2  . ILE A 1 13  ? 5.882   6.846   -3.830  1.00 0.00 ? 13  ILE A CG2  3  
ATOM 4027  C CD1  . ILE A 1 13  ? 7.904   4.653   -4.086  1.00 0.00 ? 13  ILE A CD1  3  
ATOM 4028  H H    . ILE A 1 13  ? 3.232   6.751   -4.725  1.00 0.00 ? 13  ILE A H    3  
ATOM 4029  H HA   . ILE A 1 13  ? 3.872   4.043   -3.866  1.00 0.00 ? 13  ILE A HA   3  
ATOM 4030  H HB   . ILE A 1 13  ? 5.493   5.351   -5.282  1.00 0.00 ? 13  ILE A HB   3  
ATOM 4031  H HG12 . ILE A 1 13  ? 6.457   4.468   -2.556  1.00 0.00 ? 13  ILE A HG12 3  
ATOM 4032  H HG13 . ILE A 1 13  ? 6.194   3.421   -3.946  1.00 0.00 ? 13  ILE A HG13 3  
ATOM 4033  H HG21 . ILE A 1 13  ? 5.836   6.958   -2.755  1.00 0.00 ? 13  ILE A HG21 3  
ATOM 4034  H HG22 . ILE A 1 13  ? 5.203   7.546   -4.294  1.00 0.00 ? 13  ILE A HG22 3  
ATOM 4035  H HG23 . ILE A 1 13  ? 6.888   7.040   -4.169  1.00 0.00 ? 13  ILE A HG23 3  
ATOM 4036  H HD11 . ILE A 1 13  ? 8.201   5.656   -3.821  1.00 0.00 ? 13  ILE A HD11 3  
ATOM 4037  H HD12 . ILE A 1 13  ? 7.966   4.528   -5.157  1.00 0.00 ? 13  ILE A HD12 3  
ATOM 4038  H HD13 . ILE A 1 13  ? 8.559   3.944   -3.603  1.00 0.00 ? 13  ILE A HD13 3  
ATOM 4039  N N    . SER A 1 14  ? 4.039   4.393   -1.413  1.00 0.00 ? 14  SER A N    3  
ATOM 4040  C CA   . SER A 1 14  ? 3.914   4.557   0.020   1.00 0.00 ? 14  SER A CA   3  
ATOM 4041  C C    . SER A 1 14  ? 4.992   3.766   0.746   1.00 0.00 ? 14  SER A C    3  
ATOM 4042  O O    . SER A 1 14  ? 5.269   2.619   0.403   1.00 0.00 ? 14  SER A O    3  
ATOM 4043  C CB   . SER A 1 14  ? 2.521   4.119   0.472   1.00 0.00 ? 14  SER A CB   3  
ATOM 4044  O OG   . SER A 1 14  ? 2.216   2.816   0.001   1.00 0.00 ? 14  SER A OG   3  
ATOM 4045  H H    . SER A 1 14  ? 4.207   3.503   -1.789  1.00 0.00 ? 14  SER A H    3  
ATOM 4046  H HA   . SER A 1 14  ? 4.042   5.604   0.246   1.00 0.00 ? 14  SER A HA   3  
ATOM 4047  H HB2  . SER A 1 14  ? 2.477   4.118   1.553   1.00 0.00 ? 14  SER A HB2  3  
ATOM 4048  H HB3  . SER A 1 14  ? 1.785   4.810   0.081   1.00 0.00 ? 14  SER A HB3  3  
ATOM 4049  H HG   . SER A 1 14  ? 2.704   2.648   -0.816  1.00 0.00 ? 14  SER A HG   3  
ATOM 4050  N N    . ARG A 1 15  ? 5.603   4.382   1.737   1.00 0.00 ? 15  ARG A N    3  
ATOM 4051  C CA   . ARG A 1 15  ? 6.643   3.734   2.507   1.00 0.00 ? 15  ARG A CA   3  
ATOM 4052  C C    . ARG A 1 15  ? 6.124   3.508   3.916   1.00 0.00 ? 15  ARG A C    3  
ATOM 4053  O O    . ARG A 1 15  ? 5.515   4.403   4.505   1.00 0.00 ? 15  ARG A O    3  
ATOM 4054  C CB   . ARG A 1 15  ? 7.902   4.603   2.519   1.00 0.00 ? 15  ARG A CB   3  
ATOM 4055  C CG   . ARG A 1 15  ? 8.350   5.027   1.128   1.00 0.00 ? 15  ARG A CG   3  
ATOM 4056  C CD   . ARG A 1 15  ? 9.524   5.986   1.181   1.00 0.00 ? 15  ARG A CD   3  
ATOM 4057  N NE   . ARG A 1 15  ? 9.837   6.537   -0.138  1.00 0.00 ? 15  ARG A NE   3  
ATOM 4058  C CZ   . ARG A 1 15  ? 10.898  7.301   -0.394  1.00 0.00 ? 15  ARG A CZ   3  
ATOM 4059  N NH1  . ARG A 1 15  ? 11.760  7.589   0.575   1.00 0.00 ? 15  ARG A NH1  3  
ATOM 4060  N NH2  . ARG A 1 15  ? 11.093  7.784   -1.618  1.00 0.00 ? 15  ARG A NH2  3  
ATOM 4061  H H    . ARG A 1 15  ? 5.333   5.295   1.988   1.00 0.00 ? 15  ARG A H    3  
ATOM 4062  H HA   . ARG A 1 15  ? 6.863   2.781   2.046   1.00 0.00 ? 15  ARG A HA   3  
ATOM 4063  H HB2  . ARG A 1 15  ? 7.708   5.493   3.099   1.00 0.00 ? 15  ARG A HB2  3  
ATOM 4064  H HB3  . ARG A 1 15  ? 8.705   4.047   2.980   1.00 0.00 ? 15  ARG A HB3  3  
ATOM 4065  H HG2  . ARG A 1 15  ? 8.642   4.148   0.572   1.00 0.00 ? 15  ARG A HG2  3  
ATOM 4066  H HG3  . ARG A 1 15  ? 7.523   5.512   0.627   1.00 0.00 ? 15  ARG A HG3  3  
ATOM 4067  H HD2  . ARG A 1 15  ? 9.279   6.796   1.852   1.00 0.00 ? 15  ARG A HD2  3  
ATOM 4068  H HD3  . ARG A 1 15  ? 10.391  5.458   1.556   1.00 0.00 ? 15  ARG A HD3  3  
ATOM 4069  H HE   . ARG A 1 15  ? 9.215   6.331   -0.871  1.00 0.00 ? 15  ARG A HE   3  
ATOM 4070  H HH11 . ARG A 1 15  ? 11.612  7.234   1.509   1.00 0.00 ? 15  ARG A HH11 3  
ATOM 4071  H HH12 . ARG A 1 15  ? 12.572  8.147   0.381   1.00 0.00 ? 15  ARG A HH12 3  
ATOM 4072  H HH21 . ARG A 1 15  ? 10.443  7.574   -2.360  1.00 0.00 ? 15  ARG A HH21 3  
ATOM 4073  H HH22 . ARG A 1 15  ? 11.895  8.371   -1.810  1.00 0.00 ? 15  ARG A HH22 3  
ATOM 4074  N N    . HIS A 1 16  ? 6.323   2.314   4.447   1.00 0.00 ? 16  HIS A N    3  
ATOM 4075  C CA   . HIS A 1 16  ? 5.742   1.980   5.734   1.00 0.00 ? 16  HIS A CA   3  
ATOM 4076  C C    . HIS A 1 16  ? 6.602   1.011   6.527   1.00 0.00 ? 16  HIS A C    3  
ATOM 4077  O O    . HIS A 1 16  ? 7.504   0.365   5.992   1.00 0.00 ? 16  HIS A O    3  
ATOM 4078  C CB   . HIS A 1 16  ? 4.323   1.407   5.561   1.00 0.00 ? 16  HIS A CB   3  
ATOM 4079  C CG   . HIS A 1 16  ? 4.205   0.145   4.755   1.00 0.00 ? 16  HIS A CG   3  
ATOM 4080  N ND1  . HIS A 1 16  ? 3.209   -0.041  3.821   1.00 0.00 ? 16  HIS A ND1  3  
ATOM 4081  C CD2  . HIS A 1 16  ? 4.911   -1.012  4.781   1.00 0.00 ? 16  HIS A CD2  3  
ATOM 4082  C CE1  . HIS A 1 16  ? 3.305   -1.253  3.313   1.00 0.00 ? 16  HIS A CE1  3  
ATOM 4083  N NE2  . HIS A 1 16  ? 4.330   -1.865  3.873   1.00 0.00 ? 16  HIS A NE2  3  
ATOM 4084  H H    . HIS A 1 16  ? 6.884   1.655   3.976   1.00 0.00 ? 16  HIS A H    3  
ATOM 4085  H HA   . HIS A 1 16  ? 5.667   2.899   6.297   1.00 0.00 ? 16  HIS A HA   3  
ATOM 4086  H HB2  . HIS A 1 16  ? 3.917   1.199   6.538   1.00 0.00 ? 16  HIS A HB2  3  
ATOM 4087  H HB3  . HIS A 1 16  ? 3.707   2.156   5.086   1.00 0.00 ? 16  HIS A HB3  3  
ATOM 4088  H HD1  . HIS A 1 16  ? 2.532   0.622   3.568   1.00 0.00 ? 16  HIS A HD1  3  
ATOM 4089  H HD2  . HIS A 1 16  ? 5.772   -1.224  5.397   1.00 0.00 ? 16  HIS A HD2  3  
ATOM 4090  H HE1  . HIS A 1 16  ? 2.652   -1.677  2.566   1.00 0.00 ? 16  HIS A HE1  3  
ATOM 4091  H HE2  . HIS A 1 16  ? 4.723   -2.705  3.553   1.00 0.00 ? 16  HIS A HE2  3  
ATOM 4092  N N    . ASN A 1 17  ? 6.276   0.907   7.803   1.00 0.00 ? 17  ASN A N    3  
ATOM 4093  C CA   . ASN A 1 17  ? 6.898   -0.052  8.697   1.00 0.00 ? 17  ASN A CA   3  
ATOM 4094  C C    . ASN A 1 17  ? 6.312   -1.430  8.417   1.00 0.00 ? 17  ASN A C    3  
ATOM 4095  O O    . ASN A 1 17  ? 5.168   -1.531  7.957   1.00 0.00 ? 17  ASN A O    3  
ATOM 4096  C CB   . ASN A 1 17  ? 6.658   0.371   10.156  1.00 0.00 ? 17  ASN A CB   3  
ATOM 4097  C CG   . ASN A 1 17  ? 6.017   -0.712  11.007  1.00 0.00 ? 17  ASN A CG   3  
ATOM 4098  O OD1  . ASN A 1 17  ? 4.799   -0.869  11.014  1.00 0.00 ? 17  ASN A OD1  3  
ATOM 4099  N ND2  . ASN A 1 17  ? 6.828   -1.458  11.737  1.00 0.00 ? 17  ASN A ND2  3  
ATOM 4100  H H    . ASN A 1 17  ? 5.558   1.483   8.152   1.00 0.00 ? 17  ASN A H    3  
ATOM 4101  H HA   . ASN A 1 17  ? 7.960   -0.068  8.494   1.00 0.00 ? 17  ASN A HA   3  
ATOM 4102  H HB2  . ASN A 1 17  ? 7.604   0.634   10.605  1.00 0.00 ? 17  ASN A HB2  3  
ATOM 4103  H HB3  . ASN A 1 17  ? 6.013   1.237   10.165  1.00 0.00 ? 17  ASN A HB3  3  
ATOM 4104  H HD21 . ASN A 1 17  ? 7.794   -1.277  11.688  1.00 0.00 ? 17  ASN A HD21 3  
ATOM 4105  H HD22 . ASN A 1 17  ? 6.431   -2.148  12.311  1.00 0.00 ? 17  ASN A HD22 3  
ATOM 4106  N N    . ILE A 1 18  ? 7.099   -2.468  8.705   1.00 0.00 ? 18  ILE A N    3  
ATOM 4107  C CA   . ILE A 1 18  ? 6.827   -3.842  8.260   1.00 0.00 ? 18  ILE A CA   3  
ATOM 4108  C C    . ILE A 1 18  ? 5.410   -4.317  8.574   1.00 0.00 ? 18  ILE A C    3  
ATOM 4109  O O    . ILE A 1 18  ? 4.851   -5.122  7.830   1.00 0.00 ? 18  ILE A O    3  
ATOM 4110  C CB   . ILE A 1 18  ? 7.831   -4.844  8.870   1.00 0.00 ? 18  ILE A CB   3  
ATOM 4111  C CG1  . ILE A 1 18  ? 7.791   -4.785  10.400  1.00 0.00 ? 18  ILE A CG1  3  
ATOM 4112  C CG2  . ILE A 1 18  ? 9.238   -4.568  8.352   1.00 0.00 ? 18  ILE A CG2  3  
ATOM 4113  C CD1  . ILE A 1 18  ? 8.643   -5.838  11.069  1.00 0.00 ? 18  ILE A CD1  3  
ATOM 4114  H H    . ILE A 1 18  ? 7.903   -2.304  9.255   1.00 0.00 ? 18  ILE A H    3  
ATOM 4115  H HA   . ILE A 1 18  ? 6.957   -3.861  7.189   1.00 0.00 ? 18  ILE A HA   3  
ATOM 4116  H HB   . ILE A 1 18  ? 7.549   -5.837  8.550   1.00 0.00 ? 18  ILE A HB   3  
ATOM 4117  H HG12 . ILE A 1 18  ? 8.141   -3.817  10.725  1.00 0.00 ? 18  ILE A HG12 3  
ATOM 4118  H HG13 . ILE A 1 18  ? 6.772   -4.922  10.731  1.00 0.00 ? 18  ILE A HG13 3  
ATOM 4119  H HG21 . ILE A 1 18  ? 9.927   -5.270  8.796   1.00 0.00 ? 18  ILE A HG21 3  
ATOM 4120  H HG22 . ILE A 1 18  ? 9.527   -3.562  8.618   1.00 0.00 ? 18  ILE A HG22 3  
ATOM 4121  H HG23 . ILE A 1 18  ? 9.254   -4.676  7.277   1.00 0.00 ? 18  ILE A HG23 3  
ATOM 4122  H HD11 . ILE A 1 18  ? 8.270   -6.817  10.815  1.00 0.00 ? 18  ILE A HD11 3  
ATOM 4123  H HD12 . ILE A 1 18  ? 8.609   -5.703  12.139  1.00 0.00 ? 18  ILE A HD12 3  
ATOM 4124  H HD13 . ILE A 1 18  ? 9.664   -5.743  10.728  1.00 0.00 ? 18  ILE A HD13 3  
ATOM 4125  N N    . GLU A 1 19  ? 4.834   -3.815  9.659   1.00 0.00 ? 19  GLU A N    3  
ATOM 4126  C CA   . GLU A 1 19  ? 3.499   -4.222  10.077  1.00 0.00 ? 19  GLU A CA   3  
ATOM 4127  C C    . GLU A 1 19  ? 2.441   -3.694  9.117   1.00 0.00 ? 19  GLU A C    3  
ATOM 4128  O O    . GLU A 1 19  ? 1.317   -4.193  9.084   1.00 0.00 ? 19  GLU A O    3  
ATOM 4129  C CB   . GLU A 1 19  ? 3.225   -3.721  11.493  1.00 0.00 ? 19  GLU A CB   3  
ATOM 4130  C CG   . GLU A 1 19  ? 4.185   -4.289  12.523  1.00 0.00 ? 19  GLU A CG   3  
ATOM 4131  C CD   . GLU A 1 19  ? 4.055   -3.615  13.869  1.00 0.00 ? 19  GLU A CD   3  
ATOM 4132  O OE1  . GLU A 1 19  ? 3.070   -3.892  14.587  1.00 0.00 ? 19  GLU A OE1  3  
ATOM 4133  O OE2  . GLU A 1 19  ? 4.941   -2.807  14.217  1.00 0.00 ? 19  GLU A OE2  3  
ATOM 4134  H H    . GLU A 1 19  ? 5.319   -3.148  10.190  1.00 0.00 ? 19  GLU A H    3  
ATOM 4135  H HA   . GLU A 1 19  ? 3.467   -5.299  10.073  1.00 0.00 ? 19  GLU A HA   3  
ATOM 4136  H HB2  . GLU A 1 19  ? 3.306   -2.644  11.505  1.00 0.00 ? 19  GLU A HB2  3  
ATOM 4137  H HB3  . GLU A 1 19  ? 2.220   -4.002  11.774  1.00 0.00 ? 19  GLU A HB3  3  
ATOM 4138  H HG2  . GLU A 1 19  ? 3.984   -5.342  12.641  1.00 0.00 ? 19  GLU A HG2  3  
ATOM 4139  H HG3  . GLU A 1 19  ? 5.195   -4.154  12.166  1.00 0.00 ? 19  GLU A HG3  3  
ATOM 4140  N N    . GLY A 1 20  ? 2.823   -2.707  8.318   1.00 0.00 ? 20  GLY A N    3  
ATOM 4141  C CA   . GLY A 1 20  ? 1.893   -2.086  7.401   1.00 0.00 ? 20  GLY A CA   3  
ATOM 4142  C C    . GLY A 1 20  ? 1.578   -0.656  7.786   1.00 0.00 ? 20  GLY A C    3  
ATOM 4143  O O    . GLY A 1 20  ? 0.652   -0.054  7.246   1.00 0.00 ? 20  GLY A O    3  
ATOM 4144  H H    . GLY A 1 20  ? 3.762   -2.419  8.330   1.00 0.00 ? 20  GLY A H    3  
ATOM 4145  H HA2  . GLY A 1 20  ? 2.322   -2.097  6.409   1.00 0.00 ? 20  GLY A HA2  3  
ATOM 4146  H HA3  . GLY A 1 20  ? 0.976   -2.655  7.391   1.00 0.00 ? 20  GLY A HA3  3  
ATOM 4147  N N    . ILE A 1 21  ? 2.364   -0.099  8.702   1.00 0.00 ? 21  ILE A N    3  
ATOM 4148  C CA   . ILE A 1 21  ? 2.095   1.238   9.229   1.00 0.00 ? 21  ILE A CA   3  
ATOM 4149  C C    . ILE A 1 21  ? 2.814   2.293   8.402   1.00 0.00 ? 21  ILE A C    3  
ATOM 4150  O O    . ILE A 1 21  ? 4.040   2.385   8.438   1.00 0.00 ? 21  ILE A O    3  
ATOM 4151  C CB   . ILE A 1 21  ? 2.534   1.362   10.703  1.00 0.00 ? 21  ILE A CB   3  
ATOM 4152  C CG1  . ILE A 1 21  ? 1.882   0.264   11.550  1.00 0.00 ? 21  ILE A CG1  3  
ATOM 4153  C CG2  . ILE A 1 21  ? 2.186   2.740   11.256  1.00 0.00 ? 21  ILE A CG2  3  
ATOM 4154  C CD1  . ILE A 1 21  ? 0.370   0.320   11.575  1.00 0.00 ? 21  ILE A CD1  3  
ATOM 4155  H H    . ILE A 1 21  ? 3.152   -0.592  9.035   1.00 0.00 ? 21  ILE A H    3  
ATOM 4156  H HA   . ILE A 1 21  ? 1.028   1.412   9.174   1.00 0.00 ? 21  ILE A HA   3  
ATOM 4157  H HB   . ILE A 1 21  ? 3.605   1.245   10.743  1.00 0.00 ? 21  ILE A HB   3  
ATOM 4158  H HG12 . ILE A 1 21  ? 2.168   -0.699  11.155  1.00 0.00 ? 21  ILE A HG12 3  
ATOM 4159  H HG13 . ILE A 1 21  ? 2.238   0.349   12.567  1.00 0.00 ? 21  ILE A HG13 3  
ATOM 4160  H HG21 . ILE A 1 21  ? 2.668   3.502   10.658  1.00 0.00 ? 21  ILE A HG21 3  
ATOM 4161  H HG22 . ILE A 1 21  ? 2.530   2.815   12.276  1.00 0.00 ? 21  ILE A HG22 3  
ATOM 4162  H HG23 . ILE A 1 21  ? 1.115   2.882   11.226  1.00 0.00 ? 21  ILE A HG23 3  
ATOM 4163  H HD11 . ILE A 1 21  ? -0.009  -0.481  12.192  1.00 0.00 ? 21  ILE A HD11 3  
ATOM 4164  H HD12 . ILE A 1 21  ? -0.013  0.213   10.571  1.00 0.00 ? 21  ILE A HD12 3  
ATOM 4165  H HD13 . ILE A 1 21  ? 0.052   1.270   11.982  1.00 0.00 ? 21  ILE A HD13 3  
ATOM 4166  N N    . PHE A 1 22  ? 2.053   3.082   7.659   1.00 0.00 ? 22  PHE A N    3  
ATOM 4167  C CA   . PHE A 1 22  ? 2.623   4.046   6.722   1.00 0.00 ? 22  PHE A CA   3  
ATOM 4168  C C    . PHE A 1 22  ? 3.338   5.183   7.440   1.00 0.00 ? 22  PHE A C    3  
ATOM 4169  O O    . PHE A 1 22  ? 2.830   5.734   8.417   1.00 0.00 ? 22  PHE A O    3  
ATOM 4170  C CB   . PHE A 1 22  ? 1.534   4.605   5.809   1.00 0.00 ? 22  PHE A CB   3  
ATOM 4171  C CG   . PHE A 1 22  ? 0.892   3.558   4.951   1.00 0.00 ? 22  PHE A CG   3  
ATOM 4172  C CD1  . PHE A 1 22  ? -0.220  2.863   5.396   1.00 0.00 ? 22  PHE A CD1  3  
ATOM 4173  C CD2  . PHE A 1 22  ? 1.401   3.269   3.697   1.00 0.00 ? 22  PHE A CD2  3  
ATOM 4174  C CE1  . PHE A 1 22  ? -0.812  1.901   4.607   1.00 0.00 ? 22  PHE A CE1  3  
ATOM 4175  C CE2  . PHE A 1 22  ? 0.811   2.305   2.903   1.00 0.00 ? 22  PHE A CE2  3  
ATOM 4176  C CZ   . PHE A 1 22  ? -0.297  1.622   3.358   1.00 0.00 ? 22  PHE A CZ   3  
ATOM 4177  H H    . PHE A 1 22  ? 1.078   3.026   7.747   1.00 0.00 ? 22  PHE A H    3  
ATOM 4178  H HA   . PHE A 1 22  ? 3.345   3.521   6.114   1.00 0.00 ? 22  PHE A HA   3  
ATOM 4179  H HB2  . PHE A 1 22  ? 0.763   5.059   6.413   1.00 0.00 ? 22  PHE A HB2  3  
ATOM 4180  H HB3  . PHE A 1 22  ? 1.964   5.353   5.158   1.00 0.00 ? 22  PHE A HB3  3  
ATOM 4181  H HD1  . PHE A 1 22  ? -0.625  3.082   6.374   1.00 0.00 ? 22  PHE A HD1  3  
ATOM 4182  H HD2  . PHE A 1 22  ? 2.269   3.803   3.341   1.00 0.00 ? 22  PHE A HD2  3  
ATOM 4183  H HE1  . PHE A 1 22  ? -1.680  1.364   4.967   1.00 0.00 ? 22  PHE A HE1  3  
ATOM 4184  H HE2  . PHE A 1 22  ? 1.217   2.089   1.926   1.00 0.00 ? 22  PHE A HE2  3  
ATOM 4185  H HZ   . PHE A 1 22  ? -0.759  0.868   2.739   1.00 0.00 ? 22  PHE A HZ   3  
ATOM 4186  N N    . THR A 1 23  ? 4.522   5.517   6.947   1.00 0.00 ? 23  THR A N    3  
ATOM 4187  C CA   . THR A 1 23  ? 5.323   6.591   7.512   1.00 0.00 ? 23  THR A CA   3  
ATOM 4188  C C    . THR A 1 23  ? 5.558   7.703   6.487   1.00 0.00 ? 23  THR A C    3  
ATOM 4189  O O    . THR A 1 23  ? 5.861   8.843   6.848   1.00 0.00 ? 23  THR A O    3  
ATOM 4190  C CB   . THR A 1 23  ? 6.676   6.053   8.018   1.00 0.00 ? 23  THR A CB   3  
ATOM 4191  O OG1  . THR A 1 23  ? 7.228   5.136   7.061   1.00 0.00 ? 23  THR A OG1  3  
ATOM 4192  C CG2  . THR A 1 23  ? 6.518   5.358   9.362   1.00 0.00 ? 23  THR A CG2  3  
ATOM 4193  H H    . THR A 1 23  ? 4.879   5.016   6.183   1.00 0.00 ? 23  THR A H    3  
ATOM 4194  H HA   . THR A 1 23  ? 4.786   7.001   8.353   1.00 0.00 ? 23  THR A HA   3  
ATOM 4195  H HB   . THR A 1 23  ? 7.354   6.885   8.137   1.00 0.00 ? 23  THR A HB   3  
ATOM 4196  H HG1  . THR A 1 23  ? 7.989   4.677   7.457   1.00 0.00 ? 23  THR A HG1  3  
ATOM 4197  H HG21 . THR A 1 23  ? 5.845   4.520   9.257   1.00 0.00 ? 23  THR A HG21 3  
ATOM 4198  H HG22 . THR A 1 23  ? 6.116   6.056   10.081  1.00 0.00 ? 23  THR A HG22 3  
ATOM 4199  H HG23 . THR A 1 23  ? 7.482   5.009   9.700   1.00 0.00 ? 23  THR A HG23 3  
ATOM 4200  N N    . PHE A 1 24  ? 5.419   7.370   5.204   1.00 0.00 ? 24  PHE A N    3  
ATOM 4201  C CA   . PHE A 1 24  ? 5.532   8.357   4.134   1.00 0.00 ? 24  PHE A CA   3  
ATOM 4202  C C    . PHE A 1 24  ? 4.605   8.000   2.971   1.00 0.00 ? 24  PHE A C    3  
ATOM 4203  O O    . PHE A 1 24  ? 4.696   6.909   2.408   1.00 0.00 ? 24  PHE A O    3  
ATOM 4204  C CB   . PHE A 1 24  ? 6.983   8.450   3.643   1.00 0.00 ? 24  PHE A CB   3  
ATOM 4205  C CG   . PHE A 1 24  ? 7.174   9.403   2.493   1.00 0.00 ? 24  PHE A CG   3  
ATOM 4206  C CD1  . PHE A 1 24  ? 7.147   10.773  2.699   1.00 0.00 ? 24  PHE A CD1  3  
ATOM 4207  C CD2  . PHE A 1 24  ? 7.380   8.928   1.206   1.00 0.00 ? 24  PHE A CD2  3  
ATOM 4208  C CE1  . PHE A 1 24  ? 7.322   11.650  1.645   1.00 0.00 ? 24  PHE A CE1  3  
ATOM 4209  C CE2  . PHE A 1 24  ? 7.555   9.801   0.149   1.00 0.00 ? 24  PHE A CE2  3  
ATOM 4210  C CZ   . PHE A 1 24  ? 7.525   11.165  0.368   1.00 0.00 ? 24  PHE A CZ   3  
ATOM 4211  H H    . PHE A 1 24  ? 5.260   6.430   4.967   1.00 0.00 ? 24  PHE A H    3  
ATOM 4212  H HA   . PHE A 1 24  ? 5.236   9.315   4.535   1.00 0.00 ? 24  PHE A HA   3  
ATOM 4213  H HB2  . PHE A 1 24  ? 7.610   8.783   4.456   1.00 0.00 ? 24  PHE A HB2  3  
ATOM 4214  H HB3  . PHE A 1 24  ? 7.310   7.471   3.323   1.00 0.00 ? 24  PHE A HB3  3  
ATOM 4215  H HD1  . PHE A 1 24  ? 6.988   11.156  3.697   1.00 0.00 ? 24  PHE A HD1  3  
ATOM 4216  H HD2  . PHE A 1 24  ? 7.404   7.862   1.032   1.00 0.00 ? 24  PHE A HD2  3  
ATOM 4217  H HE1  . PHE A 1 24  ? 7.299   12.715  1.820   1.00 0.00 ? 24  PHE A HE1  3  
ATOM 4218  H HE2  . PHE A 1 24  ? 7.712   9.419   -0.848  1.00 0.00 ? 24  PHE A HE2  3  
ATOM 4219  H HZ   . PHE A 1 24  ? 7.661   11.848  -0.457  1.00 0.00 ? 24  PHE A HZ   3  
ATOM 4220  N N    . VAL A 1 25  ? 3.713   8.921   2.620   1.00 0.00 ? 25  VAL A N    3  
ATOM 4221  C CA   . VAL A 1 25  ? 2.773   8.707   1.524   1.00 0.00 ? 25  VAL A CA   3  
ATOM 4222  C C    . VAL A 1 25  ? 2.771   9.902   0.570   1.00 0.00 ? 25  VAL A C    3  
ATOM 4223  O O    . VAL A 1 25  ? 2.792   11.055  1.006   1.00 0.00 ? 25  VAL A O    3  
ATOM 4224  C CB   . VAL A 1 25  ? 1.339   8.479   2.051   1.00 0.00 ? 25  VAL A CB   3  
ATOM 4225  C CG1  . VAL A 1 25  ? 0.353   8.361   0.899   1.00 0.00 ? 25  VAL A CG1  3  
ATOM 4226  C CG2  . VAL A 1 25  ? 1.280   7.238   2.928   1.00 0.00 ? 25  VAL A CG2  3  
ATOM 4227  H H    . VAL A 1 25  ? 3.680   9.766   3.115   1.00 0.00 ? 25  VAL A H    3  
ATOM 4228  H HA   . VAL A 1 25  ? 3.083   7.824   0.982   1.00 0.00 ? 25  VAL A HA   3  
ATOM 4229  H HB   . VAL A 1 25  ? 1.056   9.332   2.651   1.00 0.00 ? 25  VAL A HB   3  
ATOM 4230  H HG11 . VAL A 1 25  ? 0.624   7.519   0.279   1.00 0.00 ? 25  VAL A HG11 3  
ATOM 4231  H HG12 . VAL A 1 25  ? 0.379   9.268   0.307   1.00 0.00 ? 25  VAL A HG12 3  
ATOM 4232  H HG13 . VAL A 1 25  ? -0.643  8.216   1.290   1.00 0.00 ? 25  VAL A HG13 3  
ATOM 4233  H HG21 . VAL A 1 25  ? 1.944   7.361   3.770   1.00 0.00 ? 25  VAL A HG21 3  
ATOM 4234  H HG22 . VAL A 1 25  ? 1.586   6.376   2.352   1.00 0.00 ? 25  VAL A HG22 3  
ATOM 4235  H HG23 . VAL A 1 25  ? 0.270   7.094   3.281   1.00 0.00 ? 25  VAL A HG23 3  
ATOM 4236  N N    . ASP A 1 26  ? 2.764   9.618   -0.729  1.00 0.00 ? 26  ASP A N    3  
ATOM 4237  C CA   . ASP A 1 26  ? 2.697   10.652  -1.755  1.00 0.00 ? 26  ASP A CA   3  
ATOM 4238  C C    . ASP A 1 26  ? 1.248   11.034  -2.050  1.00 0.00 ? 26  ASP A C    3  
ATOM 4239  O O    . ASP A 1 26  ? 0.341   10.208  -1.961  1.00 0.00 ? 26  ASP A O    3  
ATOM 4240  C CB   . ASP A 1 26  ? 3.371   10.151  -3.036  1.00 0.00 ? 26  ASP A CB   3  
ATOM 4241  C CG   . ASP A 1 26  ? 3.398   11.196  -4.134  1.00 0.00 ? 26  ASP A CG   3  
ATOM 4242  O OD1  . ASP A 1 26  ? 2.387   11.345  -4.854  1.00 0.00 ? 26  ASP A OD1  3  
ATOM 4243  O OD2  . ASP A 1 26  ? 4.431   11.880  -4.285  1.00 0.00 ? 26  ASP A OD2  3  
ATOM 4244  H H    . ASP A 1 26  ? 2.818   8.684   -1.025  1.00 0.00 ? 26  ASP A H    3  
ATOM 4245  H HA   . ASP A 1 26  ? 3.219   11.527  -1.395  1.00 0.00 ? 26  ASP A HA   3  
ATOM 4246  H HB2  . ASP A 1 26  ? 4.388   9.868   -2.809  1.00 0.00 ? 26  ASP A HB2  3  
ATOM 4247  H HB3  . ASP A 1 26  ? 2.835   9.286   -3.399  1.00 0.00 ? 26  ASP A HB3  3  
ATOM 4248  N N    . HIS A 1 27  ? 1.071   12.305  -2.405  1.00 0.00 ? 27  HIS A N    3  
ATOM 4249  C CA   . HIS A 1 27  ? -0.238  12.923  -2.649  1.00 0.00 ? 27  HIS A CA   3  
ATOM 4250  C C    . HIS A 1 27  ? -1.123  12.135  -3.611  1.00 0.00 ? 27  HIS A C    3  
ATOM 4251  O O    . HIS A 1 27  ? -2.340  12.303  -3.607  1.00 0.00 ? 27  HIS A O    3  
ATOM 4252  C CB   . HIS A 1 27  ? -0.032  14.319  -3.226  1.00 0.00 ? 27  HIS A CB   3  
ATOM 4253  C CG   . HIS A 1 27  ? 0.569   15.317  -2.282  1.00 0.00 ? 27  HIS A CG   3  
ATOM 4254  N ND1  . HIS A 1 27  ? 1.871   15.741  -2.368  1.00 0.00 ? 27  HIS A ND1  3  
ATOM 4255  C CD2  . HIS A 1 27  ? 0.012   16.030  -1.281  1.00 0.00 ? 27  HIS A CD2  3  
ATOM 4256  C CE1  . HIS A 1 27  ? 2.089   16.678  -1.466  1.00 0.00 ? 27  HIS A CE1  3  
ATOM 4257  N NE2  . HIS A 1 27  ? 0.973   16.883  -0.789  1.00 0.00 ? 27  HIS A NE2  3  
ATOM 4258  H H    . HIS A 1 27  ? 1.870   12.864  -2.514  1.00 0.00 ? 27  HIS A H    3  
ATOM 4259  H HA   . HIS A 1 27  ? -0.755  13.010  -1.709  1.00 0.00 ? 27  HIS A HA   3  
ATOM 4260  H HB2  . HIS A 1 27  ? 0.624   14.240  -4.075  1.00 0.00 ? 27  HIS A HB2  3  
ATOM 4261  H HB3  . HIS A 1 27  ? -0.987  14.706  -3.554  1.00 0.00 ? 27  HIS A HB3  3  
ATOM 4262  H HD1  . HIS A 1 27  ? 2.552   15.389  -2.993  1.00 0.00 ? 27  HIS A HD1  3  
ATOM 4263  H HD2  . HIS A 1 27  ? -0.997  15.923  -0.915  1.00 0.00 ? 27  HIS A HD2  3  
ATOM 4264  H HE1  . HIS A 1 27  ? 3.025   17.193  -1.309  1.00 0.00 ? 27  HIS A HE1  3  
ATOM 4265  H HE2  . HIS A 1 27  ? 0.764   17.739  -0.338  1.00 0.00 ? 27  HIS A HE2  3  
ATOM 4266  N N    . ARG A 1 28  ? -0.521  11.293  -4.443  1.00 0.00 ? 28  ARG A N    3  
ATOM 4267  C CA   . ARG A 1 28  ? -1.275  10.507  -5.422  1.00 0.00 ? 28  ARG A CA   3  
ATOM 4268  C C    . ARG A 1 28  ? -2.193  9.486   -4.743  1.00 0.00 ? 28  ARG A C    3  
ATOM 4269  O O    . ARG A 1 28  ? -2.990  8.811   -5.403  1.00 0.00 ? 28  ARG A O    3  
ATOM 4270  C CB   . ARG A 1 28  ? -0.315  9.802   -6.378  1.00 0.00 ? 28  ARG A CB   3  
ATOM 4271  C CG   . ARG A 1 28  ? 0.530   10.762  -7.193  1.00 0.00 ? 28  ARG A CG   3  
ATOM 4272  C CD   . ARG A 1 28  ? 1.582   10.035  -8.014  1.00 0.00 ? 28  ARG A CD   3  
ATOM 4273  N NE   . ARG A 1 28  ? 2.445   10.971  -8.733  1.00 0.00 ? 28  ARG A NE   3  
ATOM 4274  C CZ   . ARG A 1 28  ? 3.045   10.701  -9.887  1.00 0.00 ? 28  ARG A CZ   3  
ATOM 4275  N NH1  . ARG A 1 28  ? 2.953   9.486   -10.418 1.00 0.00 ? 28  ARG A NH1  3  
ATOM 4276  N NH2  . ARG A 1 28  ? 3.763   11.640  -10.494 1.00 0.00 ? 28  ARG A NH2  3  
ATOM 4277  H H    . ARG A 1 28  ? 0.462   11.197  -4.400  1.00 0.00 ? 28  ARG A H    3  
ATOM 4278  H HA   . ARG A 1 28  ? -1.886  11.193  -5.990  1.00 0.00 ? 28  ARG A HA   3  
ATOM 4279  H HB2  . ARG A 1 28  ? 0.346   9.170   -5.805  1.00 0.00 ? 28  ARG A HB2  3  
ATOM 4280  H HB3  . ARG A 1 28  ? -0.888  9.189   -7.059  1.00 0.00 ? 28  ARG A HB3  3  
ATOM 4281  H HG2  . ARG A 1 28  ? -0.114  11.315  -7.862  1.00 0.00 ? 28  ARG A HG2  3  
ATOM 4282  H HG3  . ARG A 1 28  ? 1.026   11.449  -6.520  1.00 0.00 ? 28  ARG A HG3  3  
ATOM 4283  H HD2  . ARG A 1 28  ? 2.188   9.435   -7.350  1.00 0.00 ? 28  ARG A HD2  3  
ATOM 4284  H HD3  . ARG A 1 28  ? 1.085   9.396   -8.728  1.00 0.00 ? 28  ARG A HD3  3  
ATOM 4285  H HE   . ARG A 1 28  ? 2.575   11.865  -8.327  1.00 0.00 ? 28  ARG A HE   3  
ATOM 4286  H HH11 . ARG A 1 28  ? 2.434   8.767   -9.946  1.00 0.00 ? 28  ARG A HH11 3  
ATOM 4287  H HH12 . ARG A 1 28  ? 3.410   9.275   -11.296 1.00 0.00 ? 28  ARG A HH12 3  
ATOM 4288  H HH21 . ARG A 1 28  ? 3.857   12.554  -10.079 1.00 0.00 ? 28  ARG A HH21 3  
ATOM 4289  H HH22 . ARG A 1 28  ? 4.210   11.449  -11.379 1.00 0.00 ? 28  ARG A HH22 3  
ATOM 4290  N N    . CYS A 1 29  ? -2.084  9.381   -3.426  1.00 0.00 ? 29  CYS A N    3  
ATOM 4291  C CA   . CYS A 1 29  ? -2.910  8.472   -2.648  1.00 0.00 ? 29  CYS A CA   3  
ATOM 4292  C C    . CYS A 1 29  ? -4.385  8.850   -2.729  1.00 0.00 ? 29  CYS A C    3  
ATOM 4293  O O    . CYS A 1 29  ? -5.249  7.974   -2.792  1.00 0.00 ? 29  CYS A O    3  
ATOM 4294  C CB   . CYS A 1 29  ? -2.440  8.463   -1.196  1.00 0.00 ? 29  CYS A CB   3  
ATOM 4295  S SG   . CYS A 1 29  ? -2.377  10.103  -0.450  1.00 0.00 ? 29  CYS A SG   3  
ATOM 4296  H H    . CYS A 1 29  ? -1.415  9.932   -2.957  1.00 0.00 ? 29  CYS A H    3  
ATOM 4297  H HA   . CYS A 1 29  ? -2.789  7.487   -3.055  1.00 0.00 ? 29  CYS A HA   3  
ATOM 4298  H HB2  . CYS A 1 29  ? -3.113  7.858   -0.607  1.00 0.00 ? 29  CYS A HB2  3  
ATOM 4299  H HB3  . CYS A 1 29  ? -1.447  8.040   -1.150  1.00 0.00 ? 29  CYS A HB3  3  
ATOM 4300  H HG   . CYS A 1 29  ? -3.604  10.391  -0.037  1.00 0.00 ? 29  CYS A HG   3  
ATOM 4301  N N    . VAL A 1 30  ? -4.672  10.150  -2.763  1.00 0.00 ? 30  VAL A N    3  
ATOM 4302  C CA   . VAL A 1 30  ? -6.052  10.619  -2.785  1.00 0.00 ? 30  VAL A CA   3  
ATOM 4303  C C    . VAL A 1 30  ? -6.764  10.153  -4.044  1.00 0.00 ? 30  VAL A C    3  
ATOM 4304  O O    . VAL A 1 30  ? -7.967  9.899   -4.033  1.00 0.00 ? 30  VAL A O    3  
ATOM 4305  C CB   . VAL A 1 30  ? -6.143  12.157  -2.683  1.00 0.00 ? 30  VAL A CB   3  
ATOM 4306  C CG1  . VAL A 1 30  ? -5.510  12.647  -1.395  1.00 0.00 ? 30  VAL A CG1  3  
ATOM 4307  C CG2  . VAL A 1 30  ? -5.501  12.828  -3.888  1.00 0.00 ? 30  VAL A CG2  3  
ATOM 4308  H H    . VAL A 1 30  ? -3.941  10.804  -2.778  1.00 0.00 ? 30  VAL A H    3  
ATOM 4309  H HA   . VAL A 1 30  ? -6.556  10.194  -1.927  1.00 0.00 ? 30  VAL A HA   3  
ATOM 4310  H HB   . VAL A 1 30  ? -7.187  12.428  -2.665  1.00 0.00 ? 30  VAL A HB   3  
ATOM 4311  H HG11 . VAL A 1 30  ? -5.579  13.724  -1.347  1.00 0.00 ? 30  VAL A HG11 3  
ATOM 4312  H HG12 . VAL A 1 30  ? -4.471  12.353  -1.368  1.00 0.00 ? 30  VAL A HG12 3  
ATOM 4313  H HG13 . VAL A 1 30  ? -6.029  12.216  -0.552  1.00 0.00 ? 30  VAL A HG13 3  
ATOM 4314  H HG21 . VAL A 1 30  ? -5.999  12.505  -4.788  1.00 0.00 ? 30  VAL A HG21 3  
ATOM 4315  H HG22 . VAL A 1 30  ? -4.457  12.559  -3.935  1.00 0.00 ? 30  VAL A HG22 3  
ATOM 4316  H HG23 . VAL A 1 30  ? -5.590  13.900  -3.791  1.00 0.00 ? 30  VAL A HG23 3  
ATOM 4317  N N    . ALA A 1 31  ? -6.015  10.018  -5.126  1.00 0.00 ? 31  ALA A N    3  
ATOM 4318  C CA   . ALA A 1 31  ? -6.595  9.582   -6.383  1.00 0.00 ? 31  ALA A CA   3  
ATOM 4319  C C    . ALA A 1 31  ? -6.794  8.076   -6.389  1.00 0.00 ? 31  ALA A C    3  
ATOM 4320  O O    . ALA A 1 31  ? -7.882  7.585   -6.680  1.00 0.00 ? 31  ALA A O    3  
ATOM 4321  C CB   . ALA A 1 31  ? -5.716  9.996   -7.545  1.00 0.00 ? 31  ALA A CB   3  
ATOM 4322  H H    . ALA A 1 31  ? -5.051  10.216  -5.073  1.00 0.00 ? 31  ALA A H    3  
ATOM 4323  H HA   . ALA A 1 31  ? -7.554  10.066  -6.495  1.00 0.00 ? 31  ALA A HA   3  
ATOM 4324  H HB1  . ALA A 1 31  ? -5.608  11.071  -7.552  1.00 0.00 ? 31  ALA A HB1  3  
ATOM 4325  H HB2  . ALA A 1 31  ? -6.169  9.673   -8.471  1.00 0.00 ? 31  ALA A HB2  3  
ATOM 4326  H HB3  . ALA A 1 31  ? -4.743  9.537   -7.441  1.00 0.00 ? 31  ALA A HB3  3  
ATOM 4327  N N    . THR A 1 32  ? -5.731  7.354   -6.070  1.00 0.00 ? 32  THR A N    3  
ATOM 4328  C CA   . THR A 1 32  ? -5.771  5.901   -6.011  1.00 0.00 ? 32  THR A CA   3  
ATOM 4329  C C    . THR A 1 32  ? -6.780  5.374   -4.990  1.00 0.00 ? 32  THR A C    3  
ATOM 4330  O O    . THR A 1 32  ? -7.611  4.527   -5.316  1.00 0.00 ? 32  THR A O    3  
ATOM 4331  C CB   . THR A 1 32  ? -4.382  5.349   -5.656  1.00 0.00 ? 32  THR A CB   3  
ATOM 4332  O OG1  . THR A 1 32  ? -3.373  6.112   -6.333  1.00 0.00 ? 32  THR A OG1  3  
ATOM 4333  C CG2  . THR A 1 32  ? -4.258  3.885   -6.048  1.00 0.00 ? 32  THR A CG2  3  
ATOM 4334  H H    . THR A 1 32  ? -4.864  7.797   -5.956  1.00 0.00 ? 32  THR A H    3  
ATOM 4335  H HA   . THR A 1 32  ? -6.036  5.534   -6.991  1.00 0.00 ? 32  THR A HA   3  
ATOM 4336  H HB   . THR A 1 32  ? -4.238  5.433   -4.585  1.00 0.00 ? 32  THR A HB   3  
ATOM 4337  H HG1  . THR A 1 32  ? -3.159  6.900   -5.819  1.00 0.00 ? 32  THR A HG1  3  
ATOM 4338  H HG21 . THR A 1 32  ? -3.305  3.503   -5.711  1.00 0.00 ? 32  THR A HG21 3  
ATOM 4339  H HG22 . THR A 1 32  ? -4.322  3.794   -7.121  1.00 0.00 ? 32  THR A HG22 3  
ATOM 4340  H HG23 . THR A 1 32  ? -5.057  3.319   -5.589  1.00 0.00 ? 32  THR A HG23 3  
ATOM 4341  N N    . VAL A 1 33  ? -6.710  5.863   -3.754  1.00 0.00 ? 33  VAL A N    3  
ATOM 4342  C CA   . VAL A 1 33  ? -7.458  5.243   -2.665  1.00 0.00 ? 33  VAL A CA   3  
ATOM 4343  C C    . VAL A 1 33  ? -8.261  6.256   -1.847  1.00 0.00 ? 33  VAL A C    3  
ATOM 4344  O O    . VAL A 1 33  ? -8.849  5.905   -0.829  1.00 0.00 ? 33  VAL A O    3  
ATOM 4345  C CB   . VAL A 1 33  ? -6.515  4.464   -1.721  1.00 0.00 ? 33  VAL A CB   3  
ATOM 4346  C CG1  . VAL A 1 33  ? -5.734  3.415   -2.494  1.00 0.00 ? 33  VAL A CG1  3  
ATOM 4347  C CG2  . VAL A 1 33  ? -5.564  5.406   -0.996  1.00 0.00 ? 33  VAL A CG2  3  
ATOM 4348  H H    . VAL A 1 33  ? -6.165  6.663   -3.571  1.00 0.00 ? 33  VAL A H    3  
ATOM 4349  H HA   . VAL A 1 33  ? -8.146  4.533   -3.105  1.00 0.00 ? 33  VAL A HA   3  
ATOM 4350  H HB   . VAL A 1 33  ? -7.118  3.957   -0.981  1.00 0.00 ? 33  VAL A HB   3  
ATOM 4351  H HG11 . VAL A 1 33  ? -5.146  3.899   -3.259  1.00 0.00 ? 33  VAL A HG11 3  
ATOM 4352  H HG12 . VAL A 1 33  ? -6.421  2.720   -2.955  1.00 0.00 ? 33  VAL A HG12 3  
ATOM 4353  H HG13 . VAL A 1 33  ? -5.079  2.882   -1.820  1.00 0.00 ? 33  VAL A HG13 3  
ATOM 4354  H HG21 . VAL A 1 33  ? -4.896  4.833   -0.370  1.00 0.00 ? 33  VAL A HG21 3  
ATOM 4355  H HG22 . VAL A 1 33  ? -6.132  6.092   -0.384  1.00 0.00 ? 33  VAL A HG22 3  
ATOM 4356  H HG23 . VAL A 1 33  ? -4.988  5.962   -1.721  1.00 0.00 ? 33  VAL A HG23 3  
ATOM 4357  N N    . GLY A 1 34  ? -8.278  7.506   -2.277  1.00 0.00 ? 34  GLY A N    3  
ATOM 4358  C CA   . GLY A 1 34  ? -9.084  8.502   -1.590  1.00 0.00 ? 34  GLY A CA   3  
ATOM 4359  C C    . GLY A 1 34  ? -8.386  9.136   -0.397  1.00 0.00 ? 34  GLY A C    3  
ATOM 4360  O O    . GLY A 1 34  ? -8.586  10.316  -0.113  1.00 0.00 ? 34  GLY A O    3  
ATOM 4361  H H    . GLY A 1 34  ? -7.758  7.749   -3.072  1.00 0.00 ? 34  GLY A H    3  
ATOM 4362  H HA2  . GLY A 1 34  ? -9.349  9.281   -2.287  1.00 0.00 ? 34  GLY A HA2  3  
ATOM 4363  H HA3  . GLY A 1 34  ? -9.990  8.023   -1.240  1.00 0.00 ? 34  GLY A HA3  3  
ATOM 4364  N N    . TYR A 1 35  ? -7.572  8.358   0.303   1.00 0.00 ? 35  TYR A N    3  
ATOM 4365  C CA   . TYR A 1 35  ? -6.923  8.838   1.518   1.00 0.00 ? 35  TYR A CA   3  
ATOM 4366  C C    . TYR A 1 35  ? -5.831  9.838   1.198   1.00 0.00 ? 35  TYR A C    3  
ATOM 4367  O O    . TYR A 1 35  ? -5.142  9.719   0.190   1.00 0.00 ? 35  TYR A O    3  
ATOM 4368  C CB   . TYR A 1 35  ? -6.329  7.680   2.321   1.00 0.00 ? 35  TYR A CB   3  
ATOM 4369  C CG   . TYR A 1 35  ? -7.359  6.681   2.772   1.00 0.00 ? 35  TYR A CG   3  
ATOM 4370  C CD1  . TYR A 1 35  ? -8.482  7.095   3.472   1.00 0.00 ? 35  TYR A CD1  3  
ATOM 4371  C CD2  . TYR A 1 35  ? -7.215  5.332   2.498   1.00 0.00 ? 35  TYR A CD2  3  
ATOM 4372  C CE1  . TYR A 1 35  ? -9.437  6.191   3.885   1.00 0.00 ? 35  TYR A CE1  3  
ATOM 4373  C CE2  . TYR A 1 35  ? -8.162  4.421   2.909   1.00 0.00 ? 35  TYR A CE2  3  
ATOM 4374  C CZ   . TYR A 1 35  ? -9.274  4.857   3.600   1.00 0.00 ? 35  TYR A CZ   3  
ATOM 4375  O OH   . TYR A 1 35  ? -10.226 3.952   4.003   1.00 0.00 ? 35  TYR A OH   3  
ATOM 4376  H H    . TYR A 1 35  ? -7.397  7.448   -0.013  1.00 0.00 ? 35  TYR A H    3  
ATOM 4377  H HA   . TYR A 1 35  ? -7.673  9.329   2.119   1.00 0.00 ? 35  TYR A HA   3  
ATOM 4378  H HB2  . TYR A 1 35  ? -5.603  7.162   1.716   1.00 0.00 ? 35  TYR A HB2  3  
ATOM 4379  H HB3  . TYR A 1 35  ? -5.841  8.076   3.200   1.00 0.00 ? 35  TYR A HB3  3  
ATOM 4380  H HD1  . TYR A 1 35  ? -8.606  8.144   3.692   1.00 0.00 ? 35  TYR A HD1  3  
ATOM 4381  H HD2  . TYR A 1 35  ? -6.342  4.996   1.957   1.00 0.00 ? 35  TYR A HD2  3  
ATOM 4382  H HE1  . TYR A 1 35  ? -10.307 6.535   4.428   1.00 0.00 ? 35  TYR A HE1  3  
ATOM 4383  H HE2  . TYR A 1 35  ? -8.034  3.370   2.686   1.00 0.00 ? 35  TYR A HE2  3  
ATOM 4384  H HH   . TYR A 1 35  ? -9.792  3.141   4.279   1.00 0.00 ? 35  TYR A HH   3  
ATOM 4385  N N    . GLN A 1 36  ? -5.685  10.820  2.065   1.00 0.00 ? 36  GLN A N    3  
ATOM 4386  C CA   . GLN A 1 36  ? -4.635  11.810  1.921   1.00 0.00 ? 36  GLN A CA   3  
ATOM 4387  C C    . GLN A 1 36  ? -3.389  11.312  2.645   1.00 0.00 ? 36  GLN A C    3  
ATOM 4388  O O    . GLN A 1 36  ? -3.490  10.396  3.459   1.00 0.00 ? 36  GLN A O    3  
ATOM 4389  C CB   . GLN A 1 36  ? -5.087  13.158  2.490   1.00 0.00 ? 36  GLN A CB   3  
ATOM 4390  C CG   . GLN A 1 36  ? -6.520  13.521  2.134   1.00 0.00 ? 36  GLN A CG   3  
ATOM 4391  C CD   . GLN A 1 36  ? -6.814  14.986  2.311   1.00 0.00 ? 36  GLN A CD   3  
ATOM 4392  O OE1  . GLN A 1 36  ? -7.159  15.446  3.396   1.00 0.00 ? 36  GLN A OE1  3  
ATOM 4393  N NE2  . GLN A 1 36  ? -6.706  15.727  1.226   1.00 0.00 ? 36  GLN A NE2  3  
ATOM 4394  H H    . GLN A 1 36  ? -6.287  10.859  2.836   1.00 0.00 ? 36  GLN A H    3  
ATOM 4395  H HA   . GLN A 1 36  ? -4.414  11.915  0.866   1.00 0.00 ? 36  GLN A HA   3  
ATOM 4396  H HB2  . GLN A 1 36  ? -5.004  13.126  3.566   1.00 0.00 ? 36  GLN A HB2  3  
ATOM 4397  H HB3  . GLN A 1 36  ? -4.436  13.933  2.110   1.00 0.00 ? 36  GLN A HB3  3  
ATOM 4398  H HG2  . GLN A 1 36  ? -6.695  13.270  1.101   1.00 0.00 ? 36  GLN A HG2  3  
ATOM 4399  H HG3  . GLN A 1 36  ? -7.190  12.954  2.761   1.00 0.00 ? 36  GLN A HG3  3  
ATOM 4400  H HE21 . GLN A 1 36  ? -6.442  15.289  0.388   1.00 0.00 ? 36  GLN A HE21 3  
ATOM 4401  H HE22 . GLN A 1 36  ? -6.919  16.676  1.295   1.00 0.00 ? 36  GLN A HE22 3  
ATOM 4402  N N    . PRO A 1 37  ? -2.206  11.884  2.356   1.00 0.00 ? 37  PRO A N    3  
ATOM 4403  C CA   . PRO A 1 37  ? -0.950  11.445  2.979   1.00 0.00 ? 37  PRO A CA   3  
ATOM 4404  C C    . PRO A 1 37  ? -1.078  11.285  4.493   1.00 0.00 ? 37  PRO A C    3  
ATOM 4405  O O    . PRO A 1 37  ? -0.795  10.220  5.040   1.00 0.00 ? 37  PRO A O    3  
ATOM 4406  C CB   . PRO A 1 37  ? 0.013   12.579  2.641   1.00 0.00 ? 37  PRO A CB   3  
ATOM 4407  C CG   . PRO A 1 37  ? -0.490  13.128  1.352   1.00 0.00 ? 37  PRO A CG   3  
ATOM 4408  C CD   . PRO A 1 37  ? -1.987  12.977  1.386   1.00 0.00 ? 37  PRO A CD   3  
ATOM 4409  H HA   . PRO A 1 37  ? -0.593  10.525  2.549   1.00 0.00 ? 37  PRO A HA   3  
ATOM 4410  H HB2  . PRO A 1 37  ? -0.011  13.321  3.425   1.00 0.00 ? 37  PRO A HB2  3  
ATOM 4411  H HB3  . PRO A 1 37  ? 1.013   12.187  2.537   1.00 0.00 ? 37  PRO A HB3  3  
ATOM 4412  H HG2  . PRO A 1 37  ? -0.221  14.171  1.269   1.00 0.00 ? 37  PRO A HG2  3  
ATOM 4413  H HG3  . PRO A 1 37  ? -0.076  12.568  0.527   1.00 0.00 ? 37  PRO A HG3  3  
ATOM 4414  H HD2  . PRO A 1 37  ? -2.450  13.892  1.726   1.00 0.00 ? 37  PRO A HD2  3  
ATOM 4415  H HD3  . PRO A 1 37  ? -2.361  12.706  0.409   1.00 0.00 ? 37  PRO A HD3  3  
ATOM 4416  N N    . GLN A 1 38  ? -1.580  12.330  5.141   1.00 0.00 ? 38  GLN A N    3  
ATOM 4417  C CA   . GLN A 1 38  ? -1.732  12.348  6.594   1.00 0.00 ? 38  GLN A CA   3  
ATOM 4418  C C    . GLN A 1 38  ? -2.689  11.253  7.046   1.00 0.00 ? 38  GLN A C    3  
ATOM 4419  O O    . GLN A 1 38  ? -2.451  10.580  8.047   1.00 0.00 ? 38  GLN A O    3  
ATOM 4420  C CB   . GLN A 1 38  ? -2.248  13.714  7.053   1.00 0.00 ? 38  GLN A CB   3  
ATOM 4421  C CG   . GLN A 1 38  ? -1.337  14.867  6.669   1.00 0.00 ? 38  GLN A CG   3  
ATOM 4422  C CD   . GLN A 1 38  ? 0.024   14.787  7.328   1.00 0.00 ? 38  GLN A CD   3  
ATOM 4423  O OE1  . GLN A 1 38  ? 0.159   14.292  8.447   1.00 0.00 ? 38  GLN A OE1  3  
ATOM 4424  N NE2  . GLN A 1 38  ? 1.046   15.253  6.628   1.00 0.00 ? 38  GLN A NE2  3  
ATOM 4425  H H    . GLN A 1 38  ? -1.866  13.103  4.617   1.00 0.00 ? 38  GLN A H    3  
ATOM 4426  H HA   . GLN A 1 38  ? -0.761  12.170  7.033   1.00 0.00 ? 38  GLN A HA   3  
ATOM 4427  H HB2  . GLN A 1 38  ? -3.218  13.885  6.611   1.00 0.00 ? 38  GLN A HB2  3  
ATOM 4428  H HB3  . GLN A 1 38  ? -2.347  13.704  8.128   1.00 0.00 ? 38  GLN A HB3  3  
ATOM 4429  H HG2  . GLN A 1 38  ? -1.203  14.862  5.597   1.00 0.00 ? 38  GLN A HG2  3  
ATOM 4430  H HG3  . GLN A 1 38  ? -1.809  15.792  6.964   1.00 0.00 ? 38  GLN A HG3  3  
ATOM 4431  H HE21 . GLN A 1 38  ? 0.870   15.616  5.736   1.00 0.00 ? 38  GLN A HE21 3  
ATOM 4432  H HE22 . GLN A 1 38  ? 1.944   15.227  7.037   1.00 0.00 ? 38  GLN A HE22 3  
ATOM 4433  N N    . GLU A 1 39  ? -3.744  11.055  6.264   1.00 0.00 ? 39  GLU A N    3  
ATOM 4434  C CA   . GLU A 1 39  ? -4.781  10.082  6.576   1.00 0.00 ? 39  GLU A CA   3  
ATOM 4435  C C    . GLU A 1 39  ? -4.214  8.683   6.720   1.00 0.00 ? 39  GLU A C    3  
ATOM 4436  O O    . GLU A 1 39  ? -4.667  7.906   7.561   1.00 0.00 ? 39  GLU A O    3  
ATOM 4437  C CB   . GLU A 1 39  ? -5.854  10.090  5.490   1.00 0.00 ? 39  GLU A CB   3  
ATOM 4438  C CG   . GLU A 1 39  ? -6.971  11.074  5.753   1.00 0.00 ? 39  GLU A CG   3  
ATOM 4439  C CD   . GLU A 1 39  ? -7.839  10.635  6.910   1.00 0.00 ? 39  GLU A CD   3  
ATOM 4440  O OE1  . GLU A 1 39  ? -7.477  10.913  8.070   1.00 0.00 ? 39  GLU A OE1  3  
ATOM 4441  O OE2  . GLU A 1 39  ? -8.873  9.978   6.662   1.00 0.00 ? 39  GLU A OE2  3  
ATOM 4442  H H    . GLU A 1 39  ? -3.814  11.564  5.431   1.00 0.00 ? 39  GLU A H    3  
ATOM 4443  H HA   . GLU A 1 39  ? -5.233  10.371  7.513   1.00 0.00 ? 39  GLU A HA   3  
ATOM 4444  H HB2  . GLU A 1 39  ? -5.395  10.345  4.546   1.00 0.00 ? 39  GLU A HB2  3  
ATOM 4445  H HB3  . GLU A 1 39  ? -6.284  9.103   5.415   1.00 0.00 ? 39  GLU A HB3  3  
ATOM 4446  H HG2  . GLU A 1 39  ? -6.540  12.036  5.984   1.00 0.00 ? 39  GLU A HG2  3  
ATOM 4447  H HG3  . GLU A 1 39  ? -7.585  11.154  4.867   1.00 0.00 ? 39  GLU A HG3  3  
ATOM 4448  N N    . LEU A 1 40  ? -3.225  8.357   5.910   1.00 0.00 ? 40  LEU A N    3  
ATOM 4449  C CA   . LEU A 1 40  ? -2.697  7.007   5.898   1.00 0.00 ? 40  LEU A CA   3  
ATOM 4450  C C    . LEU A 1 40  ? -1.577  6.856   6.922   1.00 0.00 ? 40  LEU A C    3  
ATOM 4451  O O    . LEU A 1 40  ? -1.263  5.744   7.354   1.00 0.00 ? 40  LEU A O    3  
ATOM 4452  C CB   . LEU A 1 40  ? -2.213  6.660   4.493   1.00 0.00 ? 40  LEU A CB   3  
ATOM 4453  C CG   . LEU A 1 40  ? -2.287  5.179   4.128   1.00 0.00 ? 40  LEU A CG   3  
ATOM 4454  C CD1  . LEU A 1 40  ? -3.681  4.628   4.402   1.00 0.00 ? 40  LEU A CD1  3  
ATOM 4455  C CD2  . LEU A 1 40  ? -1.919  4.982   2.667   1.00 0.00 ? 40  LEU A CD2  3  
ATOM 4456  H H    . LEU A 1 40  ? -2.843  9.031   5.302   1.00 0.00 ? 40  LEU A H    3  
ATOM 4457  H HA   . LEU A 1 40  ? -3.502  6.338   6.164   1.00 0.00 ? 40  LEU A HA   3  
ATOM 4458  H HB2  . LEU A 1 40  ? -2.806  7.217   3.781   1.00 0.00 ? 40  LEU A HB2  3  
ATOM 4459  H HB3  . LEU A 1 40  ? -1.184  6.978   4.402   1.00 0.00 ? 40  LEU A HB3  3  
ATOM 4460  H HG   . LEU A 1 40  ? -1.581  4.626   4.732   1.00 0.00 ? 40  LEU A HG   3  
ATOM 4461  H HD11 . LEU A 1 40  ? -4.405  5.165   3.806   1.00 0.00 ? 40  LEU A HD11 3  
ATOM 4462  H HD12 . LEU A 1 40  ? -3.918  4.748   5.450   1.00 0.00 ? 40  LEU A HD12 3  
ATOM 4463  H HD13 . LEU A 1 40  ? -3.711  3.579   4.145   1.00 0.00 ? 40  LEU A HD13 3  
ATOM 4464  H HD21 . LEU A 1 40  ? -1.996  3.936   2.413   1.00 0.00 ? 40  LEU A HD21 3  
ATOM 4465  H HD22 . LEU A 1 40  ? -0.908  5.320   2.505   1.00 0.00 ? 40  LEU A HD22 3  
ATOM 4466  H HD23 . LEU A 1 40  ? -2.594  5.555   2.048   1.00 0.00 ? 40  LEU A HD23 3  
ATOM 4467  N N    . LEU A 1 41  ? -0.986  7.979   7.315   1.00 0.00 ? 41  LEU A N    3  
ATOM 4468  C CA   . LEU A 1 41  ? 0.080   7.969   8.311   1.00 0.00 ? 41  LEU A CA   3  
ATOM 4469  C C    . LEU A 1 41  ? -0.475  7.625   9.691   1.00 0.00 ? 41  LEU A C    3  
ATOM 4470  O O    . LEU A 1 41  ? -0.976  8.493   10.409  1.00 0.00 ? 41  LEU A O    3  
ATOM 4471  C CB   . LEU A 1 41  ? 0.796   9.321   8.365   1.00 0.00 ? 41  LEU A CB   3  
ATOM 4472  C CG   . LEU A 1 41  ? 1.337   9.838   7.030   1.00 0.00 ? 41  LEU A CG   3  
ATOM 4473  C CD1  . LEU A 1 41  ? 2.004   11.191  7.214   1.00 0.00 ? 41  LEU A CD1  3  
ATOM 4474  C CD2  . LEU A 1 41  ? 2.308   8.842   6.422   1.00 0.00 ? 41  LEU A CD2  3  
ATOM 4475  H H    . LEU A 1 41  ? -1.259  8.829   6.904   1.00 0.00 ? 41  LEU A H    3  
ATOM 4476  H HA   . LEU A 1 41  ? 0.790   7.207   8.026   1.00 0.00 ? 41  LEU A HA   3  
ATOM 4477  H HB2  . LEU A 1 41  ? 0.108   10.055  8.758   1.00 0.00 ? 41  LEU A HB2  3  
ATOM 4478  H HB3  . LEU A 1 41  ? 1.628   9.231   9.050   1.00 0.00 ? 41  LEU A HB3  3  
ATOM 4479  H HG   . LEU A 1 41  ? 0.512   9.966   6.342   1.00 0.00 ? 41  LEU A HG   3  
ATOM 4480  H HD11 . LEU A 1 41  ? 2.810   11.103  7.927   1.00 0.00 ? 41  LEU A HD11 3  
ATOM 4481  H HD12 . LEU A 1 41  ? 1.278   11.905  7.578   1.00 0.00 ? 41  LEU A HD12 3  
ATOM 4482  H HD13 . LEU A 1 41  ? 2.396   11.530  6.267   1.00 0.00 ? 41  LEU A HD13 3  
ATOM 4483  H HD21 . LEU A 1 41  ? 3.140   8.693   7.095   1.00 0.00 ? 41  LEU A HD21 3  
ATOM 4484  H HD22 . LEU A 1 41  ? 2.673   9.225   5.478   1.00 0.00 ? 41  LEU A HD22 3  
ATOM 4485  H HD23 . LEU A 1 41  ? 1.805   7.903   6.257   1.00 0.00 ? 41  LEU A HD23 3  
ATOM 4486  N N    . GLY A 1 42  ? -0.393  6.351   10.048  1.00 0.00 ? 42  GLY A N    3  
ATOM 4487  C CA   . GLY A 1 42  ? -0.852  5.916   11.351  1.00 0.00 ? 42  GLY A CA   3  
ATOM 4488  C C    . GLY A 1 42  ? -1.771  4.717   11.282  1.00 0.00 ? 42  GLY A C    3  
ATOM 4489  O O    . GLY A 1 42  ? -1.861  3.941   12.234  1.00 0.00 ? 42  GLY A O    3  
ATOM 4490  H H    . GLY A 1 42  ? -0.009  5.704   9.419   1.00 0.00 ? 42  GLY A H    3  
ATOM 4491  H HA2  . GLY A 1 42  ? 0.008   5.663   11.954  1.00 0.00 ? 42  GLY A HA2  3  
ATOM 4492  H HA3  . GLY A 1 42  ? -1.379  6.732   11.824  1.00 0.00 ? 42  GLY A HA3  3  
ATOM 4493  N N    . LYS A 1 43  ? -2.449  4.550   10.157  1.00 0.00 ? 43  LYS A N    3  
ATOM 4494  C CA   . LYS A 1 43  ? -3.395  3.462   10.005  1.00 0.00 ? 43  LYS A CA   3  
ATOM 4495  C C    . LYS A 1 43  ? -2.835  2.403   9.063   1.00 0.00 ? 43  LYS A C    3  
ATOM 4496  O O    . LYS A 1 43  ? -2.261  2.722   8.024   1.00 0.00 ? 43  LYS A O    3  
ATOM 4497  C CB   . LYS A 1 43  ? -4.741  4.000   9.507   1.00 0.00 ? 43  LYS A CB   3  
ATOM 4498  C CG   . LYS A 1 43  ? -5.385  4.975   10.488  1.00 0.00 ? 43  LYS A CG   3  
ATOM 4499  C CD   . LYS A 1 43  ? -6.847  5.242   10.159  1.00 0.00 ? 43  LYS A CD   3  
ATOM 4500  C CE   . LYS A 1 43  ? -7.016  6.153   8.953   1.00 0.00 ? 43  LYS A CE   3  
ATOM 4501  N NZ   . LYS A 1 43  ? -6.662  7.565   9.258   1.00 0.00 ? 43  LYS A NZ   3  
ATOM 4502  H H    . LYS A 1 43  ? -2.294  5.156   9.401   1.00 0.00 ? 43  LYS A H    3  
ATOM 4503  H HA   . LYS A 1 43  ? -3.539  3.016   10.977  1.00 0.00 ? 43  LYS A HA   3  
ATOM 4504  H HB2  . LYS A 1 43  ? -4.589  4.512   8.566   1.00 0.00 ? 43  LYS A HB2  3  
ATOM 4505  H HB3  . LYS A 1 43  ? -5.417  3.171   9.356   1.00 0.00 ? 43  LYS A HB3  3  
ATOM 4506  H HG2  . LYS A 1 43  ? -5.323  4.560   11.480  1.00 0.00 ? 43  LYS A HG2  3  
ATOM 4507  H HG3  . LYS A 1 43  ? -4.843  5.910   10.454  1.00 0.00 ? 43  LYS A HG3  3  
ATOM 4508  H HD2  . LYS A 1 43  ? -7.335  4.301   9.951   1.00 0.00 ? 43  LYS A HD2  3  
ATOM 4509  H HD3  . LYS A 1 43  ? -7.313  5.706   11.014  1.00 0.00 ? 43  LYS A HD3  3  
ATOM 4510  H HE2  . LYS A 1 43  ? -6.377  5.797   8.159   1.00 0.00 ? 43  LYS A HE2  3  
ATOM 4511  H HE3  . LYS A 1 43  ? -8.046  6.110   8.629   1.00 0.00 ? 43  LYS A HE3  3  
ATOM 4512  H HZ1  . LYS A 1 43  ? -7.399  8.205   8.897   1.00 0.00 ? 43  LYS A HZ1  3  
ATOM 4513  H HZ2  . LYS A 1 43  ? -5.756  7.812   8.803   1.00 0.00 ? 43  LYS A HZ2  3  
ATOM 4514  H HZ3  . LYS A 1 43  ? -6.566  7.705   10.287  1.00 0.00 ? 43  LYS A HZ3  3  
ATOM 4515  N N    . ASN A 1 44  ? -2.994  1.143   9.450   1.00 0.00 ? 44  ASN A N    3  
ATOM 4516  C CA   . ASN A 1 44  ? -2.397  0.024   8.724   1.00 0.00 ? 44  ASN A CA   3  
ATOM 4517  C C    . ASN A 1 44  ? -3.130  -0.231  7.410   1.00 0.00 ? 44  ASN A C    3  
ATOM 4518  O O    . ASN A 1 44  ? -4.351  -0.095  7.326   1.00 0.00 ? 44  ASN A O    3  
ATOM 4519  C CB   . ASN A 1 44  ? -2.448  -1.235  9.601   1.00 0.00 ? 44  ASN A CB   3  
ATOM 4520  C CG   . ASN A 1 44  ? -1.502  -2.332  9.139   1.00 0.00 ? 44  ASN A CG   3  
ATOM 4521  O OD1  . ASN A 1 44  ? -1.249  -2.505  7.949   1.00 0.00 ? 44  ASN A OD1  3  
ATOM 4522  N ND2  . ASN A 1 44  ? -0.969  -3.087  10.084  1.00 0.00 ? 44  ASN A ND2  3  
ATOM 4523  H H    . ASN A 1 44  ? -3.534  0.951   10.244  1.00 0.00 ? 44  ASN A H    3  
ATOM 4524  H HA   . ASN A 1 44  ? -1.368  0.270   8.513   1.00 0.00 ? 44  ASN A HA   3  
ATOM 4525  H HB2  . ASN A 1 44  ? -2.192  -0.968  10.614  1.00 0.00 ? 44  ASN A HB2  3  
ATOM 4526  H HB3  . ASN A 1 44  ? -3.456  -1.626  9.580   1.00 0.00 ? 44  ASN A HB3  3  
ATOM 4527  H HD21 . ASN A 1 44  ? -1.214  -2.909  11.020  1.00 0.00 ? 44  ASN A HD21 3  
ATOM 4528  H HD22 . ASN A 1 44  ? -0.334  -3.786  9.815   1.00 0.00 ? 44  ASN A HD22 3  
ATOM 4529  N N    . ILE A 1 45  ? -2.363  -0.612  6.391   1.00 0.00 ? 45  ILE A N    3  
ATOM 4530  C CA   . ILE A 1 45  ? -2.910  -0.979  5.089   1.00 0.00 ? 45  ILE A CA   3  
ATOM 4531  C C    . ILE A 1 45  ? -3.830  -2.191  5.217   1.00 0.00 ? 45  ILE A C    3  
ATOM 4532  O O    . ILE A 1 45  ? -4.755  -2.363  4.429   1.00 0.00 ? 45  ILE A O    3  
ATOM 4533  C CB   . ILE A 1 45  ? -1.780  -1.285  4.070   1.00 0.00 ? 45  ILE A CB   3  
ATOM 4534  C CG1  . ILE A 1 45  ? -2.361  -1.573  2.681   1.00 0.00 ? 45  ILE A CG1  3  
ATOM 4535  C CG2  . ILE A 1 45  ? -0.923  -2.454  4.542   1.00 0.00 ? 45  ILE A CG2  3  
ATOM 4536  C CD1  . ILE A 1 45  ? -1.312  -1.784  1.611   1.00 0.00 ? 45  ILE A CD1  3  
ATOM 4537  H H    . ILE A 1 45  ? -1.390  -0.649  6.523   1.00 0.00 ? 45  ILE A H    3  
ATOM 4538  H HA   . ILE A 1 45  ? -3.485  -0.140  4.720   1.00 0.00 ? 45  ILE A HA   3  
ATOM 4539  H HB   . ILE A 1 45  ? -1.143  -0.414  4.008   1.00 0.00 ? 45  ILE A HB   3  
ATOM 4540  H HG12 . ILE A 1 45  ? -2.963  -2.465  2.732   1.00 0.00 ? 45  ILE A HG12 3  
ATOM 4541  H HG13 . ILE A 1 45  ? -2.982  -0.741  2.379   1.00 0.00 ? 45  ILE A HG13 3  
ATOM 4542  H HG21 . ILE A 1 45  ? -0.134  -2.634  3.827   1.00 0.00 ? 45  ILE A HG21 3  
ATOM 4543  H HG22 . ILE A 1 45  ? -1.538  -3.338  4.626   1.00 0.00 ? 45  ILE A HG22 3  
ATOM 4544  H HG23 . ILE A 1 45  ? -0.492  -2.220  5.503   1.00 0.00 ? 45  ILE A HG23 3  
ATOM 4545  H HD11 . ILE A 1 45  ? -0.677  -2.613  1.887   1.00 0.00 ? 45  ILE A HD11 3  
ATOM 4546  H HD12 . ILE A 1 45  ? -0.713  -0.890  1.512   1.00 0.00 ? 45  ILE A HD12 3  
ATOM 4547  H HD13 . ILE A 1 45  ? -1.797  -1.999  0.670   1.00 0.00 ? 45  ILE A HD13 3  
ATOM 4548  N N    . VAL A 1 46  ? -3.587  -3.013  6.233   1.00 0.00 ? 46  VAL A N    3  
ATOM 4549  C CA   . VAL A 1 46  ? -4.393  -4.197  6.469   1.00 0.00 ? 46  VAL A CA   3  
ATOM 4550  C C    . VAL A 1 46  ? -5.747  -3.812  7.073   1.00 0.00 ? 46  VAL A C    3  
ATOM 4551  O O    . VAL A 1 46  ? -6.732  -4.531  6.917   1.00 0.00 ? 46  VAL A O    3  
ATOM 4552  C CB   . VAL A 1 46  ? -3.658  -5.186  7.393   1.00 0.00 ? 46  VAL A CB   3  
ATOM 4553  C CG1  . VAL A 1 46  ? -4.468  -6.461  7.590   1.00 0.00 ? 46  VAL A CG1  3  
ATOM 4554  C CG2  . VAL A 1 46  ? -2.282  -5.513  6.832   1.00 0.00 ? 46  VAL A CG2  3  
ATOM 4555  H H    . VAL A 1 46  ? -2.841  -2.819  6.845   1.00 0.00 ? 46  VAL A H    3  
ATOM 4556  H HA   . VAL A 1 46  ? -4.559  -4.681  5.516   1.00 0.00 ? 46  VAL A HA   3  
ATOM 4557  H HB   . VAL A 1 46  ? -3.524  -4.709  8.351   1.00 0.00 ? 46  VAL A HB   3  
ATOM 4558  H HG11 . VAL A 1 46  ? -4.625  -6.941  6.633   1.00 0.00 ? 46  VAL A HG11 3  
ATOM 4559  H HG12 . VAL A 1 46  ? -5.424  -6.215  8.027   1.00 0.00 ? 46  VAL A HG12 3  
ATOM 4560  H HG13 . VAL A 1 46  ? -3.933  -7.130  8.245   1.00 0.00 ? 46  VAL A HG13 3  
ATOM 4561  H HG21 . VAL A 1 46  ? -1.716  -4.600  6.714   1.00 0.00 ? 46  VAL A HG21 3  
ATOM 4562  H HG22 . VAL A 1 46  ? -2.390  -5.998  5.873   1.00 0.00 ? 46  VAL A HG22 3  
ATOM 4563  H HG23 . VAL A 1 46  ? -1.763  -6.171  7.514   1.00 0.00 ? 46  VAL A HG23 3  
ATOM 4564  N N    . GLU A 1 47  ? -5.794  -2.655  7.736   1.00 0.00 ? 47  GLU A N    3  
ATOM 4565  C CA   . GLU A 1 47  ? -7.047  -2.129  8.274   1.00 0.00 ? 47  GLU A CA   3  
ATOM 4566  C C    . GLU A 1 47  ? -7.965  -1.717  7.130   1.00 0.00 ? 47  GLU A C    3  
ATOM 4567  O O    . GLU A 1 47  ? -9.191  -1.725  7.255   1.00 0.00 ? 47  GLU A O    3  
ATOM 4568  C CB   . GLU A 1 47  ? -6.786  -0.927  9.184   1.00 0.00 ? 47  GLU A CB   3  
ATOM 4569  C CG   . GLU A 1 47  ? -6.034  -1.271  10.456  1.00 0.00 ? 47  GLU A CG   3  
ATOM 4570  C CD   . GLU A 1 47  ? -6.835  -2.156  11.387  1.00 0.00 ? 47  GLU A CD   3  
ATOM 4571  O OE1  . GLU A 1 47  ? -7.793  -1.653  12.010  1.00 0.00 ? 47  GLU A OE1  3  
ATOM 4572  O OE2  . GLU A 1 47  ? -6.505  -3.354  11.507  1.00 0.00 ? 47  GLU A OE2  3  
ATOM 4573  H H    . GLU A 1 47  ? -4.967  -2.143  7.864   1.00 0.00 ? 47  GLU A H    3  
ATOM 4574  H HA   . GLU A 1 47  ? -7.521  -2.910  8.846   1.00 0.00 ? 47  GLU A HA   3  
ATOM 4575  H HB2  . GLU A 1 47  ? -6.206  -0.200  8.639   1.00 0.00 ? 47  GLU A HB2  3  
ATOM 4576  H HB3  . GLU A 1 47  ? -7.732  -0.485  9.460   1.00 0.00 ? 47  GLU A HB3  3  
ATOM 4577  H HG2  . GLU A 1 47  ? -5.129  -1.791  10.188  1.00 0.00 ? 47  GLU A HG2  3  
ATOM 4578  H HG3  . GLU A 1 47  ? -5.786  -0.355  10.974  1.00 0.00 ? 47  GLU A HG3  3  
ATOM 4579  N N    . PHE A 1 48  ? -7.361  -1.353  6.008   1.00 0.00 ? 48  PHE A N    3  
ATOM 4580  C CA   . PHE A 1 48  ? -8.117  -0.970  4.828   1.00 0.00 ? 48  PHE A CA   3  
ATOM 4581  C C    . PHE A 1 48  ? -8.007  -2.044  3.763   1.00 0.00 ? 48  PHE A C    3  
ATOM 4582  O O    . PHE A 1 48  ? -8.345  -1.824  2.602   1.00 0.00 ? 48  PHE A O    3  
ATOM 4583  C CB   . PHE A 1 48  ? -7.630  0.368   4.282   1.00 0.00 ? 48  PHE A CB   3  
ATOM 4584  C CG   . PHE A 1 48  ? -7.759  1.484   5.271   1.00 0.00 ? 48  PHE A CG   3  
ATOM 4585  C CD1  . PHE A 1 48  ? -8.991  1.795   5.826   1.00 0.00 ? 48  PHE A CD1  3  
ATOM 4586  C CD2  . PHE A 1 48  ? -6.649  2.215   5.655   1.00 0.00 ? 48  PHE A CD2  3  
ATOM 4587  C CE1  . PHE A 1 48  ? -9.111  2.818   6.742   1.00 0.00 ? 48  PHE A CE1  3  
ATOM 4588  C CE2  . PHE A 1 48  ? -6.765  3.239   6.572   1.00 0.00 ? 48  PHE A CE2  3  
ATOM 4589  C CZ   . PHE A 1 48  ? -7.999  3.540   7.116   1.00 0.00 ? 48  PHE A CZ   3  
ATOM 4590  H H    . PHE A 1 48  ? -6.380  -1.350  5.970   1.00 0.00 ? 48  PHE A H    3  
ATOM 4591  H HA   . PHE A 1 48  ? -9.153  -0.875  5.119   1.00 0.00 ? 48  PHE A HA   3  
ATOM 4592  H HB2  . PHE A 1 48  ? -6.589  0.281   4.010   1.00 0.00 ? 48  PHE A HB2  3  
ATOM 4593  H HB3  . PHE A 1 48  ? -8.209  0.626   3.408   1.00 0.00 ? 48  PHE A HB3  3  
ATOM 4594  H HD1  . PHE A 1 48  ? -9.865  1.230   5.535   1.00 0.00 ? 48  PHE A HD1  3  
ATOM 4595  H HD2  . PHE A 1 48  ? -5.687  1.979   5.226   1.00 0.00 ? 48  PHE A HD2  3  
ATOM 4596  H HE1  . PHE A 1 48  ? -10.076 3.053   7.167   1.00 0.00 ? 48  PHE A HE1  3  
ATOM 4597  H HE2  . PHE A 1 48  ? -5.892  3.804   6.866   1.00 0.00 ? 48  PHE A HE2  3  
ATOM 4598  H HZ   . PHE A 1 48  ? -8.090  4.340   7.832   1.00 0.00 ? 48  PHE A HZ   3  
ATOM 4599  N N    . CYS A 1 49  ? -7.528  -3.201  4.173   1.00 0.00 ? 49  CYS A N    3  
ATOM 4600  C CA   . CYS A 1 49  ? -7.431  -4.341  3.286   1.00 0.00 ? 49  CYS A CA   3  
ATOM 4601  C C    . CYS A 1 49  ? -8.710  -5.150  3.340   1.00 0.00 ? 49  CYS A C    3  
ATOM 4602  O O    . CYS A 1 49  ? -9.243  -5.401  4.422   1.00 0.00 ? 49  CYS A O    3  
ATOM 4603  C CB   . CYS A 1 49  ? -6.246  -5.225  3.679   1.00 0.00 ? 49  CYS A CB   3  
ATOM 4604  S SG   . CYS A 1 49  ? -6.181  -6.796  2.790   1.00 0.00 ? 49  CYS A SG   3  
ATOM 4605  H H    . CYS A 1 49  ? -7.234  -3.296  5.105   1.00 0.00 ? 49  CYS A H    3  
ATOM 4606  H HA   . CYS A 1 49  ? -7.285  -3.977  2.280   1.00 0.00 ? 49  CYS A HA   3  
ATOM 4607  H HB2  . CYS A 1 49  ? -5.327  -4.695  3.475   1.00 0.00 ? 49  CYS A HB2  3  
ATOM 4608  H HB3  . CYS A 1 49  ? -6.303  -5.445  4.736   1.00 0.00 ? 49  CYS A HB3  3  
ATOM 4609  H HG   . CYS A 1 49  ? -7.403  -7.309  2.787   1.00 0.00 ? 49  CYS A HG   3  
ATOM 4610  N N    . HIS A 1 50  ? -9.222  -5.503  2.163   1.00 0.00 ? 50  HIS A N    3  
ATOM 4611  C CA   . HIS A 1 50  ? -10.368 -6.395  2.051   1.00 0.00 ? 50  HIS A CA   3  
ATOM 4612  C C    . HIS A 1 50  ? -10.180 -7.576  3.000   1.00 0.00 ? 50  HIS A C    3  
ATOM 4613  O O    . HIS A 1 50  ? -9.166  -8.261  2.943   1.00 0.00 ? 50  HIS A O    3  
ATOM 4614  C CB   . HIS A 1 50  ? -10.503 -6.875  0.601   1.00 0.00 ? 50  HIS A CB   3  
ATOM 4615  C CG   . HIS A 1 50  ? -11.721 -7.705  0.327   1.00 0.00 ? 50  HIS A CG   3  
ATOM 4616  N ND1  . HIS A 1 50  ? -11.661 -9.003  -0.125  1.00 0.00 ? 50  HIS A ND1  3  
ATOM 4617  C CD2  . HIS A 1 50  ? -13.035 -7.406  0.428   1.00 0.00 ? 50  HIS A CD2  3  
ATOM 4618  C CE1  . HIS A 1 50  ? -12.883 -9.468  -0.286  1.00 0.00 ? 50  HIS A CE1  3  
ATOM 4619  N NE2  . HIS A 1 50  ? -13.738 -8.521  0.045   1.00 0.00 ? 50  HIS A NE2  3  
ATOM 4620  H H    . HIS A 1 50  ? -8.829  -5.123  1.344   1.00 0.00 ? 50  HIS A H    3  
ATOM 4621  H HA   . HIS A 1 50  ? -11.255 -5.847  2.334   1.00 0.00 ? 50  HIS A HA   3  
ATOM 4622  H HB2  . HIS A 1 50  ? -10.544 -6.015  -0.050  1.00 0.00 ? 50  HIS A HB2  3  
ATOM 4623  H HB3  . HIS A 1 50  ? -9.636  -7.467  0.347   1.00 0.00 ? 50  HIS A HB3  3  
ATOM 4624  H HD1  . HIS A 1 50  ? -10.826 -9.511  -0.329  1.00 0.00 ? 50  HIS A HD1  3  
ATOM 4625  H HD2  . HIS A 1 50  ? -13.453 -6.463  0.744   1.00 0.00 ? 50  HIS A HD2  3  
ATOM 4626  H HE1  . HIS A 1 50  ? -13.140 -10.460 -0.630  1.00 0.00 ? 50  HIS A HE1  3  
ATOM 4627  H HE2  . HIS A 1 50  ? -14.695 -8.682  0.245   1.00 0.00 ? 50  HIS A HE2  3  
ATOM 4628  N N    . PRO A 1 51  ? -11.150 -7.785  3.911   1.00 0.00 ? 51  PRO A N    3  
ATOM 4629  C CA   . PRO A 1 51  ? -11.063 -8.789  4.987   1.00 0.00 ? 51  PRO A CA   3  
ATOM 4630  C C    . PRO A 1 51  ? -10.639 -10.178 4.521   1.00 0.00 ? 51  PRO A C    3  
ATOM 4631  O O    . PRO A 1 51  ? -10.043 -10.935 5.285   1.00 0.00 ? 51  PRO A O    3  
ATOM 4632  C CB   . PRO A 1 51  ? -12.488 -8.835  5.534   1.00 0.00 ? 51  PRO A CB   3  
ATOM 4633  C CG   . PRO A 1 51  ? -13.029 -7.474  5.280   1.00 0.00 ? 51  PRO A CG   3  
ATOM 4634  C CD   . PRO A 1 51  ? -12.399 -7.004  3.998   1.00 0.00 ? 51  PRO A CD   3  
ATOM 4635  H HA   . PRO A 1 51  ? -10.395 -8.461  5.771   1.00 0.00 ? 51  PRO A HA   3  
ATOM 4636  H HB2  . PRO A 1 51  ? -13.054 -9.592  5.012   1.00 0.00 ? 51  PRO A HB2  3  
ATOM 4637  H HB3  . PRO A 1 51  ? -12.462 -9.059  6.591   1.00 0.00 ? 51  PRO A HB3  3  
ATOM 4638  H HG2  . PRO A 1 51  ? -14.104 -7.520  5.173   1.00 0.00 ? 51  PRO A HG2  3  
ATOM 4639  H HG3  . PRO A 1 51  ? -12.759 -6.816  6.092   1.00 0.00 ? 51  PRO A HG3  3  
ATOM 4640  H HD2  . PRO A 1 51  ? -13.043 -7.214  3.158   1.00 0.00 ? 51  PRO A HD2  3  
ATOM 4641  H HD3  . PRO A 1 51  ? -12.182 -5.947  4.054   1.00 0.00 ? 51  PRO A HD3  3  
ATOM 4642  N N    . GLU A 1 52  ? -10.930 -10.514 3.276   1.00 0.00 ? 52  GLU A N    3  
ATOM 4643  C CA   . GLU A 1 52  ? -10.585 -11.823 2.749   1.00 0.00 ? 52  GLU A CA   3  
ATOM 4644  C C    . GLU A 1 52  ? -9.200  -11.817 2.108   1.00 0.00 ? 52  GLU A C    3  
ATOM 4645  O O    . GLU A 1 52  ? -8.691  -12.865 1.711   1.00 0.00 ? 52  GLU A O    3  
ATOM 4646  C CB   . GLU A 1 52  ? -11.634 -12.280 1.740   1.00 0.00 ? 52  GLU A CB   3  
ATOM 4647  C CG   . GLU A 1 52  ? -13.000 -12.518 2.356   1.00 0.00 ? 52  GLU A CG   3  
ATOM 4648  C CD   . GLU A 1 52  ? -12.940 -13.494 3.509   1.00 0.00 ? 52  GLU A CD   3  
ATOM 4649  O OE1  . GLU A 1 52  ? -12.467 -14.631 3.305   1.00 0.00 ? 52  GLU A OE1  3  
ATOM 4650  O OE2  . GLU A 1 52  ? -13.340 -13.122 4.631   1.00 0.00 ? 52  GLU A OE2  3  
ATOM 4651  H H    . GLU A 1 52  ? -11.378 -9.870  2.692   1.00 0.00 ? 52  GLU A H    3  
ATOM 4652  H HA   . GLU A 1 52  ? -10.579 -12.515 3.574   1.00 0.00 ? 52  GLU A HA   3  
ATOM 4653  H HB2  . GLU A 1 52  ? -11.732 -11.524 0.979   1.00 0.00 ? 52  GLU A HB2  3  
ATOM 4654  H HB3  . GLU A 1 52  ? -11.303 -13.201 1.283   1.00 0.00 ? 52  GLU A HB3  3  
ATOM 4655  H HG2  . GLU A 1 52  ? -13.391 -11.578 2.718   1.00 0.00 ? 52  GLU A HG2  3  
ATOM 4656  H HG3  . GLU A 1 52  ? -13.662 -12.915 1.599   1.00 0.00 ? 52  GLU A HG3  3  
ATOM 4657  N N    . ASP A 1 53  ? -8.589  -10.641 2.033   1.00 0.00 ? 53  ASP A N    3  
ATOM 4658  C CA   . ASP A 1 53  ? -7.317  -10.471 1.335   1.00 0.00 ? 53  ASP A CA   3  
ATOM 4659  C C    . ASP A 1 53  ? -6.211  -10.214 2.347   1.00 0.00 ? 53  ASP A C    3  
ATOM 4660  O O    . ASP A 1 53  ? -5.034  -10.141 1.994   1.00 0.00 ? 53  ASP A O    3  
ATOM 4661  C CB   . ASP A 1 53  ? -7.362  -9.275  0.365   1.00 0.00 ? 53  ASP A CB   3  
ATOM 4662  C CG   . ASP A 1 53  ? -8.493  -9.317  -0.647  1.00 0.00 ? 53  ASP A CG   3  
ATOM 4663  O OD1  . ASP A 1 53  ? -9.379  -10.192 -0.545  1.00 0.00 ? 53  ASP A OD1  3  
ATOM 4664  O OD2  . ASP A 1 53  ? -8.522  -8.444  -1.541  1.00 0.00 ? 53  ASP A OD2  3  
ATOM 4665  H H    . ASP A 1 53  ? -8.976  -9.861  2.492   1.00 0.00 ? 53  ASP A H    3  
ATOM 4666  H HA   . ASP A 1 53  ? -7.101  -11.375 0.787   1.00 0.00 ? 53  ASP A HA   3  
ATOM 4667  H HB2  . ASP A 1 53  ? -7.464  -8.368  0.940   1.00 0.00 ? 53  ASP A HB2  3  
ATOM 4668  H HB3  . ASP A 1 53  ? -6.427  -9.239  -0.176  1.00 0.00 ? 53  ASP A HB3  3  
ATOM 4669  N N    . GLN A 1 54  ? -6.596  -10.077 3.615   1.00 0.00 ? 54  GLN A N    3  
ATOM 4670  C CA   . GLN A 1 54  ? -5.662  -9.686  4.663   1.00 0.00 ? 54  GLN A CA   3  
ATOM 4671  C C    . GLN A 1 54  ? -4.587  -10.752 4.848   1.00 0.00 ? 54  GLN A C    3  
ATOM 4672  O O    . GLN A 1 54  ? -3.420  -10.437 5.084   1.00 0.00 ? 54  GLN A O    3  
ATOM 4673  C CB   . GLN A 1 54  ? -6.410  -9.434  5.976   1.00 0.00 ? 54  GLN A CB   3  
ATOM 4674  C CG   . GLN A 1 54  ? -7.565  -8.452  5.830   1.00 0.00 ? 54  GLN A CG   3  
ATOM 4675  C CD   . GLN A 1 54  ? -8.286  -8.181  7.136   1.00 0.00 ? 54  GLN A CD   3  
ATOM 4676  O OE1  . GLN A 1 54  ? -9.190  -8.921  7.520   1.00 0.00 ? 54  GLN A OE1  3  
ATOM 4677  N NE2  . GLN A 1 54  ? -7.929  -7.096  7.804   1.00 0.00 ? 54  GLN A NE2  3  
ATOM 4678  H H    . GLN A 1 54  ? -7.530  -10.254 3.850   1.00 0.00 ? 54  GLN A H    3  
ATOM 4679  H HA   . GLN A 1 54  ? -5.185  -8.767  4.351   1.00 0.00 ? 54  GLN A HA   3  
ATOM 4680  H HB2  . GLN A 1 54  ? -6.807  -10.372 6.336   1.00 0.00 ? 54  GLN A HB2  3  
ATOM 4681  H HB3  . GLN A 1 54  ? -5.719  -9.041  6.706   1.00 0.00 ? 54  GLN A HB3  3  
ATOM 4682  H HG2  . GLN A 1 54  ? -7.177  -7.517  5.454   1.00 0.00 ? 54  GLN A HG2  3  
ATOM 4683  H HG3  . GLN A 1 54  ? -8.274  -8.857  5.122   1.00 0.00 ? 54  GLN A HG3  3  
ATOM 4684  H HE21 . GLN A 1 54  ? -7.226  -6.525  7.424   1.00 0.00 ? 54  GLN A HE21 3  
ATOM 4685  H HE22 . GLN A 1 54  ? -8.390  -6.901  8.646   1.00 0.00 ? 54  GLN A HE22 3  
ATOM 4686  N N    . GLN A 1 55  ? -4.985  -12.011 4.711   1.00 0.00 ? 55  GLN A N    3  
ATOM 4687  C CA   . GLN A 1 55  ? -4.050  -13.129 4.776   1.00 0.00 ? 55  GLN A CA   3  
ATOM 4688  C C    . GLN A 1 55  ? -3.153  -13.143 3.537   1.00 0.00 ? 55  GLN A C    3  
ATOM 4689  O O    . GLN A 1 55  ? -1.961  -13.439 3.623   1.00 0.00 ? 55  GLN A O    3  
ATOM 4690  C CB   . GLN A 1 55  ? -4.822  -14.449 4.898   1.00 0.00 ? 55  GLN A CB   3  
ATOM 4691  C CG   . GLN A 1 55  ? -3.971  -15.707 4.747   1.00 0.00 ? 55  GLN A CG   3  
ATOM 4692  C CD   . GLN A 1 55  ? -2.853  -15.837 5.773   1.00 0.00 ? 55  GLN A CD   3  
ATOM 4693  O OE1  . GLN A 1 55  ? -1.800  -16.400 5.474   1.00 0.00 ? 55  GLN A OE1  3  
ATOM 4694  N NE2  . GLN A 1 55  ? -3.073  -15.354 6.987   1.00 0.00 ? 55  GLN A NE2  3  
ATOM 4695  H H    . GLN A 1 55  ? -5.935  -12.193 4.559   1.00 0.00 ? 55  GLN A H    3  
ATOM 4696  H HA   . GLN A 1 55  ? -3.433  -12.997 5.652   1.00 0.00 ? 55  GLN A HA   3  
ATOM 4697  H HB2  . GLN A 1 55  ? -5.303  -14.479 5.863   1.00 0.00 ? 55  GLN A HB2  3  
ATOM 4698  H HB3  . GLN A 1 55  ? -5.584  -14.467 4.134   1.00 0.00 ? 55  GLN A HB3  3  
ATOM 4699  H HG2  . GLN A 1 55  ? -4.615  -16.567 4.841   1.00 0.00 ? 55  GLN A HG2  3  
ATOM 4700  H HG3  . GLN A 1 55  ? -3.530  -15.703 3.760   1.00 0.00 ? 55  GLN A HG3  3  
ATOM 4701  H HE21 . GLN A 1 55  ? -3.936  -14.933 7.176   1.00 0.00 ? 55  GLN A HE21 3  
ATOM 4702  H HE22 . GLN A 1 55  ? -2.358  -15.449 7.657   1.00 0.00 ? 55  GLN A HE22 3  
ATOM 4703  N N    . LEU A 1 56  ? -3.735  -12.805 2.390   1.00 0.00 ? 56  LEU A N    3  
ATOM 4704  C CA   . LEU A 1 56  ? -2.993  -12.746 1.137   1.00 0.00 ? 56  LEU A CA   3  
ATOM 4705  C C    . LEU A 1 56  ? -1.898  -11.686 1.241   1.00 0.00 ? 56  LEU A C    3  
ATOM 4706  O O    . LEU A 1 56  ? -0.735  -11.943 0.912   1.00 0.00 ? 56  LEU A O    3  
ATOM 4707  C CB   . LEU A 1 56  ? -3.949  -12.429 -0.023  1.00 0.00 ? 56  LEU A CB   3  
ATOM 4708  C CG   . LEU A 1 56  ? -3.597  -13.059 -1.377  1.00 0.00 ? 56  LEU A CG   3  
ATOM 4709  C CD1  . LEU A 1 56  ? -4.698  -12.783 -2.389  1.00 0.00 ? 56  LEU A CD1  3  
ATOM 4710  C CD2  . LEU A 1 56  ? -2.268  -12.540 -1.902  1.00 0.00 ? 56  LEU A CD2  3  
ATOM 4711  H H    . LEU A 1 56  ? -4.691  -12.598 2.385   1.00 0.00 ? 56  LEU A H    3  
ATOM 4712  H HA   . LEU A 1 56  ? -2.536  -13.708 0.970   1.00 0.00 ? 56  LEU A HA   3  
ATOM 4713  H HB2  . LEU A 1 56  ? -4.937  -12.766 0.257   1.00 0.00 ? 56  LEU A HB2  3  
ATOM 4714  H HB3  . LEU A 1 56  ? -3.980  -11.356 -0.152  1.00 0.00 ? 56  LEU A HB3  3  
ATOM 4715  H HG   . LEU A 1 56  ? -3.516  -14.131 -1.257  1.00 0.00 ? 56  LEU A HG   3  
ATOM 4716  H HD11 . LEU A 1 56  ? -4.432  -13.222 -3.340  1.00 0.00 ? 56  LEU A HD11 3  
ATOM 4717  H HD12 . LEU A 1 56  ? -4.818  -11.717 -2.507  1.00 0.00 ? 56  LEU A HD12 3  
ATOM 4718  H HD13 . LEU A 1 56  ? -5.625  -13.213 -2.040  1.00 0.00 ? 56  LEU A HD13 3  
ATOM 4719  H HD21 . LEU A 1 56  ? -1.481  -12.792 -1.205  1.00 0.00 ? 56  LEU A HD21 3  
ATOM 4720  H HD22 . LEU A 1 56  ? -2.319  -11.468 -2.014  1.00 0.00 ? 56  LEU A HD22 3  
ATOM 4721  H HD23 . LEU A 1 56  ? -2.056  -12.994 -2.860  1.00 0.00 ? 56  LEU A HD23 3  
ATOM 4722  N N    . LEU A 1 57  ? -2.276  -10.506 1.718   1.00 0.00 ? 57  LEU A N    3  
ATOM 4723  C CA   . LEU A 1 57  ? -1.313  -9.440  1.969   1.00 0.00 ? 57  LEU A CA   3  
ATOM 4724  C C    . LEU A 1 57  ? -0.305  -9.869  3.019   1.00 0.00 ? 57  LEU A C    3  
ATOM 4725  O O    . LEU A 1 57  ? 0.881   -9.606  2.879   1.00 0.00 ? 57  LEU A O    3  
ATOM 4726  C CB   . LEU A 1 57  ? -1.998  -8.149  2.428   1.00 0.00 ? 57  LEU A CB   3  
ATOM 4727  C CG   . LEU A 1 57  ? -2.531  -7.252  1.311   1.00 0.00 ? 57  LEU A CG   3  
ATOM 4728  C CD1  . LEU A 1 57  ? -3.084  -5.966  1.895   1.00 0.00 ? 57  LEU A CD1  3  
ATOM 4729  C CD2  . LEU A 1 57  ? -1.440  -6.942  0.299   1.00 0.00 ? 57  LEU A CD2  3  
ATOM 4730  H H    . LEU A 1 57  ? -3.230  -10.348 1.900   1.00 0.00 ? 57  LEU A H    3  
ATOM 4731  H HA   . LEU A 1 57  ? -0.788  -9.247  1.046   1.00 0.00 ? 57  LEU A HA   3  
ATOM 4732  H HB2  . LEU A 1 57  ? -2.825  -8.417  3.069   1.00 0.00 ? 57  LEU A HB2  3  
ATOM 4733  H HB3  . LEU A 1 57  ? -1.287  -7.578  3.007   1.00 0.00 ? 57  LEU A HB3  3  
ATOM 4734  H HG   . LEU A 1 57  ? -3.333  -7.760  0.799   1.00 0.00 ? 57  LEU A HG   3  
ATOM 4735  H HD11 . LEU A 1 57  ? -2.303  -5.451  2.436   1.00 0.00 ? 57  LEU A HD11 3  
ATOM 4736  H HD12 . LEU A 1 57  ? -3.896  -6.196  2.567   1.00 0.00 ? 57  LEU A HD12 3  
ATOM 4737  H HD13 . LEU A 1 57  ? -3.445  -5.335  1.097   1.00 0.00 ? 57  LEU A HD13 3  
ATOM 4738  H HD21 . LEU A 1 57  ? -0.614  -6.453  0.798   1.00 0.00 ? 57  LEU A HD21 3  
ATOM 4739  H HD22 . LEU A 1 57  ? -1.835  -6.290  -0.464  1.00 0.00 ? 57  LEU A HD22 3  
ATOM 4740  H HD23 . LEU A 1 57  ? -1.095  -7.860  -0.155  1.00 0.00 ? 57  LEU A HD23 3  
ATOM 4741  N N    . ARG A 1 58  ? -0.784  -10.533 4.065   1.00 0.00 ? 58  ARG A N    3  
ATOM 4742  C CA   . ARG A 1 58  ? 0.083   -10.985 5.147   1.00 0.00 ? 58  ARG A CA   3  
ATOM 4743  C C    . ARG A 1 58  ? 1.187   -11.876 4.598   1.00 0.00 ? 58  ARG A C    3  
ATOM 4744  O O    . ARG A 1 58  ? 2.370   -11.619 4.817   1.00 0.00 ? 58  ARG A O    3  
ATOM 4745  C CB   . ARG A 1 58  ? -0.735  -11.742 6.196   1.00 0.00 ? 58  ARG A CB   3  
ATOM 4746  C CG   . ARG A 1 58  ? 0.033   -12.074 7.464   1.00 0.00 ? 58  ARG A CG   3  
ATOM 4747  C CD   . ARG A 1 58  ? -0.859  -12.783 8.467   1.00 0.00 ? 58  ARG A CD   3  
ATOM 4748  N NE   . ARG A 1 58  ? -0.187  -13.025 9.742   1.00 0.00 ? 58  ARG A NE   3  
ATOM 4749  C CZ   . ARG A 1 58  ? -0.814  -13.445 10.841  1.00 0.00 ? 58  ARG A CZ   3  
ATOM 4750  N NH1  . ARG A 1 58  ? -2.126  -13.650 10.833  1.00 0.00 ? 58  ARG A NH1  3  
ATOM 4751  N NH2  . ARG A 1 58  ? -0.132  -13.648 11.961  1.00 0.00 ? 58  ARG A NH2  3  
ATOM 4752  H H    . ARG A 1 58  ? -1.749  -10.725 4.114   1.00 0.00 ? 58  ARG A H    3  
ATOM 4753  H HA   . ARG A 1 58  ? 0.530   -10.117 5.603   1.00 0.00 ? 58  ARG A HA   3  
ATOM 4754  H HB2  . ARG A 1 58  ? -1.589  -11.142 6.470   1.00 0.00 ? 58  ARG A HB2  3  
ATOM 4755  H HB3  . ARG A 1 58  ? -1.083  -12.668 5.759   1.00 0.00 ? 58  ARG A HB3  3  
ATOM 4756  H HG2  . ARG A 1 58  ? 0.865   -12.719 7.215   1.00 0.00 ? 58  ARG A HG2  3  
ATOM 4757  H HG3  . ARG A 1 58  ? 0.401   -11.157 7.903   1.00 0.00 ? 58  ARG A HG3  3  
ATOM 4758  H HD2  . ARG A 1 58  ? -1.731  -12.172 8.644   1.00 0.00 ? 58  ARG A HD2  3  
ATOM 4759  H HD3  . ARG A 1 58  ? -1.165  -13.731 8.047   1.00 0.00 ? 58  ARG A HD3  3  
ATOM 4760  H HE   . ARG A 1 58  ? 0.789   -12.866 9.778   1.00 0.00 ? 58  ARG A HE   3  
ATOM 4761  H HH11 . ARG A 1 58  ? -2.664  -13.490 9.995   1.00 0.00 ? 58  ARG A HH11 3  
ATOM 4762  H HH12 . ARG A 1 58  ? -2.589  -13.968 11.667  1.00 0.00 ? 58  ARG A HH12 3  
ATOM 4763  H HH21 . ARG A 1 58  ? 0.859   -13.486 11.988  1.00 0.00 ? 58  ARG A HH21 3  
ATOM 4764  H HH22 . ARG A 1 58  ? -0.608  -13.963 12.788  1.00 0.00 ? 58  ARG A HH22 3  
ATOM 4765  N N    . ASP A 1 59  ? 0.789   -12.897 3.853   1.00 0.00 ? 59  ASP A N    3  
ATOM 4766  C CA   . ASP A 1 59  ? 1.727   -13.848 3.269   1.00 0.00 ? 59  ASP A CA   3  
ATOM 4767  C C    . ASP A 1 59  ? 2.708   -13.137 2.354   1.00 0.00 ? 59  ASP A C    3  
ATOM 4768  O O    . ASP A 1 59  ? 3.915   -13.318 2.461   1.00 0.00 ? 59  ASP A O    3  
ATOM 4769  C CB   . ASP A 1 59  ? 0.969   -14.887 2.449   1.00 0.00 ? 59  ASP A CB   3  
ATOM 4770  C CG   . ASP A 1 59  ? 1.695   -16.218 2.343   1.00 0.00 ? 59  ASP A CG   3  
ATOM 4771  O OD1  . ASP A 1 59  ? 2.910   -16.234 2.038   1.00 0.00 ? 59  ASP A OD1  3  
ATOM 4772  O OD2  . ASP A 1 59  ? 1.047   -17.261 2.569   1.00 0.00 ? 59  ASP A OD2  3  
ATOM 4773  H H    . ASP A 1 59  ? -0.175  -13.018 3.689   1.00 0.00 ? 59  ASP A H    3  
ATOM 4774  H HA   . ASP A 1 59  ? 2.263   -14.339 4.066   1.00 0.00 ? 59  ASP A HA   3  
ATOM 4775  H HB2  . ASP A 1 59  ? 0.009   -15.053 2.903   1.00 0.00 ? 59  ASP A HB2  3  
ATOM 4776  H HB3  . ASP A 1 59  ? 0.825   -14.500 1.452   1.00 0.00 ? 59  ASP A HB3  3  
ATOM 4777  N N    . SER A 1 60  ? 2.170   -12.299 1.481   1.00 0.00 ? 60  SER A N    3  
ATOM 4778  C CA   . SER A 1 60  ? 2.954   -11.660 0.435   1.00 0.00 ? 60  SER A CA   3  
ATOM 4779  C C    . SER A 1 60  ? 3.908   -10.617 1.017   1.00 0.00 ? 60  SER A C    3  
ATOM 4780  O O    . SER A 1 60  ? 5.020   -10.430 0.520   1.00 0.00 ? 60  SER A O    3  
ATOM 4781  C CB   . SER A 1 60  ? 2.018   -11.038 -0.603  1.00 0.00 ? 60  SER A CB   3  
ATOM 4782  O OG   . SER A 1 60  ? 1.259   -12.038 -1.263  1.00 0.00 ? 60  SER A OG   3  
ATOM 4783  H H    . SER A 1 60  ? 1.216   -12.087 1.554   1.00 0.00 ? 60  SER A H    3  
ATOM 4784  H HA   . SER A 1 60  ? 3.541   -12.428 -0.045  1.00 0.00 ? 60  SER A HA   3  
ATOM 4785  H HB2  . SER A 1 60  ? 1.334   -10.364 -0.110  1.00 0.00 ? 60  SER A HB2  3  
ATOM 4786  H HB3  . SER A 1 60  ? 2.598   -10.496 -1.335  1.00 0.00 ? 60  SER A HB3  3  
ATOM 4787  H HG   . SER A 1 60  ? 0.534   -12.318 -0.690  1.00 0.00 ? 60  SER A HG   3  
ATOM 4788  N N    . PHE A 1 61  ? 3.485   -9.956  2.086   1.00 0.00 ? 61  PHE A N    3  
ATOM 4789  C CA   . PHE A 1 61  ? 4.349   -9.011  2.770   1.00 0.00 ? 61  PHE A CA   3  
ATOM 4790  C C    . PHE A 1 61  ? 5.493   -9.759  3.431   1.00 0.00 ? 61  PHE A C    3  
ATOM 4791  O O    . PHE A 1 61  ? 6.635   -9.304  3.424   1.00 0.00 ? 61  PHE A O    3  
ATOM 4792  C CB   . PHE A 1 61  ? 3.570   -8.201  3.810   1.00 0.00 ? 61  PHE A CB   3  
ATOM 4793  C CG   . PHE A 1 61  ? 2.694   -7.124  3.222   1.00 0.00 ? 61  PHE A CG   3  
ATOM 4794  C CD1  . PHE A 1 61  ? 2.811   -6.757  1.889   1.00 0.00 ? 61  PHE A CD1  3  
ATOM 4795  C CD2  . PHE A 1 61  ? 1.759   -6.472  4.010   1.00 0.00 ? 61  PHE A CD2  3  
ATOM 4796  C CE1  . PHE A 1 61  ? 2.015   -5.760  1.357   1.00 0.00 ? 61  PHE A CE1  3  
ATOM 4797  C CE2  . PHE A 1 61  ? 0.958   -5.474  3.483   1.00 0.00 ? 61  PHE A CE2  3  
ATOM 4798  C CZ   . PHE A 1 61  ? 1.088   -5.119  2.154   1.00 0.00 ? 61  PHE A CZ   3  
ATOM 4799  H H    . PHE A 1 61  ? 2.575   -10.109 2.424   1.00 0.00 ? 61  PHE A H    3  
ATOM 4800  H HA   . PHE A 1 61  ? 4.757   -8.338  2.031   1.00 0.00 ? 61  PHE A HA   3  
ATOM 4801  H HB2  . PHE A 1 61  ? 2.937   -8.873  4.371   1.00 0.00 ? 61  PHE A HB2  3  
ATOM 4802  H HB3  . PHE A 1 61  ? 4.270   -7.733  4.481   1.00 0.00 ? 61  PHE A HB3  3  
ATOM 4803  H HD1  . PHE A 1 61  ? 3.535   -7.258  1.262   1.00 0.00 ? 61  PHE A HD1  3  
ATOM 4804  H HD2  . PHE A 1 61  ? 1.655   -6.752  5.050   1.00 0.00 ? 61  PHE A HD2  3  
ATOM 4805  H HE1  . PHE A 1 61  ? 2.116   -5.484  0.318   1.00 0.00 ? 61  PHE A HE1  3  
ATOM 4806  H HE2  . PHE A 1 61  ? 0.233   -4.972  4.110   1.00 0.00 ? 61  PHE A HE2  3  
ATOM 4807  H HZ   . PHE A 1 61  ? 0.465   -4.340  1.739   1.00 0.00 ? 61  PHE A HZ   3  
ATOM 4808  N N    . GLN A 1 62  ? 5.183   -10.928 3.975   1.00 0.00 ? 62  GLN A N    3  
ATOM 4809  C CA   . GLN A 1 62  ? 6.199   -11.787 4.553   1.00 0.00 ? 62  GLN A CA   3  
ATOM 4810  C C    . GLN A 1 62  ? 7.144   -12.265 3.462   1.00 0.00 ? 62  GLN A C    3  
ATOM 4811  O O    . GLN A 1 62  ? 8.352   -12.346 3.662   1.00 0.00 ? 62  GLN A O    3  
ATOM 4812  C CB   . GLN A 1 62  ? 5.557   -12.990 5.251   1.00 0.00 ? 62  GLN A CB   3  
ATOM 4813  C CG   . GLN A 1 62  ? 4.659   -12.636 6.432   1.00 0.00 ? 62  GLN A CG   3  
ATOM 4814  C CD   . GLN A 1 62  ? 5.415   -12.174 7.672   1.00 0.00 ? 62  GLN A CD   3  
ATOM 4815  O OE1  . GLN A 1 62  ? 4.966   -12.395 8.798   1.00 0.00 ? 62  GLN A OE1  3  
ATOM 4816  N NE2  . GLN A 1 62  ? 6.552   -11.522 7.484   1.00 0.00 ? 62  GLN A NE2  3  
ATOM 4817  H H    . GLN A 1 62  ? 4.247   -11.224 3.974   1.00 0.00 ? 62  GLN A H    3  
ATOM 4818  H HA   . GLN A 1 62  ? 6.756   -11.211 5.276   1.00 0.00 ? 62  GLN A HA   3  
ATOM 4819  H HB2  . GLN A 1 62  ? 4.959   -13.526 4.530   1.00 0.00 ? 62  GLN A HB2  3  
ATOM 4820  H HB3  . GLN A 1 62  ? 6.340   -13.640 5.604   1.00 0.00 ? 62  GLN A HB3  3  
ATOM 4821  H HG2  . GLN A 1 62  ? 3.990   -11.847 6.128   1.00 0.00 ? 62  GLN A HG2  3  
ATOM 4822  H HG3  . GLN A 1 62  ? 4.077   -13.510 6.688   1.00 0.00 ? 62  GLN A HG3  3  
ATOM 4823  H HE21 . GLN A 1 62  ? 6.850   -11.370 6.567   1.00 0.00 ? 62  GLN A HE21 3  
ATOM 4824  H HE22 . GLN A 1 62  ? 7.052   -11.226 8.276   1.00 0.00 ? 62  GLN A HE22 3  
ATOM 4825  N N    . GLN A 1 63  ? 6.573   -12.562 2.299   1.00 0.00 ? 63  GLN A N    3  
ATOM 4826  C CA   . GLN A 1 63  ? 7.338   -13.042 1.157   1.00 0.00 ? 63  GLN A CA   3  
ATOM 4827  C C    . GLN A 1 63  ? 8.413   -12.044 0.740   1.00 0.00 ? 63  GLN A C    3  
ATOM 4828  O O    . GLN A 1 63  ? 9.578   -12.408 0.619   1.00 0.00 ? 63  GLN A O    3  
ATOM 4829  C CB   . GLN A 1 63  ? 6.419   -13.326 -0.025  1.00 0.00 ? 63  GLN A CB   3  
ATOM 4830  C CG   . GLN A 1 63  ? 5.486   -14.494 0.209   1.00 0.00 ? 63  GLN A CG   3  
ATOM 4831  C CD   . GLN A 1 63  ? 6.219   -15.793 0.461   1.00 0.00 ? 63  GLN A CD   3  
ATOM 4832  O OE1  . GLN A 1 63  ? 7.328   -16.002 -0.029  1.00 0.00 ? 63  GLN A OE1  3  
ATOM 4833  N NE2  . GLN A 1 63  ? 5.599   -16.673 1.227   1.00 0.00 ? 63  GLN A NE2  3  
ATOM 4834  H H    . GLN A 1 63  ? 5.597   -12.473 2.214   1.00 0.00 ? 63  GLN A H    3  
ATOM 4835  H HA   . GLN A 1 63  ? 7.811   -13.965 1.450   1.00 0.00 ? 63  GLN A HA   3  
ATOM 4836  H HB2  . GLN A 1 63  ? 5.821   -12.448 -0.223  1.00 0.00 ? 63  GLN A HB2  3  
ATOM 4837  H HB3  . GLN A 1 63  ? 7.023   -13.542 -0.890  1.00 0.00 ? 63  GLN A HB3  3  
ATOM 4838  H HG2  . GLN A 1 63  ? 4.882   -14.275 1.073   1.00 0.00 ? 63  GLN A HG2  3  
ATOM 4839  H HG3  . GLN A 1 63  ? 4.853   -14.614 -0.656  1.00 0.00 ? 63  GLN A HG3  3  
ATOM 4840  H HE21 . GLN A 1 63  ? 4.710   -16.433 1.583   1.00 0.00 ? 63  GLN A HE21 3  
ATOM 4841  H HE22 . GLN A 1 63  ? 6.043   -17.526 1.408   1.00 0.00 ? 63  GLN A HE22 3  
ATOM 4842  N N    . VAL A 1 64  ? 8.027   -10.789 0.531   1.00 0.00 ? 64  VAL A N    3  
ATOM 4843  C CA   . VAL A 1 64  ? 8.978   -9.777  0.078   1.00 0.00 ? 64  VAL A CA   3  
ATOM 4844  C C    . VAL A 1 64  ? 10.044  -9.508  1.140   1.00 0.00 ? 64  VAL A C    3  
ATOM 4845  O O    . VAL A 1 64  ? 11.181  -9.174  0.814   1.00 0.00 ? 64  VAL A O    3  
ATOM 4846  C CB   . VAL A 1 64  ? 8.286   -8.454  -0.333  1.00 0.00 ? 64  VAL A CB   3  
ATOM 4847  C CG1  . VAL A 1 64  ? 7.612   -7.770  0.847   1.00 0.00 ? 64  VAL A CG1  3  
ATOM 4848  C CG2  . VAL A 1 64  ? 9.288   -7.519  -0.993  1.00 0.00 ? 64  VAL A CG2  3  
ATOM 4849  H H    . VAL A 1 64  ? 7.087   -10.544 0.671   1.00 0.00 ? 64  VAL A H    3  
ATOM 4850  H HA   . VAL A 1 64  ? 9.473   -10.175 -0.797  1.00 0.00 ? 64  VAL A HA   3  
ATOM 4851  H HB   . VAL A 1 64  ? 7.524   -8.688  -1.062  1.00 0.00 ? 64  VAL A HB   3  
ATOM 4852  H HG11 . VAL A 1 64  ? 7.176   -6.836  0.519   1.00 0.00 ? 64  VAL A HG11 3  
ATOM 4853  H HG12 . VAL A 1 64  ? 8.344   -7.574  1.616   1.00 0.00 ? 64  VAL A HG12 3  
ATOM 4854  H HG13 . VAL A 1 64  ? 6.837   -8.410  1.240   1.00 0.00 ? 64  VAL A HG13 3  
ATOM 4855  H HG21 . VAL A 1 64  ? 8.802   -6.590  -1.247  1.00 0.00 ? 64  VAL A HG21 3  
ATOM 4856  H HG22 . VAL A 1 64  ? 9.672   -7.982  -1.891  1.00 0.00 ? 64  VAL A HG22 3  
ATOM 4857  H HG23 . VAL A 1 64  ? 10.103  -7.325  -0.311  1.00 0.00 ? 64  VAL A HG23 3  
ATOM 4858  N N    . VAL A 1 65  ? 9.682   -9.683  2.407   1.00 0.00 ? 65  VAL A N    3  
ATOM 4859  C CA   . VAL A 1 65  ? 10.639  -9.528  3.505   1.00 0.00 ? 65  VAL A CA   3  
ATOM 4860  C C    . VAL A 1 65  ? 11.659  -10.668 3.476   1.00 0.00 ? 65  VAL A C    3  
ATOM 4861  O O    . VAL A 1 65  ? 12.803  -10.515 3.904   1.00 0.00 ? 65  VAL A O    3  
ATOM 4862  C CB   . VAL A 1 65  ? 9.933   -9.482  4.884   1.00 0.00 ? 65  VAL A CB   3  
ATOM 4863  C CG1  . VAL A 1 65  ? 10.941  -9.453  6.024   1.00 0.00 ? 65  VAL A CG1  3  
ATOM 4864  C CG2  . VAL A 1 65  ? 9.019   -8.272  4.973   1.00 0.00 ? 65  VAL A CG2  3  
ATOM 4865  H H    . VAL A 1 65  ? 8.752   -9.925  2.610   1.00 0.00 ? 65  VAL A H    3  
ATOM 4866  H HA   . VAL A 1 65  ? 11.161  -8.593  3.357   1.00 0.00 ? 65  VAL A HA   3  
ATOM 4867  H HB   . VAL A 1 65  ? 9.328   -10.371 4.989   1.00 0.00 ? 65  VAL A HB   3  
ATOM 4868  H HG11 . VAL A 1 65  ? 10.417  -9.414  6.967   1.00 0.00 ? 65  VAL A HG11 3  
ATOM 4869  H HG12 . VAL A 1 65  ? 11.569  -8.581  5.926   1.00 0.00 ? 65  VAL A HG12 3  
ATOM 4870  H HG13 . VAL A 1 65  ? 11.551  -10.343 5.989   1.00 0.00 ? 65  VAL A HG13 3  
ATOM 4871  H HG21 . VAL A 1 65  ? 8.266   -8.333  4.201   1.00 0.00 ? 65  VAL A HG21 3  
ATOM 4872  H HG22 . VAL A 1 65  ? 9.601   -7.373  4.836   1.00 0.00 ? 65  VAL A HG22 3  
ATOM 4873  H HG23 . VAL A 1 65  ? 8.542   -8.250  5.941   1.00 0.00 ? 65  VAL A HG23 3  
ATOM 4874  N N    . LYS A 1 66  ? 11.229  -11.806 2.957   1.00 0.00 ? 66  LYS A N    3  
ATOM 4875  C CA   . LYS A 1 66  ? 12.105  -12.955 2.778   1.00 0.00 ? 66  LYS A CA   3  
ATOM 4876  C C    . LYS A 1 66  ? 12.907  -12.814 1.488   1.00 0.00 ? 66  LYS A C    3  
ATOM 4877  O O    . LYS A 1 66  ? 14.051  -13.263 1.398   1.00 0.00 ? 66  LYS A O    3  
ATOM 4878  C CB   . LYS A 1 66  ? 11.277  -14.239 2.745   1.00 0.00 ? 66  LYS A CB   3  
ATOM 4879  C CG   . LYS A 1 66  ? 10.545  -14.516 4.047   1.00 0.00 ? 66  LYS A CG   3  
ATOM 4880  C CD   . LYS A 1 66  ? 9.459   -15.562 3.867   1.00 0.00 ? 66  LYS A CD   3  
ATOM 4881  C CE   . LYS A 1 66  ? 8.734   -15.821 5.175   1.00 0.00 ? 66  LYS A CE   3  
ATOM 4882  N NZ   . LYS A 1 66  ? 7.565   -16.725 5.009   1.00 0.00 ? 66  LYS A NZ   3  
ATOM 4883  H H    . LYS A 1 66  ? 10.287  -11.879 2.693   1.00 0.00 ? 66  LYS A H    3  
ATOM 4884  H HA   . LYS A 1 66  ? 12.785  -12.993 3.614   1.00 0.00 ? 66  LYS A HA   3  
ATOM 4885  H HB2  . LYS A 1 66  ? 10.545  -14.162 1.956   1.00 0.00 ? 66  LYS A HB2  3  
ATOM 4886  H HB3  . LYS A 1 66  ? 11.931  -15.071 2.540   1.00 0.00 ? 66  LYS A HB3  3  
ATOM 4887  H HG2  . LYS A 1 66  ? 11.256  -14.873 4.777   1.00 0.00 ? 66  LYS A HG2  3  
ATOM 4888  H HG3  . LYS A 1 66  ? 10.097  -13.599 4.398   1.00 0.00 ? 66  LYS A HG3  3  
ATOM 4889  H HD2  . LYS A 1 66  ? 8.747   -15.211 3.134   1.00 0.00 ? 66  LYS A HD2  3  
ATOM 4890  H HD3  . LYS A 1 66  ? 9.909   -16.484 3.527   1.00 0.00 ? 66  LYS A HD3  3  
ATOM 4891  H HE2  . LYS A 1 66  ? 9.426   -16.272 5.871   1.00 0.00 ? 66  LYS A HE2  3  
ATOM 4892  H HE3  . LYS A 1 66  ? 8.392   -14.876 5.574   1.00 0.00 ? 66  LYS A HE3  3  
ATOM 4893  H HZ1  . LYS A 1 66  ? 6.799   -16.244 4.492   1.00 0.00 ? 66  LYS A HZ1  3  
ATOM 4894  H HZ2  . LYS A 1 66  ? 7.206   -17.017 5.940   1.00 0.00 ? 66  LYS A HZ2  3  
ATOM 4895  H HZ3  . LYS A 1 66  ? 7.840   -17.579 4.475   1.00 0.00 ? 66  LYS A HZ3  3  
ATOM 4896  N N    . LEU A 1 67  ? 12.291  -12.188 0.492   1.00 0.00 ? 67  LEU A N    3  
ATOM 4897  C CA   . LEU A 1 67  ? 12.937  -11.948 -0.791  1.00 0.00 ? 67  LEU A CA   3  
ATOM 4898  C C    . LEU A 1 67  ? 14.031  -10.893 -0.658  1.00 0.00 ? 67  LEU A C    3  
ATOM 4899  O O    . LEU A 1 67  ? 15.176  -11.129 -1.050  1.00 0.00 ? 67  LEU A O    3  
ATOM 4900  C CB   . LEU A 1 67  ? 11.899  -11.505 -1.832  1.00 0.00 ? 67  LEU A CB   3  
ATOM 4901  C CG   . LEU A 1 67  ? 10.833  -12.551 -2.164  1.00 0.00 ? 67  LEU A CG   3  
ATOM 4902  C CD1  . LEU A 1 67  ? 9.852   -12.005 -3.185  1.00 0.00 ? 67  LEU A CD1  3  
ATOM 4903  C CD2  . LEU A 1 67  ? 11.478  -13.829 -2.677  1.00 0.00 ? 67  LEU A CD2  3  
ATOM 4904  H H    . LEU A 1 67  ? 11.362  -11.893 0.624   1.00 0.00 ? 67  LEU A H    3  
ATOM 4905  H HA   . LEU A 1 67  ? 13.385  -12.874 -1.114  1.00 0.00 ? 67  LEU A HA   3  
ATOM 4906  H HB2  . LEU A 1 67  ? 11.398  -10.613 -1.468  1.00 0.00 ? 67  LEU A HB2  3  
ATOM 4907  H HB3  . LEU A 1 67  ? 12.423  -11.256 -2.743  1.00 0.00 ? 67  LEU A HB3  3  
ATOM 4908  H HG   . LEU A 1 67  ? 10.282  -12.791 -1.268  1.00 0.00 ? 67  LEU A HG   3  
ATOM 4909  H HD11 . LEU A 1 67  ? 9.348   -11.143 -2.774  1.00 0.00 ? 67  LEU A HD11 3  
ATOM 4910  H HD12 . LEU A 1 67  ? 9.124   -12.765 -3.426  1.00 0.00 ? 67  LEU A HD12 3  
ATOM 4911  H HD13 . LEU A 1 67  ? 10.384  -11.718 -4.079  1.00 0.00 ? 67  LEU A HD13 3  
ATOM 4912  H HD21 . LEU A 1 67  ? 10.710  -14.556 -2.893  1.00 0.00 ? 67  LEU A HD21 3  
ATOM 4913  H HD22 . LEU A 1 67  ? 12.145  -14.222 -1.925  1.00 0.00 ? 67  LEU A HD22 3  
ATOM 4914  H HD23 . LEU A 1 67  ? 12.035  -13.615 -3.578  1.00 0.00 ? 67  LEU A HD23 3  
ATOM 4915  N N    . LYS A 1 68  ? 13.664  -9.748  -0.088  1.00 0.00 ? 68  LYS A N    3  
ATOM 4916  C CA   . LYS A 1 68  ? 14.587  -8.634  0.130   1.00 0.00 ? 68  LYS A CA   3  
ATOM 4917  C C    . LYS A 1 68  ? 15.230  -8.157  -1.167  1.00 0.00 ? 68  LYS A C    3  
ATOM 4918  O O    . LYS A 1 68  ? 16.260  -8.674  -1.608  1.00 0.00 ? 68  LYS A O    3  
ATOM 4919  C CB   . LYS A 1 68  ? 15.655  -9.005  1.157   1.00 0.00 ? 68  LYS A CB   3  
ATOM 4920  C CG   . LYS A 1 68  ? 15.122  -9.029  2.575   1.00 0.00 ? 68  LYS A CG   3  
ATOM 4921  C CD   . LYS A 1 68  ? 16.171  -9.478  3.574   1.00 0.00 ? 68  LYS A CD   3  
ATOM 4922  C CE   . LYS A 1 68  ? 15.654  -9.357  4.996   1.00 0.00 ? 68  LYS A CE   3  
ATOM 4923  N NZ   . LYS A 1 68  ? 16.629  -9.882  5.989   1.00 0.00 ? 68  LYS A NZ   3  
ATOM 4924  H H    . LYS A 1 68  ? 12.729  -9.657  0.207   1.00 0.00 ? 68  LYS A H    3  
ATOM 4925  H HA   . LYS A 1 68  ? 14.004  -7.817  0.531   1.00 0.00 ? 68  LYS A HA   3  
ATOM 4926  H HB2  . LYS A 1 68  ? 16.044  -9.984  0.922   1.00 0.00 ? 68  LYS A HB2  3  
ATOM 4927  H HB3  . LYS A 1 68  ? 16.457  -8.284  1.108   1.00 0.00 ? 68  LYS A HB3  3  
ATOM 4928  H HG2  . LYS A 1 68  ? 14.794  -8.037  2.841   1.00 0.00 ? 68  LYS A HG2  3  
ATOM 4929  H HG3  . LYS A 1 68  ? 14.282  -9.710  2.619   1.00 0.00 ? 68  LYS A HG3  3  
ATOM 4930  H HD2  . LYS A 1 68  ? 16.426  -10.507 3.380   1.00 0.00 ? 68  LYS A HD2  3  
ATOM 4931  H HD3  . LYS A 1 68  ? 17.049  -8.858  3.463   1.00 0.00 ? 68  LYS A HD3  3  
ATOM 4932  H HE2  . LYS A 1 68  ? 15.461  -8.316  5.208   1.00 0.00 ? 68  LYS A HE2  3  
ATOM 4933  H HE3  . LYS A 1 68  ? 14.733  -9.916  5.076   1.00 0.00 ? 68  LYS A HE3  3  
ATOM 4934  H HZ1  . LYS A 1 68  ? 16.696  -10.920 5.909   1.00 0.00 ? 68  LYS A HZ1  3  
ATOM 4935  H HZ2  . LYS A 1 68  ? 16.329  -9.636  6.958   1.00 0.00 ? 68  LYS A HZ2  3  
ATOM 4936  H HZ3  . LYS A 1 68  ? 17.572  -9.471  5.815   1.00 0.00 ? 68  LYS A HZ3  3  
ATOM 4937  N N    . GLY A 1 69  ? 14.612  -7.158  -1.771  1.00 0.00 ? 69  GLY A N    3  
ATOM 4938  C CA   . GLY A 1 69  ? 15.140  -6.591  -2.992  1.00 0.00 ? 69  GLY A CA   3  
ATOM 4939  C C    . GLY A 1 69  ? 14.265  -6.889  -4.187  1.00 0.00 ? 69  GLY A C    3  
ATOM 4940  O O    . GLY A 1 69  ? 14.277  -6.154  -5.172  1.00 0.00 ? 69  GLY A O    3  
ATOM 4941  H H    . GLY A 1 69  ? 13.792  -6.794  -1.380  1.00 0.00 ? 69  GLY A H    3  
ATOM 4942  H HA2  . GLY A 1 69  ? 15.223  -5.521  -2.876  1.00 0.00 ? 69  GLY A HA2  3  
ATOM 4943  H HA3  . GLY A 1 69  ? 16.123  -7.003  -3.170  1.00 0.00 ? 69  GLY A HA3  3  
ATOM 4944  N N    . GLN A 1 70  ? 13.492  -7.959  -4.092  1.00 0.00 ? 70  GLN A N    3  
ATOM 4945  C CA   . GLN A 1 70  ? 12.637  -8.373  -5.185  1.00 0.00 ? 70  GLN A CA   3  
ATOM 4946  C C    . GLN A 1 70  ? 11.304  -7.645  -5.114  1.00 0.00 ? 70  GLN A C    3  
ATOM 4947  O O    . GLN A 1 70  ? 10.661  -7.614  -4.065  1.00 0.00 ? 70  GLN A O    3  
ATOM 4948  C CB   . GLN A 1 70  ? 12.416  -9.886  -5.145  1.00 0.00 ? 70  GLN A CB   3  
ATOM 4949  C CG   . GLN A 1 70  ? 11.521  -10.396 -6.262  1.00 0.00 ? 70  GLN A CG   3  
ATOM 4950  C CD   . GLN A 1 70  ? 12.099  -10.131 -7.637  1.00 0.00 ? 70  GLN A CD   3  
ATOM 4951  O OE1  . GLN A 1 70  ? 11.860  -9.082  -8.235  1.00 0.00 ? 70  GLN A OE1  3  
ATOM 4952  N NE2  . GLN A 1 70  ? 12.862  -11.081 -8.152  1.00 0.00 ? 70  GLN A NE2  3  
ATOM 4953  H H    . GLN A 1 70  ? 13.480  -8.473  -3.259  1.00 0.00 ? 70  GLN A H    3  
ATOM 4954  H HA   . GLN A 1 70  ? 13.129  -8.113  -6.109  1.00 0.00 ? 70  GLN A HA   3  
ATOM 4955  H HB2  . GLN A 1 70  ? 13.373  -10.381 -5.225  1.00 0.00 ? 70  GLN A HB2  3  
ATOM 4956  H HB3  . GLN A 1 70  ? 11.961  -10.148 -4.201  1.00 0.00 ? 70  GLN A HB3  3  
ATOM 4957  H HG2  . GLN A 1 70  ? 11.387  -11.459 -6.142  1.00 0.00 ? 70  GLN A HG2  3  
ATOM 4958  H HG3  . GLN A 1 70  ? 10.564  -9.902  -6.187  1.00 0.00 ? 70  GLN A HG3  3  
ATOM 4959  H HE21 . GLN A 1 70  ? 13.009  -11.895 -7.621  1.00 0.00 ? 70  GLN A HE21 3  
ATOM 4960  H HE22 . GLN A 1 70  ? 13.248  -10.936 -9.044  1.00 0.00 ? 70  GLN A HE22 3  
ATOM 4961  N N    . VAL A 1 71  ? 10.905  -7.052  -6.229  1.00 0.00 ? 71  VAL A N    3  
ATOM 4962  C CA   . VAL A 1 71  ? 9.626   -6.371  -6.309  1.00 0.00 ? 71  VAL A CA   3  
ATOM 4963  C C    . VAL A 1 71  ? 8.509   -7.395  -6.462  1.00 0.00 ? 71  VAL A C    3  
ATOM 4964  O O    . VAL A 1 71  ? 8.383   -8.050  -7.501  1.00 0.00 ? 71  VAL A O    3  
ATOM 4965  C CB   . VAL A 1 71  ? 9.589   -5.374  -7.484  1.00 0.00 ? 71  VAL A CB   3  
ATOM 4966  C CG1  . VAL A 1 71  ? 8.266   -4.628  -7.522  1.00 0.00 ? 71  VAL A CG1  3  
ATOM 4967  C CG2  . VAL A 1 71  ? 10.754  -4.400  -7.394  1.00 0.00 ? 71  VAL A CG2  3  
ATOM 4968  H H    . VAL A 1 71  ? 11.482  -7.082  -7.019  1.00 0.00 ? 71  VAL A H    3  
ATOM 4969  H HA   . VAL A 1 71  ? 9.480   -5.824  -5.388  1.00 0.00 ? 71  VAL A HA   3  
ATOM 4970  H HB   . VAL A 1 71  ? 9.687   -5.931  -8.404  1.00 0.00 ? 71  VAL A HB   3  
ATOM 4971  H HG11 . VAL A 1 71  ? 8.287   -3.901  -8.321  1.00 0.00 ? 71  VAL A HG11 3  
ATOM 4972  H HG12 . VAL A 1 71  ? 8.108   -4.120  -6.581  1.00 0.00 ? 71  VAL A HG12 3  
ATOM 4973  H HG13 . VAL A 1 71  ? 7.461   -5.328  -7.693  1.00 0.00 ? 71  VAL A HG13 3  
ATOM 4974  H HG21 . VAL A 1 71  ? 11.684  -4.948  -7.430  1.00 0.00 ? 71  VAL A HG21 3  
ATOM 4975  H HG22 . VAL A 1 71  ? 10.695  -3.851  -6.466  1.00 0.00 ? 71  VAL A HG22 3  
ATOM 4976  H HG23 . VAL A 1 71  ? 10.710  -3.711  -8.224  1.00 0.00 ? 71  VAL A HG23 3  
ATOM 4977  N N    . LEU A 1 72  ? 7.703   -7.526  -5.426  1.00 0.00 ? 72  LEU A N    3  
ATOM 4978  C CA   . LEU A 1 72  ? 6.688   -8.563  -5.380  1.00 0.00 ? 72  LEU A CA   3  
ATOM 4979  C C    . LEU A 1 72  ? 5.320   -7.987  -5.718  1.00 0.00 ? 72  LEU A C    3  
ATOM 4980  O O    . LEU A 1 72  ? 4.910   -6.979  -5.151  1.00 0.00 ? 72  LEU A O    3  
ATOM 4981  C CB   . LEU A 1 72  ? 6.649   -9.207  -3.992  1.00 0.00 ? 72  LEU A CB   3  
ATOM 4982  C CG   . LEU A 1 72  ? 5.973   -10.574 -3.947  1.00 0.00 ? 72  LEU A CG   3  
ATOM 4983  C CD1  . LEU A 1 72  ? 6.754   -11.571 -4.788  1.00 0.00 ? 72  LEU A CD1  3  
ATOM 4984  C CD2  . LEU A 1 72  ? 5.851   -11.062 -2.518  1.00 0.00 ? 72  LEU A CD2  3  
ATOM 4985  H H    . LEU A 1 72  ? 7.774   -6.880  -4.685  1.00 0.00 ? 72  LEU A H    3  
ATOM 4986  H HA   . LEU A 1 72  ? 6.944   -9.314  -6.111  1.00 0.00 ? 72  LEU A HA   3  
ATOM 4987  H HB2  . LEU A 1 72  ? 7.664   -9.313  -3.630  1.00 0.00 ? 72  LEU A HB2  3  
ATOM 4988  H HB3  . LEU A 1 72  ? 6.115   -8.545  -3.327  1.00 0.00 ? 72  LEU A HB3  3  
ATOM 4989  H HG   . LEU A 1 72  ? 4.979   -10.492 -4.361  1.00 0.00 ? 72  LEU A HG   3  
ATOM 4990  H HD11 . LEU A 1 72  ? 6.302   -12.548 -4.704  1.00 0.00 ? 72  LEU A HD11 3  
ATOM 4991  H HD12 . LEU A 1 72  ? 7.777   -11.614 -4.436  1.00 0.00 ? 72  LEU A HD12 3  
ATOM 4992  H HD13 . LEU A 1 72  ? 6.744   -11.257 -5.822  1.00 0.00 ? 72  LEU A HD13 3  
ATOM 4993  H HD21 . LEU A 1 72  ? 6.837   -11.173 -2.092  1.00 0.00 ? 72  LEU A HD21 3  
ATOM 4994  H HD22 . LEU A 1 72  ? 5.344   -12.016 -2.505  1.00 0.00 ? 72  LEU A HD22 3  
ATOM 4995  H HD23 . LEU A 1 72  ? 5.286   -10.346 -1.940  1.00 0.00 ? 72  LEU A HD23 3  
ATOM 4996  N N    . SER A 1 73  ? 4.618   -8.621  -6.641  1.00 0.00 ? 73  SER A N    3  
ATOM 4997  C CA   . SER A 1 73  ? 3.292   -8.169  -7.027  1.00 0.00 ? 73  SER A CA   3  
ATOM 4998  C C    . SER A 1 73  ? 2.230   -8.839  -6.163  1.00 0.00 ? 73  SER A C    3  
ATOM 4999  O O    . SER A 1 73  ? 2.142   -10.065 -6.111  1.00 0.00 ? 73  SER A O    3  
ATOM 5000  C CB   . SER A 1 73  ? 3.039   -8.505  -8.496  1.00 0.00 ? 73  SER A CB   3  
ATOM 5001  O OG   . SER A 1 73  ? 4.053   -7.970  -9.333  1.00 0.00 ? 73  SER A OG   3  
ATOM 5002  H H    . SER A 1 73  ? 4.990   -9.421  -7.070  1.00 0.00 ? 73  SER A H    3  
ATOM 5003  H HA   . SER A 1 73  ? 3.237   -7.097  -6.893  1.00 0.00 ? 73  SER A HA   3  
ATOM 5004  H HB2  . SER A 1 73  ? 3.020   -9.577  -8.617  1.00 0.00 ? 73  SER A HB2  3  
ATOM 5005  H HB3  . SER A 1 73  ? 2.086   -8.094  -8.795  1.00 0.00 ? 73  SER A HB3  3  
ATOM 5006  H HG   . SER A 1 73  ? 4.911   -8.341  -9.076  1.00 0.00 ? 73  SER A HG   3  
ATOM 5007  N N    . VAL A 1 74  ? 1.437   -8.038  -5.474  1.00 0.00 ? 74  VAL A N    3  
ATOM 5008  C CA   . VAL A 1 74  ? 0.318   -8.559  -4.709  1.00 0.00 ? 74  VAL A CA   3  
ATOM 5009  C C    . VAL A 1 74  ? -0.943  -7.799  -5.050  1.00 0.00 ? 74  VAL A C    3  
ATOM 5010  O O    . VAL A 1 74  ? -0.960  -6.570  -5.105  1.00 0.00 ? 74  VAL A O    3  
ATOM 5011  C CB   . VAL A 1 74  ? 0.586   -8.528  -3.183  1.00 0.00 ? 74  VAL A CB   3  
ATOM 5012  C CG1  . VAL A 1 74  ? 0.926   -7.121  -2.711  1.00 0.00 ? 74  VAL A CG1  3  
ATOM 5013  C CG2  . VAL A 1 74  ? -0.605  -9.079  -2.413  1.00 0.00 ? 74  VAL A CG2  3  
ATOM 5014  H H    . VAL A 1 74  ? 1.613   -7.070  -5.460  1.00 0.00 ? 74  VAL A H    3  
ATOM 5015  H HA   . VAL A 1 74  ? 0.162   -9.583  -5.008  1.00 0.00 ? 74  VAL A HA   3  
ATOM 5016  H HB   . VAL A 1 74  ? 1.436   -9.161  -2.979  1.00 0.00 ? 74  VAL A HB   3  
ATOM 5017  H HG11 . VAL A 1 74  ? 1.811   -6.772  -3.221  1.00 0.00 ? 74  VAL A HG11 3  
ATOM 5018  H HG12 . VAL A 1 74  ? 1.105   -7.132  -1.646  1.00 0.00 ? 74  VAL A HG12 3  
ATOM 5019  H HG13 . VAL A 1 74  ? 0.100   -6.459  -2.930  1.00 0.00 ? 74  VAL A HG13 3  
ATOM 5020  H HG21 . VAL A 1 74  ? -1.477  -8.472  -2.613  1.00 0.00 ? 74  VAL A HG21 3  
ATOM 5021  H HG22 . VAL A 1 74  ? -0.389  -9.060  -1.355  1.00 0.00 ? 74  VAL A HG22 3  
ATOM 5022  H HG23 . VAL A 1 74  ? -0.797  -10.096 -2.724  1.00 0.00 ? 74  VAL A HG23 3  
ATOM 5023  N N    . MET A 1 75  ? -1.988  -8.548  -5.314  1.00 0.00 ? 75  MET A N    3  
ATOM 5024  C CA   . MET A 1 75  ? -3.223  -7.969  -5.765  1.00 0.00 ? 75  MET A CA   3  
ATOM 5025  C C    . MET A 1 75  ? -4.307  -8.163  -4.716  1.00 0.00 ? 75  MET A C    3  
ATOM 5026  O O    . MET A 1 75  ? -4.499  -9.270  -4.210  1.00 0.00 ? 75  MET A O    3  
ATOM 5027  C CB   . MET A 1 75  ? -3.634  -8.599  -7.089  1.00 0.00 ? 75  MET A CB   3  
ATOM 5028  C CG   . MET A 1 75  ? -4.423  -7.652  -7.955  1.00 0.00 ? 75  MET A CG   3  
ATOM 5029  S SD   . MET A 1 75  ? -5.230  -8.474  -9.342  1.00 0.00 ? 75  MET A SD   3  
ATOM 5030  C CE   . MET A 1 75  ? -6.055  -7.087  -10.119 1.00 0.00 ? 75  MET A CE   3  
ATOM 5031  H H    . MET A 1 75  ? -1.925  -9.523  -5.194  1.00 0.00 ? 75  MET A H    3  
ATOM 5032  H HA   . MET A 1 75  ? -3.063  -6.912  -5.911  1.00 0.00 ? 75  MET A HA   3  
ATOM 5033  H HB2  . MET A 1 75  ? -2.746  -8.900  -7.627  1.00 0.00 ? 75  MET A HB2  3  
ATOM 5034  H HB3  . MET A 1 75  ? -4.243  -9.468  -6.892  1.00 0.00 ? 75  MET A HB3  3  
ATOM 5035  H HG2  . MET A 1 75  ? -5.161  -7.181  -7.340  1.00 0.00 ? 75  MET A HG2  3  
ATOM 5036  H HG3  . MET A 1 75  ? -3.750  -6.900  -8.342  1.00 0.00 ? 75  MET A HG3  3  
ATOM 5037  H HE1  . MET A 1 75  ? -6.599  -7.432  -10.986 1.00 0.00 ? 75  MET A HE1  3  
ATOM 5038  H HE2  . MET A 1 75  ? -5.321  -6.356  -10.422 1.00 0.00 ? 75  MET A HE2  3  
ATOM 5039  H HE3  . MET A 1 75  ? -6.744  -6.637  -9.417  1.00 0.00 ? 75  MET A HE3  3  
ATOM 5040  N N    . PHE A 1 76  ? -5.007  -7.090  -4.402  1.00 0.00 ? 76  PHE A N    3  
ATOM 5041  C CA   . PHE A 1 76  ? -6.004  -7.110  -3.342  1.00 0.00 ? 76  PHE A CA   3  
ATOM 5042  C C    . PHE A 1 76  ? -6.970  -5.948  -3.517  1.00 0.00 ? 76  PHE A C    3  
ATOM 5043  O O    . PHE A 1 76  ? -6.825  -5.147  -4.446  1.00 0.00 ? 76  PHE A O    3  
ATOM 5044  C CB   . PHE A 1 76  ? -5.321  -7.021  -1.969  1.00 0.00 ? 76  PHE A CB   3  
ATOM 5045  C CG   . PHE A 1 76  ? -4.780  -5.654  -1.645  1.00 0.00 ? 76  PHE A CG   3  
ATOM 5046  C CD1  . PHE A 1 76  ? -3.704  -5.130  -2.343  1.00 0.00 ? 76  PHE A CD1  3  
ATOM 5047  C CD2  . PHE A 1 76  ? -5.356  -4.893  -0.640  1.00 0.00 ? 76  PHE A CD2  3  
ATOM 5048  C CE1  . PHE A 1 76  ? -3.215  -3.875  -2.044  1.00 0.00 ? 76  PHE A CE1  3  
ATOM 5049  C CE2  . PHE A 1 76  ? -4.869  -3.636  -0.338  1.00 0.00 ? 76  PHE A CE2  3  
ATOM 5050  C CZ   . PHE A 1 76  ? -3.798  -3.129  -1.042  1.00 0.00 ? 76  PHE A CZ   3  
ATOM 5051  H H    . PHE A 1 76  ? -4.863  -6.263  -4.914  1.00 0.00 ? 76  PHE A H    3  
ATOM 5052  H HA   . PHE A 1 76  ? -6.549  -8.038  -3.409  1.00 0.00 ? 76  PHE A HA   3  
ATOM 5053  H HB2  . PHE A 1 76  ? -6.037  -7.281  -1.204  1.00 0.00 ? 76  PHE A HB2  3  
ATOM 5054  H HB3  . PHE A 1 76  ? -4.498  -7.722  -1.937  1.00 0.00 ? 76  PHE A HB3  3  
ATOM 5055  H HD1  . PHE A 1 76  ? -3.249  -5.715  -3.131  1.00 0.00 ? 76  PHE A HD1  3  
ATOM 5056  H HD2  . PHE A 1 76  ? -6.195  -5.292  -0.089  1.00 0.00 ? 76  PHE A HD2  3  
ATOM 5057  H HE1  . PHE A 1 76  ? -2.376  -3.476  -2.596  1.00 0.00 ? 76  PHE A HE1  3  
ATOM 5058  H HE2  . PHE A 1 76  ? -5.328  -3.052  0.446   1.00 0.00 ? 76  PHE A HE2  3  
ATOM 5059  H HZ   . PHE A 1 76  ? -3.415  -2.146  -0.809  1.00 0.00 ? 76  PHE A HZ   3  
ATOM 5060  N N    . ARG A 1 77  ? -7.952  -5.858  -2.631  1.00 0.00 ? 77  ARG A N    3  
ATOM 5061  C CA   . ARG A 1 77  ? -8.896  -4.755  -2.657  1.00 0.00 ? 77  ARG A CA   3  
ATOM 5062  C C    . ARG A 1 77  ? -8.626  -3.777  -1.518  1.00 0.00 ? 77  ARG A C    3  
ATOM 5063  O O    . ARG A 1 77  ? -8.737  -4.130  -0.340  1.00 0.00 ? 77  ARG A O    3  
ATOM 5064  C CB   . ARG A 1 77  ? -10.330 -5.270  -2.582  1.00 0.00 ? 77  ARG A CB   3  
ATOM 5065  C CG   . ARG A 1 77  ? -10.941 -5.577  -3.939  1.00 0.00 ? 77  ARG A CG   3  
ATOM 5066  C CD   . ARG A 1 77  ? -12.354 -6.111  -3.799  1.00 0.00 ? 77  ARG A CD   3  
ATOM 5067  N NE   . ARG A 1 77  ? -13.144 -5.910  -5.015  1.00 0.00 ? 77  ARG A NE   3  
ATOM 5068  C CZ   . ARG A 1 77  ? -14.184 -6.669  -5.365  1.00 0.00 ? 77  ARG A CZ   3  
ATOM 5069  N NH1  . ARG A 1 77  ? -14.477 -7.762  -4.674  1.00 0.00 ? 77  ARG A NH1  3  
ATOM 5070  N NH2  . ARG A 1 77  ? -14.910 -6.355  -6.434  1.00 0.00 ? 77  ARG A NH2  3  
ATOM 5071  H H    . ARG A 1 77  ? -8.039  -6.543  -1.928  1.00 0.00 ? 77  ARG A H    3  
ATOM 5072  H HA   . ARG A 1 77  ? -8.760  -4.234  -3.594  1.00 0.00 ? 77  ARG A HA   3  
ATOM 5073  H HB2  . ARG A 1 77  ? -10.345 -6.175  -1.992  1.00 0.00 ? 77  ARG A HB2  3  
ATOM 5074  H HB3  . ARG A 1 77  ? -10.942 -4.525  -2.096  1.00 0.00 ? 77  ARG A HB3  3  
ATOM 5075  H HG2  . ARG A 1 77  ? -10.968 -4.669  -4.523  1.00 0.00 ? 77  ARG A HG2  3  
ATOM 5076  H HG3  . ARG A 1 77  ? -10.330 -6.316  -4.439  1.00 0.00 ? 77  ARG A HG3  3  
ATOM 5077  H HD2  . ARG A 1 77  ? -12.305 -7.169  -3.584  1.00 0.00 ? 77  ARG A HD2  3  
ATOM 5078  H HD3  . ARG A 1 77  ? -12.837 -5.602  -2.979  1.00 0.00 ? 77  ARG A HD3  3  
ATOM 5079  H HE   . ARG A 1 77  ? -12.904 -5.143  -5.581  1.00 0.00 ? 77  ARG A HE   3  
ATOM 5080  H HH11 . ARG A 1 77  ? -13.911 -8.033  -3.887  1.00 0.00 ? 77  ARG A HH11 3  
ATOM 5081  H HH12 . ARG A 1 77  ? -15.274 -8.321  -4.925  1.00 0.00 ? 77  ARG A HH12 3  
ATOM 5082  H HH21 . ARG A 1 77  ? -14.683 -5.542  -6.985  1.00 0.00 ? 77  ARG A HH21 3  
ATOM 5083  H HH22 . ARG A 1 77  ? -15.692 -6.937  -6.703  1.00 0.00 ? 77  ARG A HH22 3  
ATOM 5084  N N    . PHE A 1 78  ? -8.280  -2.549  -1.888  1.00 0.00 ? 78  PHE A N    3  
ATOM 5085  C CA   . PHE A 1 78  ? -7.983  -1.486  -0.934  1.00 0.00 ? 78  PHE A CA   3  
ATOM 5086  C C    . PHE A 1 78  ? -9.260  -0.700  -0.660  1.00 0.00 ? 78  PHE A C    3  
ATOM 5087  O O    . PHE A 1 78  ? -10.008 -0.387  -1.588  1.00 0.00 ? 78  PHE A O    3  
ATOM 5088  C CB   . PHE A 1 78  ? -6.920  -0.559  -1.541  1.00 0.00 ? 78  PHE A CB   3  
ATOM 5089  C CG   . PHE A 1 78  ? -6.170  0.320   -0.575  1.00 0.00 ? 78  PHE A CG   3  
ATOM 5090  C CD1  . PHE A 1 78  ? -6.761  1.435   0.005   1.00 0.00 ? 78  PHE A CD1  3  
ATOM 5091  C CD2  . PHE A 1 78  ? -4.842  0.047   -0.285  1.00 0.00 ? 78  PHE A CD2  3  
ATOM 5092  C CE1  . PHE A 1 78  ? -6.038  2.253   0.857   1.00 0.00 ? 78  PHE A CE1  3  
ATOM 5093  C CE2  . PHE A 1 78  ? -4.121  0.857   0.565   1.00 0.00 ? 78  PHE A CE2  3  
ATOM 5094  C CZ   . PHE A 1 78  ? -4.715  1.962   1.136   1.00 0.00 ? 78  PHE A CZ   3  
ATOM 5095  H H    . PHE A 1 78  ? -8.233  -2.339  -2.847  1.00 0.00 ? 78  PHE A H    3  
ATOM 5096  H HA   . PHE A 1 78  ? -7.615  -1.923  -0.018  1.00 0.00 ? 78  PHE A HA   3  
ATOM 5097  H HB2  . PHE A 1 78  ? -6.190  -1.165  -2.055  1.00 0.00 ? 78  PHE A HB2  3  
ATOM 5098  H HB3  . PHE A 1 78  ? -7.400  0.085   -2.263  1.00 0.00 ? 78  PHE A HB3  3  
ATOM 5099  H HD1  . PHE A 1 78  ? -7.794  1.668   -0.216  1.00 0.00 ? 78  PHE A HD1  3  
ATOM 5100  H HD2  . PHE A 1 78  ? -4.371  -0.815  -0.733  1.00 0.00 ? 78  PHE A HD2  3  
ATOM 5101  H HE1  . PHE A 1 78  ? -6.507  3.117   1.303   1.00 0.00 ? 78  PHE A HE1  3  
ATOM 5102  H HE2  . PHE A 1 78  ? -3.088  0.628   0.782   1.00 0.00 ? 78  PHE A HE2  3  
ATOM 5103  H HZ   . PHE A 1 78  ? -4.144  2.603   1.791   1.00 0.00 ? 78  PHE A HZ   3  
ATOM 5104  N N    . ARG A 1 79  ? -9.534  -0.406  0.596   1.00 0.00 ? 79  ARG A N    3  
ATOM 5105  C CA   . ARG A 1 79  ? -10.705 0.383   0.934   1.00 0.00 ? 79  ARG A CA   3  
ATOM 5106  C C    . ARG A 1 79  ? -10.444 1.858   0.659   1.00 0.00 ? 79  ARG A C    3  
ATOM 5107  O O    . ARG A 1 79  ? -9.656  2.488   1.350   1.00 0.00 ? 79  ARG A O    3  
ATOM 5108  C CB   . ARG A 1 79  ? -11.084 0.206   2.398   1.00 0.00 ? 79  ARG A CB   3  
ATOM 5109  C CG   . ARG A 1 79  ? -12.546 0.514   2.671   1.00 0.00 ? 79  ARG A CG   3  
ATOM 5110  C CD   . ARG A 1 79  ? -12.776 0.913   4.113   1.00 0.00 ? 79  ARG A CD   3  
ATOM 5111  N NE   . ARG A 1 79  ? -12.090 0.028   5.062   1.00 0.00 ? 79  ARG A NE   3  
ATOM 5112  C CZ   . ARG A 1 79  ? -12.617 -0.366  6.222   1.00 0.00 ? 79  ARG A CZ   3  
ATOM 5113  N NH1  . ARG A 1 79  ? -13.849 -0.005  6.551   1.00 0.00 ? 79  ARG A NH1  3  
ATOM 5114  N NH2  . ARG A 1 79  ? -11.910 -1.135  7.044   1.00 0.00 ? 79  ARG A NH2  3  
ATOM 5115  H H    . ARG A 1 79  ? -8.949  -0.743  1.314   1.00 0.00 ? 79  ARG A H    3  
ATOM 5116  H HA   . ARG A 1 79  ? -11.523 0.050   0.311   1.00 0.00 ? 79  ARG A HA   3  
ATOM 5117  H HB2  . ARG A 1 79  ? -10.889 -0.814  2.689   1.00 0.00 ? 79  ARG A HB2  3  
ATOM 5118  H HB3  . ARG A 1 79  ? -10.481 0.869   2.999   1.00 0.00 ? 79  ARG A HB3  3  
ATOM 5119  H HG2  . ARG A 1 79  ? -12.855 1.326   2.031   1.00 0.00 ? 79  ARG A HG2  3  
ATOM 5120  H HG3  . ARG A 1 79  ? -13.135 -0.365  2.449   1.00 0.00 ? 79  ARG A HG3  3  
ATOM 5121  H HD2  . ARG A 1 79  ? -12.415 1.916   4.246   1.00 0.00 ? 79  ARG A HD2  3  
ATOM 5122  H HD3  . ARG A 1 79  ? -13.837 0.886   4.314   1.00 0.00 ? 79  ARG A HD3  3  
ATOM 5123  H HE   . ARG A 1 79  ? -11.189 -0.274  4.823   1.00 0.00 ? 79  ARG A HE   3  
ATOM 5124  H HH11 . ARG A 1 79  ? -14.392 0.562   5.925   1.00 0.00 ? 79  ARG A HH11 3  
ATOM 5125  H HH12 . ARG A 1 79  ? -14.251 -0.304  7.429   1.00 0.00 ? 79  ARG A HH12 3  
ATOM 5126  H HH21 . ARG A 1 79  ? -10.977 -1.421  6.802   1.00 0.00 ? 79  ARG A HH21 3  
ATOM 5127  H HH22 . ARG A 1 79  ? -12.310 -1.450  7.916   1.00 0.00 ? 79  ARG A HH22 3  
ATOM 5128  N N    . SER A 1 80  ? -11.090 2.387   -0.367  1.00 0.00 ? 80  SER A N    3  
ATOM 5129  C CA   . SER A 1 80  ? -10.981 3.800   -0.695  1.00 0.00 ? 80  SER A CA   3  
ATOM 5130  C C    . SER A 1 80  ? -11.642 4.670   0.370   1.00 0.00 ? 80  SER A C    3  
ATOM 5131  O O    . SER A 1 80  ? -12.239 4.169   1.323   1.00 0.00 ? 80  SER A O    3  
ATOM 5132  C CB   . SER A 1 80  ? -11.632 4.078   -2.049  1.00 0.00 ? 80  SER A CB   3  
ATOM 5133  O OG   . SER A 1 80  ? -12.991 3.682   -2.045  1.00 0.00 ? 80  SER A OG   3  
ATOM 5134  H H    . SER A 1 80  ? -11.628 1.799   -0.940  1.00 0.00 ? 80  SER A H    3  
ATOM 5135  H HA   . SER A 1 80  ? -9.934  4.051   -0.751  1.00 0.00 ? 80  SER A HA   3  
ATOM 5136  H HB2  . SER A 1 80  ? -11.579 5.134   -2.259  1.00 0.00 ? 80  SER A HB2  3  
ATOM 5137  H HB3  . SER A 1 80  ? -11.109 3.527   -2.819  1.00 0.00 ? 80  SER A HB3  3  
ATOM 5138  H HG   . SER A 1 80  ? -13.043 2.719   -2.122  1.00 0.00 ? 80  SER A HG   3  
ATOM 5139  N N    . LYS A 1 81  ? -11.570 5.979   0.168   1.00 0.00 ? 81  LYS A N    3  
ATOM 5140  C CA   . LYS A 1 81  ? -12.145 6.945   1.101   1.00 0.00 ? 81  LYS A CA   3  
ATOM 5141  C C    . LYS A 1 81  ? -13.667 6.980   0.951   1.00 0.00 ? 81  LYS A C    3  
ATOM 5142  O O    . LYS A 1 81  ? -14.361 7.748   1.617   1.00 0.00 ? 81  LYS A O    3  
ATOM 5143  C CB   . LYS A 1 81  ? -11.555 8.339   0.840   1.00 0.00 ? 81  LYS A CB   3  
ATOM 5144  C CG   . LYS A 1 81  ? -11.899 9.374   1.907   1.00 0.00 ? 81  LYS A CG   3  
ATOM 5145  C CD   . LYS A 1 81  ? -11.296 9.013   3.256   1.00 0.00 ? 81  LYS A CD   3  
ATOM 5146  C CE   . LYS A 1 81  ? -11.819 9.919   4.361   1.00 0.00 ? 81  LYS A CE   3  
ATOM 5147  N NZ   . LYS A 1 81  ? -11.268 9.557   5.695   1.00 0.00 ? 81  LYS A NZ   3  
ATOM 5148  H H    . LYS A 1 81  ? -11.116 6.313   -0.636  1.00 0.00 ? 81  LYS A H    3  
ATOM 5149  H HA   . LYS A 1 81  ? -11.896 6.632   2.104   1.00 0.00 ? 81  LYS A HA   3  
ATOM 5150  H HB2  . LYS A 1 81  ? -10.479 8.258   0.784   1.00 0.00 ? 81  LYS A HB2  3  
ATOM 5151  H HB3  . LYS A 1 81  ? -11.927 8.698   -0.109  1.00 0.00 ? 81  LYS A HB3  3  
ATOM 5152  H HG2  . LYS A 1 81  ? -11.514 10.335  1.598   1.00 0.00 ? 81  LYS A HG2  3  
ATOM 5153  H HG3  . LYS A 1 81  ? -12.973 9.431   2.005   1.00 0.00 ? 81  LYS A HG3  3  
ATOM 5154  H HD2  . LYS A 1 81  ? -11.548 7.992   3.491   1.00 0.00 ? 81  LYS A HD2  3  
ATOM 5155  H HD3  . LYS A 1 81  ? -10.223 9.116   3.197   1.00 0.00 ? 81  LYS A HD3  3  
ATOM 5156  H HE2  . LYS A 1 81  ? -11.542 10.937  4.134   1.00 0.00 ? 81  LYS A HE2  3  
ATOM 5157  H HE3  . LYS A 1 81  ? -12.894 9.835   4.393   1.00 0.00 ? 81  LYS A HE3  3  
ATOM 5158  H HZ1  . LYS A 1 81  ? -10.245 9.770   5.741   1.00 0.00 ? 81  LYS A HZ1  3  
ATOM 5159  H HZ2  . LYS A 1 81  ? -11.405 8.539   5.879   1.00 0.00 ? 81  LYS A HZ2  3  
ATOM 5160  H HZ3  . LYS A 1 81  ? -11.755 10.099  6.443   1.00 0.00 ? 81  LYS A HZ3  3  
ATOM 5161  N N    . ASN A 1 82  ? -14.179 6.136   0.067   1.00 0.00 ? 82  ASN A N    3  
ATOM 5162  C CA   . ASN A 1 82  ? -15.610 6.041   -0.171  1.00 0.00 ? 82  ASN A CA   3  
ATOM 5163  C C    . ASN A 1 82  ? -16.121 4.730   0.404   1.00 0.00 ? 82  ASN A C    3  
ATOM 5164  O O    . ASN A 1 82  ? -17.260 4.327   0.168   1.00 0.00 ? 82  ASN A O    3  
ATOM 5165  C CB   . ASN A 1 82  ? -15.909 6.116   -1.668  1.00 0.00 ? 82  ASN A CB   3  
ATOM 5166  C CG   . ASN A 1 82  ? -15.159 7.242   -2.349  1.00 0.00 ? 82  ASN A CG   3  
ATOM 5167  O OD1  . ASN A 1 82  ? -15.606 8.389   -2.365  1.00 0.00 ? 82  ASN A OD1  3  
ATOM 5168  N ND2  . ASN A 1 82  ? -14.014 6.917   -2.934  1.00 0.00 ? 82  ASN A ND2  3  
ATOM 5169  H H    . ASN A 1 82  ? -13.577 5.545   -0.436  1.00 0.00 ? 82  ASN A H    3  
ATOM 5170  H HA   . ASN A 1 82  ? -16.092 6.865   0.337   1.00 0.00 ? 82  ASN A HA   3  
ATOM 5171  H HB2  . ASN A 1 82  ? -15.623 5.184   -2.132  1.00 0.00 ? 82  ASN A HB2  3  
ATOM 5172  H HB3  . ASN A 1 82  ? -16.968 6.273   -1.808  1.00 0.00 ? 82  ASN A HB3  3  
ATOM 5173  H HD21 . ASN A 1 82  ? -13.729 5.978   -2.902  1.00 0.00 ? 82  ASN A HD21 3  
ATOM 5174  H HD22 . ASN A 1 82  ? -13.487 7.633   -3.363  1.00 0.00 ? 82  ASN A HD22 3  
ATOM 5175  N N    . GLN A 1 83  ? -15.229 4.064   1.141   1.00 0.00 ? 83  GLN A N    3  
ATOM 5176  C CA   . GLN A 1 83  ? -15.523 2.814   1.836   1.00 0.00 ? 83  GLN A CA   3  
ATOM 5177  C C    . GLN A 1 83  ? -15.757 1.657   0.865   1.00 0.00 ? 83  GLN A C    3  
ATOM 5178  O O    . GLN A 1 83  ? -16.223 0.589   1.264   1.00 0.00 ? 83  GLN A O    3  
ATOM 5179  C CB   . GLN A 1 83  ? -16.713 2.962   2.791   1.00 0.00 ? 83  GLN A CB   3  
ATOM 5180  C CG   . GLN A 1 83  ? -16.402 3.742   4.066   1.00 0.00 ? 83  GLN A CG   3  
ATOM 5181  C CD   . GLN A 1 83  ? -16.254 5.236   3.838   1.00 0.00 ? 83  GLN A CD   3  
ATOM 5182  O OE1  . GLN A 1 83  ? -17.233 5.981   3.877   1.00 0.00 ? 83  GLN A OE1  3  
ATOM 5183  N NE2  . GLN A 1 83  ? -15.026 5.694   3.632   1.00 0.00 ? 83  GLN A NE2  3  
ATOM 5184  H H    . GLN A 1 83  ? -14.323 4.434   1.222   1.00 0.00 ? 83  GLN A H    3  
ATOM 5185  H HA   . GLN A 1 83  ? -14.648 2.574   2.425   1.00 0.00 ? 83  GLN A HA   3  
ATOM 5186  H HB2  . GLN A 1 83  ? -17.511 3.472   2.273   1.00 0.00 ? 83  GLN A HB2  3  
ATOM 5187  H HB3  . GLN A 1 83  ? -17.054 1.976   3.074   1.00 0.00 ? 83  GLN A HB3  3  
ATOM 5188  H HG2  . GLN A 1 83  ? -17.203 3.584   4.771   1.00 0.00 ? 83  GLN A HG2  3  
ATOM 5189  H HG3  . GLN A 1 83  ? -15.476 3.364   4.483   1.00 0.00 ? 83  GLN A HG3  3  
ATOM 5190  H HE21 . GLN A 1 83  ? -14.278 5.046   3.642   1.00 0.00 ? 83  GLN A HE21 3  
ATOM 5191  H HE22 . GLN A 1 83  ? -14.910 6.653   3.467   1.00 0.00 ? 83  GLN A HE22 3  
ATOM 5192  N N    . GLU A 1 84  ? -15.435 1.861   -0.408  1.00 0.00 ? 84  GLU A N    3  
ATOM 5193  C CA   . GLU A 1 84  ? -15.512 0.789   -1.372  1.00 0.00 ? 84  GLU A CA   3  
ATOM 5194  C C    . GLU A 1 84  ? -14.125 0.228   -1.635  1.00 0.00 ? 84  GLU A C    3  
ATOM 5195  O O    . GLU A 1 84  ? -13.130 0.949   -1.553  1.00 0.00 ? 84  GLU A O    3  
ATOM 5196  C CB   . GLU A 1 84  ? -16.168 1.262   -2.666  1.00 0.00 ? 84  GLU A CB   3  
ATOM 5197  C CG   . GLU A 1 84  ? -15.366 2.289   -3.442  1.00 0.00 ? 84  GLU A CG   3  
ATOM 5198  C CD   . GLU A 1 84  ? -15.973 2.583   -4.797  1.00 0.00 ? 84  GLU A CD   3  
ATOM 5199  O OE1  . GLU A 1 84  ? -15.710 1.819   -5.747  1.00 0.00 ? 84  GLU A OE1  3  
ATOM 5200  O OE2  . GLU A 1 84  ? -16.727 3.571   -4.917  1.00 0.00 ? 84  GLU A OE2  3  
ATOM 5201  H H    . GLU A 1 84  ? -15.152 2.744   -0.705  1.00 0.00 ? 84  GLU A H    3  
ATOM 5202  H HA   . GLU A 1 84  ? -16.112 0.011   -0.938  1.00 0.00 ? 84  GLU A HA   3  
ATOM 5203  H HB2  . GLU A 1 84  ? -16.321 0.412   -3.298  1.00 0.00 ? 84  GLU A HB2  3  
ATOM 5204  H HB3  . GLU A 1 84  ? -17.127 1.697   -2.427  1.00 0.00 ? 84  GLU A HB3  3  
ATOM 5205  H HG2  . GLU A 1 84  ? -15.332 3.203   -2.870  1.00 0.00 ? 84  GLU A HG2  3  
ATOM 5206  H HG3  . GLU A 1 84  ? -14.364 1.911   -3.582  1.00 0.00 ? 84  GLU A HG3  3  
ATOM 5207  N N    . TRP A 1 85  ? -14.062 -1.052  -1.957  1.00 0.00 ? 85  TRP A N    3  
ATOM 5208  C CA   . TRP A 1 85  ? -12.801 -1.765  -2.027  1.00 0.00 ? 85  TRP A CA   3  
ATOM 5209  C C    . TRP A 1 85  ? -12.385 -1.960  -3.484  1.00 0.00 ? 85  TRP A C    3  
ATOM 5210  O O    . TRP A 1 85  ? -12.958 -2.790  -4.193  1.00 0.00 ? 85  TRP A O    3  
ATOM 5211  C CB   . TRP A 1 85  ? -12.949 -3.114  -1.318  1.00 0.00 ? 85  TRP A CB   3  
ATOM 5212  C CG   . TRP A 1 85  ? -13.570 -3.002  0.049   1.00 0.00 ? 85  TRP A CG   3  
ATOM 5213  C CD1  . TRP A 1 85  ? -14.895 -2.817  0.333   1.00 0.00 ? 85  TRP A CD1  3  
ATOM 5214  C CD2  . TRP A 1 85  ? -12.899 -3.063  1.313   1.00 0.00 ? 85  TRP A CD2  3  
ATOM 5215  N NE1  . TRP A 1 85  ? -15.081 -2.749  1.689   1.00 0.00 ? 85  TRP A NE1  3  
ATOM 5216  C CE2  . TRP A 1 85  ? -13.878 -2.904  2.312   1.00 0.00 ? 85  TRP A CE2  3  
ATOM 5217  C CE3  . TRP A 1 85  ? -11.572 -3.238  1.699   1.00 0.00 ? 85  TRP A CE3  3  
ATOM 5218  C CZ2  . TRP A 1 85  ? -13.570 -2.913  3.668   1.00 0.00 ? 85  TRP A CZ2  3  
ATOM 5219  C CZ3  . TRP A 1 85  ? -11.270 -3.244  3.049   1.00 0.00 ? 85  TRP A CZ3  3  
ATOM 5220  C CH2  . TRP A 1 85  ? -12.264 -3.086  4.017   1.00 0.00 ? 85  TRP A CH2  3  
ATOM 5221  H H    . TRP A 1 85  ? -14.878 -1.537  -2.184  1.00 0.00 ? 85  TRP A H    3  
ATOM 5222  H HA   . TRP A 1 85  ? -12.052 -1.176  -1.521  1.00 0.00 ? 85  TRP A HA   3  
ATOM 5223  H HB2  . TRP A 1 85  ? -13.572 -3.763  -1.916  1.00 0.00 ? 85  TRP A HB2  3  
ATOM 5224  H HB3  . TRP A 1 85  ? -11.976 -3.561  -1.206  1.00 0.00 ? 85  TRP A HB3  3  
ATOM 5225  H HD1  . TRP A 1 85  ? -15.668 -2.726  -0.414  1.00 0.00 ? 85  TRP A HD1  3  
ATOM 5226  H HE1  . TRP A 1 85  ? -15.947 -2.611  2.145   1.00 0.00 ? 85  TRP A HE1  3  
ATOM 5227  H HE3  . TRP A 1 85  ? -10.788 -3.364  0.966   1.00 0.00 ? 85  TRP A HE3  3  
ATOM 5228  H HZ2  . TRP A 1 85  ? -14.329 -2.793  4.427   1.00 0.00 ? 85  TRP A HZ2  3  
ATOM 5229  H HZ3  . TRP A 1 85  ? -10.246 -3.379  3.365   1.00 0.00 ? 85  TRP A HZ3  3  
ATOM 5230  H HH2  . TRP A 1 85  ? -11.977 -3.099  5.058   1.00 0.00 ? 85  TRP A HH2  3  
ATOM 5231  N N    . LEU A 1 86  ? -11.399 -1.189  -3.922  1.00 0.00 ? 86  LEU A N    3  
ATOM 5232  C CA   . LEU A 1 86  ? -10.983 -1.192  -5.320  1.00 0.00 ? 86  LEU A CA   3  
ATOM 5233  C C    . LEU A 1 86  ? -9.852  -2.195  -5.542  1.00 0.00 ? 86  LEU A C    3  
ATOM 5234  O O    . LEU A 1 86  ? -9.183  -2.602  -4.597  1.00 0.00 ? 86  LEU A O    3  
ATOM 5235  C CB   . LEU A 1 86  ? -10.527 0.212   -5.757  1.00 0.00 ? 86  LEU A CB   3  
ATOM 5236  C CG   . LEU A 1 86  ? -10.988 1.377   -4.868  1.00 0.00 ? 86  LEU A CG   3  
ATOM 5237  C CD1  . LEU A 1 86  ? -9.935  1.696   -3.820  1.00 0.00 ? 86  LEU A CD1  3  
ATOM 5238  C CD2  . LEU A 1 86  ? -11.296 2.606   -5.700  1.00 0.00 ? 86  LEU A CD2  3  
ATOM 5239  H H    . LEU A 1 86  ? -10.927 -0.609  -3.283  1.00 0.00 ? 86  LEU A H    3  
ATOM 5240  H HA   . LEU A 1 86  ? -11.831 -1.487  -5.918  1.00 0.00 ? 86  LEU A HA   3  
ATOM 5241  H HB2  . LEU A 1 86  ? -9.447  0.220   -5.787  1.00 0.00 ? 86  LEU A HB2  3  
ATOM 5242  H HB3  . LEU A 1 86  ? -10.896 0.389   -6.757  1.00 0.00 ? 86  LEU A HB3  3  
ATOM 5243  H HG   . LEU A 1 86  ? -11.892 1.092   -4.351  1.00 0.00 ? 86  LEU A HG   3  
ATOM 5244  H HD11 . LEU A 1 86  ? -10.285 2.504   -3.194  1.00 0.00 ? 86  LEU A HD11 3  
ATOM 5245  H HD12 . LEU A 1 86  ? -9.019  1.992   -4.309  1.00 0.00 ? 86  LEU A HD12 3  
ATOM 5246  H HD13 . LEU A 1 86  ? -9.754  0.825   -3.212  1.00 0.00 ? 86  LEU A HD13 3  
ATOM 5247  H HD21 . LEU A 1 86  ? -12.072 2.372   -6.412  1.00 0.00 ? 86  LEU A HD21 3  
ATOM 5248  H HD22 . LEU A 1 86  ? -10.405 2.920   -6.221  1.00 0.00 ? 86  LEU A HD22 3  
ATOM 5249  H HD23 . LEU A 1 86  ? -11.634 3.400   -5.047  1.00 0.00 ? 86  LEU A HD23 3  
ATOM 5250  N N    . TRP A 1 87  ? -9.654  -2.593  -6.793  1.00 0.00 ? 87  TRP A N    3  
ATOM 5251  C CA   . TRP A 1 87  ? -8.596  -3.529  -7.153  1.00 0.00 ? 87  TRP A CA   3  
ATOM 5252  C C    . TRP A 1 87  ? -7.300  -2.795  -7.461  1.00 0.00 ? 87  TRP A C    3  
ATOM 5253  O O    . TRP A 1 87  ? -7.239  -1.983  -8.392  1.00 0.00 ? 87  TRP A O    3  
ATOM 5254  C CB   . TRP A 1 87  ? -8.993  -4.358  -8.377  1.00 0.00 ? 87  TRP A CB   3  
ATOM 5255  C CG   . TRP A 1 87  ? -10.042 -5.388  -8.106  1.00 0.00 ? 87  TRP A CG   3  
ATOM 5256  C CD1  . TRP A 1 87  ? -11.368 -5.318  -8.425  1.00 0.00 ? 87  TRP A CD1  3  
ATOM 5257  C CD2  . TRP A 1 87  ? -9.844  -6.653  -7.469  1.00 0.00 ? 87  TRP A CD2  3  
ATOM 5258  N NE1  . TRP A 1 87  ? -12.007 -6.468  -8.029  1.00 0.00 ? 87  TRP A NE1  3  
ATOM 5259  C CE2  . TRP A 1 87  ? -11.092 -7.302  -7.435  1.00 0.00 ? 87  TRP A CE2  3  
ATOM 5260  C CE3  . TRP A 1 87  ? -8.730  -7.301  -6.922  1.00 0.00 ? 87  TRP A CE3  3  
ATOM 5261  C CZ2  . TRP A 1 87  ? -11.257 -8.568  -6.877  1.00 0.00 ? 87  TRP A CZ2  3  
ATOM 5262  C CZ3  . TRP A 1 87  ? -8.894  -8.555  -6.368  1.00 0.00 ? 87  TRP A CZ3  3  
ATOM 5263  C CH2  . TRP A 1 87  ? -10.149 -9.178  -6.350  1.00 0.00 ? 87  TRP A CH2  3  
ATOM 5264  H H    . TRP A 1 87  ? -10.235 -2.244  -7.502  1.00 0.00 ? 87  TRP A H    3  
ATOM 5265  H HA   . TRP A 1 87  ? -8.435  -4.191  -6.316  1.00 0.00 ? 87  TRP A HA   3  
ATOM 5266  H HB2  . TRP A 1 87  ? -9.374  -3.698  -9.142  1.00 0.00 ? 87  TRP A HB2  3  
ATOM 5267  H HB3  . TRP A 1 87  ? -8.117  -4.865  -8.754  1.00 0.00 ? 87  TRP A HB3  3  
ATOM 5268  H HD1  . TRP A 1 87  ? -11.831 -4.475  -8.922  1.00 0.00 ? 87  TRP A HD1  3  
ATOM 5269  H HE1  . TRP A 1 87  ? -12.959 -6.661  -8.147  1.00 0.00 ? 87  TRP A HE1  3  
ATOM 5270  H HE3  . TRP A 1 87  ? -7.755  -6.835  -6.927  1.00 0.00 ? 87  TRP A HE3  3  
ATOM 5271  H HZ2  . TRP A 1 87  ? -12.216 -9.062  -6.854  1.00 0.00 ? 87  TRP A HZ2  3  
ATOM 5272  H HZ3  . TRP A 1 87  ? -8.044  -9.069  -5.936  1.00 0.00 ? 87  TRP A HZ3  3  
ATOM 5273  H HH2  . TRP A 1 87  ? -10.233 -10.158 -5.903  1.00 0.00 ? 87  TRP A HH2  3  
ATOM 5274  N N    . MET A 1 88  ? -6.275  -3.075  -6.680  1.00 0.00 ? 88  MET A N    3  
ATOM 5275  C CA   . MET A 1 88  ? -4.954  -2.528  -6.934  1.00 0.00 ? 88  MET A CA   3  
ATOM 5276  C C    . MET A 1 88  ? -3.893  -3.611  -6.868  1.00 0.00 ? 88  MET A C    3  
ATOM 5277  O O    . MET A 1 88  ? -4.004  -4.563  -6.094  1.00 0.00 ? 88  MET A O    3  
ATOM 5278  C CB   . MET A 1 88  ? -4.602  -1.405  -5.953  1.00 0.00 ? 88  MET A CB   3  
ATOM 5279  C CG   . MET A 1 88  ? -5.359  -1.459  -4.639  1.00 0.00 ? 88  MET A CG   3  
ATOM 5280  S SD   . MET A 1 88  ? -6.948  -0.613  -4.747  1.00 0.00 ? 88  MET A SD   3  
ATOM 5281  C CE   . MET A 1 88  ? -6.407  1.068   -5.037  1.00 0.00 ? 88  MET A CE   3  
ATOM 5282  H H    . MET A 1 88  ? -6.411  -3.657  -5.896  1.00 0.00 ? 88  MET A H    3  
ATOM 5283  H HA   . MET A 1 88  ? -4.960  -2.121  -7.934  1.00 0.00 ? 88  MET A HA   3  
ATOM 5284  H HB2  . MET A 1 88  ? -3.549  -1.457  -5.732  1.00 0.00 ? 88  MET A HB2  3  
ATOM 5285  H HB3  . MET A 1 88  ? -4.814  -0.456  -6.426  1.00 0.00 ? 88  MET A HB3  3  
ATOM 5286  H HG2  . MET A 1 88  ? -5.530  -2.493  -4.378  1.00 0.00 ? 88  MET A HG2  3  
ATOM 5287  H HG3  . MET A 1 88  ? -4.764  -0.983  -3.873  1.00 0.00 ? 88  MET A HG3  3  
ATOM 5288  H HE1  . MET A 1 88  ? -5.833  1.110   -5.952  1.00 0.00 ? 88  MET A HE1  3  
ATOM 5289  H HE2  . MET A 1 88  ? -5.789  1.391   -4.211  1.00 0.00 ? 88  MET A HE2  3  
ATOM 5290  H HE3  . MET A 1 88  ? -7.267  1.715   -5.120  1.00 0.00 ? 88  MET A HE3  3  
ATOM 5291  N N    . ARG A 1 89  ? -2.889  -3.469  -7.714  1.00 0.00 ? 89  ARG A N    3  
ATOM 5292  C CA   . ARG A 1 89  ? -1.735  -4.349  -7.697  1.00 0.00 ? 89  ARG A CA   3  
ATOM 5293  C C    . ARG A 1 89  ? -0.568  -3.608  -7.066  1.00 0.00 ? 89  ARG A C    3  
ATOM 5294  O O    . ARG A 1 89  ? -0.051  -2.641  -7.631  1.00 0.00 ? 89  ARG A O    3  
ATOM 5295  C CB   . ARG A 1 89  ? -1.390  -4.798  -9.118  1.00 0.00 ? 89  ARG A CB   3  
ATOM 5296  C CG   . ARG A 1 89  ? -0.202  -5.738  -9.206  1.00 0.00 ? 89  ARG A CG   3  
ATOM 5297  C CD   . ARG A 1 89  ? 0.058   -6.136  -10.649 1.00 0.00 ? 89  ARG A CD   3  
ATOM 5298  N NE   . ARG A 1 89  ? 1.299   -6.889  -10.804 1.00 0.00 ? 89  ARG A NE   3  
ATOM 5299  C CZ   . ARG A 1 89  ? 1.513   -7.778  -11.772 1.00 0.00 ? 89  ARG A CZ   3  
ATOM 5300  N NH1  . ARG A 1 89  ? 0.582   -8.011  -12.689 1.00 0.00 ? 89  ARG A NH1  3  
ATOM 5301  N NH2  . ARG A 1 89  ? 2.665   -8.433  -11.830 1.00 0.00 ? 89  ARG A NH2  3  
ATOM 5302  H H    . ARG A 1 89  ? -2.920  -2.741  -8.372  1.00 0.00 ? 89  ARG A H    3  
ATOM 5303  H HA   . ARG A 1 89  ? -1.977  -5.210  -7.094  1.00 0.00 ? 89  ARG A HA   3  
ATOM 5304  H HB2  . ARG A 1 89  ? -2.248  -5.300  -9.539  1.00 0.00 ? 89  ARG A HB2  3  
ATOM 5305  H HB3  . ARG A 1 89  ? -1.168  -3.926  -9.711  1.00 0.00 ? 89  ARG A HB3  3  
ATOM 5306  H HG2  . ARG A 1 89  ? 0.674   -5.241  -8.814  1.00 0.00 ? 89  ARG A HG2  3  
ATOM 5307  H HG3  . ARG A 1 89  ? -0.408  -6.626  -8.627  1.00 0.00 ? 89  ARG A HG3  3  
ATOM 5308  H HD2  . ARG A 1 89  ? -0.764  -6.748  -10.990 1.00 0.00 ? 89  ARG A HD2  3  
ATOM 5309  H HD3  . ARG A 1 89  ? 0.114   -5.240  -11.250 1.00 0.00 ? 89  ARG A HD3  3  
ATOM 5310  H HE   . ARG A 1 89  ? 2.012   -6.722  -10.145 1.00 0.00 ? 89  ARG A HE   3  
ATOM 5311  H HH11 . ARG A 1 89  ? -0.293  -7.512  -12.666 1.00 0.00 ? 89  ARG A HH11 3  
ATOM 5312  H HH12 . ARG A 1 89  ? 0.741   -8.702  -13.404 1.00 0.00 ? 89  ARG A HH12 3  
ATOM 5313  H HH21 . ARG A 1 89  ? 3.379   -8.265  -11.143 1.00 0.00 ? 89  ARG A HH21 3  
ATOM 5314  H HH22 . ARG A 1 89  ? 2.829   -9.099  -12.566 1.00 0.00 ? 89  ARG A HH22 3  
ATOM 5315  N N    . THR A 1 90  ? -0.192  -4.037  -5.880  1.00 0.00 ? 90  THR A N    3  
ATOM 5316  C CA   . THR A 1 90  ? 0.845   -3.375  -5.122  1.00 0.00 ? 90  THR A CA   3  
ATOM 5317  C C    . THR A 1 90  ? 2.210   -4.020  -5.353  1.00 0.00 ? 90  THR A C    3  
ATOM 5318  O O    . THR A 1 90  ? 2.355   -5.244  -5.298  1.00 0.00 ? 90  THR A O    3  
ATOM 5319  C CB   . THR A 1 90  ? 0.499   -3.395  -3.622  1.00 0.00 ? 90  THR A CB   3  
ATOM 5320  O OG1  . THR A 1 90  ? -0.779  -2.779  -3.420  1.00 0.00 ? 90  THR A OG1  3  
ATOM 5321  C CG2  . THR A 1 90  ? 1.554   -2.671  -2.801  1.00 0.00 ? 90  THR A CG2  3  
ATOM 5322  H H    . THR A 1 90  ? -0.642  -4.820  -5.487  1.00 0.00 ? 90  THR A H    3  
ATOM 5323  H HA   . THR A 1 90  ? 0.887   -2.345  -5.444  1.00 0.00 ? 90  THR A HA   3  
ATOM 5324  H HB   . THR A 1 90  ? 0.451   -4.423  -3.294  1.00 0.00 ? 90  THR A HB   3  
ATOM 5325  H HG1  . THR A 1 90  ? -0.662  -1.907  -3.019  1.00 0.00 ? 90  THR A HG1  3  
ATOM 5326  H HG21 . THR A 1 90  ? 1.284   -2.708  -1.755  1.00 0.00 ? 90  THR A HG21 3  
ATOM 5327  H HG22 . THR A 1 90  ? 1.613   -1.642  -3.120  1.00 0.00 ? 90  THR A HG22 3  
ATOM 5328  H HG23 . THR A 1 90  ? 2.513   -3.148  -2.942  1.00 0.00 ? 90  THR A HG23 3  
ATOM 5329  N N    . SER A 1 91  ? 3.195   -3.183  -5.632  1.00 0.00 ? 91  SER A N    3  
ATOM 5330  C CA   . SER A 1 91  ? 4.568   -3.623  -5.784  1.00 0.00 ? 91  SER A CA   3  
ATOM 5331  C C    . SER A 1 91  ? 5.284   -3.541  -4.440  1.00 0.00 ? 91  SER A C    3  
ATOM 5332  O O    . SER A 1 91  ? 5.409   -2.460  -3.861  1.00 0.00 ? 91  SER A O    3  
ATOM 5333  C CB   . SER A 1 91  ? 5.277   -2.749  -6.818  1.00 0.00 ? 91  SER A CB   3  
ATOM 5334  O OG   . SER A 1 91  ? 4.562   -2.735  -8.043  1.00 0.00 ? 91  SER A OG   3  
ATOM 5335  H H    . SER A 1 91  ? 2.988   -2.226  -5.733  1.00 0.00 ? 91  SER A H    3  
ATOM 5336  H HA   . SER A 1 91  ? 4.562   -4.649  -6.124  1.00 0.00 ? 91  SER A HA   3  
ATOM 5337  H HB2  . SER A 1 91  ? 5.347   -1.738  -6.446  1.00 0.00 ? 91  SER A HB2  3  
ATOM 5338  H HB3  . SER A 1 91  ? 6.267   -3.138  -6.998  1.00 0.00 ? 91  SER A HB3  3  
ATOM 5339  H HG   . SER A 1 91  ? 3.891   -3.432  -8.031  1.00 0.00 ? 91  SER A HG   3  
ATOM 5340  N N    . SER A 1 92  ? 5.735   -4.682  -3.946  1.00 0.00 ? 92  SER A N    3  
ATOM 5341  C CA   . SER A 1 92  ? 6.380   -4.754  -2.646  1.00 0.00 ? 92  SER A CA   3  
ATOM 5342  C C    . SER A 1 92  ? 7.892   -4.702  -2.792  1.00 0.00 ? 92  SER A C    3  
ATOM 5343  O O    . SER A 1 92  ? 8.472   -5.440  -3.588  1.00 0.00 ? 92  SER A O    3  
ATOM 5344  C CB   . SER A 1 92  ? 5.980   -6.047  -1.930  1.00 0.00 ? 92  SER A CB   3  
ATOM 5345  O OG   . SER A 1 92  ? 4.578   -6.257  -2.010  1.00 0.00 ? 92  SER A OG   3  
ATOM 5346  H H    . SER A 1 92  ? 5.637   -5.504  -4.474  1.00 0.00 ? 92  SER A H    3  
ATOM 5347  H HA   . SER A 1 92  ? 6.055   -3.909  -2.060  1.00 0.00 ? 92  SER A HA   3  
ATOM 5348  H HB2  . SER A 1 92  ? 6.496   -6.889  -2.382  1.00 0.00 ? 92  SER A HB2  3  
ATOM 5349  H HB3  . SER A 1 92  ? 6.259   -5.974  -0.889  1.00 0.00 ? 92  SER A HB3  3  
ATOM 5350  H HG   . SER A 1 92  ? 4.308   -6.274  -2.934  1.00 0.00 ? 92  SER A HG   3  
ATOM 5351  N N    . PHE A 1 93  ? 8.519   -3.820  -2.033  1.00 0.00 ? 93  PHE A N    3  
ATOM 5352  C CA   . PHE A 1 93  ? 9.967   -3.734  -1.987  1.00 0.00 ? 93  PHE A CA   3  
ATOM 5353  C C    . PHE A 1 93  ? 10.421  -3.500  -0.555  1.00 0.00 ? 93  PHE A C    3  
ATOM 5354  O O    . PHE A 1 93  ? 9.837   -2.703  0.165   1.00 0.00 ? 93  PHE A O    3  
ATOM 5355  C CB   . PHE A 1 93  ? 10.456  -2.601  -2.895  1.00 0.00 ? 93  PHE A CB   3  
ATOM 5356  C CG   . PHE A 1 93  ? 11.942  -2.361  -2.834  1.00 0.00 ? 93  PHE A CG   3  
ATOM 5357  C CD1  . PHE A 1 93  ? 12.814  -3.137  -3.583  1.00 0.00 ? 93  PHE A CD1  3  
ATOM 5358  C CD2  . PHE A 1 93  ? 12.465  -1.360  -2.026  1.00 0.00 ? 93  PHE A CD2  3  
ATOM 5359  C CE1  . PHE A 1 93  ? 14.179  -2.919  -3.525  1.00 0.00 ? 93  PHE A CE1  3  
ATOM 5360  C CE2  . PHE A 1 93  ? 13.828  -1.139  -1.966  1.00 0.00 ? 93  PHE A CE2  3  
ATOM 5361  C CZ   . PHE A 1 93  ? 14.685  -1.920  -2.715  1.00 0.00 ? 93  PHE A CZ   3  
ATOM 5362  H H    . PHE A 1 93  ? 7.990   -3.195  -1.493  1.00 0.00 ? 93  PHE A H    3  
ATOM 5363  H HA   . PHE A 1 93  ? 10.372  -4.670  -2.338  1.00 0.00 ? 93  PHE A HA   3  
ATOM 5364  H HB2  . PHE A 1 93  ? 10.201  -2.841  -3.915  1.00 0.00 ? 93  PHE A HB2  3  
ATOM 5365  H HB3  . PHE A 1 93  ? 9.960   -1.684  -2.613  1.00 0.00 ? 93  PHE A HB3  3  
ATOM 5366  H HD1  . PHE A 1 93  ? 12.419  -3.919  -4.217  1.00 0.00 ? 93  PHE A HD1  3  
ATOM 5367  H HD2  . PHE A 1 93  ? 11.796  -0.749  -1.440  1.00 0.00 ? 93  PHE A HD2  3  
ATOM 5368  H HE1  . PHE A 1 93  ? 14.848  -3.528  -4.114  1.00 0.00 ? 93  PHE A HE1  3  
ATOM 5369  H HE2  . PHE A 1 93  ? 14.223  -0.359  -1.323  1.00 0.00 ? 93  PHE A HE2  3  
ATOM 5370  H HZ   . PHE A 1 93  ? 15.750  -1.749  -2.669  1.00 0.00 ? 93  PHE A HZ   3  
ATOM 5371  N N    . THR A 1 94  ? 11.445  -4.214  -0.137  1.00 0.00 ? 94  THR A N    3  
ATOM 5372  C CA   . THR A 1 94  ? 12.027  -4.006  1.174   1.00 0.00 ? 94  THR A CA   3  
ATOM 5373  C C    . THR A 1 94  ? 13.344  -3.259  1.029   1.00 0.00 ? 94  THR A C    3  
ATOM 5374  O O    . THR A 1 94  ? 14.323  -3.815  0.526   1.00 0.00 ? 94  THR A O    3  
ATOM 5375  C CB   . THR A 1 94  ? 12.263  -5.347  1.883   1.00 0.00 ? 94  THR A CB   3  
ATOM 5376  O OG1  . THR A 1 94  ? 13.026  -6.208  1.031   1.00 0.00 ? 94  THR A OG1  3  
ATOM 5377  C CG2  . THR A 1 94  ? 10.942  -6.009  2.246   1.00 0.00 ? 94  THR A CG2  3  
ATOM 5378  H H    . THR A 1 94  ? 11.820  -4.902  -0.719  1.00 0.00 ? 94  THR A H    3  
ATOM 5379  H HA   . THR A 1 94  ? 11.341  -3.415  1.762   1.00 0.00 ? 94  THR A HA   3  
ATOM 5380  H HB   . THR A 1 94  ? 12.816  -5.162  2.790   1.00 0.00 ? 94  THR A HB   3  
ATOM 5381  H HG1  . THR A 1 94  ? 13.850  -5.764  0.791   1.00 0.00 ? 94  THR A HG1  3  
ATOM 5382  H HG21 . THR A 1 94  ? 11.135  -6.956  2.731   1.00 0.00 ? 94  THR A HG21 3  
ATOM 5383  H HG22 . THR A 1 94  ? 10.363  -6.177  1.350   1.00 0.00 ? 94  THR A HG22 3  
ATOM 5384  H HG23 . THR A 1 94  ? 10.390  -5.369  2.916   1.00 0.00 ? 94  THR A HG23 3  
ATOM 5385  N N    . PHE A 1 95  ? 13.369  -1.997  1.442   1.00 0.00 ? 95  PHE A N    3  
ATOM 5386  C CA   . PHE A 1 95  ? 14.537  -1.163  1.214   1.00 0.00 ? 95  PHE A CA   3  
ATOM 5387  C C    . PHE A 1 95  ? 15.674  -1.564  2.136   1.00 0.00 ? 95  PHE A C    3  
ATOM 5388  O O    . PHE A 1 95  ? 15.648  -1.280  3.333   1.00 0.00 ? 95  PHE A O    3  
ATOM 5389  C CB   . PHE A 1 95  ? 14.210  0.321   1.400   1.00 0.00 ? 95  PHE A CB   3  
ATOM 5390  C CG   . PHE A 1 95  ? 15.166  1.233   0.676   1.00 0.00 ? 95  PHE A CG   3  
ATOM 5391  C CD1  . PHE A 1 95  ? 16.486  1.349   1.081   1.00 0.00 ? 95  PHE A CD1  3  
ATOM 5392  C CD2  . PHE A 1 95  ? 14.743  1.962   -0.419  1.00 0.00 ? 95  PHE A CD2  3  
ATOM 5393  C CE1  . PHE A 1 95  ? 17.363  2.176   0.406   1.00 0.00 ? 95  PHE A CE1  3  
ATOM 5394  C CE2  . PHE A 1 95  ? 15.611  2.792   -1.096  1.00 0.00 ? 95  PHE A CE2  3  
ATOM 5395  C CZ   . PHE A 1 95  ? 16.924  2.899   -0.685  1.00 0.00 ? 95  PHE A CZ   3  
ATOM 5396  H H    . PHE A 1 95  ? 12.593  -1.626  1.919   1.00 0.00 ? 95  PHE A H    3  
ATOM 5397  H HA   . PHE A 1 95  ? 14.854  -1.323  0.193   1.00 0.00 ? 95  PHE A HA   3  
ATOM 5398  H HB2  . PHE A 1 95  ? 13.214  0.517   1.028   1.00 0.00 ? 95  PHE A HB2  3  
ATOM 5399  H HB3  . PHE A 1 95  ? 14.251  0.564   2.453   1.00 0.00 ? 95  PHE A HB3  3  
ATOM 5400  H HD1  . PHE A 1 95  ? 16.830  0.784   1.934   1.00 0.00 ? 95  PHE A HD1  3  
ATOM 5401  H HD2  . PHE A 1 95  ? 13.717  1.879   -0.742  1.00 0.00 ? 95  PHE A HD2  3  
ATOM 5402  H HE1  . PHE A 1 95  ? 18.390  2.258   0.732   1.00 0.00 ? 95  PHE A HE1  3  
ATOM 5403  H HE2  . PHE A 1 95  ? 15.263  3.357   -1.948  1.00 0.00 ? 95  PHE A HE2  3  
ATOM 5404  H HZ   . PHE A 1 95  ? 17.607  3.546   -1.216  1.00 0.00 ? 95  PHE A HZ   3  
ATOM 5405  N N    . GLN A 1 96  ? 16.660  -2.240  1.574   1.00 0.00 ? 96  GLN A N    3  
ATOM 5406  C CA   . GLN A 1 96  ? 17.855  -2.593  2.313   1.00 0.00 ? 96  GLN A CA   3  
ATOM 5407  C C    . GLN A 1 96  ? 18.909  -1.520  2.147   1.00 0.00 ? 96  GLN A C    3  
ATOM 5408  O O    . GLN A 1 96  ? 19.192  -1.093  1.028   1.00 0.00 ? 96  GLN A O    3  
ATOM 5409  C CB   . GLN A 1 96  ? 18.430  -3.922  1.830   1.00 0.00 ? 96  GLN A CB   3  
ATOM 5410  C CG   . GLN A 1 96  ? 17.522  -5.109  2.063   1.00 0.00 ? 96  GLN A CG   3  
ATOM 5411  C CD   . GLN A 1 96  ? 18.153  -6.410  1.614   1.00 0.00 ? 96  GLN A CD   3  
ATOM 5412  O OE1  . GLN A 1 96  ? 18.018  -6.812  0.458   1.00 0.00 ? 96  GLN A OE1  3  
ATOM 5413  N NE2  . GLN A 1 96  ? 18.849  -7.074  2.524   1.00 0.00 ? 96  GLN A NE2  3  
ATOM 5414  H H    . GLN A 1 96  ? 16.581  -2.509  0.636   1.00 0.00 ? 96  GLN A H    3  
ATOM 5415  H HA   . GLN A 1 96  ? 17.594  -2.677  3.358   1.00 0.00 ? 96  GLN A HA   3  
ATOM 5416  H HB2  . GLN A 1 96  ? 18.620  -3.850  0.769   1.00 0.00 ? 96  GLN A HB2  3  
ATOM 5417  H HB3  . GLN A 1 96  ? 19.364  -4.103  2.342   1.00 0.00 ? 96  GLN A HB3  3  
ATOM 5418  H HG2  . GLN A 1 96  ? 17.306  -5.177  3.120   1.00 0.00 ? 96  GLN A HG2  3  
ATOM 5419  H HG3  . GLN A 1 96  ? 16.604  -4.959  1.517   1.00 0.00 ? 96  GLN A HG3  3  
ATOM 5420  H HE21 . GLN A 1 96  ? 18.919  -6.692  3.428   1.00 0.00 ? 96  GLN A HE21 3  
ATOM 5421  H HE22 . GLN A 1 96  ? 19.268  -7.919  2.262   1.00 0.00 ? 96  GLN A HE22 3  
ATOM 5422  N N    . ASN A 1 97  ? 19.470  -1.078  3.256   1.00 0.00 ? 97  ASN A N    3  
ATOM 5423  C CA   . ASN A 1 97  ? 20.621  -0.192  3.221   1.00 0.00 ? 97  ASN A CA   3  
ATOM 5424  C C    . ASN A 1 97  ? 21.783  -0.952  2.591   1.00 0.00 ? 97  ASN A C    3  
ATOM 5425  O O    . ASN A 1 97  ? 22.224  -1.962  3.132   1.00 0.00 ? 97  ASN A O    3  
ATOM 5426  C CB   . ASN A 1 97  ? 20.977  0.269   4.640   1.00 0.00 ? 97  ASN A CB   3  
ATOM 5427  C CG   . ASN A 1 97  ? 22.146  1.244   4.699   1.00 0.00 ? 97  ASN A CG   3  
ATOM 5428  O OD1  . ASN A 1 97  ? 23.073  1.196   3.890   1.00 0.00 ? 97  ASN A OD1  3  
ATOM 5429  N ND2  . ASN A 1 97  ? 22.106  2.137   5.672   1.00 0.00 ? 97  ASN A ND2  3  
ATOM 5430  H H    . ASN A 1 97  ? 19.100  -1.359  4.125   1.00 0.00 ? 97  ASN A H    3  
ATOM 5431  H HA   . ASN A 1 97  ? 20.376  0.663   2.609   1.00 0.00 ? 97  ASN A HA   3  
ATOM 5432  H HB2  . ASN A 1 97  ? 20.116  0.751   5.078   1.00 0.00 ? 97  ASN A HB2  3  
ATOM 5433  H HB3  . ASN A 1 97  ? 21.230  -0.598  5.234   1.00 0.00 ? 97  ASN A HB3  3  
ATOM 5434  H HD21 . ASN A 1 97  ? 21.339  2.120   6.284   1.00 0.00 ? 97  ASN A HD21 3  
ATOM 5435  H HD22 . ASN A 1 97  ? 22.848  2.777   5.751   1.00 0.00 ? 97  ASN A HD22 3  
ATOM 5436  N N    . PRO A 1 98  ? 22.290  -0.484  1.439   1.00 0.00 ? 98  PRO A N    3  
ATOM 5437  C CA   . PRO A 1 98  ? 23.323  -1.195  0.669   1.00 0.00 ? 98  PRO A CA   3  
ATOM 5438  C C    . PRO A 1 98  ? 24.615  -1.419  1.456   1.00 0.00 ? 98  PRO A C    3  
ATOM 5439  O O    . PRO A 1 98  ? 25.468  -2.211  1.057   1.00 0.00 ? 98  PRO A O    3  
ATOM 5440  C CB   . PRO A 1 98  ? 23.587  -0.272  -0.528  1.00 0.00 ? 98  PRO A CB   3  
ATOM 5441  C CG   . PRO A 1 98  ? 23.052  1.059   -0.125  1.00 0.00 ? 98  PRO A CG   3  
ATOM 5442  C CD   . PRO A 1 98  ? 21.898  0.777   0.791   1.00 0.00 ? 98  PRO A CD   3  
ATOM 5443  H HA   . PRO A 1 98  ? 22.956  -2.147  0.312   1.00 0.00 ? 98  PRO A HA   3  
ATOM 5444  H HB2  . PRO A 1 98  ? 24.648  -0.226  -0.722  1.00 0.00 ? 98  PRO A HB2  3  
ATOM 5445  H HB3  . PRO A 1 98  ? 23.075  -0.651  -1.400  1.00 0.00 ? 98  PRO A HB3  3  
ATOM 5446  H HG2  . PRO A 1 98  ? 23.818  1.619   0.394   1.00 0.00 ? 98  PRO A HG2  3  
ATOM 5447  H HG3  . PRO A 1 98  ? 22.716  1.601   -0.996  1.00 0.00 ? 98  PRO A HG3  3  
ATOM 5448  H HD2  . PRO A 1 98  ? 21.789  1.568   1.518   1.00 0.00 ? 98  PRO A HD2  3  
ATOM 5449  H HD3  . PRO A 1 98  ? 20.989  0.653   0.225   1.00 0.00 ? 98  PRO A HD3  3  
ATOM 5450  N N    . TYR A 1 99  ? 24.752  -0.729  2.576   1.00 0.00 ? 99  TYR A N    3  
ATOM 5451  C CA   . TYR A 1 99  ? 25.968  -0.805  3.368   1.00 0.00 ? 99  TYR A CA   3  
ATOM 5452  C C    . TYR A 1 99  ? 25.699  -1.415  4.745   1.00 0.00 ? 99  TYR A C    3  
ATOM 5453  O O    . TYR A 1 99  ? 26.573  -1.406  5.612   1.00 0.00 ? 99  TYR A O    3  
ATOM 5454  C CB   . TYR A 1 99  ? 26.580  0.592   3.507   1.00 0.00 ? 99  TYR A CB   3  
ATOM 5455  C CG   . TYR A 1 99  ? 26.890  1.241   2.176   1.00 0.00 ? 99  TYR A CG   3  
ATOM 5456  C CD1  . TYR A 1 99  ? 28.094  0.999   1.528   1.00 0.00 ? 99  TYR A CD1  3  
ATOM 5457  C CD2  . TYR A 1 99  ? 25.977  2.093   1.564   1.00 0.00 ? 99  TYR A CD2  3  
ATOM 5458  C CE1  . TYR A 1 99  ? 28.378  1.583   0.309   1.00 0.00 ? 99  TYR A CE1  3  
ATOM 5459  C CE2  . TYR A 1 99  ? 26.254  2.680   0.346   1.00 0.00 ? 99  TYR A CE2  3  
ATOM 5460  C CZ   . TYR A 1 99  ? 27.456  2.423   -0.279  1.00 0.00 ? 99  TYR A CZ   3  
ATOM 5461  O OH   . TYR A 1 99  ? 27.740  3.007   -1.494  1.00 0.00 ? 99  TYR A OH   3  
ATOM 5462  H H    . TYR A 1 99  ? 24.014  -0.150  2.875   1.00 0.00 ? 99  TYR A H    3  
ATOM 5463  H HA   . TYR A 1 99  ? 26.664  -1.440  2.840   1.00 0.00 ? 99  TYR A HA   3  
ATOM 5464  H HB2  . TYR A 1 99  ? 25.887  1.231   4.035   1.00 0.00 ? 99  TYR A HB2  3  
ATOM 5465  H HB3  . TYR A 1 99  ? 27.500  0.522   4.068   1.00 0.00 ? 99  TYR A HB3  3  
ATOM 5466  H HD1  . TYR A 1 99  ? 28.814  0.341   1.990   1.00 0.00 ? 99  TYR A HD1  3  
ATOM 5467  H HD2  . TYR A 1 99  ? 25.036  2.290   2.055   1.00 0.00 ? 99  TYR A HD2  3  
ATOM 5468  H HE1  . TYR A 1 99  ? 29.318  1.380   -0.179  1.00 0.00 ? 99  TYR A HE1  3  
ATOM 5469  H HE2  . TYR A 1 99  ? 25.528  3.336   -0.113  1.00 0.00 ? 99  TYR A HE2  3  
ATOM 5470  H HH   . TYR A 1 99  ? 27.550  3.951   -1.445  1.00 0.00 ? 99  TYR A HH   3  
ATOM 5471  N N    . SER A 1 100 ? 24.498  -1.955  4.937   1.00 0.00 ? 100 SER A N    3  
ATOM 5472  C CA   . SER A 1 100 ? 24.127  -2.537  6.226   1.00 0.00 ? 100 SER A CA   3  
ATOM 5473  C C    . SER A 1 100 ? 23.216  -3.760  6.052   1.00 0.00 ? 100 SER A C    3  
ATOM 5474  O O    . SER A 1 100 ? 23.038  -4.544  6.986   1.00 0.00 ? 100 SER A O    3  
ATOM 5475  C CB   . SER A 1 100 ? 23.440  -1.476  7.099   1.00 0.00 ? 100 SER A CB   3  
ATOM 5476  O OG   . SER A 1 100 ? 23.189  -1.957  8.409   1.00 0.00 ? 100 SER A OG   3  
ATOM 5477  H H    . SER A 1 100 ? 23.854  -1.968  4.197   1.00 0.00 ? 100 SER A H    3  
ATOM 5478  H HA   . SER A 1 100 ? 25.036  -2.852  6.715   1.00 0.00 ? 100 SER A HA   3  
ATOM 5479  H HB2  . SER A 1 100 ? 24.075  -0.604  7.166   1.00 0.00 ? 100 SER A HB2  3  
ATOM 5480  H HB3  . SER A 1 100 ? 22.498  -1.198  6.646   1.00 0.00 ? 100 SER A HB3  3  
ATOM 5481  H HG   . SER A 1 100 ? 22.567  -1.352  8.860   1.00 0.00 ? 100 SER A HG   3  
ATOM 5482  N N    . ASP A 1 101 ? 22.638  -3.903  4.857   1.00 0.00 ? 101 ASP A N    3  
ATOM 5483  C CA   . ASP A 1 101 ? 21.762  -5.034  4.508   1.00 0.00 ? 101 ASP A CA   3  
ATOM 5484  C C    . ASP A 1 101 ? 20.447  -5.023  5.287   1.00 0.00 ? 101 ASP A C    3  
ATOM 5485  O O    . ASP A 1 101 ? 19.601  -5.899  5.095   1.00 0.00 ? 101 ASP A O    3  
ATOM 5486  C CB   . ASP A 1 101 ? 22.474  -6.376  4.713   1.00 0.00 ? 101 ASP A CB   3  
ATOM 5487  C CG   . ASP A 1 101 ? 22.790  -7.075  3.404   1.00 0.00 ? 101 ASP A CG   3  
ATOM 5488  O OD1  . ASP A 1 101 ? 23.848  -6.776  2.805   1.00 0.00 ? 101 ASP A OD1  3  
ATOM 5489  O OD2  . ASP A 1 101 ? 21.997  -7.942  2.977   1.00 0.00 ? 101 ASP A OD2  3  
ATOM 5490  H H    . ASP A 1 101 ? 22.809  -3.225  4.169   1.00 0.00 ? 101 ASP A H    3  
ATOM 5491  H HA   . ASP A 1 101 ? 21.527  -4.935  3.460   1.00 0.00 ? 101 ASP A HA   3  
ATOM 5492  H HB2  . ASP A 1 101 ? 23.398  -6.209  5.242   1.00 0.00 ? 101 ASP A HB2  3  
ATOM 5493  H HB3  . ASP A 1 101 ? 21.839  -7.023  5.301   1.00 0.00 ? 101 ASP A HB3  3  
ATOM 5494  N N    . GLU A 1 102 ? 20.267  -4.032  6.148   1.00 0.00 ? 102 GLU A N    3  
ATOM 5495  C CA   . GLU A 1 102 ? 19.075  -3.941  6.983   1.00 0.00 ? 102 GLU A CA   3  
ATOM 5496  C C    . GLU A 1 102 ? 17.922  -3.297  6.220   1.00 0.00 ? 102 GLU A C    3  
ATOM 5497  O O    . GLU A 1 102 ? 18.138  -2.546  5.268   1.00 0.00 ? 102 GLU A O    3  
ATOM 5498  C CB   . GLU A 1 102 ? 19.380  -3.123  8.238   1.00 0.00 ? 102 GLU A CB   3  
ATOM 5499  C CG   . GLU A 1 102 ? 19.764  -1.682  7.943   1.00 0.00 ? 102 GLU A CG   3  
ATOM 5500  C CD   . GLU A 1 102 ? 20.034  -0.886  9.198   1.00 0.00 ? 102 GLU A CD   3  
ATOM 5501  O OE1  . GLU A 1 102 ? 19.068  -0.534  9.905   1.00 0.00 ? 102 GLU A OE1  3  
ATOM 5502  O OE2  . GLU A 1 102 ? 21.213  -0.613  9.488   1.00 0.00 ? 102 GLU A OE2  3  
ATOM 5503  H H    . GLU A 1 102 ? 20.952  -3.341  6.233   1.00 0.00 ? 102 GLU A H    3  
ATOM 5504  H HA   . GLU A 1 102 ? 18.792  -4.941  7.274   1.00 0.00 ? 102 GLU A HA   3  
ATOM 5505  H HB2  . GLU A 1 102 ? 18.505  -3.117  8.872   1.00 0.00 ? 102 GLU A HB2  3  
ATOM 5506  H HB3  . GLU A 1 102 ? 20.196  -3.589  8.771   1.00 0.00 ? 102 GLU A HB3  3  
ATOM 5507  H HG2  . GLU A 1 102 ? 20.656  -1.677  7.335   1.00 0.00 ? 102 GLU A HG2  3  
ATOM 5508  H HG3  . GLU A 1 102 ? 18.958  -1.210  7.400   1.00 0.00 ? 102 GLU A HG3  3  
ATOM 5509  N N    . ILE A 1 103 ? 16.703  -3.590  6.652   1.00 0.00 ? 103 ILE A N    3  
ATOM 5510  C CA   . ILE A 1 103 ? 15.512  -3.024  6.036   1.00 0.00 ? 103 ILE A CA   3  
ATOM 5511  C C    . ILE A 1 103 ? 15.168  -1.702  6.704   1.00 0.00 ? 103 ILE A C    3  
ATOM 5512  O O    . ILE A 1 103 ? 14.809  -1.675  7.884   1.00 0.00 ? 103 ILE A O    3  
ATOM 5513  C CB   . ILE A 1 103 ? 14.296  -3.964  6.178   1.00 0.00 ? 103 ILE A CB   3  
ATOM 5514  C CG1  . ILE A 1 103 ? 14.644  -5.373  5.701   1.00 0.00 ? 103 ILE A CG1  3  
ATOM 5515  C CG2  . ILE A 1 103 ? 13.103  -3.418  5.407   1.00 0.00 ? 103 ILE A CG2  3  
ATOM 5516  C CD1  . ILE A 1 103 ? 15.015  -5.453  4.239   1.00 0.00 ? 103 ILE A CD1  3  
ATOM 5517  H H    . ILE A 1 103 ? 16.598  -4.194  7.424   1.00 0.00 ? 103 ILE A H    3  
ATOM 5518  H HA   . ILE A 1 103 ? 15.710  -2.861  4.984   1.00 0.00 ? 103 ILE A HA   3  
ATOM 5519  H HB   . ILE A 1 103 ? 14.024  -4.005  7.222   1.00 0.00 ? 103 ILE A HB   3  
ATOM 5520  H HG12 . ILE A 1 103 ? 15.484  -5.724  6.269   1.00 0.00 ? 103 ILE A HG12 3  
ATOM 5521  H HG13 . ILE A 1 103 ? 13.800  -6.024  5.869   1.00 0.00 ? 103 ILE A HG13 3  
ATOM 5522  H HG21 . ILE A 1 103 ? 12.835  -2.447  5.798   1.00 0.00 ? 103 ILE A HG21 3  
ATOM 5523  H HG22 . ILE A 1 103 ? 12.266  -4.091  5.512   1.00 0.00 ? 103 ILE A HG22 3  
ATOM 5524  H HG23 . ILE A 1 103 ? 13.360  -3.327  4.361   1.00 0.00 ? 103 ILE A HG23 3  
ATOM 5525  H HD11 . ILE A 1 103 ? 15.132  -6.488  3.955   1.00 0.00 ? 103 ILE A HD11 3  
ATOM 5526  H HD12 . ILE A 1 103 ? 15.946  -4.929  4.076   1.00 0.00 ? 103 ILE A HD12 3  
ATOM 5527  H HD13 . ILE A 1 103 ? 14.239  -5.001  3.644   1.00 0.00 ? 103 ILE A HD13 3  
ATOM 5528  N N    . GLU A 1 104 ? 15.288  -0.609  5.959   1.00 0.00 ? 104 GLU A N    3  
ATOM 5529  C CA   . GLU A 1 104 ? 14.908  0.699   6.474   1.00 0.00 ? 104 GLU A CA   3  
ATOM 5530  C C    . GLU A 1 104 ? 13.402  0.730   6.683   1.00 0.00 ? 104 GLU A C    3  
ATOM 5531  O O    . GLU A 1 104 ? 12.901  1.217   7.696   1.00 0.00 ? 104 GLU A O    3  
ATOM 5532  C CB   . GLU A 1 104 ? 15.299  1.816   5.504   1.00 0.00 ? 104 GLU A CB   3  
ATOM 5533  C CG   . GLU A 1 104 ? 16.707  1.708   4.968   1.00 0.00 ? 104 GLU A CG   3  
ATOM 5534  C CD   . GLU A 1 104 ? 17.189  2.997   4.325   1.00 0.00 ? 104 GLU A CD   3  
ATOM 5535  O OE1  . GLU A 1 104 ? 16.445  3.580   3.507   1.00 0.00 ? 104 GLU A OE1  3  
ATOM 5536  O OE2  . GLU A 1 104 ? 18.319  3.436   4.627   1.00 0.00 ? 104 GLU A OE2  3  
ATOM 5537  H H    . GLU A 1 104 ? 15.640  -0.686  5.041   1.00 0.00 ? 104 GLU A H    3  
ATOM 5538  H HA   . GLU A 1 104 ? 15.409  0.851   7.412   1.00 0.00 ? 104 GLU A HA   3  
ATOM 5539  H HB2  . GLU A 1 104 ? 14.628  1.794   4.667   1.00 0.00 ? 104 GLU A HB2  3  
ATOM 5540  H HB3  . GLU A 1 104 ? 15.201  2.765   6.008   1.00 0.00 ? 104 GLU A HB3  3  
ATOM 5541  H HG2  . GLU A 1 104 ? 17.361  1.457   5.780   1.00 0.00 ? 104 GLU A HG2  3  
ATOM 5542  H HG3  . GLU A 1 104 ? 16.726  0.920   4.228   1.00 0.00 ? 104 GLU A HG3  3  
ATOM 5543  N N    . TYR A 1 105 ? 12.699  0.190   5.694   1.00 0.00 ? 105 TYR A N    3  
ATOM 5544  C CA   . TYR A 1 105 ? 11.242  0.141   5.683   1.00 0.00 ? 105 TYR A CA   3  
ATOM 5545  C C    . TYR A 1 105 ? 10.767  -0.588  4.434   1.00 0.00 ? 105 TYR A C    3  
ATOM 5546  O O    . TYR A 1 105 ? 11.577  -0.991  3.596   1.00 0.00 ? 105 TYR A O    3  
ATOM 5547  C CB   . TYR A 1 105 ? 10.643  1.559   5.721   1.00 0.00 ? 105 TYR A CB   3  
ATOM 5548  C CG   . TYR A 1 105 ? 11.293  2.545   4.768   1.00 0.00 ? 105 TYR A CG   3  
ATOM 5549  C CD1  . TYR A 1 105 ? 11.162  2.415   3.389   1.00 0.00 ? 105 TYR A CD1  3  
ATOM 5550  C CD2  . TYR A 1 105 ? 12.038  3.609   5.255   1.00 0.00 ? 105 TYR A CD2  3  
ATOM 5551  C CE1  . TYR A 1 105 ? 11.762  3.316   2.530   1.00 0.00 ? 105 TYR A CE1  3  
ATOM 5552  C CE2  . TYR A 1 105 ? 12.640  4.512   4.402   1.00 0.00 ? 105 TYR A CE2  3  
ATOM 5553  C CZ   . TYR A 1 105 ? 12.497  4.362   3.040   1.00 0.00 ? 105 TYR A CZ   3  
ATOM 5554  O OH   . TYR A 1 105 ? 13.100  5.260   2.186   1.00 0.00 ? 105 TYR A OH   3  
ATOM 5555  H H    . TYR A 1 105 ? 13.188  -0.174  4.925   1.00 0.00 ? 105 TYR A H    3  
ATOM 5556  H HA   . TYR A 1 105 ? 10.916  -0.407  6.558   1.00 0.00 ? 105 TYR A HA   3  
ATOM 5557  H HB2  . TYR A 1 105 ? 9.595   1.502   5.471   1.00 0.00 ? 105 TYR A HB2  3  
ATOM 5558  H HB3  . TYR A 1 105 ? 10.745  1.951   6.723   1.00 0.00 ? 105 TYR A HB3  3  
ATOM 5559  H HD1  . TYR A 1 105 ? 10.585  1.594   2.990   1.00 0.00 ? 105 TYR A HD1  3  
ATOM 5560  H HD2  . TYR A 1 105 ? 12.150  3.725   6.324   1.00 0.00 ? 105 TYR A HD2  3  
ATOM 5561  H HE1  . TYR A 1 105 ? 11.652  3.198   1.459   1.00 0.00 ? 105 TYR A HE1  3  
ATOM 5562  H HE2  . TYR A 1 105 ? 13.216  5.332   4.803   1.00 0.00 ? 105 TYR A HE2  3  
ATOM 5563  H HH   . TYR A 1 105 ? 13.998  5.439   2.496   1.00 0.00 ? 105 TYR A HH   3  
ATOM 5564  N N    . ILE A 1 106 ? 9.461   -0.752  4.310   1.00 0.00 ? 106 ILE A N    3  
ATOM 5565  C CA   . ILE A 1 106 ? 8.886   -1.370  3.131   1.00 0.00 ? 106 ILE A CA   3  
ATOM 5566  C C    . ILE A 1 106 ? 8.320   -0.292  2.215   1.00 0.00 ? 106 ILE A C    3  
ATOM 5567  O O    . ILE A 1 106 ? 7.761   0.700   2.687   1.00 0.00 ? 106 ILE A O    3  
ATOM 5568  C CB   . ILE A 1 106 ? 7.761   -2.367  3.496   1.00 0.00 ? 106 ILE A CB   3  
ATOM 5569  C CG1  . ILE A 1 106 ? 8.265   -3.411  4.492   1.00 0.00 ? 106 ILE A CG1  3  
ATOM 5570  C CG2  . ILE A 1 106 ? 7.219   -3.049  2.246   1.00 0.00 ? 106 ILE A CG2  3  
ATOM 5571  C CD1  . ILE A 1 106 ? 7.192   -4.378  4.942   1.00 0.00 ? 106 ILE A CD1  3  
ATOM 5572  H H    . ILE A 1 106 ? 8.864   -0.433  5.026   1.00 0.00 ? 106 ILE A H    3  
ATOM 5573  H HA   . ILE A 1 106 ? 9.668   -1.904  2.611   1.00 0.00 ? 106 ILE A HA   3  
ATOM 5574  H HB   . ILE A 1 106 ? 6.954   -1.810  3.949   1.00 0.00 ? 106 ILE A HB   3  
ATOM 5575  H HG12 . ILE A 1 106 ? 9.057   -3.986  4.033   1.00 0.00 ? 106 ILE A HG12 3  
ATOM 5576  H HG13 . ILE A 1 106 ? 8.650   -2.908  5.368   1.00 0.00 ? 106 ILE A HG13 3  
ATOM 5577  H HG21 . ILE A 1 106 ? 8.011   -3.597  1.761   1.00 0.00 ? 106 ILE A HG21 3  
ATOM 5578  H HG22 . ILE A 1 106 ? 6.831   -2.302  1.568   1.00 0.00 ? 106 ILE A HG22 3  
ATOM 5579  H HG23 . ILE A 1 106 ? 6.427   -3.729  2.522   1.00 0.00 ? 106 ILE A HG23 3  
ATOM 5580  H HD11 . ILE A 1 106 ? 7.605   -5.072  5.658   1.00 0.00 ? 106 ILE A HD11 3  
ATOM 5581  H HD12 . ILE A 1 106 ? 6.816   -4.922  4.088   1.00 0.00 ? 106 ILE A HD12 3  
ATOM 5582  H HD13 . ILE A 1 106 ? 6.381   -3.827  5.401   1.00 0.00 ? 106 ILE A HD13 3  
ATOM 5583  N N    . ILE A 1 107 ? 8.443   -0.501  0.917   1.00 0.00 ? 107 ILE A N    3  
ATOM 5584  C CA   . ILE A 1 107 ? 7.964   0.441   -0.067  1.00 0.00 ? 107 ILE A CA   3  
ATOM 5585  C C    . ILE A 1 107 ? 6.925   -0.244  -0.934  1.00 0.00 ? 107 ILE A C    3  
ATOM 5586  O O    . ILE A 1 107 ? 7.233   -1.182  -1.669  1.00 0.00 ? 107 ILE A O    3  
ATOM 5587  C CB   . ILE A 1 107 ? 9.106   0.967   -0.961  1.00 0.00 ? 107 ILE A CB   3  
ATOM 5588  C CG1  . ILE A 1 107 ? 10.112  1.762   -0.130  1.00 0.00 ? 107 ILE A CG1  3  
ATOM 5589  C CG2  . ILE A 1 107 ? 8.551   1.823   -2.093  1.00 0.00 ? 107 ILE A CG2  3  
ATOM 5590  C CD1  . ILE A 1 107 ? 11.259  2.323   -0.941  1.00 0.00 ? 107 ILE A CD1  3  
ATOM 5591  H H    . ILE A 1 107 ? 8.803   -1.356  0.594   1.00 0.00 ? 107 ILE A H    3  
ATOM 5592  H HA   . ILE A 1 107 ? 7.510   1.276   0.449   1.00 0.00 ? 107 ILE A HA   3  
ATOM 5593  H HB   . ILE A 1 107 ? 9.608   0.118   -1.401  1.00 0.00 ? 107 ILE A HB   3  
ATOM 5594  H HG12 . ILE A 1 107 ? 9.604   2.592   0.341   1.00 0.00 ? 107 ILE A HG12 3  
ATOM 5595  H HG13 . ILE A 1 107 ? 10.526  1.120   0.634   1.00 0.00 ? 107 ILE A HG13 3  
ATOM 5596  H HG21 . ILE A 1 107 ? 8.013   2.663   -1.678  1.00 0.00 ? 107 ILE A HG21 3  
ATOM 5597  H HG22 . ILE A 1 107 ? 7.881   1.230   -2.698  1.00 0.00 ? 107 ILE A HG22 3  
ATOM 5598  H HG23 . ILE A 1 107 ? 9.365   2.183   -2.704  1.00 0.00 ? 107 ILE A HG23 3  
ATOM 5599  H HD11 . ILE A 1 107 ? 11.948  2.831   -0.283  1.00 0.00 ? 107 ILE A HD11 3  
ATOM 5600  H HD12 . ILE A 1 107 ? 10.874  3.020   -1.668  1.00 0.00 ? 107 ILE A HD12 3  
ATOM 5601  H HD13 . ILE A 1 107 ? 11.768  1.517   -1.446  1.00 0.00 ? 107 ILE A HD13 3  
ATOM 5602  N N    . CYS A 1 108 ? 5.695   0.200   -0.818  1.00 0.00 ? 108 CYS A N    3  
ATOM 5603  C CA   . CYS A 1 108 ? 4.610   -0.378  -1.576  1.00 0.00 ? 108 CYS A CA   3  
ATOM 5604  C C    . CYS A 1 108 ? 4.049   0.633   -2.564  1.00 0.00 ? 108 CYS A C    3  
ATOM 5605  O O    . CYS A 1 108 ? 3.476   1.654   -2.173  1.00 0.00 ? 108 CYS A O    3  
ATOM 5606  C CB   . CYS A 1 108 ? 3.516   -0.882  -0.635  1.00 0.00 ? 108 CYS A CB   3  
ATOM 5607  S SG   . CYS A 1 108 ? 4.013   -2.304  0.368   1.00 0.00 ? 108 CYS A SG   3  
ATOM 5608  H H    . CYS A 1 108 ? 5.510   0.952   -0.213  1.00 0.00 ? 108 CYS A H    3  
ATOM 5609  H HA   . CYS A 1 108 ? 5.007   -1.216  -2.130  1.00 0.00 ? 108 CYS A HA   3  
ATOM 5610  H HB2  . CYS A 1 108 ? 3.233   -0.088  0.040   1.00 0.00 ? 108 CYS A HB2  3  
ATOM 5611  H HB3  . CYS A 1 108 ? 2.657   -1.176  -1.218  1.00 0.00 ? 108 CYS A HB3  3  
ATOM 5612  H HG   . CYS A 1 108 ? 4.088   -3.360  -0.432  1.00 0.00 ? 108 CYS A HG   3  
ATOM 5613  N N    . THR A 1 109 ? 4.265   0.364   -3.837  1.00 0.00 ? 109 THR A N    3  
ATOM 5614  C CA   . THR A 1 109 ? 3.673   1.154   -4.893  1.00 0.00 ? 109 THR A CA   3  
ATOM 5615  C C    . THR A 1 109 ? 2.301   0.580   -5.217  1.00 0.00 ? 109 THR A C    3  
ATOM 5616  O O    . THR A 1 109 ? 2.161   -0.625  -5.405  1.00 0.00 ? 109 THR A O    3  
ATOM 5617  C CB   . THR A 1 109 ? 4.560   1.144   -6.152  1.00 0.00 ? 109 THR A CB   3  
ATOM 5618  O OG1  . THR A 1 109 ? 5.901   1.502   -5.799  1.00 0.00 ? 109 THR A OG1  3  
ATOM 5619  C CG2  . THR A 1 109 ? 4.039   2.115   -7.199  1.00 0.00 ? 109 THR A CG2  3  
ATOM 5620  H H    . THR A 1 109 ? 4.842   -0.394  -4.074  1.00 0.00 ? 109 THR A H    3  
ATOM 5621  H HA   . THR A 1 109 ? 3.566   2.170   -4.545  1.00 0.00 ? 109 THR A HA   3  
ATOM 5622  H HB   . THR A 1 109 ? 4.558   0.146   -6.571  1.00 0.00 ? 109 THR A HB   3  
ATOM 5623  H HG1  . THR A 1 109 ? 6.512   1.155   -6.466  1.00 0.00 ? 109 THR A HG1  3  
ATOM 5624  H HG21 . THR A 1 109 ? 4.015   3.111   -6.784  1.00 0.00 ? 109 THR A HG21 3  
ATOM 5625  H HG22 . THR A 1 109 ? 3.040   1.825   -7.495  1.00 0.00 ? 109 THR A HG22 3  
ATOM 5626  H HG23 . THR A 1 109 ? 4.691   2.099   -8.061  1.00 0.00 ? 109 THR A HG23 3  
ATOM 5627  N N    . ASN A 1 110 ? 1.298   1.432   -5.287  1.00 0.00 ? 110 ASN A N    3  
ATOM 5628  C CA   . ASN A 1 110 ? -0.075  0.964   -5.413  1.00 0.00 ? 110 ASN A CA   3  
ATOM 5629  C C    . ASN A 1 110 ? -0.684  1.450   -6.713  1.00 0.00 ? 110 ASN A C    3  
ATOM 5630  O O    . ASN A 1 110 ? -0.890  2.649   -6.898  1.00 0.00 ? 110 ASN A O    3  
ATOM 5631  C CB   . ASN A 1 110 ? -0.919  1.437   -4.226  1.00 0.00 ? 110 ASN A CB   3  
ATOM 5632  C CG   . ASN A 1 110 ? -0.407  0.922   -2.894  1.00 0.00 ? 110 ASN A CG   3  
ATOM 5633  O OD1  . ASN A 1 110 ? -0.764  -0.168  -2.454  1.00 0.00 ? 110 ASN A OD1  3  
ATOM 5634  N ND2  . ASN A 1 110 ? 0.432   1.712   -2.240  1.00 0.00 ? 110 ASN A ND2  3  
ATOM 5635  H H    . ASN A 1 110 ? 1.492   2.397   -5.324  1.00 0.00 ? 110 ASN A H    3  
ATOM 5636  H HA   . ASN A 1 110 ? -0.056  -0.117  -5.421  1.00 0.00 ? 110 ASN A HA   3  
ATOM 5637  H HB2  . ASN A 1 110 ? -0.912  2.515   -4.196  1.00 0.00 ? 110 ASN A HB2  3  
ATOM 5638  H HB3  . ASN A 1 110 ? -1.936  1.094   -4.354  1.00 0.00 ? 110 ASN A HB3  3  
ATOM 5639  H HD21 . ASN A 1 110 ? 0.672   2.571   -2.646  1.00 0.00 ? 110 ASN A HD21 3  
ATOM 5640  H HD22 . ASN A 1 110 ? 0.776   1.406   -1.374  1.00 0.00 ? 110 ASN A HD22 3  
ATOM 5641  N N    . THR A 1 111 ? -0.957  0.518   -7.611  1.00 0.00 ? 111 THR A N    3  
ATOM 5642  C CA   . THR A 1 111 ? -1.529  0.845   -8.905  1.00 0.00 ? 111 THR A CA   3  
ATOM 5643  C C    . THR A 1 111 ? -3.003  0.460   -8.949  1.00 0.00 ? 111 THR A C    3  
ATOM 5644  O O    . THR A 1 111 ? -3.350  -0.707  -8.764  1.00 0.00 ? 111 THR A O    3  
ATOM 5645  C CB   . THR A 1 111 ? -0.783  0.101   -10.032 1.00 0.00 ? 111 THR A CB   3  
ATOM 5646  O OG1  . THR A 1 111 ? 0.635   0.280   -9.888  1.00 0.00 ? 111 THR A OG1  3  
ATOM 5647  C CG2  . THR A 1 111 ? -1.228  0.598   -11.401 1.00 0.00 ? 111 THR A CG2  3  
ATOM 5648  H H    . THR A 1 111 ? -0.767  -0.422  -7.403  1.00 0.00 ? 111 THR A H    3  
ATOM 5649  H HA   . THR A 1 111 ? -1.429  1.907   -9.067  1.00 0.00 ? 111 THR A HA   3  
ATOM 5650  H HB   . THR A 1 111 ? -1.012  -0.952  -9.958  1.00 0.00 ? 111 THR A HB   3  
ATOM 5651  H HG1  . THR A 1 111 ? 0.882   1.181   -10.145 1.00 0.00 ? 111 THR A HG1  3  
ATOM 5652  H HG21 . THR A 1 111 ? -1.050  1.661   -11.475 1.00 0.00 ? 111 THR A HG21 3  
ATOM 5653  H HG22 . THR A 1 111 ? -2.281  0.400   -11.531 1.00 0.00 ? 111 THR A HG22 3  
ATOM 5654  H HG23 . THR A 1 111 ? -0.668  0.085   -12.169 1.00 0.00 ? 111 THR A HG23 3  
ATOM 5655  N N    . ASN A 1 112 ? -3.867  1.431   -9.202  1.00 0.00 ? 112 ASN A N    3  
ATOM 5656  C CA   . ASN A 1 112 ? -5.293  1.161   -9.290  1.00 0.00 ? 112 ASN A CA   3  
ATOM 5657  C C    . ASN A 1 112 ? -5.614  0.634   -10.675 1.00 0.00 ? 112 ASN A C    3  
ATOM 5658  O O    . ASN A 1 112 ? -5.320  1.283   -11.678 1.00 0.00 ? 112 ASN A O    3  
ATOM 5659  C CB   . ASN A 1 112 ? -6.108  2.427   -9.035  1.00 0.00 ? 112 ASN A CB   3  
ATOM 5660  C CG   . ASN A 1 112 ? -7.591  2.146   -8.849  1.00 0.00 ? 112 ASN A CG   3  
ATOM 5661  O OD1  . ASN A 1 112 ? -8.437  2.933   -9.268  1.00 0.00 ? 112 ASN A OD1  3  
ATOM 5662  N ND2  . ASN A 1 112 ? -7.921  1.033   -8.204  1.00 0.00 ? 112 ASN A ND2  3  
ATOM 5663  H H    . ASN A 1 112 ? -3.531  2.342   -9.378  1.00 0.00 ? 112 ASN A H    3  
ATOM 5664  H HA   . ASN A 1 112 ? -5.544  0.414   -8.554  1.00 0.00 ? 112 ASN A HA   3  
ATOM 5665  H HB2  . ASN A 1 112 ? -5.734  2.917   -8.149  1.00 0.00 ? 112 ASN A HB2  3  
ATOM 5666  H HB3  . ASN A 1 112 ? -5.992  3.084   -9.880  1.00 0.00 ? 112 ASN A HB3  3  
ATOM 5667  H HD21 . ASN A 1 112 ? -7.203  0.449   -7.882  1.00 0.00 ? 112 ASN A HD21 3  
ATOM 5668  H HD22 . ASN A 1 112 ? -8.873  0.851   -8.063  1.00 0.00 ? 112 ASN A HD22 3  
ATOM 5669  N N    . VAL A 1 113 ? -6.196  -0.549  -10.737 1.00 0.00 ? 113 VAL A N    3  
ATOM 5670  C CA   . VAL A 1 113 ? -6.494  -1.159  -12.017 1.00 0.00 ? 113 VAL A CA   3  
ATOM 5671  C C    . VAL A 1 113 ? -7.932  -0.857  -12.435 1.00 0.00 ? 113 VAL A C    3  
ATOM 5672  O O    . VAL A 1 113 ? -8.229  0.219   -12.942 1.00 0.00 ? 113 VAL A O    3  
ATOM 5673  C CB   . VAL A 1 113 ? -6.260  -2.690  -11.988 1.00 0.00 ? 113 VAL A CB   3  
ATOM 5674  C CG1  . VAL A 1 113 ? -6.359  -3.284  -13.388 1.00 0.00 ? 113 VAL A CG1  3  
ATOM 5675  C CG2  . VAL A 1 113 ? -4.912  -3.018  -11.359 1.00 0.00 ? 113 VAL A CG2  3  
ATOM 5676  H H    . VAL A 1 113 ? -6.429  -1.023  -9.909  1.00 0.00 ? 113 VAL A H    3  
ATOM 5677  H HA   . VAL A 1 113 ? -5.825  -0.730  -12.750 1.00 0.00 ? 113 VAL A HA   3  
ATOM 5678  H HB   . VAL A 1 113 ? -7.034  -3.137  -11.378 1.00 0.00 ? 113 VAL A HB   3  
ATOM 5679  H HG11 . VAL A 1 113 ? -5.616  -2.829  -14.025 1.00 0.00 ? 113 VAL A HG11 3  
ATOM 5680  H HG12 . VAL A 1 113 ? -7.343  -3.092  -13.789 1.00 0.00 ? 113 VAL A HG12 3  
ATOM 5681  H HG13 . VAL A 1 113 ? -6.190  -4.350  -13.340 1.00 0.00 ? 113 VAL A HG13 3  
ATOM 5682  H HG21 . VAL A 1 113 ? -4.122  -2.569  -11.942 1.00 0.00 ? 113 VAL A HG21 3  
ATOM 5683  H HG22 . VAL A 1 113 ? -4.777  -4.090  -11.336 1.00 0.00 ? 113 VAL A HG22 3  
ATOM 5684  H HG23 . VAL A 1 113 ? -4.880  -2.631  -10.350 1.00 0.00 ? 113 VAL A HG23 3  
ATOM 5685  N N    . LYS A 1 114 ? -8.822  -1.801  -12.184 1.00 0.00 ? 114 LYS A N    3  
ATOM 5686  C CA   . LYS A 1 114 ? -10.204 -1.706  -12.643 1.00 0.00 ? 114 LYS A CA   3  
ATOM 5687  C C    . LYS A 1 114 ? -11.138 -1.158  -11.559 1.00 0.00 ? 114 LYS A C    3  
ATOM 5688  O O    . LYS A 1 114 ? -12.341 -1.423  -11.582 1.00 0.00 ? 114 LYS A O    3  
ATOM 5689  C CB   . LYS A 1 114 ? -10.664 -3.097  -13.094 1.00 0.00 ? 114 LYS A CB   3  
ATOM 5690  C CG   . LYS A 1 114 ? -10.739 -4.119  -11.971 1.00 0.00 ? 114 LYS A CG   3  
ATOM 5691  C CD   . LYS A 1 114 ? -10.876 -5.542  -12.496 1.00 0.00 ? 114 LYS A CD   3  
ATOM 5692  C CE   . LYS A 1 114 ? -12.132 -5.749  -13.334 1.00 0.00 ? 114 LYS A CE   3  
ATOM 5693  N NZ   . LYS A 1 114 ? -11.936 -5.355  -14.756 1.00 0.00 ? 114 LYS A NZ   3  
ATOM 5694  H H    . LYS A 1 114 ? -8.531  -2.619  -11.733 1.00 0.00 ? 114 LYS A H    3  
ATOM 5695  H HA   . LYS A 1 114 ? -10.227 -1.039  -13.490 1.00 0.00 ? 114 LYS A HA   3  
ATOM 5696  H HB2  . LYS A 1 114 ? -11.644 -3.018  -13.538 1.00 0.00 ? 114 LYS A HB2  3  
ATOM 5697  H HB3  . LYS A 1 114 ? -9.973  -3.464  -13.838 1.00 0.00 ? 114 LYS A HB3  3  
ATOM 5698  H HG2  . LYS A 1 114 ? -9.840  -4.055  -11.378 1.00 0.00 ? 114 LYS A HG2  3  
ATOM 5699  H HG3  . LYS A 1 114 ? -11.595 -3.893  -11.351 1.00 0.00 ? 114 LYS A HG3  3  
ATOM 5700  H HD2  . LYS A 1 114 ? -10.020 -5.759  -13.112 1.00 0.00 ? 114 LYS A HD2  3  
ATOM 5701  H HD3  . LYS A 1 114 ? -10.898 -6.222  -11.657 1.00 0.00 ? 114 LYS A HD3  3  
ATOM 5702  H HE2  . LYS A 1 114 ? -12.406 -6.792  -13.295 1.00 0.00 ? 114 LYS A HE2  3  
ATOM 5703  H HE3  . LYS A 1 114 ? -12.929 -5.155  -12.914 1.00 0.00 ? 114 LYS A HE3  3  
ATOM 5704  H HZ1  . LYS A 1 114 ? -11.937 -4.314  -14.853 1.00 0.00 ? 114 LYS A HZ1  3  
ATOM 5705  H HZ2  . LYS A 1 114 ? -12.696 -5.746  -15.342 1.00 0.00 ? 114 LYS A HZ2  3  
ATOM 5706  H HZ3  . LYS A 1 114 ? -11.025 -5.722  -15.105 1.00 0.00 ? 114 LYS A HZ3  3  
ATOM 5707  N N    . ASN A 1 115 ? -10.585 -0.371  -10.636 1.00 0.00 ? 115 ASN A N    3  
ATOM 5708  C CA   . ASN A 1 115 ? -11.339 0.113   -9.473  1.00 0.00 ? 115 ASN A CA   3  
ATOM 5709  C C    . ASN A 1 115 ? -11.975 -1.074  -8.743  1.00 0.00 ? 115 ASN A C    3  
ATOM 5710  O O    . ASN A 1 115 ? -11.411 -2.165  -8.745  1.00 0.00 ? 115 ASN A O    3  
ATOM 5711  C CB   . ASN A 1 115 ? -12.412 1.137   -9.874  1.00 0.00 ? 115 ASN A CB   3  
ATOM 5712  C CG   . ASN A 1 115 ? -11.853 2.356   -10.580 1.00 0.00 ? 115 ASN A CG   3  
ATOM 5713  O OD1  . ASN A 1 115 ? -11.456 3.326   -9.938  1.00 0.00 ? 115 ASN A OD1  3  
ATOM 5714  N ND2  . ASN A 1 115 ? -11.843 2.331   -11.903 1.00 0.00 ? 115 ASN A ND2  3  
ATOM 5715  H H    . ASN A 1 115 ? -9.650  -0.101  -10.744 1.00 0.00 ? 115 ASN A H    3  
ATOM 5716  H HA   . ASN A 1 115 ? -10.633 0.587   -8.805  1.00 0.00 ? 115 ASN A HA   3  
ATOM 5717  H HB2  . ASN A 1 115 ? -13.128 0.665   -10.529 1.00 0.00 ? 115 ASN A HB2  3  
ATOM 5718  H HB3  . ASN A 1 115 ? -12.916 1.476   -8.981  1.00 0.00 ? 115 ASN A HB3  3  
ATOM 5719  H HD21 . ASN A 1 115 ? -12.192 1.534   -12.356 1.00 0.00 ? 115 ASN A HD21 3  
ATOM 5720  H HD22 . ASN A 1 115 ? -11.494 3.118   -12.379 1.00 0.00 ? 115 ASN A HD22 3  
ATOM 5721  N N    . SER A 1 116 ? -13.134 -0.881  -8.123  1.00 0.00 ? 116 SER A N    3  
ATOM 5722  C CA   . SER A 1 116 ? -13.766 -1.945  -7.359  1.00 0.00 ? 116 SER A CA   3  
ATOM 5723  C C    . SER A 1 116 ? -14.464 -2.941  -8.277  1.00 0.00 ? 116 SER A C    3  
ATOM 5724  O O    . SER A 1 116 ? -14.448 -4.149  -8.018  1.00 0.00 ? 116 SER A O    3  
ATOM 5725  C CB   . SER A 1 116 ? -14.762 -1.355  -6.354  1.00 0.00 ? 116 SER A CB   3  
ATOM 5726  O OG   . SER A 1 116 ? -15.666 -0.468  -6.989  1.00 0.00 ? 116 SER A OG   3  
ATOM 5727  H H    . SER A 1 116 ? -13.587 -0.019  -8.194  1.00 0.00 ? 116 SER A H    3  
ATOM 5728  H HA   . SER A 1 116 ? -12.989 -2.461  -6.814  1.00 0.00 ? 116 SER A HA   3  
ATOM 5729  H HB2  . SER A 1 116 ? -15.324 -2.155  -5.896  1.00 0.00 ? 116 SER A HB2  3  
ATOM 5730  H HB3  . SER A 1 116 ? -14.222 -0.814  -5.590  1.00 0.00 ? 116 SER A HB3  3  
ATOM 5731  H HG   . SER A 1 116 ? -15.673 0.384   -6.510  1.00 0.00 ? 116 SER A HG   3  
ATOM 5732  N N    . SER A 1 117 ? -15.068 -2.422  -9.352  1.00 0.00 ? 117 SER A N    3  
ATOM 5733  C CA   . SER A 1 117 ? -15.832 -3.233  -10.298 1.00 0.00 ? 117 SER A CA   3  
ATOM 5734  C C    . SER A 1 117 ? -16.964 -3.967  -9.585  1.00 0.00 ? 117 SER A C    3  
ATOM 5735  O O    . SER A 1 117 ? -17.330 -5.086  -9.947  1.00 0.00 ? 117 SER A O    3  
ATOM 5736  C CB   . SER A 1 117 ? -14.918 -4.222  -11.027 1.00 0.00 ? 117 SER A CB   3  
ATOM 5737  O OG   . SER A 1 117 ? -13.968 -3.542  -11.833 1.00 0.00 ? 117 SER A OG   3  
ATOM 5738  H H    . SER A 1 117 ? -15.004 -1.450  -9.508  1.00 0.00 ? 117 SER A H    3  
ATOM 5739  H HA   . SER A 1 117 ? -16.266 -2.562  -11.025 1.00 0.00 ? 117 SER A HA   3  
ATOM 5740  H HB2  . SER A 1 117 ? -14.389 -4.822  -10.301 1.00 0.00 ? 117 SER A HB2  3  
ATOM 5741  H HB3  . SER A 1 117 ? -15.513 -4.865  -11.659 1.00 0.00 ? 117 SER A HB3  3  
ATOM 5742  H HG   . SER A 1 117 ? -13.628 -2.774  -11.351 1.00 0.00 ? 117 SER A HG   3  
ATOM 5743  N N    . GLN A 1 118 ? -17.513 -3.320  -8.568  1.00 0.00 ? 118 GLN A N    3  
ATOM 5744  C CA   . GLN A 1 118 ? -18.587 -3.901  -7.783  1.00 0.00 ? 118 GLN A CA   3  
ATOM 5745  C C    . GLN A 1 118 ? -19.901 -3.211  -8.126  1.00 0.00 ? 118 GLN A C    3  
ATOM 5746  O O    . GLN A 1 118 ? -20.343 -2.303  -7.417  1.00 0.00 ? 118 GLN A O    3  
ATOM 5747  C CB   . GLN A 1 118 ? -18.284 -3.763  -6.285  1.00 0.00 ? 118 GLN A CB   3  
ATOM 5748  C CG   . GLN A 1 118 ? -19.073 -4.720  -5.403  1.00 0.00 ? 118 GLN A CG   3  
ATOM 5749  C CD   . GLN A 1 118 ? -18.810 -4.511  -3.921  1.00 0.00 ? 118 GLN A CD   3  
ATOM 5750  O OE1  . GLN A 1 118 ? -18.828 -5.459  -3.134  1.00 0.00 ? 118 GLN A OE1  3  
ATOM 5751  N NE2  . GLN A 1 118 ? -18.590 -3.267  -3.525  1.00 0.00 ? 118 GLN A NE2  3  
ATOM 5752  H H    . GLN A 1 118 ? -17.192 -2.421  -8.346  1.00 0.00 ? 118 GLN A H    3  
ATOM 5753  H HA   . GLN A 1 118 ? -18.660 -4.948  -8.037  1.00 0.00 ? 118 GLN A HA   3  
ATOM 5754  H HB2  . GLN A 1 118 ? -17.232 -3.946  -6.125  1.00 0.00 ? 118 GLN A HB2  3  
ATOM 5755  H HB3  . GLN A 1 118 ? -18.513 -2.753  -5.976  1.00 0.00 ? 118 GLN A HB3  3  
ATOM 5756  H HG2  . GLN A 1 118 ? -20.128 -4.570  -5.587  1.00 0.00 ? 118 GLN A HG2  3  
ATOM 5757  H HG3  . GLN A 1 118 ? -18.806 -5.734  -5.662  1.00 0.00 ? 118 GLN A HG3  3  
ATOM 5758  H HE21 . GLN A 1 118 ? -18.609 -2.556  -4.199  1.00 0.00 ? 118 GLN A HE21 3  
ATOM 5759  H HE22 . GLN A 1 118 ? -18.426 -3.107  -2.572  1.00 0.00 ? 118 GLN A HE22 3  
ATOM 5760  N N    . GLU A 1 119 ? -20.507 -3.623  -9.230  1.00 0.00 ? 119 GLU A N    3  
ATOM 5761  C CA   . GLU A 1 119 ? -21.751 -3.020  -9.683  1.00 0.00 ? 119 GLU A CA   3  
ATOM 5762  C C    . GLU A 1 119 ? -22.940 -3.617  -8.931  1.00 0.00 ? 119 GLU A C    3  
ATOM 5763  O O    . GLU A 1 119 ? -23.619 -2.858  -8.212  1.00 0.00 ? 119 GLU A O    3  
ATOM 5764  C CB   . GLU A 1 119 ? -21.928 -3.148  -11.211 1.00 0.00 ? 119 GLU A CB   3  
ATOM 5765  C CG   . GLU A 1 119 ? -21.945 -4.570  -11.762 1.00 0.00 ? 119 GLU A CG   3  
ATOM 5766  C CD   . GLU A 1 119 ? -20.588 -5.251  -11.735 1.00 0.00 ? 119 GLU A CD   3  
ATOM 5767  O OE1  . GLU A 1 119 ? -19.766 -4.989  -12.637 1.00 0.00 ? 119 GLU A OE1  3  
ATOM 5768  O OE2  . GLU A 1 119 ? -20.345 -6.062  -10.816 1.00 0.00 ? 119 GLU A OE2  3  
ATOM 5769  O OXT  . GLU A 1 119 ? -23.153 -4.844  -9.009  1.00 0.00 ? 119 GLU A OXT  3  
ATOM 5770  H H    . GLU A 1 119 ? -20.116 -4.364  -9.745  1.00 0.00 ? 119 GLU A H    3  
ATOM 5771  H HA   . GLU A 1 119 ? -21.697 -1.971  -9.434  1.00 0.00 ? 119 GLU A HA   3  
ATOM 5772  H HB2  . GLU A 1 119 ? -22.860 -2.680  -11.484 1.00 0.00 ? 119 GLU A HB2  3  
ATOM 5773  H HB3  . GLU A 1 119 ? -21.122 -2.613  -11.692 1.00 0.00 ? 119 GLU A HB3  3  
ATOM 5774  H HG2  . GLU A 1 119 ? -22.630 -5.158  -11.171 1.00 0.00 ? 119 GLU A HG2  3  
ATOM 5775  H HG3  . GLU A 1 119 ? -22.294 -4.538  -12.784 1.00 0.00 ? 119 GLU A HG3  3  
ATOM 5776  N N    . GLY A 1 1   ? 3.824   19.070  2.238   1.00 0.00 ? 1   GLY A N    4  
ATOM 5777  C CA   . GLY A 1 1   ? 2.596   19.816  2.606   1.00 0.00 ? 1   GLY A CA   4  
ATOM 5778  C C    . GLY A 1 1   ? 1.385   18.910  2.697   1.00 0.00 ? 1   GLY A C    4  
ATOM 5779  O O    . GLY A 1 1   ? 1.256   17.958  1.920   1.00 0.00 ? 1   GLY A O    4  
ATOM 5780  H H1   . GLY A 1 1   ? 4.629   19.726  2.142   1.00 0.00 ? 1   GLY A H1   4  
ATOM 5781  H H2   . GLY A 1 1   ? 3.686   18.574  1.334   1.00 0.00 ? 1   GLY A H2   4  
ATOM 5782  H H3   . GLY A 1 1   ? 4.051   18.368  2.976   1.00 0.00 ? 1   GLY A H3   4  
ATOM 5783  H HA2  . GLY A 1 1   ? 2.750   20.293  3.563   1.00 0.00 ? 1   GLY A HA2  4  
ATOM 5784  H HA3  . GLY A 1 1   ? 2.411   20.575  1.860   1.00 0.00 ? 1   GLY A HA3  4  
ATOM 5785  N N    . ALA A 1 2   ? 0.500   19.198  3.639   1.00 0.00 ? 2   ALA A N    4  
ATOM 5786  C CA   . ALA A 1 2   ? -0.707  18.409  3.822   1.00 0.00 ? 2   ALA A CA   4  
ATOM 5787  C C    . ALA A 1 2   ? -1.883  19.060  3.106   1.00 0.00 ? 2   ALA A C    4  
ATOM 5788  O O    . ALA A 1 2   ? -1.901  20.279  2.914   1.00 0.00 ? 2   ALA A O    4  
ATOM 5789  C CB   . ALA A 1 2   ? -1.013  18.236  5.302   1.00 0.00 ? 2   ALA A CB   4  
ATOM 5790  H H    . ALA A 1 2   ? 0.659   19.971  4.233   1.00 0.00 ? 2   ALA A H    4  
ATOM 5791  H HA   . ALA A 1 2   ? -0.535  17.431  3.394   1.00 0.00 ? 2   ALA A HA   4  
ATOM 5792  H HB1  . ALA A 1 2   ? -0.165  17.783  5.794   1.00 0.00 ? 2   ALA A HB1  4  
ATOM 5793  H HB2  . ALA A 1 2   ? -1.878  17.602  5.419   1.00 0.00 ? 2   ALA A HB2  4  
ATOM 5794  H HB3  . ALA A 1 2   ? -1.212  19.202  5.743   1.00 0.00 ? 2   ALA A HB3  4  
ATOM 5795  N N    . MET A 1 3   ? -2.852  18.235  2.706   1.00 0.00 ? 3   MET A N    4  
ATOM 5796  C CA   . MET A 1 3   ? -4.046  18.696  1.994   1.00 0.00 ? 3   MET A CA   4  
ATOM 5797  C C    . MET A 1 3   ? -3.657  19.393  0.690   1.00 0.00 ? 3   MET A C    4  
ATOM 5798  O O    . MET A 1 3   ? -4.288  20.365  0.269   1.00 0.00 ? 3   MET A O    4  
ATOM 5799  C CB   . MET A 1 3   ? -4.887  19.635  2.870   1.00 0.00 ? 3   MET A CB   4  
ATOM 5800  C CG   . MET A 1 3   ? -5.253  19.055  4.229   1.00 0.00 ? 3   MET A CG   4  
ATOM 5801  S SD   . MET A 1 3   ? -6.145  17.488  4.120   1.00 0.00 ? 3   MET A SD   4  
ATOM 5802  C CE   . MET A 1 3   ? -7.644  18.005  3.285   1.00 0.00 ? 3   MET A CE   4  
ATOM 5803  H H    . MET A 1 3   ? -2.762  17.278  2.898   1.00 0.00 ? 3   MET A H    4  
ATOM 5804  H HA   . MET A 1 3   ? -4.636  17.822  1.755   1.00 0.00 ? 3   MET A HA   4  
ATOM 5805  H HB2  . MET A 1 3   ? -4.334  20.548  3.031   1.00 0.00 ? 3   MET A HB2  4  
ATOM 5806  H HB3  . MET A 1 3   ? -5.802  19.869  2.345   1.00 0.00 ? 3   MET A HB3  4  
ATOM 5807  H HG2  . MET A 1 3   ? -4.344  18.892  4.789   1.00 0.00 ? 3   MET A HG2  4  
ATOM 5808  H HG3  . MET A 1 3   ? -5.872  19.769  4.754   1.00 0.00 ? 3   MET A HG3  4  
ATOM 5809  H HE1  . MET A 1 3   ? -8.145  18.756  3.877   1.00 0.00 ? 3   MET A HE1  4  
ATOM 5810  H HE2  . MET A 1 3   ? -8.296  17.153  3.157   1.00 0.00 ? 3   MET A HE2  4  
ATOM 5811  H HE3  . MET A 1 3   ? -7.394  18.415  2.319   1.00 0.00 ? 3   MET A HE3  4  
ATOM 5812  N N    . ASP A 1 4   ? -2.601  18.889  0.068   1.00 0.00 ? 4   ASP A N    4  
ATOM 5813  C CA   . ASP A 1 4   ? -2.099  19.431  -1.190  1.00 0.00 ? 4   ASP A CA   4  
ATOM 5814  C C    . ASP A 1 4   ? -2.167  18.357  -2.268  1.00 0.00 ? 4   ASP A C    4  
ATOM 5815  O O    . ASP A 1 4   ? -1.188  17.654  -2.524  1.00 0.00 ? 4   ASP A O    4  
ATOM 5816  C CB   . ASP A 1 4   ? -0.658  19.928  -1.007  1.00 0.00 ? 4   ASP A CB   4  
ATOM 5817  C CG   . ASP A 1 4   ? -0.009  20.391  -2.299  1.00 0.00 ? 4   ASP A CG   4  
ATOM 5818  O OD1  . ASP A 1 4   ? -0.514  21.351  -2.914  1.00 0.00 ? 4   ASP A OD1  4  
ATOM 5819  O OD2  . ASP A 1 4   ? 1.020   19.800  -2.695  1.00 0.00 ? 4   ASP A OD2  4  
ATOM 5820  H H    . ASP A 1 4   ? -2.149  18.119  0.464   1.00 0.00 ? 4   ASP A H    4  
ATOM 5821  H HA   . ASP A 1 4   ? -2.732  20.259  -1.476  1.00 0.00 ? 4   ASP A HA   4  
ATOM 5822  H HB2  . ASP A 1 4   ? -0.658  20.758  -0.315  1.00 0.00 ? 4   ASP A HB2  4  
ATOM 5823  H HB3  . ASP A 1 4   ? -0.061  19.126  -0.594  1.00 0.00 ? 4   ASP A HB3  4  
ATOM 5824  N N    . ASN A 1 5   ? -3.339  18.209  -2.873  1.00 0.00 ? 5   ASN A N    4  
ATOM 5825  C CA   . ASN A 1 5   ? -3.580  17.128  -3.824  1.00 0.00 ? 5   ASN A CA   4  
ATOM 5826  C C    . ASN A 1 5   ? -4.918  17.288  -4.545  1.00 0.00 ? 5   ASN A C    4  
ATOM 5827  O O    . ASN A 1 5   ? -5.964  16.862  -4.059  1.00 0.00 ? 5   ASN A O    4  
ATOM 5828  C CB   . ASN A 1 5   ? -3.510  15.768  -3.111  1.00 0.00 ? 5   ASN A CB   4  
ATOM 5829  C CG   . ASN A 1 5   ? -4.101  15.785  -1.707  1.00 0.00 ? 5   ASN A CG   4  
ATOM 5830  O OD1  . ASN A 1 5   ? -5.072  16.484  -1.418  1.00 0.00 ? 5   ASN A OD1  4  
ATOM 5831  N ND2  . ASN A 1 5   ? -3.494  15.025  -0.812  1.00 0.00 ? 5   ASN A ND2  4  
ATOM 5832  H H    . ASN A 1 5   ? -4.066  18.836  -2.673  1.00 0.00 ? 5   ASN A H    4  
ATOM 5833  H HA   . ASN A 1 5   ? -2.792  17.168  -4.562  1.00 0.00 ? 5   ASN A HA   4  
ATOM 5834  H HB2  . ASN A 1 5   ? -4.051  15.040  -3.695  1.00 0.00 ? 5   ASN A HB2  4  
ATOM 5835  H HB3  . ASN A 1 5   ? -2.476  15.463  -3.042  1.00 0.00 ? 5   ASN A HB3  4  
ATOM 5836  H HD21 . ASN A 1 5   ? -2.717  14.505  -1.099  1.00 0.00 ? 5   ASN A HD21 4  
ATOM 5837  H HD22 . ASN A 1 5   ? -3.853  15.012  0.107   1.00 0.00 ? 5   ASN A HD22 4  
ATOM 5838  N N    . VAL A 1 6   ? -4.869  17.914  -5.711  1.00 0.00 ? 6   VAL A N    4  
ATOM 5839  C CA   . VAL A 1 6   ? -6.051  18.086  -6.544  1.00 0.00 ? 6   VAL A CA   4  
ATOM 5840  C C    . VAL A 1 6   ? -5.803  17.505  -7.936  1.00 0.00 ? 6   VAL A C    4  
ATOM 5841  O O    . VAL A 1 6   ? -4.821  17.863  -8.590  1.00 0.00 ? 6   VAL A O    4  
ATOM 5842  C CB   . VAL A 1 6   ? -6.437  19.577  -6.675  1.00 0.00 ? 6   VAL A CB   4  
ATOM 5843  C CG1  . VAL A 1 6   ? -7.693  19.743  -7.516  1.00 0.00 ? 6   VAL A CG1  4  
ATOM 5844  C CG2  . VAL A 1 6   ? -6.626  20.205  -5.301  1.00 0.00 ? 6   VAL A CG2  4  
ATOM 5845  H H    . VAL A 1 6   ? -4.010  18.280  -6.025  1.00 0.00 ? 6   VAL A H    4  
ATOM 5846  H HA   . VAL A 1 6   ? -6.871  17.557  -6.082  1.00 0.00 ? 6   VAL A HA   4  
ATOM 5847  H HB   . VAL A 1 6   ? -5.629  20.094  -7.172  1.00 0.00 ? 6   VAL A HB   4  
ATOM 5848  H HG11 . VAL A 1 6   ? -8.507  19.204  -7.057  1.00 0.00 ? 6   VAL A HG11 4  
ATOM 5849  H HG12 . VAL A 1 6   ? -7.516  19.352  -8.508  1.00 0.00 ? 6   VAL A HG12 4  
ATOM 5850  H HG13 . VAL A 1 6   ? -7.946  20.791  -7.583  1.00 0.00 ? 6   VAL A HG13 4  
ATOM 5851  H HG21 . VAL A 1 6   ? -6.887  21.246  -5.415  1.00 0.00 ? 6   VAL A HG21 4  
ATOM 5852  H HG22 . VAL A 1 6   ? -5.708  20.122  -4.737  1.00 0.00 ? 6   VAL A HG22 4  
ATOM 5853  H HG23 . VAL A 1 6   ? -7.418  19.692  -4.777  1.00 0.00 ? 6   VAL A HG23 4  
ATOM 5854  N N    . CYS A 1 7   ? -6.687  16.599  -8.365  1.00 0.00 ? 7   CYS A N    4  
ATOM 5855  C CA   . CYS A 1 7   ? -6.584  15.951  -9.676  1.00 0.00 ? 7   CYS A CA   4  
ATOM 5856  C C    . CYS A 1 7   ? -5.247  15.227  -9.821  1.00 0.00 ? 7   CYS A C    4  
ATOM 5857  O O    . CYS A 1 7   ? -4.329  15.708  -10.486 1.00 0.00 ? 7   CYS A O    4  
ATOM 5858  C CB   . CYS A 1 7   ? -6.759  16.978  -10.800 1.00 0.00 ? 7   CYS A CB   4  
ATOM 5859  S SG   . CYS A 1 7   ? -8.302  17.914  -10.710 1.00 0.00 ? 7   CYS A SG   4  
ATOM 5860  H H    . CYS A 1 7   ? -7.436  16.359  -7.780  1.00 0.00 ? 7   CYS A H    4  
ATOM 5861  H HA   . CYS A 1 7   ? -7.378  15.223  -9.743  1.00 0.00 ? 7   CYS A HA   4  
ATOM 5862  H HB2  . CYS A 1 7   ? -5.945  17.686  -10.758 1.00 0.00 ? 7   CYS A HB2  4  
ATOM 5863  H HB3  . CYS A 1 7   ? -6.738  16.467  -11.750 1.00 0.00 ? 7   CYS A HB3  4  
ATOM 5864  H HG   . CYS A 1 7   ? -7.991  19.205  -10.700 1.00 0.00 ? 7   CYS A HG   4  
ATOM 5865  N N    . GLN A 1 8   ? -5.144  14.064  -9.201  1.00 0.00 ? 8   GLN A N    4  
ATOM 5866  C CA   . GLN A 1 8   ? -3.888  13.333  -9.164  1.00 0.00 ? 8   GLN A CA   4  
ATOM 5867  C C    . GLN A 1 8   ? -4.015  11.994  -9.889  1.00 0.00 ? 8   GLN A C    4  
ATOM 5868  O O    . GLN A 1 8   ? -5.107  11.435  -9.985  1.00 0.00 ? 8   GLN A O    4  
ATOM 5869  C CB   . GLN A 1 8   ? -3.455  13.106  -7.710  1.00 0.00 ? 8   GLN A CB   4  
ATOM 5870  C CG   . GLN A 1 8   ? -3.362  14.375  -6.863  1.00 0.00 ? 8   GLN A CG   4  
ATOM 5871  C CD   . GLN A 1 8   ? -2.228  15.314  -7.263  1.00 0.00 ? 8   GLN A CD   4  
ATOM 5872  O OE1  . GLN A 1 8   ? -1.646  15.984  -6.413  1.00 0.00 ? 8   GLN A OE1  4  
ATOM 5873  N NE2  . GLN A 1 8   ? -1.934  15.406  -8.551  1.00 0.00 ? 8   GLN A NE2  4  
ATOM 5874  H H    . GLN A 1 8   ? -5.943  13.674  -8.773  1.00 0.00 ? 8   GLN A H    4  
ATOM 5875  H HA   . GLN A 1 8   ? -3.141  13.930  -9.664  1.00 0.00 ? 8   GLN A HA   4  
ATOM 5876  H HB2  . GLN A 1 8   ? -4.165  12.441  -7.238  1.00 0.00 ? 8   GLN A HB2  4  
ATOM 5877  H HB3  . GLN A 1 8   ? -2.484  12.632  -7.711  1.00 0.00 ? 8   GLN A HB3  4  
ATOM 5878  H HG2  . GLN A 1 8   ? -4.292  14.916  -6.952  1.00 0.00 ? 8   GLN A HG2  4  
ATOM 5879  H HG3  . GLN A 1 8   ? -3.218  14.087  -5.832  1.00 0.00 ? 8   GLN A HG3  4  
ATOM 5880  H HE21 . GLN A 1 8   ? -2.458  14.874  -9.184  1.00 0.00 ? 8   GLN A HE21 4  
ATOM 5881  H HE22 . GLN A 1 8   ? -1.198  15.997  -8.822  1.00 0.00 ? 8   GLN A HE22 4  
ATOM 5882  N N    . PRO A 1 9   ? -2.897  11.490  -10.440 1.00 0.00 ? 9   PRO A N    4  
ATOM 5883  C CA   . PRO A 1 9   ? -2.837  10.156  -11.060 1.00 0.00 ? 9   PRO A CA   4  
ATOM 5884  C C    . PRO A 1 9   ? -3.217  9.044   -10.083 1.00 0.00 ? 9   PRO A C    4  
ATOM 5885  O O    . PRO A 1 9   ? -3.074  9.199   -8.871  1.00 0.00 ? 9   PRO A O    4  
ATOM 5886  C CB   . PRO A 1 9   ? -1.366  10.016  -11.468 1.00 0.00 ? 9   PRO A CB   4  
ATOM 5887  C CG   . PRO A 1 9   ? -0.862  11.411  -11.570 1.00 0.00 ? 9   PRO A CG   4  
ATOM 5888  C CD   . PRO A 1 9   ? -1.608  12.193  -10.530 1.00 0.00 ? 9   PRO A CD   4  
ATOM 5889  H HA   . PRO A 1 9   ? -3.467  10.096  -11.937 1.00 0.00 ? 9   PRO A HA   4  
ATOM 5890  H HB2  . PRO A 1 9   ? -0.834  9.456   -10.711 1.00 0.00 ? 9   PRO A HB2  4  
ATOM 5891  H HB3  . PRO A 1 9   ? -1.300  9.502   -12.415 1.00 0.00 ? 9   PRO A HB3  4  
ATOM 5892  H HG2  . PRO A 1 9   ? 0.200   11.432  -11.368 1.00 0.00 ? 9   PRO A HG2  4  
ATOM 5893  H HG3  . PRO A 1 9   ? -1.067  11.804  -12.555 1.00 0.00 ? 9   PRO A HG3  4  
ATOM 5894  H HD2  . PRO A 1 9   ? -1.084  12.164  -9.585  1.00 0.00 ? 9   PRO A HD2  4  
ATOM 5895  H HD3  . PRO A 1 9   ? -1.748  13.214  -10.854 1.00 0.00 ? 9   PRO A HD3  4  
ATOM 5896  N N    . THR A 1 10  ? -3.676  7.916   -10.616 1.00 0.00 ? 10  THR A N    4  
ATOM 5897  C CA   . THR A 1 10  ? -4.179  6.825   -9.788  1.00 0.00 ? 10  THR A CA   4  
ATOM 5898  C C    . THR A 1 10  ? -3.074  5.895   -9.296  1.00 0.00 ? 10  THR A C    4  
ATOM 5899  O O    . THR A 1 10  ? -3.347  4.857   -8.685  1.00 0.00 ? 10  THR A O    4  
ATOM 5900  C CB   . THR A 1 10  ? -5.244  6.013   -10.538 1.00 0.00 ? 10  THR A CB   4  
ATOM 5901  O OG1  . THR A 1 10  ? -4.962  6.012   -11.944 1.00 0.00 ? 10  THR A OG1  4  
ATOM 5902  C CG2  . THR A 1 10  ? -6.629  6.585   -10.284 1.00 0.00 ? 10  THR A CG2  4  
ATOM 5903  H H    . THR A 1 10  ? -3.675  7.808   -11.593 1.00 0.00 ? 10  THR A H    4  
ATOM 5904  H HA   . THR A 1 10  ? -4.651  7.271   -8.927  1.00 0.00 ? 10  THR A HA   4  
ATOM 5905  H HB   . THR A 1 10  ? -5.219  4.995   -10.173 1.00 0.00 ? 10  THR A HB   4  
ATOM 5906  H HG1  . THR A 1 10  ? -5.014  5.100   -12.280 1.00 0.00 ? 10  THR A HG1  4  
ATOM 5907  H HG21 . THR A 1 10  ? -6.665  7.608   -10.631 1.00 0.00 ? 10  THR A HG21 4  
ATOM 5908  H HG22 . THR A 1 10  ? -6.841  6.557   -9.225  1.00 0.00 ? 10  THR A HG22 4  
ATOM 5909  H HG23 . THR A 1 10  ? -7.363  5.999   -10.814 1.00 0.00 ? 10  THR A HG23 4  
ATOM 5910  N N    . GLU A 1 11  ? -1.838  6.273   -9.556  1.00 0.00 ? 11  GLU A N    4  
ATOM 5911  C CA   . GLU A 1 11  ? -0.689  5.573   -9.003  1.00 0.00 ? 11  GLU A CA   4  
ATOM 5912  C C    . GLU A 1 11  ? -0.173  6.351   -7.809  1.00 0.00 ? 11  GLU A C    4  
ATOM 5913  O O    . GLU A 1 11  ? -0.199  7.577   -7.826  1.00 0.00 ? 11  GLU A O    4  
ATOM 5914  C CB   . GLU A 1 11  ? 0.445   5.452   -10.026 1.00 0.00 ? 11  GLU A CB   4  
ATOM 5915  C CG   . GLU A 1 11  ? 0.174   4.499   -11.174 1.00 0.00 ? 11  GLU A CG   4  
ATOM 5916  C CD   . GLU A 1 11  ? 1.408   4.288   -12.030 1.00 0.00 ? 11  GLU A CD   4  
ATOM 5917  O OE1  . GLU A 1 11  ? 1.674   5.125   -12.922 1.00 0.00 ? 11  GLU A OE1  4  
ATOM 5918  O OE2  . GLU A 1 11  ? 2.133   3.297   -11.802 1.00 0.00 ? 11  GLU A OE2  4  
ATOM 5919  H H    . GLU A 1 11  ? -1.696  7.064   -10.112 1.00 0.00 ? 11  GLU A H    4  
ATOM 5920  H HA   . GLU A 1 11  ? -1.002  4.590   -8.687  1.00 0.00 ? 11  GLU A HA   4  
ATOM 5921  H HB2  . GLU A 1 11  ? 0.633   6.429   -10.445 1.00 0.00 ? 11  GLU A HB2  4  
ATOM 5922  H HB3  . GLU A 1 11  ? 1.337   5.117   -9.516  1.00 0.00 ? 11  GLU A HB3  4  
ATOM 5923  H HG2  . GLU A 1 11  ? -0.139  3.546   -10.772 1.00 0.00 ? 11  GLU A HG2  4  
ATOM 5924  H HG3  . GLU A 1 11  ? -0.613  4.908   -11.792 1.00 0.00 ? 11  GLU A HG3  4  
ATOM 5925  N N    . PHE A 1 12  ? 0.291   5.666   -6.780  1.00 0.00 ? 12  PHE A N    4  
ATOM 5926  C CA   . PHE A 1 12  ? 0.926   6.379   -5.675  1.00 0.00 ? 12  PHE A CA   4  
ATOM 5927  C C    . PHE A 1 12  ? 2.112   5.610   -5.126  1.00 0.00 ? 12  PHE A C    4  
ATOM 5928  O O    . PHE A 1 12  ? 2.185   4.384   -5.239  1.00 0.00 ? 12  PHE A O    4  
ATOM 5929  C CB   . PHE A 1 12  ? -0.069  6.774   -4.549  1.00 0.00 ? 12  PHE A CB   4  
ATOM 5930  C CG   . PHE A 1 12  ? -0.649  5.658   -3.694  1.00 0.00 ? 12  PHE A CG   4  
ATOM 5931  C CD1  . PHE A 1 12  ? 0.162   4.840   -2.917  1.00 0.00 ? 12  PHE A CD1  4  
ATOM 5932  C CD2  . PHE A 1 12  ? -2.022  5.461   -3.639  1.00 0.00 ? 12  PHE A CD2  4  
ATOM 5933  C CE1  . PHE A 1 12  ? -0.383  3.846   -2.118  1.00 0.00 ? 12  PHE A CE1  4  
ATOM 5934  C CE2  . PHE A 1 12  ? -2.572  4.473   -2.837  1.00 0.00 ? 12  PHE A CE2  4  
ATOM 5935  C CZ   . PHE A 1 12  ? -1.750  3.664   -2.078  1.00 0.00 ? 12  PHE A CZ   4  
ATOM 5936  H H    . PHE A 1 12  ? 0.241   4.680   -6.780  1.00 0.00 ? 12  PHE A H    4  
ATOM 5937  H HA   . PHE A 1 12  ? 1.315   7.296   -6.100  1.00 0.00 ? 12  PHE A HA   4  
ATOM 5938  H HB2  . PHE A 1 12  ? 0.433   7.452   -3.879  1.00 0.00 ? 12  PHE A HB2  4  
ATOM 5939  H HB3  . PHE A 1 12  ? -0.900  7.298   -5.002  1.00 0.00 ? 12  PHE A HB3  4  
ATOM 5940  H HD1  . PHE A 1 12  ? 1.233   4.977   -2.944  1.00 0.00 ? 12  PHE A HD1  4  
ATOM 5941  H HD2  . PHE A 1 12  ? -2.670  6.087   -4.237  1.00 0.00 ? 12  PHE A HD2  4  
ATOM 5942  H HE1  . PHE A 1 12  ? 0.263   3.213   -1.529  1.00 0.00 ? 12  PHE A HE1  4  
ATOM 5943  H HE2  . PHE A 1 12  ? -3.641  4.332   -2.807  1.00 0.00 ? 12  PHE A HE2  4  
ATOM 5944  H HZ   . PHE A 1 12  ? -2.179  2.893   -1.447  1.00 0.00 ? 12  PHE A HZ   4  
ATOM 5945  N N    . ILE A 1 13  ? 3.053   6.349   -4.562  1.00 0.00 ? 13  ILE A N    4  
ATOM 5946  C CA   . ILE A 1 13  ? 4.220   5.763   -3.930  1.00 0.00 ? 13  ILE A CA   4  
ATOM 5947  C C    . ILE A 1 13  ? 4.153   6.014   -2.432  1.00 0.00 ? 13  ILE A C    4  
ATOM 5948  O O    . ILE A 1 13  ? 3.927   7.139   -1.992  1.00 0.00 ? 13  ILE A O    4  
ATOM 5949  C CB   . ILE A 1 13  ? 5.534   6.358   -4.490  1.00 0.00 ? 13  ILE A CB   4  
ATOM 5950  C CG1  . ILE A 1 13  ? 5.621   6.143   -6.005  1.00 0.00 ? 13  ILE A CG1  4  
ATOM 5951  C CG2  . ILE A 1 13  ? 6.746   5.748   -3.795  1.00 0.00 ? 13  ILE A CG2  4  
ATOM 5952  C CD1  . ILE A 1 13  ? 5.604   4.686   -6.420  1.00 0.00 ? 13  ILE A CD1  4  
ATOM 5953  H H    . ILE A 1 13  ? 2.958   7.325   -4.569  1.00 0.00 ? 13  ILE A H    4  
ATOM 5954  H HA   . ILE A 1 13  ? 4.210   4.699   -4.116  1.00 0.00 ? 13  ILE A HA   4  
ATOM 5955  H HB   . ILE A 1 13  ? 5.534   7.419   -4.287  1.00 0.00 ? 13  ILE A HB   4  
ATOM 5956  H HG12 . ILE A 1 13  ? 4.781   6.629   -6.480  1.00 0.00 ? 13  ILE A HG12 4  
ATOM 5957  H HG13 . ILE A 1 13  ? 6.537   6.582   -6.372  1.00 0.00 ? 13  ILE A HG13 4  
ATOM 5958  H HG21 . ILE A 1 13  ? 6.686   5.942   -2.734  1.00 0.00 ? 13  ILE A HG21 4  
ATOM 5959  H HG22 . ILE A 1 13  ? 7.648   6.188   -4.191  1.00 0.00 ? 13  ILE A HG22 4  
ATOM 5960  H HG23 . ILE A 1 13  ? 6.760   4.681   -3.965  1.00 0.00 ? 13  ILE A HG23 4  
ATOM 5961  H HD11 . ILE A 1 13  ? 6.459   4.183   -5.994  1.00 0.00 ? 13  ILE A HD11 4  
ATOM 5962  H HD12 . ILE A 1 13  ? 5.644   4.617   -7.496  1.00 0.00 ? 13  ILE A HD12 4  
ATOM 5963  H HD13 . ILE A 1 13  ? 4.698   4.222   -6.062  1.00 0.00 ? 13  ILE A HD13 4  
ATOM 5964  N N    . SER A 1 14  ? 4.302   4.966   -1.649  1.00 0.00 ? 14  SER A N    4  
ATOM 5965  C CA   . SER A 1 14  ? 4.271   5.102   -0.207  1.00 0.00 ? 14  SER A CA   4  
ATOM 5966  C C    . SER A 1 14  ? 5.287   4.183   0.449   1.00 0.00 ? 14  SER A C    4  
ATOM 5967  O O    . SER A 1 14  ? 5.625   3.126   -0.085  1.00 0.00 ? 14  SER A O    4  
ATOM 5968  C CB   . SER A 1 14  ? 2.865   4.805   0.318   1.00 0.00 ? 14  SER A CB   4  
ATOM 5969  O OG   . SER A 1 14  ? 1.917   5.674   -0.277  1.00 0.00 ? 14  SER A OG   4  
ATOM 5970  H H    . SER A 1 14  ? 4.429   4.078   -2.050  1.00 0.00 ? 14  SER A H    4  
ATOM 5971  H HA   . SER A 1 14  ? 4.524   6.124   0.033   1.00 0.00 ? 14  SER A HA   4  
ATOM 5972  H HB2  . SER A 1 14  ? 2.600   3.787   0.080   1.00 0.00 ? 14  SER A HB2  4  
ATOM 5973  H HB3  . SER A 1 14  ? 2.844   4.943   1.391   1.00 0.00 ? 14  SER A HB3  4  
ATOM 5974  H HG   . SER A 1 14  ? 2.341   6.168   -0.985  1.00 0.00 ? 14  SER A HG   4  
ATOM 5975  N N    . ARG A 1 15  ? 5.790   4.602   1.594   1.00 0.00 ? 15  ARG A N    4  
ATOM 5976  C CA   . ARG A 1 15  ? 6.704   3.792   2.368   1.00 0.00 ? 15  ARG A CA   4  
ATOM 5977  C C    . ARG A 1 15  ? 6.015   3.368   3.655   1.00 0.00 ? 15  ARG A C    4  
ATOM 5978  O O    . ARG A 1 15  ? 5.490   4.204   4.393   1.00 0.00 ? 15  ARG A O    4  
ATOM 5979  C CB   . ARG A 1 15  ? 7.989   4.569   2.674   1.00 0.00 ? 15  ARG A CB   4  
ATOM 5980  C CG   . ARG A 1 15  ? 8.652   5.162   1.438   1.00 0.00 ? 15  ARG A CG   4  
ATOM 5981  C CD   . ARG A 1 15  ? 10.017  5.747   1.755   1.00 0.00 ? 15  ARG A CD   4  
ATOM 5982  N NE   . ARG A 1 15  ? 9.972   6.722   2.845   1.00 0.00 ? 15  ARG A NE   4  
ATOM 5983  C CZ   . ARG A 1 15  ? 10.981  7.538   3.151   1.00 0.00 ? 15  ARG A CZ   4  
ATOM 5984  N NH1  . ARG A 1 15  ? 12.080  7.547   2.404   1.00 0.00 ? 15  ARG A NH1  4  
ATOM 5985  N NH2  . ARG A 1 15  ? 10.882  8.360   4.189   1.00 0.00 ? 15  ARG A NH2  4  
ATOM 5986  H H    . ARG A 1 15  ? 5.532   5.487   1.941   1.00 0.00 ? 15  ARG A H    4  
ATOM 5987  H HA   . ARG A 1 15  ? 6.946   2.911   1.788   1.00 0.00 ? 15  ARG A HA   4  
ATOM 5988  H HB2  . ARG A 1 15  ? 7.755   5.377   3.352   1.00 0.00 ? 15  ARG A HB2  4  
ATOM 5989  H HB3  . ARG A 1 15  ? 8.695   3.903   3.149   1.00 0.00 ? 15  ARG A HB3  4  
ATOM 5990  H HG2  . ARG A 1 15  ? 8.770   4.383   0.698   1.00 0.00 ? 15  ARG A HG2  4  
ATOM 5991  H HG3  . ARG A 1 15  ? 8.019   5.943   1.041   1.00 0.00 ? 15  ARG A HG3  4  
ATOM 5992  H HD2  . ARG A 1 15  ? 10.679  4.942   2.036   1.00 0.00 ? 15  ARG A HD2  4  
ATOM 5993  H HD3  . ARG A 1 15  ? 10.403  6.231   0.870   1.00 0.00 ? 15  ARG A HD3  4  
ATOM 5994  H HE   . ARG A 1 15  ? 9.156   6.753   3.390   1.00 0.00 ? 15  ARG A HE   4  
ATOM 5995  H HH11 . ARG A 1 15  ? 12.157  6.943   1.601   1.00 0.00 ? 15  ARG A HH11 4  
ATOM 5996  H HH12 . ARG A 1 15  ? 12.851  8.150   2.645   1.00 0.00 ? 15  ARG A HH12 4  
ATOM 5997  H HH21 . ARG A 1 15  ? 10.042  8.375   4.753   1.00 0.00 ? 15  ARG A HH21 4  
ATOM 5998  H HH22 . ARG A 1 15  ? 11.650  8.967   4.432   1.00 0.00 ? 15  ARG A HH22 4  
ATOM 5999  N N    . HIS A 1 16  ? 5.990   2.072   3.906   1.00 0.00 ? 16  HIS A N    4  
ATOM 6000  C CA   . HIS A 1 16  ? 5.311   1.538   5.070   1.00 0.00 ? 16  HIS A CA   4  
ATOM 6001  C C    . HIS A 1 16  ? 6.134   0.426   5.685   1.00 0.00 ? 16  HIS A C    4  
ATOM 6002  O O    . HIS A 1 16  ? 6.794   -0.323  4.978   1.00 0.00 ? 16  HIS A O    4  
ATOM 6003  C CB   . HIS A 1 16  ? 3.897   1.043   4.701   1.00 0.00 ? 16  HIS A CB   4  
ATOM 6004  C CG   . HIS A 1 16  ? 3.834   -0.159  3.799   1.00 0.00 ? 16  HIS A CG   4  
ATOM 6005  N ND1  . HIS A 1 16  ? 2.753   -1.015  3.781   1.00 0.00 ? 16  HIS A ND1  4  
ATOM 6006  C CD2  . HIS A 1 16  ? 4.699   -0.638  2.876   1.00 0.00 ? 16  HIS A CD2  4  
ATOM 6007  C CE1  . HIS A 1 16  ? 2.959   -1.968  2.892   1.00 0.00 ? 16  HIS A CE1  4  
ATOM 6008  N NE2  . HIS A 1 16  ? 4.133   -1.764  2.326   1.00 0.00 ? 16  HIS A NE2  4  
ATOM 6009  H H    . HIS A 1 16  ? 6.470   1.457   3.302   1.00 0.00 ? 16  HIS A H    4  
ATOM 6010  H HA   . HIS A 1 16  ? 5.223   2.337   5.789   1.00 0.00 ? 16  HIS A HA   4  
ATOM 6011  H HB2  . HIS A 1 16  ? 3.370   0.794   5.608   1.00 0.00 ? 16  HIS A HB2  4  
ATOM 6012  H HB3  . HIS A 1 16  ? 3.373   1.849   4.207   1.00 0.00 ? 16  HIS A HB3  4  
ATOM 6013  H HD1  . HIS A 1 16  ? 1.950   -0.932  4.336   1.00 0.00 ? 16  HIS A HD1  4  
ATOM 6014  H HD2  . HIS A 1 16  ? 5.664   -0.221  2.626   1.00 0.00 ? 16  HIS A HD2  4  
ATOM 6015  H HE1  . HIS A 1 16  ? 2.281   -2.775  2.664   1.00 0.00 ? 16  HIS A HE1  4  
ATOM 6016  H HE2  . HIS A 1 16  ? 4.592   -2.399  1.733   1.00 0.00 ? 16  HIS A HE2  4  
ATOM 6017  N N    . ASN A 1 17  ? 6.097   0.312   6.998   1.00 0.00 ? 17  ASN A N    4  
ATOM 6018  C CA   . ASN A 1 17  ? 6.899   -0.683  7.680   1.00 0.00 ? 17  ASN A CA   4  
ATOM 6019  C C    . ASN A 1 17  ? 6.200   -2.037  7.582   1.00 0.00 ? 17  ASN A C    4  
ATOM 6020  O O    . ASN A 1 17  ? 5.039   -2.087  7.162   1.00 0.00 ? 17  ASN A O    4  
ATOM 6021  C CB   . ASN A 1 17  ? 7.168   -0.262  9.132   1.00 0.00 ? 17  ASN A CB   4  
ATOM 6022  C CG   . ASN A 1 17  ? 5.999   -0.482  10.063  1.00 0.00 ? 17  ASN A CG   4  
ATOM 6023  O OD1  . ASN A 1 17  ? 4.852   -0.570  9.633   1.00 0.00 ? 17  ASN A OD1  4  
ATOM 6024  N ND2  . ASN A 1 17  ? 6.286   -0.552  11.349  1.00 0.00 ? 17  ASN A ND2  4  
ATOM 6025  H H    . ASN A 1 17  ? 5.478   0.875   7.519   1.00 0.00 ? 17  ASN A H    4  
ATOM 6026  H HA   . ASN A 1 17  ? 7.842   -0.751  7.158   1.00 0.00 ? 17  ASN A HA   4  
ATOM 6027  H HB2  . ASN A 1 17  ? 8.000   -0.829  9.510   1.00 0.00 ? 17  ASN A HB2  4  
ATOM 6028  H HB3  . ASN A 1 17  ? 7.423   0.789   9.152   1.00 0.00 ? 17  ASN A HB3  4  
ATOM 6029  H HD21 . ASN A 1 17  ? 7.223   -0.453  11.618  1.00 0.00 ? 17  ASN A HD21 4  
ATOM 6030  H HD22 . ASN A 1 17  ? 5.552   -0.733  11.981  1.00 0.00 ? 17  ASN A HD22 4  
ATOM 6031  N N    . ILE A 1 18  ? 6.883   -3.102  7.999   1.00 0.00 ? 18  ILE A N    4  
ATOM 6032  C CA   . ILE A 1 18  ? 6.509   -4.475  7.639   1.00 0.00 ? 18  ILE A CA   4  
ATOM 6033  C C    . ILE A 1 18  ? 5.076   -4.847  8.037   1.00 0.00 ? 18  ILE A C    4  
ATOM 6034  O O    . ILE A 1 18  ? 4.440   -5.662  7.371   1.00 0.00 ? 18  ILE A O    4  
ATOM 6035  C CB   . ILE A 1 18  ? 7.490   -5.518  8.235   1.00 0.00 ? 18  ILE A CB   4  
ATOM 6036  C CG1  . ILE A 1 18  ? 7.332   -5.625  9.751   1.00 0.00 ? 18  ILE A CG1  4  
ATOM 6037  C CG2  . ILE A 1 18  ? 8.923   -5.147  7.886   1.00 0.00 ? 18  ILE A CG2  4  
ATOM 6038  C CD1  . ILE A 1 18  ? 8.158   -6.724  10.384  1.00 0.00 ? 18  ILE A CD1  4  
ATOM 6039  H H    . ILE A 1 18  ? 7.655   -2.962  8.577   1.00 0.00 ? 18  ILE A H    4  
ATOM 6040  H HA   . ILE A 1 18  ? 6.585   -4.547  6.565   1.00 0.00 ? 18  ILE A HA   4  
ATOM 6041  H HB   . ILE A 1 18  ? 7.274   -6.474  7.785   1.00 0.00 ? 18  ILE A HB   4  
ATOM 6042  H HG12 . ILE A 1 18  ? 7.629   -4.690  10.202  1.00 0.00 ? 18  ILE A HG12 4  
ATOM 6043  H HG13 . ILE A 1 18  ? 6.294   -5.817  9.982   1.00 0.00 ? 18  ILE A HG13 4  
ATOM 6044  H HG21 . ILE A 1 18  ? 9.031   -5.090  6.813   1.00 0.00 ? 18  ILE A HG21 4  
ATOM 6045  H HG22 . ILE A 1 18  ? 9.593   -5.897  8.276   1.00 0.00 ? 18  ILE A HG22 4  
ATOM 6046  H HG23 . ILE A 1 18  ? 9.159   -4.190  8.323   1.00 0.00 ? 18  ILE A HG23 4  
ATOM 6047  H HD11 . ILE A 1 18  ? 7.855   -7.682  9.986   1.00 0.00 ? 18  ILE A HD11 4  
ATOM 6048  H HD12 . ILE A 1 18  ? 8.008   -6.717  11.455  1.00 0.00 ? 18  ILE A HD12 4  
ATOM 6049  H HD13 . ILE A 1 18  ? 9.204   -6.561  10.168  1.00 0.00 ? 18  ILE A HD13 4  
ATOM 6050  N N    . GLU A 1 19  ? 4.567   -4.254  9.104   1.00 0.00 ? 19  GLU A N    4  
ATOM 6051  C CA   . GLU A 1 19  ? 3.215   -4.561  9.556   1.00 0.00 ? 19  GLU A CA   4  
ATOM 6052  C C    . GLU A 1 19  ? 2.187   -3.798  8.721   1.00 0.00 ? 19  GLU A C    4  
ATOM 6053  O O    . GLU A 1 19  ? 0.979   -3.929  8.922   1.00 0.00 ? 19  GLU A O    4  
ATOM 6054  C CB   . GLU A 1 19  ? 3.055   -4.219  11.036  1.00 0.00 ? 19  GLU A CB   4  
ATOM 6055  C CG   . GLU A 1 19  ? 4.271   -4.574  11.876  1.00 0.00 ? 19  GLU A CG   4  
ATOM 6056  C CD   . GLU A 1 19  ? 5.237   -3.419  12.013  1.00 0.00 ? 19  GLU A CD   4  
ATOM 6057  O OE1  . GLU A 1 19  ? 5.032   -2.576  12.913  1.00 0.00 ? 19  GLU A OE1  4  
ATOM 6058  O OE2  . GLU A 1 19  ? 6.196   -3.344  11.221  1.00 0.00 ? 19  GLU A OE2  4  
ATOM 6059  H H    . GLU A 1 19  ? 5.112   -3.613  9.617   1.00 0.00 ? 19  GLU A H    4  
ATOM 6060  H HA   . GLU A 1 19  ? 3.051   -5.619  9.420   1.00 0.00 ? 19  GLU A HA   4  
ATOM 6061  H HB2  . GLU A 1 19  ? 2.876   -3.158  11.130  1.00 0.00 ? 19  GLU A HB2  4  
ATOM 6062  H HB3  . GLU A 1 19  ? 2.204   -4.756  11.430  1.00 0.00 ? 19  GLU A HB3  4  
ATOM 6063  H HG2  . GLU A 1 19  ? 3.947   -4.868  12.856  1.00 0.00 ? 19  GLU A HG2  4  
ATOM 6064  H HG3  . GLU A 1 19  ? 4.788   -5.398  11.406  1.00 0.00 ? 19  GLU A HG3  4  
ATOM 6065  N N    . GLY A 1 20  ? 2.671   -2.999  7.781   1.00 0.00 ? 20  GLY A N    4  
ATOM 6066  C CA   . GLY A 1 20  ? 1.791   -2.270  6.906   1.00 0.00 ? 20  GLY A CA   4  
ATOM 6067  C C    . GLY A 1 20  ? 1.480   -0.881  7.415   1.00 0.00 ? 20  GLY A C    4  
ATOM 6068  O O    . GLY A 1 20  ? 0.428   -0.332  7.092   1.00 0.00 ? 20  GLY A O    4  
ATOM 6069  H H    . GLY A 1 20  ? 3.651   -2.905  7.676   1.00 0.00 ? 20  GLY A H    4  
ATOM 6070  H HA2  . GLY A 1 20  ? 2.254   -2.192  5.934   1.00 0.00 ? 20  GLY A HA2  4  
ATOM 6071  H HA3  . GLY A 1 20  ? 0.868   -2.820  6.808   1.00 0.00 ? 20  GLY A HA3  4  
ATOM 6072  N N    . ILE A 1 21  ? 2.391   -0.299  8.194   1.00 0.00 ? 21  ILE A N    4  
ATOM 6073  C CA   . ILE A 1 21  ? 2.172   1.041   8.752   1.00 0.00 ? 21  ILE A CA   4  
ATOM 6074  C C    . ILE A 1 21  ? 2.829   2.091   7.870   1.00 0.00 ? 21  ILE A C    4  
ATOM 6075  O O    . ILE A 1 21  ? 4.043   2.074   7.679   1.00 0.00 ? 21  ILE A O    4  
ATOM 6076  C CB   . ILE A 1 21  ? 2.733   1.179   10.188  1.00 0.00 ? 21  ILE A CB   4  
ATOM 6077  C CG1  . ILE A 1 21  ? 2.057   0.184   11.134  1.00 0.00 ? 21  ILE A CG1  4  
ATOM 6078  C CG2  . ILE A 1 21  ? 2.568   2.606   10.701  1.00 0.00 ? 21  ILE A CG2  4  
ATOM 6079  C CD1  . ILE A 1 21  ? 0.585   0.448   11.338  1.00 0.00 ? 21  ILE A CD1  4  
ATOM 6080  H H    . ILE A 1 21  ? 3.241   -0.767  8.398   1.00 0.00 ? 21  ILE A H    4  
ATOM 6081  H HA   . ILE A 1 21  ? 1.106   1.224   8.783   1.00 0.00 ? 21  ILE A HA   4  
ATOM 6082  H HB   . ILE A 1 21  ? 3.791   0.961   10.153  1.00 0.00 ? 21  ILE A HB   4  
ATOM 6083  H HG12 . ILE A 1 21  ? 2.157   -0.812  10.730  1.00 0.00 ? 21  ILE A HG12 4  
ATOM 6084  H HG13 . ILE A 1 21  ? 2.540   0.226   12.100  1.00 0.00 ? 21  ILE A HG13 4  
ATOM 6085  H HG21 . ILE A 1 21  ? 1.521   2.871   10.696  1.00 0.00 ? 21  ILE A HG21 4  
ATOM 6086  H HG22 . ILE A 1 21  ? 3.113   3.284   10.061  1.00 0.00 ? 21  ILE A HG22 4  
ATOM 6087  H HG23 . ILE A 1 21  ? 2.951   2.675   11.709  1.00 0.00 ? 21  ILE A HG23 4  
ATOM 6088  H HD11 . ILE A 1 21  ? 0.451   1.430   11.767  1.00 0.00 ? 21  ILE A HD11 4  
ATOM 6089  H HD12 . ILE A 1 21  ? 0.177   -0.296  12.006  1.00 0.00 ? 21  ILE A HD12 4  
ATOM 6090  H HD13 . ILE A 1 21  ? 0.076   0.398   10.387  1.00 0.00 ? 21  ILE A HD13 4  
ATOM 6091  N N    . PHE A 1 22  ? 2.029   3.002   7.339   1.00 0.00 ? 22  PHE A N    4  
ATOM 6092  C CA   . PHE A 1 22  ? 2.532   4.009   6.416   1.00 0.00 ? 22  PHE A CA   4  
ATOM 6093  C C    . PHE A 1 22  ? 3.224   5.144   7.160   1.00 0.00 ? 22  PHE A C    4  
ATOM 6094  O O    . PHE A 1 22  ? 2.637   5.773   8.043   1.00 0.00 ? 22  PHE A O    4  
ATOM 6095  C CB   . PHE A 1 22  ? 1.395   4.560   5.558   1.00 0.00 ? 22  PHE A CB   4  
ATOM 6096  C CG   . PHE A 1 22  ? 0.775   3.529   4.662   1.00 0.00 ? 22  PHE A CG   4  
ATOM 6097  C CD1  . PHE A 1 22  ? -0.256  2.727   5.120   1.00 0.00 ? 22  PHE A CD1  4  
ATOM 6098  C CD2  . PHE A 1 22  ? 1.226   3.362   3.364   1.00 0.00 ? 22  PHE A CD2  4  
ATOM 6099  C CE1  . PHE A 1 22  ? -0.826  1.776   4.300   1.00 0.00 ? 22  PHE A CE1  4  
ATOM 6100  C CE2  . PHE A 1 22  ? 0.659   2.411   2.537   1.00 0.00 ? 22  PHE A CE2  4  
ATOM 6101  C CZ   . PHE A 1 22  ? -0.369  1.617   3.005   1.00 0.00 ? 22  PHE A CZ   4  
ATOM 6102  H H    . PHE A 1 22  ? 1.078   3.009   7.581   1.00 0.00 ? 22  PHE A H    4  
ATOM 6103  H HA   . PHE A 1 22  ? 3.252   3.531   5.771   1.00 0.00 ? 22  PHE A HA   4  
ATOM 6104  H HB2  . PHE A 1 22  ? 0.620   4.951   6.203   1.00 0.00 ? 22  PHE A HB2  4  
ATOM 6105  H HB3  . PHE A 1 22  ? 1.774   5.358   4.935   1.00 0.00 ? 22  PHE A HB3  4  
ATOM 6106  H HD1  . PHE A 1 22  ? -0.615  2.849   6.133   1.00 0.00 ? 22  PHE A HD1  4  
ATOM 6107  H HD2  . PHE A 1 22  ? 2.030   3.982   2.998   1.00 0.00 ? 22  PHE A HD2  4  
ATOM 6108  H HE1  . PHE A 1 22  ? -1.631  1.157   4.670   1.00 0.00 ? 22  PHE A HE1  4  
ATOM 6109  H HE2  . PHE A 1 22  ? 1.019   2.289   1.527   1.00 0.00 ? 22  PHE A HE2  4  
ATOM 6110  H HZ   . PHE A 1 22  ? -0.816  0.872   2.363   1.00 0.00 ? 22  PHE A HZ   4  
ATOM 6111  N N    . THR A 1 23  ? 4.475   5.388   6.802   1.00 0.00 ? 23  THR A N    4  
ATOM 6112  C CA   . THR A 1 23  ? 5.246   6.467   7.397   1.00 0.00 ? 23  THR A CA   4  
ATOM 6113  C C    . THR A 1 23  ? 5.379   7.640   6.429   1.00 0.00 ? 23  THR A C    4  
ATOM 6114  O O    . THR A 1 23  ? 5.532   8.792   6.844   1.00 0.00 ? 23  THR A O    4  
ATOM 6115  C CB   . THR A 1 23  ? 6.644   5.980   7.821   1.00 0.00 ? 23  THR A CB   4  
ATOM 6116  O OG1  . THR A 1 23  ? 7.255   5.246   6.751   1.00 0.00 ? 23  THR A OG1  4  
ATOM 6117  C CG2  . THR A 1 23  ? 6.556   5.104   9.062   1.00 0.00 ? 23  THR A CG2  4  
ATOM 6118  H H    . THR A 1 23  ? 4.900   4.820   6.122   1.00 0.00 ? 23  THR A H    4  
ATOM 6119  H HA   . THR A 1 23  ? 4.720   6.801   8.280   1.00 0.00 ? 23  THR A HA   4  
ATOM 6120  H HB   . THR A 1 23  ? 7.254   6.842   8.051   1.00 0.00 ? 23  THR A HB   4  
ATOM 6121  H HG1  . THR A 1 23  ? 8.148   4.982   7.013   1.00 0.00 ? 23  THR A HG1  4  
ATOM 6122  H HG21 . THR A 1 23  ? 7.547   4.784   9.348   1.00 0.00 ? 23  THR A HG21 4  
ATOM 6123  H HG22 . THR A 1 23  ? 5.946   4.239   8.851   1.00 0.00 ? 23  THR A HG22 4  
ATOM 6124  H HG23 . THR A 1 23  ? 6.114   5.667   9.870   1.00 0.00 ? 23  THR A HG23 4  
ATOM 6125  N N    . PHE A 1 24  ? 5.318   7.343   5.136   1.00 0.00 ? 24  PHE A N    4  
ATOM 6126  C CA   . PHE A 1 24  ? 5.358   8.372   4.105   1.00 0.00 ? 24  PHE A CA   4  
ATOM 6127  C C    . PHE A 1 24  ? 4.422   8.008   2.965   1.00 0.00 ? 24  PHE A C    4  
ATOM 6128  O O    . PHE A 1 24  ? 4.530   6.924   2.393   1.00 0.00 ? 24  PHE A O    4  
ATOM 6129  C CB   . PHE A 1 24  ? 6.781   8.558   3.571   1.00 0.00 ? 24  PHE A CB   4  
ATOM 6130  C CG   . PHE A 1 24  ? 6.866   9.525   2.423   1.00 0.00 ? 24  PHE A CG   4  
ATOM 6131  C CD1  . PHE A 1 24  ? 6.708   10.886  2.633   1.00 0.00 ? 24  PHE A CD1  4  
ATOM 6132  C CD2  . PHE A 1 24  ? 7.094   9.072   1.132   1.00 0.00 ? 24  PHE A CD2  4  
ATOM 6133  C CE1  . PHE A 1 24  ? 6.775   11.776  1.577   1.00 0.00 ? 24  PHE A CE1  4  
ATOM 6134  C CE2  . PHE A 1 24  ? 7.160   9.957   0.073   1.00 0.00 ? 24  PHE A CE2  4  
ATOM 6135  C CZ   . PHE A 1 24  ? 7.002   11.310  0.297   1.00 0.00 ? 24  PHE A CZ   4  
ATOM 6136  H H    . PHE A 1 24  ? 5.249   6.404   4.863   1.00 0.00 ? 24  PHE A H    4  
ATOM 6137  H HA   . PHE A 1 24  ? 5.023   9.300   4.549   1.00 0.00 ? 24  PHE A HA   4  
ATOM 6138  H HB2  . PHE A 1 24  ? 7.411   8.930   4.367   1.00 0.00 ? 24  PHE A HB2  4  
ATOM 6139  H HB3  . PHE A 1 24  ? 7.159   7.604   3.234   1.00 0.00 ? 24  PHE A HB3  4  
ATOM 6140  H HD1  . PHE A 1 24  ? 6.532   11.251  3.633   1.00 0.00 ? 24  PHE A HD1  4  
ATOM 6141  H HD2  . PHE A 1 24  ? 7.218   8.014   0.957   1.00 0.00 ? 24  PHE A HD2  4  
ATOM 6142  H HE1  . PHE A 1 24  ? 6.650   12.833  1.754   1.00 0.00 ? 24  PHE A HE1  4  
ATOM 6143  H HE2  . PHE A 1 24  ? 7.336   9.590   -0.927  1.00 0.00 ? 24  PHE A HE2  4  
ATOM 6144  H HZ   . PHE A 1 24  ? 7.053   12.005  -0.529  1.00 0.00 ? 24  PHE A HZ   4  
ATOM 6145  N N    . VAL A 1 25  ? 3.508   8.910   2.639   1.00 0.00 ? 25  VAL A N    4  
ATOM 6146  C CA   . VAL A 1 25  ? 2.552   8.680   1.563   1.00 0.00 ? 25  VAL A CA   4  
ATOM 6147  C C    . VAL A 1 25  ? 2.553   9.845   0.576   1.00 0.00 ? 25  VAL A C    4  
ATOM 6148  O O    . VAL A 1 25  ? 2.544   11.013  0.979   1.00 0.00 ? 25  VAL A O    4  
ATOM 6149  C CB   . VAL A 1 25  ? 1.120   8.484   2.105   1.00 0.00 ? 25  VAL A CB   4  
ATOM 6150  C CG1  . VAL A 1 25  ? 0.128   8.345   0.961   1.00 0.00 ? 25  VAL A CG1  4  
ATOM 6151  C CG2  . VAL A 1 25  ? 1.047   7.272   3.022   1.00 0.00 ? 25  VAL A CG2  4  
ATOM 6152  H H    . VAL A 1 25  ? 3.473   9.755   3.134   1.00 0.00 ? 25  VAL A H    4  
ATOM 6153  H HA   . VAL A 1 25  ? 2.844   7.778   1.043   1.00 0.00 ? 25  VAL A HA   4  
ATOM 6154  H HB   . VAL A 1 25  ? 0.850   9.360   2.681   1.00 0.00 ? 25  VAL A HB   4  
ATOM 6155  H HG11 . VAL A 1 25  ? -0.868  8.221   1.358   1.00 0.00 ? 25  VAL A HG11 4  
ATOM 6156  H HG12 . VAL A 1 25  ? 0.388   7.486   0.362   1.00 0.00 ? 25  VAL A HG12 4  
ATOM 6157  H HG13 . VAL A 1 25  ? 0.161   9.238   0.344   1.00 0.00 ? 25  VAL A HG13 4  
ATOM 6158  H HG21 . VAL A 1 25  ? 0.028   7.126   3.349   1.00 0.00 ? 25  VAL A HG21 4  
ATOM 6159  H HG22 . VAL A 1 25  ? 1.683   7.432   3.881   1.00 0.00 ? 25  VAL A HG22 4  
ATOM 6160  H HG23 . VAL A 1 25  ? 1.381   6.396   2.486   1.00 0.00 ? 25  VAL A HG23 4  
ATOM 6161  N N    . ASP A 1 26  ? 2.584   9.520   -0.712  1.00 0.00 ? 26  ASP A N    4  
ATOM 6162  C CA   . ASP A 1 26  ? 2.484   10.513  -1.774  1.00 0.00 ? 26  ASP A CA   4  
ATOM 6163  C C    . ASP A 1 26  ? 1.045   10.994  -1.939  1.00 0.00 ? 26  ASP A C    4  
ATOM 6164  O O    . ASP A 1 26  ? 0.089   10.260  -1.692  1.00 0.00 ? 26  ASP A O    4  
ATOM 6165  C CB   . ASP A 1 26  ? 3.005   9.929   -3.091  1.00 0.00 ? 26  ASP A CB   4  
ATOM 6166  C CG   . ASP A 1 26  ? 2.703   10.816  -4.282  1.00 0.00 ? 26  ASP A CG   4  
ATOM 6167  O OD1  . ASP A 1 26  ? 3.027   12.023  -4.229  1.00 0.00 ? 26  ASP A OD1  4  
ATOM 6168  O OD2  . ASP A 1 26  ? 2.134   10.313  -5.269  1.00 0.00 ? 26  ASP A OD2  4  
ATOM 6169  H H    . ASP A 1 26  ? 2.683   8.581   -0.976  1.00 0.00 ? 26  ASP A H    4  
ATOM 6170  H HA   . ASP A 1 26  ? 3.100   11.356  -1.496  1.00 0.00 ? 26  ASP A HA   4  
ATOM 6171  H HB2  . ASP A 1 26  ? 4.075   9.805   -3.024  1.00 0.00 ? 26  ASP A HB2  4  
ATOM 6172  H HB3  . ASP A 1 26  ? 2.544   8.964   -3.256  1.00 0.00 ? 26  ASP A HB3  4  
ATOM 6173  N N    . HIS A 1 27  ? 0.924   12.248  -2.360  1.00 0.00 ? 27  HIS A N    4  
ATOM 6174  C CA   . HIS A 1 27  ? -0.346  12.975  -2.429  1.00 0.00 ? 27  HIS A CA   4  
ATOM 6175  C C    . HIS A 1 27  ? -1.409  12.246  -3.237  1.00 0.00 ? 27  HIS A C    4  
ATOM 6176  O O    . HIS A 1 27  ? -2.601  12.444  -3.006  1.00 0.00 ? 27  HIS A O    4  
ATOM 6177  C CB   . HIS A 1 27  ? -0.119  14.342  -3.067  1.00 0.00 ? 27  HIS A CB   4  
ATOM 6178  C CG   . HIS A 1 27  ? 0.917   15.181  -2.384  1.00 0.00 ? 27  HIS A CG   4  
ATOM 6179  N ND1  . HIS A 1 27  ? 2.150   15.449  -2.937  1.00 0.00 ? 27  HIS A ND1  4  
ATOM 6180  C CD2  . HIS A 1 27  ? 0.889   15.831  -1.200  1.00 0.00 ? 27  HIS A CD2  4  
ATOM 6181  C CE1  . HIS A 1 27  ? 2.836   16.224  -2.121  1.00 0.00 ? 27  HIS A CE1  4  
ATOM 6182  N NE2  . HIS A 1 27  ? 2.096   16.477  -1.057  1.00 0.00 ? 27  HIS A NE2  4  
ATOM 6183  H H    . HIS A 1 27  ? 1.740   12.707  -2.666  1.00 0.00 ? 27  HIS A H    4  
ATOM 6184  H HA   . HIS A 1 27  ? -0.713  13.113  -1.426  1.00 0.00 ? 27  HIS A HA   4  
ATOM 6185  H HB2  . HIS A 1 27  ? 0.200   14.191  -4.082  1.00 0.00 ? 27  HIS A HB2  4  
ATOM 6186  H HB3  . HIS A 1 27  ? -1.049  14.892  -3.065  1.00 0.00 ? 27  HIS A HB3  4  
ATOM 6187  H HD1  . HIS A 1 27  ? 2.477   15.122  -3.813  1.00 0.00 ? 27  HIS A HD1  4  
ATOM 6188  H HD2  . HIS A 1 27  ? 0.066   15.840  -0.495  1.00 0.00 ? 27  HIS A HD2  4  
ATOM 6189  H HE1  . HIS A 1 27  ? 3.837   16.595  -2.294  1.00 0.00 ? 27  HIS A HE1  4  
ATOM 6190  H HE2  . HIS A 1 27  ? 2.269   17.212  -0.427  1.00 0.00 ? 27  HIS A HE2  4  
ATOM 6191  N N    . ARG A 1 28  ? -0.979  11.416  -4.176  1.00 0.00 ? 28  ARG A N    4  
ATOM 6192  C CA   . ARG A 1 28  ? -1.899  10.739  -5.084  1.00 0.00 ? 28  ARG A CA   4  
ATOM 6193  C C    . ARG A 1 28  ? -2.716  9.667   -4.368  1.00 0.00 ? 28  ARG A C    4  
ATOM 6194  O O    . ARG A 1 28  ? -3.578  9.030   -4.970  1.00 0.00 ? 28  ARG A O    4  
ATOM 6195  C CB   . ARG A 1 28  ? -1.119  10.130  -6.242  1.00 0.00 ? 28  ARG A CB   4  
ATOM 6196  C CG   . ARG A 1 28  ? -0.370  11.160  -7.067  1.00 0.00 ? 28  ARG A CG   4  
ATOM 6197  C CD   . ARG A 1 28  ? 0.600   10.498  -8.023  1.00 0.00 ? 28  ARG A CD   4  
ATOM 6198  N NE   . ARG A 1 28  ? 1.359   11.473  -8.803  1.00 0.00 ? 28  ARG A NE   4  
ATOM 6199  C CZ   . ARG A 1 28  ? 2.666   11.672  -8.663  1.00 0.00 ? 28  ARG A CZ   4  
ATOM 6200  N NH1  . ARG A 1 28  ? 3.316   11.133  -7.639  1.00 0.00 ? 28  ARG A NH1  4  
ATOM 6201  N NH2  . ARG A 1 28  ? 3.302   12.471  -9.510  1.00 0.00 ? 28  ARG A NH2  4  
ATOM 6202  H H    . ARG A 1 28  ? -0.014  11.248  -4.262  1.00 0.00 ? 28  ARG A H    4  
ATOM 6203  H HA   . ARG A 1 28  ? -2.577  11.482  -5.476  1.00 0.00 ? 28  ARG A HA   4  
ATOM 6204  H HB2  . ARG A 1 28  ? -0.405  9.423   -5.849  1.00 0.00 ? 28  ARG A HB2  4  
ATOM 6205  H HB3  . ARG A 1 28  ? -1.808  9.610   -6.892  1.00 0.00 ? 28  ARG A HB3  4  
ATOM 6206  H HG2  . ARG A 1 28  ? -1.081  11.741  -7.636  1.00 0.00 ? 28  ARG A HG2  4  
ATOM 6207  H HG3  . ARG A 1 28  ? 0.180   11.810  -6.401  1.00 0.00 ? 28  ARG A HG3  4  
ATOM 6208  H HD2  . ARG A 1 28  ? 1.290   9.894   -7.454  1.00 0.00 ? 28  ARG A HD2  4  
ATOM 6209  H HD3  . ARG A 1 28  ? 0.042   9.867   -8.699  1.00 0.00 ? 28  ARG A HD3  4  
ATOM 6210  H HE   . ARG A 1 28  ? 0.874   11.973  -9.497  1.00 0.00 ? 28  ARG A HE   4  
ATOM 6211  H HH11 . ARG A 1 28  ? 2.820   10.573  -6.958  1.00 0.00 ? 28  ARG A HH11 4  
ATOM 6212  H HH12 . ARG A 1 28  ? 4.308   11.281  -7.528  1.00 0.00 ? 28  ARG A HH12 4  
ATOM 6213  H HH21 . ARG A 1 28  ? 2.799   12.927  -10.252 1.00 0.00 ? 28  ARG A HH21 4  
ATOM 6214  H HH22 . ARG A 1 28  ? 4.296   12.621  -9.418  1.00 0.00 ? 28  ARG A HH22 4  
ATOM 6215  N N    . CYS A 1 29  ? -2.448  9.479   -3.080  1.00 0.00 ? 29  CYS A N    4  
ATOM 6216  C CA   . CYS A 1 29  ? -3.228  8.566   -2.256  1.00 0.00 ? 29  CYS A CA   4  
ATOM 6217  C C    . CYS A 1 29  ? -4.703  8.951   -2.283  1.00 0.00 ? 29  CYS A C    4  
ATOM 6218  O O    . CYS A 1 29  ? -5.585  8.089   -2.294  1.00 0.00 ? 29  CYS A O    4  
ATOM 6219  C CB   . CYS A 1 29  ? -2.702  8.579   -0.821  1.00 0.00 ? 29  CYS A CB   4  
ATOM 6220  S SG   . CYS A 1 29  ? -3.512  7.397   0.280   1.00 0.00 ? 29  CYS A SG   4  
ATOM 6221  H H    . CYS A 1 29  ? -1.695  9.960   -2.674  1.00 0.00 ? 29  CYS A H    4  
ATOM 6222  H HA   . CYS A 1 29  ? -3.121  7.578   -2.657  1.00 0.00 ? 29  CYS A HA   4  
ATOM 6223  H HB2  . CYS A 1 29  ? -1.648  8.346   -0.831  1.00 0.00 ? 29  CYS A HB2  4  
ATOM 6224  H HB3  . CYS A 1 29  ? -2.842  9.565   -0.402  1.00 0.00 ? 29  CYS A HB3  4  
ATOM 6225  H HG   . CYS A 1 29  ? -4.711  7.884   0.574   1.00 0.00 ? 29  CYS A HG   4  
ATOM 6226  N N    . VAL A 1 30  ? -4.959  10.251  -2.331  1.00 0.00 ? 30  VAL A N    4  
ATOM 6227  C CA   . VAL A 1 30  ? -6.319  10.759  -2.325  1.00 0.00 ? 30  VAL A CA   4  
ATOM 6228  C C    . VAL A 1 30  ? -7.006  10.449  -3.646  1.00 0.00 ? 30  VAL A C    4  
ATOM 6229  O O    . VAL A 1 30  ? -8.223  10.288  -3.710  1.00 0.00 ? 30  VAL A O    4  
ATOM 6230  C CB   . VAL A 1 30  ? -6.352  12.280  -2.064  1.00 0.00 ? 30  VAL A CB   4  
ATOM 6231  C CG1  . VAL A 1 30  ? -5.497  12.618  -0.859  1.00 0.00 ? 30  VAL A CG1  4  
ATOM 6232  C CG2  . VAL A 1 30  ? -5.892  13.069  -3.283  1.00 0.00 ? 30  VAL A CG2  4  
ATOM 6233  H H    . VAL A 1 30  ? -4.213  10.884  -2.379  1.00 0.00 ? 30  VAL A H    4  
ATOM 6234  H HA   . VAL A 1 30  ? -6.855  10.266  -1.527  1.00 0.00 ? 30  VAL A HA   4  
ATOM 6235  H HB   . VAL A 1 30  ? -7.371  12.562  -1.844  1.00 0.00 ? 30  VAL A HB   4  
ATOM 6236  H HG11 . VAL A 1 30  ? -5.541  13.682  -0.671  1.00 0.00 ? 30  VAL A HG11 4  
ATOM 6237  H HG12 . VAL A 1 30  ? -4.473  12.330  -1.049  1.00 0.00 ? 30  VAL A HG12 4  
ATOM 6238  H HG13 . VAL A 1 30  ? -5.866  12.085  0.006   1.00 0.00 ? 30  VAL A HG13 4  
ATOM 6239  H HG21 . VAL A 1 30  ? -4.866  12.816  -3.510  1.00 0.00 ? 30  VAL A HG21 4  
ATOM 6240  H HG22 . VAL A 1 30  ? -5.964  14.127  -3.078  1.00 0.00 ? 30  VAL A HG22 4  
ATOM 6241  H HG23 . VAL A 1 30  ? -6.517  12.823  -4.127  1.00 0.00 ? 30  VAL A HG23 4  
ATOM 6242  N N    . ALA A 1 31  ? -6.204  10.344  -4.693  1.00 0.00 ? 31  ALA A N    4  
ATOM 6243  C CA   . ALA A 1 31  ? -6.722  10.087  -6.022  1.00 0.00 ? 31  ALA A CA   4  
ATOM 6244  C C    . ALA A 1 31  ? -7.157  8.638   -6.161  1.00 0.00 ? 31  ALA A C    4  
ATOM 6245  O O    . ALA A 1 31  ? -8.255  8.353   -6.637  1.00 0.00 ? 31  ALA A O    4  
ATOM 6246  C CB   . ALA A 1 31  ? -5.675  10.427  -7.064  1.00 0.00 ? 31  ALA A CB   4  
ATOM 6247  H H    . ALA A 1 31  ? -5.233  10.438  -4.565  1.00 0.00 ? 31  ALA A H    4  
ATOM 6248  H HA   . ALA A 1 31  ? -7.577  10.729  -6.178  1.00 0.00 ? 31  ALA A HA   4  
ATOM 6249  H HB1  . ALA A 1 31  ? -4.809  9.797   -6.921  1.00 0.00 ? 31  ALA A HB1  4  
ATOM 6250  H HB2  . ALA A 1 31  ? -5.388  11.462  -6.960  1.00 0.00 ? 31  ALA A HB2  4  
ATOM 6251  H HB3  . ALA A 1 31  ? -6.083  10.262  -8.049  1.00 0.00 ? 31  ALA A HB3  4  
ATOM 6252  N N    . THR A 1 32  ? -6.276  7.725   -5.775  1.00 0.00 ? 32  THR A N    4  
ATOM 6253  C CA   . THR A 1 32  ? -6.572  6.308   -5.842  1.00 0.00 ? 32  THR A CA   4  
ATOM 6254  C C    . THR A 1 32  ? -7.651  5.885   -4.848  1.00 0.00 ? 32  THR A C    4  
ATOM 6255  O O    . THR A 1 32  ? -8.651  5.288   -5.236  1.00 0.00 ? 32  THR A O    4  
ATOM 6256  C CB   . THR A 1 32  ? -5.309  5.480   -5.567  1.00 0.00 ? 32  THR A CB   4  
ATOM 6257  O OG1  . THR A 1 32  ? -4.207  6.014   -6.311  1.00 0.00 ? 32  THR A OG1  4  
ATOM 6258  C CG2  . THR A 1 32  ? -5.523  4.025   -5.949  1.00 0.00 ? 32  THR A CG2  4  
ATOM 6259  H H    . THR A 1 32  ? -5.375  8.003   -5.500  1.00 0.00 ? 32  THR A H    4  
ATOM 6260  H HA   . THR A 1 32  ? -6.908  6.082   -6.845  1.00 0.00 ? 32  THR A HA   4  
ATOM 6261  H HB   . THR A 1 32  ? -5.083  5.533   -4.512  1.00 0.00 ? 32  THR A HB   4  
ATOM 6262  H HG1  . THR A 1 32  ? -4.156  5.582   -7.170  1.00 0.00 ? 32  THR A HG1  4  
ATOM 6263  H HG21 . THR A 1 32  ? -5.747  3.956   -7.003  1.00 0.00 ? 32  THR A HG21 4  
ATOM 6264  H HG22 . THR A 1 32  ? -6.344  3.621   -5.379  1.00 0.00 ? 32  THR A HG22 4  
ATOM 6265  H HG23 . THR A 1 32  ? -4.624  3.462   -5.736  1.00 0.00 ? 32  THR A HG23 4  
ATOM 6266  N N    . VAL A 1 33  ? -7.461  6.199   -3.570  1.00 0.00 ? 33  VAL A N    4  
ATOM 6267  C CA   . VAL A 1 33  ? -8.304  5.619   -2.529  1.00 0.00 ? 33  VAL A CA   4  
ATOM 6268  C C    . VAL A 1 33  ? -8.886  6.676   -1.599  1.00 0.00 ? 33  VAL A C    4  
ATOM 6269  O O    . VAL A 1 33  ? -9.274  6.370   -0.476  1.00 0.00 ? 33  VAL A O    4  
ATOM 6270  C CB   . VAL A 1 33  ? -7.532  4.575   -1.693  1.00 0.00 ? 33  VAL A CB   4  
ATOM 6271  C CG1  . VAL A 1 33  ? -7.150  3.385   -2.556  1.00 0.00 ? 33  VAL A CG1  4  
ATOM 6272  C CG2  . VAL A 1 33  ? -6.295  5.193   -1.058  1.00 0.00 ? 33  VAL A CG2  4  
ATOM 6273  H H    . VAL A 1 33  ? -6.774  6.859   -3.320  1.00 0.00 ? 33  VAL A H    4  
ATOM 6274  H HA   . VAL A 1 33  ? -9.120  5.111   -3.020  1.00 0.00 ? 33  VAL A HA   4  
ATOM 6275  H HB   . VAL A 1 33  ? -8.182  4.225   -0.903  1.00 0.00 ? 33  VAL A HB   4  
ATOM 6276  H HG11 . VAL A 1 33  ? -6.608  2.667   -1.959  1.00 0.00 ? 33  VAL A HG11 4  
ATOM 6277  H HG12 . VAL A 1 33  ? -6.527  3.717   -3.373  1.00 0.00 ? 33  VAL A HG12 4  
ATOM 6278  H HG13 . VAL A 1 33  ? -8.043  2.923   -2.950  1.00 0.00 ? 33  VAL A HG13 4  
ATOM 6279  H HG21 . VAL A 1 33  ? -6.590  6.010   -0.415  1.00 0.00 ? 33  VAL A HG21 4  
ATOM 6280  H HG22 . VAL A 1 33  ? -5.640  5.564   -1.831  1.00 0.00 ? 33  VAL A HG22 4  
ATOM 6281  H HG23 . VAL A 1 33  ? -5.777  4.446   -0.474  1.00 0.00 ? 33  VAL A HG23 4  
ATOM 6282  N N    . GLY A 1 34  ? -8.940  7.913   -2.064  1.00 0.00 ? 34  GLY A N    4  
ATOM 6283  C CA   . GLY A 1 34  ? -9.595  8.969   -1.305  1.00 0.00 ? 34  GLY A CA   4  
ATOM 6284  C C    . GLY A 1 34  ? -8.826  9.433   -0.073  1.00 0.00 ? 34  GLY A C    4  
ATOM 6285  O O    . GLY A 1 34  ? -8.948  10.591  0.331   1.00 0.00 ? 34  GLY A O    4  
ATOM 6286  H H    . GLY A 1 34  ? -8.556  8.105   -2.947  1.00 0.00 ? 34  GLY A H    4  
ATOM 6287  H HA2  . GLY A 1 34  ? -9.747  9.817   -1.951  1.00 0.00 ? 34  GLY A HA2  4  
ATOM 6288  H HA3  . GLY A 1 34  ? -10.563 8.603   -0.983  1.00 0.00 ? 34  GLY A HA3  4  
ATOM 6289  N N    . TYR A 1 35  ? -8.053  8.539   0.532   1.00 0.00 ? 35  TYR A N    4  
ATOM 6290  C CA   . TYR A 1 35  ? -7.356  8.851   1.771   1.00 0.00 ? 35  TYR A CA   4  
ATOM 6291  C C    . TYR A 1 35  ? -6.218  9.815   1.531   1.00 0.00 ? 35  TYR A C    4  
ATOM 6292  O O    . TYR A 1 35  ? -5.469  9.688   0.570   1.00 0.00 ? 35  TYR A O    4  
ATOM 6293  C CB   . TYR A 1 35  ? -6.793  7.591   2.434   1.00 0.00 ? 35  TYR A CB   4  
ATOM 6294  C CG   . TYR A 1 35  ? -7.840  6.614   2.912   1.00 0.00 ? 35  TYR A CG   4  
ATOM 6295  C CD1  . TYR A 1 35  ? -9.084  7.055   3.338   1.00 0.00 ? 35  TYR A CD1  4  
ATOM 6296  C CD2  . TYR A 1 35  ? -7.575  5.251   2.960   1.00 0.00 ? 35  TYR A CD2  4  
ATOM 6297  C CE1  . TYR A 1 35  ? -10.037 6.170   3.798   1.00 0.00 ? 35  TYR A CE1  4  
ATOM 6298  C CE2  . TYR A 1 35  ? -8.523  4.357   3.415   1.00 0.00 ? 35  TYR A CE2  4  
ATOM 6299  C CZ   . TYR A 1 35  ? -9.754  4.822   3.833   1.00 0.00 ? 35  TYR A CZ   4  
ATOM 6300  O OH   . TYR A 1 35  ? -10.704 3.938   4.291   1.00 0.00 ? 35  TYR A OH   4  
ATOM 6301  H H    . TYR A 1 35  ? -7.954  7.649   0.136   1.00 0.00 ? 35  TYR A H    4  
ATOM 6302  H HA   . TYR A 1 35  ? -8.064  9.312   2.441   1.00 0.00 ? 35  TYR A HA   4  
ATOM 6303  H HB2  . TYR A 1 35  ? -6.156  7.079   1.733   1.00 0.00 ? 35  TYR A HB2  4  
ATOM 6304  H HB3  . TYR A 1 35  ? -6.202  7.885   3.291   1.00 0.00 ? 35  TYR A HB3  4  
ATOM 6305  H HD1  . TYR A 1 35  ? -9.304  8.111   3.306   1.00 0.00 ? 35  TYR A HD1  4  
ATOM 6306  H HD2  . TYR A 1 35  ? -6.610  4.891   2.631   1.00 0.00 ? 35  TYR A HD2  4  
ATOM 6307  H HE1  . TYR A 1 35  ? -11.002 6.538   4.125   1.00 0.00 ? 35  TYR A HE1  4  
ATOM 6308  H HE2  . TYR A 1 35  ? -8.296  3.298   3.445   1.00 0.00 ? 35  TYR A HE2  4  
ATOM 6309  H HH   . TYR A 1 35  ? -10.291 3.310   4.891   1.00 0.00 ? 35  TYR A HH   4  
ATOM 6310  N N    . GLN A 1 36  ? -6.089  10.768  2.427   1.00 0.00 ? 36  GLN A N    4  
ATOM 6311  C CA   . GLN A 1 36  ? -4.968  11.677  2.405   1.00 0.00 ? 36  GLN A CA   4  
ATOM 6312  C C    . GLN A 1 36  ? -3.747  10.960  2.945   1.00 0.00 ? 36  GLN A C    4  
ATOM 6313  O O    . GLN A 1 36  ? -3.895  10.026  3.734   1.00 0.00 ? 36  GLN A O    4  
ATOM 6314  C CB   . GLN A 1 36  ? -5.253  12.908  3.272   1.00 0.00 ? 36  GLN A CB   4  
ATOM 6315  C CG   . GLN A 1 36  ? -6.336  13.823  2.732   1.00 0.00 ? 36  GLN A CG   4  
ATOM 6316  C CD   . GLN A 1 36  ? -5.809  14.772  1.673   1.00 0.00 ? 36  GLN A CD   4  
ATOM 6317  O OE1  . GLN A 1 36  ? -4.632  15.142  1.688   1.00 0.00 ? 36  GLN A OE1  4  
ATOM 6318  N NE2  . GLN A 1 36  ? -6.670  15.179  0.756   1.00 0.00 ? 36  GLN A NE2  4  
ATOM 6319  H H    . GLN A 1 36  ? -6.754  10.833  3.138   1.00 0.00 ? 36  GLN A H    4  
ATOM 6320  H HA   . GLN A 1 36  ? -4.786  11.973  1.379   1.00 0.00 ? 36  GLN A HA   4  
ATOM 6321  H HB2  . GLN A 1 36  ? -5.556  12.575  4.253   1.00 0.00 ? 36  GLN A HB2  4  
ATOM 6322  H HB3  . GLN A 1 36  ? -4.343  13.483  3.366   1.00 0.00 ? 36  GLN A HB3  4  
ATOM 6323  H HG2  . GLN A 1 36  ? -7.117  13.214  2.298   1.00 0.00 ? 36  GLN A HG2  4  
ATOM 6324  H HG3  . GLN A 1 36  ? -6.742  14.404  3.547   1.00 0.00 ? 36  GLN A HG3  4  
ATOM 6325  H HE21 . GLN A 1 36  ? -7.591  14.854  0.809   1.00 0.00 ? 36  GLN A HE21 4  
ATOM 6326  H HE22 . GLN A 1 36  ? -6.348  15.787  0.053   1.00 0.00 ? 36  GLN A HE22 4  
ATOM 6327  N N    . PRO A 1 37  ? -2.539  11.357  2.535   1.00 0.00 ? 37  PRO A N    4  
ATOM 6328  C CA   . PRO A 1 37  ? -1.311  10.790  3.091   1.00 0.00 ? 37  PRO A CA   4  
ATOM 6329  C C    . PRO A 1 37  ? -1.366  10.762  4.614   1.00 0.00 ? 37  PRO A C    4  
ATOM 6330  O O    . PRO A 1 37  ? -1.128  9.733   5.242   1.00 0.00 ? 37  PRO A O    4  
ATOM 6331  C CB   . PRO A 1 37  ? -0.236  11.758  2.600   1.00 0.00 ? 37  PRO A CB   4  
ATOM 6332  C CG   . PRO A 1 37  ? -0.777  12.286  1.317   1.00 0.00 ? 37  PRO A CG   4  
ATOM 6333  C CD   . PRO A 1 37  ? -2.268  12.367  1.499   1.00 0.00 ? 37  PRO A CD   4  
ATOM 6334  H HA   . PRO A 1 37  ? -1.118  9.797   2.714   1.00 0.00 ? 37  PRO A HA   4  
ATOM 6335  H HB2  . PRO A 1 37  ? -0.096  12.545  3.327   1.00 0.00 ? 37  PRO A HB2  4  
ATOM 6336  H HB3  . PRO A 1 37  ? 0.692   11.227  2.449   1.00 0.00 ? 37  PRO A HB3  4  
ATOM 6337  H HG2  . PRO A 1 37  ? -0.371  13.268  1.122   1.00 0.00 ? 37  PRO A HG2  4  
ATOM 6338  H HG3  . PRO A 1 37  ? -0.535  11.611  0.509   1.00 0.00 ? 37  PRO A HG3  4  
ATOM 6339  H HD2  . PRO A 1 37  ? -2.554  13.351  1.837   1.00 0.00 ? 37  PRO A HD2  4  
ATOM 6340  H HD3  . PRO A 1 37  ? -2.776  12.120  0.580   1.00 0.00 ? 37  PRO A HD3  4  
ATOM 6341  N N    . GLN A 1 38  ? -1.750  11.901  5.180   1.00 0.00 ? 38  GLN A N    4  
ATOM 6342  C CA   . GLN A 1 38  ? -1.896  12.052  6.622   1.00 0.00 ? 38  GLN A CA   4  
ATOM 6343  C C    . GLN A 1 38  ? -2.862  11.009  7.188   1.00 0.00 ? 38  GLN A C    4  
ATOM 6344  O O    . GLN A 1 38  ? -2.573  10.371  8.198   1.00 0.00 ? 38  GLN A O    4  
ATOM 6345  C CB   . GLN A 1 38  ? -2.405  13.457  6.948   1.00 0.00 ? 38  GLN A CB   4  
ATOM 6346  C CG   . GLN A 1 38  ? -1.532  14.575  6.395   1.00 0.00 ? 38  GLN A CG   4  
ATOM 6347  C CD   . GLN A 1 38  ? -0.166  14.635  7.050   1.00 0.00 ? 38  GLN A CD   4  
ATOM 6348  O OE1  . GLN A 1 38  ? 0.018   15.300  8.069   1.00 0.00 ? 38  GLN A OE1  4  
ATOM 6349  N NE2  . GLN A 1 38  ? 0.805   13.950  6.469   1.00 0.00 ? 38  GLN A NE2  4  
ATOM 6350  H H    . GLN A 1 38  ? -1.944  12.663  4.598   1.00 0.00 ? 38  GLN A H    4  
ATOM 6351  H HA   . GLN A 1 38  ? -0.926  11.914  7.074   1.00 0.00 ? 38  GLN A HA   4  
ATOM 6352  H HB2  . GLN A 1 38  ? -3.398  13.571  6.538   1.00 0.00 ? 38  GLN A HB2  4  
ATOM 6353  H HB3  . GLN A 1 38  ? -2.454  13.568  8.020   1.00 0.00 ? 38  GLN A HB3  4  
ATOM 6354  H HG2  . GLN A 1 38  ? -1.396  14.413  5.335   1.00 0.00 ? 38  GLN A HG2  4  
ATOM 6355  H HG3  . GLN A 1 38  ? -2.034  15.519  6.551   1.00 0.00 ? 38  GLN A HG3  4  
ATOM 6356  H HE21 . GLN A 1 38  ? 0.596   13.445  5.656   1.00 0.00 ? 38  GLN A HE21 4  
ATOM 6357  H HE22 . GLN A 1 38  ? 1.696   13.976  6.878   1.00 0.00 ? 38  GLN A HE22 4  
ATOM 6358  N N    . GLU A 1 39  ? -3.989  10.817  6.498   1.00 0.00 ? 39  GLU A N    4  
ATOM 6359  C CA   . GLU A 1 39  ? -5.047  9.913   6.955   1.00 0.00 ? 39  GLU A CA   4  
ATOM 6360  C C    . GLU A 1 39  ? -4.527  8.492   7.107   1.00 0.00 ? 39  GLU A C    4  
ATOM 6361  O O    . GLU A 1 39  ? -4.972  7.743   7.980   1.00 0.00 ? 39  GLU A O    4  
ATOM 6362  C CB   . GLU A 1 39  ? -6.209  9.910   5.956   1.00 0.00 ? 39  GLU A CB   4  
ATOM 6363  C CG   . GLU A 1 39  ? -7.018  11.194  5.938   1.00 0.00 ? 39  GLU A CG   4  
ATOM 6364  C CD   . GLU A 1 39  ? -7.926  11.322  7.141   1.00 0.00 ? 39  GLU A CD   4  
ATOM 6365  O OE1  . GLU A 1 39  ? -7.462  11.801  8.195   1.00 0.00 ? 39  GLU A OE1  4  
ATOM 6366  O OE2  . GLU A 1 39  ? -9.114  10.943  7.036   1.00 0.00 ? 39  GLU A OE2  4  
ATOM 6367  H H    . GLU A 1 39  ? -4.100  11.277  5.638   1.00 0.00 ? 39  GLU A H    4  
ATOM 6368  H HA   . GLU A 1 39  ? -5.402  10.265  7.912   1.00 0.00 ? 39  GLU A HA   4  
ATOM 6369  H HB2  . GLU A 1 39  ? -5.813  9.751   4.964   1.00 0.00 ? 39  GLU A HB2  4  
ATOM 6370  H HB3  . GLU A 1 39  ? -6.875  9.096   6.201   1.00 0.00 ? 39  GLU A HB3  4  
ATOM 6371  H HG2  . GLU A 1 39  ? -6.337  12.033  5.932   1.00 0.00 ? 39  GLU A HG2  4  
ATOM 6372  H HG3  . GLU A 1 39  ? -7.622  11.214  5.043   1.00 0.00 ? 39  GLU A HG3  4  
ATOM 6373  N N    . LEU A 1 40  ? -3.588  8.135   6.250   1.00 0.00 ? 40  LEU A N    4  
ATOM 6374  C CA   . LEU A 1 40  ? -3.081  6.780   6.187   1.00 0.00 ? 40  LEU A CA   4  
ATOM 6375  C C    . LEU A 1 40  ? -1.894  6.591   7.139   1.00 0.00 ? 40  LEU A C    4  
ATOM 6376  O O    . LEU A 1 40  ? -1.619  5.476   7.587   1.00 0.00 ? 40  LEU A O    4  
ATOM 6377  C CB   . LEU A 1 40  ? -2.679  6.487   4.740   1.00 0.00 ? 40  LEU A CB   4  
ATOM 6378  C CG   . LEU A 1 40  ? -2.626  5.014   4.343   1.00 0.00 ? 40  LEU A CG   4  
ATOM 6379  C CD1  . LEU A 1 40  ? -3.935  4.318   4.683   1.00 0.00 ? 40  LEU A CD1  4  
ATOM 6380  C CD2  . LEU A 1 40  ? -2.338  4.895   2.855   1.00 0.00 ? 40  LEU A CD2  4  
ATOM 6381  H H    . LEU A 1 40  ? -3.233  8.800   5.622   1.00 0.00 ? 40  LEU A H    4  
ATOM 6382  H HA   . LEU A 1 40  ? -3.875  6.109   6.475   1.00 0.00 ? 40  LEU A HA   4  
ATOM 6383  H HB2  . LEU A 1 40  ? -3.382  6.985   4.089   1.00 0.00 ? 40  LEU A HB2  4  
ATOM 6384  H HB3  . LEU A 1 40  ? -1.701  6.914   4.571   1.00 0.00 ? 40  LEU A HB3  4  
ATOM 6385  H HG   . LEU A 1 40  ? -1.830  4.523   4.884   1.00 0.00 ? 40  LEU A HG   4  
ATOM 6386  H HD11 . LEU A 1 40  ? -4.742  4.777   4.130   1.00 0.00 ? 40  LEU A HD11 4  
ATOM 6387  H HD12 . LEU A 1 40  ? -4.128  4.409   5.741   1.00 0.00 ? 40  LEU A HD12 4  
ATOM 6388  H HD13 . LEU A 1 40  ? -3.869  3.274   4.419   1.00 0.00 ? 40  LEU A HD13 4  
ATOM 6389  H HD21 . LEU A 1 40  ? -1.379  5.341   2.638   1.00 0.00 ? 40  LEU A HD21 4  
ATOM 6390  H HD22 . LEU A 1 40  ? -3.108  5.410   2.298   1.00 0.00 ? 40  LEU A HD22 4  
ATOM 6391  H HD23 . LEU A 1 40  ? -2.323  3.854   2.572   1.00 0.00 ? 40  LEU A HD23 4  
ATOM 6392  N N    . LEU A 1 41  ? -1.201  7.685   7.447   1.00 0.00 ? 41  LEU A N    4  
ATOM 6393  C CA   . LEU A 1 41  ? -0.034  7.630   8.328   1.00 0.00 ? 41  LEU A CA   4  
ATOM 6394  C C    . LEU A 1 41  ? -0.414  7.159   9.727   1.00 0.00 ? 41  LEU A C    4  
ATOM 6395  O O    . LEU A 1 41  ? -1.115  7.854   10.467  1.00 0.00 ? 41  LEU A O    4  
ATOM 6396  C CB   . LEU A 1 41  ? 0.656   8.993   8.419   1.00 0.00 ? 41  LEU A CB   4  
ATOM 6397  C CG   . LEU A 1 41  ? 1.117   9.591   7.092   1.00 0.00 ? 41  LEU A CG   4  
ATOM 6398  C CD1  . LEU A 1 41  ? 1.794   10.928  7.327   1.00 0.00 ? 41  LEU A CD1  4  
ATOM 6399  C CD2  . LEU A 1 41  ? 2.052   8.641   6.367   1.00 0.00 ? 41  LEU A CD2  4  
ATOM 6400  H H    . LEU A 1 41  ? -1.465  8.542   7.043   1.00 0.00 ? 41  LEU A H    4  
ATOM 6401  H HA   . LEU A 1 41  ? 0.660   6.920   7.904   1.00 0.00 ? 41  LEU A HA   4  
ATOM 6402  H HB2  . LEU A 1 41  ? -0.026  9.687   8.886   1.00 0.00 ? 41  LEU A HB2  4  
ATOM 6403  H HB3  . LEU A 1 41  ? 1.523   8.885   9.056   1.00 0.00 ? 41  LEU A HB3  4  
ATOM 6404  H HG   . LEU A 1 41  ? 0.255   9.761   6.462   1.00 0.00 ? 41  LEU A HG   4  
ATOM 6405  H HD11 . LEU A 1 41  ? 2.659   10.788  7.958   1.00 0.00 ? 41  LEU A HD11 4  
ATOM 6406  H HD12 . LEU A 1 41  ? 1.103   11.604  7.809   1.00 0.00 ? 41  LEU A HD12 4  
ATOM 6407  H HD13 . LEU A 1 41  ? 2.103   11.346  6.380   1.00 0.00 ? 41  LEU A HD13 4  
ATOM 6408  H HD21 . LEU A 1 41  ? 2.925   8.459   6.976   1.00 0.00 ? 41  LEU A HD21 4  
ATOM 6409  H HD22 . LEU A 1 41  ? 2.355   9.079   5.427   1.00 0.00 ? 41  LEU A HD22 4  
ATOM 6410  H HD23 . LEU A 1 41  ? 1.543   7.707   6.180   1.00 0.00 ? 41  LEU A HD23 4  
ATOM 6411  N N    . GLY A 1 42  ? 0.052   5.970   10.082  1.00 0.00 ? 42  GLY A N    4  
ATOM 6412  C CA   . GLY A 1 42  ? -0.195  5.441   11.408  1.00 0.00 ? 42  GLY A CA   4  
ATOM 6413  C C    . GLY A 1 42  ? -1.190  4.301   11.405  1.00 0.00 ? 42  GLY A C    4  
ATOM 6414  O O    . GLY A 1 42  ? -1.363  3.621   12.416  1.00 0.00 ? 42  GLY A O    4  
ATOM 6415  H H    . GLY A 1 42  ? 0.567   5.444   9.436   1.00 0.00 ? 42  GLY A H    4  
ATOM 6416  H HA2  . GLY A 1 42  ? 0.739   5.088   11.821  1.00 0.00 ? 42  GLY A HA2  4  
ATOM 6417  H HA3  . GLY A 1 42  ? -0.575  6.234   12.035  1.00 0.00 ? 42  GLY A HA3  4  
ATOM 6418  N N    . LYS A 1 43  ? -1.853  4.087   10.277  1.00 0.00 ? 43  LYS A N    4  
ATOM 6419  C CA   . LYS A 1 43  ? -2.827  3.018   10.168  1.00 0.00 ? 43  LYS A CA   4  
ATOM 6420  C C    . LYS A 1 43  ? -2.275  1.860   9.355   1.00 0.00 ? 43  LYS A C    4  
ATOM 6421  O O    . LYS A 1 43  ? -1.321  2.016   8.589   1.00 0.00 ? 43  LYS A O    4  
ATOM 6422  C CB   . LYS A 1 43  ? -4.110  3.542   9.536   1.00 0.00 ? 43  LYS A CB   4  
ATOM 6423  C CG   . LYS A 1 43  ? -4.762  4.633   10.356  1.00 0.00 ? 43  LYS A CG   4  
ATOM 6424  C CD   . LYS A 1 43  ? -6.102  5.042   9.780   1.00 0.00 ? 43  LYS A CD   4  
ATOM 6425  C CE   . LYS A 1 43  ? -6.785  6.056   10.673  1.00 0.00 ? 43  LYS A CE   4  
ATOM 6426  N NZ   . LYS A 1 43  ? -6.038  7.341   10.724  1.00 0.00 ? 43  LYS A NZ   4  
ATOM 6427  H H    . LYS A 1 43  ? -1.686  4.658   9.498   1.00 0.00 ? 43  LYS A H    4  
ATOM 6428  H HA   . LYS A 1 43  ? -3.046  2.668   11.166  1.00 0.00 ? 43  LYS A HA   4  
ATOM 6429  H HB2  . LYS A 1 43  ? -3.882  3.939   8.558   1.00 0.00 ? 43  LYS A HB2  4  
ATOM 6430  H HB3  . LYS A 1 43  ? -4.811  2.726   9.434   1.00 0.00 ? 43  LYS A HB3  4  
ATOM 6431  H HG2  . LYS A 1 43  ? -4.907  4.272   11.362  1.00 0.00 ? 43  LYS A HG2  4  
ATOM 6432  H HG3  . LYS A 1 43  ? -4.111  5.494   10.373  1.00 0.00 ? 43  LYS A HG3  4  
ATOM 6433  H HD2  . LYS A 1 43  ? -5.948  5.482   8.807   1.00 0.00 ? 43  LYS A HD2  4  
ATOM 6434  H HD3  . LYS A 1 43  ? -6.731  4.168   9.694   1.00 0.00 ? 43  LYS A HD3  4  
ATOM 6435  H HE2  . LYS A 1 43  ? -7.780  6.241   10.297  1.00 0.00 ? 43  LYS A HE2  4  
ATOM 6436  H HE3  . LYS A 1 43  ? -6.843  5.641   11.669  1.00 0.00 ? 43  LYS A HE3  4  
ATOM 6437  H HZ1  . LYS A 1 43  ? -6.504  8.005   11.377  1.00 0.00 ? 43  LYS A HZ1  4  
ATOM 6438  H HZ2  . LYS A 1 43  ? -5.998  7.774   9.780   1.00 0.00 ? 43  LYS A HZ2  4  
ATOM 6439  H HZ3  . LYS A 1 43  ? -5.061  7.178   11.056  1.00 0.00 ? 43  LYS A HZ3  4  
ATOM 6440  N N    . ASN A 1 44  ? -2.883  0.698   9.538   1.00 0.00 ? 44  ASN A N    4  
ATOM 6441  C CA   . ASN A 1 44  ? -2.459  -0.512  8.847   1.00 0.00 ? 44  ASN A CA   4  
ATOM 6442  C C    . ASN A 1 44  ? -3.175  -0.648  7.516   1.00 0.00 ? 44  ASN A C    4  
ATOM 6443  O O    . ASN A 1 44  ? -4.400  -0.545  7.443   1.00 0.00 ? 44  ASN A O    4  
ATOM 6444  C CB   . ASN A 1 44  ? -2.768  -1.752  9.695   1.00 0.00 ? 44  ASN A CB   4  
ATOM 6445  C CG   . ASN A 1 44  ? -1.877  -1.888  10.917  1.00 0.00 ? 44  ASN A CG   4  
ATOM 6446  O OD1  . ASN A 1 44  ? -2.187  -1.355  11.985  1.00 0.00 ? 44  ASN A OD1  4  
ATOM 6447  N ND2  . ASN A 1 44  ? -0.774  -2.611  10.783  1.00 0.00 ? 44  ASN A ND2  4  
ATOM 6448  H H    . ASN A 1 44  ? -3.650  0.647   10.156  1.00 0.00 ? 44  ASN A H    4  
ATOM 6449  H HA   . ASN A 1 44  ? -1.395  -0.454  8.676   1.00 0.00 ? 44  ASN A HA   4  
ATOM 6450  H HB2  . ASN A 1 44  ? -3.789  -1.686  10.034  1.00 0.00 ? 44  ASN A HB2  4  
ATOM 6451  H HB3  . ASN A 1 44  ? -2.660  -2.636  9.080   1.00 0.00 ? 44  ASN A HB3  4  
ATOM 6452  H HD21 . ASN A 1 44  ? -0.581  -3.020  9.909   1.00 0.00 ? 44  ASN A HD21 4  
ATOM 6453  H HD22 . ASN A 1 44  ? -0.188  -2.709  11.564  1.00 0.00 ? 44  ASN A HD22 4  
ATOM 6454  N N    . ILE A 1 45  ? -2.399  -0.896  6.467   1.00 0.00 ? 45  ILE A N    4  
ATOM 6455  C CA   . ILE A 1 45  ? -2.951  -1.179  5.146   1.00 0.00 ? 45  ILE A CA   4  
ATOM 6456  C C    . ILE A 1 45  ? -3.837  -2.427  5.196   1.00 0.00 ? 45  ILE A C    4  
ATOM 6457  O O    . ILE A 1 45  ? -4.741  -2.592  4.386   1.00 0.00 ? 45  ILE A O    4  
ATOM 6458  C CB   . ILE A 1 45  ? -1.823  -1.382  4.100   1.00 0.00 ? 45  ILE A CB   4  
ATOM 6459  C CG1  . ILE A 1 45  ? -2.404  -1.614  2.701   1.00 0.00 ? 45  ILE A CG1  4  
ATOM 6460  C CG2  . ILE A 1 45  ? -0.918  -2.541  4.502   1.00 0.00 ? 45  ILE A CG2  4  
ATOM 6461  C CD1  . ILE A 1 45  ? -1.351  -1.774  1.623   1.00 0.00 ? 45  ILE A CD1  4  
ATOM 6462  H H    . ILE A 1 45  ? -1.423  -0.865  6.579   1.00 0.00 ? 45  ILE A H    4  
ATOM 6463  H HA   . ILE A 1 45  ? -3.554  -0.331  4.842   1.00 0.00 ? 45  ILE A HA   4  
ATOM 6464  H HB   . ILE A 1 45  ? -1.223  -0.486  4.086   1.00 0.00 ? 45  ILE A HB   4  
ATOM 6465  H HG12 . ILE A 1 45  ? -3.006  -2.511  2.711   1.00 0.00 ? 45  ILE A HG12 4  
ATOM 6466  H HG13 . ILE A 1 45  ? -3.028  -0.773  2.434   1.00 0.00 ? 45  ILE A HG13 4  
ATOM 6467  H HG21 . ILE A 1 45  ? -0.465  -2.328  5.460   1.00 0.00 ? 45  ILE A HG21 4  
ATOM 6468  H HG22 . ILE A 1 45  ? -0.144  -2.669  3.760   1.00 0.00 ? 45  ILE A HG22 4  
ATOM 6469  H HG23 . ILE A 1 45  ? -1.502  -3.446  4.575   1.00 0.00 ? 45  ILE A HG23 4  
ATOM 6470  H HD11 . ILE A 1 45  ? -1.834  -1.948  0.672   1.00 0.00 ? 45  ILE A HD11 4  
ATOM 6471  H HD12 . ILE A 1 45  ? -0.715  -2.612  1.862   1.00 0.00 ? 45  ILE A HD12 4  
ATOM 6472  H HD13 . ILE A 1 45  ? -0.756  -0.874  1.566   1.00 0.00 ? 45  ILE A HD13 4  
ATOM 6473  N N    . VAL A 1 46  ? -3.571  -3.289  6.175   1.00 0.00 ? 46  VAL A N    4  
ATOM 6474  C CA   . VAL A 1 46  ? -4.336  -4.511  6.362   1.00 0.00 ? 46  VAL A CA   4  
ATOM 6475  C C    . VAL A 1 46  ? -5.748  -4.196  6.862   1.00 0.00 ? 46  VAL A C    4  
ATOM 6476  O O    . VAL A 1 46  ? -6.703  -4.894  6.535   1.00 0.00 ? 46  VAL A O    4  
ATOM 6477  C CB   . VAL A 1 46  ? -3.620  -5.448  7.360   1.00 0.00 ? 46  VAL A CB   4  
ATOM 6478  C CG1  . VAL A 1 46  ? -4.409  -6.731  7.578   1.00 0.00 ? 46  VAL A CG1  4  
ATOM 6479  C CG2  . VAL A 1 46  ? -2.213  -5.763  6.874   1.00 0.00 ? 46  VAL A CG2  4  
ATOM 6480  H H    . VAL A 1 46  ? -2.840  -3.094  6.793   1.00 0.00 ? 46  VAL A H    4  
ATOM 6481  H HA   . VAL A 1 46  ? -4.404  -5.016  5.409   1.00 0.00 ? 46  VAL A HA   4  
ATOM 6482  H HB   . VAL A 1 46  ? -3.540  -4.932  8.305   1.00 0.00 ? 46  VAL A HB   4  
ATOM 6483  H HG11 . VAL A 1 46  ? -4.503  -7.260  6.639   1.00 0.00 ? 46  VAL A HG11 4  
ATOM 6484  H HG12 . VAL A 1 46  ? -5.393  -6.488  7.953   1.00 0.00 ? 46  VAL A HG12 4  
ATOM 6485  H HG13 . VAL A 1 46  ? -3.894  -7.354  8.293   1.00 0.00 ? 46  VAL A HG13 4  
ATOM 6486  H HG21 . VAL A 1 46  ? -1.722  -6.413  7.586   1.00 0.00 ? 46  VAL A HG21 4  
ATOM 6487  H HG22 . VAL A 1 46  ? -1.651  -4.845  6.779   1.00 0.00 ? 46  VAL A HG22 4  
ATOM 6488  H HG23 . VAL A 1 46  ? -2.263  -6.255  5.914   1.00 0.00 ? 46  VAL A HG23 4  
ATOM 6489  N N    . GLU A 1 47  ? -5.876  -3.113  7.622   1.00 0.00 ? 47  GLU A N    4  
ATOM 6490  C CA   . GLU A 1 47  ? -7.168  -2.705  8.165   1.00 0.00 ? 47  GLU A CA   4  
ATOM 6491  C C    . GLU A 1 47  ? -8.057  -2.156  7.058   1.00 0.00 ? 47  GLU A C    4  
ATOM 6492  O O    . GLU A 1 47  ? -9.279  -2.281  7.104   1.00 0.00 ? 47  GLU A O    4  
ATOM 6493  C CB   . GLU A 1 47  ? -6.986  -1.657  9.262   1.00 0.00 ? 47  GLU A CB   4  
ATOM 6494  C CG   . GLU A 1 47  ? -6.273  -2.187  10.496  1.00 0.00 ? 47  GLU A CG   4  
ATOM 6495  C CD   . GLU A 1 47  ? -7.105  -3.184  11.277  1.00 0.00 ? 47  GLU A CD   4  
ATOM 6496  O OE1  . GLU A 1 47  ? -8.001  -2.752  12.033  1.00 0.00 ? 47  GLU A OE1  4  
ATOM 6497  O OE2  . GLU A 1 47  ? -6.850  -4.401  11.155  1.00 0.00 ? 47  GLU A OE2  4  
ATOM 6498  H H    . GLU A 1 47  ? -5.086  -2.565  7.808   1.00 0.00 ? 47  GLU A H    4  
ATOM 6499  H HA   . GLU A 1 47  ? -7.638  -3.579  8.590   1.00 0.00 ? 47  GLU A HA   4  
ATOM 6500  H HB2  . GLU A 1 47  ? -6.410  -0.835  8.864   1.00 0.00 ? 47  GLU A HB2  4  
ATOM 6501  H HB3  . GLU A 1 47  ? -7.958  -1.292  9.562   1.00 0.00 ? 47  GLU A HB3  4  
ATOM 6502  H HG2  . GLU A 1 47  ? -5.367  -2.677  10.183  1.00 0.00 ? 47  GLU A HG2  4  
ATOM 6503  H HG3  . GLU A 1 47  ? -6.030  -1.356  11.142  1.00 0.00 ? 47  GLU A HG3  4  
ATOM 6504  N N    . PHE A 1 48  ? -7.431  -1.548  6.057   1.00 0.00 ? 48  PHE A N    4  
ATOM 6505  C CA   . PHE A 1 48  ? -8.156  -1.042  4.903   1.00 0.00 ? 48  PHE A CA   4  
ATOM 6506  C C    . PHE A 1 48  ? -8.106  -2.047  3.768   1.00 0.00 ? 48  PHE A C    4  
ATOM 6507  O O    . PHE A 1 48  ? -8.548  -1.765  2.655   1.00 0.00 ? 48  PHE A O    4  
ATOM 6508  C CB   . PHE A 1 48  ? -7.583  0.291   4.433   1.00 0.00 ? 48  PHE A CB   4  
ATOM 6509  C CG   . PHE A 1 48  ? -7.606  1.354   5.485   1.00 0.00 ? 48  PHE A CG   4  
ATOM 6510  C CD1  . PHE A 1 48  ? -8.807  1.910   5.907   1.00 0.00 ? 48  PHE A CD1  4  
ATOM 6511  C CD2  . PHE A 1 48  ? -6.428  1.797   6.056   1.00 0.00 ? 48  PHE A CD2  4  
ATOM 6512  C CE1  . PHE A 1 48  ? -8.823  2.889   6.880   1.00 0.00 ? 48  PHE A CE1  4  
ATOM 6513  C CE2  . PHE A 1 48  ? -6.439  2.773   7.027   1.00 0.00 ? 48  PHE A CE2  4  
ATOM 6514  C CZ   . PHE A 1 48  ? -7.636  3.320   7.439   1.00 0.00 ? 48  PHE A CZ   4  
ATOM 6515  H H    . PHE A 1 48  ? -6.457  -1.440  6.099   1.00 0.00 ? 48  PHE A H    4  
ATOM 6516  H HA   . PHE A 1 48  ? -9.185  -0.898  5.196   1.00 0.00 ? 48  PHE A HA   4  
ATOM 6517  H HB2  . PHE A 1 48  ? -6.557  0.147   4.130   1.00 0.00 ? 48  PHE A HB2  4  
ATOM 6518  H HB3  . PHE A 1 48  ? -8.158  0.643   3.590   1.00 0.00 ? 48  PHE A HB3  4  
ATOM 6519  H HD1  . PHE A 1 48  ? -9.737  1.572   5.466   1.00 0.00 ? 48  PHE A HD1  4  
ATOM 6520  H HD2  . PHE A 1 48  ? -5.491  1.370   5.732   1.00 0.00 ? 48  PHE A HD2  4  
ATOM 6521  H HE1  . PHE A 1 48  ? -9.762  3.317   7.202   1.00 0.00 ? 48  PHE A HE1  4  
ATOM 6522  H HE2  . PHE A 1 48  ? -5.511  3.109   7.465   1.00 0.00 ? 48  PHE A HE2  4  
ATOM 6523  H HZ   . PHE A 1 48  ? -7.643  4.086   8.199   1.00 0.00 ? 48  PHE A HZ   4  
ATOM 6524  N N    . CYS A 1 49  ? -7.548  -3.212  4.052   1.00 0.00 ? 49  CYS A N    4  
ATOM 6525  C CA   . CYS A 1 49  ? -7.527  -4.286  3.082   1.00 0.00 ? 49  CYS A CA   4  
ATOM 6526  C C    . CYS A 1 49  ? -8.776  -5.131  3.231   1.00 0.00 ? 49  CYS A C    4  
ATOM 6527  O O    . CYS A 1 49  ? -9.244  -5.373  4.345   1.00 0.00 ? 49  CYS A O    4  
ATOM 6528  C CB   . CYS A 1 49  ? -6.290  -5.167  3.258   1.00 0.00 ? 49  CYS A CB   4  
ATOM 6529  S SG   . CYS A 1 49  ? -6.180  -6.509  2.048   1.00 0.00 ? 49  CYS A SG   4  
ATOM 6530  H H    . CYS A 1 49  ? -7.146  -3.354  4.937   1.00 0.00 ? 49  CYS A H    4  
ATOM 6531  H HA   . CYS A 1 49  ? -7.512  -3.846  2.099   1.00 0.00 ? 49  CYS A HA   4  
ATOM 6532  H HB2  . CYS A 1 49  ? -5.403  -4.557  3.157   1.00 0.00 ? 49  CYS A HB2  4  
ATOM 6533  H HB3  . CYS A 1 49  ? -6.307  -5.609  4.243   1.00 0.00 ? 49  CYS A HB3  4  
ATOM 6534  H HG   . CYS A 1 49  ? -5.465  -7.488  2.581   1.00 0.00 ? 49  CYS A HG   4  
ATOM 6535  N N    . HIS A 1 50  ? -9.333  -5.524  2.089   1.00 0.00 ? 50  HIS A N    4  
ATOM 6536  C CA   . HIS A 1 50  ? -10.480 -6.421  2.042   1.00 0.00 ? 50  HIS A CA   4  
ATOM 6537  C C    . HIS A 1 50  ? -10.274 -7.578  3.018   1.00 0.00 ? 50  HIS A C    4  
ATOM 6538  O O    . HIS A 1 50  ? -9.258  -8.260  2.966   1.00 0.00 ? 50  HIS A O    4  
ATOM 6539  C CB   . HIS A 1 50  ? -10.652 -6.944  0.610   1.00 0.00 ? 50  HIS A CB   4  
ATOM 6540  C CG   . HIS A 1 50  ? -11.925 -7.696  0.379   1.00 0.00 ? 50  HIS A CG   4  
ATOM 6541  N ND1  . HIS A 1 50  ? -11.971 -9.056  0.189   1.00 0.00 ? 50  HIS A ND1  4  
ATOM 6542  C CD2  . HIS A 1 50  ? -13.199 -7.262  0.296   1.00 0.00 ? 50  HIS A CD2  4  
ATOM 6543  C CE1  . HIS A 1 50  ? -13.221 -9.433  0.006   1.00 0.00 ? 50  HIS A CE1  4  
ATOM 6544  N NE2  . HIS A 1 50  ? -13.987 -8.362  0.067   1.00 0.00 ? 50  HIS A NE2  4  
ATOM 6545  H H    . HIS A 1 50  ? -8.966  -5.172  1.249   1.00 0.00 ? 50  HIS A H    4  
ATOM 6546  H HA   . HIS A 1 50  ? -11.362 -5.861  2.329   1.00 0.00 ? 50  HIS A HA   4  
ATOM 6547  H HB2  . HIS A 1 50  ? -10.636 -6.109  -0.073  1.00 0.00 ? 50  HIS A HB2  4  
ATOM 6548  H HB3  . HIS A 1 50  ? -9.829  -7.606  0.380   1.00 0.00 ? 50  HIS A HB3  4  
ATOM 6549  H HD1  . HIS A 1 50  ? -11.184 -9.658  0.133   1.00 0.00 ? 50  HIS A HD1  4  
ATOM 6550  H HD2  . HIS A 1 50  ? -13.529 -6.237  0.372   1.00 0.00 ? 50  HIS A HD2  4  
ATOM 6551  H HE1  . HIS A 1 50  ? -13.559 -10.445 -0.163  1.00 0.00 ? 50  HIS A HE1  4  
ATOM 6552  H HE2  . HIS A 1 50  ? -14.976 -8.374  0.074   1.00 0.00 ? 50  HIS A HE2  4  
ATOM 6553  N N    . PRO A 1 51  ? -11.244 -7.791  3.929   1.00 0.00 ? 51  PRO A N    4  
ATOM 6554  C CA   . PRO A 1 51  ? -11.124 -8.734  5.057   1.00 0.00 ? 51  PRO A CA   4  
ATOM 6555  C C    . PRO A 1 51  ? -10.659 -10.135 4.659   1.00 0.00 ? 51  PRO A C    4  
ATOM 6556  O O    . PRO A 1 51  ? -10.013 -10.821 5.446   1.00 0.00 ? 51  PRO A O    4  
ATOM 6557  C CB   . PRO A 1 51  ? -12.544 -8.794  5.646   1.00 0.00 ? 51  PRO A CB   4  
ATOM 6558  C CG   . PRO A 1 51  ? -13.423 -8.081  4.672   1.00 0.00 ? 51  PRO A CG   4  
ATOM 6559  C CD   . PRO A 1 51  ? -12.542 -7.105  3.952   1.00 0.00 ? 51  PRO A CD   4  
ATOM 6560  H HA   . PRO A 1 51  ? -10.450 -8.347  5.807   1.00 0.00 ? 51  PRO A HA   4  
ATOM 6561  H HB2  . PRO A 1 51  ? -12.842 -9.825  5.760   1.00 0.00 ? 51  PRO A HB2  4  
ATOM 6562  H HB3  . PRO A 1 51  ? -12.552 -8.307  6.611   1.00 0.00 ? 51  PRO A HB3  4  
ATOM 6563  H HG2  . PRO A 1 51  ? -13.846 -8.788  3.975   1.00 0.00 ? 51  PRO A HG2  4  
ATOM 6564  H HG3  . PRO A 1 51  ? -14.208 -7.558  5.200   1.00 0.00 ? 51  PRO A HG3  4  
ATOM 6565  H HD2  . PRO A 1 51  ? -12.907 -6.935  2.949   1.00 0.00 ? 51  PRO A HD2  4  
ATOM 6566  H HD3  . PRO A 1 51  ? -12.479 -6.176  4.497   1.00 0.00 ? 51  PRO A HD3  4  
ATOM 6567  N N    . GLU A 1 52  ? -10.974 -10.553 3.441   1.00 0.00 ? 52  GLU A N    4  
ATOM 6568  C CA   . GLU A 1 52  ? -10.592 -11.879 2.967   1.00 0.00 ? 52  GLU A CA   4  
ATOM 6569  C C    . GLU A 1 52  ? -9.223  -11.855 2.294   1.00 0.00 ? 52  GLU A C    4  
ATOM 6570  O O    . GLU A 1 52  ? -8.681  -12.895 1.926   1.00 0.00 ? 52  GLU A O    4  
ATOM 6571  C CB   . GLU A 1 52  ? -11.636 -12.414 2.001   1.00 0.00 ? 52  GLU A CB   4  
ATOM 6572  C CG   . GLU A 1 52  ? -12.982 -12.678 2.648   1.00 0.00 ? 52  GLU A CG   4  
ATOM 6573  C CD   . GLU A 1 52  ? -14.012 -13.141 1.647   1.00 0.00 ? 52  GLU A CD   4  
ATOM 6574  O OE1  . GLU A 1 52  ? -13.861 -14.253 1.105   1.00 0.00 ? 52  GLU A OE1  4  
ATOM 6575  O OE2  . GLU A 1 52  ? -14.966 -12.384 1.379   1.00 0.00 ? 52  GLU A OE2  4  
ATOM 6576  H H    . GLU A 1 52  ? -11.469 -9.960  2.842   1.00 0.00 ? 52  GLU A H    4  
ATOM 6577  H HA   . GLU A 1 52  ? -10.545 -12.531 3.822   1.00 0.00 ? 52  GLU A HA   4  
ATOM 6578  H HB2  . GLU A 1 52  ? -11.774 -11.697 1.212   1.00 0.00 ? 52  GLU A HB2  4  
ATOM 6579  H HB3  . GLU A 1 52  ? -11.275 -13.341 1.577   1.00 0.00 ? 52  GLU A HB3  4  
ATOM 6580  H HG2  . GLU A 1 52  ? -12.864 -13.443 3.401   1.00 0.00 ? 52  GLU A HG2  4  
ATOM 6581  H HG3  . GLU A 1 52  ? -13.333 -11.768 3.110   1.00 0.00 ? 52  GLU A HG3  4  
ATOM 6582  N N    . ASP A 1 53  ? -8.664  -10.667 2.149   1.00 0.00 ? 53  ASP A N    4  
ATOM 6583  C CA   . ASP A 1 53  ? -7.400  -10.490 1.453   1.00 0.00 ? 53  ASP A CA   4  
ATOM 6584  C C    . ASP A 1 53  ? -6.354  -9.965  2.426   1.00 0.00 ? 53  ASP A C    4  
ATOM 6585  O O    . ASP A 1 53  ? -5.231  -9.641  2.042   1.00 0.00 ? 53  ASP A O    4  
ATOM 6586  C CB   . ASP A 1 53  ? -7.562  -9.518  0.278   1.00 0.00 ? 53  ASP A CB   4  
ATOM 6587  C CG   . ASP A 1 53  ? -8.506  -10.034 -0.791  1.00 0.00 ? 53  ASP A CG   4  
ATOM 6588  O OD1  . ASP A 1 53  ? -9.733  -10.040 -0.556  1.00 0.00 ? 53  ASP A OD1  4  
ATOM 6589  O OD2  . ASP A 1 53  ? -8.031  -10.444 -1.867  1.00 0.00 ? 53  ASP A OD2  4  
ATOM 6590  H H    . ASP A 1 53  ? -9.081  -9.877  2.562   1.00 0.00 ? 53  ASP A H    4  
ATOM 6591  H HA   . ASP A 1 53  ? -7.083  -11.453 1.078   1.00 0.00 ? 53  ASP A HA   4  
ATOM 6592  H HB2  . ASP A 1 53  ? -7.951  -8.580  0.648   1.00 0.00 ? 53  ASP A HB2  4  
ATOM 6593  H HB3  . ASP A 1 53  ? -6.596  -9.347  -0.173  1.00 0.00 ? 53  ASP A HB3  4  
ATOM 6594  N N    . GLN A 1 54  ? -6.736  -9.883  3.698   1.00 0.00 ? 54  GLN A N    4  
ATOM 6595  C CA   . GLN A 1 54  ? -5.832  -9.416  4.743   1.00 0.00 ? 54  GLN A CA   4  
ATOM 6596  C C    . GLN A 1 54  ? -4.653  -10.366 4.892   1.00 0.00 ? 54  GLN A C    4  
ATOM 6597  O O    . GLN A 1 54  ? -3.498  -9.938  4.929   1.00 0.00 ? 54  GLN A O    4  
ATOM 6598  C CB   . GLN A 1 54  ? -6.570  -9.278  6.075   1.00 0.00 ? 54  GLN A CB   4  
ATOM 6599  C CG   . GLN A 1 54  ? -7.590  -8.154  6.092   1.00 0.00 ? 54  GLN A CG   4  
ATOM 6600  C CD   . GLN A 1 54  ? -8.217  -7.951  7.458   1.00 0.00 ? 54  GLN A CD   4  
ATOM 6601  O OE1  . GLN A 1 54  ? -8.388  -8.899  8.227   1.00 0.00 ? 54  GLN A OE1  4  
ATOM 6602  N NE2  . GLN A 1 54  ? -8.544  -6.709  7.774   1.00 0.00 ? 54  GLN A NE2  4  
ATOM 6603  H H    . GLN A 1 54  ? -7.651  -10.140 3.938   1.00 0.00 ? 54  GLN A H    4  
ATOM 6604  H HA   . GLN A 1 54  ? -5.460  -8.445  4.445   1.00 0.00 ? 54  GLN A HA   4  
ATOM 6605  H HB2  . GLN A 1 54  ? -7.083  -10.204 6.287   1.00 0.00 ? 54  GLN A HB2  4  
ATOM 6606  H HB3  . GLN A 1 54  ? -5.847  -9.089  6.853   1.00 0.00 ? 54  GLN A HB3  4  
ATOM 6607  H HG2  . GLN A 1 54  ? -7.104  -7.236  5.797   1.00 0.00 ? 54  GLN A HG2  4  
ATOM 6608  H HG3  . GLN A 1 54  ? -8.374  -8.386  5.385   1.00 0.00 ? 54  GLN A HG3  4  
ATOM 6609  H HE21 . GLN A 1 54  ? -8.369  -6.002  7.113   1.00 0.00 ? 54  GLN A HE21 4  
ATOM 6610  H HE22 . GLN A 1 54  ? -8.930  -6.540  8.662   1.00 0.00 ? 54  GLN A HE22 4  
ATOM 6611  N N    . GLN A 1 55  ? -4.950  -11.658 4.961   1.00 0.00 ? 55  GLN A N    4  
ATOM 6612  C CA   . GLN A 1 55  ? -3.908  -12.673 5.030   1.00 0.00 ? 55  GLN A CA   4  
ATOM 6613  C C    . GLN A 1 55  ? -3.122  -12.720 3.732   1.00 0.00 ? 55  GLN A C    4  
ATOM 6614  O O    . GLN A 1 55  ? -1.926  -13.004 3.736   1.00 0.00 ? 55  GLN A O    4  
ATOM 6615  C CB   . GLN A 1 55  ? -4.503  -14.046 5.329   1.00 0.00 ? 55  GLN A CB   4  
ATOM 6616  C CG   . GLN A 1 55  ? -4.746  -14.292 6.806   1.00 0.00 ? 55  GLN A CG   4  
ATOM 6617  C CD   . GLN A 1 55  ? -3.480  -14.128 7.623   1.00 0.00 ? 55  GLN A CD   4  
ATOM 6618  O OE1  . GLN A 1 55  ? -3.199  -13.051 8.148   1.00 0.00 ? 55  GLN A OE1  4  
ATOM 6619  N NE2  . GLN A 1 55  ? -2.688  -15.181 7.696   1.00 0.00 ? 55  GLN A NE2  4  
ATOM 6620  H H    . GLN A 1 55  ? -5.890  -11.935 4.970   1.00 0.00 ? 55  GLN A H    4  
ATOM 6621  H HA   . GLN A 1 55  ? -3.237  -12.401 5.832   1.00 0.00 ? 55  GLN A HA   4  
ATOM 6622  H HB2  . GLN A 1 55  ? -5.444  -14.142 4.809   1.00 0.00 ? 55  GLN A HB2  4  
ATOM 6623  H HB3  . GLN A 1 55  ? -3.823  -14.804 4.970   1.00 0.00 ? 55  GLN A HB3  4  
ATOM 6624  H HG2  . GLN A 1 55  ? -5.484  -13.588 7.160   1.00 0.00 ? 55  GLN A HG2  4  
ATOM 6625  H HG3  . GLN A 1 55  ? -5.114  -15.299 6.936   1.00 0.00 ? 55  GLN A HG3  4  
ATOM 6626  H HE21 . GLN A 1 55  ? -2.959  -15.996 7.219   1.00 0.00 ? 55  GLN A HE21 4  
ATOM 6627  H HE22 . GLN A 1 55  ? -1.857  -15.112 8.224   1.00 0.00 ? 55  GLN A HE22 4  
ATOM 6628  N N    . LEU A 1 56  ? -3.802  -12.429 2.629   1.00 0.00 ? 56  LEU A N    4  
ATOM 6629  C CA   . LEU A 1 56  ? -3.158  -12.379 1.327   1.00 0.00 ? 56  LEU A CA   4  
ATOM 6630  C C    . LEU A 1 56  ? -2.053  -11.327 1.356   1.00 0.00 ? 56  LEU A C    4  
ATOM 6631  O O    . LEU A 1 56  ? -0.929  -11.577 0.919   1.00 0.00 ? 56  LEU A O    4  
ATOM 6632  C CB   . LEU A 1 56  ? -4.190  -12.054 0.237   1.00 0.00 ? 56  LEU A CB   4  
ATOM 6633  C CG   . LEU A 1 56  ? -3.908  -12.628 -1.159  1.00 0.00 ? 56  LEU A CG   4  
ATOM 6634  C CD1  . LEU A 1 56  ? -5.062  -12.316 -2.097  1.00 0.00 ? 56  LEU A CD1  4  
ATOM 6635  C CD2  . LEU A 1 56  ? -2.611  -12.078 -1.734  1.00 0.00 ? 56  LEU A CD2  4  
ATOM 6636  H H    . LEU A 1 56  ? -4.761  -12.244 2.695   1.00 0.00 ? 56  LEU A H    4  
ATOM 6637  H HA   . LEU A 1 56  ? -2.721  -13.344 1.132   1.00 0.00 ? 56  LEU A HA   4  
ATOM 6638  H HB2  . LEU A 1 56  ? -5.149  -12.428 0.564   1.00 0.00 ? 56  LEU A HB2  4  
ATOM 6639  H HB3  . LEU A 1 56  ? -4.257  -10.979 0.150   1.00 0.00 ? 56  LEU A HB3  4  
ATOM 6640  H HG   . LEU A 1 56  ? -3.816  -13.702 -1.089  1.00 0.00 ? 56  LEU A HG   4  
ATOM 6641  H HD11 . LEU A 1 56  ? -5.970  -12.749 -1.706  1.00 0.00 ? 56  LEU A HD11 4  
ATOM 6642  H HD12 . LEU A 1 56  ? -4.856  -12.732 -3.072  1.00 0.00 ? 56  LEU A HD12 4  
ATOM 6643  H HD13 . LEU A 1 56  ? -5.179  -11.245 -2.180  1.00 0.00 ? 56  LEU A HD13 4  
ATOM 6644  H HD21 . LEU A 1 56  ? -1.790  -12.348 -1.088  1.00 0.00 ? 56  LEU A HD21 4  
ATOM 6645  H HD22 . LEU A 1 56  ? -2.676  -11.003 -1.805  1.00 0.00 ? 56  LEU A HD22 4  
ATOM 6646  H HD23 . LEU A 1 56  ? -2.449  -12.494 -2.718  1.00 0.00 ? 56  LEU A HD23 4  
ATOM 6647  N N    . LEU A 1 57  ? -2.379  -10.158 1.894   1.00 0.00 ? 57  LEU A N    4  
ATOM 6648  C CA   . LEU A 1 57  ? -1.391  -9.105  2.078   1.00 0.00 ? 57  LEU A CA   4  
ATOM 6649  C C    . LEU A 1 57  ? -0.309  -9.538  3.050   1.00 0.00 ? 57  LEU A C    4  
ATOM 6650  O O    . LEU A 1 57  ? 0.875   -9.415  2.745   1.00 0.00 ? 57  LEU A O    4  
ATOM 6651  C CB   . LEU A 1 57  ? -2.027  -7.807  2.580   1.00 0.00 ? 57  LEU A CB   4  
ATOM 6652  C CG   . LEU A 1 57  ? -2.666  -6.929  1.507   1.00 0.00 ? 57  LEU A CG   4  
ATOM 6653  C CD1  . LEU A 1 57  ? -2.972  -5.554  2.076   1.00 0.00 ? 57  LEU A CD1  4  
ATOM 6654  C CD2  . LEU A 1 57  ? -1.752  -6.813  0.297   1.00 0.00 ? 57  LEU A CD2  4  
ATOM 6655  H H    . LEU A 1 57  ? -3.310  -9.999  2.165   1.00 0.00 ? 57  LEU A H    4  
ATOM 6656  H HA   . LEU A 1 57  ? -0.933  -8.917  1.119   1.00 0.00 ? 57  LEU A HA   4  
ATOM 6657  H HB2  . LEU A 1 57  ? -2.787  -8.064  3.304   1.00 0.00 ? 57  LEU A HB2  4  
ATOM 6658  H HB3  . LEU A 1 57  ? -1.264  -7.228  3.078   1.00 0.00 ? 57  LEU A HB3  4  
ATOM 6659  H HG   . LEU A 1 57  ? -3.597  -7.377  1.188   1.00 0.00 ? 57  LEU A HG   4  
ATOM 6660  H HD11 . LEU A 1 57  ? -2.057  -5.094  2.416   1.00 0.00 ? 57  LEU A HD11 4  
ATOM 6661  H HD12 . LEU A 1 57  ? -3.657  -5.652  2.907   1.00 0.00 ? 57  LEU A HD12 4  
ATOM 6662  H HD13 . LEU A 1 57  ? -3.420  -4.940  1.309   1.00 0.00 ? 57  LEU A HD13 4  
ATOM 6663  H HD21 . LEU A 1 57  ? -2.218  -6.185  -0.447  1.00 0.00 ? 57  LEU A HD21 4  
ATOM 6664  H HD22 . LEU A 1 57  ? -1.577  -7.794  -0.117  1.00 0.00 ? 57  LEU A HD22 4  
ATOM 6665  H HD23 . LEU A 1 57  ? -0.812  -6.376  0.599   1.00 0.00 ? 57  LEU A HD23 4  
ATOM 6666  N N    . ARG A 1 58  ? -0.719  -10.054 4.210   1.00 0.00 ? 58  ARG A N    4  
ATOM 6667  C CA   . ARG A 1 58  ? 0.229   -10.450 5.245   1.00 0.00 ? 58  ARG A CA   4  
ATOM 6668  C C    . ARG A 1 58  ? 1.289   -11.376 4.674   1.00 0.00 ? 58  ARG A C    4  
ATOM 6669  O O    . ARG A 1 58  ? 2.481   -11.080 4.738   1.00 0.00 ? 58  ARG A O    4  
ATOM 6670  C CB   . ARG A 1 58  ? -0.469  -11.151 6.417   1.00 0.00 ? 58  ARG A CB   4  
ATOM 6671  C CG   . ARG A 1 58  ? 0.456   -11.350 7.608   1.00 0.00 ? 58  ARG A CG   4  
ATOM 6672  C CD   . ARG A 1 58  ? -0.246  -12.012 8.778   1.00 0.00 ? 58  ARG A CD   4  
ATOM 6673  N NE   . ARG A 1 58  ? 0.645   -12.159 9.929   1.00 0.00 ? 58  ARG A NE   4  
ATOM 6674  C CZ   . ARG A 1 58  ? 0.339   -12.844 11.028  1.00 0.00 ? 58  ARG A CZ   4  
ATOM 6675  N NH1  . ARG A 1 58  ? -0.844  -13.434 11.140  1.00 0.00 ? 58  ARG A NH1  4  
ATOM 6676  N NH2  . ARG A 1 58  ? 1.218   -12.940 12.016  1.00 0.00 ? 58  ARG A NH2  4  
ATOM 6677  H H    . ARG A 1 58  ? -1.683  -10.168 4.372   1.00 0.00 ? 58  ARG A H    4  
ATOM 6678  H HA   . ARG A 1 58  ? 0.712   -9.556  5.611   1.00 0.00 ? 58  ARG A HA   4  
ATOM 6679  H HB2  . ARG A 1 58  ? -1.318  -10.565 6.732   1.00 0.00 ? 58  ARG A HB2  4  
ATOM 6680  H HB3  . ARG A 1 58  ? -0.812  -12.120 6.090   1.00 0.00 ? 58  ARG A HB3  4  
ATOM 6681  H HG2  . ARG A 1 58  ? 1.283   -11.974 7.305   1.00 0.00 ? 58  ARG A HG2  4  
ATOM 6682  H HG3  . ARG A 1 58  ? 0.829   -10.388 7.923   1.00 0.00 ? 58  ARG A HG3  4  
ATOM 6683  H HD2  . ARG A 1 58  ? -1.093  -11.405 9.066   1.00 0.00 ? 58  ARG A HD2  4  
ATOM 6684  H HD3  . ARG A 1 58  ? -0.591  -12.990 8.472   1.00 0.00 ? 58  ARG A HD3  4  
ATOM 6685  H HE   . ARG A 1 58  ? 1.527   -11.714 9.874   1.00 0.00 ? 58  ARG A HE   4  
ATOM 6686  H HH11 . ARG A 1 58  ? -1.510  -13.367 10.399  1.00 0.00 ? 58  ARG A HH11 4  
ATOM 6687  H HH12 . ARG A 1 58  ? -1.078  -13.950 11.975  1.00 0.00 ? 58  ARG A HH12 4  
ATOM 6688  H HH21 . ARG A 1 58  ? 2.122   -12.498 11.935  1.00 0.00 ? 58  ARG A HH21 4  
ATOM 6689  H HH22 . ARG A 1 58  ? 0.985   -13.449 12.854  1.00 0.00 ? 58  ARG A HH22 4  
ATOM 6690  N N    . ASP A 1 59  ? 0.836   -12.480 4.085   1.00 0.00 ? 59  ASP A N    4  
ATOM 6691  C CA   . ASP A 1 59  ? 1.732   -13.474 3.507   1.00 0.00 ? 59  ASP A CA   4  
ATOM 6692  C C    . ASP A 1 59  ? 2.663   -12.841 2.494   1.00 0.00 ? 59  ASP A C    4  
ATOM 6693  O O    . ASP A 1 59  ? 3.874   -12.990 2.578   1.00 0.00 ? 59  ASP A O    4  
ATOM 6694  C CB   . ASP A 1 59  ? 0.935   -14.581 2.820   1.00 0.00 ? 59  ASP A CB   4  
ATOM 6695  C CG   . ASP A 1 59  ? 1.823   -15.687 2.283   1.00 0.00 ? 59  ASP A CG   4  
ATOM 6696  O OD1  . ASP A 1 59  ? 2.283   -16.526 3.087   1.00 0.00 ? 59  ASP A OD1  4  
ATOM 6697  O OD2  . ASP A 1 59  ? 2.055   -15.726 1.054   1.00 0.00 ? 59  ASP A OD2  4  
ATOM 6698  H H    . ASP A 1 59  ? -0.134  -12.629 4.037   1.00 0.00 ? 59  ASP A H    4  
ATOM 6699  H HA   . ASP A 1 59  ? 2.319   -13.904 4.305   1.00 0.00 ? 59  ASP A HA   4  
ATOM 6700  H HB2  . ASP A 1 59  ? 0.246   -15.006 3.522   1.00 0.00 ? 59  ASP A HB2  4  
ATOM 6701  H HB3  . ASP A 1 59  ? 0.382   -14.155 1.993   1.00 0.00 ? 59  ASP A HB3  4  
ATOM 6702  N N    . SER A 1 60  ? 2.086   -12.089 1.574   1.00 0.00 ? 60  SER A N    4  
ATOM 6703  C CA   . SER A 1 60  ? 2.818   -11.560 0.435   1.00 0.00 ? 60  SER A CA   4  
ATOM 6704  C C    . SER A 1 60  ? 3.837   -10.512 0.873   1.00 0.00 ? 60  SER A C    4  
ATOM 6705  O O    . SER A 1 60  ? 4.902   -10.373 0.270   1.00 0.00 ? 60  SER A O    4  
ATOM 6706  C CB   . SER A 1 60  ? 1.835   -10.983 -0.577  1.00 0.00 ? 60  SER A CB   4  
ATOM 6707  O OG   . SER A 1 60  ? 0.911   -11.975 -0.993  1.00 0.00 ? 60  SER A OG   4  
ATOM 6708  H H    . SER A 1 60  ? 1.141   -11.863 1.676   1.00 0.00 ? 60  SER A H    4  
ATOM 6709  H HA   . SER A 1 60  ? 3.347   -12.383 -0.025  1.00 0.00 ? 60  SER A HA   4  
ATOM 6710  H HB2  . SER A 1 60  ? 1.284   -10.177 -0.120  1.00 0.00 ? 60  SER A HB2  4  
ATOM 6711  H HB3  . SER A 1 60  ? 2.370   -10.617 -1.441  1.00 0.00 ? 60  SER A HB3  4  
ATOM 6712  H HG   . SER A 1 60  ? 0.108   -11.899 -0.460  1.00 0.00 ? 60  SER A HG   4  
ATOM 6713  N N    . PHE A 1 61  ? 3.514   -9.785  1.935   1.00 0.00 ? 61  PHE A N    4  
ATOM 6714  C CA   . PHE A 1 61  ? 4.450   -8.836  2.511   1.00 0.00 ? 61  PHE A CA   4  
ATOM 6715  C C    . PHE A 1 61  ? 5.581   -9.584  3.199   1.00 0.00 ? 61  PHE A C    4  
ATOM 6716  O O    . PHE A 1 61  ? 6.731   -9.164  3.159   1.00 0.00 ? 61  PHE A O    4  
ATOM 6717  C CB   . PHE A 1 61  ? 3.754   -7.911  3.506   1.00 0.00 ? 61  PHE A CB   4  
ATOM 6718  C CG   . PHE A 1 61  ? 2.825   -6.910  2.875   1.00 0.00 ? 61  PHE A CG   4  
ATOM 6719  C CD1  . PHE A 1 61  ? 3.007   -6.499  1.562   1.00 0.00 ? 61  PHE A CD1  4  
ATOM 6720  C CD2  . PHE A 1 61  ? 1.773   -6.375  3.600   1.00 0.00 ? 61  PHE A CD2  4  
ATOM 6721  C CE1  . PHE A 1 61  ? 2.155   -5.575  0.988   1.00 0.00 ? 61  PHE A CE1  4  
ATOM 6722  C CE2  . PHE A 1 61  ? 0.919   -5.450  3.029   1.00 0.00 ? 61  PHE A CE2  4  
ATOM 6723  C CZ   . PHE A 1 61  ? 1.111   -5.050  1.721   1.00 0.00 ? 61  PHE A CZ   4  
ATOM 6724  H H    . PHE A 1 61  ? 2.624   -9.888  2.342   1.00 0.00 ? 61  PHE A H    4  
ATOM 6725  H HA   . PHE A 1 61  ? 4.862   -8.245  1.706   1.00 0.00 ? 61  PHE A HA   4  
ATOM 6726  H HB2  . PHE A 1 61  ? 3.174   -8.510  4.188   1.00 0.00 ? 61  PHE A HB2  4  
ATOM 6727  H HB3  . PHE A 1 61  ? 4.500   -7.370  4.059   1.00 0.00 ? 61  PHE A HB3  4  
ATOM 6728  H HD1  . PHE A 1 61  ? 3.821   -6.912  0.986   1.00 0.00 ? 61  PHE A HD1  4  
ATOM 6729  H HD2  . PHE A 1 61  ? 1.622   -6.688  4.622   1.00 0.00 ? 61  PHE A HD2  4  
ATOM 6730  H HE1  . PHE A 1 61  ? 2.307   -5.265  -0.035  1.00 0.00 ? 61  PHE A HE1  4  
ATOM 6731  H HE2  . PHE A 1 61  ? 0.103   -5.042  3.606   1.00 0.00 ? 61  PHE A HE2  4  
ATOM 6732  H HZ   . PHE A 1 61  ? 0.445   -4.329  1.275   1.00 0.00 ? 61  PHE A HZ   4  
ATOM 6733  N N    . GLN A 1 62  ? 5.245   -10.709 3.813   1.00 0.00 ? 62  GLN A N    4  
ATOM 6734  C CA   . GLN A 1 62  ? 6.244   -11.556 4.439   1.00 0.00 ? 62  GLN A CA   4  
ATOM 6735  C C    . GLN A 1 62  ? 7.157   -12.136 3.372   1.00 0.00 ? 62  GLN A C    4  
ATOM 6736  O O    . GLN A 1 62  ? 8.359   -12.269 3.572   1.00 0.00 ? 62  GLN A O    4  
ATOM 6737  C CB   . GLN A 1 62  ? 5.576   -12.688 5.226   1.00 0.00 ? 62  GLN A CB   4  
ATOM 6738  C CG   . GLN A 1 62  ? 4.696   -12.208 6.368   1.00 0.00 ? 62  GLN A CG   4  
ATOM 6739  C CD   . GLN A 1 62  ? 5.478   -11.518 7.470   1.00 0.00 ? 62  GLN A CD   4  
ATOM 6740  O OE1  . GLN A 1 62  ? 6.650   -11.814 7.699   1.00 0.00 ? 62  GLN A OE1  4  
ATOM 6741  N NE2  . GLN A 1 62  ? 4.831   -10.597 8.168   1.00 0.00 ? 62  GLN A NE2  4  
ATOM 6742  H H    . GLN A 1 62  ? 4.301   -10.982 3.836   1.00 0.00 ? 62  GLN A H    4  
ATOM 6743  H HA   . GLN A 1 62  ? 6.829   -10.947 5.113   1.00 0.00 ? 62  GLN A HA   4  
ATOM 6744  H HB2  . GLN A 1 62  ? 4.963   -13.265 4.549   1.00 0.00 ? 62  GLN A HB2  4  
ATOM 6745  H HB3  . GLN A 1 62  ? 6.343   -13.327 5.634   1.00 0.00 ? 62  GLN A HB3  4  
ATOM 6746  H HG2  . GLN A 1 62  ? 3.975   -11.509 5.974   1.00 0.00 ? 62  GLN A HG2  4  
ATOM 6747  H HG3  . GLN A 1 62  ? 4.178   -13.056 6.788   1.00 0.00 ? 62  GLN A HG3  4  
ATOM 6748  H HE21 . GLN A 1 62  ? 3.895   -10.414 7.940   1.00 0.00 ? 62  GLN A HE21 4  
ATOM 6749  H HE22 . GLN A 1 62  ? 5.314   -10.135 8.885   1.00 0.00 ? 62  GLN A HE22 4  
ATOM 6750  N N    . GLN A 1 63  ? 6.567   -12.454 2.226   1.00 0.00 ? 63  GLN A N    4  
ATOM 6751  C CA   . GLN A 1 63  ? 7.298   -13.033 1.110   1.00 0.00 ? 63  GLN A CA   4  
ATOM 6752  C C    . GLN A 1 63  ? 8.378   -12.089 0.607   1.00 0.00 ? 63  GLN A C    4  
ATOM 6753  O O    . GLN A 1 63  ? 9.504   -12.509 0.374   1.00 0.00 ? 63  GLN A O    4  
ATOM 6754  C CB   . GLN A 1 63  ? 6.341   -13.397 -0.021  1.00 0.00 ? 63  GLN A CB   4  
ATOM 6755  C CG   . GLN A 1 63  ? 5.253   -14.344 0.438   1.00 0.00 ? 63  GLN A CG   4  
ATOM 6756  C CD   . GLN A 1 63  ? 5.756   -15.730 0.790   1.00 0.00 ? 63  GLN A CD   4  
ATOM 6757  O OE1  . GLN A 1 63  ? 6.933   -15.930 1.103   1.00 0.00 ? 63  GLN A OE1  4  
ATOM 6758  N NE2  . GLN A 1 63  ? 4.848   -16.687 0.800   1.00 0.00 ? 63  GLN A NE2  4  
ATOM 6759  H H    . GLN A 1 63  ? 5.595   -12.316 2.139   1.00 0.00 ? 63  GLN A H    4  
ATOM 6760  H HA   . GLN A 1 63  ? 7.763   -13.937 1.466   1.00 0.00 ? 63  GLN A HA   4  
ATOM 6761  H HB2  . GLN A 1 63  ? 5.879   -12.496 -0.397  1.00 0.00 ? 63  GLN A HB2  4  
ATOM 6762  H HB3  . GLN A 1 63  ? 6.894   -13.872 -0.814  1.00 0.00 ? 63  GLN A HB3  4  
ATOM 6763  H HG2  . GLN A 1 63  ? 4.797   -13.923 1.318   1.00 0.00 ? 63  GLN A HG2  4  
ATOM 6764  H HG3  . GLN A 1 63  ? 4.515   -14.430 -0.344  1.00 0.00 ? 63  GLN A HG3  4  
ATOM 6765  H HE21 . GLN A 1 63  ? 3.916   -16.447 0.583   1.00 0.00 ? 63  GLN A HE21 4  
ATOM 6766  H HE22 . GLN A 1 63  ? 5.133   -17.590 1.042   1.00 0.00 ? 63  GLN A HE22 4  
ATOM 6767  N N    . VAL A 1 64  ? 8.044   -10.812 0.452   1.00 0.00 ? 64  VAL A N    4  
ATOM 6768  C CA   . VAL A 1 64  ? 9.026   -9.834  0.000   1.00 0.00 ? 64  VAL A CA   4  
ATOM 6769  C C    . VAL A 1 64  ? 10.063  -9.561  1.094   1.00 0.00 ? 64  VAL A C    4  
ATOM 6770  O O    . VAL A 1 64  ? 11.207  -9.215  0.803   1.00 0.00 ? 64  VAL A O    4  
ATOM 6771  C CB   . VAL A 1 64  ? 8.368   -8.515  -0.478  1.00 0.00 ? 64  VAL A CB   4  
ATOM 6772  C CG1  . VAL A 1 64  ? 7.657   -7.796  0.652   1.00 0.00 ? 64  VAL A CG1  4  
ATOM 6773  C CG2  . VAL A 1 64  ? 9.399   -7.600  -1.123  1.00 0.00 ? 64  VAL A CG2  4  
ATOM 6774  H H    . VAL A 1 64  ? 7.121   -10.529 0.635   1.00 0.00 ? 64  VAL A H    4  
ATOM 6775  H HA   . VAL A 1 64  ? 9.540   -10.271 -0.847  1.00 0.00 ? 64  VAL A HA   4  
ATOM 6776  H HB   . VAL A 1 64  ? 7.631   -8.761  -1.228  1.00 0.00 ? 64  VAL A HB   4  
ATOM 6777  H HG11 . VAL A 1 64  ? 6.916   -8.450  1.086   1.00 0.00 ? 64  VAL A HG11 4  
ATOM 6778  H HG12 . VAL A 1 64  ? 7.173   -6.910  0.262   1.00 0.00 ? 64  VAL A HG12 4  
ATOM 6779  H HG13 . VAL A 1 64  ? 8.376   -7.510  1.406   1.00 0.00 ? 64  VAL A HG13 4  
ATOM 6780  H HG21 . VAL A 1 64  ? 8.919   -6.687  -1.443  1.00 0.00 ? 64  VAL A HG21 4  
ATOM 6781  H HG22 . VAL A 1 64  ? 9.834   -8.096  -1.979  1.00 0.00 ? 64  VAL A HG22 4  
ATOM 6782  H HG23 . VAL A 1 64  ? 10.173  -7.370  -0.407  1.00 0.00 ? 64  VAL A HG23 4  
ATOM 6783  N N    . VAL A 1 65  ? 9.670   -9.757  2.351   1.00 0.00 ? 65  VAL A N    4  
ATOM 6784  C CA   . VAL A 1 65  ? 10.602  -9.658  3.471   1.00 0.00 ? 65  VAL A CA   4  
ATOM 6785  C C    . VAL A 1 65  ? 11.546  -10.858 3.463   1.00 0.00 ? 65  VAL A C    4  
ATOM 6786  O O    . VAL A 1 65  ? 12.681  -10.781 3.926   1.00 0.00 ? 65  VAL A O    4  
ATOM 6787  C CB   . VAL A 1 65  ? 9.854   -9.575  4.827   1.00 0.00 ? 65  VAL A CB   4  
ATOM 6788  C CG1  . VAL A 1 65  ? 10.813  -9.695  6.005   1.00 0.00 ? 65  VAL A CG1  4  
ATOM 6789  C CG2  . VAL A 1 65  ? 9.074   -8.274  4.921   1.00 0.00 ? 65  VAL A CG2  4  
ATOM 6790  H H    . VAL A 1 65  ? 8.731   -9.978  2.533   1.00 0.00 ? 65  VAL A H    4  
ATOM 6791  H HA   . VAL A 1 65  ? 11.181  -8.754  3.344   1.00 0.00 ? 65  VAL A HA   4  
ATOM 6792  H HB   . VAL A 1 65  ? 9.150   -10.394 4.880   1.00 0.00 ? 65  VAL A HB   4  
ATOM 6793  H HG11 . VAL A 1 65  ? 11.520  -8.878  5.977   1.00 0.00 ? 65  VAL A HG11 4  
ATOM 6794  H HG12 . VAL A 1 65  ? 11.344  -10.634 5.942   1.00 0.00 ? 65  VAL A HG12 4  
ATOM 6795  H HG13 . VAL A 1 65  ? 10.256  -9.659  6.929   1.00 0.00 ? 65  VAL A HG13 4  
ATOM 6796  H HG21 . VAL A 1 65  ? 8.577   -8.220  5.878   1.00 0.00 ? 65  VAL A HG21 4  
ATOM 6797  H HG22 . VAL A 1 65  ? 8.339   -8.237  4.131   1.00 0.00 ? 65  VAL A HG22 4  
ATOM 6798  H HG23 . VAL A 1 65  ? 9.753   -7.439  4.822   1.00 0.00 ? 65  VAL A HG23 4  
ATOM 6799  N N    . LYS A 1 66  ? 11.066  -11.966 2.921   1.00 0.00 ? 66  LYS A N    4  
ATOM 6800  C CA   . LYS A 1 66  ? 11.881  -13.160 2.760   1.00 0.00 ? 66  LYS A CA   4  
ATOM 6801  C C    . LYS A 1 66  ? 12.681  -13.083 1.461   1.00 0.00 ? 66  LYS A C    4  
ATOM 6802  O O    . LYS A 1 66  ? 13.709  -13.744 1.309   1.00 0.00 ? 66  LYS A O    4  
ATOM 6803  C CB   . LYS A 1 66  ? 10.995  -14.409 2.775   1.00 0.00 ? 66  LYS A CB   4  
ATOM 6804  C CG   . LYS A 1 66  ? 10.257  -14.597 4.089   1.00 0.00 ? 66  LYS A CG   4  
ATOM 6805  C CD   . LYS A 1 66  ? 9.251   -15.731 4.017   1.00 0.00 ? 66  LYS A CD   4  
ATOM 6806  C CE   . LYS A 1 66  ? 8.433   -15.824 5.295   1.00 0.00 ? 66  LYS A CE   4  
ATOM 6807  N NZ   . LYS A 1 66  ? 9.282   -16.075 6.492   1.00 0.00 ? 66  LYS A NZ   4  
ATOM 6808  H H    . LYS A 1 66  ? 10.127  -11.986 2.636   1.00 0.00 ? 66  LYS A H    4  
ATOM 6809  H HA   . LYS A 1 66  ? 12.569  -13.204 3.591   1.00 0.00 ? 66  LYS A HA   4  
ATOM 6810  H HB2  . LYS A 1 66  ? 10.262  -14.331 1.983   1.00 0.00 ? 66  LYS A HB2  4  
ATOM 6811  H HB3  . LYS A 1 66  ? 11.609  -15.277 2.603   1.00 0.00 ? 66  LYS A HB3  4  
ATOM 6812  H HG2  . LYS A 1 66  ? 10.976  -14.821 4.862   1.00 0.00 ? 66  LYS A HG2  4  
ATOM 6813  H HG3  . LYS A 1 66  ? 9.739   -13.681 4.331   1.00 0.00 ? 66  LYS A HG3  4  
ATOM 6814  H HD2  . LYS A 1 66  ? 8.584   -15.555 3.185   1.00 0.00 ? 66  LYS A HD2  4  
ATOM 6815  H HD3  . LYS A 1 66  ? 9.780   -16.663 3.868   1.00 0.00 ? 66  LYS A HD3  4  
ATOM 6816  H HE2  . LYS A 1 66  ? 7.900   -14.896 5.432   1.00 0.00 ? 66  LYS A HE2  4  
ATOM 6817  H HE3  . LYS A 1 66  ? 7.723   -16.633 5.193   1.00 0.00 ? 66  LYS A HE3  4  
ATOM 6818  H HZ1  . LYS A 1 66  ? 9.702   -17.029 6.440   1.00 0.00 ? 66  LYS A HZ1  4  
ATOM 6819  H HZ2  . LYS A 1 66  ? 8.707   -16.006 7.359   1.00 0.00 ? 66  LYS A HZ2  4  
ATOM 6820  H HZ3  . LYS A 1 66  ? 10.053  -15.373 6.542   1.00 0.00 ? 66  LYS A HZ3  4  
ATOM 6821  N N    . LEU A 1 67  ? 12.193  -12.280 0.523   1.00 0.00 ? 67  LEU A N    4  
ATOM 6822  C CA   . LEU A 1 67  ? 12.899  -12.038 -0.727  1.00 0.00 ? 67  LEU A CA   4  
ATOM 6823  C C    . LEU A 1 67  ? 14.065  -11.087 -0.508  1.00 0.00 ? 67  LEU A C    4  
ATOM 6824  O O    . LEU A 1 67  ? 15.196  -11.395 -0.878  1.00 0.00 ? 67  LEU A O    4  
ATOM 6825  C CB   . LEU A 1 67  ? 11.953  -11.462 -1.793  1.00 0.00 ? 67  LEU A CB   4  
ATOM 6826  C CG   . LEU A 1 67  ? 10.899  -12.434 -2.318  1.00 0.00 ? 67  LEU A CG   4  
ATOM 6827  C CD1  . LEU A 1 67  ? 10.139  -11.808 -3.471  1.00 0.00 ? 67  LEU A CD1  4  
ATOM 6828  C CD2  . LEU A 1 67  ? 11.538  -13.747 -2.745  1.00 0.00 ? 67  LEU A CD2  4  
ATOM 6829  H H    . LEU A 1 67  ? 11.319  -11.856 0.670   1.00 0.00 ? 67  LEU A H    4  
ATOM 6830  H HA   . LEU A 1 67  ? 13.284  -12.984 -1.078  1.00 0.00 ? 67  LEU A HA   4  
ATOM 6831  H HB2  . LEU A 1 67  ? 11.438  -10.599 -1.375  1.00 0.00 ? 67  LEU A HB2  4  
ATOM 6832  H HB3  . LEU A 1 67  ? 12.551  -11.130 -2.630  1.00 0.00 ? 67  LEU A HB3  4  
ATOM 6833  H HG   . LEU A 1 67  ? 10.190  -12.646 -1.529  1.00 0.00 ? 67  LEU A HG   4  
ATOM 6834  H HD11 . LEU A 1 67  ? 9.384   -12.495 -3.821  1.00 0.00 ? 67  LEU A HD11 4  
ATOM 6835  H HD12 . LEU A 1 67  ? 10.825  -11.587 -4.276  1.00 0.00 ? 67  LEU A HD12 4  
ATOM 6836  H HD13 . LEU A 1 67  ? 9.668   -10.894 -3.140  1.00 0.00 ? 67  LEU A HD13 4  
ATOM 6837  H HD21 . LEU A 1 67  ? 10.773  -14.419 -3.106  1.00 0.00 ? 67  LEU A HD21 4  
ATOM 6838  H HD22 . LEU A 1 67  ? 12.040  -14.194 -1.899  1.00 0.00 ? 67  LEU A HD22 4  
ATOM 6839  H HD23 . LEU A 1 67  ? 12.254  -13.560 -3.531  1.00 0.00 ? 67  LEU A HD23 4  
ATOM 6840  N N    . LYS A 1 68  ? 13.769  -9.944  0.106   1.00 0.00 ? 68  LYS A N    4  
ATOM 6841  C CA   . LYS A 1 68  ? 14.766  -8.910  0.377   1.00 0.00 ? 68  LYS A CA   4  
ATOM 6842  C C    . LYS A 1 68  ? 15.591  -8.582  -0.860  1.00 0.00 ? 68  LYS A C    4  
ATOM 6843  O O    . LYS A 1 68  ? 16.720  -9.055  -1.020  1.00 0.00 ? 68  LYS A O    4  
ATOM 6844  C CB   . LYS A 1 68  ? 15.680  -9.325  1.531   1.00 0.00 ? 68  LYS A CB   4  
ATOM 6845  C CG   . LYS A 1 68  ? 15.005  -9.243  2.881   1.00 0.00 ? 68  LYS A CG   4  
ATOM 6846  C CD   . LYS A 1 68  ? 15.939  -9.642  4.007   1.00 0.00 ? 68  LYS A CD   4  
ATOM 6847  C CE   . LYS A 1 68  ? 15.268  -9.462  5.356   1.00 0.00 ? 68  LYS A CE   4  
ATOM 6848  N NZ   . LYS A 1 68  ? 16.186  -9.780  6.486   1.00 0.00 ? 68  LYS A NZ   4  
ATOM 6849  H H    . LYS A 1 68  ? 12.839  -9.804  0.400   1.00 0.00 ? 68  LYS A H    4  
ATOM 6850  H HA   . LYS A 1 68  ? 14.230  -8.020  0.670   1.00 0.00 ? 68  LYS A HA   4  
ATOM 6851  H HB2  . LYS A 1 68  ? 16.006  -10.342 1.371   1.00 0.00 ? 68  LYS A HB2  4  
ATOM 6852  H HB3  . LYS A 1 68  ? 16.541  -8.676  1.543   1.00 0.00 ? 68  LYS A HB3  4  
ATOM 6853  H HG2  . LYS A 1 68  ? 14.681  -8.226  3.045   1.00 0.00 ? 68  LYS A HG2  4  
ATOM 6854  H HG3  . LYS A 1 68  ? 14.147  -9.900  2.884   1.00 0.00 ? 68  LYS A HG3  4  
ATOM 6855  H HD2  . LYS A 1 68  ? 16.214  -10.679 3.884   1.00 0.00 ? 68  LYS A HD2  4  
ATOM 6856  H HD3  . LYS A 1 68  ? 16.823  -9.023  3.968   1.00 0.00 ? 68  LYS A HD3  4  
ATOM 6857  H HE2  . LYS A 1 68  ? 14.940  -8.437  5.443   1.00 0.00 ? 68  LYS A HE2  4  
ATOM 6858  H HE3  . LYS A 1 68  ? 14.410  -10.119 5.401   1.00 0.00 ? 68  LYS A HE3  4  
ATOM 6859  H HZ1  . LYS A 1 68  ? 15.701  -9.638  7.398   1.00 0.00 ? 68  LYS A HZ1  4  
ATOM 6860  H HZ2  . LYS A 1 68  ? 17.024  -9.163  6.457   1.00 0.00 ? 68  LYS A HZ2  4  
ATOM 6861  H HZ3  . LYS A 1 68  ? 16.502  -10.773 6.425   1.00 0.00 ? 68  LYS A HZ3  4  
ATOM 6862  N N    . GLY A 1 69  ? 15.023  -7.763  -1.727  1.00 0.00 ? 69  GLY A N    4  
ATOM 6863  C CA   . GLY A 1 69  ? 15.707  -7.389  -2.946  1.00 0.00 ? 69  GLY A CA   4  
ATOM 6864  C C    . GLY A 1 69  ? 14.832  -7.529  -4.170  1.00 0.00 ? 69  GLY A C    4  
ATOM 6865  O O    . GLY A 1 69  ? 14.918  -6.719  -5.092  1.00 0.00 ? 69  GLY A O    4  
ATOM 6866  H H    . GLY A 1 69  ? 14.141  -7.388  -1.524  1.00 0.00 ? 69  GLY A H    4  
ATOM 6867  H HA2  . GLY A 1 69  ? 16.029  -6.361  -2.863  1.00 0.00 ? 69  GLY A HA2  4  
ATOM 6868  H HA3  . GLY A 1 69  ? 16.577  -8.019  -3.064  1.00 0.00 ? 69  GLY A HA3  4  
ATOM 6869  N N    . GLN A 1 70  ? 13.971  -8.539  -4.173  1.00 0.00 ? 70  GLN A N    4  
ATOM 6870  C CA   . GLN A 1 70  ? 13.113  -8.797  -5.316  1.00 0.00 ? 70  GLN A CA   4  
ATOM 6871  C C    . GLN A 1 70  ? 11.767  -8.121  -5.129  1.00 0.00 ? 70  GLN A C    4  
ATOM 6872  O O    . GLN A 1 70  ? 11.258  -8.035  -4.008  1.00 0.00 ? 70  GLN A O    4  
ATOM 6873  C CB   . GLN A 1 70  ? 12.913  -10.300 -5.518  1.00 0.00 ? 70  GLN A CB   4  
ATOM 6874  C CG   . GLN A 1 70  ? 14.196  -11.058 -5.797  1.00 0.00 ? 70  GLN A CG   4  
ATOM 6875  C CD   . GLN A 1 70  ? 13.950  -12.484 -6.257  1.00 0.00 ? 70  GLN A CD   4  
ATOM 6876  O OE1  . GLN A 1 70  ? 14.741  -13.046 -7.012  1.00 0.00 ? 70  GLN A OE1  4  
ATOM 6877  N NE2  . GLN A 1 70  ? 12.848  -13.073 -5.818  1.00 0.00 ? 70  GLN A NE2  4  
ATOM 6878  H H    . GLN A 1 70  ? 13.890  -9.105  -3.379  1.00 0.00 ? 70  GLN A H    4  
ATOM 6879  H HA   . GLN A 1 70  ? 13.593  -8.384  -6.191  1.00 0.00 ? 70  GLN A HA   4  
ATOM 6880  H HB2  . GLN A 1 70  ? 12.468  -10.713 -4.627  1.00 0.00 ? 70  GLN A HB2  4  
ATOM 6881  H HB3  . GLN A 1 70  ? 12.240  -10.453 -6.349  1.00 0.00 ? 70  GLN A HB3  4  
ATOM 6882  H HG2  . GLN A 1 70  ? 14.749  -10.537 -6.564  1.00 0.00 ? 70  GLN A HG2  4  
ATOM 6883  H HG3  . GLN A 1 70  ? 14.778  -11.086 -4.889  1.00 0.00 ? 70  GLN A HG3  4  
ATOM 6884  H HE21 . GLN A 1 70  ? 12.256  -12.567 -5.227  1.00 0.00 ? 70  GLN A HE21 4  
ATOM 6885  H HE22 . GLN A 1 70  ? 12.670  -13.997 -6.100  1.00 0.00 ? 70  GLN A HE22 4  
ATOM 6886  N N    . VAL A 1 71  ? 11.206  -7.635  -6.225  1.00 0.00 ? 71  VAL A N    4  
ATOM 6887  C CA   . VAL A 1 71  ? 9.901   -6.995  -6.198  1.00 0.00 ? 71  VAL A CA   4  
ATOM 6888  C C    . VAL A 1 71  ? 8.798   -8.042  -6.130  1.00 0.00 ? 71  VAL A C    4  
ATOM 6889  O O    . VAL A 1 71  ? 8.756   -8.971  -6.942  1.00 0.00 ? 71  VAL A O    4  
ATOM 6890  C CB   . VAL A 1 71  ? 9.686   -6.099  -7.439  1.00 0.00 ? 71  VAL A CB   4  
ATOM 6891  C CG1  . VAL A 1 71  ? 8.295   -5.484  -7.438  1.00 0.00 ? 71  VAL A CG1  4  
ATOM 6892  C CG2  . VAL A 1 71  ? 10.747  -5.011  -7.498  1.00 0.00 ? 71  VAL A CG2  4  
ATOM 6893  H H    . VAL A 1 71  ? 11.685  -7.705  -7.078  1.00 0.00 ? 71  VAL A H    4  
ATOM 6894  H HA   . VAL A 1 71  ? 9.851   -6.374  -5.314  1.00 0.00 ? 71  VAL A HA   4  
ATOM 6895  H HB   . VAL A 1 71  ? 9.781   -6.713  -8.322  1.00 0.00 ? 71  VAL A HB   4  
ATOM 6896  H HG11 . VAL A 1 71  ? 8.175   -4.866  -6.560  1.00 0.00 ? 71  VAL A HG11 4  
ATOM 6897  H HG12 . VAL A 1 71  ? 7.554   -6.269  -7.429  1.00 0.00 ? 71  VAL A HG12 4  
ATOM 6898  H HG13 . VAL A 1 71  ? 8.168   -4.880  -8.323  1.00 0.00 ? 71  VAL A HG13 4  
ATOM 6899  H HG21 . VAL A 1 71  ? 10.696  -4.409  -6.603  1.00 0.00 ? 71  VAL A HG21 4  
ATOM 6900  H HG22 . VAL A 1 71  ? 10.575  -4.389  -8.363  1.00 0.00 ? 71  VAL A HG22 4  
ATOM 6901  H HG23 . VAL A 1 71  ? 11.724  -5.467  -7.570  1.00 0.00 ? 71  VAL A HG23 4  
ATOM 6902  N N    . LEU A 1 72  ? 7.918   -7.890  -5.155  1.00 0.00 ? 72  LEU A N    4  
ATOM 6903  C CA   . LEU A 1 72  ? 6.806   -8.811  -4.975  1.00 0.00 ? 72  LEU A CA   4  
ATOM 6904  C C    . LEU A 1 72  ? 5.505   -8.043  -5.153  1.00 0.00 ? 72  LEU A C    4  
ATOM 6905  O O    . LEU A 1 72  ? 5.190   -7.171  -4.351  1.00 0.00 ? 72  LEU A O    4  
ATOM 6906  C CB   . LEU A 1 72  ? 6.871   -9.430  -3.570  1.00 0.00 ? 72  LEU A CB   4  
ATOM 6907  C CG   . LEU A 1 72  ? 6.208   -10.804 -3.393  1.00 0.00 ? 72  LEU A CG   4  
ATOM 6908  C CD1  . LEU A 1 72  ? 4.705   -10.741 -3.625  1.00 0.00 ? 72  LEU A CD1  4  
ATOM 6909  C CD2  . LEU A 1 72  ? 6.852   -11.820 -4.321  1.00 0.00 ? 72  LEU A CD2  4  
ATOM 6910  H H    . LEU A 1 72  ? 8.004   -7.119  -4.553  1.00 0.00 ? 72  LEU A H    4  
ATOM 6911  H HA   . LEU A 1 72  ? 6.874   -9.589  -5.722  1.00 0.00 ? 72  LEU A HA   4  
ATOM 6912  H HB2  . LEU A 1 72  ? 7.909   -9.524  -3.293  1.00 0.00 ? 72  LEU A HB2  4  
ATOM 6913  H HB3  . LEU A 1 72  ? 6.400   -8.742  -2.882  1.00 0.00 ? 72  LEU A HB3  4  
ATOM 6914  H HG   . LEU A 1 72  ? 6.366   -11.137 -2.379  1.00 0.00 ? 72  LEU A HG   4  
ATOM 6915  H HD11 . LEU A 1 72  ? 4.511   -10.419 -4.638  1.00 0.00 ? 72  LEU A HD11 4  
ATOM 6916  H HD12 . LEU A 1 72  ? 4.263   -10.039 -2.934  1.00 0.00 ? 72  LEU A HD12 4  
ATOM 6917  H HD13 . LEU A 1 72  ? 4.275   -11.718 -3.469  1.00 0.00 ? 72  LEU A HD13 4  
ATOM 6918  H HD21 . LEU A 1 72  ? 6.672   -11.537 -5.347  1.00 0.00 ? 72  LEU A HD21 4  
ATOM 6919  H HD22 . LEU A 1 72  ? 6.433   -12.796 -4.134  1.00 0.00 ? 72  LEU A HD22 4  
ATOM 6920  H HD23 . LEU A 1 72  ? 7.921   -11.844 -4.138  1.00 0.00 ? 72  LEU A HD23 4  
ATOM 6921  N N    . SER A 1 73  ? 4.741   -8.366  -6.182  1.00 0.00 ? 73  SER A N    4  
ATOM 6922  C CA   . SER A 1 73  ? 3.540   -7.607  -6.475  1.00 0.00 ? 73  SER A CA   4  
ATOM 6923  C C    . SER A 1 73  ? 2.301   -8.379  -6.056  1.00 0.00 ? 73  SER A C    4  
ATOM 6924  O O    . SER A 1 73  ? 2.033   -9.475  -6.548  1.00 0.00 ? 73  SER A O    4  
ATOM 6925  C CB   . SER A 1 73  ? 3.489   -7.254  -7.961  1.00 0.00 ? 73  SER A CB   4  
ATOM 6926  O OG   . SER A 1 73  ? 4.625   -6.486  -8.333  1.00 0.00 ? 73  SER A OG   4  
ATOM 6927  H H    . SER A 1 73  ? 4.968   -9.147  -6.735  1.00 0.00 ? 73  SER A H    4  
ATOM 6928  H HA   . SER A 1 73  ? 3.577   -6.694  -5.902  1.00 0.00 ? 73  SER A HA   4  
ATOM 6929  H HB2  . SER A 1 73  ? 3.475   -8.162  -8.547  1.00 0.00 ? 73  SER A HB2  4  
ATOM 6930  H HB3  . SER A 1 73  ? 2.598   -6.679  -8.165  1.00 0.00 ? 73  SER A HB3  4  
ATOM 6931  H HG   . SER A 1 73  ? 4.379   -5.551  -8.390  1.00 0.00 ? 73  SER A HG   4  
ATOM 6932  N N    . VAL A 1 74  ? 1.544   -7.774  -5.159  1.00 0.00 ? 74  VAL A N    4  
ATOM 6933  C CA   . VAL A 1 74  ? 0.353   -8.386  -4.602  1.00 0.00 ? 74  VAL A CA   4  
ATOM 6934  C C    . VAL A 1 74  ? -0.874  -7.601  -4.991  1.00 0.00 ? 74  VAL A C    4  
ATOM 6935  O O    . VAL A 1 74  ? -0.884  -6.372  -4.983  1.00 0.00 ? 74  VAL A O    4  
ATOM 6936  C CB   . VAL A 1 74  ? 0.459   -8.511  -3.061  1.00 0.00 ? 74  VAL A CB   4  
ATOM 6937  C CG1  . VAL A 1 74  ? 0.767   -7.163  -2.426  1.00 0.00 ? 74  VAL A CG1  4  
ATOM 6938  C CG2  . VAL A 1 74  ? -0.809  -9.105  -2.468  1.00 0.00 ? 74  VAL A CG2  4  
ATOM 6939  H H    . VAL A 1 74  ? 1.795   -6.869  -4.859  1.00 0.00 ? 74  VAL A H    4  
ATOM 6940  H HA   . VAL A 1 74  ? 0.248   -9.375  -5.022  1.00 0.00 ? 74  VAL A HA   4  
ATOM 6941  H HB   . VAL A 1 74  ? 1.278   -9.179  -2.836  1.00 0.00 ? 74  VAL A HB   4  
ATOM 6942  H HG11 . VAL A 1 74  ? 1.716   -6.798  -2.793  1.00 0.00 ? 74  VAL A HG11 4  
ATOM 6943  H HG12 . VAL A 1 74  ? 0.817   -7.275  -1.352  1.00 0.00 ? 74  VAL A HG12 4  
ATOM 6944  H HG13 . VAL A 1 74  ? -0.012  -6.460  -2.677  1.00 0.00 ? 74  VAL A HG13 4  
ATOM 6945  H HG21 . VAL A 1 74  ? -0.982  -10.083 -2.893  1.00 0.00 ? 74  VAL A HG21 4  
ATOM 6946  H HG22 . VAL A 1 74  ? -1.648  -8.462  -2.693  1.00 0.00 ? 74  VAL A HG22 4  
ATOM 6947  H HG23 . VAL A 1 74  ? -0.700  -9.192  -1.397  1.00 0.00 ? 74  VAL A HG23 4  
ATOM 6948  N N    . MET A 1 75  ? -1.897  -8.331  -5.351  1.00 0.00 ? 75  MET A N    4  
ATOM 6949  C CA   . MET A 1 75  ? -3.107  -7.742  -5.854  1.00 0.00 ? 75  MET A CA   4  
ATOM 6950  C C    . MET A 1 75  ? -4.233  -7.938  -4.845  1.00 0.00 ? 75  MET A C    4  
ATOM 6951  O O    . MET A 1 75  ? -4.508  -9.060  -4.422  1.00 0.00 ? 75  MET A O    4  
ATOM 6952  C CB   . MET A 1 75  ? -3.459  -8.368  -7.199  1.00 0.00 ? 75  MET A CB   4  
ATOM 6953  C CG   . MET A 1 75  ? -4.462  -7.554  -7.970  1.00 0.00 ? 75  MET A CG   4  
ATOM 6954  S SD   . MET A 1 75  ? -5.059  -8.398  -9.445  1.00 0.00 ? 75  MET A SD   4  
ATOM 6955  C CE   . MET A 1 75  ? -6.244  -7.209  -10.067 1.00 0.00 ? 75  MET A CE   4  
ATOM 6956  H H    . MET A 1 75  ? -1.840  -9.311  -5.251  1.00 0.00 ? 75  MET A H    4  
ATOM 6957  H HA   . MET A 1 75  ? -2.934  -6.683  -5.989  1.00 0.00 ? 75  MET A HA   4  
ATOM 6958  H HB2  . MET A 1 75  ? -2.562  -8.459  -7.792  1.00 0.00 ? 75  MET A HB2  4  
ATOM 6959  H HB3  . MET A 1 75  ? -3.874  -9.350  -7.030  1.00 0.00 ? 75  MET A HB3  4  
ATOM 6960  H HG2  . MET A 1 75  ? -5.283  -7.348  -7.317  1.00 0.00 ? 75  MET A HG2  4  
ATOM 6961  H HG3  . MET A 1 75  ? -3.997  -6.625  -8.268  1.00 0.00 ? 75  MET A HG3  4  
ATOM 6962  H HE1  . MET A 1 75  ? -7.010  -7.043  -9.327  1.00 0.00 ? 75  MET A HE1  4  
ATOM 6963  H HE2  . MET A 1 75  ? -6.693  -7.590  -10.973 1.00 0.00 ? 75  MET A HE2  4  
ATOM 6964  H HE3  . MET A 1 75  ? -5.741  -6.276  -10.279 1.00 0.00 ? 75  MET A HE3  4  
ATOM 6965  N N    . PHE A 1 76  ? -4.879  -6.845  -4.472  1.00 0.00 ? 76  PHE A N    4  
ATOM 6966  C CA   . PHE A 1 76  ? -5.865  -6.865  -3.397  1.00 0.00 ? 76  PHE A CA   4  
ATOM 6967  C C    . PHE A 1 76  ? -6.834  -5.702  -3.542  1.00 0.00 ? 76  PHE A C    4  
ATOM 6968  O O    . PHE A 1 76  ? -6.710  -4.893  -4.464  1.00 0.00 ? 76  PHE A O    4  
ATOM 6969  C CB   . PHE A 1 76  ? -5.163  -6.796  -2.036  1.00 0.00 ? 76  PHE A CB   4  
ATOM 6970  C CG   . PHE A 1 76  ? -4.457  -5.492  -1.785  1.00 0.00 ? 76  PHE A CG   4  
ATOM 6971  C CD1  . PHE A 1 76  ? -3.285  -5.184  -2.455  1.00 0.00 ? 76  PHE A CD1  4  
ATOM 6972  C CD2  . PHE A 1 76  ? -4.967  -4.577  -0.877  1.00 0.00 ? 76  PHE A CD2  4  
ATOM 6973  C CE1  . PHE A 1 76  ? -2.636  -3.987  -2.226  1.00 0.00 ? 76  PHE A CE1  4  
ATOM 6974  C CE2  . PHE A 1 76  ? -4.322  -3.380  -0.646  1.00 0.00 ? 76  PHE A CE2  4  
ATOM 6975  C CZ   . PHE A 1 76  ? -3.155  -3.084  -1.320  1.00 0.00 ? 76  PHE A CZ   4  
ATOM 6976  H H    . PHE A 1 76  ? -4.702  -6.006  -4.951  1.00 0.00 ? 76  PHE A H    4  
ATOM 6977  H HA   . PHE A 1 76  ? -6.417  -7.792  -3.467  1.00 0.00 ? 76  PHE A HA   4  
ATOM 6978  H HB2  . PHE A 1 76  ? -5.897  -6.930  -1.254  1.00 0.00 ? 76  PHE A HB2  4  
ATOM 6979  H HB3  . PHE A 1 76  ? -4.432  -7.588  -1.976  1.00 0.00 ? 76  PHE A HB3  4  
ATOM 6980  H HD1  . PHE A 1 76  ? -2.880  -5.889  -3.166  1.00 0.00 ? 76  PHE A HD1  4  
ATOM 6981  H HD2  . PHE A 1 76  ? -5.881  -4.808  -0.350  1.00 0.00 ? 76  PHE A HD2  4  
ATOM 6982  H HE1  . PHE A 1 76  ? -1.721  -3.757  -2.756  1.00 0.00 ? 76  PHE A HE1  4  
ATOM 6983  H HE2  . PHE A 1 76  ? -4.730  -2.674  0.064   1.00 0.00 ? 76  PHE A HE2  4  
ATOM 6984  H HZ   . PHE A 1 76  ? -2.647  -2.147  -1.141  1.00 0.00 ? 76  PHE A HZ   4  
ATOM 6985  N N    . ARG A 1 77  ? -7.799  -5.618  -2.632  1.00 0.00 ? 77  ARG A N    4  
ATOM 6986  C CA   . ARG A 1 77  ? -8.792  -4.564  -2.682  1.00 0.00 ? 77  ARG A CA   4  
ATOM 6987  C C    . ARG A 1 77  ? -8.587  -3.571  -1.546  1.00 0.00 ? 77  ARG A C    4  
ATOM 6988  O O    . ARG A 1 77  ? -8.738  -3.907  -0.370  1.00 0.00 ? 77  ARG A O    4  
ATOM 6989  C CB   . ARG A 1 77  ? -10.190 -5.169  -2.644  1.00 0.00 ? 77  ARG A CB   4  
ATOM 6990  C CG   . ARG A 1 77  ? -10.498 -5.980  -3.888  1.00 0.00 ? 77  ARG A CG   4  
ATOM 6991  C CD   . ARG A 1 77  ? -11.633 -6.958  -3.665  1.00 0.00 ? 77  ARG A CD   4  
ATOM 6992  N NE   . ARG A 1 77  ? -12.925 -6.304  -3.496  1.00 0.00 ? 77  ARG A NE   4  
ATOM 6993  C CZ   . ARG A 1 77  ? -14.056 -6.976  -3.290  1.00 0.00 ? 77  ARG A CZ   4  
ATOM 6994  N NH1  . ARG A 1 77  ? -14.026 -8.302  -3.193  1.00 0.00 ? 77  ARG A NH1  4  
ATOM 6995  N NH2  . ARG A 1 77  ? -15.208 -6.329  -3.174  1.00 0.00 ? 77  ARG A NH2  4  
ATOM 6996  H H    . ARG A 1 77  ? -7.834  -6.263  -1.893  1.00 0.00 ? 77  ARG A H    4  
ATOM 6997  H HA   . ARG A 1 77  ? -8.662  -4.041  -3.620  1.00 0.00 ? 77  ARG A HA   4  
ATOM 6998  H HB2  . ARG A 1 77  ? -10.271 -5.814  -1.781  1.00 0.00 ? 77  ARG A HB2  4  
ATOM 6999  H HB3  . ARG A 1 77  ? -10.917 -4.375  -2.565  1.00 0.00 ? 77  ARG A HB3  4  
ATOM 7000  H HG2  . ARG A 1 77  ? -10.775 -5.303  -4.684  1.00 0.00 ? 77  ARG A HG2  4  
ATOM 7001  H HG3  . ARG A 1 77  ? -9.610  -6.530  -4.171  1.00 0.00 ? 77  ARG A HG3  4  
ATOM 7002  H HD2  . ARG A 1 77  ? -11.691 -7.618  -4.516  1.00 0.00 ? 77  ARG A HD2  4  
ATOM 7003  H HD3  . ARG A 1 77  ? -11.417 -7.540  -2.780  1.00 0.00 ? 77  ARG A HD3  4  
ATOM 7004  H HE   . ARG A 1 77  ? -12.953 -5.320  -3.555  1.00 0.00 ? 77  ARG A HE   4  
ATOM 7005  H HH11 . ARG A 1 77  ? -13.151 -8.795  -3.271  1.00 0.00 ? 77  ARG A HH11 4  
ATOM 7006  H HH12 . ARG A 1 77  ? -14.881 -8.823  -3.050  1.00 0.00 ? 77  ARG A HH12 4  
ATOM 7007  H HH21 . ARG A 1 77  ? -15.234 -5.332  -3.239  1.00 0.00 ? 77  ARG A HH21 4  
ATOM 7008  H HH22 . ARG A 1 77  ? -16.065 -6.839  -3.018  1.00 0.00 ? 77  ARG A HH22 4  
ATOM 7009  N N    . PHE A 1 78  ? -8.234  -2.354  -1.929  1.00 0.00 ? 78  PHE A N    4  
ATOM 7010  C CA   . PHE A 1 78  ? -7.920  -1.279  -0.997  1.00 0.00 ? 78  PHE A CA   4  
ATOM 7011  C C    . PHE A 1 78  ? -9.182  -0.469  -0.728  1.00 0.00 ? 78  PHE A C    4  
ATOM 7012  O O    . PHE A 1 78  ? -9.939  -0.178  -1.660  1.00 0.00 ? 78  PHE A O    4  
ATOM 7013  C CB   . PHE A 1 78  ? -6.858  -0.385  -1.642  1.00 0.00 ? 78  PHE A CB   4  
ATOM 7014  C CG   . PHE A 1 78  ? -5.971  0.384   -0.700  1.00 0.00 ? 78  PHE A CG   4  
ATOM 7015  C CD1  . PHE A 1 78  ? -6.459  1.430   0.067   1.00 0.00 ? 78  PHE A CD1  4  
ATOM 7016  C CD2  . PHE A 1 78  ? -4.621  0.086   -0.632  1.00 0.00 ? 78  PHE A CD2  4  
ATOM 7017  C CE1  . PHE A 1 78  ? -5.613  2.162   0.882   1.00 0.00 ? 78  PHE A CE1  4  
ATOM 7018  C CE2  . PHE A 1 78  ? -3.776  0.804   0.186   1.00 0.00 ? 78  PHE A CE2  4  
ATOM 7019  C CZ   . PHE A 1 78  ? -4.269  1.844   0.941   1.00 0.00 ? 78  PHE A CZ   4  
ATOM 7020  H H    . PHE A 1 78  ? -8.195  -2.157  -2.889  1.00 0.00 ? 78  PHE A H    4  
ATOM 7021  H HA   . PHE A 1 78  ? -7.544  -1.702  -0.079  1.00 0.00 ? 78  PHE A HA   4  
ATOM 7022  H HB2  . PHE A 1 78  ? -6.218  -0.999  -2.255  1.00 0.00 ? 78  PHE A HB2  4  
ATOM 7023  H HB3  . PHE A 1 78  ? -7.358  0.333   -2.278  1.00 0.00 ? 78  PHE A HB3  4  
ATOM 7024  H HD1  . PHE A 1 78  ? -7.511  1.676   0.022   1.00 0.00 ? 78  PHE A HD1  4  
ATOM 7025  H HD2  . PHE A 1 78  ? -4.231  -0.730  -1.222  1.00 0.00 ? 78  PHE A HD2  4  
ATOM 7026  H HE1  . PHE A 1 78  ? -6.003  2.975   1.476   1.00 0.00 ? 78  PHE A HE1  4  
ATOM 7027  H HE2  . PHE A 1 78  ? -2.725  0.552   0.229   1.00 0.00 ? 78  PHE A HE2  4  
ATOM 7028  H HZ   . PHE A 1 78  ? -3.601  2.417   1.566   1.00 0.00 ? 78  PHE A HZ   4  
ATOM 7029  N N    . ARG A 1 79  ? -9.429  -0.120  0.527   1.00 0.00 ? 79  ARG A N    4  
ATOM 7030  C CA   . ARG A 1 79  ? -10.613 0.658   0.857   1.00 0.00 ? 79  ARG A CA   4  
ATOM 7031  C C    . ARG A 1 79  ? -10.413 2.135   0.539   1.00 0.00 ? 79  ARG A C    4  
ATOM 7032  O O    . ARG A 1 79  ? -9.512  2.787   1.060   1.00 0.00 ? 79  ARG A O    4  
ATOM 7033  C CB   . ARG A 1 79  ? -10.998 0.512   2.323   1.00 0.00 ? 79  ARG A CB   4  
ATOM 7034  C CG   . ARG A 1 79  ? -12.405 1.016   2.603   1.00 0.00 ? 79  ARG A CG   4  
ATOM 7035  C CD   . ARG A 1 79  ? -12.629 1.260   4.079   1.00 0.00 ? 79  ARG A CD   4  
ATOM 7036  N NE   . ARG A 1 79  ? -12.267 0.099   4.888   1.00 0.00 ? 79  ARG A NE   4  
ATOM 7037  C CZ   . ARG A 1 79  ? -12.225 0.097   6.220   1.00 0.00 ? 79  ARG A CZ   4  
ATOM 7038  N NH1  . ARG A 1 79  ? -12.512 1.197   6.903   1.00 0.00 ? 79  ARG A NH1  4  
ATOM 7039  N NH2  . ARG A 1 79  ? -11.887 -1.011  6.867   1.00 0.00 ? 79  ARG A NH2  4  
ATOM 7040  H H    . ARG A 1 79  ? -8.821  -0.409  1.241   1.00 0.00 ? 79  ARG A H    4  
ATOM 7041  H HA   . ARG A 1 79  ? -11.424 0.286   0.249   1.00 0.00 ? 79  ARG A HA   4  
ATOM 7042  H HB2  . ARG A 1 79  ? -10.945 -0.532  2.599   1.00 0.00 ? 79  ARG A HB2  4  
ATOM 7043  H HB3  . ARG A 1 79  ? -10.307 1.076   2.930   1.00 0.00 ? 79  ARG A HB3  4  
ATOM 7044  H HG2  . ARG A 1 79  ? -12.557 1.942   2.070   1.00 0.00 ? 79  ARG A HG2  4  
ATOM 7045  H HG3  . ARG A 1 79  ? -13.114 0.279   2.259   1.00 0.00 ? 79  ARG A HG3  4  
ATOM 7046  H HD2  . ARG A 1 79  ? -12.031 2.103   4.379   1.00 0.00 ? 79  ARG A HD2  4  
ATOM 7047  H HD3  . ARG A 1 79  ? -13.673 1.490   4.238   1.00 0.00 ? 79  ARG A HD3  4  
ATOM 7048  H HE   . ARG A 1 79  ? -12.046 -0.727  4.407   1.00 0.00 ? 79  ARG A HE   4  
ATOM 7049  H HH11 . ARG A 1 79  ? -12.770 2.043   6.422   1.00 0.00 ? 79  ARG A HH11 4  
ATOM 7050  H HH12 . ARG A 1 79  ? -12.468 1.192   7.912   1.00 0.00 ? 79  ARG A HH12 4  
ATOM 7051  H HH21 . ARG A 1 79  ? -11.661 -1.844  6.360   1.00 0.00 ? 79  ARG A HH21 4  
ATOM 7052  H HH22 . ARG A 1 79  ? -11.864 -1.026  7.874   1.00 0.00 ? 79  ARG A HH22 4  
ATOM 7053  N N    . SER A 1 80  ? -11.249 2.627   -0.348  1.00 0.00 ? 80  SER A N    4  
ATOM 7054  C CA   . SER A 1 80  ? -11.300 4.034   -0.692  1.00 0.00 ? 80  SER A CA   4  
ATOM 7055  C C    . SER A 1 80  ? -11.956 4.853   0.423   1.00 0.00 ? 80  SER A C    4  
ATOM 7056  O O    . SER A 1 80  ? -12.603 4.307   1.320   1.00 0.00 ? 80  SER A O    4  
ATOM 7057  C CB   . SER A 1 80  ? -12.101 4.182   -1.981  1.00 0.00 ? 80  SER A CB   4  
ATOM 7058  O OG   . SER A 1 80  ? -12.210 5.537   -2.385  1.00 0.00 ? 80  SER A OG   4  
ATOM 7059  H H    . SER A 1 80  ? -11.835 1.999   -0.826  1.00 0.00 ? 80  SER A H    4  
ATOM 7060  H HA   . SER A 1 80  ? -10.293 4.386   -0.854  1.00 0.00 ? 80  SER A HA   4  
ATOM 7061  H HB2  . SER A 1 80  ? -11.619 3.624   -2.768  1.00 0.00 ? 80  SER A HB2  4  
ATOM 7062  H HB3  . SER A 1 80  ? -13.095 3.787   -1.817  1.00 0.00 ? 80  SER A HB3  4  
ATOM 7063  H HG   . SER A 1 80  ? -12.050 5.594   -3.343  1.00 0.00 ? 80  SER A HG   4  
ATOM 7064  N N    . LYS A 1 81  ? -11.809 6.176   0.333   1.00 0.00 ? 81  LYS A N    4  
ATOM 7065  C CA   . LYS A 1 81  ? -12.451 7.110   1.254   1.00 0.00 ? 81  LYS A CA   4  
ATOM 7066  C C    . LYS A 1 81  ? -13.957 7.117   1.017   1.00 0.00 ? 81  LYS A C    4  
ATOM 7067  O O    . LYS A 1 81  ? -14.726 7.682   1.792   1.00 0.00 ? 81  LYS A O    4  
ATOM 7068  C CB   . LYS A 1 81  ? -11.889 8.521   1.044   1.00 0.00 ? 81  LYS A CB   4  
ATOM 7069  C CG   . LYS A 1 81  ? -12.331 9.528   2.093   1.00 0.00 ? 81  LYS A CG   4  
ATOM 7070  C CD   . LYS A 1 81  ? -11.747 9.214   3.459   1.00 0.00 ? 81  LYS A CD   4  
ATOM 7071  C CE   . LYS A 1 81  ? -12.359 10.097  4.528   1.00 0.00 ? 81  LYS A CE   4  
ATOM 7072  N NZ   . LYS A 1 81  ? -11.731 9.900   5.861   1.00 0.00 ? 81  LYS A NZ   4  
ATOM 7073  H H    . LYS A 1 81  ? -11.237 6.541   -0.378  1.00 0.00 ? 81  LYS A H    4  
ATOM 7074  H HA   . LYS A 1 81  ? -12.249 6.787   2.263   1.00 0.00 ? 81  LYS A HA   4  
ATOM 7075  H HB2  . LYS A 1 81  ? -10.810 8.474   1.050   1.00 0.00 ? 81  LYS A HB2  4  
ATOM 7076  H HB3  . LYS A 1 81  ? -12.214 8.880   0.077   1.00 0.00 ? 81  LYS A HB3  4  
ATOM 7077  H HG2  . LYS A 1 81  ? -12.004 10.512  1.790   1.00 0.00 ? 81  LYS A HG2  4  
ATOM 7078  H HG3  . LYS A 1 81  ? -13.409 9.513   2.160   1.00 0.00 ? 81  LYS A HG3  4  
ATOM 7079  H HD2  . LYS A 1 81  ? -11.947 8.181   3.699   1.00 0.00 ? 81  LYS A HD2  4  
ATOM 7080  H HD3  . LYS A 1 81  ? -10.680 9.383   3.432   1.00 0.00 ? 81  LYS A HD3  4  
ATOM 7081  H HE2  . LYS A 1 81  ? -12.240 11.129  4.235   1.00 0.00 ? 81  LYS A HE2  4  
ATOM 7082  H HE3  . LYS A 1 81  ? -13.411 9.866   4.601   1.00 0.00 ? 81  LYS A HE3  4  
ATOM 7083  H HZ1  . LYS A 1 81  ? -10.716 10.124  5.821   1.00 0.00 ? 81  LYS A HZ1  4  
ATOM 7084  H HZ2  . LYS A 1 81  ? -11.849 8.913   6.175   1.00 0.00 ? 81  LYS A HZ2  4  
ATOM 7085  H HZ3  . LYS A 1 81  ? -12.184 10.527  6.560   1.00 0.00 ? 81  LYS A HZ3  4  
ATOM 7086  N N    . ASN A 1 82  ? -14.368 6.464   -0.060  1.00 0.00 ? 82  ASN A N    4  
ATOM 7087  C CA   . ASN A 1 82  ? -15.775 6.326   -0.391  1.00 0.00 ? 82  ASN A CA   4  
ATOM 7088  C C    . ASN A 1 82  ? -16.255 4.968   0.092   1.00 0.00 ? 82  ASN A C    4  
ATOM 7089  O O    . ASN A 1 82  ? -17.374 4.543   -0.195  1.00 0.00 ? 82  ASN A O    4  
ATOM 7090  C CB   . ASN A 1 82  ? -15.988 6.448   -1.903  1.00 0.00 ? 82  ASN A CB   4  
ATOM 7091  C CG   . ASN A 1 82  ? -15.427 7.738   -2.474  1.00 0.00 ? 82  ASN A CG   4  
ATOM 7092  O OD1  . ASN A 1 82  ? -16.107 8.763   -2.514  1.00 0.00 ? 82  ASN A OD1  4  
ATOM 7093  N ND2  . ASN A 1 82  ? -14.183 7.694   -2.931  1.00 0.00 ? 82  ASN A ND2  4  
ATOM 7094  H H    . ASN A 1 82  ? -13.705 6.027   -0.638  1.00 0.00 ? 82  ASN A H    4  
ATOM 7095  H HA   . ASN A 1 82  ? -16.325 7.103   0.118   1.00 0.00 ? 82  ASN A HA   4  
ATOM 7096  H HB2  . ASN A 1 82  ? -15.504 5.620   -2.397  1.00 0.00 ? 82  ASN A HB2  4  
ATOM 7097  H HB3  . ASN A 1 82  ? -17.048 6.416   -2.115  1.00 0.00 ? 82  ASN A HB3  4  
ATOM 7098  H HD21 . ASN A 1 82  ? -13.699 6.841   -2.885  1.00 0.00 ? 82  ASN A HD21 4  
ATOM 7099  H HD22 . ASN A 1 82  ? -13.793 8.518   -3.292  1.00 0.00 ? 82  ASN A HD22 4  
ATOM 7100  N N    . GLN A 1 83  ? -15.362 4.294   0.816   1.00 0.00 ? 83  GLN A N    4  
ATOM 7101  C CA   . GLN A 1 83  ? -15.604 2.961   1.358   1.00 0.00 ? 83  GLN A CA   4  
ATOM 7102  C C    . GLN A 1 83  ? -15.816 1.950   0.241   1.00 0.00 ? 83  GLN A C    4  
ATOM 7103  O O    . GLN A 1 83  ? -16.575 0.992   0.378   1.00 0.00 ? 83  GLN A O    4  
ATOM 7104  C CB   . GLN A 1 83  ? -16.770 2.961   2.350   1.00 0.00 ? 83  GLN A CB   4  
ATOM 7105  C CG   . GLN A 1 83  ? -16.404 3.514   3.722   1.00 0.00 ? 83  GLN A CG   4  
ATOM 7106  C CD   . GLN A 1 83  ? -16.025 4.985   3.700   1.00 0.00 ? 83  GLN A CD   4  
ATOM 7107  O OE1  . GLN A 1 83  ? -16.883 5.861   3.821   1.00 0.00 ? 83  GLN A OE1  4  
ATOM 7108  N NE2  . GLN A 1 83  ? -14.736 5.268   3.568   1.00 0.00 ? 83  GLN A NE2  4  
ATOM 7109  H H    . GLN A 1 83  ? -14.493 4.715   0.995   1.00 0.00 ? 83  GLN A H    4  
ATOM 7110  H HA   . GLN A 1 83  ? -14.709 2.676   1.894   1.00 0.00 ? 83  GLN A HA   4  
ATOM 7111  H HB2  . GLN A 1 83  ? -17.572 3.561   1.944   1.00 0.00 ? 83  GLN A HB2  4  
ATOM 7112  H HB3  . GLN A 1 83  ? -17.119 1.947   2.475   1.00 0.00 ? 83  GLN A HB3  4  
ATOM 7113  H HG2  . GLN A 1 83  ? -17.247 3.388   4.384   1.00 0.00 ? 83  GLN A HG2  4  
ATOM 7114  H HG3  . GLN A 1 83  ? -15.561 2.950   4.108   1.00 0.00 ? 83  GLN A HG3  4  
ATOM 7115  H HE21 . GLN A 1 83  ? -14.102 4.520   3.498   1.00 0.00 ? 83  GLN A HE21 4  
ATOM 7116  H HE22 . GLN A 1 83  ? -14.466 6.213   3.548   1.00 0.00 ? 83  GLN A HE22 4  
ATOM 7117  N N    . GLU A 1 84  ? -15.134 2.186   -0.870  1.00 0.00 ? 84  GLU A N    4  
ATOM 7118  C CA   . GLU A 1 84  ? -15.095 1.247   -1.967  1.00 0.00 ? 84  GLU A CA   4  
ATOM 7119  C C    . GLU A 1 84  ? -13.914 0.316   -1.766  1.00 0.00 ? 84  GLU A C    4  
ATOM 7120  O O    . GLU A 1 84  ? -13.004 0.635   -1.011  1.00 0.00 ? 84  GLU A O    4  
ATOM 7121  C CB   . GLU A 1 84  ? -14.940 1.992   -3.289  1.00 0.00 ? 84  GLU A CB   4  
ATOM 7122  C CG   . GLU A 1 84  ? -16.032 3.014   -3.550  1.00 0.00 ? 84  GLU A CG   4  
ATOM 7123  C CD   . GLU A 1 84  ? -15.814 3.773   -4.842  1.00 0.00 ? 84  GLU A CD   4  
ATOM 7124  O OE1  . GLU A 1 84  ? -14.966 4.691   -4.867  1.00 0.00 ? 84  GLU A OE1  4  
ATOM 7125  O OE2  . GLU A 1 84  ? -16.489 3.458   -5.840  1.00 0.00 ? 84  GLU A OE2  4  
ATOM 7126  H H    . GLU A 1 84  ? -14.636 3.020   -0.958  1.00 0.00 ? 84  GLU A H    4  
ATOM 7127  H HA   . GLU A 1 84  ? -16.011 0.678   -1.969  1.00 0.00 ? 84  GLU A HA   4  
ATOM 7128  H HB2  . GLU A 1 84  ? -13.990 2.506   -3.288  1.00 0.00 ? 84  GLU A HB2  4  
ATOM 7129  H HB3  . GLU A 1 84  ? -14.948 1.277   -4.090  1.00 0.00 ? 84  GLU A HB3  4  
ATOM 7130  H HG2  . GLU A 1 84  ? -16.982 2.500   -3.607  1.00 0.00 ? 84  GLU A HG2  4  
ATOM 7131  H HG3  . GLU A 1 84  ? -16.052 3.718   -2.731  1.00 0.00 ? 84  GLU A HG3  4  
ATOM 7132  N N    . TRP A 1 85  ? -13.918 -0.824  -2.429  1.00 0.00 ? 85  TRP A N    4  
ATOM 7133  C CA   . TRP A 1 85  ? -12.831 -1.769  -2.294  1.00 0.00 ? 85  TRP A CA   4  
ATOM 7134  C C    . TRP A 1 85  ? -12.255 -2.093  -3.665  1.00 0.00 ? 85  TRP A C    4  
ATOM 7135  O O    . TRP A 1 85  ? -12.567 -3.127  -4.253  1.00 0.00 ? 85  TRP A O    4  
ATOM 7136  C CB   . TRP A 1 85  ? -13.337 -3.032  -1.605  1.00 0.00 ? 85  TRP A CB   4  
ATOM 7137  C CG   . TRP A 1 85  ? -13.824 -2.783  -0.206  1.00 0.00 ? 85  TRP A CG   4  
ATOM 7138  C CD1  . TRP A 1 85  ? -15.080 -2.405  0.175   1.00 0.00 ? 85  TRP A CD1  4  
ATOM 7139  C CD2  . TRP A 1 85  ? -13.057 -2.887  0.996   1.00 0.00 ? 85  TRP A CD2  4  
ATOM 7140  N NE1  . TRP A 1 85  ? -15.136 -2.267  1.542   1.00 0.00 ? 85  TRP A NE1  4  
ATOM 7141  C CE2  . TRP A 1 85  ? -13.911 -2.563  2.066   1.00 0.00 ? 85  TRP A CE2  4  
ATOM 7142  C CE3  . TRP A 1 85  ? -11.734 -3.223  1.273   1.00 0.00 ? 85  TRP A CE3  4  
ATOM 7143  C CZ2  . TRP A 1 85  ? -13.481 -2.570  3.388   1.00 0.00 ? 85  TRP A CZ2  4  
ATOM 7144  C CZ3  . TRP A 1 85  ? -11.311 -3.225  2.587   1.00 0.00 ? 85  TRP A CZ3  4  
ATOM 7145  C CH2  . TRP A 1 85  ? -12.182 -2.903  3.628   1.00 0.00 ? 85  TRP A CH2  4  
ATOM 7146  H H    . TRP A 1 85  ? -14.660 -1.051  -3.019  1.00 0.00 ? 85  TRP A H    4  
ATOM 7147  H HA   . TRP A 1 85  ? -12.063 -1.314  -1.685  1.00 0.00 ? 85  TRP A HA   4  
ATOM 7148  H HB2  . TRP A 1 85  ? -14.158 -3.443  -2.175  1.00 0.00 ? 85  TRP A HB2  4  
ATOM 7149  H HB3  . TRP A 1 85  ? -12.542 -3.752  -1.561  1.00 0.00 ? 85  TRP A HB3  4  
ATOM 7150  H HD1  . TRP A 1 85  ? -15.900 -2.238  -0.508  1.00 0.00 ? 85  TRP A HD1  4  
ATOM 7151  H HE1  . TRP A 1 85  ? -15.925 -2.002  2.059   1.00 0.00 ? 85  TRP A HE1  4  
ATOM 7152  H HE3  . TRP A 1 85  ? -11.042 -3.474  0.481   1.00 0.00 ? 85  TRP A HE3  4  
ATOM 7153  H HZ2  . TRP A 1 85  ? -14.141 -2.327  4.203   1.00 0.00 ? 85  TRP A HZ2  4  
ATOM 7154  H HZ3  . TRP A 1 85  ? -10.289 -3.484  2.821   1.00 0.00 ? 85  TRP A HZ3  4  
ATOM 7155  H HH2  . TRP A 1 85  ? -11.805 -2.919  4.641   1.00 0.00 ? 85  TRP A HH2  4  
ATOM 7156  N N    . LEU A 1 86  ? -11.405 -1.205  -4.160  1.00 0.00 ? 86  LEU A N    4  
ATOM 7157  C CA   . LEU A 1 86  ? -10.919 -1.288  -5.531  1.00 0.00 ? 86  LEU A CA   4  
ATOM 7158  C C    . LEU A 1 86  ? -9.718  -2.205  -5.659  1.00 0.00 ? 86  LEU A C    4  
ATOM 7159  O O    . LEU A 1 86  ? -9.032  -2.503  -4.686  1.00 0.00 ? 86  LEU A O    4  
ATOM 7160  C CB   . LEU A 1 86  ? -10.581 0.106   -6.071  1.00 0.00 ? 86  LEU A CB   4  
ATOM 7161  C CG   . LEU A 1 86  ? -9.924  1.070   -5.079  1.00 0.00 ? 86  LEU A CG   4  
ATOM 7162  C CD1  . LEU A 1 86  ? -8.459  0.722   -4.856  1.00 0.00 ? 86  LEU A CD1  4  
ATOM 7163  C CD2  . LEU A 1 86  ? -10.065 2.500   -5.566  1.00 0.00 ? 86  LEU A CD2  4  
ATOM 7164  H H    . LEU A 1 86  ? -11.072 -0.487  -3.576  1.00 0.00 ? 86  LEU A H    4  
ATOM 7165  H HA   . LEU A 1 86  ? -11.718 -1.698  -6.128  1.00 0.00 ? 86  LEU A HA   4  
ATOM 7166  H HB2  . LEU A 1 86  ? -9.909  -0.016  -6.908  1.00 0.00 ? 86  LEU A HB2  4  
ATOM 7167  H HB3  . LEU A 1 86  ? -11.491 0.556   -6.430  1.00 0.00 ? 86  LEU A HB3  4  
ATOM 7168  H HG   . LEU A 1 86  ? -10.429 0.992   -4.127  1.00 0.00 ? 86  LEU A HG   4  
ATOM 7169  H HD11 . LEU A 1 86  ? -8.030  1.408   -4.142  1.00 0.00 ? 86  LEU A HD11 4  
ATOM 7170  H HD12 . LEU A 1 86  ? -7.925  0.798   -5.794  1.00 0.00 ? 86  LEU A HD12 4  
ATOM 7171  H HD13 . LEU A 1 86  ? -8.381  -0.288  -4.480  1.00 0.00 ? 86  LEU A HD13 4  
ATOM 7172  H HD21 . LEU A 1 86  ? -9.619  3.171   -4.847  1.00 0.00 ? 86  LEU A HD21 4  
ATOM 7173  H HD22 . LEU A 1 86  ? -11.112 2.740   -5.682  1.00 0.00 ? 86  LEU A HD22 4  
ATOM 7174  H HD23 . LEU A 1 86  ? -9.565  2.608   -6.516  1.00 0.00 ? 86  LEU A HD23 4  
ATOM 7175  N N    . TRP A 1 87  ? -9.462  -2.617  -6.887  1.00 0.00 ? 87  TRP A N    4  
ATOM 7176  C CA   . TRP A 1 87  ? -8.400  -3.560  -7.181  1.00 0.00 ? 87  TRP A CA   4  
ATOM 7177  C C    . TRP A 1 87  ? -7.122  -2.838  -7.563  1.00 0.00 ? 87  TRP A C    4  
ATOM 7178  O O    . TRP A 1 87  ? -7.074  -2.112  -8.561  1.00 0.00 ? 87  TRP A O    4  
ATOM 7179  C CB   . TRP A 1 87  ? -8.812  -4.494  -8.315  1.00 0.00 ? 87  TRP A CB   4  
ATOM 7180  C CG   . TRP A 1 87  ? -9.810  -5.528  -7.907  1.00 0.00 ? 87  TRP A CG   4  
ATOM 7181  C CD1  . TRP A 1 87  ? -11.170 -5.453  -8.017  1.00 0.00 ? 87  TRP A CD1  4  
ATOM 7182  C CD2  . TRP A 1 87  ? -9.520  -6.798  -7.316  1.00 0.00 ? 87  TRP A CD2  4  
ATOM 7183  N NE1  . TRP A 1 87  ? -11.740 -6.610  -7.542  1.00 0.00 ? 87  TRP A NE1  4  
ATOM 7184  C CE2  . TRP A 1 87  ? -10.748 -7.450  -7.104  1.00 0.00 ? 87  TRP A CE2  4  
ATOM 7185  C CE3  . TRP A 1 87  ? -8.338  -7.447  -6.949  1.00 0.00 ? 87  TRP A CE3  4  
ATOM 7186  C CZ2  . TRP A 1 87  ? -10.827 -8.723  -6.542  1.00 0.00 ? 87  TRP A CZ2  4  
ATOM 7187  C CZ3  . TRP A 1 87  ? -8.416  -8.706  -6.390  1.00 0.00 ? 87  TRP A CZ3  4  
ATOM 7188  C CH2  . TRP A 1 87  ? -9.652  -9.334  -6.191  1.00 0.00 ? 87  TRP A CH2  4  
ATOM 7189  H H    . TRP A 1 87  ? -9.991  -2.249  -7.631  1.00 0.00 ? 87  TRP A H    4  
ATOM 7190  H HA   . TRP A 1 87  ? -8.220  -4.145  -6.293  1.00 0.00 ? 87  TRP A HA   4  
ATOM 7191  H HB2  . TRP A 1 87  ? -9.244  -3.912  -9.116  1.00 0.00 ? 87  TRP A HB2  4  
ATOM 7192  H HB3  . TRP A 1 87  ? -7.933  -5.005  -8.685  1.00 0.00 ? 87  TRP A HB3  4  
ATOM 7193  H HD1  . TRP A 1 87  ? -11.704 -4.604  -8.427  1.00 0.00 ? 87  TRP A HD1  4  
ATOM 7194  H HE1  . TRP A 1 87  ? -12.704 -6.804  -7.519  1.00 0.00 ? 87  TRP A HE1  4  
ATOM 7195  H HE3  . TRP A 1 87  ? -7.374  -6.979  -7.096  1.00 0.00 ? 87  TRP A HE3  4  
ATOM 7196  H HZ2  . TRP A 1 87  ? -11.772 -9.219  -6.383  1.00 0.00 ? 87  TRP A HZ2  4  
ATOM 7197  H HZ3  . TRP A 1 87  ? -7.512  -9.221  -6.096  1.00 0.00 ? 87  TRP A HZ3  4  
ATOM 7198  H HH2  . TRP A 1 87  ? -9.668  -10.319 -5.750  1.00 0.00 ? 87  TRP A HH2  4  
ATOM 7199  N N    . MET A 1 88  ? -6.093  -3.030  -6.768  1.00 0.00 ? 88  MET A N    4  
ATOM 7200  C CA   . MET A 1 88  ? -4.789  -2.492  -7.090  1.00 0.00 ? 88  MET A CA   4  
ATOM 7201  C C    . MET A 1 88  ? -3.737  -3.569  -6.912  1.00 0.00 ? 88  MET A C    4  
ATOM 7202  O O    . MET A 1 88  ? -3.882  -4.454  -6.066  1.00 0.00 ? 88  MET A O    4  
ATOM 7203  C CB   . MET A 1 88  ? -4.458  -1.278  -6.213  1.00 0.00 ? 88  MET A CB   4  
ATOM 7204  C CG   . MET A 1 88  ? -4.183  -1.622  -4.755  1.00 0.00 ? 88  MET A CG   4  
ATOM 7205  S SD   . MET A 1 88  ? -3.516  -0.231  -3.822  1.00 0.00 ? 88  MET A SD   4  
ATOM 7206  C CE   . MET A 1 88  ? -4.769  1.010   -4.119  1.00 0.00 ? 88  MET A CE   4  
ATOM 7207  H H    . MET A 1 88  ? -6.212  -3.552  -5.941  1.00 0.00 ? 88  MET A H    4  
ATOM 7208  H HA   . MET A 1 88  ? -4.802  -2.186  -8.127  1.00 0.00 ? 88  MET A HA   4  
ATOM 7209  H HB2  . MET A 1 88  ? -3.588  -0.784  -6.614  1.00 0.00 ? 88  MET A HB2  4  
ATOM 7210  H HB3  . MET A 1 88  ? -5.292  -0.594  -6.244  1.00 0.00 ? 88  MET A HB3  4  
ATOM 7211  H HG2  . MET A 1 88  ? -5.105  -1.934  -4.295  1.00 0.00 ? 88  MET A HG2  4  
ATOM 7212  H HG3  . MET A 1 88  ? -3.471  -2.434  -4.720  1.00 0.00 ? 88  MET A HG3  4  
ATOM 7213  H HE1  . MET A 1 88  ? -5.720  0.656   -3.754  1.00 0.00 ? 88  MET A HE1  4  
ATOM 7214  H HE2  . MET A 1 88  ? -4.838  1.203   -5.180  1.00 0.00 ? 88  MET A HE2  4  
ATOM 7215  H HE3  . MET A 1 88  ? -4.501  1.922   -3.606  1.00 0.00 ? 88  MET A HE3  4  
ATOM 7216  N N    . ARG A 1 89  ? -2.704  -3.522  -7.726  1.00 0.00 ? 89  ARG A N    4  
ATOM 7217  C CA   . ARG A 1 89  ? -1.583  -4.417  -7.545  1.00 0.00 ? 89  ARG A CA   4  
ATOM 7218  C C    . ARG A 1 89  ? -0.404  -3.617  -7.036  1.00 0.00 ? 89  ARG A C    4  
ATOM 7219  O O    . ARG A 1 89  ? 0.119   -2.740  -7.727  1.00 0.00 ? 89  ARG A O    4  
ATOM 7220  C CB   . ARG A 1 89  ? -1.226  -5.155  -8.836  1.00 0.00 ? 89  ARG A CB   4  
ATOM 7221  C CG   . ARG A 1 89  ? -0.285  -6.331  -8.609  1.00 0.00 ? 89  ARG A CG   4  
ATOM 7222  C CD   . ARG A 1 89  ? 0.025   -7.075  -9.898  1.00 0.00 ? 89  ARG A CD   4  
ATOM 7223  N NE   . ARG A 1 89  ? 0.810   -8.289  -9.652  1.00 0.00 ? 89  ARG A NE   4  
ATOM 7224  C CZ   . ARG A 1 89  ? 1.534   -8.911  -10.586 1.00 0.00 ? 89  ARG A CZ   4  
ATOM 7225  N NH1  . ARG A 1 89  ? 1.581   -8.431  -11.821 1.00 0.00 ? 89  ARG A NH1  4  
ATOM 7226  N NH2  . ARG A 1 89  ? 2.215   -10.009 -10.277 1.00 0.00 ? 89  ARG A NH2  4  
ATOM 7227  H H    . ARG A 1 89  ? -2.684  -2.862  -8.456  1.00 0.00 ? 89  ARG A H    4  
ATOM 7228  H HA   . ARG A 1 89  ? -1.861  -5.139  -6.790  1.00 0.00 ? 89  ARG A HA   4  
ATOM 7229  H HB2  . ARG A 1 89  ? -2.136  -5.526  -9.289  1.00 0.00 ? 89  ARG A HB2  4  
ATOM 7230  H HB3  . ARG A 1 89  ? -0.746  -4.465  -9.512  1.00 0.00 ? 89  ARG A HB3  4  
ATOM 7231  H HG2  . ARG A 1 89  ? 0.639   -5.960  -8.192  1.00 0.00 ? 89  ARG A HG2  4  
ATOM 7232  H HG3  . ARG A 1 89  ? -0.744  -7.016  -7.909  1.00 0.00 ? 89  ARG A HG3  4  
ATOM 7233  H HD2  . ARG A 1 89  ? -0.906  -7.350  -10.372 1.00 0.00 ? 89  ARG A HD2  4  
ATOM 7234  H HD3  . ARG A 1 89  ? 0.584   -6.423  -10.550 1.00 0.00 ? 89  ARG A HD3  4  
ATOM 7235  H HE   . ARG A 1 89  ? 0.791   -8.662  -8.743  1.00 0.00 ? 89  ARG A HE   4  
ATOM 7236  H HH11 . ARG A 1 89  ? 1.074   -7.599  -12.060 1.00 0.00 ? 89  ARG A HH11 4  
ATOM 7237  H HH12 . ARG A 1 89  ? 2.125   -8.896  -12.528 1.00 0.00 ? 89  ARG A HH12 4  
ATOM 7238  H HH21 . ARG A 1 89  ? 2.190   -10.375 -9.346  1.00 0.00 ? 89  ARG A HH21 4  
ATOM 7239  H HH22 . ARG A 1 89  ? 2.764   -10.478 -10.984 1.00 0.00 ? 89  ARG A HH22 4  
ATOM 7240  N N    . THR A 1 90  ? -0.029  -3.896  -5.810  1.00 0.00 ? 90  THR A N    4  
ATOM 7241  C CA   . THR A 1 90  ? 1.057   -3.200  -5.163  1.00 0.00 ? 90  THR A CA   4  
ATOM 7242  C C    . THR A 1 90  ? 2.363   -3.961  -5.338  1.00 0.00 ? 90  THR A C    4  
ATOM 7243  O O    . THR A 1 90  ? 2.460   -5.139  -4.994  1.00 0.00 ? 90  THR A O    4  
ATOM 7244  C CB   . THR A 1 90  ? 0.768   -3.017  -3.662  1.00 0.00 ? 90  THR A CB   4  
ATOM 7245  O OG1  . THR A 1 90  ? -0.444  -2.276  -3.488  1.00 0.00 ? 90  THR A OG1  4  
ATOM 7246  C CG2  . THR A 1 90  ? 1.908   -2.294  -2.965  1.00 0.00 ? 90  THR A CG2  4  
ATOM 7247  H H    . THR A 1 90  ? -0.507  -4.601  -5.316  1.00 0.00 ? 90  THR A H    4  
ATOM 7248  H HA   . THR A 1 90  ? 1.153   -2.225  -5.616  1.00 0.00 ? 90  THR A HA   4  
ATOM 7249  H HB   . THR A 1 90  ? 0.651   -3.992  -3.211  1.00 0.00 ? 90  THR A HB   4  
ATOM 7250  H HG1  . THR A 1 90  ? -0.540  -1.640  -4.202  1.00 0.00 ? 90  THR A HG1  4  
ATOM 7251  H HG21 . THR A 1 90  ? 2.820   -2.858  -3.090  1.00 0.00 ? 90  THR A HG21 4  
ATOM 7252  H HG22 . THR A 1 90  ? 1.684   -2.198  -1.912  1.00 0.00 ? 90  THR A HG22 4  
ATOM 7253  H HG23 . THR A 1 90  ? 2.029   -1.313  -3.399  1.00 0.00 ? 90  THR A HG23 4  
ATOM 7254  N N    . SER A 1 91  ? 3.358   -3.287  -5.882  1.00 0.00 ? 91  SER A N    4  
ATOM 7255  C CA   . SER A 1 91  ? 4.672   -3.872  -6.038  1.00 0.00 ? 91  SER A CA   4  
ATOM 7256  C C    . SER A 1 91  ? 5.507   -3.547  -4.807  1.00 0.00 ? 91  SER A C    4  
ATOM 7257  O O    . SER A 1 91  ? 5.714   -2.375  -4.478  1.00 0.00 ? 91  SER A O    4  
ATOM 7258  C CB   . SER A 1 91  ? 5.339   -3.353  -7.313  1.00 0.00 ? 91  SER A CB   4  
ATOM 7259  O OG   . SER A 1 91  ? 4.526   -3.615  -8.450  1.00 0.00 ? 91  SER A OG   4  
ATOM 7260  H H    . SER A 1 91  ? 3.208   -2.355  -6.155  1.00 0.00 ? 91  SER A H    4  
ATOM 7261  H HA   . SER A 1 91  ? 4.553   -4.942  -6.107  1.00 0.00 ? 91  SER A HA   4  
ATOM 7262  H HB2  . SER A 1 91  ? 5.492   -2.288  -7.231  1.00 0.00 ? 91  SER A HB2  4  
ATOM 7263  H HB3  . SER A 1 91  ? 6.291   -3.846  -7.446  1.00 0.00 ? 91  SER A HB3  4  
ATOM 7264  H HG   . SER A 1 91  ? 4.152   -2.777  -8.775  1.00 0.00 ? 91  SER A HG   4  
ATOM 7265  N N    . SER A 1 92  ? 5.961   -4.580  -4.118  1.00 0.00 ? 92  SER A N    4  
ATOM 7266  C CA   . SER A 1 92  ? 6.652   -4.405  -2.857  1.00 0.00 ? 92  SER A CA   4  
ATOM 7267  C C    . SER A 1 92  ? 8.152   -4.411  -3.056  1.00 0.00 ? 92  SER A C    4  
ATOM 7268  O O    . SER A 1 92  ? 8.671   -4.948  -4.038  1.00 0.00 ? 92  SER A O    4  
ATOM 7269  C CB   . SER A 1 92  ? 6.274   -5.506  -1.862  1.00 0.00 ? 92  SER A CB   4  
ATOM 7270  O OG   . SER A 1 92  ? 6.653   -5.158  -0.546  1.00 0.00 ? 92  SER A OG   4  
ATOM 7271  H H    . SER A 1 92  ? 5.844   -5.487  -4.479  1.00 0.00 ? 92  SER A H    4  
ATOM 7272  H HA   . SER A 1 92  ? 6.360   -3.451  -2.449  1.00 0.00 ? 92  SER A HA   4  
ATOM 7273  H HB2  . SER A 1 92  ? 5.212   -5.653  -1.877  1.00 0.00 ? 92  SER A HB2  4  
ATOM 7274  H HB3  . SER A 1 92  ? 6.780   -6.432  -2.132  1.00 0.00 ? 92  SER A HB3  4  
ATOM 7275  H HG   . SER A 1 92  ? 6.662   -5.947  0.001   1.00 0.00 ? 92  SER A HG   4  
ATOM 7276  N N    . PHE A 1 93  ? 8.824   -3.809  -2.107  1.00 0.00 ? 93  PHE A N    4  
ATOM 7277  C CA   . PHE A 1 93  ? 10.265  -3.791  -2.051  1.00 0.00 ? 93  PHE A CA   4  
ATOM 7278  C C    . PHE A 1 93  ? 10.680  -3.504  -0.626  1.00 0.00 ? 93  PHE A C    4  
ATOM 7279  O O    . PHE A 1 93  ? 10.120  -2.627  0.022   1.00 0.00 ? 93  PHE A O    4  
ATOM 7280  C CB   . PHE A 1 93  ? 10.836  -2.734  -3.001  1.00 0.00 ? 93  PHE A CB   4  
ATOM 7281  C CG   . PHE A 1 93  ? 12.315  -2.494  -2.830  1.00 0.00 ? 93  PHE A CG   4  
ATOM 7282  C CD1  . PHE A 1 93  ? 13.241  -3.246  -3.535  1.00 0.00 ? 93  PHE A CD1  4  
ATOM 7283  C CD2  . PHE A 1 93  ? 12.779  -1.524  -1.949  1.00 0.00 ? 93  PHE A CD2  4  
ATOM 7284  C CE1  . PHE A 1 93  ? 14.597  -3.034  -3.369  1.00 0.00 ? 93  PHE A CE1  4  
ATOM 7285  C CE2  . PHE A 1 93  ? 14.133  -1.310  -1.779  1.00 0.00 ? 93  PHE A CE2  4  
ATOM 7286  C CZ   . PHE A 1 93  ? 15.042  -2.067  -2.491  1.00 0.00 ? 93  PHE A CZ   4  
ATOM 7287  H H    . PHE A 1 93  ? 8.322   -3.363  -1.393  1.00 0.00 ? 93  PHE A H    4  
ATOM 7288  H HA   . PHE A 1 93  ? 10.630  -4.768  -2.338  1.00 0.00 ? 93  PHE A HA   4  
ATOM 7289  H HB2  . PHE A 1 93  ? 10.667  -3.055  -4.017  1.00 0.00 ? 93  PHE A HB2  4  
ATOM 7290  H HB3  . PHE A 1 93  ? 10.323  -1.799  -2.836  1.00 0.00 ? 93  PHE A HB3  4  
ATOM 7291  H HD1  . PHE A 1 93  ? 12.894  -4.004  -4.223  1.00 0.00 ? 93  PHE A HD1  4  
ATOM 7292  H HD2  . PHE A 1 93  ? 12.068  -0.932  -1.393  1.00 0.00 ? 93  PHE A HD2  4  
ATOM 7293  H HE1  . PHE A 1 93  ? 15.308  -3.626  -3.926  1.00 0.00 ? 93  PHE A HE1  4  
ATOM 7294  H HE2  . PHE A 1 93  ? 14.480  -0.554  -1.084  1.00 0.00 ? 93  PHE A HE2  4  
ATOM 7295  H HZ   . PHE A 1 93  ? 16.102  -1.902  -2.360  1.00 0.00 ? 93  PHE A HZ   4  
ATOM 7296  N N    . THR A 1 94  ? 11.639  -4.248  -0.133  1.00 0.00 ? 94  THR A N    4  
ATOM 7297  C CA   . THR A 1 94  ? 12.110  -4.049  1.215   1.00 0.00 ? 94  THR A CA   4  
ATOM 7298  C C    . THR A 1 94  ? 13.484  -3.406  1.198   1.00 0.00 ? 94  THR A C    4  
ATOM 7299  O O    . THR A 1 94  ? 14.470  -4.043  0.812   1.00 0.00 ? 94  THR A O    4  
ATOM 7300  C CB   . THR A 1 94  ? 12.161  -5.388  1.964   1.00 0.00 ? 94  THR A CB   4  
ATOM 7301  O OG1  . THR A 1 94  ? 13.016  -6.300  1.261   1.00 0.00 ? 94  THR A OG1  4  
ATOM 7302  C CG2  . THR A 1 94  ? 10.768  -5.988  2.092   1.00 0.00 ? 94  THR A CG2  4  
ATOM 7303  H H    . THR A 1 94  ? 12.038  -4.953  -0.679  1.00 0.00 ? 94  THR A H    4  
ATOM 7304  H HA   . THR A 1 94  ? 11.417  -3.396  1.724   1.00 0.00 ? 94  THR A HA   4  
ATOM 7305  H HB   . THR A 1 94  ? 12.557  -5.215  2.953   1.00 0.00 ? 94  THR A HB   4  
ATOM 7306  H HG1  . THR A 1 94  ? 13.848  -5.855  1.057   1.00 0.00 ? 94  THR A HG1  4  
ATOM 7307  H HG21 . THR A 1 94  ? 10.370  -6.183  1.108   1.00 0.00 ? 94  THR A HG21 4  
ATOM 7308  H HG22 . THR A 1 94  ? 10.124  -5.295  2.611   1.00 0.00 ? 94  THR A HG22 4  
ATOM 7309  H HG23 . THR A 1 94  ? 10.826  -6.913  2.647   1.00 0.00 ? 94  THR A HG23 4  
ATOM 7310  N N    . PHE A 1 95  ? 13.549  -2.137  1.579   1.00 0.00 ? 95  PHE A N    4  
ATOM 7311  C CA   . PHE A 1 95  ? 14.813  -1.427  1.579   1.00 0.00 ? 95  PHE A CA   4  
ATOM 7312  C C    . PHE A 1 95  ? 15.671  -1.940  2.722   1.00 0.00 ? 95  PHE A C    4  
ATOM 7313  O O    . PHE A 1 95  ? 15.281  -1.859  3.891   1.00 0.00 ? 95  PHE A O    4  
ATOM 7314  C CB   . PHE A 1 95  ? 14.609  0.084   1.696   1.00 0.00 ? 95  PHE A CB   4  
ATOM 7315  C CG   . PHE A 1 95  ? 15.703  0.872   1.034   1.00 0.00 ? 95  PHE A CG   4  
ATOM 7316  C CD1  . PHE A 1 95  ? 16.976  0.921   1.581   1.00 0.00 ? 95  PHE A CD1  4  
ATOM 7317  C CD2  . PHE A 1 95  ? 15.461  1.550   -0.148  1.00 0.00 ? 95  PHE A CD2  4  
ATOM 7318  C CE1  . PHE A 1 95  ? 17.984  1.632   0.962   1.00 0.00 ? 95  PHE A CE1  4  
ATOM 7319  C CE2  . PHE A 1 95  ? 16.464  2.266   -0.771  1.00 0.00 ? 95  PHE A CE2  4  
ATOM 7320  C CZ   . PHE A 1 95  ? 17.728  2.306   -0.216  1.00 0.00 ? 95  PHE A CZ   4  
ATOM 7321  H H    . PHE A 1 95  ? 12.735  -1.677  1.880   1.00 0.00 ? 95  PHE A H    4  
ATOM 7322  H HA   . PHE A 1 95  ? 15.314  -1.646  0.645   1.00 0.00 ? 95  PHE A HA   4  
ATOM 7323  H HB2  . PHE A 1 95  ? 13.672  0.354   1.232   1.00 0.00 ? 95  PHE A HB2  4  
ATOM 7324  H HB3  . PHE A 1 95  ? 14.583  0.358   2.741   1.00 0.00 ? 95  PHE A HB3  4  
ATOM 7325  H HD1  . PHE A 1 95  ? 17.175  0.393   2.501   1.00 0.00 ? 95  PHE A HD1  4  
ATOM 7326  H HD2  . PHE A 1 95  ? 14.473  1.519   -0.584  1.00 0.00 ? 95  PHE A HD2  4  
ATOM 7327  H HE1  . PHE A 1 95  ? 18.971  1.663   1.398   1.00 0.00 ? 95  PHE A HE1  4  
ATOM 7328  H HE2  . PHE A 1 95  ? 16.260  2.791   -1.693  1.00 0.00 ? 95  PHE A HE2  4  
ATOM 7329  H HZ   . PHE A 1 95  ? 18.515  2.862   -0.702  1.00 0.00 ? 95  PHE A HZ   4  
ATOM 7330  N N    . GLN A 1 96  ? 16.818  -2.493  2.375   1.00 0.00 ? 96  GLN A N    4  
ATOM 7331  C CA   . GLN A 1 96  ? 17.682  -3.124  3.352   1.00 0.00 ? 96  GLN A CA   4  
ATOM 7332  C C    . GLN A 1 96  ? 18.795  -2.196  3.798   1.00 0.00 ? 96  GLN A C    4  
ATOM 7333  O O    . GLN A 1 96  ? 19.386  -1.478  2.991   1.00 0.00 ? 96  GLN A O    4  
ATOM 7334  C CB   . GLN A 1 96  ? 18.292  -4.398  2.776   1.00 0.00 ? 96  GLN A CB   4  
ATOM 7335  C CG   . GLN A 1 96  ? 17.276  -5.474  2.450   1.00 0.00 ? 96  GLN A CG   4  
ATOM 7336  C CD   . GLN A 1 96  ? 17.935  -6.751  1.987   1.00 0.00 ? 96  GLN A CD   4  
ATOM 7337  O OE1  . GLN A 1 96  ? 18.161  -6.954  0.795   1.00 0.00 ? 96  GLN A OE1  4  
ATOM 7338  N NE2  . GLN A 1 96  ? 18.262  -7.615  2.930   1.00 0.00 ? 96  GLN A NE2  4  
ATOM 7339  H H    . GLN A 1 96  ? 17.093  -2.478  1.431   1.00 0.00 ? 96  GLN A H    4  
ATOM 7340  H HA   . GLN A 1 96  ? 17.080  -3.383  4.208   1.00 0.00 ? 96  GLN A HA   4  
ATOM 7341  H HB2  . GLN A 1 96  ? 18.825  -4.152  1.869   1.00 0.00 ? 96  GLN A HB2  4  
ATOM 7342  H HB3  . GLN A 1 96  ? 18.992  -4.802  3.494   1.00 0.00 ? 96  GLN A HB3  4  
ATOM 7343  H HG2  . GLN A 1 96  ? 16.694  -5.686  3.336   1.00 0.00 ? 96  GLN A HG2  4  
ATOM 7344  H HG3  . GLN A 1 96  ? 16.624  -5.114  1.667   1.00 0.00 ? 96  GLN A HG3  4  
ATOM 7345  H HE21 . GLN A 1 96  ? 18.059  -7.382  3.864   1.00 0.00 ? 96  GLN A HE21 4  
ATOM 7346  H HE22 . GLN A 1 96  ? 18.698  -8.452  2.663   1.00 0.00 ? 96  GLN A HE22 4  
ATOM 7347  N N    . ASN A 1 97  ? 19.055  -2.217  5.096   1.00 0.00 ? 97  ASN A N    4  
ATOM 7348  C CA   . ASN A 1 97  ? 20.236  -1.595  5.662   1.00 0.00 ? 97  ASN A CA   4  
ATOM 7349  C C    . ASN A 1 97  ? 21.461  -2.166  4.968   1.00 0.00 ? 97  ASN A C    4  
ATOM 7350  O O    . ASN A 1 97  ? 21.730  -3.360  5.084   1.00 0.00 ? 97  ASN A O    4  
ATOM 7351  C CB   . ASN A 1 97  ? 20.318  -1.875  7.171   1.00 0.00 ? 97  ASN A CB   4  
ATOM 7352  C CG   . ASN A 1 97  ? 19.262  -1.144  7.982   1.00 0.00 ? 97  ASN A CG   4  
ATOM 7353  O OD1  . ASN A 1 97  ? 18.828  -1.623  9.030   1.00 0.00 ? 97  ASN A OD1  4  
ATOM 7354  N ND2  . ASN A 1 97  ? 18.841  0.018   7.514   1.00 0.00 ? 97  ASN A ND2  4  
ATOM 7355  H H    . ASN A 1 97  ? 18.419  -2.669  5.696   1.00 0.00 ? 97  ASN A H    4  
ATOM 7356  H HA   . ASN A 1 97  ? 20.184  -0.531  5.490   1.00 0.00 ? 97  ASN A HA   4  
ATOM 7357  H HB2  . ASN A 1 97  ? 20.190  -2.935  7.339   1.00 0.00 ? 97  ASN A HB2  4  
ATOM 7358  H HB3  . ASN A 1 97  ? 21.292  -1.580  7.532   1.00 0.00 ? 97  ASN A HB3  4  
ATOM 7359  H HD21 . ASN A 1 97  ? 19.220  0.349   6.670   1.00 0.00 ? 97  ASN A HD21 4  
ATOM 7360  H HD22 . ASN A 1 97  ? 18.167  0.509   8.032   1.00 0.00 ? 97  ASN A HD22 4  
ATOM 7361  N N    . PRO A 1 98  ? 22.216  -1.331  4.241   1.00 0.00 ? 98  PRO A N    4  
ATOM 7362  C CA   . PRO A 1 98  ? 23.314  -1.792  3.381   1.00 0.00 ? 98  PRO A CA   4  
ATOM 7363  C C    . PRO A 1 98  ? 24.410  -2.547  4.135   1.00 0.00 ? 98  PRO A C    4  
ATOM 7364  O O    . PRO A 1 98  ? 25.289  -3.145  3.523   1.00 0.00 ? 98  PRO A O    4  
ATOM 7365  C CB   . PRO A 1 98  ? 23.874  -0.500  2.774   1.00 0.00 ? 98  PRO A CB   4  
ATOM 7366  C CG   . PRO A 1 98  ? 23.374  0.600   3.649   1.00 0.00 ? 98  PRO A CG   4  
ATOM 7367  C CD   . PRO A 1 98  ? 22.057  0.132   4.193   1.00 0.00 ? 98  PRO A CD   4  
ATOM 7368  H HA   . PRO A 1 98  ? 22.940  -2.424  2.587   1.00 0.00 ? 98  PRO A HA   4  
ATOM 7369  H HB2  . PRO A 1 98  ? 24.954  -0.542  2.773   1.00 0.00 ? 98  PRO A HB2  4  
ATOM 7370  H HB3  . PRO A 1 98  ? 23.514  -0.392  1.760   1.00 0.00 ? 98  PRO A HB3  4  
ATOM 7371  H HG2  . PRO A 1 98  ? 24.071  0.775   4.453   1.00 0.00 ? 98  PRO A HG2  4  
ATOM 7372  H HG3  . PRO A 1 98  ? 23.239  1.498   3.064   1.00 0.00 ? 98  PRO A HG3  4  
ATOM 7373  H HD2  . PRO A 1 98  ? 21.890  0.536   5.181   1.00 0.00 ? 98  PRO A HD2  4  
ATOM 7374  H HD3  . PRO A 1 98  ? 21.254  0.412   3.530   1.00 0.00 ? 98  PRO A HD3  4  
ATOM 7375  N N    . TYR A 1 99  ? 24.358  -2.524  5.457   1.00 0.00 ? 99  TYR A N    4  
ATOM 7376  C CA   . TYR A 1 99  ? 25.373  -3.185  6.261   1.00 0.00 ? 99  TYR A CA   4  
ATOM 7377  C C    . TYR A 1 99  ? 24.762  -4.248  7.168   1.00 0.00 ? 99  TYR A C    4  
ATOM 7378  O O    . TYR A 1 99  ? 25.485  -5.003  7.818   1.00 0.00 ? 99  TYR A O    4  
ATOM 7379  C CB   . TYR A 1 99  ? 26.131  -2.152  7.100   1.00 0.00 ? 99  TYR A CB   4  
ATOM 7380  C CG   . TYR A 1 99  ? 26.766  -1.064  6.268   1.00 0.00 ? 99  TYR A CG   4  
ATOM 7381  C CD1  . TYR A 1 99  ? 28.048  -1.211  5.759   1.00 0.00 ? 99  TYR A CD1  4  
ATOM 7382  C CD2  . TYR A 1 99  ? 26.073  0.103   5.976   1.00 0.00 ? 99  TYR A CD2  4  
ATOM 7383  C CE1  . TYR A 1 99  ? 28.623  -0.225  4.980   1.00 0.00 ? 99  TYR A CE1  4  
ATOM 7384  C CE2  . TYR A 1 99  ? 26.640  1.094   5.201   1.00 0.00 ? 99  TYR A CE2  4  
ATOM 7385  C CZ   . TYR A 1 99  ? 27.914  0.925   4.704   1.00 0.00 ? 99  TYR A CZ   4  
ATOM 7386  O OH   . TYR A 1 99  ? 28.481  1.908   3.924   1.00 0.00 ? 99  TYR A OH   4  
ATOM 7387  H H    . TYR A 1 99  ? 23.622  -2.048  5.903   1.00 0.00 ? 99  TYR A H    4  
ATOM 7388  H HA   . TYR A 1 99  ? 26.069  -3.663  5.587   1.00 0.00 ? 99  TYR A HA   4  
ATOM 7389  H HB2  . TYR A 1 99  ? 25.448  -1.685  7.793   1.00 0.00 ? 99  TYR A HB2  4  
ATOM 7390  H HB3  . TYR A 1 99  ? 26.915  -2.650  7.652   1.00 0.00 ? 99  TYR A HB3  4  
ATOM 7391  H HD1  . TYR A 1 99  ? 28.600  -2.114  5.978   1.00 0.00 ? 99  TYR A HD1  4  
ATOM 7392  H HD2  . TYR A 1 99  ? 25.075  0.232   6.367   1.00 0.00 ? 99  TYR A HD2  4  
ATOM 7393  H HE1  . TYR A 1 99  ? 29.622  -0.357  4.593   1.00 0.00 ? 99  TYR A HE1  4  
ATOM 7394  H HE2  . TYR A 1 99  ? 26.083  1.993   4.983   1.00 0.00 ? 99  TYR A HE2  4  
ATOM 7395  H HH   . TYR A 1 99  ? 28.917  1.500   3.165   1.00 0.00 ? 99  TYR A HH   4  
ATOM 7396  N N    . SER A 1 100 ? 23.435  -4.324  7.199   1.00 0.00 ? 100 SER A N    4  
ATOM 7397  C CA   . SER A 1 100 ? 22.755  -5.209  8.141   1.00 0.00 ? 100 SER A CA   4  
ATOM 7398  C C    . SER A 1 100 ? 21.696  -6.085  7.467   1.00 0.00 ? 100 SER A C    4  
ATOM 7399  O O    . SER A 1 100 ? 21.182  -7.022  8.080   1.00 0.00 ? 100 SER A O    4  
ATOM 7400  C CB   . SER A 1 100 ? 22.108  -4.371  9.242   1.00 0.00 ? 100 SER A CB   4  
ATOM 7401  O OG   . SER A 1 100 ? 23.068  -3.551  9.885   1.00 0.00 ? 100 SER A OG   4  
ATOM 7402  H H    . SER A 1 100 ? 22.903  -3.770  6.589   1.00 0.00 ? 100 SER A H    4  
ATOM 7403  H HA   . SER A 1 100 ? 23.501  -5.848  8.585   1.00 0.00 ? 100 SER A HA   4  
ATOM 7404  H HB2  . SER A 1 100 ? 21.345  -3.739  8.810   1.00 0.00 ? 100 SER A HB2  4  
ATOM 7405  H HB3  . SER A 1 100 ? 21.660  -5.023  9.974   1.00 0.00 ? 100 SER A HB3  4  
ATOM 7406  H HG   . SER A 1 100 ? 23.790  -4.108  10.213  1.00 0.00 ? 100 SER A HG   4  
ATOM 7407  N N    . ASP A 1 101 ? 21.369  -5.769  6.209   1.00 0.00 ? 101 ASP A N    4  
ATOM 7408  C CA   . ASP A 1 101 ? 20.314  -6.467  5.455   1.00 0.00 ? 101 ASP A CA   4  
ATOM 7409  C C    . ASP A 1 101 ? 18.941  -6.337  6.118   1.00 0.00 ? 101 ASP A C    4  
ATOM 7410  O O    . ASP A 1 101 ? 17.970  -6.957  5.674   1.00 0.00 ? 101 ASP A O    4  
ATOM 7411  C CB   . ASP A 1 101 ? 20.650  -7.949  5.250   1.00 0.00 ? 101 ASP A CB   4  
ATOM 7412  C CG   . ASP A 1 101 ? 21.704  -8.175  4.186   1.00 0.00 ? 101 ASP A CG   4  
ATOM 7413  O OD1  . ASP A 1 101 ? 21.349  -8.235  2.987   1.00 0.00 ? 101 ASP A OD1  4  
ATOM 7414  O OD2  . ASP A 1 101 ? 22.894  -8.309  4.539   1.00 0.00 ? 101 ASP A OD2  4  
ATOM 7415  H H    . ASP A 1 101 ? 21.872  -5.060  5.753   1.00 0.00 ? 101 ASP A H    4  
ATOM 7416  H HA   . ASP A 1 101 ? 20.258  -5.995  4.485   1.00 0.00 ? 101 ASP A HA   4  
ATOM 7417  H HB2  . ASP A 1 101 ? 21.017  -8.357  6.181   1.00 0.00 ? 101 ASP A HB2  4  
ATOM 7418  H HB3  . ASP A 1 101 ? 19.754  -8.478  4.960   1.00 0.00 ? 101 ASP A HB3  4  
ATOM 7419  N N    . GLU A 1 102 ? 18.857  -5.521  7.160   1.00 0.00 ? 102 GLU A N    4  
ATOM 7420  C CA   . GLU A 1 102 ? 17.604  -5.306  7.869   1.00 0.00 ? 102 GLU A CA   4  
ATOM 7421  C C    . GLU A 1 102 ? 16.719  -4.374  7.072   1.00 0.00 ? 102 GLU A C    4  
ATOM 7422  O O    . GLU A 1 102 ? 17.210  -3.572  6.293   1.00 0.00 ? 102 GLU A O    4  
ATOM 7423  C CB   . GLU A 1 102 ? 17.877  -4.708  9.245   1.00 0.00 ? 102 GLU A CB   4  
ATOM 7424  C CG   . GLU A 1 102 ? 18.670  -5.623  10.154  1.00 0.00 ? 102 GLU A CG   4  
ATOM 7425  C CD   . GLU A 1 102 ? 17.872  -6.835  10.589  1.00 0.00 ? 102 GLU A CD   4  
ATOM 7426  O OE1  . GLU A 1 102 ? 17.820  -7.828  9.834   1.00 0.00 ? 102 GLU A OE1  4  
ATOM 7427  O OE2  . GLU A 1 102 ? 17.276  -6.790  11.685  1.00 0.00 ? 102 GLU A OE2  4  
ATOM 7428  H H    . GLU A 1 102 ? 19.653  -5.040  7.458   1.00 0.00 ? 102 GLU A H    4  
ATOM 7429  H HA   . GLU A 1 102 ? 17.109  -6.260  7.983   1.00 0.00 ? 102 GLU A HA   4  
ATOM 7430  H HB2  . GLU A 1 102 ? 18.430  -3.788  9.123   1.00 0.00 ? 102 GLU A HB2  4  
ATOM 7431  H HB3  . GLU A 1 102 ? 16.934  -4.490  9.725   1.00 0.00 ? 102 GLU A HB3  4  
ATOM 7432  H HG2  . GLU A 1 102 ? 19.552  -5.954  9.624   1.00 0.00 ? 102 GLU A HG2  4  
ATOM 7433  H HG3  . GLU A 1 102 ? 18.967  -5.070  11.034  1.00 0.00 ? 102 GLU A HG3  4  
ATOM 7434  N N    . ILE A 1 103 ? 15.425  -4.456  7.274   1.00 0.00 ? 103 ILE A N    4  
ATOM 7435  C CA   . ILE A 1 103 ? 14.510  -3.650  6.497   1.00 0.00 ? 103 ILE A CA   4  
ATOM 7436  C C    . ILE A 1 103 ? 14.129  -2.401  7.252   1.00 0.00 ? 103 ILE A C    4  
ATOM 7437  O O    . ILE A 1 103 ? 13.575  -2.459  8.350   1.00 0.00 ? 103 ILE A O    4  
ATOM 7438  C CB   . ILE A 1 103 ? 13.251  -4.434  6.122   1.00 0.00 ? 103 ILE A CB   4  
ATOM 7439  C CG1  . ILE A 1 103 ? 13.660  -5.666  5.335   1.00 0.00 ? 103 ILE A CG1  4  
ATOM 7440  C CG2  . ILE A 1 103 ? 12.292  -3.568  5.314   1.00 0.00 ? 103 ILE A CG2  4  
ATOM 7441  C CD1  . ILE A 1 103 ? 12.510  -6.581  5.033   1.00 0.00 ? 103 ILE A CD1  4  
ATOM 7442  H H    . ILE A 1 103 ? 15.071  -5.049  7.976   1.00 0.00 ? 103 ILE A H    4  
ATOM 7443  H HA   . ILE A 1 103 ? 15.014  -3.365  5.585   1.00 0.00 ? 103 ILE A HA   4  
ATOM 7444  H HB   . ILE A 1 103 ? 12.753  -4.741  7.029   1.00 0.00 ? 103 ILE A HB   4  
ATOM 7445  H HG12 . ILE A 1 103 ? 14.095  -5.361  4.394   1.00 0.00 ? 103 ILE A HG12 4  
ATOM 7446  H HG13 . ILE A 1 103 ? 14.389  -6.217  5.902   1.00 0.00 ? 103 ILE A HG13 4  
ATOM 7447  H HG21 . ILE A 1 103 ? 12.006  -2.707  5.900   1.00 0.00 ? 103 ILE A HG21 4  
ATOM 7448  H HG22 . ILE A 1 103 ? 11.410  -4.140  5.062   1.00 0.00 ? 103 ILE A HG22 4  
ATOM 7449  H HG23 . ILE A 1 103 ? 12.780  -3.241  4.408   1.00 0.00 ? 103 ILE A HG23 4  
ATOM 7450  H HD11 . ILE A 1 103 ? 11.768  -6.034  4.472   1.00 0.00 ? 103 ILE A HD11 4  
ATOM 7451  H HD12 . ILE A 1 103 ? 12.081  -6.932  5.958   1.00 0.00 ? 103 ILE A HD12 4  
ATOM 7452  H HD13 . ILE A 1 103 ? 12.860  -7.418  4.452   1.00 0.00 ? 103 ILE A HD13 4  
ATOM 7453  N N    . GLU A 1 104 ? 14.458  -1.275  6.656   1.00 0.00 ? 104 GLU A N    4  
ATOM 7454  C CA   . GLU A 1 104 ? 14.126  0.015   7.218   1.00 0.00 ? 104 GLU A CA   4  
ATOM 7455  C C    . GLU A 1 104 ? 12.637  0.253   7.053   1.00 0.00 ? 104 GLU A C    4  
ATOM 7456  O O    . GLU A 1 104 ? 11.941  0.657   7.981   1.00 0.00 ? 104 GLU A O    4  
ATOM 7457  C CB   . GLU A 1 104 ? 14.910  1.112   6.508   1.00 0.00 ? 104 GLU A CB   4  
ATOM 7458  C CG   . GLU A 1 104 ? 16.097  0.583   5.748   1.00 0.00 ? 104 GLU A CG   4  
ATOM 7459  C CD   . GLU A 1 104 ? 16.917  1.683   5.107   1.00 0.00 ? 104 GLU A CD   4  
ATOM 7460  O OE1  . GLU A 1 104 ? 16.344  2.507   4.364   1.00 0.00 ? 104 GLU A OE1  4  
ATOM 7461  O OE2  . GLU A 1 104 ? 18.138  1.748   5.368   1.00 0.00 ? 104 GLU A OE2  4  
ATOM 7462  H H    . GLU A 1 104 ? 14.939  -1.315  5.799   1.00 0.00 ? 104 GLU A H    4  
ATOM 7463  H HA   . GLU A 1 104 ? 14.384  0.007   8.256   1.00 0.00 ? 104 GLU A HA   4  
ATOM 7464  H HB2  . GLU A 1 104 ? 14.264  1.611   5.812   1.00 0.00 ? 104 GLU A HB2  4  
ATOM 7465  H HB3  . GLU A 1 104 ? 15.262  1.822   7.239   1.00 0.00 ? 104 GLU A HB3  4  
ATOM 7466  H HG2  . GLU A 1 104 ? 16.722  0.047   6.437   1.00 0.00 ? 104 GLU A HG2  4  
ATOM 7467  H HG3  . GLU A 1 104 ? 15.736  -0.095  4.982   1.00 0.00 ? 104 GLU A HG3  4  
ATOM 7468  N N    . TYR A 1 105 ? 12.167  -0.032  5.850   1.00 0.00 ? 105 TYR A N    4  
ATOM 7469  C CA   . TYR A 1 105 ? 10.772  0.136   5.492   1.00 0.00 ? 105 TYR A CA   4  
ATOM 7470  C C    . TYR A 1 105 ? 10.502  -0.545  4.158   1.00 0.00 ? 105 TYR A C    4  
ATOM 7471  O O    . TYR A 1 105 ? 11.419  -0.773  3.364   1.00 0.00 ? 105 TYR A O    4  
ATOM 7472  C CB   . TYR A 1 105 ? 10.408  1.629   5.402   1.00 0.00 ? 105 TYR A CB   4  
ATOM 7473  C CG   . TYR A 1 105 ? 11.448  2.481   4.696   1.00 0.00 ? 105 TYR A CG   4  
ATOM 7474  C CD1  . TYR A 1 105 ? 11.592  2.451   3.314   1.00 0.00 ? 105 TYR A CD1  4  
ATOM 7475  C CD2  . TYR A 1 105 ? 12.293  3.312   5.422   1.00 0.00 ? 105 TYR A CD2  4  
ATOM 7476  C CE1  . TYR A 1 105 ? 12.550  3.220   2.678   1.00 0.00 ? 105 TYR A CE1  4  
ATOM 7477  C CE2  . TYR A 1 105 ? 13.248  4.086   4.792   1.00 0.00 ? 105 TYR A CE2  4  
ATOM 7478  C CZ   . TYR A 1 105 ? 13.374  4.037   3.422   1.00 0.00 ? 105 TYR A CZ   4  
ATOM 7479  O OH   . TYR A 1 105 ? 14.337  4.797   2.798   1.00 0.00 ? 105 TYR A OH   4  
ATOM 7480  H H    . TYR A 1 105 ? 12.796  -0.350  5.166   1.00 0.00 ? 105 TYR A H    4  
ATOM 7481  H HA   . TYR A 1 105 ? 10.167  -0.332  6.262   1.00 0.00 ? 105 TYR A HA   4  
ATOM 7482  H HB2  . TYR A 1 105 ? 9.478   1.731   4.864   1.00 0.00 ? 105 TYR A HB2  4  
ATOM 7483  H HB3  . TYR A 1 105 ? 10.281  2.018   6.401   1.00 0.00 ? 105 TYR A HB3  4  
ATOM 7484  H HD1  . TYR A 1 105 ? 10.944  1.810   2.733   1.00 0.00 ? 105 TYR A HD1  4  
ATOM 7485  H HD2  . TYR A 1 105 ? 12.193  3.352   6.497   1.00 0.00 ? 105 TYR A HD2  4  
ATOM 7486  H HE1  . TYR A 1 105 ? 12.646  3.182   1.602   1.00 0.00 ? 105 TYR A HE1  4  
ATOM 7487  H HE2  . TYR A 1 105 ? 13.893  4.726   5.377   1.00 0.00 ? 105 TYR A HE2  4  
ATOM 7488  H HH   . TYR A 1 105 ? 15.182  4.652   3.240   1.00 0.00 ? 105 TYR A HH   4  
ATOM 7489  N N    . ILE A 1 106 ? 9.251   -0.885  3.932   1.00 0.00 ? 106 ILE A N    4  
ATOM 7490  C CA   . ILE A 1 106 ? 8.822   -1.434  2.664   1.00 0.00 ? 106 ILE A CA   4  
ATOM 7491  C C    . ILE A 1 106 ? 8.343   -0.296  1.776   1.00 0.00 ? 106 ILE A C    4  
ATOM 7492  O O    . ILE A 1 106 ? 7.711   0.646   2.255   1.00 0.00 ? 106 ILE A O    4  
ATOM 7493  C CB   . ILE A 1 106 ? 7.675   -2.458  2.853   1.00 0.00 ? 106 ILE A CB   4  
ATOM 7494  C CG1  . ILE A 1 106 ? 8.107   -3.580  3.803   1.00 0.00 ? 106 ILE A CG1  4  
ATOM 7495  C CG2  . ILE A 1 106 ? 7.232   -3.040  1.515   1.00 0.00 ? 106 ILE A CG2  4  
ATOM 7496  C CD1  . ILE A 1 106 ? 7.002   -4.571  4.104   1.00 0.00 ? 106 ILE A CD1  4  
ATOM 7497  H H    . ILE A 1 106 ? 8.583   -0.746  4.637   1.00 0.00 ? 106 ILE A H    4  
ATOM 7498  H HA   . ILE A 1 106 ? 9.663   -1.927  2.198   1.00 0.00 ? 106 ILE A HA   4  
ATOM 7499  H HB   . ILE A 1 106 ? 6.832   -1.941  3.285   1.00 0.00 ? 106 ILE A HB   4  
ATOM 7500  H HG12 . ILE A 1 106 ? 8.928   -4.122  3.362   1.00 0.00 ? 106 ILE A HG12 4  
ATOM 7501  H HG13 . ILE A 1 106 ? 8.429   -3.146  4.739   1.00 0.00 ? 106 ILE A HG13 4  
ATOM 7502  H HG21 . ILE A 1 106 ? 6.897   -2.241  0.871   1.00 0.00 ? 106 ILE A HG21 4  
ATOM 7503  H HG22 . ILE A 1 106 ? 6.420   -3.735  1.676   1.00 0.00 ? 106 ILE A HG22 4  
ATOM 7504  H HG23 . ILE A 1 106 ? 8.060   -3.555  1.052   1.00 0.00 ? 106 ILE A HG23 4  
ATOM 7505  H HD11 . ILE A 1 106 ? 6.659   -5.019  3.183   1.00 0.00 ? 106 ILE A HD11 4  
ATOM 7506  H HD12 . ILE A 1 106 ? 6.181   -4.057  4.583   1.00 0.00 ? 106 ILE A HD12 4  
ATOM 7507  H HD13 . ILE A 1 106 ? 7.378   -5.341  4.762   1.00 0.00 ? 106 ILE A HD13 4  
ATOM 7508  N N    . ILE A 1 107 ? 8.617   -0.387  0.493   1.00 0.00 ? 107 ILE A N    4  
ATOM 7509  C CA   . ILE A 1 107 ? 8.227   0.653   -0.436  1.00 0.00 ? 107 ILE A CA   4  
ATOM 7510  C C    . ILE A 1 107 ? 7.145   0.100   -1.346  1.00 0.00 ? 107 ILE A C    4  
ATOM 7511  O O    . ILE A 1 107 ? 7.416   -0.734  -2.213  1.00 0.00 ? 107 ILE A O    4  
ATOM 7512  C CB   . ILE A 1 107 ? 9.417   1.157   -1.282  1.00 0.00 ? 107 ILE A CB   4  
ATOM 7513  C CG1  . ILE A 1 107 ? 10.544  1.649   -0.368  1.00 0.00 ? 107 ILE A CG1  4  
ATOM 7514  C CG2  . ILE A 1 107 ? 8.964   2.270   -2.221  1.00 0.00 ? 107 ILE A CG2  4  
ATOM 7515  C CD1  . ILE A 1 107 ? 11.774  2.116   -1.117  1.00 0.00 ? 107 ILE A CD1  4  
ATOM 7516  H H    . ILE A 1 107 ? 9.008   -1.218  0.138   1.00 0.00 ? 107 ILE A H    4  
ATOM 7517  H HA   . ILE A 1 107 ? 7.826   1.481   0.131   1.00 0.00 ? 107 ILE A HA   4  
ATOM 7518  H HB   . ILE A 1 107 ? 9.779   0.337   -1.884  1.00 0.00 ? 107 ILE A HB   4  
ATOM 7519  H HG12 . ILE A 1 107 ? 10.184  2.476   0.223   1.00 0.00 ? 107 ILE A HG12 4  
ATOM 7520  H HG13 . ILE A 1 107 ? 10.841  0.844   0.288   1.00 0.00 ? 107 ILE A HG13 4  
ATOM 7521  H HG21 . ILE A 1 107 ? 8.208   1.891   -2.893  1.00 0.00 ? 107 ILE A HG21 4  
ATOM 7522  H HG22 . ILE A 1 107 ? 9.808   2.626   -2.793  1.00 0.00 ? 107 ILE A HG22 4  
ATOM 7523  H HG23 . ILE A 1 107 ? 8.554   3.085   -1.641  1.00 0.00 ? 107 ILE A HG23 4  
ATOM 7524  H HD11 . ILE A 1 107 ? 12.511  2.468   -0.412  1.00 0.00 ? 107 ILE A HD11 4  
ATOM 7525  H HD12 . ILE A 1 107 ? 11.503  2.920   -1.786  1.00 0.00 ? 107 ILE A HD12 4  
ATOM 7526  H HD13 . ILE A 1 107 ? 12.184  1.295   -1.687  1.00 0.00 ? 107 ILE A HD13 4  
ATOM 7527  N N    . CYS A 1 108 ? 5.920   0.537   -1.123  1.00 0.00 ? 108 CYS A N    4  
ATOM 7528  C CA   . CYS A 1 108 ? 4.786   -0.015  -1.833  1.00 0.00 ? 108 CYS A CA   4  
ATOM 7529  C C    . CYS A 1 108 ? 4.393   0.861   -3.014  1.00 0.00 ? 108 CYS A C    4  
ATOM 7530  O O    . CYS A 1 108 ? 3.950   2.000   -2.845  1.00 0.00 ? 108 CYS A O    4  
ATOM 7531  C CB   . CYS A 1 108 ? 3.604   -0.214  -0.878  1.00 0.00 ? 108 CYS A CB   4  
ATOM 7532  S SG   . CYS A 1 108 ? 3.191   1.231   0.122   1.00 0.00 ? 108 CYS A SG   4  
ATOM 7533  H H    . CYS A 1 108 ? 5.778   1.269   -0.481  1.00 0.00 ? 108 CYS A H    4  
ATOM 7534  H HA   . CYS A 1 108 ? 5.085   -0.981  -2.213  1.00 0.00 ? 108 CYS A HA   4  
ATOM 7535  H HB2  . CYS A 1 108 ? 2.727   -0.467  -1.455  1.00 0.00 ? 108 CYS A HB2  4  
ATOM 7536  H HB3  . CYS A 1 108 ? 3.830   -1.026  -0.204  1.00 0.00 ? 108 CYS A HB3  4  
ATOM 7537  H HG   . CYS A 1 108 ? 2.761   2.182   -0.698  1.00 0.00 ? 108 CYS A HG   4  
ATOM 7538  N N    . THR A 1 109 ? 4.591   0.329   -4.210  1.00 0.00 ? 109 THR A N    4  
ATOM 7539  C CA   . THR A 1 109 ? 4.150   0.991   -5.422  1.00 0.00 ? 109 THR A CA   4  
ATOM 7540  C C    . THR A 1 109 ? 2.699   0.618   -5.705  1.00 0.00 ? 109 THR A C    4  
ATOM 7541  O O    . THR A 1 109 ? 2.357   -0.562  -5.745  1.00 0.00 ? 109 THR A O    4  
ATOM 7542  C CB   . THR A 1 109 ? 5.024   0.590   -6.628  1.00 0.00 ? 109 THR A CB   4  
ATOM 7543  O OG1  . THR A 1 109 ? 6.408   0.845   -6.341  1.00 0.00 ? 109 THR A OG1  4  
ATOM 7544  C CG2  . THR A 1 109 ? 4.614   1.354   -7.877  1.00 0.00 ? 109 THR A CG2  4  
ATOM 7545  H H    . THR A 1 109 ? 5.041   -0.543  -4.279  1.00 0.00 ? 109 THR A H    4  
ATOM 7546  H HA   . THR A 1 109 ? 4.225   2.059   -5.277  1.00 0.00 ? 109 THR A HA   4  
ATOM 7547  H HB   . THR A 1 109 ? 4.893   -0.465  -6.811  1.00 0.00 ? 109 THR A HB   4  
ATOM 7548  H HG1  . THR A 1 109 ? 6.637   0.468   -5.481  1.00 0.00 ? 109 THR A HG1  4  
ATOM 7549  H HG21 . THR A 1 109 ? 5.249   1.065   -8.701  1.00 0.00 ? 109 THR A HG21 4  
ATOM 7550  H HG22 . THR A 1 109 ? 4.716   2.414   -7.699  1.00 0.00 ? 109 THR A HG22 4  
ATOM 7551  H HG23 . THR A 1 109 ? 3.586   1.126   -8.116  1.00 0.00 ? 109 THR A HG23 4  
ATOM 7552  N N    . ASN A 1 110 ? 1.855   1.615   -5.903  1.00 0.00 ? 110 ASN A N    4  
ATOM 7553  C CA   . ASN A 1 110 ? 0.438   1.372   -6.127  1.00 0.00 ? 110 ASN A CA   4  
ATOM 7554  C C    . ASN A 1 110 ? 0.088   1.521   -7.590  1.00 0.00 ? 110 ASN A C    4  
ATOM 7555  O O    . ASN A 1 110 ? 0.224   2.610   -8.159  1.00 0.00 ? 110 ASN A O    4  
ATOM 7556  C CB   . ASN A 1 110 ? -0.433  2.335   -5.324  1.00 0.00 ? 110 ASN A CB   4  
ATOM 7557  C CG   . ASN A 1 110 ? -1.848  2.415   -5.873  1.00 0.00 ? 110 ASN A CG   4  
ATOM 7558  O OD1  . ASN A 1 110 ? -2.440  1.413   -6.272  1.00 0.00 ? 110 ASN A OD1  4  
ATOM 7559  N ND2  . ASN A 1 110 ? -2.382  3.617   -5.947  1.00 0.00 ? 110 ASN A ND2  4  
ATOM 7560  H H    . ASN A 1 110 ? 2.204   2.533   -5.956  1.00 0.00 ? 110 ASN A H    4  
ATOM 7561  H HA   . ASN A 1 110 ? 0.221   0.360   -5.817  1.00 0.00 ? 110 ASN A HA   4  
ATOM 7562  H HB2  . ASN A 1 110 ? -0.486  1.998   -4.302  1.00 0.00 ? 110 ASN A HB2  4  
ATOM 7563  H HB3  . ASN A 1 110 ? 0.004   3.321   -5.354  1.00 0.00 ? 110 ASN A HB3  4  
ATOM 7564  H HD21 . ASN A 1 110 ? -1.848  4.382   -5.645  1.00 0.00 ? 110 ASN A HD21 4  
ATOM 7565  H HD22 . ASN A 1 110 ? -3.286  3.698   -6.308  1.00 0.00 ? 110 ASN A HD22 4  
ATOM 7566  N N    . THR A 1 111 ? -0.370  0.427   -8.176  1.00 0.00 ? 111 THR A N    4  
ATOM 7567  C CA   . THR A 1 111 ? -0.918  0.437   -9.512  1.00 0.00 ? 111 THR A CA   4  
ATOM 7568  C C    . THR A 1 111 ? -2.392  0.061   -9.445  1.00 0.00 ? 111 THR A C    4  
ATOM 7569  O O    . THR A 1 111 ? -2.747  -1.105  -9.249  1.00 0.00 ? 111 THR A O    4  
ATOM 7570  C CB   . THR A 1 111 ? -0.168  -0.545  -10.432 1.00 0.00 ? 111 THR A CB   4  
ATOM 7571  O OG1  . THR A 1 111 ? 1.226   -0.209  -10.474 1.00 0.00 ? 111 THR A OG1  4  
ATOM 7572  C CG2  . THR A 1 111 ? -0.746  -0.518  -11.842 1.00 0.00 ? 111 THR A CG2  4  
ATOM 7573  H H    . THR A 1 111 ? -0.347  -0.426  -7.694  1.00 0.00 ? 111 THR A H    4  
ATOM 7574  H HA   . THR A 1 111 ? -0.821  1.435   -9.913  1.00 0.00 ? 111 THR A HA   4  
ATOM 7575  H HB   . THR A 1 111 ? -0.278  -1.543  -10.034 1.00 0.00 ? 111 THR A HB   4  
ATOM 7576  H HG1  . THR A 1 111 ? 1.323   0.748   -10.566 1.00 0.00 ? 111 THR A HG1  4  
ATOM 7577  H HG21 . THR A 1 111 ? -1.788  -0.806  -11.810 1.00 0.00 ? 111 THR A HG21 4  
ATOM 7578  H HG22 . THR A 1 111 ? -0.202  -1.211  -12.467 1.00 0.00 ? 111 THR A HG22 4  
ATOM 7579  H HG23 . THR A 1 111 ? -0.659  0.478   -12.248 1.00 0.00 ? 111 THR A HG23 4  
ATOM 7580  N N    . ASN A 1 112 ? -3.241  1.057   -9.594  1.00 0.00 ? 112 ASN A N    4  
ATOM 7581  C CA   . ASN A 1 112 ? -4.677  0.862   -9.492  1.00 0.00 ? 112 ASN A CA   4  
ATOM 7582  C C    . ASN A 1 112 ? -5.224  0.353   -10.816 1.00 0.00 ? 112 ASN A C    4  
ATOM 7583  O O    . ASN A 1 112 ? -5.045  0.982   -11.857 1.00 0.00 ? 112 ASN A O    4  
ATOM 7584  C CB   . ASN A 1 112 ? -5.346  2.180   -9.104  1.00 0.00 ? 112 ASN A CB   4  
ATOM 7585  C CG   . ASN A 1 112 ? -6.868  2.121   -9.113  1.00 0.00 ? 112 ASN A CG   4  
ATOM 7586  O OD1  . ASN A 1 112 ? -7.531  3.093   -9.462  1.00 0.00 ? 112 ASN A OD1  4  
ATOM 7587  N ND2  . ASN A 1 112 ? -7.437  0.995   -8.698  1.00 0.00 ? 112 ASN A ND2  4  
ATOM 7588  H H    . ASN A 1 112 ? -2.893  1.945   -9.818  1.00 0.00 ? 112 ASN A H    4  
ATOM 7589  H HA   . ASN A 1 112 ? -4.864  0.129   -8.724  1.00 0.00 ? 112 ASN A HA   4  
ATOM 7590  H HB2  . ASN A 1 112 ? -5.029  2.453   -8.108  1.00 0.00 ? 112 ASN A HB2  4  
ATOM 7591  H HB3  . ASN A 1 112 ? -5.026  2.944   -9.793  1.00 0.00 ? 112 ASN A HB3  4  
ATOM 7592  H HD21 . ASN A 1 112 ? -6.858  0.264   -8.403  1.00 0.00 ? 112 ASN A HD21 4  
ATOM 7593  H HD22 . ASN A 1 112 ? -8.415  0.940   -8.707  1.00 0.00 ? 112 ASN A HD22 4  
ATOM 7594  N N    . VAL A 1 113 ? -5.875  -0.798  -10.776 1.00 0.00 ? 113 VAL A N    4  
ATOM 7595  C CA   . VAL A 1 113 ? -6.406  -1.404  -11.980 1.00 0.00 ? 113 VAL A CA   4  
ATOM 7596  C C    . VAL A 1 113 ? -7.856  -0.975  -12.186 1.00 0.00 ? 113 VAL A C    4  
ATOM 7597  O O    . VAL A 1 113 ? -8.130  0.052   -12.808 1.00 0.00 ? 113 VAL A O    4  
ATOM 7598  C CB   . VAL A 1 113 ? -6.323  -2.949  -11.918 1.00 0.00 ? 113 VAL A CB   4  
ATOM 7599  C CG1  . VAL A 1 113 ? -6.584  -3.563  -13.287 1.00 0.00 ? 113 VAL A CG1  4  
ATOM 7600  C CG2  . VAL A 1 113 ? -4.971  -3.398  -11.371 1.00 0.00 ? 113 VAL A CG2  4  
ATOM 7601  H H    . VAL A 1 113 ? -6.011  -1.249  -9.914  1.00 0.00 ? 113 VAL A H    4  
ATOM 7602  H HA   . VAL A 1 113 ? -5.815  -1.063  -12.816 1.00 0.00 ? 113 VAL A HA   4  
ATOM 7603  H HB   . VAL A 1 113 ? -7.091  -3.300  -11.243 1.00 0.00 ? 113 VAL A HB   4  
ATOM 7604  H HG11 . VAL A 1 113 ? -5.845  -3.205  -13.989 1.00 0.00 ? 113 VAL A HG11 4  
ATOM 7605  H HG12 . VAL A 1 113 ? -7.569  -3.283  -13.628 1.00 0.00 ? 113 VAL A HG12 4  
ATOM 7606  H HG13 . VAL A 1 113 ? -6.520  -4.640  -13.215 1.00 0.00 ? 113 VAL A HG13 4  
ATOM 7607  H HG21 . VAL A 1 113 ? -4.183  -3.030  -12.012 1.00 0.00 ? 113 VAL A HG21 4  
ATOM 7608  H HG22 . VAL A 1 113 ? -4.936  -4.477  -11.342 1.00 0.00 ? 113 VAL A HG22 4  
ATOM 7609  H HG23 . VAL A 1 113 ? -4.835  -3.005  -10.374 1.00 0.00 ? 113 VAL A HG23 4  
ATOM 7610  N N    . LYS A 1 114 ? -8.776  -1.759  -11.651 1.00 0.00 ? 114 LYS A N    4  
ATOM 7611  C CA   . LYS A 1 114 ? -10.189 -1.444  -11.725 1.00 0.00 ? 114 LYS A CA   4  
ATOM 7612  C C    . LYS A 1 114 ? -10.790 -1.350  -10.328 1.00 0.00 ? 114 LYS A C    4  
ATOM 7613  O O    . LYS A 1 114 ? -10.133 -1.667  -9.338  1.00 0.00 ? 114 LYS A O    4  
ATOM 7614  C CB   . LYS A 1 114 ? -10.908 -2.502  -12.570 1.00 0.00 ? 114 LYS A CB   4  
ATOM 7615  C CG   . LYS A 1 114 ? -10.793 -3.928  -12.036 1.00 0.00 ? 114 LYS A CG   4  
ATOM 7616  C CD   . LYS A 1 114 ? -11.969 -4.310  -11.146 1.00 0.00 ? 114 LYS A CD   4  
ATOM 7617  C CE   . LYS A 1 114 ? -13.268 -4.418  -11.936 1.00 0.00 ? 114 LYS A CE   4  
ATOM 7618  N NZ   . LYS A 1 114 ? -13.169 -5.399  -13.048 1.00 0.00 ? 114 LYS A NZ   4  
ATOM 7619  H H    . LYS A 1 114 ? -8.498  -2.598  -11.236 1.00 0.00 ? 114 LYS A H    4  
ATOM 7620  H HA   . LYS A 1 114 ? -10.287 -0.484  -12.209 1.00 0.00 ? 114 LYS A HA   4  
ATOM 7621  H HB2  . LYS A 1 114 ? -11.954 -2.246  -12.629 1.00 0.00 ? 114 LYS A HB2  4  
ATOM 7622  H HB3  . LYS A 1 114 ? -10.488 -2.485  -13.564 1.00 0.00 ? 114 LYS A HB3  4  
ATOM 7623  H HG2  . LYS A 1 114 ? -10.756 -4.610  -12.872 1.00 0.00 ? 114 LYS A HG2  4  
ATOM 7624  H HG3  . LYS A 1 114 ? -9.881  -4.013  -11.463 1.00 0.00 ? 114 LYS A HG3  4  
ATOM 7625  H HD2  . LYS A 1 114 ? -11.764 -5.264  -10.685 1.00 0.00 ? 114 LYS A HD2  4  
ATOM 7626  H HD3  . LYS A 1 114 ? -12.085 -3.556  -10.380 1.00 0.00 ? 114 LYS A HD3  4  
ATOM 7627  H HE2  . LYS A 1 114 ? -14.055 -4.731  -11.264 1.00 0.00 ? 114 LYS A HE2  4  
ATOM 7628  H HE3  . LYS A 1 114 ? -13.511 -3.447  -12.341 1.00 0.00 ? 114 LYS A HE3  4  
ATOM 7629  H HZ1  . LYS A 1 114 ? -12.895 -6.337  -12.678 1.00 0.00 ? 114 LYS A HZ1  4  
ATOM 7630  H HZ2  . LYS A 1 114 ? -12.454 -5.089  -13.742 1.00 0.00 ? 114 LYS A HZ2  4  
ATOM 7631  H HZ3  . LYS A 1 114 ? -14.087 -5.486  -13.534 1.00 0.00 ? 114 LYS A HZ3  4  
ATOM 7632  N N    . ASN A 1 115 ? -12.031 -0.910  -10.249 1.00 0.00 ? 115 ASN A N    4  
ATOM 7633  C CA   . ASN A 1 115 ? -12.700 -0.734  -8.968  1.00 0.00 ? 115 ASN A CA   4  
ATOM 7634  C C    . ASN A 1 115 ? -13.827 -1.742  -8.799  1.00 0.00 ? 115 ASN A C    4  
ATOM 7635  O O    . ASN A 1 115 ? -14.534 -2.069  -9.752  1.00 0.00 ? 115 ASN A O    4  
ATOM 7636  C CB   . ASN A 1 115 ? -13.240 0.693   -8.859  1.00 0.00 ? 115 ASN A CB   4  
ATOM 7637  C CG   . ASN A 1 115 ? -13.976 0.971   -7.558  1.00 0.00 ? 115 ASN A CG   4  
ATOM 7638  O OD1  . ASN A 1 115 ? -13.672 0.392   -6.515  1.00 0.00 ? 115 ASN A OD1  4  
ATOM 7639  N ND2  . ASN A 1 115 ? -14.954 1.862   -7.616  1.00 0.00 ? 115 ASN A ND2  4  
ATOM 7640  H H    . ASN A 1 115 ? -12.516 -0.692  -11.078 1.00 0.00 ? 115 ASN A H    4  
ATOM 7641  H HA   . ASN A 1 115 ? -11.971 -0.893  -8.189  1.00 0.00 ? 115 ASN A HA   4  
ATOM 7642  H HB2  . ASN A 1 115 ? -12.413 1.380   -8.933  1.00 0.00 ? 115 ASN A HB2  4  
ATOM 7643  H HB3  . ASN A 1 115 ? -13.919 0.870   -9.680  1.00 0.00 ? 115 ASN A HB3  4  
ATOM 7644  H HD21 . ASN A 1 115 ? -15.146 2.282   -8.481  1.00 0.00 ? 115 ASN A HD21 4  
ATOM 7645  H HD22 . ASN A 1 115 ? -15.446 2.072   -6.788  1.00 0.00 ? 115 ASN A HD22 4  
ATOM 7646  N N    . SER A 1 116 ? -13.983 -2.238  -7.584  1.00 0.00 ? 116 SER A N    4  
ATOM 7647  C CA   . SER A 1 116 ? -15.016 -3.204  -7.282  1.00 0.00 ? 116 SER A CA   4  
ATOM 7648  C C    . SER A 1 116 ? -16.288 -2.489  -6.838  1.00 0.00 ? 116 SER A C    4  
ATOM 7649  O O    . SER A 1 116 ? -16.309 -1.827  -5.798  1.00 0.00 ? 116 SER A O    4  
ATOM 7650  C CB   . SER A 1 116 ? -14.530 -4.159  -6.189  1.00 0.00 ? 116 SER A CB   4  
ATOM 7651  O OG   . SER A 1 116 ? -15.529 -5.095  -5.827  1.00 0.00 ? 116 SER A OG   4  
ATOM 7652  H H    . SER A 1 116 ? -13.397 -1.922  -6.861  1.00 0.00 ? 116 SER A H    4  
ATOM 7653  H HA   . SER A 1 116 ? -15.224 -3.767  -8.179  1.00 0.00 ? 116 SER A HA   4  
ATOM 7654  H HB2  . SER A 1 116 ? -13.666 -4.697  -6.547  1.00 0.00 ? 116 SER A HB2  4  
ATOM 7655  H HB3  . SER A 1 116 ? -14.258 -3.587  -5.314  1.00 0.00 ? 116 SER A HB3  4  
ATOM 7656  H HG   . SER A 1 116 ? -15.244 -5.986  -6.095  1.00 0.00 ? 116 SER A HG   4  
ATOM 7657  N N    . SER A 1 117 ? -17.345 -2.627  -7.628  1.00 0.00 ? 117 SER A N    4  
ATOM 7658  C CA   . SER A 1 117 ? -18.630 -2.019  -7.307  1.00 0.00 ? 117 SER A CA   4  
ATOM 7659  C C    . SER A 1 117 ? -19.376 -2.901  -6.307  1.00 0.00 ? 117 SER A C    4  
ATOM 7660  O O    . SER A 1 117 ? -20.504 -3.335  -6.559  1.00 0.00 ? 117 SER A O    4  
ATOM 7661  C CB   . SER A 1 117 ? -19.448 -1.831  -8.595  1.00 0.00 ? 117 SER A CB   4  
ATOM 7662  O OG   . SER A 1 117 ? -20.651 -1.107  -8.362  1.00 0.00 ? 117 SER A OG   4  
ATOM 7663  H H    . SER A 1 117 ? -17.265 -3.166  -8.446  1.00 0.00 ? 117 SER A H    4  
ATOM 7664  H HA   . SER A 1 117 ? -18.443 -1.056  -6.856  1.00 0.00 ? 117 SER A HA   4  
ATOM 7665  H HB2  . SER A 1 117 ? -18.856 -1.287  -9.315  1.00 0.00 ? 117 SER A HB2  4  
ATOM 7666  H HB3  . SER A 1 117 ? -19.701 -2.799  -9.001  1.00 0.00 ? 117 SER A HB3  4  
ATOM 7667  H HG   . SER A 1 117 ? -20.601 -0.660  -7.503  1.00 0.00 ? 117 SER A HG   4  
ATOM 7668  N N    . GLN A 1 118 ? -18.724 -3.163  -5.172  1.00 0.00 ? 118 GLN A N    4  
ATOM 7669  C CA   . GLN A 1 118 ? -19.251 -4.066  -4.154  1.00 0.00 ? 118 GLN A CA   4  
ATOM 7670  C C    . GLN A 1 118 ? -19.548 -5.430  -4.786  1.00 0.00 ? 118 GLN A C    4  
ATOM 7671  O O    . GLN A 1 118 ? -20.631 -5.992  -4.621  1.00 0.00 ? 118 GLN A O    4  
ATOM 7672  C CB   . GLN A 1 118 ? -20.508 -3.468  -3.502  1.00 0.00 ? 118 GLN A CB   4  
ATOM 7673  C CG   . GLN A 1 118 ? -20.997 -4.226  -2.273  1.00 0.00 ? 118 GLN A CG   4  
ATOM 7674  C CD   . GLN A 1 118 ? -20.225 -3.904  -1.001  1.00 0.00 ? 118 GLN A CD   4  
ATOM 7675  O OE1  . GLN A 1 118 ? -20.765 -4.008  0.100   1.00 0.00 ? 118 GLN A OE1  4  
ATOM 7676  N NE2  . GLN A 1 118 ? -18.971 -3.494  -1.131  1.00 0.00 ? 118 GLN A NE2  4  
ATOM 7677  H H    . GLN A 1 118 ? -17.855 -2.727  -5.019  1.00 0.00 ? 118 GLN A H    4  
ATOM 7678  H HA   . GLN A 1 118 ? -18.486 -4.192  -3.401  1.00 0.00 ? 118 GLN A HA   4  
ATOM 7679  H HB2  . GLN A 1 118 ? -20.295 -2.451  -3.208  1.00 0.00 ? 118 GLN A HB2  4  
ATOM 7680  H HB3  . GLN A 1 118 ? -21.305 -3.459  -4.231  1.00 0.00 ? 118 GLN A HB3  4  
ATOM 7681  H HG2  . GLN A 1 118 ? -22.035 -3.980  -2.110  1.00 0.00 ? 118 GLN A HG2  4  
ATOM 7682  H HG3  . GLN A 1 118 ? -20.910 -5.286  -2.467  1.00 0.00 ? 118 GLN A HG3  4  
ATOM 7683  H HE21 . GLN A 1 118 ? -18.598 -3.413  -2.031  1.00 0.00 ? 118 GLN A HE21 4  
ATOM 7684  H HE22 . GLN A 1 118 ? -18.466 -3.284  -0.312  1.00 0.00 ? 118 GLN A HE22 4  
ATOM 7685  N N    . GLU A 1 119 ? -18.579 -5.943  -5.529  1.00 0.00 ? 119 GLU A N    4  
ATOM 7686  C CA   . GLU A 1 119 ? -18.749 -7.199  -6.243  1.00 0.00 ? 119 GLU A CA   4  
ATOM 7687  C C    . GLU A 1 119 ? -17.832 -8.270  -5.661  1.00 0.00 ? 119 GLU A C    4  
ATOM 7688  O O    . GLU A 1 119 ? -16.874 -8.691  -6.340  1.00 0.00 ? 119 GLU A O    4  
ATOM 7689  C CB   . GLU A 1 119 ? -18.495 -6.990  -7.748  1.00 0.00 ? 119 GLU A CB   4  
ATOM 7690  C CG   . GLU A 1 119 ? -17.236 -6.192  -8.058  1.00 0.00 ? 119 GLU A CG   4  
ATOM 7691  C CD   . GLU A 1 119 ? -17.065 -5.886  -9.530  1.00 0.00 ? 119 GLU A CD   4  
ATOM 7692  O OE1  . GLU A 1 119 ? -17.581 -4.842  -9.988  1.00 0.00 ? 119 GLU A OE1  4  
ATOM 7693  O OE2  . GLU A 1 119 ? -16.395 -6.670  -10.233 1.00 0.00 ? 119 GLU A OE2  4  
ATOM 7694  O OXT  . GLU A 1 119 ? -18.061 -8.667  -4.498  1.00 0.00 ? 119 GLU A OXT  4  
ATOM 7695  H H    . GLU A 1 119 ? -17.719 -5.475  -5.585  1.00 0.00 ? 119 GLU A H    4  
ATOM 7696  H HA   . GLU A 1 119 ? -19.772 -7.513  -6.105  1.00 0.00 ? 119 GLU A HA   4  
ATOM 7697  H HB2  . GLU A 1 119 ? -18.404 -7.958  -8.220  1.00 0.00 ? 119 GLU A HB2  4  
ATOM 7698  H HB3  . GLU A 1 119 ? -19.339 -6.470  -8.175  1.00 0.00 ? 119 GLU A HB3  4  
ATOM 7699  H HG2  . GLU A 1 119 ? -17.279 -5.256  -7.521  1.00 0.00 ? 119 GLU A HG2  4  
ATOM 7700  H HG3  . GLU A 1 119 ? -16.378 -6.757  -7.722  1.00 0.00 ? 119 GLU A HG3  4  
ATOM 7701  N N    . GLY A 1 1   ? -7.394  21.336  8.035   1.00 0.00 ? 1   GLY A N    5  
ATOM 7702  C CA   . GLY A 1 1   ? -7.780  21.241  6.609   1.00 0.00 ? 1   GLY A CA   5  
ATOM 7703  C C    . GLY A 1 1   ? -7.293  19.958  5.973   1.00 0.00 ? 1   GLY A C    5  
ATOM 7704  O O    . GLY A 1 1   ? -7.551  18.865  6.480   1.00 0.00 ? 1   GLY A O    5  
ATOM 7705  H H1   . GLY A 1 1   ? -6.357  21.285  8.125   1.00 0.00 ? 1   GLY A H1   5  
ATOM 7706  H H2   . GLY A 1 1   ? -7.819  20.551  8.575   1.00 0.00 ? 1   GLY A H2   5  
ATOM 7707  H H3   . GLY A 1 1   ? -7.725  22.239  8.439   1.00 0.00 ? 1   GLY A H3   5  
ATOM 7708  H HA2  . GLY A 1 1   ? -8.856  21.283  6.533   1.00 0.00 ? 1   GLY A HA2  5  
ATOM 7709  H HA3  . GLY A 1 1   ? -7.358  22.080  6.075   1.00 0.00 ? 1   GLY A HA3  5  
ATOM 7710  N N    . ALA A 1 2   ? -6.584  20.087  4.862   1.00 0.00 ? 2   ALA A N    5  
ATOM 7711  C CA   . ALA A 1 2   ? -6.056  18.937  4.154   1.00 0.00 ? 2   ALA A CA   5  
ATOM 7712  C C    . ALA A 1 2   ? -4.749  19.310  3.472   1.00 0.00 ? 2   ALA A C    5  
ATOM 7713  O O    . ALA A 1 2   ? -4.253  20.422  3.641   1.00 0.00 ? 2   ALA A O    5  
ATOM 7714  C CB   . ALA A 1 2   ? -7.067  18.437  3.132   1.00 0.00 ? 2   ALA A CB   5  
ATOM 7715  H H    . ALA A 1 2   ? -6.402  20.990  4.507   1.00 0.00 ? 2   ALA A H    5  
ATOM 7716  H HA   . ALA A 1 2   ? -5.874  18.152  4.871   1.00 0.00 ? 2   ALA A HA   5  
ATOM 7717  H HB1  . ALA A 1 2   ? -7.990  18.185  3.634   1.00 0.00 ? 2   ALA A HB1  5  
ATOM 7718  H HB2  . ALA A 1 2   ? -6.674  17.561  2.638   1.00 0.00 ? 2   ALA A HB2  5  
ATOM 7719  H HB3  . ALA A 1 2   ? -7.252  19.211  2.403   1.00 0.00 ? 2   ALA A HB3  5  
ATOM 7720  N N    . MET A 1 3   ? -4.193  18.379  2.715   1.00 0.00 ? 3   MET A N    5  
ATOM 7721  C CA   . MET A 1 3   ? -2.975  18.639  1.968   1.00 0.00 ? 3   MET A CA   5  
ATOM 7722  C C    . MET A 1 3   ? -3.322  18.928  0.520   1.00 0.00 ? 3   MET A C    5  
ATOM 7723  O O    . MET A 1 3   ? -4.158  18.244  -0.066  1.00 0.00 ? 3   MET A O    5  
ATOM 7724  C CB   . MET A 1 3   ? -2.017  17.447  2.066   1.00 0.00 ? 3   MET A CB   5  
ATOM 7725  C CG   . MET A 1 3   ? -1.466  17.237  3.467   1.00 0.00 ? 3   MET A CG   5  
ATOM 7726  S SD   . MET A 1 3   ? -0.551  18.670  4.067   1.00 0.00 ? 3   MET A SD   5  
ATOM 7727  C CE   . MET A 1 3   ? -0.222  18.194  5.766   1.00 0.00 ? 3   MET A CE   5  
ATOM 7728  H H    . MET A 1 3   ? -4.621  17.503  2.637   1.00 0.00 ? 3   MET A H    5  
ATOM 7729  H HA   . MET A 1 3   ? -2.501  19.510  2.398   1.00 0.00 ? 3   MET A HA   5  
ATOM 7730  H HB2  . MET A 1 3   ? -2.541  16.552  1.770   1.00 0.00 ? 3   MET A HB2  5  
ATOM 7731  H HB3  . MET A 1 3   ? -1.187  17.610  1.396   1.00 0.00 ? 3   MET A HB3  5  
ATOM 7732  H HG2  . MET A 1 3   ? -2.289  17.046  4.138   1.00 0.00 ? 3   MET A HG2  5  
ATOM 7733  H HG3  . MET A 1 3   ? -0.806  16.383  3.455   1.00 0.00 ? 3   MET A HG3  5  
ATOM 7734  H HE1  . MET A 1 3   ? 0.354   17.279  5.779   1.00 0.00 ? 3   MET A HE1  5  
ATOM 7735  H HE2  . MET A 1 3   ? -1.157  18.039  6.285   1.00 0.00 ? 3   MET A HE2  5  
ATOM 7736  H HE3  . MET A 1 3   ? 0.335   18.978  6.258   1.00 0.00 ? 3   MET A HE3  5  
ATOM 7737  N N    . ASP A 1 4   ? -2.700  19.956  -0.039  1.00 0.00 ? 4   ASP A N    5  
ATOM 7738  C CA   . ASP A 1 4   ? -2.979  20.372  -1.407  1.00 0.00 ? 4   ASP A CA   5  
ATOM 7739  C C    . ASP A 1 4   ? -2.607  19.278  -2.407  1.00 0.00 ? 4   ASP A C    5  
ATOM 7740  O O    . ASP A 1 4   ? -1.440  18.909  -2.554  1.00 0.00 ? 4   ASP A O    5  
ATOM 7741  C CB   . ASP A 1 4   ? -2.253  21.682  -1.743  1.00 0.00 ? 4   ASP A CB   5  
ATOM 7742  C CG   . ASP A 1 4   ? -0.744  21.592  -1.611  1.00 0.00 ? 4   ASP A CG   5  
ATOM 7743  O OD1  . ASP A 1 4   ? -0.240  21.584  -0.464  1.00 0.00 ? 4   ASP A OD1  5  
ATOM 7744  O OD2  . ASP A 1 4   ? -0.055  21.560  -2.649  1.00 0.00 ? 4   ASP A OD2  5  
ATOM 7745  H H    . ASP A 1 4   ? -2.036  20.455  0.486   1.00 0.00 ? 4   ASP A H    5  
ATOM 7746  H HA   . ASP A 1 4   ? -4.044  20.544  -1.477  1.00 0.00 ? 4   ASP A HA   5  
ATOM 7747  H HB2  . ASP A 1 4   ? -2.485  21.962  -2.759  1.00 0.00 ? 4   ASP A HB2  5  
ATOM 7748  H HB3  . ASP A 1 4   ? -2.606  22.455  -1.076  1.00 0.00 ? 4   ASP A HB3  5  
ATOM 7749  N N    . ASN A 1 5   ? -3.625  18.747  -3.067  1.00 0.00 ? 5   ASN A N    5  
ATOM 7750  C CA   . ASN A 1 5   ? -3.453  17.712  -4.075  1.00 0.00 ? 5   ASN A CA   5  
ATOM 7751  C C    . ASN A 1 5   ? -4.726  17.573  -4.899  1.00 0.00 ? 5   ASN A C    5  
ATOM 7752  O O    . ASN A 1 5   ? -5.830  17.720  -4.373  1.00 0.00 ? 5   ASN A O    5  
ATOM 7753  C CB   . ASN A 1 5   ? -3.071  16.370  -3.426  1.00 0.00 ? 5   ASN A CB   5  
ATOM 7754  C CG   . ASN A 1 5   ? -3.947  15.986  -2.239  1.00 0.00 ? 5   ASN A CG   5  
ATOM 7755  O OD1  . ASN A 1 5   ? -5.143  16.265  -2.197  1.00 0.00 ? 5   ASN A OD1  5  
ATOM 7756  N ND2  . ASN A 1 5   ? -3.345  15.343  -1.249  1.00 0.00 ? 5   ASN A ND2  5  
ATOM 7757  H H    . ASN A 1 5   ? -4.533  19.054  -2.859  1.00 0.00 ? 5   ASN A H    5  
ATOM 7758  H HA   . ASN A 1 5   ? -2.651  18.026  -4.729  1.00 0.00 ? 5   ASN A HA   5  
ATOM 7759  H HB2  . ASN A 1 5   ? -3.152  15.590  -4.167  1.00 0.00 ? 5   ASN A HB2  5  
ATOM 7760  H HB3  . ASN A 1 5   ? -2.046  16.426  -3.086  1.00 0.00 ? 5   ASN A HB3  5  
ATOM 7761  H HD21 . ASN A 1 5   ? -2.394  15.153  -1.337  1.00 0.00 ? 5   ASN A HD21 5  
ATOM 7762  H HD22 . ASN A 1 5   ? -3.882  15.095  -0.464  1.00 0.00 ? 5   ASN A HD22 5  
ATOM 7763  N N    . VAL A 1 6   ? -4.575  17.330  -6.196  1.00 0.00 ? 6   VAL A N    5  
ATOM 7764  C CA   . VAL A 1 6   ? -5.728  17.195  -7.081  1.00 0.00 ? 6   VAL A CA   5  
ATOM 7765  C C    . VAL A 1 6   ? -5.283  16.821  -8.497  1.00 0.00 ? 6   VAL A C    5  
ATOM 7766  O O    . VAL A 1 6   ? -4.225  17.257  -8.955  1.00 0.00 ? 6   VAL A O    5  
ATOM 7767  C CB   . VAL A 1 6   ? -6.565  18.503  -7.120  1.00 0.00 ? 6   VAL A CB   5  
ATOM 7768  C CG1  . VAL A 1 6   ? -5.788  19.639  -7.770  1.00 0.00 ? 6   VAL A CG1  5  
ATOM 7769  C CG2  . VAL A 1 6   ? -7.896  18.282  -7.826  1.00 0.00 ? 6   VAL A CG2  5  
ATOM 7770  H H    . VAL A 1 6   ? -3.670  17.248  -6.570  1.00 0.00 ? 6   VAL A H    5  
ATOM 7771  H HA   . VAL A 1 6   ? -6.353  16.404  -6.693  1.00 0.00 ? 6   VAL A HA   5  
ATOM 7772  H HB   . VAL A 1 6   ? -6.775  18.790  -6.100  1.00 0.00 ? 6   VAL A HB   5  
ATOM 7773  H HG11 . VAL A 1 6   ? -5.519  19.359  -8.778  1.00 0.00 ? 6   VAL A HG11 5  
ATOM 7774  H HG12 . VAL A 1 6   ? -4.894  19.836  -7.199  1.00 0.00 ? 6   VAL A HG12 5  
ATOM 7775  H HG13 . VAL A 1 6   ? -6.404  20.526  -7.795  1.00 0.00 ? 6   VAL A HG13 5  
ATOM 7776  H HG21 . VAL A 1 6   ? -8.449  17.506  -7.318  1.00 0.00 ? 6   VAL A HG21 5  
ATOM 7777  H HG22 . VAL A 1 6   ? -7.715  17.985  -8.847  1.00 0.00 ? 6   VAL A HG22 5  
ATOM 7778  H HG23 . VAL A 1 6   ? -8.466  19.200  -7.815  1.00 0.00 ? 6   VAL A HG23 5  
ATOM 7779  N N    . CYS A 1 7   ? -6.088  15.994  -9.163  1.00 0.00 ? 7   CYS A N    5  
ATOM 7780  C CA   . CYS A 1 7   ? -5.836  15.589  -10.546 1.00 0.00 ? 7   CYS A CA   5  
ATOM 7781  C C    . CYS A 1 7   ? -4.473  14.926  -10.697 1.00 0.00 ? 7   CYS A C    5  
ATOM 7782  O O    . CYS A 1 7   ? -3.626  15.374  -11.470 1.00 0.00 ? 7   CYS A O    5  
ATOM 7783  C CB   . CYS A 1 7   ? -5.948  16.796  -11.478 1.00 0.00 ? 7   CYS A CB   5  
ATOM 7784  S SG   . CYS A 1 7   ? -7.571  17.593  -11.453 1.00 0.00 ? 7   CYS A SG   5  
ATOM 7785  H H    . CYS A 1 7   ? -6.882  15.647  -8.710  1.00 0.00 ? 7   CYS A H    5  
ATOM 7786  H HA   . CYS A 1 7   ? -6.593  14.870  -10.817 1.00 0.00 ? 7   CYS A HA   5  
ATOM 7787  H HB2  . CYS A 1 7   ? -5.214  17.535  -11.193 1.00 0.00 ? 7   CYS A HB2  5  
ATOM 7788  H HB3  . CYS A 1 7   ? -5.753  16.479  -12.494 1.00 0.00 ? 7   CYS A HB3  5  
ATOM 7789  H HG   . CYS A 1 7   ? -8.135  17.391  -12.641 1.00 0.00 ? 7   CYS A HG   5  
ATOM 7790  N N    . GLN A 1 8   ? -4.270  13.848  -9.962  1.00 0.00 ? 8   GLN A N    5  
ATOM 7791  C CA   . GLN A 1 8   ? -3.002  13.145  -9.985  1.00 0.00 ? 8   GLN A CA   5  
ATOM 7792  C C    . GLN A 1 8   ? -3.200  11.716  -10.483 1.00 0.00 ? 8   GLN A C    5  
ATOM 7793  O O    . GLN A 1 8   ? -4.332  11.231  -10.532 1.00 0.00 ? 8   GLN A O    5  
ATOM 7794  C CB   . GLN A 1 8   ? -2.363  13.166  -8.593  1.00 0.00 ? 8   GLN A CB   5  
ATOM 7795  C CG   . GLN A 1 8   ? -2.255  14.568  -8.007  1.00 0.00 ? 8   GLN A CG   5  
ATOM 7796  C CD   . GLN A 1 8   ? -1.331  14.647  -6.807  1.00 0.00 ? 8   GLN A CD   5  
ATOM 7797  O OE1  . GLN A 1 8   ? -1.157  13.678  -6.074  1.00 0.00 ? 8   GLN A OE1  5  
ATOM 7798  N NE2  . GLN A 1 8   ? -0.752  15.818  -6.586  1.00 0.00 ? 8   GLN A NE2  5  
ATOM 7799  H H    . GLN A 1 8   ? -5.000  13.502  -9.408  1.00 0.00 ? 8   GLN A H    5  
ATOM 7800  H HA   . GLN A 1 8   ? -2.350  13.661  -10.676 1.00 0.00 ? 8   GLN A HA   5  
ATOM 7801  H HB2  . GLN A 1 8   ? -2.958  12.561  -7.925  1.00 0.00 ? 8   GLN A HB2  5  
ATOM 7802  H HB3  . GLN A 1 8   ? -1.372  12.747  -8.656  1.00 0.00 ? 8   GLN A HB3  5  
ATOM 7803  H HG2  . GLN A 1 8   ? -1.877  15.230  -8.771  1.00 0.00 ? 8   GLN A HG2  5  
ATOM 7804  H HG3  . GLN A 1 8   ? -3.240  14.894  -7.707  1.00 0.00 ? 8   GLN A HG3  5  
ATOM 7805  H HE21 . GLN A 1 8   ? -0.957  16.563  -7.200  1.00 0.00 ? 8   GLN A HE21 5  
ATOM 7806  H HE22 . GLN A 1 8   ? -0.131  15.893  -5.831  1.00 0.00 ? 8   GLN A HE22 5  
ATOM 7807  N N    . PRO A 1 9   ? -2.111  11.055  -10.918 1.00 0.00 ? 9   PRO A N    5  
ATOM 7808  C CA   . PRO A 1 9   ? -2.137  9.651   -11.357 1.00 0.00 ? 9   PRO A CA   5  
ATOM 7809  C C    . PRO A 1 9   ? -2.865  8.721   -10.382 1.00 0.00 ? 9   PRO A C    5  
ATOM 7810  O O    . PRO A 1 9   ? -2.914  8.976   -9.177  1.00 0.00 ? 9   PRO A O    5  
ATOM 7811  C CB   . PRO A 1 9   ? -0.656  9.285   -11.422 1.00 0.00 ? 9   PRO A CB   5  
ATOM 7812  C CG   . PRO A 1 9   ? 0.037   10.565  -11.726 1.00 0.00 ? 9   PRO A CG   5  
ATOM 7813  C CD   . PRO A 1 9   ? -0.764  11.647  -11.057 1.00 0.00 ? 9   PRO A CD   5  
ATOM 7814  H HA   . PRO A 1 9   ? -2.577  9.553   -12.339 1.00 0.00 ? 9   PRO A HA   5  
ATOM 7815  H HB2  . PRO A 1 9   ? -0.341  8.880   -10.471 1.00 0.00 ? 9   PRO A HB2  5  
ATOM 7816  H HB3  . PRO A 1 9   ? -0.497  8.555   -12.201 1.00 0.00 ? 9   PRO A HB3  5  
ATOM 7817  H HG2  . PRO A 1 9   ? 1.041   10.541  -11.327 1.00 0.00 ? 9   PRO A HG2  5  
ATOM 7818  H HG3  . PRO A 1 9   ? 0.062   10.724  -12.793 1.00 0.00 ? 9   PRO A HG3  5  
ATOM 7819  H HD2  . PRO A 1 9   ? -0.348  11.885  -10.090 1.00 0.00 ? 9   PRO A HD2  5  
ATOM 7820  H HD3  . PRO A 1 9   ? -0.795  12.530  -11.679 1.00 0.00 ? 9   PRO A HD3  5  
ATOM 7821  N N    . THR A 1 10  ? -3.403  7.629   -10.915 1.00 0.00 ? 10  THR A N    5  
ATOM 7822  C CA   . THR A 1 10  ? -4.168  6.674   -10.120 1.00 0.00 ? 10  THR A CA   5  
ATOM 7823  C C    . THR A 1 10  ? -3.242  5.618   -9.507  1.00 0.00 ? 10  THR A C    5  
ATOM 7824  O O    . THR A 1 10  ? -3.661  4.507   -9.173  1.00 0.00 ? 10  THR A O    5  
ATOM 7825  C CB   . THR A 1 10  ? -5.247  5.988   -10.984 1.00 0.00 ? 10  THR A CB   5  
ATOM 7826  O OG1  . THR A 1 10  ? -5.719  6.899   -11.989 1.00 0.00 ? 10  THR A OG1  5  
ATOM 7827  C CG2  . THR A 1 10  ? -6.423  5.541   -10.130 1.00 0.00 ? 10  THR A CG2  5  
ATOM 7828  H H    . THR A 1 10  ? -3.282  7.456   -11.873 1.00 0.00 ? 10  THR A H    5  
ATOM 7829  H HA   . THR A 1 10  ? -4.658  7.217   -9.325  1.00 0.00 ? 10  THR A HA   5  
ATOM 7830  H HB   . THR A 1 10  ? -4.813  5.122   -11.462 1.00 0.00 ? 10  THR A HB   5  
ATOM 7831  H HG1  . THR A 1 10  ? -6.141  6.398   -12.700 1.00 0.00 ? 10  THR A HG1  5  
ATOM 7832  H HG21 . THR A 1 10  ? -7.153  5.046   -10.754 1.00 0.00 ? 10  THR A HG21 5  
ATOM 7833  H HG22 . THR A 1 10  ? -6.876  6.402   -9.660  1.00 0.00 ? 10  THR A HG22 5  
ATOM 7834  H HG23 . THR A 1 10  ? -6.077  4.857   -9.370  1.00 0.00 ? 10  THR A HG23 5  
ATOM 7835  N N    . GLU A 1 11  ? -1.974  5.972   -9.391  1.00 0.00 ? 11  GLU A N    5  
ATOM 7836  C CA   . GLU A 1 11  ? -0.983  5.120   -8.763  1.00 0.00 ? 11  GLU A CA   5  
ATOM 7837  C C    . GLU A 1 11  ? -0.144  5.948   -7.798  1.00 0.00 ? 11  GLU A C    5  
ATOM 7838  O O    . GLU A 1 11  ? 0.317   7.042   -8.143  1.00 0.00 ? 11  GLU A O    5  
ATOM 7839  C CB   . GLU A 1 11  ? -0.096  4.485   -9.839  1.00 0.00 ? 11  GLU A CB   5  
ATOM 7840  C CG   . GLU A 1 11  ? 1.060   3.666   -9.294  1.00 0.00 ? 11  GLU A CG   5  
ATOM 7841  C CD   . GLU A 1 11  ? 1.923   3.084   -10.391 1.00 0.00 ? 11  GLU A CD   5  
ATOM 7842  O OE1  . GLU A 1 11  ? 2.596   3.867   -11.100 1.00 0.00 ? 11  GLU A OE1  5  
ATOM 7843  O OE2  . GLU A 1 11  ? 1.942   1.848   -10.549 1.00 0.00 ? 11  GLU A OE2  5  
ATOM 7844  H H    . GLU A 1 11  ? -1.691  6.837   -9.749  1.00 0.00 ? 11  GLU A H    5  
ATOM 7845  H HA   . GLU A 1 11  ? -1.497  4.345   -8.215  1.00 0.00 ? 11  GLU A HA   5  
ATOM 7846  H HB2  . GLU A 1 11  ? -0.704  3.838   -10.453 1.00 0.00 ? 11  GLU A HB2  5  
ATOM 7847  H HB3  . GLU A 1 11  ? 0.311   5.270   -10.459 1.00 0.00 ? 11  GLU A HB3  5  
ATOM 7848  H HG2  . GLU A 1 11  ? 1.673   4.300   -8.669  1.00 0.00 ? 11  GLU A HG2  5  
ATOM 7849  H HG3  . GLU A 1 11  ? 0.660   2.855   -8.700  1.00 0.00 ? 11  GLU A HG3  5  
ATOM 7850  N N    . PHE A 1 12  ? 0.068   5.432   -6.598  1.00 0.00 ? 12  PHE A N    5  
ATOM 7851  C CA   . PHE A 1 12  ? 0.835   6.160   -5.602  1.00 0.00 ? 12  PHE A CA   5  
ATOM 7852  C C    . PHE A 1 12  ? 1.857   5.261   -4.932  1.00 0.00 ? 12  PHE A C    5  
ATOM 7853  O O    . PHE A 1 12  ? 1.598   4.084   -4.668  1.00 0.00 ? 12  PHE A O    5  
ATOM 7854  C CB   . PHE A 1 12  ? -0.080  6.811   -4.549  1.00 0.00 ? 12  PHE A CB   5  
ATOM 7855  C CG   . PHE A 1 12  ? -0.704  5.866   -3.550  1.00 0.00 ? 12  PHE A CG   5  
ATOM 7856  C CD1  . PHE A 1 12  ? -1.851  5.155   -3.860  1.00 0.00 ? 12  PHE A CD1  5  
ATOM 7857  C CD2  . PHE A 1 12  ? -0.149  5.711   -2.286  1.00 0.00 ? 12  PHE A CD2  5  
ATOM 7858  C CE1  . PHE A 1 12  ? -2.434  4.308   -2.933  1.00 0.00 ? 12  PHE A CE1  5  
ATOM 7859  C CE2  . PHE A 1 12  ? -0.724  4.863   -1.357  1.00 0.00 ? 12  PHE A CE2  5  
ATOM 7860  C CZ   . PHE A 1 12  ? -1.870  4.161   -1.680  1.00 0.00 ? 12  PHE A CZ   5  
ATOM 7861  H H    . PHE A 1 12  ? -0.290  4.542   -6.381  1.00 0.00 ? 12  PHE A H    5  
ATOM 7862  H HA   . PHE A 1 12  ? 1.368   6.944   -6.121  1.00 0.00 ? 12  PHE A HA   5  
ATOM 7863  H HB2  . PHE A 1 12  ? 0.494   7.535   -3.993  1.00 0.00 ? 12  PHE A HB2  5  
ATOM 7864  H HB3  . PHE A 1 12  ? -0.884  7.323   -5.060  1.00 0.00 ? 12  PHE A HB3  5  
ATOM 7865  H HD1  . PHE A 1 12  ? -2.293  5.266   -4.839  1.00 0.00 ? 12  PHE A HD1  5  
ATOM 7866  H HD2  . PHE A 1 12  ? 0.745   6.258   -2.029  1.00 0.00 ? 12  PHE A HD2  5  
ATOM 7867  H HE1  . PHE A 1 12  ? -3.329  3.761   -3.188  1.00 0.00 ? 12  PHE A HE1  5  
ATOM 7868  H HE2  . PHE A 1 12  ? -0.279  4.751   -0.380  1.00 0.00 ? 12  PHE A HE2  5  
ATOM 7869  H HZ   . PHE A 1 12  ? -2.324  3.501   -0.953  1.00 0.00 ? 12  PHE A HZ   5  
ATOM 7870  N N    . ILE A 1 13  ? 3.026   5.818   -4.677  1.00 0.00 ? 13  ILE A N    5  
ATOM 7871  C CA   . ILE A 1 13  ? 4.064   5.112   -3.960  1.00 0.00 ? 13  ILE A CA   5  
ATOM 7872  C C    . ILE A 1 13  ? 4.075   5.564   -2.507  1.00 0.00 ? 13  ILE A C    5  
ATOM 7873  O O    . ILE A 1 13  ? 4.020   6.759   -2.214  1.00 0.00 ? 13  ILE A O    5  
ATOM 7874  C CB   . ILE A 1 13  ? 5.456   5.343   -4.592  1.00 0.00 ? 13  ILE A CB   5  
ATOM 7875  C CG1  . ILE A 1 13  ? 5.446   4.920   -6.065  1.00 0.00 ? 13  ILE A CG1  5  
ATOM 7876  C CG2  . ILE A 1 13  ? 6.525   4.571   -3.825  1.00 0.00 ? 13  ILE A CG2  5  
ATOM 7877  C CD1  . ILE A 1 13  ? 6.767   5.144   -6.771  1.00 0.00 ? 13  ILE A CD1  5  
ATOM 7878  H H    . ILE A 1 13  ? 3.191   6.737   -4.974  1.00 0.00 ? 13  ILE A H    5  
ATOM 7879  H HA   . ILE A 1 13  ? 3.839   4.054   -3.999  1.00 0.00 ? 13  ILE A HA   5  
ATOM 7880  H HB   . ILE A 1 13  ? 5.688   6.394   -4.526  1.00 0.00 ? 13  ILE A HB   5  
ATOM 7881  H HG12 . ILE A 1 13  ? 5.212   3.869   -6.129  1.00 0.00 ? 13  ILE A HG12 5  
ATOM 7882  H HG13 . ILE A 1 13  ? 4.690   5.484   -6.589  1.00 0.00 ? 13  ILE A HG13 5  
ATOM 7883  H HG21 . ILE A 1 13  ? 6.540   4.903   -2.798  1.00 0.00 ? 13  ILE A HG21 5  
ATOM 7884  H HG22 . ILE A 1 13  ? 7.491   4.750   -4.275  1.00 0.00 ? 13  ILE A HG22 5  
ATOM 7885  H HG23 . ILE A 1 13  ? 6.301   3.516   -3.859  1.00 0.00 ? 13  ILE A HG23 5  
ATOM 7886  H HD11 . ILE A 1 13  ? 6.687   4.814   -7.796  1.00 0.00 ? 13  ILE A HD11 5  
ATOM 7887  H HD12 . ILE A 1 13  ? 7.541   4.581   -6.271  1.00 0.00 ? 13  ILE A HD12 5  
ATOM 7888  H HD13 . ILE A 1 13  ? 7.014   6.195   -6.749  1.00 0.00 ? 13  ILE A HD13 5  
ATOM 7889  N N    . SER A 1 14  ? 4.122   4.609   -1.606  1.00 0.00 ? 14  SER A N    5  
ATOM 7890  C CA   . SER A 1 14  ? 4.132   4.910   -0.191  1.00 0.00 ? 14  SER A CA   5  
ATOM 7891  C C    . SER A 1 14  ? 5.152   4.044   0.522   1.00 0.00 ? 14  SER A C    5  
ATOM 7892  O O    . SER A 1 14  ? 5.429   2.921   0.101   1.00 0.00 ? 14  SER A O    5  
ATOM 7893  C CB   . SER A 1 14  ? 2.735   4.711   0.401   1.00 0.00 ? 14  SER A CB   5  
ATOM 7894  O OG   . SER A 1 14  ? 2.182   3.468   -0.001  1.00 0.00 ? 14  SER A OG   5  
ATOM 7895  H H    . SER A 1 14  ? 4.166   3.673   -1.909  1.00 0.00 ? 14  SER A H    5  
ATOM 7896  H HA   . SER A 1 14  ? 4.416   5.945   -0.076  1.00 0.00 ? 14  SER A HA   5  
ATOM 7897  H HB2  . SER A 1 14  ? 2.797   4.728   1.479   1.00 0.00 ? 14  SER A HB2  5  
ATOM 7898  H HB3  . SER A 1 14  ? 2.086   5.506   0.064   1.00 0.00 ? 14  SER A HB3  5  
ATOM 7899  H HG   . SER A 1 14  ? 1.245   3.583   -0.188  1.00 0.00 ? 14  SER A HG   5  
ATOM 7900  N N    . ARG A 1 15  ? 5.726   4.568   1.588   1.00 0.00 ? 15  ARG A N    5  
ATOM 7901  C CA   . ARG A 1 15  ? 6.667   3.814   2.386   1.00 0.00 ? 15  ARG A CA   5  
ATOM 7902  C C    . ARG A 1 15  ? 6.014   3.491   3.714   1.00 0.00 ? 15  ARG A C    5  
ATOM 7903  O O    . ARG A 1 15  ? 5.365   4.349   4.316   1.00 0.00 ? 15  ARG A O    5  
ATOM 7904  C CB   . ARG A 1 15  ? 7.973   4.591   2.610   1.00 0.00 ? 15  ARG A CB   5  
ATOM 7905  C CG   . ARG A 1 15  ? 8.732   4.916   1.329   1.00 0.00 ? 15  ARG A CG   5  
ATOM 7906  C CD   . ARG A 1 15  ? 8.232   6.203   0.685   1.00 0.00 ? 15  ARG A CD   5  
ATOM 7907  N NE   . ARG A 1 15  ? 8.798   6.414   -0.651  1.00 0.00 ? 15  ARG A NE   5  
ATOM 7908  C CZ   . ARG A 1 15  ? 9.193   7.601   -1.119  1.00 0.00 ? 15  ARG A CZ   5  
ATOM 7909  N NH1  . ARG A 1 15  ? 9.210   8.663   -0.325  1.00 0.00 ? 15  ARG A NH1  5  
ATOM 7910  N NH2  . ARG A 1 15  ? 9.607   7.714   -2.371  1.00 0.00 ? 15  ARG A NH2  5  
ATOM 7911  H H    . ARG A 1 15  ? 5.482   5.478   1.878   1.00 0.00 ? 15  ARG A H    5  
ATOM 7912  H HA   . ARG A 1 15  ? 6.882   2.892   1.866   1.00 0.00 ? 15  ARG A HA   5  
ATOM 7913  H HB2  . ARG A 1 15  ? 7.740   5.521   3.106   1.00 0.00 ? 15  ARG A HB2  5  
ATOM 7914  H HB3  . ARG A 1 15  ? 8.619   4.007   3.246   1.00 0.00 ? 15  ARG A HB3  5  
ATOM 7915  H HG2  . ARG A 1 15  ? 9.781   5.027   1.562   1.00 0.00 ? 15  ARG A HG2  5  
ATOM 7916  H HG3  . ARG A 1 15  ? 8.603   4.102   0.631   1.00 0.00 ? 15  ARG A HG3  5  
ATOM 7917  H HD2  . ARG A 1 15  ? 7.157   6.154   0.603   1.00 0.00 ? 15  ARG A HD2  5  
ATOM 7918  H HD3  . ARG A 1 15  ? 8.507   7.034   1.316   1.00 0.00 ? 15  ARG A HD3  5  
ATOM 7919  H HE   . ARG A 1 15  ? 8.857   5.632   -1.243  1.00 0.00 ? 15  ARG A HE   5  
ATOM 7920  H HH11 . ARG A 1 15  ? 8.935   8.585   0.637   1.00 0.00 ? 15  ARG A HH11 5  
ATOM 7921  H HH12 . ARG A 1 15  ? 9.493   9.562   -0.684  1.00 0.00 ? 15  ARG A HH12 5  
ATOM 7922  H HH21 . ARG A 1 15  ? 9.628   6.906   -2.975  1.00 0.00 ? 15  ARG A HH21 5  
ATOM 7923  H HH22 . ARG A 1 15  ? 9.903   8.608   -2.731  1.00 0.00 ? 15  ARG A HH22 5  
ATOM 7924  N N    . HIS A 1 16  ? 6.147   2.257   4.156   1.00 0.00 ? 16  HIS A N    5  
ATOM 7925  C CA   . HIS A 1 16  ? 5.528   1.849   5.400   1.00 0.00 ? 16  HIS A CA   5  
ATOM 7926  C C    . HIS A 1 16  ? 6.425   0.893   6.161   1.00 0.00 ? 16  HIS A C    5  
ATOM 7927  O O    . HIS A 1 16  ? 7.290   0.240   5.580   1.00 0.00 ? 16  HIS A O    5  
ATOM 7928  C CB   . HIS A 1 16  ? 4.136   1.225   5.158   1.00 0.00 ? 16  HIS A CB   5  
ATOM 7929  C CG   . HIS A 1 16  ? 4.095   -0.060  4.377   1.00 0.00 ? 16  HIS A CG   5  
ATOM 7930  N ND1  . HIS A 1 16  ? 3.123   -0.325  3.436   1.00 0.00 ? 16  HIS A ND1  5  
ATOM 7931  C CD2  . HIS A 1 16  ? 4.848   -1.184  4.453   1.00 0.00 ? 16  HIS A CD2  5  
ATOM 7932  C CE1  . HIS A 1 16  ? 3.276   -1.551  2.978   1.00 0.00 ? 16  HIS A CE1  5  
ATOM 7933  N NE2  . HIS A 1 16  ? 4.316   -2.094  3.576   1.00 0.00 ? 16  HIS A NE2  5  
ATOM 7934  H H    . HIS A 1 16  ? 6.692   1.612   3.647   1.00 0.00 ? 16  HIS A H    5  
ATOM 7935  H HA   . HIS A 1 16  ? 5.401   2.739   5.999   1.00 0.00 ? 16  HIS A HA   5  
ATOM 7936  H HB2  . HIS A 1 16  ? 3.683   1.024   6.115   1.00 0.00 ? 16  HIS A HB2  5  
ATOM 7937  H HB3  . HIS A 1 16  ? 3.525   1.943   4.633   1.00 0.00 ? 16  HIS A HB3  5  
ATOM 7938  H HD1  . HIS A 1 16  ? 2.429   0.302   3.138   1.00 0.00 ? 16  HIS A HD1  5  
ATOM 7939  H HD2  . HIS A 1 16  ? 5.717   -1.330  5.078   1.00 0.00 ? 16  HIS A HD2  5  
ATOM 7940  H HE1  . HIS A 1 16  ? 2.648   -2.034  2.246   1.00 0.00 ? 16  HIS A HE1  5  
ATOM 7941  H HE2  . HIS A 1 16  ? 4.585   -3.036  3.498   1.00 0.00 ? 16  HIS A HE2  5  
ATOM 7942  N N    . ASN A 1 17  ? 6.198   0.797   7.456   1.00 0.00 ? 17  ASN A N    5  
ATOM 7943  C CA   . ASN A 1 17  ? 6.955   -0.113  8.289   1.00 0.00 ? 17  ASN A CA   5  
ATOM 7944  C C    . ASN A 1 17  ? 6.463   -1.524  8.012   1.00 0.00 ? 17  ASN A C    5  
ATOM 7945  O O    . ASN A 1 17  ? 5.295   -1.703  7.654   1.00 0.00 ? 17  ASN A O    5  
ATOM 7946  C CB   . ASN A 1 17  ? 6.811   0.255   9.771   1.00 0.00 ? 17  ASN A CB   5  
ATOM 7947  C CG   . ASN A 1 17  ? 7.771   -0.520  10.652  1.00 0.00 ? 17  ASN A CG   5  
ATOM 7948  O OD1  . ASN A 1 17  ? 8.943   -0.166  10.764  1.00 0.00 ? 17  ASN A OD1  5  
ATOM 7949  N ND2  . ASN A 1 17  ? 7.282   -1.558  11.311  1.00 0.00 ? 17  ASN A ND2  5  
ATOM 7950  H H    . ASN A 1 17  ? 5.467   1.324   7.854   1.00 0.00 ? 17  ASN A H    5  
ATOM 7951  H HA   . ASN A 1 17  ? 7.994   -0.041  8.001   1.00 0.00 ? 17  ASN A HA   5  
ATOM 7952  H HB2  . ASN A 1 17  ? 7.009   1.310   9.895   1.00 0.00 ? 17  ASN A HB2  5  
ATOM 7953  H HB3  . ASN A 1 17  ? 5.802   0.042   10.092  1.00 0.00 ? 17  ASN A HB3  5  
ATOM 7954  H HD21 . ASN A 1 17  ? 6.332   -1.773  11.209  1.00 0.00 ? 17  ASN A HD21 5  
ATOM 7955  H HD22 . ASN A 1 17  ? 7.900   -2.075  11.880  1.00 0.00 ? 17  ASN A HD22 5  
ATOM 7956  N N    . ILE A 1 18  ? 7.345   -2.506  8.196   1.00 0.00 ? 18  ILE A N    5  
ATOM 7957  C CA   . ILE A 1 18  ? 7.135   -3.881  7.718   1.00 0.00 ? 18  ILE A CA   5  
ATOM 7958  C C    . ILE A 1 18  ? 5.778   -4.478  8.099   1.00 0.00 ? 18  ILE A C    5  
ATOM 7959  O O    . ILE A 1 18  ? 5.266   -5.347  7.399   1.00 0.00 ? 18  ILE A O    5  
ATOM 7960  C CB   . ILE A 1 18  ? 8.260   -4.816  8.209   1.00 0.00 ? 18  ILE A CB   5  
ATOM 7961  C CG1  . ILE A 1 18  ? 8.408   -4.741  9.732   1.00 0.00 ? 18  ILE A CG1  5  
ATOM 7962  C CG2  . ILE A 1 18  ? 9.572   -4.465  7.522   1.00 0.00 ? 18  ILE A CG2  5  
ATOM 7963  C CD1  . ILE A 1 18  ? 9.503   -5.633  10.281  1.00 0.00 ? 18  ILE A CD1  5  
ATOM 7964  H H    . ILE A 1 18  ? 8.174   -2.303  8.683   1.00 0.00 ? 18  ILE A H    5  
ATOM 7965  H HA   . ILE A 1 18  ? 7.192   -3.851  6.639   1.00 0.00 ? 18  ILE A HA   5  
ATOM 7966  H HB   . ILE A 1 18  ? 8.000   -5.826  7.929   1.00 0.00 ? 18  ILE A HB   5  
ATOM 7967  H HG12 . ILE A 1 18  ? 8.635   -3.725  10.016  1.00 0.00 ? 18  ILE A HG12 5  
ATOM 7968  H HG13 . ILE A 1 18  ? 7.476   -5.039  10.192  1.00 0.00 ? 18  ILE A HG13 5  
ATOM 7969  H HG21 . ILE A 1 18  ? 9.840   -3.446  7.760   1.00 0.00 ? 18  ILE A HG21 5  
ATOM 7970  H HG22 . ILE A 1 18  ? 9.458   -4.566  6.453   1.00 0.00 ? 18  ILE A HG22 5  
ATOM 7971  H HG23 . ILE A 1 18  ? 10.348  -5.132  7.866   1.00 0.00 ? 18  ILE A HG23 5  
ATOM 7972  H HD11 . ILE A 1 18  ? 9.542   -5.536  11.355  1.00 0.00 ? 18  ILE A HD11 5  
ATOM 7973  H HD12 . ILE A 1 18  ? 10.452  -5.338  9.857   1.00 0.00 ? 18  ILE A HD12 5  
ATOM 7974  H HD13 . ILE A 1 18  ? 9.297   -6.660  10.019  1.00 0.00 ? 18  ILE A HD13 5  
ATOM 7975  N N    . GLU A 1 19  ? 5.197   -4.005  9.190   1.00 0.00 ? 19  GLU A N    5  
ATOM 7976  C CA   . GLU A 1 19  ? 3.906   -4.506  9.653   1.00 0.00 ? 19  GLU A CA   5  
ATOM 7977  C C    . GLU A 1 19  ? 2.754   -3.999  8.787   1.00 0.00 ? 19  GLU A C    5  
ATOM 7978  O O    . GLU A 1 19  ? 1.625   -4.474  8.904   1.00 0.00 ? 19  GLU A O    5  
ATOM 7979  C CB   . GLU A 1 19  ? 3.698   -4.100  11.107  1.00 0.00 ? 19  GLU A CB   5  
ATOM 7980  C CG   . GLU A 1 19  ? 4.741   -4.702  12.024  1.00 0.00 ? 19  GLU A CG   5  
ATOM 7981  C CD   . GLU A 1 19  ? 4.677   -4.170  13.436  1.00 0.00 ? 19  GLU A CD   5  
ATOM 7982  O OE1  . GLU A 1 19  ? 3.782   -4.588  14.195  1.00 0.00 ? 19  GLU A OE1  5  
ATOM 7983  O OE2  . GLU A 1 19  ? 5.537   -3.340  13.797  1.00 0.00 ? 19  GLU A OE2  5  
ATOM 7984  H H    . GLU A 1 19  ? 5.648   -3.307  9.703   1.00 0.00 ? 19  GLU A H    5  
ATOM 7985  H HA   . GLU A 1 19  ? 3.931   -5.583  9.594   1.00 0.00 ? 19  GLU A HA   5  
ATOM 7986  H HB2  . GLU A 1 19  ? 3.749   -3.024  11.184  1.00 0.00 ? 19  GLU A HB2  5  
ATOM 7987  H HB3  . GLU A 1 19  ? 2.724   -4.434  11.430  1.00 0.00 ? 19  GLU A HB3  5  
ATOM 7988  H HG2  . GLU A 1 19  ? 4.592   -5.768  12.050  1.00 0.00 ? 19  GLU A HG2  5  
ATOM 7989  H HG3  . GLU A 1 19  ? 5.719   -4.488  11.618  1.00 0.00 ? 19  GLU A HG3  5  
ATOM 7990  N N    . GLY A 1 20  ? 3.054   -3.049  7.910   1.00 0.00 ? 20  GLY A N    5  
ATOM 7991  C CA   . GLY A 1 20  ? 2.040   -2.477  7.046   1.00 0.00 ? 20  GLY A CA   5  
ATOM 7992  C C    . GLY A 1 20  ? 1.651   -1.070  7.457   1.00 0.00 ? 20  GLY A C    5  
ATOM 7993  O O    . GLY A 1 20  ? 0.726   -0.486  6.893   1.00 0.00 ? 20  GLY A O    5  
ATOM 7994  H H    . GLY A 1 20  ? 3.985   -2.750  7.829   1.00 0.00 ? 20  GLY A H    5  
ATOM 7995  H HA2  . GLY A 1 20  ? 2.416   -2.454  6.036   1.00 0.00 ? 20  GLY A HA2  5  
ATOM 7996  H HA3  . GLY A 1 20  ? 1.162   -3.104  7.078   1.00 0.00 ? 20  GLY A HA3  5  
ATOM 7997  N N    . ILE A 1 21  ? 2.378   -0.514  8.417   1.00 0.00 ? 21  ILE A N    5  
ATOM 7998  C CA   . ILE A 1 21  ? 2.026   0.783   8.995   1.00 0.00 ? 21  ILE A CA   5  
ATOM 7999  C C    . ILE A 1 21  ? 2.598   1.915   8.156   1.00 0.00 ? 21  ILE A C    5  
ATOM 8000  O O    . ILE A 1 21  ? 3.813   2.024   8.008   1.00 0.00 ? 21  ILE A O    5  
ATOM 8001  C CB   . ILE A 1 21  ? 2.553   0.910   10.443  1.00 0.00 ? 21  ILE A CB   5  
ATOM 8002  C CG1  . ILE A 1 21  ? 1.921   -0.155  11.347  1.00 0.00 ? 21  ILE A CG1  5  
ATOM 8003  C CG2  . ILE A 1 21  ? 2.289   2.308   10.992  1.00 0.00 ? 21  ILE A CG2  5  
ATOM 8004  C CD1  . ILE A 1 21  ? 0.442   0.052   11.601  1.00 0.00 ? 21  ILE A CD1  5  
ATOM 8005  H H    . ILE A 1 21  ? 3.186   -0.972  8.738   1.00 0.00 ? 21  ILE A H    5  
ATOM 8006  H HA   . ILE A 1 21  ? 0.948   0.865   9.011   1.00 0.00 ? 21  ILE A HA   5  
ATOM 8007  H HB   . ILE A 1 21  ? 3.623   0.761   10.422  1.00 0.00 ? 21  ILE A HB   5  
ATOM 8008  H HG12 . ILE A 1 21  ? 2.038   -1.123  10.882  1.00 0.00 ? 21  ILE A HG12 5  
ATOM 8009  H HG13 . ILE A 1 21  ? 2.428   -0.155  12.302  1.00 0.00 ? 21  ILE A HG13 5  
ATOM 8010  H HG21 . ILE A 1 21  ? 1.225   2.495   10.999  1.00 0.00 ? 21  ILE A HG21 5  
ATOM 8011  H HG22 . ILE A 1 21  ? 2.779   3.039   10.368  1.00 0.00 ? 21  ILE A HG22 5  
ATOM 8012  H HG23 . ILE A 1 21  ? 2.673   2.379   12.000  1.00 0.00 ? 21  ILE A HG23 5  
ATOM 8013  H HD11 . ILE A 1 21  ? 0.076   -0.728  12.253  1.00 0.00 ? 21  ILE A HD11 5  
ATOM 8014  H HD12 . ILE A 1 21  ? -0.094  0.019   10.664  1.00 0.00 ? 21  ILE A HD12 5  
ATOM 8015  H HD13 . ILE A 1 21  ? 0.290   1.013   12.071  1.00 0.00 ? 21  ILE A HD13 5  
ATOM 8016  N N    . PHE A 1 22  ? 1.727   2.758   7.611   1.00 0.00 ? 22  PHE A N    5  
ATOM 8017  C CA   . PHE A 1 22  ? 2.161   3.839   6.730   1.00 0.00 ? 22  PHE A CA   5  
ATOM 8018  C C    . PHE A 1 22  ? 2.968   4.884   7.488   1.00 0.00 ? 22  PHE A C    5  
ATOM 8019  O O    . PHE A 1 22  ? 2.500   5.450   8.476   1.00 0.00 ? 22  PHE A O    5  
ATOM 8020  C CB   . PHE A 1 22  ? 0.968   4.510   6.054   1.00 0.00 ? 22  PHE A CB   5  
ATOM 8021  C CG   . PHE A 1 22  ? 0.262   3.639   5.057   1.00 0.00 ? 22  PHE A CG   5  
ATOM 8022  C CD1  . PHE A 1 22  ? 0.792   3.441   3.791   1.00 0.00 ? 22  PHE A CD1  5  
ATOM 8023  C CD2  . PHE A 1 22  ? -0.937  3.025   5.382   1.00 0.00 ? 22  PHE A CD2  5  
ATOM 8024  C CE1  . PHE A 1 22  ? 0.140   2.647   2.869   1.00 0.00 ? 22  PHE A CE1  5  
ATOM 8025  C CE2  . PHE A 1 22  ? -1.594  2.232   4.463   1.00 0.00 ? 22  PHE A CE2  5  
ATOM 8026  C CZ   . PHE A 1 22  ? -1.055  2.042   3.205   1.00 0.00 ? 22  PHE A CZ   5  
ATOM 8027  H H    . PHE A 1 22  ? 0.771   2.667   7.823   1.00 0.00 ? 22  PHE A H    5  
ATOM 8028  H HA   . PHE A 1 22  ? 2.792   3.404   5.969   1.00 0.00 ? 22  PHE A HA   5  
ATOM 8029  H HB2  . PHE A 1 22  ? 0.251   4.797   6.809   1.00 0.00 ? 22  PHE A HB2  5  
ATOM 8030  H HB3  . PHE A 1 22  ? 1.311   5.395   5.537   1.00 0.00 ? 22  PHE A HB3  5  
ATOM 8031  H HD1  . PHE A 1 22  ? 1.727   3.914   3.529   1.00 0.00 ? 22  PHE A HD1  5  
ATOM 8032  H HD2  . PHE A 1 22  ? -1.359  3.172   6.366   1.00 0.00 ? 22  PHE A HD2  5  
ATOM 8033  H HE1  . PHE A 1 22  ? 0.562   2.500   1.886   1.00 0.00 ? 22  PHE A HE1  5  
ATOM 8034  H HE2  . PHE A 1 22  ? -2.528  1.758   4.729   1.00 0.00 ? 22  PHE A HE2  5  
ATOM 8035  H HZ   . PHE A 1 22  ? -1.568  1.420   2.487   1.00 0.00 ? 22  PHE A HZ   5  
ATOM 8036  N N    . THR A 1 23  ? 4.180   5.131   7.014   1.00 0.00 ? 23  THR A N    5  
ATOM 8037  C CA   . THR A 1 23  ? 5.056   6.112   7.623   1.00 0.00 ? 23  THR A CA   5  
ATOM 8038  C C    . THR A 1 23  ? 5.171   7.357   6.744   1.00 0.00 ? 23  THR A C    5  
ATOM 8039  O O    . THR A 1 23  ? 5.318   8.472   7.247   1.00 0.00 ? 23  THR A O    5  
ATOM 8040  C CB   . THR A 1 23  ? 6.450   5.515   7.888   1.00 0.00 ? 23  THR A CB   5  
ATOM 8041  O OG1  . THR A 1 23  ? 6.925   4.835   6.719   1.00 0.00 ? 23  THR A OG1  5  
ATOM 8042  C CG2  . THR A 1 23  ? 6.405   4.544   9.058   1.00 0.00 ? 23  THR A CG2  5  
ATOM 8043  H H    . THR A 1 23  ? 4.497   4.635   6.231   1.00 0.00 ? 23  THR A H    5  
ATOM 8044  H HA   . THR A 1 23  ? 4.623   6.397   8.571   1.00 0.00 ? 23  THR A HA   5  
ATOM 8045  H HB   . THR A 1 23  ? 7.130   6.319   8.133   1.00 0.00 ? 23  THR A HB   5  
ATOM 8046  H HG1  . THR A 1 23  ? 7.884   4.762   6.764   1.00 0.00 ? 23  THR A HG1  5  
ATOM 8047  H HG21 . THR A 1 23  ? 6.064   5.062   9.943   1.00 0.00 ? 23  THR A HG21 5  
ATOM 8048  H HG22 . THR A 1 23  ? 7.393   4.147   9.231   1.00 0.00 ? 23  THR A HG22 5  
ATOM 8049  H HG23 . THR A 1 23  ? 5.726   3.736   8.829   1.00 0.00 ? 23  THR A HG23 5  
ATOM 8050  N N    . PHE A 1 24  ? 5.091   7.161   5.429   1.00 0.00 ? 24  PHE A N    5  
ATOM 8051  C CA   . PHE A 1 24  ? 5.063   8.275   4.487   1.00 0.00 ? 24  PHE A CA   5  
ATOM 8052  C C    . PHE A 1 24  ? 4.278   7.899   3.233   1.00 0.00 ? 24  PHE A C    5  
ATOM 8053  O O    . PHE A 1 24  ? 4.484   6.830   2.658   1.00 0.00 ? 24  PHE A O    5  
ATOM 8054  C CB   . PHE A 1 24  ? 6.480   8.711   4.101   1.00 0.00 ? 24  PHE A CB   5  
ATOM 8055  C CG   . PHE A 1 24  ? 6.493   9.823   3.091   1.00 0.00 ? 24  PHE A CG   5  
ATOM 8056  C CD1  . PHE A 1 24  ? 6.201   11.123  3.470   1.00 0.00 ? 24  PHE A CD1  5  
ATOM 8057  C CD2  . PHE A 1 24  ? 6.775   9.566   1.757   1.00 0.00 ? 24  PHE A CD2  5  
ATOM 8058  C CE1  . PHE A 1 24  ? 6.193   12.144  2.541   1.00 0.00 ? 24  PHE A CE1  5  
ATOM 8059  C CE2  . PHE A 1 24  ? 6.766   10.583  0.824   1.00 0.00 ? 24  PHE A CE2  5  
ATOM 8060  C CZ   . PHE A 1 24  ? 6.474   11.874  1.217   1.00 0.00 ? 24  PHE A CZ   5  
ATOM 8061  H H    . PHE A 1 24  ? 5.062   6.242   5.081   1.00 0.00 ? 24  PHE A H    5  
ATOM 8062  H HA   . PHE A 1 24  ? 4.563   9.101   4.973   1.00 0.00 ? 24  PHE A HA   5  
ATOM 8063  H HB2  . PHE A 1 24  ? 6.999   9.054   4.986   1.00 0.00 ? 24  PHE A HB2  5  
ATOM 8064  H HB3  . PHE A 1 24  ? 7.008   7.869   3.681   1.00 0.00 ? 24  PHE A HB3  5  
ATOM 8065  H HD1  . PHE A 1 24  ? 5.981   11.335  4.505   1.00 0.00 ? 24  PHE A HD1  5  
ATOM 8066  H HD2  . PHE A 1 24  ? 7.005   8.558   1.450   1.00 0.00 ? 24  PHE A HD2  5  
ATOM 8067  H HE1  . PHE A 1 24  ? 5.963   13.154  2.851   1.00 0.00 ? 24  PHE A HE1  5  
ATOM 8068  H HE2  . PHE A 1 24  ? 6.986   10.371  -0.210  1.00 0.00 ? 24  PHE A HE2  5  
ATOM 8069  H HZ   . PHE A 1 24  ? 6.467   12.673  0.489   1.00 0.00 ? 24  PHE A HZ   5  
ATOM 8070  N N    . VAL A 1 25  ? 3.387   8.785   2.813   1.00 0.00 ? 25  VAL A N    5  
ATOM 8071  C CA   . VAL A 1 25  ? 2.557   8.547   1.638   1.00 0.00 ? 25  VAL A CA   5  
ATOM 8072  C C    . VAL A 1 25  ? 2.619   9.736   0.686   1.00 0.00 ? 25  VAL A C    5  
ATOM 8073  O O    . VAL A 1 25  ? 2.603   10.889  1.117   1.00 0.00 ? 25  VAL A O    5  
ATOM 8074  C CB   . VAL A 1 25  ? 1.084   8.296   2.032   1.00 0.00 ? 25  VAL A CB   5  
ATOM 8075  C CG1  . VAL A 1 25  ? 0.212   8.120   0.797   1.00 0.00 ? 25  VAL A CG1  5  
ATOM 8076  C CG2  . VAL A 1 25  ? 0.969   7.081   2.940   1.00 0.00 ? 25  VAL A CG2  5  
ATOM 8077  H H    . VAL A 1 25  ? 3.290   9.628   3.299   1.00 0.00 ? 25  VAL A H    5  
ATOM 8078  H HA   . VAL A 1 25  ? 2.931   7.668   1.132   1.00 0.00 ? 25  VAL A HA   5  
ATOM 8079  H HB   . VAL A 1 25  ? 0.728   9.159   2.576   1.00 0.00 ? 25  VAL A HB   5  
ATOM 8080  H HG11 . VAL A 1 25  ? 0.553   7.266   0.234   1.00 0.00 ? 25  VAL A HG11 5  
ATOM 8081  H HG12 . VAL A 1 25  ? 0.277   9.009   0.178   1.00 0.00 ? 25  VAL A HG12 5  
ATOM 8082  H HG13 . VAL A 1 25  ? -0.813  7.968   1.100   1.00 0.00 ? 25  VAL A HG13 5  
ATOM 8083  H HG21 . VAL A 1 25  ? 1.348   6.210   2.425   1.00 0.00 ? 25  VAL A HG21 5  
ATOM 8084  H HG22 . VAL A 1 25  ? -0.067  6.921   3.199   1.00 0.00 ? 25  VAL A HG22 5  
ATOM 8085  H HG23 . VAL A 1 25  ? 1.543   7.246   3.839   1.00 0.00 ? 25  VAL A HG23 5  
ATOM 8086  N N    . ASP A 1 26  ? 2.703   9.449   -0.607  1.00 0.00 ? 26  ASP A N    5  
ATOM 8087  C CA   . ASP A 1 26  ? 2.677   10.479  -1.637  1.00 0.00 ? 26  ASP A CA   5  
ATOM 8088  C C    . ASP A 1 26  ? 1.242   10.950  -1.880  1.00 0.00 ? 26  ASP A C    5  
ATOM 8089  O O    . ASP A 1 26  ? 0.290   10.185  -1.729  1.00 0.00 ? 26  ASP A O    5  
ATOM 8090  C CB   . ASP A 1 26  ? 3.275   9.917   -2.928  1.00 0.00 ? 26  ASP A CB   5  
ATOM 8091  C CG   . ASP A 1 26  ? 3.461   10.972  -3.996  1.00 0.00 ? 26  ASP A CG   5  
ATOM 8092  O OD1  . ASP A 1 26  ? 2.476   11.308  -4.688  1.00 0.00 ? 26  ASP A OD1  5  
ATOM 8093  O OD2  . ASP A 1 26  ? 4.594   11.473  -4.149  1.00 0.00 ? 26  ASP A OD2  5  
ATOM 8094  H H    . ASP A 1 26  ? 2.794   8.517   -0.896  1.00 0.00 ? 26  ASP A H    5  
ATOM 8095  H HA   . ASP A 1 26  ? 3.272   11.315  -1.300  1.00 0.00 ? 26  ASP A HA   5  
ATOM 8096  H HB2  . ASP A 1 26  ? 4.240   9.484   -2.710  1.00 0.00 ? 26  ASP A HB2  5  
ATOM 8097  H HB3  . ASP A 1 26  ? 2.621   9.151   -3.316  1.00 0.00 ? 26  ASP A HB3  5  
ATOM 8098  N N    . HIS A 1 27  ? 1.111   12.224  -2.254  1.00 0.00 ? 27  HIS A N    5  
ATOM 8099  C CA   . HIS A 1 27  ? -0.190  12.891  -2.398  1.00 0.00 ? 27  HIS A CA   5  
ATOM 8100  C C    . HIS A 1 27  ? -1.117  12.173  -3.370  1.00 0.00 ? 27  HIS A C    5  
ATOM 8101  O O    . HIS A 1 27  ? -2.333  12.361  -3.312  1.00 0.00 ? 27  HIS A O    5  
ATOM 8102  C CB   . HIS A 1 27  ? 0.002   14.326  -2.881  1.00 0.00 ? 27  HIS A CB   5  
ATOM 8103  C CG   . HIS A 1 27  ? 0.773   15.210  -1.948  1.00 0.00 ? 27  HIS A CG   5  
ATOM 8104  N ND1  . HIS A 1 27  ? 2.100   15.513  -2.133  1.00 0.00 ? 27  HIS A ND1  5  
ATOM 8105  C CD2  . HIS A 1 27  ? 0.387   15.884  -0.843  1.00 0.00 ? 27  HIS A CD2  5  
ATOM 8106  C CE1  . HIS A 1 27  ? 2.498   16.336  -1.185  1.00 0.00 ? 27  HIS A CE1  5  
ATOM 8107  N NE2  . HIS A 1 27  ? 1.477   16.583  -0.385  1.00 0.00 ? 27  HIS A NE2  5  
ATOM 8108  H H    . HIS A 1 27  ? 1.924   12.736  -2.458  1.00 0.00 ? 27  HIS A H    5  
ATOM 8109  H HA   . HIS A 1 27  ? -0.665  12.912  -1.432  1.00 0.00 ? 27  HIS A HA   5  
ATOM 8110  H HB2  . HIS A 1 27  ? 0.536   14.298  -3.815  1.00 0.00 ? 27  HIS A HB2  5  
ATOM 8111  H HB3  . HIS A 1 27  ? -0.968  14.774  -3.042  1.00 0.00 ? 27  HIS A HB3  5  
ATOM 8112  H HD1  . HIS A 1 27  ? 2.671   15.174  -2.868  1.00 0.00 ? 27  HIS A HD1  5  
ATOM 8113  H HD2  . HIS A 1 27  ? -0.594  15.864  -0.395  1.00 0.00 ? 27  HIS A HD2  5  
ATOM 8114  H HE1  . HIS A 1 27  ? 3.494   16.743  -1.082  1.00 0.00 ? 27  HIS A HE1  5  
ATOM 8115  H HE2  . HIS A 1 27  ? 1.414   17.390  0.182   1.00 0.00 ? 27  HIS A HE2  5  
ATOM 8116  N N    . ARG A 1 28  ? -0.546  11.352  -4.248  1.00 0.00 ? 28  ARG A N    5  
ATOM 8117  C CA   . ARG A 1 28  ? -1.322  10.607  -5.244  1.00 0.00 ? 28  ARG A CA   5  
ATOM 8118  C C    . ARG A 1 28  ? -2.298  9.624   -4.583  1.00 0.00 ? 28  ARG A C    5  
ATOM 8119  O O    . ARG A 1 28  ? -3.126  9.004   -5.256  1.00 0.00 ? 28  ARG A O    5  
ATOM 8120  C CB   . ARG A 1 28  ? -0.376  9.859   -6.182  1.00 0.00 ? 28  ARG A CB   5  
ATOM 8121  C CG   . ARG A 1 28  ? 0.460   10.770  -7.068  1.00 0.00 ? 28  ARG A CG   5  
ATOM 8122  C CD   . ARG A 1 28  ? 1.677   10.036  -7.605  1.00 0.00 ? 28  ARG A CD   5  
ATOM 8123  N NE   . ARG A 1 28  ? 2.437   10.828  -8.575  1.00 0.00 ? 28  ARG A NE   5  
ATOM 8124  C CZ   . ARG A 1 28  ? 3.363   11.734  -8.254  1.00 0.00 ? 28  ARG A CZ   5  
ATOM 8125  N NH1  . ARG A 1 28  ? 3.592   12.050  -6.989  1.00 0.00 ? 28  ARG A NH1  5  
ATOM 8126  N NH2  . ARG A 1 28  ? 4.052   12.327  -9.215  1.00 0.00 ? 28  ARG A NH2  5  
ATOM 8127  H H    . ARG A 1 28  ? 0.432   11.250  -4.236  1.00 0.00 ? 28  ARG A H    5  
ATOM 8128  H HA   . ARG A 1 28  ? -1.891  11.322  -5.820  1.00 0.00 ? 28  ARG A HA   5  
ATOM 8129  H HB2  . ARG A 1 28  ? 0.295   9.257   -5.590  1.00 0.00 ? 28  ARG A HB2  5  
ATOM 8130  H HB3  . ARG A 1 28  ? -0.959  9.211   -6.819  1.00 0.00 ? 28  ARG A HB3  5  
ATOM 8131  H HG2  . ARG A 1 28  ? -0.142  11.105  -7.899  1.00 0.00 ? 28  ARG A HG2  5  
ATOM 8132  H HG3  . ARG A 1 28  ? 0.788   11.622  -6.490  1.00 0.00 ? 28  ARG A HG3  5  
ATOM 8133  H HD2  . ARG A 1 28  ? 2.325   9.789   -6.777  1.00 0.00 ? 28  ARG A HD2  5  
ATOM 8134  H HD3  . ARG A 1 28  ? 1.345   9.126   -8.082  1.00 0.00 ? 28  ARG A HD3  5  
ATOM 8135  H HE   . ARG A 1 28  ? 2.269   10.648  -9.529  1.00 0.00 ? 28  ARG A HE   5  
ATOM 8136  H HH11 . ARG A 1 28  ? 3.064   11.607  -6.247  1.00 0.00 ? 28  ARG A HH11 5  
ATOM 8137  H HH12 . ARG A 1 28  ? 4.297   12.731  -6.754  1.00 0.00 ? 28  ARG A HH12 5  
ATOM 8138  H HH21 . ARG A 1 28  ? 3.879   12.091  -10.177 1.00 0.00 ? 28  ARG A HH21 5  
ATOM 8139  H HH22 . ARG A 1 28  ? 4.751   13.011  -8.991  1.00 0.00 ? 28  ARG A HH22 5  
ATOM 8140  N N    . CYS A 1 29  ? -2.192  9.488   -3.265  1.00 0.00 ? 29  CYS A N    5  
ATOM 8141  C CA   . CYS A 1 29  ? -3.095  8.644   -2.494  1.00 0.00 ? 29  CYS A CA   5  
ATOM 8142  C C    . CYS A 1 29  ? -4.545  9.087   -2.664  1.00 0.00 ? 29  CYS A C    5  
ATOM 8143  O O    . CYS A 1 29  ? -5.457  8.258   -2.750  1.00 0.00 ? 29  CYS A O    5  
ATOM 8144  C CB   . CYS A 1 29  ? -2.705  8.677   -1.017  1.00 0.00 ? 29  CYS A CB   5  
ATOM 8145  S SG   . CYS A 1 29  ? -3.664  7.555   0.019   1.00 0.00 ? 29  CYS A SG   5  
ATOM 8146  H H    . CYS A 1 29  ? -1.474  9.965   -2.795  1.00 0.00 ? 29  CYS A H    5  
ATOM 8147  H HA   . CYS A 1 29  ? -3.001  7.640   -2.853  1.00 0.00 ? 29  CYS A HA   5  
ATOM 8148  H HB2  . CYS A 1 29  ? -1.665  8.405   -0.921  1.00 0.00 ? 29  CYS A HB2  5  
ATOM 8149  H HB3  . CYS A 1 29  ? -2.845  9.679   -0.638  1.00 0.00 ? 29  CYS A HB3  5  
ATOM 8150  H HG   . CYS A 1 29  ? -4.742  8.213   0.424   1.00 0.00 ? 29  CYS A HG   5  
ATOM 8151  N N    . VAL A 1 30  ? -4.749  10.394  -2.746  1.00 0.00 ? 30  VAL A N    5  
ATOM 8152  C CA   . VAL A 1 30  ? -6.091  10.946  -2.833  1.00 0.00 ? 30  VAL A CA   5  
ATOM 8153  C C    . VAL A 1 30  ? -6.754  10.560  -4.148  1.00 0.00 ? 30  VAL A C    5  
ATOM 8154  O O    . VAL A 1 30  ? -7.951  10.292  -4.190  1.00 0.00 ? 30  VAL A O    5  
ATOM 8155  C CB   . VAL A 1 30  ? -6.088  12.480  -2.679  1.00 0.00 ? 30  VAL A CB   5  
ATOM 8156  C CG1  . VAL A 1 30  ? -5.432  12.864  -1.367  1.00 0.00 ? 30  VAL A CG1  5  
ATOM 8157  C CG2  . VAL A 1 30  ? -5.389  13.165  -3.846  1.00 0.00 ? 30  VAL A CG2  5  
ATOM 8158  H H    . VAL A 1 30  ? -3.979  11.001  -2.752  1.00 0.00 ? 30  VAL A H    5  
ATOM 8159  H HA   . VAL A 1 30  ? -6.668  10.528  -2.019  1.00 0.00 ? 30  VAL A HA   5  
ATOM 8160  H HB   . VAL A 1 30  ? -7.113  12.817  -2.652  1.00 0.00 ? 30  VAL A HB   5  
ATOM 8161  H HG11 . VAL A 1 30  ? -4.418  12.488  -1.350  1.00 0.00 ? 30  VAL A HG11 5  
ATOM 8162  H HG12 . VAL A 1 30  ? -5.988  12.435  -0.547  1.00 0.00 ? 30  VAL A HG12 5  
ATOM 8163  H HG13 . VAL A 1 30  ? -5.418  13.940  -1.273  1.00 0.00 ? 30  VAL A HG13 5  
ATOM 8164  H HG21 . VAL A 1 30  ? -4.365  12.826  -3.901  1.00 0.00 ? 30  VAL A HG21 5  
ATOM 8165  H HG22 . VAL A 1 30  ? -5.407  14.235  -3.701  1.00 0.00 ? 30  VAL A HG22 5  
ATOM 8166  H HG23 . VAL A 1 30  ? -5.900  12.918  -4.767  1.00 0.00 ? 30  VAL A HG23 5  
ATOM 8167  N N    . ALA A 1 31  ? -5.961  10.494  -5.208  1.00 0.00 ? 31  ALA A N    5  
ATOM 8168  C CA   . ALA A 1 31  ? -6.489  10.179  -6.526  1.00 0.00 ? 31  ALA A CA   5  
ATOM 8169  C C    . ALA A 1 31  ? -6.814  8.696   -6.628  1.00 0.00 ? 31  ALA A C    5  
ATOM 8170  O O    . ALA A 1 31  ? -7.911  8.316   -7.039  1.00 0.00 ? 31  ALA A O    5  
ATOM 8171  C CB   . ALA A 1 31  ? -5.497  10.585  -7.605  1.00 0.00 ? 31  ALA A CB   5  
ATOM 8172  H H    . ALA A 1 31  ? -4.996  10.657  -5.097  1.00 0.00 ? 31  ALA A H    5  
ATOM 8173  H HA   . ALA A 1 31  ? -7.397  10.749  -6.667  1.00 0.00 ? 31  ALA A HA   5  
ATOM 8174  H HB1  . ALA A 1 31  ? -5.927  10.394  -8.577  1.00 0.00 ? 31  ALA A HB1  5  
ATOM 8175  H HB2  . ALA A 1 31  ? -4.590  10.010  -7.494  1.00 0.00 ? 31  ALA A HB2  5  
ATOM 8176  H HB3  . ALA A 1 31  ? -5.272  11.637  -7.511  1.00 0.00 ? 31  ALA A HB3  5  
ATOM 8177  N N    . THR A 1 32  ? -5.846  7.870   -6.262  1.00 0.00 ? 32  THR A N    5  
ATOM 8178  C CA   . THR A 1 32  ? -6.000  6.420   -6.264  1.00 0.00 ? 32  THR A CA   5  
ATOM 8179  C C    . THR A 1 32  ? -7.209  5.947   -5.450  1.00 0.00 ? 32  THR A C    5  
ATOM 8180  O O    . THR A 1 32  ? -8.006  5.147   -5.938  1.00 0.00 ? 32  THR A O    5  
ATOM 8181  C CB   . THR A 1 32  ? -4.726  5.761   -5.708  1.00 0.00 ? 32  THR A CB   5  
ATOM 8182  O OG1  . THR A 1 32  ? -3.570  6.396   -6.275  1.00 0.00 ? 32  THR A OG1  5  
ATOM 8183  C CG2  . THR A 1 32  ? -4.695  4.279   -6.035  1.00 0.00 ? 32  THR A CG2  5  
ATOM 8184  H H    . THR A 1 32  ? -4.961  8.234   -6.048  1.00 0.00 ? 32  THR A H    5  
ATOM 8185  H HA   . THR A 1 32  ? -6.126  6.093   -7.287  1.00 0.00 ? 32  THR A HA   5  
ATOM 8186  H HB   . THR A 1 32  ? -4.709  5.881   -4.636  1.00 0.00 ? 32  THR A HB   5  
ATOM 8187  H HG1  . THR A 1 32  ? -3.375  7.209   -5.792  1.00 0.00 ? 32  THR A HG1  5  
ATOM 8188  H HG21 . THR A 1 32  ? -5.565  3.798   -5.614  1.00 0.00 ? 32  THR A HG21 5  
ATOM 8189  H HG22 . THR A 1 32  ? -3.801  3.837   -5.615  1.00 0.00 ? 32  THR A HG22 5  
ATOM 8190  H HG23 . THR A 1 32  ? -4.691  4.145   -7.107  1.00 0.00 ? 32  THR A HG23 5  
ATOM 8191  N N    . VAL A 1 33  ? -7.360  6.434   -4.220  1.00 0.00 ? 33  VAL A N    5  
ATOM 8192  C CA   . VAL A 1 33  ? -8.416  5.919   -3.352  1.00 0.00 ? 33  VAL A CA   5  
ATOM 8193  C C    . VAL A 1 33  ? -9.232  7.019   -2.676  1.00 0.00 ? 33  VAL A C    5  
ATOM 8194  O O    . VAL A 1 33  ? -10.401 6.816   -2.365  1.00 0.00 ? 33  VAL A O    5  
ATOM 8195  C CB   . VAL A 1 33  ? -7.861  4.960   -2.276  1.00 0.00 ? 33  VAL A CB   5  
ATOM 8196  C CG1  . VAL A 1 33  ? -7.430  3.650   -2.910  1.00 0.00 ? 33  VAL A CG1  5  
ATOM 8197  C CG2  . VAL A 1 33  ? -6.704  5.597   -1.518  1.00 0.00 ? 33  VAL A CG2  5  
ATOM 8198  H H    . VAL A 1 33  ? -6.774  7.153   -3.902  1.00 0.00 ? 33  VAL A H    5  
ATOM 8199  H HA   . VAL A 1 33  ? -9.085  5.346   -3.978  1.00 0.00 ? 33  VAL A HA   5  
ATOM 8200  H HB   . VAL A 1 33  ? -8.651  4.748   -1.570  1.00 0.00 ? 33  VAL A HB   5  
ATOM 8201  H HG11 . VAL A 1 33  ? -6.660  3.841   -3.642  1.00 0.00 ? 33  VAL A HG11 5  
ATOM 8202  H HG12 . VAL A 1 33  ? -8.279  3.188   -3.392  1.00 0.00 ? 33  VAL A HG12 5  
ATOM 8203  H HG13 . VAL A 1 33  ? -7.046  2.988   -2.147  1.00 0.00 ? 33  VAL A HG13 5  
ATOM 8204  H HG21 . VAL A 1 33  ? -5.916  5.851   -2.212  1.00 0.00 ? 33  VAL A HG21 5  
ATOM 8205  H HG22 . VAL A 1 33  ? -6.328  4.901   -0.783  1.00 0.00 ? 33  VAL A HG22 5  
ATOM 8206  H HG23 . VAL A 1 33  ? -7.050  6.492   -1.022  1.00 0.00 ? 33  VAL A HG23 5  
ATOM 8207  N N    . GLY A 1 34  ? -8.637  8.177   -2.446  1.00 0.00 ? 34  GLY A N    5  
ATOM 8208  C CA   . GLY A 1 34  ? -9.361  9.228   -1.758  1.00 0.00 ? 34  GLY A CA   5  
ATOM 8209  C C    . GLY A 1 34  ? -8.741  9.594   -0.429  1.00 0.00 ? 34  GLY A C    5  
ATOM 8210  O O    . GLY A 1 34  ? -8.990  10.680  0.097   1.00 0.00 ? 34  GLY A O    5  
ATOM 8211  H H    . GLY A 1 34  ? -7.720  8.331   -2.762  1.00 0.00 ? 34  GLY A H    5  
ATOM 8212  H HA2  . GLY A 1 34  ? -9.389  10.104  -2.387  1.00 0.00 ? 34  GLY A HA2  5  
ATOM 8213  H HA3  . GLY A 1 34  ? -10.374 8.887   -1.582  1.00 0.00 ? 34  GLY A HA3  5  
ATOM 8214  N N    . TYR A 1 35  ? -7.946  8.689   0.126   1.00 0.00 ? 35  TYR A N    5  
ATOM 8215  C CA   . TYR A 1 35  ? -7.275  8.954   1.389   1.00 0.00 ? 35  TYR A CA   5  
ATOM 8216  C C    . TYR A 1 35  ? -6.180  9.973   1.189   1.00 0.00 ? 35  TYR A C    5  
ATOM 8217  O O    . TYR A 1 35  ? -5.453  9.930   0.200   1.00 0.00 ? 35  TYR A O    5  
ATOM 8218  C CB   . TYR A 1 35  ? -6.653  7.688   1.991   1.00 0.00 ? 35  TYR A CB   5  
ATOM 8219  C CG   . TYR A 1 35  ? -7.643  6.671   2.503   1.00 0.00 ? 35  TYR A CG   5  
ATOM 8220  C CD1  . TYR A 1 35  ? -8.809  7.067   3.138   1.00 0.00 ? 35  TYR A CD1  5  
ATOM 8221  C CD2  . TYR A 1 35  ? -7.397  5.312   2.368   1.00 0.00 ? 35  TYR A CD2  5  
ATOM 8222  C CE1  . TYR A 1 35  ? -9.708  6.141   3.623   1.00 0.00 ? 35  TYR A CE1  5  
ATOM 8223  C CE2  . TYR A 1 35  ? -8.288  4.377   2.850   1.00 0.00 ? 35  TYR A CE2  5  
ATOM 8224  C CZ   . TYR A 1 35  ? -9.445  4.797   3.478   1.00 0.00 ? 35  TYR A CZ   5  
ATOM 8225  O OH   . TYR A 1 35  ? -10.344 3.874   3.955   1.00 0.00 ? 35  TYR A OH   5  
ATOM 8226  H H    . TYR A 1 35  ? -7.802  7.835   -0.326  1.00 0.00 ? 35  TYR A H    5  
ATOM 8227  H HA   . TYR A 1 35  ? -8.005  9.354   2.078   1.00 0.00 ? 35  TYR A HA   5  
ATOM 8228  H HB2  . TYR A 1 35  ? -6.046  7.208   1.241   1.00 0.00 ? 35  TYR A HB2  5  
ATOM 8229  H HB3  . TYR A 1 35  ? -6.021  7.975   2.819   1.00 0.00 ? 35  TYR A HB3  5  
ATOM 8230  H HD1  . TYR A 1 35  ? -9.010  8.121   3.252   1.00 0.00 ? 35  TYR A HD1  5  
ATOM 8231  H HD2  . TYR A 1 35  ? -6.490  4.988   1.877   1.00 0.00 ? 35  TYR A HD2  5  
ATOM 8232  H HE1  . TYR A 1 35  ? -10.609 6.470   4.117   1.00 0.00 ? 35  TYR A HE1  5  
ATOM 8233  H HE2  . TYR A 1 35  ? -8.074  3.321   2.738   1.00 0.00 ? 35  TYR A HE2  5  
ATOM 8234  H HH   . TYR A 1 35  ? -9.868  3.170   4.402   1.00 0.00 ? 35  TYR A HH   5  
ATOM 8235  N N    . GLN A 1 36  ? -6.068  10.881  2.124   1.00 0.00 ? 36  GLN A N    5  
ATOM 8236  C CA   . GLN A 1 36  ? -4.951  11.794  2.141   1.00 0.00 ? 36  GLN A CA   5  
ATOM 8237  C C    . GLN A 1 36  ? -3.744  11.066  2.702   1.00 0.00 ? 36  GLN A C    5  
ATOM 8238  O O    . GLN A 1 36  ? -3.911  10.175  3.536   1.00 0.00 ? 36  GLN A O    5  
ATOM 8239  C CB   . GLN A 1 36  ? -5.261  13.024  3.006   1.00 0.00 ? 36  GLN A CB   5  
ATOM 8240  C CG   . GLN A 1 36  ? -6.366  13.913  2.461   1.00 0.00 ? 36  GLN A CG   5  
ATOM 8241  C CD   . GLN A 1 36  ? -5.888  14.806  1.332   1.00 0.00 ? 36  GLN A CD   5  
ATOM 8242  O OE1  . GLN A 1 36  ? -4.711  15.173  1.273   1.00 0.00 ? 36  GLN A OE1  5  
ATOM 8243  N NE2  . GLN A 1 36  ? -6.791  15.168  0.435   1.00 0.00 ? 36  GLN A NE2  5  
ATOM 8244  H H    . GLN A 1 36  ? -6.749  10.917  2.840   1.00 0.00 ? 36  GLN A H    5  
ATOM 8245  H HA   . GLN A 1 36  ? -4.743  12.096  1.121   1.00 0.00 ? 36  GLN A HA   5  
ATOM 8246  H HB2  . GLN A 1 36  ? -5.555  12.689  3.991   1.00 0.00 ? 36  GLN A HB2  5  
ATOM 8247  H HB3  . GLN A 1 36  ? -4.362  13.617  3.095   1.00 0.00 ? 36  GLN A HB3  5  
ATOM 8248  H HG2  . GLN A 1 36  ? -7.164  13.285  2.093   1.00 0.00 ? 36  GLN A HG2  5  
ATOM 8249  H HG3  . GLN A 1 36  ? -6.738  14.537  3.261   1.00 0.00 ? 36  GLN A HG3  5  
ATOM 8250  H HE21 . GLN A 1 36  ? -7.711  14.844  0.547   1.00 0.00 ? 36  GLN A HE21 5  
ATOM 8251  H HE22 . GLN A 1 36  ? -6.503  15.745  -0.307  1.00 0.00 ? 36  GLN A HE22 5  
ATOM 8252  N N    . PRO A 1 37  ? -2.525  11.404  2.258   1.00 0.00 ? 37  PRO A N    5  
ATOM 8253  C CA   . PRO A 1 37  ? -1.304  10.790  2.787   1.00 0.00 ? 37  PRO A CA   5  
ATOM 8254  C C    . PRO A 1 37  ? -1.324  10.743  4.312   1.00 0.00 ? 37  PRO A C    5  
ATOM 8255  O O    . PRO A 1 37  ? -1.044  9.714   4.930   1.00 0.00 ? 37  PRO A O    5  
ATOM 8256  C CB   . PRO A 1 37  ? -0.207  11.735  2.299   1.00 0.00 ? 37  PRO A CB   5  
ATOM 8257  C CG   . PRO A 1 37  ? -0.744  12.320  1.039   1.00 0.00 ? 37  PRO A CG   5  
ATOM 8258  C CD   . PRO A 1 37  ? -2.239  12.397  1.208   1.00 0.00 ? 37  PRO A CD   5  
ATOM 8259  H HA   . PRO A 1 37  ? -1.143  9.799   2.389   1.00 0.00 ? 37  PRO A HA   5  
ATOM 8260  H HB2  . PRO A 1 37  ? -0.028  12.498  3.043   1.00 0.00 ? 37  PRO A HB2  5  
ATOM 8261  H HB3  . PRO A 1 37  ? 0.701   11.179  2.120   1.00 0.00 ? 37  PRO A HB3  5  
ATOM 8262  H HG2  . PRO A 1 37  ? -0.333  13.308  0.890   1.00 0.00 ? 37  PRO A HG2  5  
ATOM 8263  H HG3  . PRO A 1 37  ? -0.493  11.682  0.203   1.00 0.00 ? 37  PRO A HG3  5  
ATOM 8264  H HD2  . PRO A 1 37  ? -2.531  13.387  1.526   1.00 0.00 ? 37  PRO A HD2  5  
ATOM 8265  H HD3  . PRO A 1 37  ? -2.734  12.135  0.284   1.00 0.00 ? 37  PRO A HD3  5  
ATOM 8266  N N    . GLN A 1 38  ? -1.728  11.865  4.891   1.00 0.00 ? 38  GLN A N    5  
ATOM 8267  C CA   . GLN A 1 38  ? -1.788  12.033  6.334   1.00 0.00 ? 38  GLN A CA   5  
ATOM 8268  C C    . GLN A 1 38  ? -2.714  11.002  6.981   1.00 0.00 ? 38  GLN A C    5  
ATOM 8269  O O    . GLN A 1 38  ? -2.407  10.466  8.042   1.00 0.00 ? 38  GLN A O    5  
ATOM 8270  C CB   . GLN A 1 38  ? -2.280  13.444  6.663   1.00 0.00 ? 38  GLN A CB   5  
ATOM 8271  C CG   . GLN A 1 38  ? -1.464  14.549  6.008   1.00 0.00 ? 38  GLN A CG   5  
ATOM 8272  C CD   . GLN A 1 38  ? -0.022  14.571  6.471   1.00 0.00 ? 38  GLN A CD   5  
ATOM 8273  O OE1  . GLN A 1 38  ? 0.308   15.207  7.467   1.00 0.00 ? 38  GLN A OE1  5  
ATOM 8274  N NE2  . GLN A 1 38  ? 0.853   13.899  5.738   1.00 0.00 ? 38  GLN A NE2  5  
ATOM 8275  H H    . GLN A 1 38  ? -2.005  12.605  4.314   1.00 0.00 ? 38  GLN A H    5  
ATOM 8276  H HA   . GLN A 1 38  ? -0.791  11.910  6.729   1.00 0.00 ? 38  GLN A HA   5  
ATOM 8277  H HB2  . GLN A 1 38  ? -3.304  13.538  6.331   1.00 0.00 ? 38  GLN A HB2  5  
ATOM 8278  H HB3  . GLN A 1 38  ? -2.243  13.583  7.733   1.00 0.00 ? 38  GLN A HB3  5  
ATOM 8279  H HG2  . GLN A 1 38  ? -1.477  14.404  4.938   1.00 0.00 ? 38  GLN A HG2  5  
ATOM 8280  H HG3  . GLN A 1 38  ? -1.918  15.503  6.241   1.00 0.00 ? 38  GLN A HG3  5  
ATOM 8281  H HE21 . GLN A 1 38  ? 0.532   13.431  4.941   1.00 0.00 ? 38  GLN A HE21 5  
ATOM 8282  H HE22 . GLN A 1 38  ? 1.791   13.899  6.025   1.00 0.00 ? 38  GLN A HE22 5  
ATOM 8283  N N    . GLU A 1 39  ? -3.828  10.703  6.314   1.00 0.00 ? 39  GLU A N    5  
ATOM 8284  C CA   . GLU A 1 39  ? -4.855  9.841   6.887   1.00 0.00 ? 39  GLU A CA   5  
ATOM 8285  C C    . GLU A 1 39  ? -4.348  8.415   7.033   1.00 0.00 ? 39  GLU A C    5  
ATOM 8286  O O    . GLU A 1 39  ? -4.804  7.667   7.898   1.00 0.00 ? 39  GLU A O    5  
ATOM 8287  C CB   . GLU A 1 39  ? -6.122  9.857   6.029   1.00 0.00 ? 39  GLU A CB   5  
ATOM 8288  C CG   . GLU A 1 39  ? -6.709  11.244  5.845   1.00 0.00 ? 39  GLU A CG   5  
ATOM 8289  C CD   . GLU A 1 39  ? -8.061  11.222  5.169   1.00 0.00 ? 39  GLU A CD   5  
ATOM 8290  O OE1  . GLU A 1 39  ? -8.123  10.993  3.944   1.00 0.00 ? 39  GLU A OE1  5  
ATOM 8291  O OE2  . GLU A 1 39  ? -9.075  11.444  5.868   1.00 0.00 ? 39  GLU A OE2  5  
ATOM 8292  H H    . GLU A 1 39  ? -3.952  11.061  5.411   1.00 0.00 ? 39  GLU A H    5  
ATOM 8293  H HA   . GLU A 1 39  ? -5.094  10.223  7.868   1.00 0.00 ? 39  GLU A HA   5  
ATOM 8294  H HB2  . GLU A 1 39  ? -5.890  9.453   5.055   1.00 0.00 ? 39  GLU A HB2  5  
ATOM 8295  H HB3  . GLU A 1 39  ? -6.867  9.233   6.499   1.00 0.00 ? 39  GLU A HB3  5  
ATOM 8296  H HG2  . GLU A 1 39  ? -6.819  11.706  6.814   1.00 0.00 ? 39  GLU A HG2  5  
ATOM 8297  H HG3  . GLU A 1 39  ? -6.031  11.828  5.241   1.00 0.00 ? 39  GLU A HG3  5  
ATOM 8298  N N    . LEU A 1 40  ? -3.400  8.047   6.187   1.00 0.00 ? 40  LEU A N    5  
ATOM 8299  C CA   . LEU A 1 40  ? -2.810  6.723   6.246   1.00 0.00 ? 40  LEU A CA   5  
ATOM 8300  C C    . LEU A 1 40  ? -1.767  6.645   7.349   1.00 0.00 ? 40  LEU A C    5  
ATOM 8301  O O    . LEU A 1 40  ? -1.587  5.597   7.971   1.00 0.00 ? 40  LEU A O    5  
ATOM 8302  C CB   . LEU A 1 40  ? -2.176  6.363   4.904   1.00 0.00 ? 40  LEU A CB   5  
ATOM 8303  C CG   . LEU A 1 40  ? -3.157  6.145   3.753   1.00 0.00 ? 40  LEU A CG   5  
ATOM 8304  C CD1  . LEU A 1 40  ? -2.415  5.690   2.509   1.00 0.00 ? 40  LEU A CD1  5  
ATOM 8305  C CD2  . LEU A 1 40  ? -4.219  5.128   4.137   1.00 0.00 ? 40  LEU A CD2  5  
ATOM 8306  H H    . LEU A 1 40  ? -3.091  8.679   5.500   1.00 0.00 ? 40  LEU A H    5  
ATOM 8307  H HA   . LEU A 1 40  ? -3.599  6.018   6.461   1.00 0.00 ? 40  LEU A HA   5  
ATOM 8308  H HB2  . LEU A 1 40  ? -1.501  7.159   4.625   1.00 0.00 ? 40  LEU A HB2  5  
ATOM 8309  H HB3  . LEU A 1 40  ? -1.604  5.462   5.033   1.00 0.00 ? 40  LEU A HB3  5  
ATOM 8310  H HG   . LEU A 1 40  ? -3.652  7.079   3.525   1.00 0.00 ? 40  LEU A HG   5  
ATOM 8311  H HD11 . LEU A 1 40  ? -3.117  5.553   1.700   1.00 0.00 ? 40  LEU A HD11 5  
ATOM 8312  H HD12 . LEU A 1 40  ? -1.912  4.757   2.712   1.00 0.00 ? 40  LEU A HD12 5  
ATOM 8313  H HD13 . LEU A 1 40  ? -1.689  6.438   2.232   1.00 0.00 ? 40  LEU A HD13 5  
ATOM 8314  H HD21 . LEU A 1 40  ? -4.907  4.999   3.314   1.00 0.00 ? 40  LEU A HD21 5  
ATOM 8315  H HD22 . LEU A 1 40  ? -4.756  5.479   5.005   1.00 0.00 ? 40  LEU A HD22 5  
ATOM 8316  H HD23 . LEU A 1 40  ? -3.747  4.184   4.363   1.00 0.00 ? 40  LEU A HD23 5  
ATOM 8317  N N    . LEU A 1 41  ? -1.088  7.762   7.592   1.00 0.00 ? 41  LEU A N    5  
ATOM 8318  C CA   . LEU A 1 41  ? -0.016  7.806   8.580   1.00 0.00 ? 41  LEU A CA   5  
ATOM 8319  C C    . LEU A 1 41  ? -0.568  7.558   9.978   1.00 0.00 ? 41  LEU A C    5  
ATOM 8320  O O    . LEU A 1 41  ? -1.263  8.402   10.548  1.00 0.00 ? 41  LEU A O    5  
ATOM 8321  C CB   . LEU A 1 41  ? 0.712   9.152   8.533   1.00 0.00 ? 41  LEU A CB   5  
ATOM 8322  C CG   . LEU A 1 41  ? 1.140   9.619   7.140   1.00 0.00 ? 41  LEU A CG   5  
ATOM 8323  C CD1  . LEU A 1 41  ? 1.918   10.922  7.227   1.00 0.00 ? 41  LEU A CD1  5  
ATOM 8324  C CD2  . LEU A 1 41  ? 1.964   8.548   6.442   1.00 0.00 ? 41  LEU A CD2  5  
ATOM 8325  H H    . LEU A 1 41  ? -1.310  8.572   7.086   1.00 0.00 ? 41  LEU A H    5  
ATOM 8326  H HA   . LEU A 1 41  ? 0.684   7.020   8.340   1.00 0.00 ? 41  LEU A HA   5  
ATOM 8327  H HB2  . LEU A 1 41  ? 0.064   9.903   8.960   1.00 0.00 ? 41  LEU A HB2  5  
ATOM 8328  H HB3  . LEU A 1 41  ? 1.599   9.072   9.144   1.00 0.00 ? 41  LEU A HB3  5  
ATOM 8329  H HG   . LEU A 1 41  ? 0.255   9.799   6.543   1.00 0.00 ? 41  LEU A HG   5  
ATOM 8330  H HD11 . LEU A 1 41  ? 2.229   11.223  6.237   1.00 0.00 ? 41  LEU A HD11 5  
ATOM 8331  H HD12 . LEU A 1 41  ? 2.788   10.780  7.850   1.00 0.00 ? 41  LEU A HD12 5  
ATOM 8332  H HD13 . LEU A 1 41  ? 1.290   11.689  7.655   1.00 0.00 ? 41  LEU A HD13 5  
ATOM 8333  H HD21 . LEU A 1 41  ? 1.369   7.654   6.328   1.00 0.00 ? 41  LEU A HD21 5  
ATOM 8334  H HD22 . LEU A 1 41  ? 2.837   8.325   7.035   1.00 0.00 ? 41  LEU A HD22 5  
ATOM 8335  H HD23 . LEU A 1 41  ? 2.269   8.903   5.470   1.00 0.00 ? 41  LEU A HD23 5  
ATOM 8336  N N    . GLY A 1 42  ? -0.263  6.390   10.514  1.00 0.00 ? 42  GLY A N    5  
ATOM 8337  C CA   . GLY A 1 42  ? -0.768  6.018   11.817  1.00 0.00 ? 42  GLY A CA   5  
ATOM 8338  C C    . GLY A 1 42  ? -1.566  4.735   11.761  1.00 0.00 ? 42  GLY A C    5  
ATOM 8339  O O    . GLY A 1 42  ? -1.725  4.048   12.770  1.00 0.00 ? 42  GLY A O    5  
ATOM 8340  H H    . GLY A 1 42  ? 0.314   5.770   10.019  1.00 0.00 ? 42  GLY A H    5  
ATOM 8341  H HA2  . GLY A 1 42  ? 0.064   5.887   12.493  1.00 0.00 ? 42  GLY A HA2  5  
ATOM 8342  H HA3  . GLY A 1 42  ? -1.402  6.810   12.187  1.00 0.00 ? 42  GLY A HA3  5  
ATOM 8343  N N    . LYS A 1 43  ? -2.080  4.413   10.583  1.00 0.00 ? 43  LYS A N    5  
ATOM 8344  C CA   . LYS A 1 43  ? -2.829  3.191   10.389  1.00 0.00 ? 43  LYS A CA   5  
ATOM 8345  C C    . LYS A 1 43  ? -2.053  2.188   9.557   1.00 0.00 ? 43  LYS A C    5  
ATOM 8346  O O    . LYS A 1 43  ? -0.945  2.455   9.088   1.00 0.00 ? 43  LYS A O    5  
ATOM 8347  C CB   . LYS A 1 43  ? -4.157  3.488   9.712   1.00 0.00 ? 43  LYS A CB   5  
ATOM 8348  C CG   . LYS A 1 43  ? -5.100  4.281   10.583  1.00 0.00 ? 43  LYS A CG   5  
ATOM 8349  C CD   . LYS A 1 43  ? -6.498  4.300   10.003  1.00 0.00 ? 43  LYS A CD   5  
ATOM 8350  C CE   . LYS A 1 43  ? -7.483  4.920   10.966  1.00 0.00 ? 43  LYS A CE   5  
ATOM 8351  N NZ   . LYS A 1 43  ? -7.848  3.997   12.072  1.00 0.00 ? 43  LYS A NZ   5  
ATOM 8352  H H    . LYS A 1 43  ? -1.959  5.016   9.817   1.00 0.00 ? 43  LYS A H    5  
ATOM 8353  H HA   . LYS A 1 43  ? -3.023  2.763   11.362  1.00 0.00 ? 43  LYS A HA   5  
ATOM 8354  H HB2  . LYS A 1 43  ? -3.970  4.053   8.810   1.00 0.00 ? 43  LYS A HB2  5  
ATOM 8355  H HB3  . LYS A 1 43  ? -4.636  2.556   9.453   1.00 0.00 ? 43  LYS A HB3  5  
ATOM 8356  H HG2  . LYS A 1 43  ? -5.127  3.835   11.563  1.00 0.00 ? 43  LYS A HG2  5  
ATOM 8357  H HG3  . LYS A 1 43  ? -4.737  5.295   10.658  1.00 0.00 ? 43  LYS A HG3  5  
ATOM 8358  H HD2  . LYS A 1 43  ? -6.493  4.873   9.088   1.00 0.00 ? 43  LYS A HD2  5  
ATOM 8359  H HD3  . LYS A 1 43  ? -6.805  3.286   9.793   1.00 0.00 ? 43  LYS A HD3  5  
ATOM 8360  H HE2  . LYS A 1 43  ? -7.025  5.795   11.388  1.00 0.00 ? 43  LYS A HE2  5  
ATOM 8361  H HE3  . LYS A 1 43  ? -8.377  5.202   10.428  1.00 0.00 ? 43  LYS A HE3  5  
ATOM 8362  H HZ1  . LYS A 1 43  ? -8.131  3.068   11.689  1.00 0.00 ? 43  LYS A HZ1  5  
ATOM 8363  H HZ2  . LYS A 1 43  ? -8.642  4.388   12.617  1.00 0.00 ? 43  LYS A HZ2  5  
ATOM 8364  H HZ3  . LYS A 1 43  ? -7.040  3.866   12.713  1.00 0.00 ? 43  LYS A HZ3  5  
ATOM 8365  N N    . ASN A 1 44  ? -2.665  1.033   9.380   1.00 0.00 ? 44  ASN A N    5  
ATOM 8366  C CA   . ASN A 1 44  ? -2.066  -0.058  8.629   1.00 0.00 ? 44  ASN A CA   5  
ATOM 8367  C C    . ASN A 1 44  ? -2.826  -0.256  7.324   1.00 0.00 ? 44  ASN A C    5  
ATOM 8368  O O    . ASN A 1 44  ? -4.038  -0.053  7.268   1.00 0.00 ? 44  ASN A O    5  
ATOM 8369  C CB   . ASN A 1 44  ? -2.112  -1.343  9.473   1.00 0.00 ? 44  ASN A CB   5  
ATOM 8370  C CG   . ASN A 1 44  ? -1.198  -2.443  8.955   1.00 0.00 ? 44  ASN A CG   5  
ATOM 8371  O OD1  . ASN A 1 44  ? -1.087  -2.664  7.751   1.00 0.00 ? 44  ASN A OD1  5  
ATOM 8372  N ND2  . ASN A 1 44  ? -0.511  -3.126  9.860   1.00 0.00 ? 44  ASN A ND2  5  
ATOM 8373  H H    . ASN A 1 44  ? -3.559  0.909   9.766   1.00 0.00 ? 44  ASN A H    5  
ATOM 8374  H HA   . ASN A 1 44  ? -1.039  0.198   8.413   1.00 0.00 ? 44  ASN A HA   5  
ATOM 8375  H HB2  . ASN A 1 44  ? -1.823  -1.110  10.487  1.00 0.00 ? 44  ASN A HB2  5  
ATOM 8376  H HB3  . ASN A 1 44  ? -3.129  -1.721  9.470   1.00 0.00 ? 44  ASN A HB3  5  
ATOM 8377  H HD21 . ASN A 1 44  ? -0.624  -2.898  10.813  1.00 0.00 ? 44  ASN A HD21 5  
ATOM 8378  H HD22 . ASN A 1 44  ? 0.098   -3.832  9.541   1.00 0.00 ? 44  ASN A HD22 5  
ATOM 8379  N N    . ILE A 1 45  ? -2.106  -0.640  6.278   1.00 0.00 ? 45  ILE A N    5  
ATOM 8380  C CA   . ILE A 1 45  ? -2.714  -0.948  4.987   1.00 0.00 ? 45  ILE A CA   5  
ATOM 8381  C C    . ILE A 1 45  ? -3.683  -2.124  5.124   1.00 0.00 ? 45  ILE A C    5  
ATOM 8382  O O    . ILE A 1 45  ? -4.626  -2.257  4.348   1.00 0.00 ? 45  ILE A O    5  
ATOM 8383  C CB   . ILE A 1 45  ? -1.632  -1.270  3.924   1.00 0.00 ? 45  ILE A CB   5  
ATOM 8384  C CG1  . ILE A 1 45  ? -2.274  -1.524  2.554   1.00 0.00 ? 45  ILE A CG1  5  
ATOM 8385  C CG2  . ILE A 1 45  ? -0.789  -2.465  4.349   1.00 0.00 ? 45  ILE A CG2  5  
ATOM 8386  C CD1  . ILE A 1 45  ? -1.270  -1.755  1.442   1.00 0.00 ? 45  ILE A CD1  5  
ATOM 8387  H H    . ILE A 1 45  ? -1.131  -0.725  6.380   1.00 0.00 ? 45  ILE A H    5  
ATOM 8388  H HA   . ILE A 1 45  ? -3.268  -0.076  4.660   1.00 0.00 ? 45  ILE A HA   5  
ATOM 8389  H HB   . ILE A 1 45  ? -0.976  -0.415  3.848   1.00 0.00 ? 45  ILE A HB   5  
ATOM 8390  H HG12 . ILE A 1 45  ? -2.902  -2.400  2.617   1.00 0.00 ? 45  ILE A HG12 5  
ATOM 8391  H HG13 . ILE A 1 45  ? -2.880  -0.670  2.285   1.00 0.00 ? 45  ILE A HG13 5  
ATOM 8392  H HG21 . ILE A 1 45  ? -1.428  -3.326  4.483   1.00 0.00 ? 45  ILE A HG21 5  
ATOM 8393  H HG22 . ILE A 1 45  ? -0.287  -2.242  5.279   1.00 0.00 ? 45  ILE A HG22 5  
ATOM 8394  H HG23 . ILE A 1 45  ? -0.055  -2.678  3.587   1.00 0.00 ? 45  ILE A HG23 5  
ATOM 8395  H HD11 . ILE A 1 45  ? -0.640  -0.884  1.337   1.00 0.00 ? 45  ILE A HD11 5  
ATOM 8396  H HD12 . ILE A 1 45  ? -1.797  -1.932  0.516   1.00 0.00 ? 45  ILE A HD12 5  
ATOM 8397  H HD13 . ILE A 1 45  ? -0.661  -2.614  1.678   1.00 0.00 ? 45  ILE A HD13 5  
ATOM 8398  N N    . VAL A 1 46  ? -3.457  -2.953  6.141   1.00 0.00 ? 46  VAL A N    5  
ATOM 8399  C CA   . VAL A 1 46  ? -4.326  -4.086  6.420   1.00 0.00 ? 46  VAL A CA   5  
ATOM 8400  C C    . VAL A 1 46  ? -5.669  -3.606  6.982   1.00 0.00 ? 46  VAL A C    5  
ATOM 8401  O O    . VAL A 1 46  ? -6.696  -4.267  6.820   1.00 0.00 ? 46  VAL A O    5  
ATOM 8402  C CB   . VAL A 1 46  ? -3.655  -5.067  7.409   1.00 0.00 ? 46  VAL A CB   5  
ATOM 8403  C CG1  . VAL A 1 46  ? -4.570  -6.240  7.739   1.00 0.00 ? 46  VAL A CG1  5  
ATOM 8404  C CG2  . VAL A 1 46  ? -2.335  -5.570  6.842   1.00 0.00 ? 46  VAL A CG2  5  
ATOM 8405  H H    . VAL A 1 46  ? -2.678  -2.800  6.718   1.00 0.00 ? 46  VAL A H    5  
ATOM 8406  H HA   . VAL A 1 46  ? -4.503  -4.608  5.490   1.00 0.00 ? 46  VAL A HA   5  
ATOM 8407  H HB   . VAL A 1 46  ? -3.444  -4.530  8.323   1.00 0.00 ? 46  VAL A HB   5  
ATOM 8408  H HG11 . VAL A 1 46  ? -4.066  -6.912  8.418   1.00 0.00 ? 46  VAL A HG11 5  
ATOM 8409  H HG12 . VAL A 1 46  ? -4.821  -6.768  6.830   1.00 0.00 ? 46  VAL A HG12 5  
ATOM 8410  H HG13 . VAL A 1 46  ? -5.474  -5.872  8.200   1.00 0.00 ? 46  VAL A HG13 5  
ATOM 8411  H HG21 . VAL A 1 46  ? -1.677  -4.732  6.663   1.00 0.00 ? 46  VAL A HG21 5  
ATOM 8412  H HG22 . VAL A 1 46  ? -2.517  -6.089  5.913   1.00 0.00 ? 46  VAL A HG22 5  
ATOM 8413  H HG23 . VAL A 1 46  ? -1.874  -6.245  7.546   1.00 0.00 ? 46  VAL A HG23 5  
ATOM 8414  N N    . GLU A 1 47  ? -5.660  -2.430  7.610   1.00 0.00 ? 47  GLU A N    5  
ATOM 8415  C CA   . GLU A 1 47  ? -6.883  -1.829  8.138   1.00 0.00 ? 47  GLU A CA   5  
ATOM 8416  C C    . GLU A 1 47  ? -7.854  -1.528  7.005   1.00 0.00 ? 47  GLU A C    5  
ATOM 8417  O O    . GLU A 1 47  ? -9.072  -1.634  7.160   1.00 0.00 ? 47  GLU A O    5  
ATOM 8418  C CB   . GLU A 1 47  ? -6.570  -0.530  8.883   1.00 0.00 ? 47  GLU A CB   5  
ATOM 8419  C CG   . GLU A 1 47  ? -5.770  -0.729  10.155  1.00 0.00 ? 47  GLU A CG   5  
ATOM 8420  C CD   . GLU A 1 47  ? -6.538  -1.493  11.205  1.00 0.00 ? 47  GLU A CD   5  
ATOM 8421  O OE1  . GLU A 1 47  ? -7.630  -1.030  11.602  1.00 0.00 ? 47  GLU A OE1  5  
ATOM 8422  O OE2  . GLU A 1 47  ? -6.060  -2.563  11.634  1.00 0.00 ? 47  GLU A OE2  5  
ATOM 8423  H H    . GLU A 1 47  ? -4.811  -1.951  7.716   1.00 0.00 ? 47  GLU A H    5  
ATOM 8424  H HA   . GLU A 1 47  ? -7.334  -2.530  8.822   1.00 0.00 ? 47  GLU A HA   5  
ATOM 8425  H HB2  . GLU A 1 47  ? -6.008  0.117   8.230   1.00 0.00 ? 47  GLU A HB2  5  
ATOM 8426  H HB3  . GLU A 1 47  ? -7.500  -0.046  9.143   1.00 0.00 ? 47  GLU A HB3  5  
ATOM 8427  H HG2  . GLU A 1 47  ? -4.875  -1.282  9.915   1.00 0.00 ? 47  GLU A HG2  5  
ATOM 8428  H HG3  . GLU A 1 47  ? -5.503  0.237   10.553  1.00 0.00 ? 47  GLU A HG3  5  
ATOM 8429  N N    . PHE A 1 48  ? -7.296  -1.145  5.868   1.00 0.00 ? 48  PHE A N    5  
ATOM 8430  C CA   . PHE A 1 48  ? -8.092  -0.806  4.700   1.00 0.00 ? 48  PHE A CA   5  
ATOM 8431  C C    . PHE A 1 48  ? -8.005  -1.909  3.665   1.00 0.00 ? 48  PHE A C    5  
ATOM 8432  O O    . PHE A 1 48  ? -8.417  -1.738  2.517   1.00 0.00 ? 48  PHE A O    5  
ATOM 8433  C CB   . PHE A 1 48  ? -7.628  0.517   4.104   1.00 0.00 ? 48  PHE A CB   5  
ATOM 8434  C CG   . PHE A 1 48  ? -7.636  1.641   5.094   1.00 0.00 ? 48  PHE A CG   5  
ATOM 8435  C CD1  . PHE A 1 48  ? -8.797  1.978   5.771   1.00 0.00 ? 48  PHE A CD1  5  
ATOM 8436  C CD2  . PHE A 1 48  ? -6.480  2.355   5.353   1.00 0.00 ? 48  PHE A CD2  5  
ATOM 8437  C CE1  . PHE A 1 48  ? -8.803  3.007   6.689   1.00 0.00 ? 48  PHE A CE1  5  
ATOM 8438  C CE2  . PHE A 1 48  ? -6.481  3.388   6.271   1.00 0.00 ? 48  PHE A CE2  5  
ATOM 8439  C CZ   . PHE A 1 48  ? -7.644  3.713   6.936   1.00 0.00 ? 48  PHE A CZ   5  
ATOM 8440  H H    . PHE A 1 48  ? -6.318  -1.098  5.809   1.00 0.00 ? 48  PHE A H    5  
ATOM 8441  H HA   . PHE A 1 48  ? -9.119  -0.705  5.014   1.00 0.00 ? 48  PHE A HA   5  
ATOM 8442  H HB2  . PHE A 1 48  ? -6.622  0.404   3.728   1.00 0.00 ? 48  PHE A HB2  5  
ATOM 8443  H HB3  . PHE A 1 48  ? -8.286  0.784   3.291   1.00 0.00 ? 48  PHE A HB3  5  
ATOM 8444  H HD1  . PHE A 1 48  ? -9.704  1.426   5.576   1.00 0.00 ? 48  PHE A HD1  5  
ATOM 8445  H HD2  . PHE A 1 48  ? -5.569  2.102   4.829   1.00 0.00 ? 48  PHE A HD2  5  
ATOM 8446  H HE1  . PHE A 1 48  ? -9.712  3.261   7.211   1.00 0.00 ? 48  PHE A HE1  5  
ATOM 8447  H HE2  . PHE A 1 48  ? -5.573  3.938   6.467   1.00 0.00 ? 48  PHE A HE2  5  
ATOM 8448  H HZ   . PHE A 1 48  ? -7.648  4.517   7.653   1.00 0.00 ? 48  PHE A HZ   5  
ATOM 8449  N N    . CYS A 1 49  ? -7.455  -3.037  4.079   1.00 0.00 ? 49  CYS A N    5  
ATOM 8450  C CA   . CYS A 1 49  ? -7.380  -4.203  3.223   1.00 0.00 ? 49  CYS A CA   5  
ATOM 8451  C C    . CYS A 1 49  ? -8.650  -5.021  3.356   1.00 0.00 ? 49  CYS A C    5  
ATOM 8452  O O    . CYS A 1 49  ? -9.134  -5.253  4.467   1.00 0.00 ? 49  CYS A O    5  
ATOM 8453  C CB   . CYS A 1 49  ? -6.169  -5.058  3.594   1.00 0.00 ? 49  CYS A CB   5  
ATOM 8454  S SG   . CYS A 1 49  ? -6.012  -6.575  2.623   1.00 0.00 ? 49  CYS A SG   5  
ATOM 8455  H H    . CYS A 1 49  ? -7.091  -3.091  4.992   1.00 0.00 ? 49  CYS A H    5  
ATOM 8456  H HA   . CYS A 1 49  ? -7.282  -3.866  2.202   1.00 0.00 ? 49  CYS A HA   5  
ATOM 8457  H HB2  . CYS A 1 49  ? -5.270  -4.480  3.444   1.00 0.00 ? 49  CYS A HB2  5  
ATOM 8458  H HB3  . CYS A 1 49  ? -6.242  -5.340  4.634   1.00 0.00 ? 49  CYS A HB3  5  
ATOM 8459  H HG   . CYS A 1 49  ? -5.327  -6.292  1.524   1.00 0.00 ? 49  CYS A HG   5  
ATOM 8460  N N    . HIS A 1 50  ? -9.209  -5.403  2.213   1.00 0.00 ? 50  HIS A N    5  
ATOM 8461  C CA   . HIS A 1 50  ? -10.363 -6.292  2.163   1.00 0.00 ? 50  HIS A CA   5  
ATOM 8462  C C    . HIS A 1 50  ? -10.153 -7.464  3.119   1.00 0.00 ? 50  HIS A C    5  
ATOM 8463  O O    . HIS A 1 50  ? -9.135  -8.139  3.059   1.00 0.00 ? 50  HIS A O    5  
ATOM 8464  C CB   . HIS A 1 50  ? -10.551 -6.784  0.723   1.00 0.00 ? 50  HIS A CB   5  
ATOM 8465  C CG   . HIS A 1 50  ? -11.787 -7.596  0.497   1.00 0.00 ? 50  HIS A CG   5  
ATOM 8466  N ND1  . HIS A 1 50  ? -11.756 -8.917  0.114   1.00 0.00 ? 50  HIS A ND1  5  
ATOM 8467  C CD2  . HIS A 1 50  ? -13.095 -7.263  0.583   1.00 0.00 ? 50  HIS A CD2  5  
ATOM 8468  C CE1  . HIS A 1 50  ? -12.989 -9.364  -0.024  1.00 0.00 ? 50  HIS A CE1  5  
ATOM 8469  N NE2  . HIS A 1 50  ? -13.821 -8.379  0.253   1.00 0.00 ? 50  HIS A NE2  5  
ATOM 8470  H H    . HIS A 1 50  ? -8.844  -5.049  1.372   1.00 0.00 ? 50  HIS A H    5  
ATOM 8471  H HA   . HIS A 1 50  ? -11.236 -5.734  2.470   1.00 0.00 ? 50  HIS A HA   5  
ATOM 8472  H HB2  . HIS A 1 50  ? -10.599 -5.928  0.066   1.00 0.00 ? 50  HIS A HB2  5  
ATOM 8473  H HB3  . HIS A 1 50  ? -9.700  -7.390  0.448   1.00 0.00 ? 50  HIS A HB3  5  
ATOM 8474  H HD1  . HIS A 1 50  ? -10.934 -9.452  -0.063  1.00 0.00 ? 50  HIS A HD1  5  
ATOM 8475  H HD2  . HIS A 1 50  ? -13.494 -6.297  0.859   1.00 0.00 ? 50  HIS A HD2  5  
ATOM 8476  H HE1  . HIS A 1 50  ? -13.268 -10.365 -0.313  1.00 0.00 ? 50  HIS A HE1  5  
ATOM 8477  H HE2  . HIS A 1 50  ? -14.787 -8.385  0.040   1.00 0.00 ? 50  HIS A HE2  5  
ATOM 8478  N N    . PRO A 1 51  ? -11.117 -7.686  4.034   1.00 0.00 ? 51  PRO A N    5  
ATOM 8479  C CA   . PRO A 1 51  ? -10.992 -8.649  5.144   1.00 0.00 ? 51  PRO A CA   5  
ATOM 8480  C C    . PRO A 1 51  ? -10.522 -10.038 4.721   1.00 0.00 ? 51  PRO A C    5  
ATOM 8481  O O    . PRO A 1 51  ? -9.864  -10.733 5.492   1.00 0.00 ? 51  PRO A O    5  
ATOM 8482  C CB   . PRO A 1 51  ? -12.411 -8.723  5.705   1.00 0.00 ? 51  PRO A CB   5  
ATOM 8483  C CG   . PRO A 1 51  ? -13.002 -7.396  5.393   1.00 0.00 ? 51  PRO A CG   5  
ATOM 8484  C CD   . PRO A 1 51  ? -12.414 -6.982  4.073   1.00 0.00 ? 51  PRO A CD   5  
ATOM 8485  H HA   . PRO A 1 51  ? -10.329 -8.274  5.908   1.00 0.00 ? 51  PRO A HA   5  
ATOM 8486  H HB2  . PRO A 1 51  ? -12.951 -9.525  5.221   1.00 0.00 ? 51  PRO A HB2  5  
ATOM 8487  H HB3  . PRO A 1 51  ? -12.371 -8.898  6.770   1.00 0.00 ? 51  PRO A HB3  5  
ATOM 8488  H HG2  . PRO A 1 51  ? -14.077 -7.483  5.314   1.00 0.00 ? 51  PRO A HG2  5  
ATOM 8489  H HG3  . PRO A 1 51  ? -12.736 -6.686  6.160   1.00 0.00 ? 51  PRO A HG3  5  
ATOM 8490  H HD2  . PRO A 1 51  ? -13.050 -7.301  3.261   1.00 0.00 ? 51  PRO A HD2  5  
ATOM 8491  H HD3  . PRO A 1 51  ? -12.271 -5.912  4.043   1.00 0.00 ? 51  PRO A HD3  5  
ATOM 8492  N N    . GLU A 1 52  ? -10.849 -10.438 3.504   1.00 0.00 ? 52  GLU A N    5  
ATOM 8493  C CA   . GLU A 1 52  ? -10.473 -11.756 3.008   1.00 0.00 ? 52  GLU A CA   5  
ATOM 8494  C C    . GLU A 1 52  ? -9.115  -11.719 2.315   1.00 0.00 ? 52  GLU A C    5  
ATOM 8495  O O    . GLU A 1 52  ? -8.572  -12.752 1.930   1.00 0.00 ? 52  GLU A O    5  
ATOM 8496  C CB   . GLU A 1 52  ? -11.537 -12.282 2.051   1.00 0.00 ? 52  GLU A CB   5  
ATOM 8497  C CG   . GLU A 1 52  ? -12.904 -12.441 2.692   1.00 0.00 ? 52  GLU A CG   5  
ATOM 8498  C CD   . GLU A 1 52  ? -12.864 -13.316 3.927   1.00 0.00 ? 52  GLU A CD   5  
ATOM 8499  O OE1  . GLU A 1 52  ? -12.814 -14.553 3.782   1.00 0.00 ? 52  GLU A OE1  5  
ATOM 8500  O OE2  . GLU A 1 52  ? -12.873 -12.771 5.050   1.00 0.00 ? 52  GLU A OE2  5  
ATOM 8501  H H    . GLU A 1 52  ? -11.349 -9.837  2.916   1.00 0.00 ? 52  GLU A H    5  
ATOM 8502  H HA   . GLU A 1 52  ? -10.413 -12.420 3.854   1.00 0.00 ? 52  GLU A HA   5  
ATOM 8503  H HB2  . GLU A 1 52  ? -11.625 -11.595 1.228   1.00 0.00 ? 52  GLU A HB2  5  
ATOM 8504  H HB3  . GLU A 1 52  ? -11.222 -13.245 1.676   1.00 0.00 ? 52  GLU A HB3  5  
ATOM 8505  H HG2  . GLU A 1 52  ? -13.273 -11.466 2.971   1.00 0.00 ? 52  GLU A HG2  5  
ATOM 8506  H HG3  . GLU A 1 52  ? -13.575 -12.889 1.974   1.00 0.00 ? 52  GLU A HG3  5  
ATOM 8507  N N    . ASP A 1 53  ? -8.564  -10.521 2.175   1.00 0.00 ? 53  ASP A N    5  
ATOM 8508  C CA   . ASP A 1 53  ? -7.320  -10.317 1.444   1.00 0.00 ? 53  ASP A CA   5  
ATOM 8509  C C    . ASP A 1 53  ? -6.207  -10.015 2.435   1.00 0.00 ? 53  ASP A C    5  
ATOM 8510  O O    . ASP A 1 53  ? -5.037  -9.910  2.067   1.00 0.00 ? 53  ASP A O    5  
ATOM 8511  C CB   . ASP A 1 53  ? -7.441  -9.135  0.468   1.00 0.00 ? 53  ASP A CB   5  
ATOM 8512  C CG   . ASP A 1 53  ? -8.566  -9.264  -0.549  1.00 0.00 ? 53  ASP A CG   5  
ATOM 8513  O OD1  . ASP A 1 53  ? -9.461  -10.122 -0.372  1.00 0.00 ? 53  ASP A OD1  5  
ATOM 8514  O OD2  . ASP A 1 53  ? -8.586  -8.473  -1.512  1.00 0.00 ? 53  ASP A OD2  5  
ATOM 8515  H H    . ASP A 1 53  ? -8.975  -9.742  2.616   1.00 0.00 ? 53  ASP A H    5  
ATOM 8516  H HA   . ASP A 1 53  ? -7.084  -11.218 0.899   1.00 0.00 ? 53  ASP A HA   5  
ATOM 8517  H HB2  . ASP A 1 53  ? -7.611  -8.232  1.036   1.00 0.00 ? 53  ASP A HB2  5  
ATOM 8518  H HB3  . ASP A 1 53  ? -6.508  -9.036  -0.071  1.00 0.00 ? 53  ASP A HB3  5  
ATOM 8519  N N    . GLN A 1 54  ? -6.590  -9.879  3.701   1.00 0.00 ? 54  GLN A N    5  
ATOM 8520  C CA   . GLN A 1 54  ? -5.660  -9.494  4.759   1.00 0.00 ? 54  GLN A CA   5  
ATOM 8521  C C    . GLN A 1 54  ? -4.540  -10.513 4.911   1.00 0.00 ? 54  GLN A C    5  
ATOM 8522  O O    . GLN A 1 54  ? -3.377  -10.147 5.062   1.00 0.00 ? 54  GLN A O    5  
ATOM 8523  C CB   . GLN A 1 54  ? -6.401  -9.324  6.088   1.00 0.00 ? 54  GLN A CB   5  
ATOM 8524  C CG   . GLN A 1 54  ? -7.391  -8.170  6.087   1.00 0.00 ? 54  GLN A CG   5  
ATOM 8525  C CD   . GLN A 1 54  ? -8.117  -8.013  7.409   1.00 0.00 ? 54  GLN A CD   5  
ATOM 8526  O OE1  . GLN A 1 54  ? -8.358  -8.989  8.124   1.00 0.00 ? 54  GLN A OE1  5  
ATOM 8527  N NE2  . GLN A 1 54  ? -8.461  -6.781  7.745   1.00 0.00 ? 54  GLN A NE2  5  
ATOM 8528  H H    . GLN A 1 54  ? -7.528  -10.042 3.930   1.00 0.00 ? 54  GLN A H    5  
ATOM 8529  H HA   . GLN A 1 54  ? -5.227  -8.547  4.482   1.00 0.00 ? 54  GLN A HA   5  
ATOM 8530  H HB2  . GLN A 1 54  ? -6.941  -10.233 6.308   1.00 0.00 ? 54  GLN A HB2  5  
ATOM 8531  H HB3  . GLN A 1 54  ? -5.677  -9.148  6.870   1.00 0.00 ? 54  GLN A HB3  5  
ATOM 8532  H HG2  . GLN A 1 54  ? -6.855  -7.255  5.879   1.00 0.00 ? 54  GLN A HG2  5  
ATOM 8533  H HG3  . GLN A 1 54  ? -8.121  -8.343  5.310   1.00 0.00 ? 54  GLN A HG3  5  
ATOM 8534  H HE21 . GLN A 1 54  ? -8.231  -6.051  7.129   1.00 0.00 ? 54  GLN A HE21 5  
ATOM 8535  H HE22 . GLN A 1 54  ? -8.929  -6.642  8.598   1.00 0.00 ? 54  GLN A HE22 5  
ATOM 8536  N N    . GLN A 1 55  ? -4.888  -11.794 4.862   1.00 0.00 ? 55  GLN A N    5  
ATOM 8537  C CA   . GLN A 1 55  ? -3.892  -12.854 4.949   1.00 0.00 ? 55  GLN A CA   5  
ATOM 8538  C C    . GLN A 1 55  ? -3.019  -12.838 3.699   1.00 0.00 ? 55  GLN A C    5  
ATOM 8539  O O    . GLN A 1 55  ? -1.821  -13.086 3.768   1.00 0.00 ? 55  GLN A O    5  
ATOM 8540  C CB   . GLN A 1 55  ? -4.570  -14.216 5.089   1.00 0.00 ? 55  GLN A CB   5  
ATOM 8541  C CG   . GLN A 1 55  ? -3.860  -15.189 6.028   1.00 0.00 ? 55  GLN A CG   5  
ATOM 8542  C CD   . GLN A 1 55  ? -2.443  -15.529 5.600   1.00 0.00 ? 55  GLN A CD   5  
ATOM 8543  O OE1  . GLN A 1 55  ? -2.227  -16.456 4.821   1.00 0.00 ? 55  GLN A OE1  5  
ATOM 8544  N NE2  . GLN A 1 55  ? -1.468  -14.811 6.137   1.00 0.00 ? 55  GLN A NE2  5  
ATOM 8545  H H    . GLN A 1 55  ? -5.835  -12.031 4.772   1.00 0.00 ? 55  GLN A H    5  
ATOM 8546  H HA   . GLN A 1 55  ? -3.274  -12.669 5.815   1.00 0.00 ? 55  GLN A HA   5  
ATOM 8547  H HB2  . GLN A 1 55  ? -5.571  -14.063 5.458   1.00 0.00 ? 55  GLN A HB2  5  
ATOM 8548  H HB3  . GLN A 1 55  ? -4.624  -14.670 4.112   1.00 0.00 ? 55  GLN A HB3  5  
ATOM 8549  H HG2  . GLN A 1 55  ? -3.820  -14.751 7.012   1.00 0.00 ? 55  GLN A HG2  5  
ATOM 8550  H HG3  . GLN A 1 55  ? -4.433  -16.104 6.071   1.00 0.00 ? 55  GLN A HG3  5  
ATOM 8551  H HE21 . GLN A 1 55  ? -1.708  -14.110 6.777   1.00 0.00 ? 55  GLN A HE21 5  
ATOM 8552  H HE22 . GLN A 1 55  ? -0.545  -15.011 5.871   1.00 0.00 ? 55  GLN A HE22 5  
ATOM 8553  N N    . LEU A 1 56  ? -3.633  -12.527 2.563   1.00 0.00 ? 56  LEU A N    5  
ATOM 8554  C CA   . LEU A 1 56  ? -2.915  -12.439 1.301   1.00 0.00 ? 56  LEU A CA   5  
ATOM 8555  C C    . LEU A 1 56  ? -1.826  -11.377 1.389   1.00 0.00 ? 56  LEU A C    5  
ATOM 8556  O O    . LEU A 1 56  ? -0.664  -11.645 1.097   1.00 0.00 ? 56  LEU A O    5  
ATOM 8557  C CB   . LEU A 1 56  ? -3.888  -12.129 0.158   1.00 0.00 ? 56  LEU A CB   5  
ATOM 8558  C CG   . LEU A 1 56  ? -3.254  -11.983 -1.227  1.00 0.00 ? 56  LEU A CG   5  
ATOM 8559  C CD1  . LEU A 1 56  ? -2.549  -13.267 -1.636  1.00 0.00 ? 56  LEU A CD1  5  
ATOM 8560  C CD2  . LEU A 1 56  ? -4.312  -11.607 -2.251  1.00 0.00 ? 56  LEU A CD2  5  
ATOM 8561  H H    . LEU A 1 56  ? -4.596  -12.349 2.576   1.00 0.00 ? 56  LEU A H    5  
ATOM 8562  H HA   . LEU A 1 56  ? -2.452  -13.395 1.118   1.00 0.00 ? 56  LEU A HA   5  
ATOM 8563  H HB2  . LEU A 1 56  ? -4.618  -12.923 0.113   1.00 0.00 ? 56  LEU A HB2  5  
ATOM 8564  H HB3  . LEU A 1 56  ? -4.400  -11.207 0.393   1.00 0.00 ? 56  LEU A HB3  5  
ATOM 8565  H HG   . LEU A 1 56  ? -2.520  -11.191 -1.196  1.00 0.00 ? 56  LEU A HG   5  
ATOM 8566  H HD11 . LEU A 1 56  ? -1.774  -13.496 -0.918  1.00 0.00 ? 56  LEU A HD11 5  
ATOM 8567  H HD12 . LEU A 1 56  ? -2.109  -13.138 -2.613  1.00 0.00 ? 56  LEU A HD12 5  
ATOM 8568  H HD13 . LEU A 1 56  ? -3.264  -14.076 -1.665  1.00 0.00 ? 56  LEU A HD13 5  
ATOM 8569  H HD21 . LEU A 1 56  ? -5.056  -12.390 -2.305  1.00 0.00 ? 56  LEU A HD21 5  
ATOM 8570  H HD22 . LEU A 1 56  ? -3.848  -11.485 -3.220  1.00 0.00 ? 56  LEU A HD22 5  
ATOM 8571  H HD23 . LEU A 1 56  ? -4.784  -10.681 -1.959  1.00 0.00 ? 56  LEU A HD23 5  
ATOM 8572  N N    . LEU A 1 57  ? -2.204  -10.182 1.821   1.00 0.00 ? 57  LEU A N    5  
ATOM 8573  C CA   . LEU A 1 57  ? -1.236  -9.112  2.033   1.00 0.00 ? 57  LEU A CA   5  
ATOM 8574  C C    . LEU A 1 57  ? -0.231  -9.494  3.106   1.00 0.00 ? 57  LEU A C    5  
ATOM 8575  O O    . LEU A 1 57  ? 0.966   -9.294  2.930   1.00 0.00 ? 57  LEU A O    5  
ATOM 8576  C CB   . LEU A 1 57  ? -1.922  -7.802  2.421   1.00 0.00 ? 57  LEU A CB   5  
ATOM 8577  C CG   . LEU A 1 57  ? -2.443  -6.960  1.259   1.00 0.00 ? 57  LEU A CG   5  
ATOM 8578  C CD1  . LEU A 1 57  ? -2.948  -5.624  1.769   1.00 0.00 ? 57  LEU A CD1  5  
ATOM 8579  C CD2  . LEU A 1 57  ? -1.352  -6.745  0.227   1.00 0.00 ? 57  LEU A CD2  5  
ATOM 8580  H H    . LEU A 1 57  ? -3.157  -10.015 1.992   1.00 0.00 ? 57  LEU A H    5  
ATOM 8581  H HA   . LEU A 1 57  ? -0.702  -8.966  1.106   1.00 0.00 ? 57  LEU A HA   5  
ATOM 8582  H HB2  . LEU A 1 57  ? -2.755  -8.036  3.068   1.00 0.00 ? 57  LEU A HB2  5  
ATOM 8583  H HB3  . LEU A 1 57  ? -1.215  -7.205  2.978   1.00 0.00 ? 57  LEU A HB3  5  
ATOM 8584  H HG   . LEU A 1 57  ? -3.266  -7.474  0.778   1.00 0.00 ? 57  LEU A HG   5  
ATOM 8585  H HD11 . LEU A 1 57  ? -3.326  -5.041  0.942   1.00 0.00 ? 57  LEU A HD11 5  
ATOM 8586  H HD12 . LEU A 1 57  ? -2.136  -5.092  2.244   1.00 0.00 ? 57  LEU A HD12 5  
ATOM 8587  H HD13 . LEU A 1 57  ? -3.738  -5.786  2.487   1.00 0.00 ? 57  LEU A HD13 5  
ATOM 8588  H HD21 . LEU A 1 57  ? -0.503  -6.271  0.696   1.00 0.00 ? 57  LEU A HD21 5  
ATOM 8589  H HD22 . LEU A 1 57  ? -1.725  -6.111  -0.566  1.00 0.00 ? 57  LEU A HD22 5  
ATOM 8590  H HD23 . LEU A 1 57  ? -1.051  -7.696  -0.184  1.00 0.00 ? 57  LEU A HD23 5  
ATOM 8591  N N    . ARG A 1 58  ? -0.717  -10.060 4.203   1.00 0.00 ? 58  ARG A N    5  
ATOM 8592  C CA   . ARG A 1 58  ? 0.148   -10.443 5.311   1.00 0.00 ? 58  ARG A CA   5  
ATOM 8593  C C    . ARG A 1 58  ? 1.237   -11.391 4.830   1.00 0.00 ? 58  ARG A C    5  
ATOM 8594  O O    . ARG A 1 58  ? 2.418   -11.172 5.083   1.00 0.00 ? 58  ARG A O    5  
ATOM 8595  C CB   . ARG A 1 58  ? -0.674  -11.100 6.419   1.00 0.00 ? 58  ARG A CB   5  
ATOM 8596  C CG   . ARG A 1 58  ? 0.145   -11.489 7.638   1.00 0.00 ? 58  ARG A CG   5  
ATOM 8597  C CD   . ARG A 1 58  ? -0.727  -12.125 8.705   1.00 0.00 ? 58  ARG A CD   5  
ATOM 8598  N NE   . ARG A 1 58  ? 0.041   -12.492 9.890   1.00 0.00 ? 58  ARG A NE   5  
ATOM 8599  C CZ   . ARG A 1 58  ? -0.499  -12.811 11.063  1.00 0.00 ? 58  ARG A CZ   5  
ATOM 8600  N NH1  . ARG A 1 58  ? -1.818  -12.851 11.207  1.00 0.00 ? 58  ARG A NH1  5  
ATOM 8601  N NH2  . ARG A 1 58  ? 0.286   -13.096 12.091  1.00 0.00 ? 58  ARG A NH2  5  
ATOM 8602  H H    . ARG A 1 58  ? -1.687  -10.231 4.269   1.00 0.00 ? 58  ARG A H    5  
ATOM 8603  H HA   . ARG A 1 58  ? 0.610   -9.548  5.697   1.00 0.00 ? 58  ARG A HA   5  
ATOM 8604  H HB2  . ARG A 1 58  ? -1.444  -10.411 6.736   1.00 0.00 ? 58  ARG A HB2  5  
ATOM 8605  H HB3  . ARG A 1 58  ? -1.141  -11.992 6.027   1.00 0.00 ? 58  ARG A HB3  5  
ATOM 8606  H HG2  . ARG A 1 58  ? 0.905   -12.195 7.339   1.00 0.00 ? 58  ARG A HG2  5  
ATOM 8607  H HG3  . ARG A 1 58  ? 0.611   -10.604 8.046   1.00 0.00 ? 58  ARG A HG3  5  
ATOM 8608  H HD2  . ARG A 1 58  ? -1.493  -11.418 8.991   1.00 0.00 ? 58  ARG A HD2  5  
ATOM 8609  H HD3  . ARG A 1 58  ? -1.190  -13.010 8.293   1.00 0.00 ? 58  ARG A HD3  5  
ATOM 8610  H HE   . ARG A 1 58  ? 1.029   -12.493 9.808   1.00 0.00 ? 58  ARG A HE   5  
ATOM 8611  H HH11 . ARG A 1 58  ? -2.420  -12.644 10.429  1.00 0.00 ? 58  ARG A HH11 5  
ATOM 8612  H HH12 . ARG A 1 58  ? -2.226  -13.087 12.101  1.00 0.00 ? 58  ARG A HH12 5  
ATOM 8613  H HH21 . ARG A 1 58  ? 1.286   -13.073 11.983  1.00 0.00 ? 58  ARG A HH21 5  
ATOM 8614  H HH22 . ARG A 1 58  ? -0.111  -13.321 12.989  1.00 0.00 ? 58  ARG A HH22 5  
ATOM 8615  N N    . ASP A 1 59  ? 0.832   -12.424 4.107   1.00 0.00 ? 59  ASP A N    5  
ATOM 8616  C CA   . ASP A 1 59  ? 1.765   -13.420 3.604   1.00 0.00 ? 59  ASP A CA   5  
ATOM 8617  C C    . ASP A 1 59  ? 2.679   -12.817 2.546   1.00 0.00 ? 59  ASP A C    5  
ATOM 8618  O O    . ASP A 1 59  ? 3.871   -13.102 2.522   1.00 0.00 ? 59  ASP A O    5  
ATOM 8619  C CB   . ASP A 1 59  ? 1.010   -14.613 3.018   1.00 0.00 ? 59  ASP A CB   5  
ATOM 8620  C CG   . ASP A 1 59  ? 1.930   -15.755 2.639   1.00 0.00 ? 59  ASP A CG   5  
ATOM 8621  O OD1  . ASP A 1 59  ? 2.258   -16.568 3.530   1.00 0.00 ? 59  ASP A OD1  5  
ATOM 8622  O OD2  . ASP A 1 59  ? 2.314   -15.855 1.459   1.00 0.00 ? 59  ASP A OD2  5  
ATOM 8623  H H    . ASP A 1 59  ? -0.127  -12.522 3.905   1.00 0.00 ? 59  ASP A H    5  
ATOM 8624  H HA   . ASP A 1 59  ? 2.368   -13.758 4.433   1.00 0.00 ? 59  ASP A HA   5  
ATOM 8625  H HB2  . ASP A 1 59  ? 0.305   -14.977 3.749   1.00 0.00 ? 59  ASP A HB2  5  
ATOM 8626  H HB3  . ASP A 1 59  ? 0.475   -14.296 2.135   1.00 0.00 ? 59  ASP A HB3  5  
ATOM 8627  N N    . SER A 1 60  ? 2.120   -11.958 1.702   1.00 0.00 ? 60  SER A N    5  
ATOM 8628  C CA   . SER A 1 60  ? 2.868   -11.354 0.603   1.00 0.00 ? 60  SER A CA   5  
ATOM 8629  C C    . SER A 1 60  ? 3.957   -10.444 1.144   1.00 0.00 ? 60  SER A C    5  
ATOM 8630  O O    . SER A 1 60  ? 5.079   -10.403 0.635   1.00 0.00 ? 60  SER A O    5  
ATOM 8631  C CB   . SER A 1 60  ? 1.925   -10.565 -0.301  1.00 0.00 ? 60  SER A CB   5  
ATOM 8632  O OG   . SER A 1 60  ? 1.551   -9.326  0.279   1.00 0.00 ? 60  SER A OG   5  
ATOM 8633  H H    . SER A 1 60  ? 1.175   -11.727 1.817   1.00 0.00 ? 60  SER A H    5  
ATOM 8634  H HA   . SER A 1 60  ? 3.326   -12.150 0.031   1.00 0.00 ? 60  SER A HA   5  
ATOM 8635  H HB2  . SER A 1 60  ? 2.404   -10.378 -1.250  1.00 0.00 ? 60  SER A HB2  5  
ATOM 8636  H HB3  . SER A 1 60  ? 1.037   -11.146 -0.454  1.00 0.00 ? 60  SER A HB3  5  
ATOM 8637  H HG   . SER A 1 60  ? 1.218   -9.474  1.169   1.00 0.00 ? 60  SER A HG   5  
ATOM 8638  N N    . PHE A 1 61  ? 3.608   -9.717  2.189   1.00 0.00 ? 61  PHE A N    5  
ATOM 8639  C CA   . PHE A 1 61  ? 4.560   -8.863  2.876   1.00 0.00 ? 61  PHE A CA   5  
ATOM 8640  C C    . PHE A 1 61  ? 5.648   -9.714  3.516   1.00 0.00 ? 61  PHE A C    5  
ATOM 8641  O O    . PHE A 1 61  ? 6.819   -9.349  3.514   1.00 0.00 ? 61  PHE A O    5  
ATOM 8642  C CB   . PHE A 1 61  ? 3.862   -7.995  3.931   1.00 0.00 ? 61  PHE A CB   5  
ATOM 8643  C CG   . PHE A 1 61  ? 3.027   -6.882  3.352   1.00 0.00 ? 61  PHE A CG   5  
ATOM 8644  C CD1  . PHE A 1 61  ? 3.425   -6.225  2.198   1.00 0.00 ? 61  PHE A CD1  5  
ATOM 8645  C CD2  . PHE A 1 61  ? 1.844   -6.489  3.966   1.00 0.00 ? 61  PHE A CD2  5  
ATOM 8646  C CE1  . PHE A 1 61  ? 2.663   -5.203  1.666   1.00 0.00 ? 61  PHE A CE1  5  
ATOM 8647  C CE2  . PHE A 1 61  ? 1.078   -5.468  3.437   1.00 0.00 ? 61  PHE A CE2  5  
ATOM 8648  C CZ   . PHE A 1 61  ? 1.488   -4.824  2.286   1.00 0.00 ? 61  PHE A CZ   5  
ATOM 8649  H H    . PHE A 1 61  ? 2.673   -9.752  2.495   1.00 0.00 ? 61  PHE A H    5  
ATOM 8650  H HA   . PHE A 1 61  ? 5.016   -8.220  2.138   1.00 0.00 ? 61  PHE A HA   5  
ATOM 8651  H HB2  . PHE A 1 61  ? 3.209   -8.620  4.523   1.00 0.00 ? 61  PHE A HB2  5  
ATOM 8652  H HB3  . PHE A 1 61  ? 4.605   -7.555  4.572   1.00 0.00 ? 61  PHE A HB3  5  
ATOM 8653  H HD1  . PHE A 1 61  ? 4.342   -6.519  1.711   1.00 0.00 ? 61  PHE A HD1  5  
ATOM 8654  H HD2  . PHE A 1 61  ? 1.520   -6.993  4.865   1.00 0.00 ? 61  PHE A HD2  5  
ATOM 8655  H HE1  . PHE A 1 61  ? 2.984   -4.701  0.766   1.00 0.00 ? 61  PHE A HE1  5  
ATOM 8656  H HE2  . PHE A 1 61  ? 0.159   -5.170  3.925   1.00 0.00 ? 61  PHE A HE2  5  
ATOM 8657  H HZ   . PHE A 1 61  ? 0.891   -4.026  1.872   1.00 0.00 ? 61  PHE A HZ   5  
ATOM 8658  N N    . GLN A 1 62  ? 5.254   -10.876 4.019   1.00 0.00 ? 62  GLN A N    5  
ATOM 8659  C CA   . GLN A 1 62  ? 6.201   -11.823 4.582   1.00 0.00 ? 62  GLN A CA   5  
ATOM 8660  C C    . GLN A 1 62  ? 7.122   -12.333 3.484   1.00 0.00 ? 62  GLN A C    5  
ATOM 8661  O O    . GLN A 1 62  ? 8.309   -12.577 3.708   1.00 0.00 ? 62  GLN A O    5  
ATOM 8662  C CB   . GLN A 1 62  ? 5.464   -12.998 5.229   1.00 0.00 ? 62  GLN A CB   5  
ATOM 8663  C CG   . GLN A 1 62  ? 4.637   -12.620 6.449   1.00 0.00 ? 62  GLN A CG   5  
ATOM 8664  C CD   . GLN A 1 62  ? 5.476   -12.090 7.593   1.00 0.00 ? 62  GLN A CD   5  
ATOM 8665  O OE1  . GLN A 1 62  ? 5.709   -10.887 7.703   1.00 0.00 ? 62  GLN A OE1  5  
ATOM 8666  N NE2  . GLN A 1 62  ? 5.931   -12.984 8.456   1.00 0.00 ? 62  GLN A NE2  5  
ATOM 8667  H H    . GLN A 1 62  ? 4.304   -11.109 3.999   1.00 0.00 ? 62  GLN A H    5  
ATOM 8668  H HA   . GLN A 1 62  ? 6.790   -11.312 5.329   1.00 0.00 ? 62  GLN A HA   5  
ATOM 8669  H HB2  . GLN A 1 62  ? 4.802   -13.435 4.496   1.00 0.00 ? 62  GLN A HB2  5  
ATOM 8670  H HB3  . GLN A 1 62  ? 6.187   -13.735 5.526   1.00 0.00 ? 62  GLN A HB3  5  
ATOM 8671  H HG2  . GLN A 1 62  ? 3.925   -11.859 6.162   1.00 0.00 ? 62  GLN A HG2  5  
ATOM 8672  H HG3  . GLN A 1 62  ? 4.103   -13.496 6.787   1.00 0.00 ? 62  GLN A HG3  5  
ATOM 8673  H HE21 . GLN A 1 62  ? 5.700   -13.926 8.312   1.00 0.00 ? 62  GLN A HE21 5  
ATOM 8674  H HE22 . GLN A 1 62  ? 6.489   -12.669 9.200   1.00 0.00 ? 62  GLN A HE22 5  
ATOM 8675  N N    . GLN A 1 63  ? 6.557   -12.479 2.288   1.00 0.00 ? 63  GLN A N    5  
ATOM 8676  C CA   . GLN A 1 63  ? 7.310   -12.927 1.133   1.00 0.00 ? 63  GLN A CA   5  
ATOM 8677  C C    . GLN A 1 63  ? 8.418   -11.940 0.806   1.00 0.00 ? 63  GLN A C    5  
ATOM 8678  O O    . GLN A 1 63  ? 9.569   -12.322 0.684   1.00 0.00 ? 63  GLN A O    5  
ATOM 8679  C CB   . GLN A 1 63  ? 6.417   -13.099 -0.091  1.00 0.00 ? 63  GLN A CB   5  
ATOM 8680  C CG   . GLN A 1 63  ? 5.272   -14.065 0.116   1.00 0.00 ? 63  GLN A CG   5  
ATOM 8681  C CD   . GLN A 1 63  ? 5.705   -15.449 0.549   1.00 0.00 ? 63  GLN A CD   5  
ATOM 8682  O OE1  . GLN A 1 63  ? 6.014   -16.308 -0.279  1.00 0.00 ? 63  GLN A OE1  5  
ATOM 8683  N NE2  . GLN A 1 63  ? 5.696   -15.684 1.851   1.00 0.00 ? 63  GLN A NE2  5  
ATOM 8684  H H    . GLN A 1 63  ? 5.597   -12.287 2.186   1.00 0.00 ? 63  GLN A H    5  
ATOM 8685  H HA   . GLN A 1 63  ? 7.739   -13.882 1.377   1.00 0.00 ? 63  GLN A HA   5  
ATOM 8686  H HB2  . GLN A 1 63  ? 6.004   -12.139 -0.356  1.00 0.00 ? 63  GLN A HB2  5  
ATOM 8687  H HB3  . GLN A 1 63  ? 7.019   -13.459 -0.908  1.00 0.00 ? 63  GLN A HB3  5  
ATOM 8688  H HG2  . GLN A 1 63  ? 4.640   -13.662 0.885   1.00 0.00 ? 63  GLN A HG2  5  
ATOM 8689  H HG3  . GLN A 1 63  ? 4.715   -14.146 -0.803  1.00 0.00 ? 63  GLN A HG3  5  
ATOM 8690  H HE21 . GLN A 1 63  ? 5.417   -14.957 2.449   1.00 0.00 ? 63  GLN A HE21 5  
ATOM 8691  H HE22 . GLN A 1 63  ? 5.939   -16.582 2.166   1.00 0.00 ? 63  GLN A HE22 5  
ATOM 8692  N N    . VAL A 1 64  ? 8.068   -10.664 0.688   1.00 0.00 ? 64  VAL A N    5  
ATOM 8693  C CA   . VAL A 1 64  ? 9.043   -9.652  0.297   1.00 0.00 ? 64  VAL A CA   5  
ATOM 8694  C C    . VAL A 1 64  ? 10.114  -9.455  1.376   1.00 0.00 ? 64  VAL A C    5  
ATOM 8695  O O    . VAL A 1 64  ? 11.211  -8.971  1.092   1.00 0.00 ? 64  VAL A O    5  
ATOM 8696  C CB   . VAL A 1 64  ? 8.379   -8.298  -0.052  1.00 0.00 ? 64  VAL A CB   5  
ATOM 8697  C CG1  . VAL A 1 64  ? 7.844   -7.594  1.182   1.00 0.00 ? 64  VAL A CG1  5  
ATOM 8698  C CG2  . VAL A 1 64  ? 9.353   -7.404  -0.804  1.00 0.00 ? 64  VAL A CG2  5  
ATOM 8699  H H    . VAL A 1 64  ? 7.134   -10.404 0.854   1.00 0.00 ? 64  VAL A H    5  
ATOM 8700  H HA   . VAL A 1 64  ? 9.533   -10.015 -0.595  1.00 0.00 ? 64  VAL A HA   5  
ATOM 8701  H HB   . VAL A 1 64  ? 7.543   -8.497  -0.708  1.00 0.00 ? 64  VAL A HB   5  
ATOM 8702  H HG11 . VAL A 1 64  ? 8.647   -7.443  1.887   1.00 0.00 ? 64  VAL A HG11 5  
ATOM 8703  H HG12 . VAL A 1 64  ? 7.073   -8.196  1.635   1.00 0.00 ? 64  VAL A HG12 5  
ATOM 8704  H HG13 . VAL A 1 64  ? 7.433   -6.636  0.897   1.00 0.00 ? 64  VAL A HG13 5  
ATOM 8705  H HG21 . VAL A 1 64  ? 8.875   -6.462  -1.029  1.00 0.00 ? 64  VAL A HG21 5  
ATOM 8706  H HG22 . VAL A 1 64  ? 9.650   -7.888  -1.722  1.00 0.00 ? 64  VAL A HG22 5  
ATOM 8707  H HG23 . VAL A 1 64  ? 10.225  -7.228  -0.190  1.00 0.00 ? 64  VAL A HG23 5  
ATOM 8708  N N    . VAL A 1 65  ? 9.803   -9.845  2.611   1.00 0.00 ? 65  VAL A N    5  
ATOM 8709  C CA   . VAL A 1 65  ? 10.781  -9.776  3.690   1.00 0.00 ? 65  VAL A CA   5  
ATOM 8710  C C    . VAL A 1 65  ? 11.867  -10.816 3.470   1.00 0.00 ? 65  VAL A C    5  
ATOM 8711  O O    . VAL A 1 65  ? 13.049  -10.547 3.647   1.00 0.00 ? 65  VAL A O    5  
ATOM 8712  C CB   . VAL A 1 65  ? 10.128  -10.001 5.073   1.00 0.00 ? 65  VAL A CB   5  
ATOM 8713  C CG1  . VAL A 1 65  ? 11.181  -10.078 6.168   1.00 0.00 ? 65  VAL A CG1  5  
ATOM 8714  C CG2  . VAL A 1 65  ? 9.137   -8.893  5.380   1.00 0.00 ? 65  VAL A CG2  5  
ATOM 8715  H H    . VAL A 1 65  ? 8.902   -10.185 2.803   1.00 0.00 ? 65  VAL A H    5  
ATOM 8716  H HA   . VAL A 1 65  ? 11.226  -8.791  3.679   1.00 0.00 ? 65  VAL A HA   5  
ATOM 8717  H HB   . VAL A 1 65  ? 9.593   -10.941 5.047   1.00 0.00 ? 65  VAL A HB   5  
ATOM 8718  H HG11 . VAL A 1 65  ? 11.750  -9.162  6.184   1.00 0.00 ? 65  VAL A HG11 5  
ATOM 8719  H HG12 . VAL A 1 65  ? 11.842  -10.911 5.976   1.00 0.00 ? 65  VAL A HG12 5  
ATOM 8720  H HG13 . VAL A 1 65  ? 10.696  -10.218 7.124   1.00 0.00 ? 65  VAL A HG13 5  
ATOM 8721  H HG21 . VAL A 1 65  ? 8.364   -8.881  4.628   1.00 0.00 ? 65  VAL A HG21 5  
ATOM 8722  H HG22 . VAL A 1 65  ? 9.653   -7.942  5.383   1.00 0.00 ? 65  VAL A HG22 5  
ATOM 8723  H HG23 . VAL A 1 65  ? 8.693   -9.065  6.352   1.00 0.00 ? 65  VAL A HG23 5  
ATOM 8724  N N    . LYS A 1 66  ? 11.454  -12.007 3.076   1.00 0.00 ? 66  LYS A N    5  
ATOM 8725  C CA   . LYS A 1 66  ? 12.386  -13.078 2.807   1.00 0.00 ? 66  LYS A CA   5  
ATOM 8726  C C    . LYS A 1 66  ? 12.920  -13.013 1.372   1.00 0.00 ? 66  LYS A C    5  
ATOM 8727  O O    . LYS A 1 66  ? 13.955  -13.596 1.056   1.00 0.00 ? 66  LYS A O    5  
ATOM 8728  C CB   . LYS A 1 66  ? 11.717  -14.396 3.110   1.00 0.00 ? 66  LYS A CB   5  
ATOM 8729  C CG   . LYS A 1 66  ? 10.536  -14.643 2.243   1.00 0.00 ? 66  LYS A CG   5  
ATOM 8730  C CD   . LYS A 1 66  ? 9.704   -15.816 2.729   1.00 0.00 ? 66  LYS A CD   5  
ATOM 8731  C CE   . LYS A 1 66  ? 10.490  -17.123 2.746   1.00 0.00 ? 66  LYS A CE   5  
ATOM 8732  N NZ   . LYS A 1 66  ? 10.762  -17.641 1.378   1.00 0.00 ? 66  LYS A NZ   5  
ATOM 8733  H H    . LYS A 1 66  ? 10.493  -12.178 2.983   1.00 0.00 ? 66  LYS A H    5  
ATOM 8734  H HA   . LYS A 1 66  ? 13.192  -12.971 3.469   1.00 0.00 ? 66  LYS A HA   5  
ATOM 8735  H HB2  . LYS A 1 66  ? 12.422  -15.190 2.965   1.00 0.00 ? 66  LYS A HB2  5  
ATOM 8736  H HB3  . LYS A 1 66  ? 11.385  -14.387 4.133   1.00 0.00 ? 66  LYS A HB3  5  
ATOM 8737  H HG2  . LYS A 1 66  ? 9.933   -13.752 2.245   1.00 0.00 ? 66  LYS A HG2  5  
ATOM 8738  H HG3  . LYS A 1 66  ? 10.893  -14.825 1.255   1.00 0.00 ? 66  LYS A HG3  5  
ATOM 8739  H HD2  . LYS A 1 66  ? 9.369   -15.603 3.731   1.00 0.00 ? 66  LYS A HD2  5  
ATOM 8740  H HD3  . LYS A 1 66  ? 8.850   -15.929 2.079   1.00 0.00 ? 66  LYS A HD3  5  
ATOM 8741  H HE2  . LYS A 1 66  ? 11.431  -16.954 3.246   1.00 0.00 ? 66  LYS A HE2  5  
ATOM 8742  H HE3  . LYS A 1 66  ? 9.921   -17.859 3.293   1.00 0.00 ? 66  LYS A HE3  5  
ATOM 8743  H HZ1  . LYS A 1 66  ? 11.159  -18.604 1.433   1.00 0.00 ? 66  LYS A HZ1  5  
ATOM 8744  H HZ2  . LYS A 1 66  ? 11.448  -17.030 0.885   1.00 0.00 ? 66  LYS A HZ2  5  
ATOM 8745  H HZ3  . LYS A 1 66  ? 9.877   -17.676 0.823   1.00 0.00 ? 66  LYS A HZ3  5  
ATOM 8746  N N    . LEU A 1 67  ? 12.208  -12.287 0.518   1.00 0.00 ? 67  LEU A N    5  
ATOM 8747  C CA   . LEU A 1 67  ? 12.631  -12.046 -0.864  1.00 0.00 ? 67  LEU A CA   5  
ATOM 8748  C C    . LEU A 1 67  ? 13.383  -10.725 -0.989  1.00 0.00 ? 67  LEU A C    5  
ATOM 8749  O O    . LEU A 1 67  ? 13.307  -10.067 -2.025  1.00 0.00 ? 67  LEU A O    5  
ATOM 8750  C CB   . LEU A 1 67  ? 11.435  -12.049 -1.826  1.00 0.00 ? 67  LEU A CB   5  
ATOM 8751  C CG   . LEU A 1 67  ? 10.682  -13.378 -1.933  1.00 0.00 ? 67  LEU A CG   5  
ATOM 8752  C CD1  . LEU A 1 67  ? 9.644   -13.301 -3.037  1.00 0.00 ? 67  LEU A CD1  5  
ATOM 8753  C CD2  . LEU A 1 67  ? 11.646  -14.531 -2.182  1.00 0.00 ? 67  LEU A CD2  5  
ATOM 8754  H H    . LEU A 1 67  ? 11.344  -11.926 0.815   1.00 0.00 ? 67  LEU A H    5  
ATOM 8755  H HA   . LEU A 1 67  ? 13.300  -12.847 -1.141  1.00 0.00 ? 67  LEU A HA   5  
ATOM 8756  H HB2  . LEU A 1 67  ? 10.735  -11.284 -1.507  1.00 0.00 ? 67  LEU A HB2  5  
ATOM 8757  H HB3  . LEU A 1 67  ? 11.798  -11.789 -2.810  1.00 0.00 ? 67  LEU A HB3  5  
ATOM 8758  H HG   . LEU A 1 67  ? 10.166  -13.565 -1.003  1.00 0.00 ? 67  LEU A HG   5  
ATOM 8759  H HD11 . LEU A 1 67  ? 9.161   -14.261 -3.145  1.00 0.00 ? 67  LEU A HD11 5  
ATOM 8760  H HD12 . LEU A 1 67  ? 10.125  -13.032 -3.965  1.00 0.00 ? 67  LEU A HD12 5  
ATOM 8761  H HD13 . LEU A 1 67  ? 8.907   -12.553 -2.786  1.00 0.00 ? 67  LEU A HD13 5  
ATOM 8762  H HD21 . LEU A 1 67  ? 11.094  -15.456 -2.240  1.00 0.00 ? 67  LEU A HD21 5  
ATOM 8763  H HD22 . LEU A 1 67  ? 12.359  -14.585 -1.372  1.00 0.00 ? 67  LEU A HD22 5  
ATOM 8764  H HD23 . LEU A 1 67  ? 12.171  -14.367 -3.112  1.00 0.00 ? 67  LEU A HD23 5  
ATOM 8765  N N    . LYS A 1 68  ? 14.059  -10.338 0.092   1.00 0.00 ? 68  LYS A N    5  
ATOM 8766  C CA   . LYS A 1 68  ? 14.843  -9.096  0.169   1.00 0.00 ? 68  LYS A CA   5  
ATOM 8767  C C    . LYS A 1 68  ? 15.420  -8.649  -1.169  1.00 0.00 ? 68  LYS A C    5  
ATOM 8768  O O    . LYS A 1 68  ? 16.334  -9.274  -1.714  1.00 0.00 ? 68  LYS A O    5  
ATOM 8769  C CB   . LYS A 1 68  ? 15.985  -9.276  1.160   1.00 0.00 ? 68  LYS A CB   5  
ATOM 8770  C CG   . LYS A 1 68  ? 15.518  -9.375  2.591   1.00 0.00 ? 68  LYS A CG   5  
ATOM 8771  C CD   . LYS A 1 68  ? 16.595  -9.944  3.489   1.00 0.00 ? 68  LYS A CD   5  
ATOM 8772  C CE   . LYS A 1 68  ? 16.076  -10.111 4.902   1.00 0.00 ? 68  LYS A CE   5  
ATOM 8773  N NZ   . LYS A 1 68  ? 16.976  -10.956 5.725   1.00 0.00 ? 68  LYS A NZ   5  
ATOM 8774  H H    . LYS A 1 68  ? 14.025  -10.912 0.885   1.00 0.00 ? 68  LYS A H    5  
ATOM 8775  H HA   . LYS A 1 68  ? 14.190  -8.319  0.538   1.00 0.00 ? 68  LYS A HA   5  
ATOM 8776  H HB2  . LYS A 1 68  ? 16.523  -10.179 0.912   1.00 0.00 ? 68  LYS A HB2  5  
ATOM 8777  H HB3  . LYS A 1 68  ? 16.655  -8.432  1.079   1.00 0.00 ? 68  LYS A HB3  5  
ATOM 8778  H HG2  . LYS A 1 68  ? 15.255  -8.390  2.943   1.00 0.00 ? 68  LYS A HG2  5  
ATOM 8779  H HG3  . LYS A 1 68  ? 14.652  -10.019 2.632   1.00 0.00 ? 68  LYS A HG3  5  
ATOM 8780  H HD2  . LYS A 1 68  ? 16.902  -10.907 3.108   1.00 0.00 ? 68  LYS A HD2  5  
ATOM 8781  H HD3  . LYS A 1 68  ? 17.438  -9.269  3.500   1.00 0.00 ? 68  LYS A HD3  5  
ATOM 8782  H HE2  . LYS A 1 68  ? 15.990  -9.137  5.356   1.00 0.00 ? 68  LYS A HE2  5  
ATOM 8783  H HE3  . LYS A 1 68  ? 15.100  -10.574 4.855   1.00 0.00 ? 68  LYS A HE3  5  
ATOM 8784  H HZ1  . LYS A 1 68  ? 17.930  -10.536 5.766   1.00 0.00 ? 68  LYS A HZ1  5  
ATOM 8785  H HZ2  . LYS A 1 68  ? 17.049  -11.910 5.311   1.00 0.00 ? 68  LYS A HZ2  5  
ATOM 8786  H HZ3  . LYS A 1 68  ? 16.604  -11.039 6.695   1.00 0.00 ? 68  LYS A HZ3  5  
ATOM 8787  N N    . GLY A 1 69  ? 14.868  -7.562  -1.684  1.00 0.00 ? 69  GLY A N    5  
ATOM 8788  C CA   . GLY A 1 69  ? 15.378  -6.965  -2.902  1.00 0.00 ? 69  GLY A CA   5  
ATOM 8789  C C    . GLY A 1 69  ? 14.468  -7.194  -4.089  1.00 0.00 ? 69  GLY A C    5  
ATOM 8790  O O    . GLY A 1 69  ? 14.549  -6.477  -5.088  1.00 0.00 ? 69  GLY A O    5  
ATOM 8791  H H    . GLY A 1 69  ? 14.096  -7.163  -1.229  1.00 0.00 ? 69  GLY A H    5  
ATOM 8792  H HA2  . GLY A 1 69  ? 15.487  -5.901  -2.749  1.00 0.00 ? 69  GLY A HA2  5  
ATOM 8793  H HA3  . GLY A 1 69  ? 16.349  -7.388  -3.118  1.00 0.00 ? 69  GLY A HA3  5  
ATOM 8794  N N    . GLN A 1 70  ? 13.595  -8.182  -3.982  1.00 0.00 ? 70  GLN A N    5  
ATOM 8795  C CA   . GLN A 1 70  ? 12.712  -8.540  -5.078  1.00 0.00 ? 70  GLN A CA   5  
ATOM 8796  C C    . GLN A 1 70  ? 11.361  -7.860  -4.927  1.00 0.00 ? 70  GLN A C    5  
ATOM 8797  O O    . GLN A 1 70  ? 10.828  -7.755  -3.822  1.00 0.00 ? 70  GLN A O    5  
ATOM 8798  C CB   . GLN A 1 70  ? 12.530  -10.056 -5.135  1.00 0.00 ? 70  GLN A CB   5  
ATOM 8799  C CG   . GLN A 1 70  ? 13.831  -10.810 -5.316  1.00 0.00 ? 70  GLN A CG   5  
ATOM 8800  C CD   . GLN A 1 70  ? 13.629  -12.299 -5.518  1.00 0.00 ? 70  GLN A CD   5  
ATOM 8801  O OE1  . GLN A 1 70  ? 12.669  -12.883 -5.020  1.00 0.00 ? 70  GLN A OE1  5  
ATOM 8802  N NE2  . GLN A 1 70  ? 14.540  -12.924 -6.251  1.00 0.00 ? 70  GLN A NE2  5  
ATOM 8803  H H    . GLN A 1 70  ? 13.531  -8.684  -3.137  1.00 0.00 ? 70  GLN A H    5  
ATOM 8804  H HA   . GLN A 1 70  ? 13.170  -8.206  -5.997  1.00 0.00 ? 70  GLN A HA   5  
ATOM 8805  H HB2  . GLN A 1 70  ? 12.078  -10.389 -4.212  1.00 0.00 ? 70  GLN A HB2  5  
ATOM 8806  H HB3  . GLN A 1 70  ? 11.879  -10.299 -5.955  1.00 0.00 ? 70  GLN A HB3  5  
ATOM 8807  H HG2  . GLN A 1 70  ? 14.346  -10.411 -6.175  1.00 0.00 ? 70  GLN A HG2  5  
ATOM 8808  H HG3  . GLN A 1 70  ? 14.433  -10.661 -4.435  1.00 0.00 ? 70  GLN A HG3  5  
ATOM 8809  H HE21 . GLN A 1 70  ? 15.284  -12.395 -6.616  1.00 0.00 ? 70  GLN A HE21 5  
ATOM 8810  H HE22 . GLN A 1 70  ? 14.436  -13.890 -6.399  1.00 0.00 ? 70  GLN A HE22 5  
ATOM 8811  N N    . VAL A 1 71  ? 10.819  -7.388  -6.043  1.00 0.00 ? 71  VAL A N    5  
ATOM 8812  C CA   . VAL A 1 71  ? 9.510   -6.756  -6.049  1.00 0.00 ? 71  VAL A CA   5  
ATOM 8813  C C    . VAL A 1 71  ? 8.415   -7.815  -6.002  1.00 0.00 ? 71  VAL A C    5  
ATOM 8814  O O    . VAL A 1 71  ? 8.288   -8.636  -6.914  1.00 0.00 ? 71  VAL A O    5  
ATOM 8815  C CB   . VAL A 1 71  ? 9.318   -5.862  -7.293  1.00 0.00 ? 71  VAL A CB   5  
ATOM 8816  C CG1  . VAL A 1 71  ? 7.934   -5.235  -7.302  1.00 0.00 ? 71  VAL A CG1  5  
ATOM 8817  C CG2  . VAL A 1 71  ? 10.389  -4.783  -7.341  1.00 0.00 ? 71  VAL A CG2  5  
ATOM 8818  H H    . VAL A 1 71  ? 11.313  -7.466  -6.886  1.00 0.00 ? 71  VAL A H    5  
ATOM 8819  H HA   . VAL A 1 71  ? 9.433   -6.135  -5.167  1.00 0.00 ? 71  VAL A HA   5  
ATOM 8820  H HB   . VAL A 1 71  ? 9.418   -6.478  -8.176  1.00 0.00 ? 71  VAL A HB   5  
ATOM 8821  H HG11 . VAL A 1 71  ? 7.815   -4.611  -6.429  1.00 0.00 ? 71  VAL A HG11 5  
ATOM 8822  H HG12 . VAL A 1 71  ? 7.184   -6.014  -7.293  1.00 0.00 ? 71  VAL A HG12 5  
ATOM 8823  H HG13 . VAL A 1 71  ? 7.816   -4.632  -8.191  1.00 0.00 ? 71  VAL A HG13 5  
ATOM 8824  H HG21 . VAL A 1 71  ? 11.364  -5.245  -7.387  1.00 0.00 ? 71  VAL A HG21 5  
ATOM 8825  H HG22 . VAL A 1 71  ? 10.321  -4.173  -6.452  1.00 0.00 ? 71  VAL A HG22 5  
ATOM 8826  H HG23 . VAL A 1 71  ? 10.242  -4.164  -8.214  1.00 0.00 ? 71  VAL A HG23 5  
ATOM 8827  N N    . LEU A 1 72  ? 7.632   -7.791  -4.939  1.00 0.00 ? 72  LEU A N    5  
ATOM 8828  C CA   . LEU A 1 72  ? 6.590   -8.786  -4.736  1.00 0.00 ? 72  LEU A CA   5  
ATOM 8829  C C    . LEU A 1 72  ? 5.237   -8.190  -5.112  1.00 0.00 ? 72  LEU A C    5  
ATOM 8830  O O    . LEU A 1 72  ? 4.774   -7.249  -4.475  1.00 0.00 ? 72  LEU A O    5  
ATOM 8831  C CB   . LEU A 1 72  ? 6.595   -9.247  -3.268  1.00 0.00 ? 72  LEU A CB   5  
ATOM 8832  C CG   . LEU A 1 72  ? 5.992   -10.632 -2.988  1.00 0.00 ? 72  LEU A CG   5  
ATOM 8833  C CD1  . LEU A 1 72  ? 4.483   -10.641 -3.185  1.00 0.00 ? 72  LEU A CD1  5  
ATOM 8834  C CD2  . LEU A 1 72  ? 6.653   -11.672 -3.878  1.00 0.00 ? 72  LEU A CD2  5  
ATOM 8835  H H    . LEU A 1 72  ? 7.743   -7.066  -4.281  1.00 0.00 ? 72  LEU A H    5  
ATOM 8836  H HA   . LEU A 1 72  ? 6.796   -9.630  -5.379  1.00 0.00 ? 72  LEU A HA   5  
ATOM 8837  H HB2  . LEU A 1 72  ? 7.619   -9.254  -2.924  1.00 0.00 ? 72  LEU A HB2  5  
ATOM 8838  H HB3  . LEU A 1 72  ? 6.047   -8.522  -2.685  1.00 0.00 ? 72  LEU A HB3  5  
ATOM 8839  H HG   . LEU A 1 72  ? 6.193   -10.902 -1.962  1.00 0.00 ? 72  LEU A HG   5  
ATOM 8840  H HD11 . LEU A 1 72  ? 4.098   -11.628 -2.974  1.00 0.00 ? 72  LEU A HD11 5  
ATOM 8841  H HD12 . LEU A 1 72  ? 4.251   -10.374 -4.206  1.00 0.00 ? 72  LEU A HD12 5  
ATOM 8842  H HD13 . LEU A 1 72  ? 4.028   -9.926  -2.515  1.00 0.00 ? 72  LEU A HD13 5  
ATOM 8843  H HD21 . LEU A 1 72  ? 6.271   -12.652 -3.633  1.00 0.00 ? 72  LEU A HD21 5  
ATOM 8844  H HD22 . LEU A 1 72  ? 7.723   -11.651 -3.722  1.00 0.00 ? 72  LEU A HD22 5  
ATOM 8845  H HD23 . LEU A 1 72  ? 6.437   -11.449 -4.912  1.00 0.00 ? 72  LEU A HD23 5  
ATOM 8846  N N    . SER A 1 73  ? 4.605   -8.731  -6.139  1.00 0.00 ? 73  SER A N    5  
ATOM 8847  C CA   . SER A 1 73  ? 3.337   -8.197  -6.608  1.00 0.00 ? 73  SER A CA   5  
ATOM 8848  C C    . SER A 1 73  ? 2.171   -8.922  -5.951  1.00 0.00 ? 73  SER A C    5  
ATOM 8849  O O    . SER A 1 73  ? 2.033   -10.138 -6.082  1.00 0.00 ? 73  SER A O    5  
ATOM 8850  C CB   . SER A 1 73  ? 3.257   -8.334  -8.128  1.00 0.00 ? 73  SER A CB   5  
ATOM 8851  O OG   . SER A 1 73  ? 3.505   -9.674  -8.528  1.00 0.00 ? 73  SER A OG   5  
ATOM 8852  H H    . SER A 1 73  ? 4.983   -9.515  -6.588  1.00 0.00 ? 73  SER A H    5  
ATOM 8853  H HA   . SER A 1 73  ? 3.291   -7.152  -6.343  1.00 0.00 ? 73  SER A HA   5  
ATOM 8854  H HB2  . SER A 1 73  ? 2.272   -8.049  -8.465  1.00 0.00 ? 73  SER A HB2  5  
ATOM 8855  H HB3  . SER A 1 73  ? 3.996   -7.692  -8.586  1.00 0.00 ? 73  SER A HB3  5  
ATOM 8856  H HG   . SER A 1 73  ? 2.997   -10.273 -7.963  1.00 0.00 ? 73  SER A HG   5  
ATOM 8857  N N    . VAL A 1 74  ? 1.339   -8.169  -5.254  1.00 0.00 ? 74  VAL A N    5  
ATOM 8858  C CA   . VAL A 1 74  ? 0.163   -8.722  -4.606  1.00 0.00 ? 74  VAL A CA   5  
ATOM 8859  C C    . VAL A 1 74  ? -1.057  -7.900  -4.944  1.00 0.00 ? 74  VAL A C    5  
ATOM 8860  O O    . VAL A 1 74  ? -1.028  -6.672  -4.953  1.00 0.00 ? 74  VAL A O    5  
ATOM 8861  C CB   . VAL A 1 74  ? 0.353   -8.820  -3.072  1.00 0.00 ? 74  VAL A CB   5  
ATOM 8862  C CG1  . VAL A 1 74  ? 0.709   -7.462  -2.484  1.00 0.00 ? 74  VAL A CG1  5  
ATOM 8863  C CG2  . VAL A 1 74  ? -0.889  -9.388  -2.401  1.00 0.00 ? 74  VAL A CG2  5  
ATOM 8864  H H    . VAL A 1 74  ? 1.525   -7.207  -5.152  1.00 0.00 ? 74  VAL A H    5  
ATOM 8865  H HA   . VAL A 1 74  ? -0.003  -9.715  -4.998  1.00 0.00 ? 74  VAL A HA   5  
ATOM 8866  H HB   . VAL A 1 74  ? 1.177   -9.493  -2.877  1.00 0.00 ? 74  VAL A HB   5  
ATOM 8867  H HG11 . VAL A 1 74  ? -0.094  -6.767  -2.678  1.00 0.00 ? 74  VAL A HG11 5  
ATOM 8868  H HG12 . VAL A 1 74  ? 1.619   -7.100  -2.940  1.00 0.00 ? 74  VAL A HG12 5  
ATOM 8869  H HG13 . VAL A 1 74  ? 0.854   -7.557  -1.417  1.00 0.00 ? 74  VAL A HG13 5  
ATOM 8870  H HG21 . VAL A 1 74  ? -1.735  -8.750  -2.612  1.00 0.00 ? 74  VAL A HG21 5  
ATOM 8871  H HG22 . VAL A 1 74  ? -0.733  -9.435  -1.333  1.00 0.00 ? 74  VAL A HG22 5  
ATOM 8872  H HG23 . VAL A 1 74  ? -1.084  -10.381 -2.780  1.00 0.00 ? 74  VAL A HG23 5  
ATOM 8873  N N    . MET A 1 75  ? -2.122  -8.598  -5.254  1.00 0.00 ? 75  MET A N    5  
ATOM 8874  C CA   . MET A 1 75  ? -3.325  -7.967  -5.721  1.00 0.00 ? 75  MET A CA   5  
ATOM 8875  C C    . MET A 1 75  ? -4.447  -8.163  -4.708  1.00 0.00 ? 75  MET A C    5  
ATOM 8876  O O    . MET A 1 75  ? -4.773  -9.289  -4.345  1.00 0.00 ? 75  MET A O    5  
ATOM 8877  C CB   . MET A 1 75  ? -3.703  -8.555  -7.073  1.00 0.00 ? 75  MET A CB   5  
ATOM 8878  C CG   . MET A 1 75  ? -4.743  -7.741  -7.788  1.00 0.00 ? 75  MET A CG   5  
ATOM 8879  S SD   . MET A 1 75  ? -5.303  -8.509  -9.320  1.00 0.00 ? 75  MET A SD   5  
ATOM 8880  C CE   . MET A 1 75  ? -6.484  -7.293  -9.902  1.00 0.00 ? 75  MET A CE   5  
ATOM 8881  H H    . MET A 1 75  ? -2.102  -9.570  -5.152  1.00 0.00 ? 75  MET A H    5  
ATOM 8882  H HA   . MET A 1 75  ? -3.132  -6.911  -5.834  1.00 0.00 ? 75  MET A HA   5  
ATOM 8883  H HB2  . MET A 1 75  ? -2.821  -8.607  -7.694  1.00 0.00 ? 75  MET A HB2  5  
ATOM 8884  H HB3  . MET A 1 75  ? -4.093  -9.552  -6.927  1.00 0.00 ? 75  MET A HB3  5  
ATOM 8885  H HG2  . MET A 1 75  ? -5.573  -7.622  -7.124  1.00 0.00 ? 75  MET A HG2  5  
ATOM 8886  H HG3  . MET A 1 75  ? -4.324  -6.773  -8.017  1.00 0.00 ? 75  MET A HG3  5  
ATOM 8887  H HE1  . MET A 1 75  ? -7.275  -7.183  -9.175  1.00 0.00 ? 75  MET A HE1  5  
ATOM 8888  H HE2  . MET A 1 75  ? -6.899  -7.620  -10.844 1.00 0.00 ? 75  MET A HE2  5  
ATOM 8889  H HE3  . MET A 1 75  ? -5.985  -6.345  -10.037 1.00 0.00 ? 75  MET A HE3  5  
ATOM 8890  N N    . PHE A 1 76  ? -5.030  -7.060  -4.266  1.00 0.00 ? 76  PHE A N    5  
ATOM 8891  C CA   . PHE A 1 76  ? -6.060  -7.086  -3.233  1.00 0.00 ? 76  PHE A CA   5  
ATOM 8892  C C    . PHE A 1 76  ? -7.040  -5.941  -3.467  1.00 0.00 ? 76  PHE A C    5  
ATOM 8893  O O    . PHE A 1 76  ? -6.867  -5.155  -4.402  1.00 0.00 ? 76  PHE A O    5  
ATOM 8894  C CB   . PHE A 1 76  ? -5.427  -6.969  -1.839  1.00 0.00 ? 76  PHE A CB   5  
ATOM 8895  C CG   . PHE A 1 76  ? -4.859  -5.613  -1.535  1.00 0.00 ? 76  PHE A CG   5  
ATOM 8896  C CD1  . PHE A 1 76  ? -3.670  -5.198  -2.109  1.00 0.00 ? 76  PHE A CD1  5  
ATOM 8897  C CD2  . PHE A 1 76  ? -5.516  -4.755  -0.670  1.00 0.00 ? 76  PHE A CD2  5  
ATOM 8898  C CE1  . PHE A 1 76  ? -3.150  -3.953  -1.827  1.00 0.00 ? 76  PHE A CE1  5  
ATOM 8899  C CE2  . PHE A 1 76  ? -4.999  -3.507  -0.383  1.00 0.00 ? 76  PHE A CE2  5  
ATOM 8900  C CZ   . PHE A 1 76  ? -3.814  -3.106  -0.964  1.00 0.00 ? 76  PHE A CZ   5  
ATOM 8901  H H    . PHE A 1 76  ? -4.778  -6.202  -4.673  1.00 0.00 ? 76  PHE A H    5  
ATOM 8902  H HA   . PHE A 1 76  ? -6.585  -8.028  -3.304  1.00 0.00 ? 76  PHE A HA   5  
ATOM 8903  H HB2  . PHE A 1 76  ? -6.176  -7.185  -1.093  1.00 0.00 ? 76  PHE A HB2  5  
ATOM 8904  H HB3  . PHE A 1 76  ? -4.628  -7.690  -1.756  1.00 0.00 ? 76  PHE A HB3  5  
ATOM 8905  H HD1  . PHE A 1 76  ? -3.150  -5.860  -2.785  1.00 0.00 ? 76  PHE A HD1  5  
ATOM 8906  H HD2  . PHE A 1 76  ? -6.445  -5.068  -0.217  1.00 0.00 ? 76  PHE A HD2  5  
ATOM 8907  H HE1  . PHE A 1 76  ? -2.222  -3.639  -2.283  1.00 0.00 ? 76  PHE A HE1  5  
ATOM 8908  H HE2  . PHE A 1 76  ? -5.523  -2.847  0.293   1.00 0.00 ? 76  PHE A HE2  5  
ATOM 8909  H HZ   . PHE A 1 76  ? -3.407  -2.131  -0.741  1.00 0.00 ? 76  PHE A HZ   5  
ATOM 8910  N N    . ARG A 1 77  ? -8.063  -5.841  -2.630  1.00 0.00 ? 77  ARG A N    5  
ATOM 8911  C CA   . ARG A 1 77  ? -9.017  -4.743  -2.729  1.00 0.00 ? 77  ARG A CA   5  
ATOM 8912  C C    . ARG A 1 77  ? -8.758  -3.702  -1.647  1.00 0.00 ? 77  ARG A C    5  
ATOM 8913  O O    . ARG A 1 77  ? -8.837  -3.998  -0.451  1.00 0.00 ? 77  ARG A O    5  
ATOM 8914  C CB   . ARG A 1 77  ? -10.458 -5.251  -2.637  1.00 0.00 ? 77  ARG A CB   5  
ATOM 8915  C CG   . ARG A 1 77  ? -10.911 -6.032  -3.857  1.00 0.00 ? 77  ARG A CG   5  
ATOM 8916  C CD   . ARG A 1 77  ? -12.381 -6.409  -3.759  1.00 0.00 ? 77  ARG A CD   5  
ATOM 8917  N NE   . ARG A 1 77  ? -12.834 -7.166  -4.924  1.00 0.00 ? 77  ARG A NE   5  
ATOM 8918  C CZ   . ARG A 1 77  ? -14.114 -7.320  -5.267  1.00 0.00 ? 77  ARG A CZ   5  
ATOM 8919  N NH1  . ARG A 1 77  ? -15.075 -6.769  -4.530  1.00 0.00 ? 77  ARG A NH1  5  
ATOM 8920  N NH2  . ARG A 1 77  ? -14.436 -8.022  -6.346  1.00 0.00 ? 77  ARG A NH2  5  
ATOM 8921  H H    . ARG A 1 77  ? -8.175  -6.510  -1.916  1.00 0.00 ? 77  ARG A H    5  
ATOM 8922  H HA   . ARG A 1 77  ? -8.874  -4.276  -3.691  1.00 0.00 ? 77  ARG A HA   5  
ATOM 8923  H HB2  . ARG A 1 77  ? -10.547 -5.892  -1.773  1.00 0.00 ? 77  ARG A HB2  5  
ATOM 8924  H HB3  . ARG A 1 77  ? -11.118 -4.404  -2.514  1.00 0.00 ? 77  ARG A HB3  5  
ATOM 8925  H HG2  . ARG A 1 77  ? -10.765 -5.427  -4.740  1.00 0.00 ? 77  ARG A HG2  5  
ATOM 8926  H HG3  . ARG A 1 77  ? -10.322 -6.935  -3.934  1.00 0.00 ? 77  ARG A HG3  5  
ATOM 8927  H HD2  . ARG A 1 77  ? -12.527 -7.010  -2.873  1.00 0.00 ? 77  ARG A HD2  5  
ATOM 8928  H HD3  . ARG A 1 77  ? -12.965 -5.504  -3.678  1.00 0.00 ? 77  ARG A HD3  5  
ATOM 8929  H HE   . ARG A 1 77  ? -12.142 -7.589  -5.478  1.00 0.00 ? 77  ARG A HE   5  
ATOM 8930  H HH11 . ARG A 1 77  ? -14.845 -6.234  -3.713  1.00 0.00 ? 77  ARG A HH11 5  
ATOM 8931  H HH12 . ARG A 1 77  ? -16.043 -6.901  -4.779  1.00 0.00 ? 77  ARG A HH12 5  
ATOM 8932  H HH21 . ARG A 1 77  ? -13.723 -8.448  -6.910  1.00 0.00 ? 77  ARG A HH21 5  
ATOM 8933  H HH22 . ARG A 1 77  ? -15.399 -8.125  -6.608  1.00 0.00 ? 77  ARG A HH22 5  
ATOM 8934  N N    . PHE A 1 78  ? -8.445  -2.489  -2.081  1.00 0.00 ? 78  PHE A N    5  
ATOM 8935  C CA   . PHE A 1 78  ? -8.167  -1.379  -1.179  1.00 0.00 ? 78  PHE A CA   5  
ATOM 8936  C C    . PHE A 1 78  ? -9.451  -0.611  -0.908  1.00 0.00 ? 78  PHE A C    5  
ATOM 8937  O O    . PHE A 1 78  ? -10.238 -0.371  -1.826  1.00 0.00 ? 78  PHE A O    5  
ATOM 8938  C CB   . PHE A 1 78  ? -7.147  -0.435  -1.823  1.00 0.00 ? 78  PHE A CB   5  
ATOM 8939  C CG   . PHE A 1 78  ? -6.349  0.406   -0.856  1.00 0.00 ? 78  PHE A CG   5  
ATOM 8940  C CD1  . PHE A 1 78  ? -6.864  1.584   -0.334  1.00 0.00 ? 78  PHE A CD1  5  
ATOM 8941  C CD2  . PHE A 1 78  ? -5.066  0.027   -0.498  1.00 0.00 ? 78  PHE A CD2  5  
ATOM 8942  C CE1  . PHE A 1 78  ? -6.114  2.361   0.529   1.00 0.00 ? 78  PHE A CE1  5  
ATOM 8943  C CE2  . PHE A 1 78  ? -4.310  0.805   0.358   1.00 0.00 ? 78  PHE A CE2  5  
ATOM 8944  C CZ   . PHE A 1 78  ? -4.836  1.973   0.873   1.00 0.00 ? 78  PHE A CZ   5  
ATOM 8945  H H    . PHE A 1 78  ? -8.416  -2.324  -3.050  1.00 0.00 ? 78  PHE A H    5  
ATOM 8946  H HA   . PHE A 1 78  ? -7.772  -1.770  -0.254  1.00 0.00 ? 78  PHE A HA   5  
ATOM 8947  H HB2  . PHE A 1 78  ? -6.454  -1.015  -2.400  1.00 0.00 ? 78  PHE A HB2  5  
ATOM 8948  H HB3  . PHE A 1 78  ? -7.671  0.240   -2.486  1.00 0.00 ? 78  PHE A HB3  5  
ATOM 8949  H HD1  . PHE A 1 78  ? -7.865  1.892   -0.603  1.00 0.00 ? 78  PHE A HD1  5  
ATOM 8950  H HD2  . PHE A 1 78  ? -4.654  -0.887  -0.896  1.00 0.00 ? 78  PHE A HD2  5  
ATOM 8951  H HE1  . PHE A 1 78  ? -6.528  3.274   0.931   1.00 0.00 ? 78  PHE A HE1  5  
ATOM 8952  H HE2  . PHE A 1 78  ? -3.312  0.497   0.629   1.00 0.00 ? 78  PHE A HE2  5  
ATOM 8953  H HZ   . PHE A 1 78  ? -4.242  2.586   1.536   1.00 0.00 ? 78  PHE A HZ   5  
ATOM 8954  N N    . ARG A 1 79  ? -9.670  -0.241  0.341   1.00 0.00 ? 79  ARG A N    5  
ATOM 8955  C CA   . ARG A 1 79  ? -10.832 0.557   0.688   1.00 0.00 ? 79  ARG A CA   5  
ATOM 8956  C C    . ARG A 1 79  ? -10.570 2.026   0.389   1.00 0.00 ? 79  ARG A C    5  
ATOM 8957  O O    . ARG A 1 79  ? -9.764  2.665   1.054   1.00 0.00 ? 79  ARG A O    5  
ATOM 8958  C CB   . ARG A 1 79  ? -11.182 0.403   2.162   1.00 0.00 ? 79  ARG A CB   5  
ATOM 8959  C CG   . ARG A 1 79  ? -12.577 0.897   2.495   1.00 0.00 ? 79  ARG A CG   5  
ATOM 8960  C CD   . ARG A 1 79  ? -12.652 1.410   3.919   1.00 0.00 ? 79  ARG A CD   5  
ATOM 8961  N NE   . ARG A 1 79  ? -12.040 0.481   4.875   1.00 0.00 ? 79  ARG A NE   5  
ATOM 8962  C CZ   . ARG A 1 79  ? -12.237 0.526   6.193   1.00 0.00 ? 79  ARG A CZ   5  
ATOM 8963  N NH1  . ARG A 1 79  ? -13.012 1.459   6.727   1.00 0.00 ? 79  ARG A NH1  5  
ATOM 8964  N NH2  . ARG A 1 79  ? -11.639 -0.360  6.983   1.00 0.00 ? 79  ARG A NH2  5  
ATOM 8965  H H    . ARG A 1 79  ? -9.044  -0.520  1.044   1.00 0.00 ? 79  ARG A H    5  
ATOM 8966  H HA   . ARG A 1 79  ? -11.662 0.218   0.087   1.00 0.00 ? 79  ARG A HA   5  
ATOM 8967  H HB2  . ARG A 1 79  ? -11.116 -0.642  2.430   1.00 0.00 ? 79  ARG A HB2  5  
ATOM 8968  H HB3  . ARG A 1 79  ? -10.474 0.965   2.752   1.00 0.00 ? 79  ARG A HB3  5  
ATOM 8969  H HG2  . ARG A 1 79  ? -12.838 1.697   1.818   1.00 0.00 ? 79  ARG A HG2  5  
ATOM 8970  H HG3  . ARG A 1 79  ? -13.276 0.080   2.378   1.00 0.00 ? 79  ARG A HG3  5  
ATOM 8971  H HD2  . ARG A 1 79  ? -12.135 2.355   3.961   1.00 0.00 ? 79  ARG A HD2  5  
ATOM 8972  H HD3  . ARG A 1 79  ? -13.690 1.555   4.182   1.00 0.00 ? 79  ARG A HD3  5  
ATOM 8973  H HE   . ARG A 1 79  ? -11.449 -0.211  4.508   1.00 0.00 ? 79  ARG A HE   5  
ATOM 8974  H HH11 . ARG A 1 79  ? -13.457 2.149   6.147   1.00 0.00 ? 79  ARG A HH11 5  
ATOM 8975  H HH12 . ARG A 1 79  ? -13.165 1.480   7.726   1.00 0.00 ? 79  ARG A HH12 5  
ATOM 8976  H HH21 . ARG A 1 79  ? -11.036 -1.062  6.595   1.00 0.00 ? 79  ARG A HH21 5  
ATOM 8977  H HH22 . ARG A 1 79  ? -11.783 -0.329  7.977   1.00 0.00 ? 79  ARG A HH22 5  
ATOM 8978  N N    . SER A 1 80  ? -11.221 2.533   -0.641  1.00 0.00 ? 80  SER A N    5  
ATOM 8979  C CA   . SER A 1 80  ? -11.160 3.949   -0.979  1.00 0.00 ? 80  SER A CA   5  
ATOM 8980  C C    . SER A 1 80  ? -11.761 4.830   0.119   1.00 0.00 ? 80  SER A C    5  
ATOM 8981  O O    . SER A 1 80  ? -12.253 4.346   1.142   1.00 0.00 ? 80  SER A O    5  
ATOM 8982  C CB   . SER A 1 80  ? -11.915 4.203   -2.278  1.00 0.00 ? 80  SER A CB   5  
ATOM 8983  O OG   . SER A 1 80  ? -13.306 3.987   -2.116  1.00 0.00 ? 80  SER A OG   5  
ATOM 8984  H H    . SER A 1 80  ? -11.720 1.920   -1.226  1.00 0.00 ? 80  SER A H    5  
ATOM 8985  H HA   . SER A 1 80  ? -10.124 4.216   -1.119  1.00 0.00 ? 80  SER A HA   5  
ATOM 8986  H HB2  . SER A 1 80  ? -11.758 5.223   -2.577  1.00 0.00 ? 80  SER A HB2  5  
ATOM 8987  H HB3  . SER A 1 80  ? -11.544 3.539   -3.046  1.00 0.00 ? 80  SER A HB3  5  
ATOM 8988  H HG   . SER A 1 80  ? -13.748 4.089   -2.979  1.00 0.00 ? 80  SER A HG   5  
ATOM 8989  N N    . LYS A 1 81  ? -11.766 6.137   -0.138  1.00 0.00 ? 81  LYS A N    5  
ATOM 8990  C CA   . LYS A 1 81  ? -12.319 7.117   0.791   1.00 0.00 ? 81  LYS A CA   5  
ATOM 8991  C C    . LYS A 1 81  ? -13.837 7.092   0.708   1.00 0.00 ? 81  LYS A C    5  
ATOM 8992  O O    . LYS A 1 81  ? -14.538 7.719   1.505   1.00 0.00 ? 81  LYS A O    5  
ATOM 8993  C CB   . LYS A 1 81  ? -11.805 8.517   0.442   1.00 0.00 ? 81  LYS A CB   5  
ATOM 8994  C CG   . LYS A 1 81  ? -12.076 9.574   1.503   1.00 0.00 ? 81  LYS A CG   5  
ATOM 8995  C CD   . LYS A 1 81  ? -11.404 9.226   2.819   1.00 0.00 ? 81  LYS A CD   5  
ATOM 8996  C CE   . LYS A 1 81  ? -11.498 10.364  3.826   1.00 0.00 ? 81  LYS A CE   5  
ATOM 8997  N NZ   . LYS A 1 81  ? -10.723 11.557  3.394   1.00 0.00 ? 81  LYS A NZ   5  
ATOM 8998  H H    . LYS A 1 81  ? -11.393 6.459   -0.992  1.00 0.00 ? 81  LYS A H    5  
ATOM 8999  H HA   . LYS A 1 81  ? -12.009 6.857   1.792   1.00 0.00 ? 81  LYS A HA   5  
ATOM 9000  H HB2  . LYS A 1 81  ? -10.738 8.463   0.283   1.00 0.00 ? 81  LYS A HB2  5  
ATOM 9001  H HB3  . LYS A 1 81  ? -12.273 8.834   -0.478  1.00 0.00 ? 81  LYS A HB3  5  
ATOM 9002  H HG2  . LYS A 1 81  ? -11.697 10.523  1.156   1.00 0.00 ? 81  LYS A HG2  5  
ATOM 9003  H HG3  . LYS A 1 81  ? -13.142 9.644   1.661   1.00 0.00 ? 81  LYS A HG3  5  
ATOM 9004  H HD2  . LYS A 1 81  ? -11.881 8.353   3.235   1.00 0.00 ? 81  LYS A HD2  5  
ATOM 9005  H HD3  . LYS A 1 81  ? -10.364 9.014   2.630   1.00 0.00 ? 81  LYS A HD3  5  
ATOM 9006  H HE2  . LYS A 1 81  ? -12.536 10.641  3.939   1.00 0.00 ? 81  LYS A HE2  5  
ATOM 9007  H HE3  . LYS A 1 81  ? -11.112 10.019  4.774   1.00 0.00 ? 81  LYS A HE3  5  
ATOM 9008  H HZ1  . LYS A 1 81  ? -11.067 11.901  2.474   1.00 0.00 ? 81  LYS A HZ1  5  
ATOM 9009  H HZ2  . LYS A 1 81  ? -9.708  11.317  3.314   1.00 0.00 ? 81  LYS A HZ2  5  
ATOM 9010  H HZ3  . LYS A 1 81  ? -10.826 12.319  4.097   1.00 0.00 ? 81  LYS A HZ3  5  
ATOM 9011  N N    . ASN A 1 82  ? -14.330 6.338   -0.258  1.00 0.00 ? 82  ASN A N    5  
ATOM 9012  C CA   . ASN A 1 82  ? -15.755 6.198   -0.486  1.00 0.00 ? 82  ASN A CA   5  
ATOM 9013  C C    . ASN A 1 82  ? -16.233 4.928   0.194   1.00 0.00 ? 82  ASN A C    5  
ATOM 9014  O O    . ASN A 1 82  ? -17.409 4.566   0.120   1.00 0.00 ? 82  ASN A O    5  
ATOM 9015  C CB   . ASN A 1 82  ? -16.032 6.127   -1.992  1.00 0.00 ? 82  ASN A CB   5  
ATOM 9016  C CG   . ASN A 1 82  ? -15.447 7.310   -2.741  1.00 0.00 ? 82  ASN A CG   5  
ATOM 9017  O OD1  . ASN A 1 82  ? -15.480 8.445   -2.264  1.00 0.00 ? 82  ASN A OD1  5  
ATOM 9018  N ND2  . ASN A 1 82  ? -14.865 7.047   -3.902  1.00 0.00 ? 82  ASN A ND2  5  
ATOM 9019  H H    . ASN A 1 82  ? -13.715 5.828   -0.828  1.00 0.00 ? 82  ASN A H    5  
ATOM 9020  H HA   . ASN A 1 82  ? -16.259 7.052   -0.060  1.00 0.00 ? 82  ASN A HA   5  
ATOM 9021  H HB2  . ASN A 1 82  ? -15.600 5.223   -2.390  1.00 0.00 ? 82  ASN A HB2  5  
ATOM 9022  H HB3  . ASN A 1 82  ? -17.101 6.114   -2.154  1.00 0.00 ? 82  ASN A HB3  5  
ATOM 9023  H HD21 . ASN A 1 82  ? -14.843 6.102   -4.211  1.00 0.00 ? 82  ASN A HD21 5  
ATOM 9024  H HD22 . ASN A 1 82  ? -14.473 7.790   -4.403  1.00 0.00 ? 82  ASN A HD22 5  
ATOM 9025  N N    . GLN A 1 83  ? -15.286 4.263   0.857   1.00 0.00 ? 83  GLN A N    5  
ATOM 9026  C CA   . GLN A 1 83  ? -15.531 3.013   1.566   1.00 0.00 ? 83  GLN A CA   5  
ATOM 9027  C C    . GLN A 1 83  ? -15.885 1.906   0.590   1.00 0.00 ? 83  GLN A C    5  
ATOM 9028  O O    . GLN A 1 83  ? -16.603 0.963   0.925   1.00 0.00 ? 83  GLN A O    5  
ATOM 9029  C CB   . GLN A 1 83  ? -16.622 3.170   2.629   1.00 0.00 ? 83  GLN A CB   5  
ATOM 9030  C CG   . GLN A 1 83  ? -16.153 3.887   3.890   1.00 0.00 ? 83  GLN A CG   5  
ATOM 9031  C CD   . GLN A 1 83  ? -15.703 5.313   3.636   1.00 0.00 ? 83  GLN A CD   5  
ATOM 9032  O OE1  . GLN A 1 83  ? -16.506 6.242   3.672   1.00 0.00 ? 83  GLN A OE1  5  
ATOM 9033  N NE2  . GLN A 1 83  ? -14.411 5.501   3.394   1.00 0.00 ? 83  GLN A NE2  5  
ATOM 9034  H H    . GLN A 1 83  ? -14.378 4.634   0.870   1.00 0.00 ? 83  GLN A H    5  
ATOM 9035  H HA   . GLN A 1 83  ? -14.609 2.742   2.062   1.00 0.00 ? 83  GLN A HA   5  
ATOM 9036  H HB2  . GLN A 1 83  ? -17.440 3.734   2.207   1.00 0.00 ? 83  GLN A HB2  5  
ATOM 9037  H HB3  . GLN A 1 83  ? -16.979 2.189   2.909   1.00 0.00 ? 83  GLN A HB3  5  
ATOM 9038  H HG2  . GLN A 1 83  ? -16.964 3.906   4.598   1.00 0.00 ? 83  GLN A HG2  5  
ATOM 9039  H HG3  . GLN A 1 83  ? -15.322 3.336   4.309   1.00 0.00 ? 83  GLN A HG3  5  
ATOM 9040  H HE21 . GLN A 1 83  ? -13.819 4.718   3.395   1.00 0.00 ? 83  GLN A HE21 5  
ATOM 9041  H HE22 . GLN A 1 83  ? -14.104 6.414   3.202   1.00 0.00 ? 83  GLN A HE22 5  
ATOM 9042  N N    . GLU A 1 84  ? -15.380 2.037   -0.625  1.00 0.00 ? 84  GLU A N    5  
ATOM 9043  C CA   . GLU A 1 84  ? -15.564 1.030   -1.635  1.00 0.00 ? 84  GLU A CA   5  
ATOM 9044  C C    . GLU A 1 84  ? -14.244 0.303   -1.847  1.00 0.00 ? 84  GLU A C    5  
ATOM 9045  O O    . GLU A 1 84  ? -13.180 0.872   -1.610  1.00 0.00 ? 84  GLU A O    5  
ATOM 9046  C CB   . GLU A 1 84  ? -16.070 1.690   -2.917  1.00 0.00 ? 84  GLU A CB   5  
ATOM 9047  C CG   . GLU A 1 84  ? -14.982 2.165   -3.861  1.00 0.00 ? 84  GLU A CG   5  
ATOM 9048  C CD   . GLU A 1 84  ? -15.375 3.428   -4.596  1.00 0.00 ? 84  GLU A CD   5  
ATOM 9049  O OE1  . GLU A 1 84  ? -16.389 3.414   -5.324  1.00 0.00 ? 84  GLU A OE1  5  
ATOM 9050  O OE2  . GLU A 1 84  ? -14.674 4.449   -4.430  1.00 0.00 ? 84  GLU A OE2  5  
ATOM 9051  H H    . GLU A 1 84  ? -14.868 2.836   -0.852  1.00 0.00 ? 84  GLU A H    5  
ATOM 9052  H HA   . GLU A 1 84  ? -16.297 0.330   -1.269  1.00 0.00 ? 84  GLU A HA   5  
ATOM 9053  H HB2  . GLU A 1 84  ? -16.689 0.993   -3.442  1.00 0.00 ? 84  GLU A HB2  5  
ATOM 9054  H HB3  . GLU A 1 84  ? -16.661 2.550   -2.643  1.00 0.00 ? 84  GLU A HB3  5  
ATOM 9055  H HG2  . GLU A 1 84  ? -14.090 2.363   -3.287  1.00 0.00 ? 84  GLU A HG2  5  
ATOM 9056  H HG3  . GLU A 1 84  ? -14.782 1.389   -4.583  1.00 0.00 ? 84  GLU A HG3  5  
ATOM 9057  N N    . TRP A 1 85  ? -14.297 -0.943  -2.271  1.00 0.00 ? 85  TRP A N    5  
ATOM 9058  C CA   . TRP A 1 85  ? -13.107 -1.762  -2.321  1.00 0.00 ? 85  TRP A CA   5  
ATOM 9059  C C    . TRP A 1 85  ? -12.706 -2.045  -3.765  1.00 0.00 ? 85  TRP A C    5  
ATOM 9060  O O    . TRP A 1 85  ? -13.288 -2.905  -4.429  1.00 0.00 ? 85  TRP A O    5  
ATOM 9061  C CB   . TRP A 1 85  ? -13.365 -3.060  -1.551  1.00 0.00 ? 85  TRP A CB   5  
ATOM 9062  C CG   . TRP A 1 85  ? -13.826 -2.818  -0.141  1.00 0.00 ? 85  TRP A CG   5  
ATOM 9063  C CD1  . TRP A 1 85  ? -15.091 -2.490  0.261   1.00 0.00 ? 85  TRP A CD1  5  
ATOM 9064  C CD2  . TRP A 1 85  ? -13.036 -2.876  1.052   1.00 0.00 ? 85  TRP A CD2  5  
ATOM 9065  N NE1  . TRP A 1 85  ? -15.130 -2.333  1.624   1.00 0.00 ? 85  TRP A NE1  5  
ATOM 9066  C CE2  . TRP A 1 85  ? -13.886 -2.572  2.133   1.00 0.00 ? 85  TRP A CE2  5  
ATOM 9067  C CE3  . TRP A 1 85  ? -11.697 -3.159  1.316   1.00 0.00 ? 85  TRP A CE3  5  
ATOM 9068  C CZ2  . TRP A 1 85  ? -13.439 -2.538  3.450   1.00 0.00 ? 85  TRP A CZ2  5  
ATOM 9069  C CZ3  . TRP A 1 85  ? -11.255 -3.123  2.625   1.00 0.00 ? 85  TRP A CZ3  5  
ATOM 9070  C CH2  . TRP A 1 85  ? -12.123 -2.821  3.676   1.00 0.00 ? 85  TRP A CH2  5  
ATOM 9071  H H    . TRP A 1 85  ? -15.147 -1.331  -2.572  1.00 0.00 ? 85  TRP A H    5  
ATOM 9072  H HA   . TRP A 1 85  ? -12.310 -1.219  -1.837  1.00 0.00 ? 85  TRP A HA   5  
ATOM 9073  H HB2  . TRP A 1 85  ? -14.127 -3.631  -2.060  1.00 0.00 ? 85  TRP A HB2  5  
ATOM 9074  H HB3  . TRP A 1 85  ? -12.456 -3.632  -1.513  1.00 0.00 ? 85  TRP A HB3  5  
ATOM 9075  H HD1  . TRP A 1 85  ? -15.926 -2.364  -0.410  1.00 0.00 ? 85  TRP A HD1  5  
ATOM 9076  H HE1  . TRP A 1 85  ? -15.921 -2.090  2.148   1.00 0.00 ? 85  TRP A HE1  5  
ATOM 9077  H HE3  . TRP A 1 85  ? -11.008 -3.397  0.519   1.00 0.00 ? 85  TRP A HE3  5  
ATOM 9078  H HZ2  . TRP A 1 85  ? -14.099 -2.306  4.272   1.00 0.00 ? 85  TRP A HZ2  5  
ATOM 9079  H HZ3  . TRP A 1 85  ? -10.220 -3.340  2.847   1.00 0.00 ? 85  TRP A HZ3  5  
ATOM 9080  H HH2  . TRP A 1 85  ? -11.732 -2.804  4.683   1.00 0.00 ? 85  TRP A HH2  5  
ATOM 9081  N N    . LEU A 1 86  ? -11.710 -1.310  -4.243  1.00 0.00 ? 86  LEU A N    5  
ATOM 9082  C CA   . LEU A 1 86  ? -11.258 -1.436  -5.622  1.00 0.00 ? 86  LEU A CA   5  
ATOM 9083  C C    . LEU A 1 86  ? -10.001 -2.292  -5.707  1.00 0.00 ? 86  LEU A C    5  
ATOM 9084  O O    . LEU A 1 86  ? -9.290  -2.468  -4.720  1.00 0.00 ? 86  LEU A O    5  
ATOM 9085  C CB   . LEU A 1 86  ? -11.033 -0.054  -6.300  1.00 0.00 ? 86  LEU A CB   5  
ATOM 9086  C CG   . LEU A 1 86  ? -10.307 1.069   -5.519  1.00 0.00 ? 86  LEU A CG   5  
ATOM 9087  C CD1  . LEU A 1 86  ? -11.246 1.763   -4.556  1.00 0.00 ? 86  LEU A CD1  5  
ATOM 9088  C CD2  . LEU A 1 86  ? -9.067  0.571   -4.786  1.00 0.00 ? 86  LEU A CD2  5  
ATOM 9089  H H    . LEU A 1 86  ? -11.250 -0.686  -3.642  1.00 0.00 ? 86  LEU A H    5  
ATOM 9090  H HA   . LEU A 1 86  ? -12.040 -1.954  -6.164  1.00 0.00 ? 86  LEU A HA   5  
ATOM 9091  H HB2  . LEU A 1 86  ? -10.473 -0.225  -7.202  1.00 0.00 ? 86  LEU A HB2  5  
ATOM 9092  H HB3  . LEU A 1 86  ? -12.007 0.323   -6.585  1.00 0.00 ? 86  LEU A HB3  5  
ATOM 9093  H HG   . LEU A 1 86  ? -9.981  1.818   -6.228  1.00 0.00 ? 86  LEU A HG   5  
ATOM 9094  H HD11 . LEU A 1 86  ? -10.707 2.529   -4.019  1.00 0.00 ? 86  LEU A HD11 5  
ATOM 9095  H HD12 . LEU A 1 86  ? -11.648 1.050   -3.860  1.00 0.00 ? 86  LEU A HD12 5  
ATOM 9096  H HD13 . LEU A 1 86  ? -12.052 2.218   -5.112  1.00 0.00 ? 86  LEU A HD13 5  
ATOM 9097  H HD21 . LEU A 1 86  ? -8.360  0.175   -5.501  1.00 0.00 ? 86  LEU A HD21 5  
ATOM 9098  H HD22 . LEU A 1 86  ? -9.349  -0.207  -4.092  1.00 0.00 ? 86  LEU A HD22 5  
ATOM 9099  H HD23 . LEU A 1 86  ? -8.616  1.389   -4.246  1.00 0.00 ? 86  LEU A HD23 5  
ATOM 9100  N N    . TRP A 1 87  ? -9.737  -2.831  -6.888  1.00 0.00 ? 87  TRP A N    5  
ATOM 9101  C CA   . TRP A 1 87  ? -8.549  -3.642  -7.096  1.00 0.00 ? 87  TRP A CA   5  
ATOM 9102  C C    . TRP A 1 87  ? -7.314  -2.777  -7.090  1.00 0.00 ? 87  TRP A C    5  
ATOM 9103  O O    . TRP A 1 87  ? -7.222  -1.807  -7.838  1.00 0.00 ? 87  TRP A O    5  
ATOM 9104  C CB   . TRP A 1 87  ? -8.613  -4.402  -8.415  1.00 0.00 ? 87  TRP A CB   5  
ATOM 9105  C CG   . TRP A 1 87  ? -9.658  -5.459  -8.430  1.00 0.00 ? 87  TRP A CG   5  
ATOM 9106  C CD1  . TRP A 1 87  ? -10.811 -5.442  -9.141  1.00 0.00 ? 87  TRP A CD1  5  
ATOM 9107  C CD2  . TRP A 1 87  ? -9.645  -6.686  -7.694  1.00 0.00 ? 87  TRP A CD2  5  
ATOM 9108  N NE1  . TRP A 1 87  ? -11.530 -6.590  -8.897  1.00 0.00 ? 87  TRP A NE1  5  
ATOM 9109  C CE2  . TRP A 1 87  ? -10.832 -7.369  -8.008  1.00 0.00 ? 87  TRP A CE2  5  
ATOM 9110  C CE3  . TRP A 1 87  ? -8.743  -7.270  -6.798  1.00 0.00 ? 87  TRP A CE3  5  
ATOM 9111  C CZ2  . TRP A 1 87  ? -11.140 -8.611  -7.460  1.00 0.00 ? 87  TRP A CZ2  5  
ATOM 9112  C CZ3  . TRP A 1 87  ? -9.049  -8.502  -6.254  1.00 0.00 ? 87  TRP A CZ3  5  
ATOM 9113  C CH2  . TRP A 1 87  ? -10.240 -9.163  -6.586  1.00 0.00 ? 87  TRP A CH2  5  
ATOM 9114  H H    . TRP A 1 87  ? -10.352 -2.669  -7.639  1.00 0.00 ? 87  TRP A H    5  
ATOM 9115  H HA   . TRP A 1 87  ? -8.484  -4.351  -6.283  1.00 0.00 ? 87  TRP A HA   5  
ATOM 9116  H HB2  . TRP A 1 87  ? -8.830  -3.707  -9.213  1.00 0.00 ? 87  TRP A HB2  5  
ATOM 9117  H HB3  . TRP A 1 87  ? -7.659  -4.870  -8.600  1.00 0.00 ? 87  TRP A HB3  5  
ATOM 9118  H HD1  . TRP A 1 87  ? -11.100 -4.629  -9.805  1.00 0.00 ? 87  TRP A HD1  5  
ATOM 9119  H HE1  . TRP A 1 87  ? -12.407 -6.811  -9.292  1.00 0.00 ? 87  TRP A HE1  5  
ATOM 9120  H HE3  . TRP A 1 87  ? -7.820  -6.776  -6.531  1.00 0.00 ? 87  TRP A HE3  5  
ATOM 9121  H HZ2  . TRP A 1 87  ? -12.052 -9.136  -7.706  1.00 0.00 ? 87  TRP A HZ2  5  
ATOM 9122  H HZ3  . TRP A 1 87  ? -8.364  -8.968  -5.562  1.00 0.00 ? 87  TRP A HZ3  5  
ATOM 9123  H HH2  . TRP A 1 87  ? -10.442 -10.123 -6.137  1.00 0.00 ? 87  TRP A HH2  5  
ATOM 9124  N N    . MET A 1 88  ? -6.385  -3.110  -6.230  1.00 0.00 ? 88  MET A N    5  
ATOM 9125  C CA   . MET A 1 88  ? -5.105  -2.447  -6.204  1.00 0.00 ? 88  MET A CA   5  
ATOM 9126  C C    . MET A 1 88  ? -3.995  -3.479  -6.117  1.00 0.00 ? 88  MET A C    5  
ATOM 9127  O O    . MET A 1 88  ? -4.000  -4.339  -5.236  1.00 0.00 ? 88  MET A O    5  
ATOM 9128  C CB   . MET A 1 88  ? -5.037  -1.484  -5.024  1.00 0.00 ? 88  MET A CB   5  
ATOM 9129  C CG   . MET A 1 88  ? -3.671  -0.857  -4.818  1.00 0.00 ? 88  MET A CG   5  
ATOM 9130  S SD   . MET A 1 88  ? -3.659  0.896   -5.210  1.00 0.00 ? 88  MET A SD   5  
ATOM 9131  C CE   . MET A 1 88  ? -4.726  1.523   -3.920  1.00 0.00 ? 88  MET A CE   5  
ATOM 9132  H H    . MET A 1 88  ? -6.576  -3.806  -5.557  1.00 0.00 ? 88  MET A H    5  
ATOM 9133  H HA   . MET A 1 88  ? -4.995  -1.890  -7.124  1.00 0.00 ? 88  MET A HA   5  
ATOM 9134  H HB2  . MET A 1 88  ? -5.750  -0.689  -5.185  1.00 0.00 ? 88  MET A HB2  5  
ATOM 9135  H HB3  . MET A 1 88  ? -5.305  -2.013  -4.134  1.00 0.00 ? 88  MET A HB3  5  
ATOM 9136  H HG2  . MET A 1 88  ? -3.383  -0.984  -3.784  1.00 0.00 ? 88  MET A HG2  5  
ATOM 9137  H HG3  . MET A 1 88  ? -2.960  -1.361  -5.453  1.00 0.00 ? 88  MET A HG3  5  
ATOM 9138  H HE1  . MET A 1 88  ? -4.836  2.593   -4.030  1.00 0.00 ? 88  MET A HE1  5  
ATOM 9139  H HE2  . MET A 1 88  ? -4.291  1.305   -2.956  1.00 0.00 ? 88  MET A HE2  5  
ATOM 9140  H HE3  . MET A 1 88  ? -5.695  1.052   -3.994  1.00 0.00 ? 88  MET A HE3  5  
ATOM 9141  N N    . ARG A 1 89  ? -3.073  -3.421  -7.058  1.00 0.00 ? 89  ARG A N    5  
ATOM 9142  C CA   . ARG A 1 89  ? -1.933  -4.310  -7.045  1.00 0.00 ? 89  ARG A CA   5  
ATOM 9143  C C    . ARG A 1 89  ? -0.745  -3.589  -6.434  1.00 0.00 ? 89  ARG A C    5  
ATOM 9144  O O    . ARG A 1 89  ? -0.223  -2.634  -7.014  1.00 0.00 ? 89  ARG A O    5  
ATOM 9145  C CB   . ARG A 1 89  ? -1.581  -4.775  -8.458  1.00 0.00 ? 89  ARG A CB   5  
ATOM 9146  C CG   . ARG A 1 89  ? -0.683  -5.998  -8.474  1.00 0.00 ? 89  ARG A CG   5  
ATOM 9147  C CD   . ARG A 1 89  ? 0.090   -6.105  -9.777  1.00 0.00 ? 89  ARG A CD   5  
ATOM 9148  N NE   . ARG A 1 89  ? 1.068   -5.026  -9.921  1.00 0.00 ? 89  ARG A NE   5  
ATOM 9149  C CZ   . ARG A 1 89  ? 1.922   -4.925  -10.935 1.00 0.00 ? 89  ARG A CZ   5  
ATOM 9150  N NH1  . ARG A 1 89  ? 1.928   -5.841  -11.898 1.00 0.00 ? 89  ARG A NH1  5  
ATOM 9151  N NH2  . ARG A 1 89  ? 2.778   -3.912  -10.980 1.00 0.00 ? 89  ARG A NH2  5  
ATOM 9152  H H    . ARG A 1 89  ? -3.157  -2.752  -7.775  1.00 0.00 ? 89  ARG A H    5  
ATOM 9153  H HA   . ARG A 1 89  ? -2.179  -5.167  -6.437  1.00 0.00 ? 89  ARG A HA   5  
ATOM 9154  H HB2  . ARG A 1 89  ? -2.491  -5.012  -8.987  1.00 0.00 ? 89  ARG A HB2  5  
ATOM 9155  H HB3  . ARG A 1 89  ? -1.070  -3.974  -8.971  1.00 0.00 ? 89  ARG A HB3  5  
ATOM 9156  H HG2  . ARG A 1 89  ? 0.014   -5.936  -7.654  1.00 0.00 ? 89  ARG A HG2  5  
ATOM 9157  H HG3  . ARG A 1 89  ? -1.295  -6.883  -8.357  1.00 0.00 ? 89  ARG A HG3  5  
ATOM 9158  H HD2  . ARG A 1 89  ? 0.608   -7.053  -9.799  1.00 0.00 ? 89  ARG A HD2  5  
ATOM 9159  H HD3  . ARG A 1 89  ? -0.606  -6.057  -10.600 1.00 0.00 ? 89  ARG A HD3  5  
ATOM 9160  H HE   . ARG A 1 89  ? 1.089   -4.337  -9.217  1.00 0.00 ? 89  ARG A HE   5  
ATOM 9161  H HH11 . ARG A 1 89  ? 1.295   -6.615  -11.862 1.00 0.00 ? 89  ARG A HH11 5  
ATOM 9162  H HH12 . ARG A 1 89  ? 2.565   -5.750  -12.680 1.00 0.00 ? 89  ARG A HH12 5  
ATOM 9163  H HH21 . ARG A 1 89  ? 2.780   -3.222  -10.249 1.00 0.00 ? 89  ARG A HH21 5  
ATOM 9164  H HH22 . ARG A 1 89  ? 3.439   -3.835  -11.740 1.00 0.00 ? 89  ARG A HH22 5  
ATOM 9165  N N    . THR A 1 90  ? -0.337  -4.027  -5.265  1.00 0.00 ? 90  THR A N    5  
ATOM 9166  C CA   . THR A 1 90  ? 0.777   -3.422  -4.574  1.00 0.00 ? 90  THR A CA   5  
ATOM 9167  C C    . THR A 1 90  ? 2.073   -4.164  -4.880  1.00 0.00 ? 90  THR A C    5  
ATOM 9168  O O    . THR A 1 90  ? 2.149   -5.390  -4.768  1.00 0.00 ? 90  THR A O    5  
ATOM 9169  C CB   . THR A 1 90  ? 0.527   -3.394  -3.054  1.00 0.00 ? 90  THR A CB   5  
ATOM 9170  O OG1  . THR A 1 90  ? -0.642  -2.615  -2.778  1.00 0.00 ? 90  THR A OG1  5  
ATOM 9171  C CG2  . THR A 1 90  ? 1.713   -2.807  -2.307  1.00 0.00 ? 90  THR A CG2  5  
ATOM 9172  H H    . THR A 1 90  ? -0.805  -4.783  -4.844  1.00 0.00 ? 90  THR A H    5  
ATOM 9173  H HA   . THR A 1 90  ? 0.870   -2.402  -4.921  1.00 0.00 ? 90  THR A HA   5  
ATOM 9174  H HB   . THR A 1 90  ? 0.367   -4.406  -2.712  1.00 0.00 ? 90  THR A HB   5  
ATOM 9175  H HG1  . THR A 1 90  ? -0.381  -1.713  -2.552  1.00 0.00 ? 90  THR A HG1  5  
ATOM 9176  H HG21 . THR A 1 90  ? 2.582   -3.429  -2.467  1.00 0.00 ? 90  THR A HG21 5  
ATOM 9177  H HG22 . THR A 1 90  ? 1.489   -2.764  -1.250  1.00 0.00 ? 90  THR A HG22 5  
ATOM 9178  H HG23 . THR A 1 90  ? 1.911   -1.812  -2.677  1.00 0.00 ? 90  THR A HG23 5  
ATOM 9179  N N    . SER A 1 91  ? 3.070   -3.411  -5.307  1.00 0.00 ? 91  SER A N    5  
ATOM 9180  C CA   . SER A 1 91  ? 4.394   -3.942  -5.538  1.00 0.00 ? 91  SER A CA   5  
ATOM 9181  C C    . SER A 1 91  ? 5.246   -3.715  -4.297  1.00 0.00 ? 91  SER A C    5  
ATOM 9182  O O    . SER A 1 91  ? 5.511   -2.574  -3.916  1.00 0.00 ? 91  SER A O    5  
ATOM 9183  C CB   . SER A 1 91  ? 5.024   -3.270  -6.757  1.00 0.00 ? 91  SER A CB   5  
ATOM 9184  O OG   . SER A 1 91  ? 4.235   -3.483  -7.919  1.00 0.00 ? 91  SER A OG   5  
ATOM 9185  H H    . SER A 1 91  ? 2.910   -2.451  -5.454  1.00 0.00 ? 91  SER A H    5  
ATOM 9186  H HA   . SER A 1 91  ? 4.306   -5.003  -5.720  1.00 0.00 ? 91  SER A HA   5  
ATOM 9187  H HB2  . SER A 1 91  ? 5.102   -2.207  -6.580  1.00 0.00 ? 91  SER A HB2  5  
ATOM 9188  H HB3  . SER A 1 91  ? 6.009   -3.681  -6.925  1.00 0.00 ? 91  SER A HB3  5  
ATOM 9189  H HG   . SER A 1 91  ? 3.491   -2.867  -7.925  1.00 0.00 ? 91  SER A HG   5  
ATOM 9190  N N    . SER A 1 92  ? 5.654   -4.800  -3.668  1.00 0.00 ? 92  SER A N    5  
ATOM 9191  C CA   . SER A 1 92  ? 6.373   -4.733  -2.412  1.00 0.00 ? 92  SER A CA   5  
ATOM 9192  C C    . SER A 1 92  ? 7.872   -4.756  -2.654  1.00 0.00 ? 92  SER A C    5  
ATOM 9193  O O    . SER A 1 92  ? 8.383   -5.641  -3.338  1.00 0.00 ? 92  SER A O    5  
ATOM 9194  C CB   . SER A 1 92  ? 5.979   -5.908  -1.517  1.00 0.00 ? 92  SER A CB   5  
ATOM 9195  O OG   . SER A 1 92  ? 4.569   -6.042  -1.449  1.00 0.00 ? 92  SER A OG   5  
ATOM 9196  H H    . SER A 1 92  ? 5.488   -5.677  -4.073  1.00 0.00 ? 92  SER A H    5  
ATOM 9197  H HA   . SER A 1 92  ? 6.110   -3.808  -1.922  1.00 0.00 ? 92  SER A HA   5  
ATOM 9198  H HB2  . SER A 1 92  ? 6.405   -6.827  -1.910  1.00 0.00 ? 92  SER A HB2  5  
ATOM 9199  H HB3  . SER A 1 92  ? 6.359   -5.738  -0.519  1.00 0.00 ? 92  SER A HB3  5  
ATOM 9200  H HG   . SER A 1 92  ? 4.234   -6.353  -2.297  1.00 0.00 ? 92  SER A HG   5  
ATOM 9201  N N    . PHE A 1 93  ? 8.557   -3.765  -2.121  1.00 0.00 ? 93  PHE A N    5  
ATOM 9202  C CA   . PHE A 1 93  ? 10.006  -3.748  -2.124  1.00 0.00 ? 93  PHE A CA   5  
ATOM 9203  C C    . PHE A 1 93  ? 10.507  -3.592  -0.698  1.00 0.00 ? 93  PHE A C    5  
ATOM 9204  O O    . PHE A 1 93  ? 9.984   -2.783  0.062   1.00 0.00 ? 93  PHE A O    5  
ATOM 9205  C CB   . PHE A 1 93  ? 10.515  -2.597  -2.999  1.00 0.00 ? 93  PHE A CB   5  
ATOM 9206  C CG   . PHE A 1 93  ? 12.003  -2.363  -2.909  1.00 0.00 ? 93  PHE A CG   5  
ATOM 9207  C CD1  . PHE A 1 93  ? 12.879  -3.060  -3.725  1.00 0.00 ? 93  PHE A CD1  5  
ATOM 9208  C CD2  . PHE A 1 93  ? 12.523  -1.445  -2.004  1.00 0.00 ? 93  PHE A CD2  5  
ATOM 9209  C CE1  . PHE A 1 93  ? 14.244  -2.847  -3.641  1.00 0.00 ? 93  PHE A CE1  5  
ATOM 9210  C CE2  . PHE A 1 93  ? 13.884  -1.230  -1.915  1.00 0.00 ? 93  PHE A CE2  5  
ATOM 9211  C CZ   . PHE A 1 93  ? 14.746  -1.933  -2.734  1.00 0.00 ? 93  PHE A CZ   5  
ATOM 9212  H H    . PHE A 1 93  ? 8.075   -3.007  -1.726  1.00 0.00 ? 93  PHE A H    5  
ATOM 9213  H HA   . PHE A 1 93  ? 10.357  -4.686  -2.524  1.00 0.00 ? 93  PHE A HA   5  
ATOM 9214  H HB2  . PHE A 1 93  ? 10.276  -2.809  -4.031  1.00 0.00 ? 93  PHE A HB2  5  
ATOM 9215  H HB3  . PHE A 1 93  ? 10.016  -1.691  -2.701  1.00 0.00 ? 93  PHE A HB3  5  
ATOM 9216  H HD1  . PHE A 1 93  ? 12.488  -3.775  -4.432  1.00 0.00 ? 93  PHE A HD1  5  
ATOM 9217  H HD2  . PHE A 1 93  ? 11.849  -0.895  -1.363  1.00 0.00 ? 93  PHE A HD2  5  
ATOM 9218  H HE1  . PHE A 1 93  ? 14.917  -3.398  -4.281  1.00 0.00 ? 93  PHE A HE1  5  
ATOM 9219  H HE2  . PHE A 1 93  ? 14.277  -0.516  -1.199  1.00 0.00 ? 93  PHE A HE2  5  
ATOM 9220  H HZ   . PHE A 1 93  ? 15.812  -1.766  -2.668  1.00 0.00 ? 93  PHE A HZ   5  
ATOM 9221  N N    . THR A 1 94  ? 11.497  -4.375  -0.325  1.00 0.00 ? 94  THR A N    5  
ATOM 9222  C CA   . THR A 1 94  ? 12.096  -4.239  0.984   1.00 0.00 ? 94  THR A CA   5  
ATOM 9223  C C    . THR A 1 94  ? 13.391  -3.444  0.897   1.00 0.00 ? 94  THR A C    5  
ATOM 9224  O O    . THR A 1 94  ? 14.388  -3.909  0.340   1.00 0.00 ? 94  THR A O    5  
ATOM 9225  C CB   . THR A 1 94  ? 12.341  -5.609  1.627   1.00 0.00 ? 94  THR A CB   5  
ATOM 9226  O OG1  . THR A 1 94  ? 12.690  -6.575  0.623   1.00 0.00 ? 94  THR A OG1  5  
ATOM 9227  C CG2  . THR A 1 94  ? 11.108  -6.067  2.391   1.00 0.00 ? 94  THR A CG2  5  
ATOM 9228  H H    . THR A 1 94  ? 11.832  -5.063  -0.936  1.00 0.00 ? 94  THR A H    5  
ATOM 9229  H HA   . THR A 1 94  ? 11.399  -3.694  1.607   1.00 0.00 ? 94  THR A HA   5  
ATOM 9230  H HB   . THR A 1 94  ? 13.157  -5.511  2.322   1.00 0.00 ? 94  THR A HB   5  
ATOM 9231  H HG1  . THR A 1 94  ? 12.198  -7.396  0.783   1.00 0.00 ? 94  THR A HG1  5  
ATOM 9232  H HG21 . THR A 1 94  ? 10.892  -5.363  3.182   1.00 0.00 ? 94  THR A HG21 5  
ATOM 9233  H HG22 . THR A 1 94  ? 11.290  -7.043  2.818   1.00 0.00 ? 94  THR A HG22 5  
ATOM 9234  H HG23 . THR A 1 94  ? 10.265  -6.119  1.717   1.00 0.00 ? 94  THR A HG23 5  
ATOM 9235  N N    . PHE A 1 95  ? 13.355  -2.231  1.432   1.00 0.00 ? 95  PHE A N    5  
ATOM 9236  C CA   . PHE A 1 95  ? 14.476  -1.311  1.326   1.00 0.00 ? 95  PHE A CA   5  
ATOM 9237  C C    . PHE A 1 95  ? 15.551  -1.658  2.342   1.00 0.00 ? 95  PHE A C    5  
ATOM 9238  O O    . PHE A 1 95  ? 15.370  -1.459  3.543   1.00 0.00 ? 95  PHE A O    5  
ATOM 9239  C CB   . PHE A 1 95  ? 13.986  0.128   1.523   1.00 0.00 ? 95  PHE A CB   5  
ATOM 9240  C CG   . PHE A 1 95  ? 15.000  1.178   1.170   1.00 0.00 ? 95  PHE A CG   5  
ATOM 9241  C CD1  . PHE A 1 95  ? 15.569  1.215   -0.093  1.00 0.00 ? 95  PHE A CD1  5  
ATOM 9242  C CD2  . PHE A 1 95  ? 15.377  2.135   2.098   1.00 0.00 ? 95  PHE A CD2  5  
ATOM 9243  C CE1  . PHE A 1 95  ? 16.496  2.185   -0.423  1.00 0.00 ? 95  PHE A CE1  5  
ATOM 9244  C CE2  . PHE A 1 95  ? 16.301  3.107   1.774   1.00 0.00 ? 95  PHE A CE2  5  
ATOM 9245  C CZ   . PHE A 1 95  ? 16.862  3.132   0.512   1.00 0.00 ? 95  PHE A CZ   5  
ATOM 9246  H H    . PHE A 1 95  ? 12.554  -1.951  1.923   1.00 0.00 ? 95  PHE A H    5  
ATOM 9247  H HA   . PHE A 1 95  ? 14.892  -1.409  0.335   1.00 0.00 ? 95  PHE A HA   5  
ATOM 9248  H HB2  . PHE A 1 95  ? 13.115  0.292   0.907   1.00 0.00 ? 95  PHE A HB2  5  
ATOM 9249  H HB3  . PHE A 1 95  ? 13.713  0.264   2.561   1.00 0.00 ? 95  PHE A HB3  5  
ATOM 9250  H HD1  . PHE A 1 95  ? 15.283  0.474   -0.824  1.00 0.00 ? 95  PHE A HD1  5  
ATOM 9251  H HD2  . PHE A 1 95  ? 14.939  2.114   3.086   1.00 0.00 ? 95  PHE A HD2  5  
ATOM 9252  H HE1  . PHE A 1 95  ? 16.932  2.201   -1.409  1.00 0.00 ? 95  PHE A HE1  5  
ATOM 9253  H HE2  . PHE A 1 95  ? 16.586  3.846   2.506   1.00 0.00 ? 95  PHE A HE2  5  
ATOM 9254  H HZ   . PHE A 1 95  ? 17.584  3.892   0.256   1.00 0.00 ? 95  PHE A HZ   5  
ATOM 9255  N N    . GLN A 1 96  ? 16.656  -2.197  1.855   1.00 0.00 ? 96  GLN A N    5  
ATOM 9256  C CA   . GLN A 1 96  ? 17.763  -2.578  2.714   1.00 0.00 ? 96  GLN A CA   5  
ATOM 9257  C C    . GLN A 1 96  ? 18.848  -1.519  2.693   1.00 0.00 ? 96  GLN A C    5  
ATOM 9258  O O    . GLN A 1 96  ? 19.103  -0.890  1.664   1.00 0.00 ? 96  GLN A O    5  
ATOM 9259  C CB   . GLN A 1 96  ? 18.358  -3.911  2.268   1.00 0.00 ? 96  GLN A CB   5  
ATOM 9260  C CG   . GLN A 1 96  ? 17.414  -5.088  2.416   1.00 0.00 ? 96  GLN A CG   5  
ATOM 9261  C CD   . GLN A 1 96  ? 18.060  -6.392  2.005   1.00 0.00 ? 96  GLN A CD   5  
ATOM 9262  O OE1  . GLN A 1 96  ? 17.974  -6.808  0.848   1.00 0.00 ? 96  GLN A OE1  5  
ATOM 9263  N NE2  . GLN A 1 96  ? 18.729  -7.038  2.945   1.00 0.00 ? 96  GLN A NE2  5  
ATOM 9264  H H    . GLN A 1 96  ? 16.732  -2.341  0.885   1.00 0.00 ? 96  GLN A H    5  
ATOM 9265  H HA   . GLN A 1 96  ? 17.387  -2.677  3.720   1.00 0.00 ? 96  GLN A HA   5  
ATOM 9266  H HB2  . GLN A 1 96  ? 18.639  -3.835  1.228   1.00 0.00 ? 96  GLN A HB2  5  
ATOM 9267  H HB3  . GLN A 1 96  ? 19.242  -4.111  2.856   1.00 0.00 ? 96  GLN A HB3  5  
ATOM 9268  H HG2  . GLN A 1 96  ? 17.108  -5.163  3.448   1.00 0.00 ? 96  GLN A HG2  5  
ATOM 9269  H HG3  . GLN A 1 96  ? 16.546  -4.920  1.794   1.00 0.00 ? 96  GLN A HG3  5  
ATOM 9270  H HE21 . GLN A 1 96  ? 18.770  -6.640  3.845   1.00 0.00 ? 96  GLN A HE21 5  
ATOM 9271  H HE22 . GLN A 1 96  ? 19.161  -7.891  2.710   1.00 0.00 ? 96  GLN A HE22 5  
ATOM 9272  N N    . ASN A 1 97  ? 19.475  -1.319  3.837   1.00 0.00 ? 97  ASN A N    5  
ATOM 9273  C CA   . ASN A 1 97  ? 20.612  -0.424  3.932   1.00 0.00 ? 97  ASN A CA   5  
ATOM 9274  C C    . ASN A 1 97  ? 21.864  -1.164  3.483   1.00 0.00 ? 97  ASN A C    5  
ATOM 9275  O O    . ASN A 1 97  ? 22.209  -2.195  4.055   1.00 0.00 ? 97  ASN A O    5  
ATOM 9276  C CB   . ASN A 1 97  ? 20.800  0.052   5.368   1.00 0.00 ? 97  ASN A CB   5  
ATOM 9277  C CG   . ASN A 1 97  ? 21.600  1.335   5.448   1.00 0.00 ? 97  ASN A CG   5  
ATOM 9278  O OD1  . ASN A 1 97  ? 22.834  1.321   5.390   1.00 0.00 ? 97  ASN A OD1  5  
ATOM 9279  N ND2  . ASN A 1 97  ? 20.907  2.453   5.609   1.00 0.00 ? 97  ASN A ND2  5  
ATOM 9280  H H    . ASN A 1 97  ? 19.160  -1.787  4.646   1.00 0.00 ? 97  ASN A H    5  
ATOM 9281  H HA   . ASN A 1 97  ? 20.441  0.424   3.286   1.00 0.00 ? 97  ASN A HA   5  
ATOM 9282  H HB2  . ASN A 1 97  ? 19.833  0.218   5.816   1.00 0.00 ? 97  ASN A HB2  5  
ATOM 9283  H HB3  . ASN A 1 97  ? 21.321  -0.711  5.927   1.00 0.00 ? 97  ASN A HB3  5  
ATOM 9284  H HD21 . ASN A 1 97  ? 19.921  2.383   5.669   1.00 0.00 ? 97  ASN A HD21 5  
ATOM 9285  H HD22 . ASN A 1 97  ? 21.392  3.299   5.668   1.00 0.00 ? 97  ASN A HD22 5  
ATOM 9286  N N    . PRO A 1 98  ? 22.572  -0.645  2.469   1.00 0.00 ? 98  PRO A N    5  
ATOM 9287  C CA   . PRO A 1 98  ? 23.732  -1.329  1.881   1.00 0.00 ? 98  PRO A CA   5  
ATOM 9288  C C    . PRO A 1 98  ? 24.865  -1.546  2.884   1.00 0.00 ? 98  PRO A C    5  
ATOM 9289  O O    . PRO A 1 98  ? 25.713  -2.418  2.693   1.00 0.00 ? 98  PRO A O    5  
ATOM 9290  C CB   . PRO A 1 98  ? 24.186  -0.387  0.759   1.00 0.00 ? 98  PRO A CB   5  
ATOM 9291  C CG   . PRO A 1 98  ? 23.585  0.940   1.084   1.00 0.00 ? 98  PRO A CG   5  
ATOM 9292  C CD   . PRO A 1 98  ? 22.305  0.649   1.816   1.00 0.00 ? 98  PRO A CD   5  
ATOM 9293  H HA   . PRO A 1 98  ? 23.449  -2.282  1.458   1.00 0.00 ? 98  PRO A HA   5  
ATOM 9294  H HB2  . PRO A 1 98  ? 25.266  -0.337  0.744   1.00 0.00 ? 98  PRO A HB2  5  
ATOM 9295  H HB3  . PRO A 1 98  ? 23.827  -0.758  -0.189  1.00 0.00 ? 98  PRO A HB3  5  
ATOM 9296  H HG2  . PRO A 1 98  ? 24.258  1.501   1.716   1.00 0.00 ? 98  PRO A HG2  5  
ATOM 9297  H HG3  . PRO A 1 98  ? 23.382  1.484   0.175   1.00 0.00 ? 98  PRO A HG3  5  
ATOM 9298  H HD2  . PRO A 1 98  ? 22.109  1.419   2.550   1.00 0.00 ? 98  PRO A HD2  5  
ATOM 9299  H HD3  . PRO A 1 98  ? 21.486  0.570   1.121   1.00 0.00 ? 98  PRO A HD3  5  
ATOM 9300  N N    . TYR A 1 99  ? 24.863  -0.764  3.958   1.00 0.00 ? 99  TYR A N    5  
ATOM 9301  C CA   . TYR A 1 99  ? 25.922  -0.836  4.959   1.00 0.00 ? 99  TYR A CA   5  
ATOM 9302  C C    . TYR A 1 99  ? 25.450  -1.553  6.219   1.00 0.00 ? 99  TYR A C    5  
ATOM 9303  O O    . TYR A 1 99  ? 26.257  -1.910  7.077   1.00 0.00 ? 99  TYR A O    5  
ATOM 9304  C CB   . TYR A 1 99  ? 26.412  0.572   5.311   1.00 0.00 ? 99  TYR A CB   5  
ATOM 9305  C CG   . TYR A 1 99  ? 27.017  1.309   4.138   1.00 0.00 ? 99  TYR A CG   5  
ATOM 9306  C CD1  . TYR A 1 99  ? 26.214  1.956   3.207   1.00 0.00 ? 99  TYR A CD1  5  
ATOM 9307  C CD2  . TYR A 1 99  ? 28.392  1.347   3.954   1.00 0.00 ? 99  TYR A CD2  5  
ATOM 9308  C CE1  . TYR A 1 99  ? 26.763  2.619   2.128   1.00 0.00 ? 99  TYR A CE1  5  
ATOM 9309  C CE2  . TYR A 1 99  ? 28.949  2.008   2.879   1.00 0.00 ? 99  TYR A CE2  5  
ATOM 9310  C CZ   . TYR A 1 99  ? 28.131  2.641   1.968   1.00 0.00 ? 99  TYR A CZ   5  
ATOM 9311  O OH   . TYR A 1 99  ? 28.686  3.300   0.891   1.00 0.00 ? 99  TYR A OH   5  
ATOM 9312  H H    . TYR A 1 99  ? 24.131  -0.122  4.078   1.00 0.00 ? 99  TYR A H    5  
ATOM 9313  H HA   . TYR A 1 99  ? 26.742  -1.393  4.531   1.00 0.00 ? 99  TYR A HA   5  
ATOM 9314  H HB2  . TYR A 1 99  ? 25.581  1.156   5.678   1.00 0.00 ? 99  TYR A HB2  5  
ATOM 9315  H HB3  . TYR A 1 99  ? 27.164  0.501   6.082   1.00 0.00 ? 99  TYR A HB3  5  
ATOM 9316  H HD1  . TYR A 1 99  ? 25.143  1.935   3.336   1.00 0.00 ? 99  TYR A HD1  5  
ATOM 9317  H HD2  . TYR A 1 99  ? 29.030  0.848   4.669   1.00 0.00 ? 99  TYR A HD2  5  
ATOM 9318  H HE1  . TYR A 1 99  ? 26.119  3.113   1.415   1.00 0.00 ? 99  TYR A HE1  5  
ATOM 9319  H HE2  . TYR A 1 99  ? 30.022  2.024   2.753   1.00 0.00 ? 99  TYR A HE2  5  
ATOM 9320  H HH   . TYR A 1 99  ? 29.500  2.844   0.622   1.00 0.00 ? 99  TYR A HH   5  
ATOM 9321  N N    . SER A 1 100 ? 24.149  -1.775  6.328   1.00 0.00 ? 100 SER A N    5  
ATOM 9322  C CA   . SER A 1 100 ? 23.588  -2.391  7.522   1.00 0.00 ? 100 SER A CA   5  
ATOM 9323  C C    . SER A 1 100 ? 23.034  -3.781  7.221   1.00 0.00 ? 100 SER A C    5  
ATOM 9324  O O    . SER A 1 100 ? 22.933  -4.621  8.113   1.00 0.00 ? 100 SER A O    5  
ATOM 9325  C CB   . SER A 1 100 ? 22.475  -1.513  8.090   1.00 0.00 ? 100 SER A CB   5  
ATOM 9326  O OG   . SER A 1 100 ? 22.911  -0.178  8.293   1.00 0.00 ? 100 SER A OG   5  
ATOM 9327  H H    . SER A 1 100 ? 23.554  -1.523  5.593   1.00 0.00 ? 100 SER A H    5  
ATOM 9328  H HA   . SER A 1 100 ? 24.376  -2.479  8.255   1.00 0.00 ? 100 SER A HA   5  
ATOM 9329  H HB2  . SER A 1 100 ? 21.643  -1.503  7.401   1.00 0.00 ? 100 SER A HB2  5  
ATOM 9330  H HB3  . SER A 1 100 ? 22.149  -1.919  9.037   1.00 0.00 ? 100 SER A HB3  5  
ATOM 9331  H HG   . SER A 1 100 ? 22.154  0.419   8.204   1.00 0.00 ? 100 SER A HG   5  
ATOM 9332  N N    . ASP A 1 101 ? 22.659  -3.991  5.955   1.00 0.00 ? 101 ASP A N    5  
ATOM 9333  C CA   . ASP A 1 101 ? 22.052  -5.244  5.480   1.00 0.00 ? 101 ASP A CA   5  
ATOM 9334  C C    . ASP A 1 101 ? 20.607  -5.386  5.963   1.00 0.00 ? 101 ASP A C    5  
ATOM 9335  O O    . ASP A 1 101 ? 19.820  -6.140  5.389   1.00 0.00 ? 101 ASP A O    5  
ATOM 9336  C CB   . ASP A 1 101 ? 22.877  -6.470  5.893   1.00 0.00 ? 101 ASP A CB   5  
ATOM 9337  C CG   . ASP A 1 101 ? 22.336  -7.756  5.301   1.00 0.00 ? 101 ASP A CG   5  
ATOM 9338  O OD1  . ASP A 1 101 ? 22.558  -8.000  4.094   1.00 0.00 ? 101 ASP A OD1  5  
ATOM 9339  O OD2  . ASP A 1 101 ? 21.680  -8.526  6.034   1.00 0.00 ? 101 ASP A OD2  5  
ATOM 9340  H H    . ASP A 1 101 ? 22.798  -3.274  5.301   1.00 0.00 ? 101 ASP A H    5  
ATOM 9341  H HA   . ASP A 1 101 ? 22.037  -5.192  4.400   1.00 0.00 ? 101 ASP A HA   5  
ATOM 9342  H HB2  . ASP A 1 101 ? 23.894  -6.343  5.560   1.00 0.00 ? 101 ASP A HB2  5  
ATOM 9343  H HB3  . ASP A 1 101 ? 22.861  -6.558  6.969   1.00 0.00 ? 101 ASP A HB3  5  
ATOM 9344  N N    . GLU A 1 102 ? 20.256  -4.639  7.001   1.00 0.00 ? 102 GLU A N    5  
ATOM 9345  C CA   . GLU A 1 102 ? 18.919  -4.686  7.569   1.00 0.00 ? 102 GLU A CA   5  
ATOM 9346  C C    . GLU A 1 102 ? 17.939  -3.926  6.683   1.00 0.00 ? 102 GLU A C    5  
ATOM 9347  O O    . GLU A 1 102 ? 18.342  -3.229  5.749   1.00 0.00 ? 102 GLU A O    5  
ATOM 9348  C CB   . GLU A 1 102 ? 18.930  -4.086  8.976   1.00 0.00 ? 102 GLU A CB   5  
ATOM 9349  C CG   . GLU A 1 102 ? 19.396  -2.640  9.020   1.00 0.00 ? 102 GLU A CG   5  
ATOM 9350  C CD   . GLU A 1 102 ? 19.404  -2.071  10.421  1.00 0.00 ? 102 GLU A CD   5  
ATOM 9351  O OE1  . GLU A 1 102 ? 18.366  -1.525  10.856  1.00 0.00 ? 102 GLU A OE1  5  
ATOM 9352  O OE2  . GLU A 1 102 ? 20.448  -2.168  11.101  1.00 0.00 ? 102 GLU A OE2  5  
ATOM 9353  H H    . GLU A 1 102 ? 20.912  -4.027  7.391   1.00 0.00 ? 102 GLU A H    5  
ATOM 9354  H HA   . GLU A 1 102 ? 18.615  -5.719  7.627   1.00 0.00 ? 102 GLU A HA   5  
ATOM 9355  H HB2  . GLU A 1 102 ? 17.930  -4.131  9.381   1.00 0.00 ? 102 GLU A HB2  5  
ATOM 9356  H HB3  . GLU A 1 102 ? 19.589  -4.672  9.600   1.00 0.00 ? 102 GLU A HB3  5  
ATOM 9357  H HG2  . GLU A 1 102 ? 20.398  -2.588  8.622   1.00 0.00 ? 102 GLU A HG2  5  
ATOM 9358  H HG3  . GLU A 1 102 ? 18.735  -2.043  8.407   1.00 0.00 ? 102 GLU A HG3  5  
ATOM 9359  N N    . ILE A 1 103 ? 16.658  -4.063  6.981   1.00 0.00 ? 103 ILE A N    5  
ATOM 9360  C CA   . ILE A 1 103 ? 15.624  -3.409  6.207   1.00 0.00 ? 103 ILE A CA   5  
ATOM 9361  C C    . ILE A 1 103 ? 15.088  -2.206  6.955   1.00 0.00 ? 103 ILE A C    5  
ATOM 9362  O O    . ILE A 1 103 ? 14.667  -2.306  8.109   1.00 0.00 ? 103 ILE A O    5  
ATOM 9363  C CB   . ILE A 1 103 ? 14.468  -4.373  5.882   1.00 0.00 ? 103 ILE A CB   5  
ATOM 9364  C CG1  . ILE A 1 103 ? 14.981  -5.505  5.003   1.00 0.00 ? 103 ILE A CG1  5  
ATOM 9365  C CG2  . ILE A 1 103 ? 13.318  -3.641  5.199   1.00 0.00 ? 103 ILE A CG2  5  
ATOM 9366  C CD1  . ILE A 1 103 ? 13.926  -6.525  4.654   1.00 0.00 ? 103 ILE A CD1  5  
ATOM 9367  H H    . ILE A 1 103 ? 16.399  -4.605  7.762   1.00 0.00 ? 103 ILE A H    5  
ATOM 9368  H HA   . ILE A 1 103 ? 16.062  -3.077  5.277   1.00 0.00 ? 103 ILE A HA   5  
ATOM 9369  H HB   . ILE A 1 103 ? 14.100  -4.786  6.809   1.00 0.00 ? 103 ILE A HB   5  
ATOM 9370  H HG12 . ILE A 1 103 ? 15.360  -5.093  4.079   1.00 0.00 ? 103 ILE A HG12 5  
ATOM 9371  H HG13 . ILE A 1 103 ? 15.778  -6.011  5.518   1.00 0.00 ? 103 ILE A HG13 5  
ATOM 9372  H HG21 . ILE A 1 103 ? 13.662  -3.222  4.265   1.00 0.00 ? 103 ILE A HG21 5  
ATOM 9373  H HG22 . ILE A 1 103 ? 12.964  -2.850  5.842   1.00 0.00 ? 103 ILE A HG22 5  
ATOM 9374  H HG23 . ILE A 1 103 ? 12.513  -4.337  5.008   1.00 0.00 ? 103 ILE A HG23 5  
ATOM 9375  H HD11 . ILE A 1 103 ? 13.520  -6.944  5.562   1.00 0.00 ? 103 ILE A HD11 5  
ATOM 9376  H HD12 . ILE A 1 103 ? 14.368  -7.308  4.059   1.00 0.00 ? 103 ILE A HD12 5  
ATOM 9377  H HD13 . ILE A 1 103 ? 13.141  -6.043  4.094   1.00 0.00 ? 103 ILE A HD13 5  
ATOM 9378  N N    . GLU A 1 104 ? 15.131  -1.076  6.279   1.00 0.00 ? 104 GLU A N    5  
ATOM 9379  C CA   . GLU A 1 104 ? 14.655  0.178   6.826   1.00 0.00 ? 104 GLU A CA   5  
ATOM 9380  C C    . GLU A 1 104 ? 13.147  0.105   6.994   1.00 0.00 ? 104 GLU A C    5  
ATOM 9381  O O    . GLU A 1 104 ? 12.602  0.426   8.052   1.00 0.00 ? 104 GLU A O    5  
ATOM 9382  C CB   . GLU A 1 104 ? 15.013  1.320   5.869   1.00 0.00 ? 104 GLU A CB   5  
ATOM 9383  C CG   . GLU A 1 104 ? 16.343  1.125   5.155   1.00 0.00 ? 104 GLU A CG   5  
ATOM 9384  C CD   . GLU A 1 104 ? 17.539  1.199   6.091   1.00 0.00 ? 104 GLU A CD   5  
ATOM 9385  O OE1  . GLU A 1 104 ? 17.858  0.189   6.744   1.00 0.00 ? 104 GLU A OE1  5  
ATOM 9386  O OE2  . GLU A 1 104 ? 18.168  2.278   6.163   1.00 0.00 ? 104 GLU A OE2  5  
ATOM 9387  H H    . GLU A 1 104 ? 15.498  -1.088  5.369   1.00 0.00 ? 104 GLU A H    5  
ATOM 9388  H HA   . GLU A 1 104 ? 15.125  0.342   7.781   1.00 0.00 ? 104 GLU A HA   5  
ATOM 9389  H HB2  . GLU A 1 104 ? 14.236  1.404   5.123   1.00 0.00 ? 104 GLU A HB2  5  
ATOM 9390  H HB3  . GLU A 1 104 ? 15.060  2.242   6.431   1.00 0.00 ? 104 GLU A HB3  5  
ATOM 9391  H HG2  . GLU A 1 104 ? 16.333  0.154   4.667   1.00 0.00 ? 104 GLU A HG2  5  
ATOM 9392  H HG3  . GLU A 1 104 ? 16.444  1.897   4.405   1.00 0.00 ? 104 GLU A HG3  5  
ATOM 9393  N N    . TYR A 1 105 ? 12.494  -0.331  5.920   1.00 0.00 ? 105 TYR A N    5  
ATOM 9394  C CA   . TYR A 1 105 ? 11.044  -0.470  5.861   1.00 0.00 ? 105 TYR A CA   5  
ATOM 9395  C C    . TYR A 1 105 ? 10.640  -1.015  4.497   1.00 0.00 ? 105 TYR A C    5  
ATOM 9396  O O    . TYR A 1 105 ? 11.496  -1.351  3.676   1.00 0.00 ? 105 TYR A O    5  
ATOM 9397  C CB   . TYR A 1 105 ? 10.333  0.872   6.120   1.00 0.00 ? 105 TYR A CB   5  
ATOM 9398  C CG   . TYR A 1 105 ? 10.923  2.059   5.385   1.00 0.00 ? 105 TYR A CG   5  
ATOM 9399  C CD1  . TYR A 1 105 ? 10.879  2.151   3.997   1.00 0.00 ? 105 TYR A CD1  5  
ATOM 9400  C CD2  . TYR A 1 105 ? 11.529  3.091   6.090   1.00 0.00 ? 105 TYR A CD2  5  
ATOM 9401  C CE1  . TYR A 1 105 ? 11.424  3.237   3.337   1.00 0.00 ? 105 TYR A CE1  5  
ATOM 9402  C CE2  . TYR A 1 105 ? 12.074  4.177   5.438   1.00 0.00 ? 105 TYR A CE2  5  
ATOM 9403  C CZ   . TYR A 1 105 ? 12.021  4.246   4.063   1.00 0.00 ? 105 TYR A CZ   5  
ATOM 9404  O OH   . TYR A 1 105 ? 12.569  5.330   3.412   1.00 0.00 ? 105 TYR A OH   5  
ATOM 9405  H H    . TYR A 1 105 ? 13.020  -0.564  5.122   1.00 0.00 ? 105 TYR A H    5  
ATOM 9406  H HA   . TYR A 1 105 ? 10.747  -1.180  6.622   1.00 0.00 ? 105 TYR A HA   5  
ATOM 9407  H HB2  . TYR A 1 105 ? 9.300   0.785   5.818   1.00 0.00 ? 105 TYR A HB2  5  
ATOM 9408  H HB3  . TYR A 1 105 ? 10.370  1.086   7.177   1.00 0.00 ? 105 TYR A HB3  5  
ATOM 9409  H HD1  . TYR A 1 105 ? 10.412  1.359   3.433   1.00 0.00 ? 105 TYR A HD1  5  
ATOM 9410  H HD2  . TYR A 1 105 ? 11.570  3.035   7.167   1.00 0.00 ? 105 TYR A HD2  5  
ATOM 9411  H HE1  . TYR A 1 105 ? 11.382  3.290   2.259   1.00 0.00 ? 105 TYR A HE1  5  
ATOM 9412  H HE2  . TYR A 1 105 ? 12.540  4.969   6.006   1.00 0.00 ? 105 TYR A HE2  5  
ATOM 9413  H HH   . TYR A 1 105 ? 13.409  5.568   3.840   1.00 0.00 ? 105 TYR A HH   5  
ATOM 9414  N N    . ILE A 1 106 ? 9.346   -1.091  4.255   1.00 0.00 ? 106 ILE A N    5  
ATOM 9415  C CA   . ILE A 1 106 ? 8.841   -1.573  2.985   1.00 0.00 ? 106 ILE A CA   5  
ATOM 9416  C C    . ILE A 1 106 ? 8.420   -0.396  2.115   1.00 0.00 ? 106 ILE A C    5  
ATOM 9417  O O    . ILE A 1 106 ? 7.816   0.562   2.601   1.00 0.00 ? 106 ILE A O    5  
ATOM 9418  C CB   . ILE A 1 106 ? 7.634   -2.522  3.173   1.00 0.00 ? 106 ILE A CB   5  
ATOM 9419  C CG1  . ILE A 1 106 ? 8.016   -3.703  4.070   1.00 0.00 ? 106 ILE A CG1  5  
ATOM 9420  C CG2  . ILE A 1 106 ? 7.129   -3.023  1.825   1.00 0.00 ? 106 ILE A CG2  5  
ATOM 9421  C CD1  . ILE A 1 106 ? 6.863   -4.646  4.347   1.00 0.00 ? 106 ILE A CD1  5  
ATOM 9422  H H    . ILE A 1 106 ? 8.708   -0.790  4.939   1.00 0.00 ? 106 ILE A H    5  
ATOM 9423  H HA   . ILE A 1 106 ? 9.632   -2.116  2.489   1.00 0.00 ? 106 ILE A HA   5  
ATOM 9424  H HB   . ILE A 1 106 ? 6.835   -1.962  3.645   1.00 0.00 ? 106 ILE A HB   5  
ATOM 9425  H HG12 . ILE A 1 106 ? 8.799   -4.271  3.594   1.00 0.00 ? 106 ILE A HG12 5  
ATOM 9426  H HG13 . ILE A 1 106 ? 8.372   -3.328  5.018   1.00 0.00 ? 106 ILE A HG13 5  
ATOM 9427  H HG21 . ILE A 1 106 ? 7.926   -3.542  1.315   1.00 0.00 ? 106 ILE A HG21 5  
ATOM 9428  H HG22 . ILE A 1 106 ? 6.806   -2.183  1.229   1.00 0.00 ? 106 ILE A HG22 5  
ATOM 9429  H HG23 . ILE A 1 106 ? 6.300   -3.696  1.979   1.00 0.00 ? 106 ILE A HG23 5  
ATOM 9430  H HD11 . ILE A 1 106 ? 7.196   -5.439  5.002   1.00 0.00 ? 106 ILE A HD11 5  
ATOM 9431  H HD12 . ILE A 1 106 ? 6.512   -5.070  3.419   1.00 0.00 ? 106 ILE A HD12 5  
ATOM 9432  H HD13 . ILE A 1 106 ? 6.058   -4.102  4.823   1.00 0.00 ? 106 ILE A HD13 5  
ATOM 9433  N N    . ILE A 1 107 ? 8.717   -0.485  0.834   1.00 0.00 ? 107 ILE A N    5  
ATOM 9434  C CA   . ILE A 1 107 ? 8.335   0.545   -0.113  1.00 0.00 ? 107 ILE A CA   5  
ATOM 9435  C C    . ILE A 1 107 ? 7.311   -0.050  -1.062  1.00 0.00 ? 107 ILE A C    5  
ATOM 9436  O O    . ILE A 1 107 ? 7.622   -0.959  -1.832  1.00 0.00 ? 107 ILE A O    5  
ATOM 9437  C CB   . ILE A 1 107 ? 9.542   1.080   -0.915  1.00 0.00 ? 107 ILE A CB   5  
ATOM 9438  C CG1  . ILE A 1 107 ? 10.601  1.655   0.030   1.00 0.00 ? 107 ILE A CG1  5  
ATOM 9439  C CG2  . ILE A 1 107 ? 9.088   2.139   -1.911  1.00 0.00 ? 107 ILE A CG2  5  
ATOM 9440  C CD1  . ILE A 1 107 ? 11.813  2.220   -0.682  1.00 0.00 ? 107 ILE A CD1  5  
ATOM 9441  H H    . ILE A 1 107 ? 9.127   -1.312  0.484   1.00 0.00 ? 107 ILE A H    5  
ATOM 9442  H HA   . ILE A 1 107 ? 7.884   1.363   0.434   1.00 0.00 ? 107 ILE A HA   5  
ATOM 9443  H HB   . ILE A 1 107 ? 9.971   0.259   -1.468  1.00 0.00 ? 107 ILE A HB   5  
ATOM 9444  H HG12 . ILE A 1 107 ? 10.160  2.453   0.612   1.00 0.00 ? 107 ILE A HG12 5  
ATOM 9445  H HG13 . ILE A 1 107 ? 10.940  0.878   0.696   1.00 0.00 ? 107 ILE A HG13 5  
ATOM 9446  H HG21 . ILE A 1 107 ? 9.941   2.506   -2.459  1.00 0.00 ? 107 ILE A HG21 5  
ATOM 9447  H HG22 . ILE A 1 107 ? 8.620   2.956   -1.381  1.00 0.00 ? 107 ILE A HG22 5  
ATOM 9448  H HG23 . ILE A 1 107 ? 8.377   1.705   -2.600  1.00 0.00 ? 107 ILE A HG23 5  
ATOM 9449  H HD11 . ILE A 1 107 ? 11.504  3.007   -1.354  1.00 0.00 ? 107 ILE A HD11 5  
ATOM 9450  H HD12 . ILE A 1 107 ? 12.297  1.435   -1.244  1.00 0.00 ? 107 ILE A HD12 5  
ATOM 9451  H HD13 . ILE A 1 107 ? 12.504  2.620   0.045   1.00 0.00 ? 107 ILE A HD13 5  
ATOM 9452  N N    . CYS A 1 108 ? 6.084   0.422   -0.974  1.00 0.00 ? 108 CYS A N    5  
ATOM 9453  C CA   . CYS A 1 108 ? 5.003   -0.171  -1.731  1.00 0.00 ? 108 CYS A CA   5  
ATOM 9454  C C    . CYS A 1 108 ? 4.477   0.765   -2.811  1.00 0.00 ? 108 CYS A C    5  
ATOM 9455  O O    . CYS A 1 108 ? 4.023   1.879   -2.529  1.00 0.00 ? 108 CYS A O    5  
ATOM 9456  C CB   . CYS A 1 108 ? 3.875   -0.594  -0.786  1.00 0.00 ? 108 CYS A CB   5  
ATOM 9457  S SG   . CYS A 1 108 ? 3.383   0.672   0.409   1.00 0.00 ? 108 CYS A SG   5  
ATOM 9458  H H    . CYS A 1 108 ? 5.900   1.194   -0.392  1.00 0.00 ? 108 CYS A H    5  
ATOM 9459  H HA   . CYS A 1 108 ? 5.394   -1.056  -2.212  1.00 0.00 ? 108 CYS A HA   5  
ATOM 9460  H HB2  . CYS A 1 108 ? 3.003   -0.845  -1.368  1.00 0.00 ? 108 CYS A HB2  5  
ATOM 9461  H HB3  . CYS A 1 108 ? 4.190   -1.464  -0.230  1.00 0.00 ? 108 CYS A HB3  5  
ATOM 9462  H HG   . CYS A 1 108 ? 3.522   1.858   -0.173  1.00 0.00 ? 108 CYS A HG   5  
ATOM 9463  N N    . THR A 1 109 ? 4.576   0.314   -4.049  1.00 0.00 ? 109 THR A N    5  
ATOM 9464  C CA   . THR A 1 109 ? 3.945   0.990   -5.165  1.00 0.00 ? 109 THR A CA   5  
ATOM 9465  C C    . THR A 1 109 ? 2.528   0.451   -5.318  1.00 0.00 ? 109 THR A C    5  
ATOM 9466  O O    . THR A 1 109 ? 2.325   -0.763  -5.355  1.00 0.00 ? 109 THR A O    5  
ATOM 9467  C CB   . THR A 1 109 ? 4.733   0.768   -6.472  1.00 0.00 ? 109 THR A CB   5  
ATOM 9468  O OG1  . THR A 1 109 ? 6.112   1.109   -6.274  1.00 0.00 ? 109 THR A OG1  5  
ATOM 9469  C CG2  . THR A 1 109 ? 4.161   1.608   -7.605  1.00 0.00 ? 109 THR A CG2  5  
ATOM 9470  H H    . THR A 1 109 ? 5.090   -0.506  -4.217  1.00 0.00 ? 109 THR A H    5  
ATOM 9471  H HA   . THR A 1 109 ? 3.906   2.049   -4.948  1.00 0.00 ? 109 THR A HA   5  
ATOM 9472  H HB   . THR A 1 109 ? 4.664   -0.274  -6.747  1.00 0.00 ? 109 THR A HB   5  
ATOM 9473  H HG1  . THR A 1 109 ? 6.591   1.008   -7.104  1.00 0.00 ? 109 THR A HG1  5  
ATOM 9474  H HG21 . THR A 1 109 ? 3.130   1.335   -7.771  1.00 0.00 ? 109 THR A HG21 5  
ATOM 9475  H HG22 . THR A 1 109 ? 4.730   1.434   -8.506  1.00 0.00 ? 109 THR A HG22 5  
ATOM 9476  H HG23 . THR A 1 109 ? 4.219   2.654   -7.340  1.00 0.00 ? 109 THR A HG23 5  
ATOM 9477  N N    . ASN A 1 110 ? 1.555   1.336   -5.409  1.00 0.00 ? 110 ASN A N    5  
ATOM 9478  C CA   . ASN A 1 110 ? 0.161   0.922   -5.374  1.00 0.00 ? 110 ASN A CA   5  
ATOM 9479  C C    . ASN A 1 110 ? -0.535  1.310   -6.666  1.00 0.00 ? 110 ASN A C    5  
ATOM 9480  O O    . ASN A 1 110 ? -0.693  2.495   -6.962  1.00 0.00 ? 110 ASN A O    5  
ATOM 9481  C CB   . ASN A 1 110 ? -0.558  1.542   -4.173  1.00 0.00 ? 110 ASN A CB   5  
ATOM 9482  C CG   . ASN A 1 110 ? 0.085   1.165   -2.850  1.00 0.00 ? 110 ASN A CG   5  
ATOM 9483  O OD1  . ASN A 1 110 ? -0.256  0.150   -2.243  1.00 0.00 ? 110 ASN A OD1  5  
ATOM 9484  N ND2  . ASN A 1 110 ? 1.017   1.985   -2.393  1.00 0.00 ? 110 ASN A ND2  5  
ATOM 9485  H H    . ASN A 1 110 ? 1.775   2.280   -5.560  1.00 0.00 ? 110 ASN A H    5  
ATOM 9486  H HA   . ASN A 1 110 ? 0.139   -0.155  -5.280  1.00 0.00 ? 110 ASN A HA   5  
ATOM 9487  H HB2  . ASN A 1 110 ? -0.539  2.618   -4.265  1.00 0.00 ? 110 ASN A HB2  5  
ATOM 9488  H HB3  . ASN A 1 110 ? -1.585  1.207   -4.162  1.00 0.00 ? 110 ASN A HB3  5  
ATOM 9489  H HD21 . ASN A 1 110 ? 1.236   2.780   -2.926  1.00 0.00 ? 110 ASN A HD21 5  
ATOM 9490  H HD22 . ASN A 1 110 ? 1.455   1.763   -1.545  1.00 0.00 ? 110 ASN A HD22 5  
ATOM 9491  N N    . THR A 1 111 ? -0.938  0.310   -7.433  1.00 0.00 ? 111 THR A N    5  
ATOM 9492  C CA   . THR A 1 111 ? -1.553  0.526   -8.719  1.00 0.00 ? 111 THR A CA   5  
ATOM 9493  C C    . THR A 1 111 ? -3.012  0.098   -8.671  1.00 0.00 ? 111 THR A C    5  
ATOM 9494  O O    . THR A 1 111 ? -3.324  -1.083  -8.508  1.00 0.00 ? 111 THR A O    5  
ATOM 9495  C CB   . THR A 1 111 ? -0.825  -0.275  -9.818  1.00 0.00 ? 111 THR A CB   5  
ATOM 9496  O OG1  . THR A 1 111 ? 0.597   -0.187  -9.633  1.00 0.00 ? 111 THR A OG1  5  
ATOM 9497  C CG2  . THR A 1 111 ? -1.191  0.244   -11.203 1.00 0.00 ? 111 THR A CG2  5  
ATOM 9498  H H    . THR A 1 111 ? -0.832  -0.606  -7.123  1.00 0.00 ? 111 THR A H    5  
ATOM 9499  H HA   . THR A 1 111 ? -1.493  1.578   -8.956  1.00 0.00 ? 111 THR A HA   5  
ATOM 9500  H HB   . THR A 1 111 ? -1.127  -1.310  -9.747  1.00 0.00 ? 111 THR A HB   5  
ATOM 9501  H HG1  . THR A 1 111 ? 0.918   0.677   -9.956  1.00 0.00 ? 111 THR A HG1  5  
ATOM 9502  H HG21 . THR A 1 111 ? -0.916  1.286   -11.283 1.00 0.00 ? 111 THR A HG21 5  
ATOM 9503  H HG22 . THR A 1 111 ? -2.255  0.140   -11.356 1.00 0.00 ? 111 THR A HG22 5  
ATOM 9504  H HG23 . THR A 1 111 ? -0.662  -0.326  -11.952 1.00 0.00 ? 111 THR A HG23 5  
ATOM 9505  N N    . ASN A 1 112 ? -3.894  1.061   -8.814  1.00 0.00 ? 112 ASN A N    5  
ATOM 9506  C CA   . ASN A 1 112 ? -5.324  0.815   -8.762  1.00 0.00 ? 112 ASN A CA   5  
ATOM 9507  C C    . ASN A 1 112 ? -5.804  0.317   -10.125 1.00 0.00 ? 112 ASN A C    5  
ATOM 9508  O O    . ASN A 1 112 ? -5.643  0.999   -11.139 1.00 0.00 ? 112 ASN A O    5  
ATOM 9509  C CB   . ASN A 1 112 ? -6.019  2.116   -8.384  1.00 0.00 ? 112 ASN A CB   5  
ATOM 9510  C CG   . ASN A 1 112 ? -7.535  2.057   -8.480  1.00 0.00 ? 112 ASN A CG   5  
ATOM 9511  O OD1  . ASN A 1 112 ? -8.181  3.019   -8.884  1.00 0.00 ? 112 ASN A OD1  5  
ATOM 9512  N ND2  . ASN A 1 112 ? -8.116  0.941   -8.072  1.00 0.00 ? 112 ASN A ND2  5  
ATOM 9513  H H    . ASN A 1 112 ? -3.572  1.970   -9.003  1.00 0.00 ? 112 ASN A H    5  
ATOM 9514  H HA   . ASN A 1 112 ? -5.525  0.059   -8.006  1.00 0.00 ? 112 ASN A HA   5  
ATOM 9515  H HB2  . ASN A 1 112 ? -5.759  2.363   -7.367  1.00 0.00 ? 112 ASN A HB2  5  
ATOM 9516  H HB3  . ASN A 1 112 ? -5.656  2.893   -9.034  1.00 0.00 ? 112 ASN A HB3  5  
ATOM 9517  H HD21 . ASN A 1 112 ? -7.547  0.220   -7.735  1.00 0.00 ? 112 ASN A HD21 5  
ATOM 9518  H HD22 . ASN A 1 112 ? -9.090  0.889   -8.117  1.00 0.00 ? 112 ASN A HD22 5  
ATOM 9519  N N    . VAL A 1 113 ? -6.378  -0.877  -10.142 1.00 0.00 ? 113 VAL A N    5  
ATOM 9520  C CA   . VAL A 1 113 ? -6.762  -1.527  -11.384 1.00 0.00 ? 113 VAL A CA   5  
ATOM 9521  C C    . VAL A 1 113 ? -8.222  -1.199  -11.739 1.00 0.00 ? 113 VAL A C    5  
ATOM 9522  O O    . VAL A 1 113 ? -8.682  -0.077  -11.534 1.00 0.00 ? 113 VAL A O    5  
ATOM 9523  C CB   . VAL A 1 113 ? -6.555  -3.063  -11.297 1.00 0.00 ? 113 VAL A CB   5  
ATOM 9524  C CG1  . VAL A 1 113 ? -6.386  -3.675  -12.682 1.00 0.00 ? 113 VAL A CG1  5  
ATOM 9525  C CG2  . VAL A 1 113 ? -5.355  -3.398  -10.419 1.00 0.00 ? 113 VAL A CG2  5  
ATOM 9526  H H    . VAL A 1 113 ? -6.555  -1.335  -9.292  1.00 0.00 ? 113 VAL A H    5  
ATOM 9527  H HA   . VAL A 1 113 ? -6.123  -1.144  -12.168 1.00 0.00 ? 113 VAL A HA   5  
ATOM 9528  H HB   . VAL A 1 113 ? -7.435  -3.498  -10.845 1.00 0.00 ? 113 VAL A HB   5  
ATOM 9529  H HG11 . VAL A 1 113 ? -7.262  -3.466  -13.277 1.00 0.00 ? 113 VAL A HG11 5  
ATOM 9530  H HG12 . VAL A 1 113 ? -6.259  -4.743  -12.590 1.00 0.00 ? 113 VAL A HG12 5  
ATOM 9531  H HG13 . VAL A 1 113 ? -5.515  -3.249  -13.159 1.00 0.00 ? 113 VAL A HG13 5  
ATOM 9532  H HG21 . VAL A 1 113 ? -5.242  -4.470  -10.354 1.00 0.00 ? 113 VAL A HG21 5  
ATOM 9533  H HG22 . VAL A 1 113 ? -5.509  -2.991  -9.430  1.00 0.00 ? 113 VAL A HG22 5  
ATOM 9534  H HG23 . VAL A 1 113 ? -4.463  -2.968  -10.848 1.00 0.00 ? 113 VAL A HG23 5  
ATOM 9535  N N    . LYS A 1 114 ? -8.950  -2.180  -12.250 1.00 0.00 ? 114 LYS A N    5  
ATOM 9536  C CA   . LYS A 1 114 ? -10.285 -1.957  -12.809 1.00 0.00 ? 114 LYS A CA   5  
ATOM 9537  C C    . LYS A 1 114 ? -11.277 -2.942  -12.213 1.00 0.00 ? 114 LYS A C    5  
ATOM 9538  O O    . LYS A 1 114 ? -11.070 -3.395  -11.093 1.00 0.00 ? 114 LYS A O    5  
ATOM 9539  C CB   . LYS A 1 114 ? -10.219 -2.103  -14.327 1.00 0.00 ? 114 LYS A CB   5  
ATOM 9540  C CG   . LYS A 1 114 ? -9.113  -1.267  -14.935 1.00 0.00 ? 114 LYS A CG   5  
ATOM 9541  C CD   . LYS A 1 114 ? -9.636  0.021   -15.567 1.00 0.00 ? 114 LYS A CD   5  
ATOM 9542  C CE   . LYS A 1 114 ? -10.328 0.936   -14.563 1.00 0.00 ? 114 LYS A CE   5  
ATOM 9543  N NZ   . LYS A 1 114 ? -9.376  1.547   -13.595 1.00 0.00 ? 114 LYS A NZ   5  
ATOM 9544  H H    . LYS A 1 114 ? -8.587  -3.090  -12.231 1.00 0.00 ? 114 LYS A H    5  
ATOM 9545  H HA   . LYS A 1 114 ? -10.590 -0.952  -12.560 1.00 0.00 ? 114 LYS A HA   5  
ATOM 9546  H HB2  . LYS A 1 114 ? -10.044 -3.139  -14.576 1.00 0.00 ? 114 LYS A HB2  5  
ATOM 9547  H HB3  . LYS A 1 114 ? -11.158 -1.788  -14.757 1.00 0.00 ? 114 LYS A HB3  5  
ATOM 9548  H HG2  . LYS A 1 114 ? -8.422  -1.018  -14.143 1.00 0.00 ? 114 LYS A HG2  5  
ATOM 9549  H HG3  . LYS A 1 114 ? -8.605  -1.853  -15.688 1.00 0.00 ? 114 LYS A HG3  5  
ATOM 9550  H HD2  . LYS A 1 114 ? -8.804  0.554   -16.002 1.00 0.00 ? 114 LYS A HD2  5  
ATOM 9551  H HD3  . LYS A 1 114 ? -10.340 -0.238  -16.345 1.00 0.00 ? 114 LYS A HD3  5  
ATOM 9552  H HE2  . LYS A 1 114 ? -10.828 1.725   -15.105 1.00 0.00 ? 114 LYS A HE2  5  
ATOM 9553  H HE3  . LYS A 1 114 ? -11.061 0.359   -14.019 1.00 0.00 ? 114 LYS A HE3  5  
ATOM 9554  H HZ1  . LYS A 1 114 ? -8.667  2.124   -14.100 1.00 0.00 ? 114 LYS A HZ1  5  
ATOM 9555  H HZ2  . LYS A 1 114 ? -8.882  0.806   -13.054 1.00 0.00 ? 114 LYS A HZ2  5  
ATOM 9556  H HZ3  . LYS A 1 114 ? -9.891  2.161   -12.925 1.00 0.00 ? 114 LYS A HZ3  5  
ATOM 9557  N N    . ASN A 1 115 ? -12.362 -3.237  -12.947 1.00 0.00 ? 115 ASN A N    5  
ATOM 9558  C CA   . ASN A 1 115 ? -13.393 -4.195  -12.509 1.00 0.00 ? 115 ASN A CA   5  
ATOM 9559  C C    . ASN A 1 115 ? -14.277 -3.590  -11.421 1.00 0.00 ? 115 ASN A C    5  
ATOM 9560  O O    . ASN A 1 115 ? -15.502 -3.641  -11.502 1.00 0.00 ? 115 ASN A O    5  
ATOM 9561  C CB   . ASN A 1 115 ? -12.758 -5.505  -12.019 1.00 0.00 ? 115 ASN A CB   5  
ATOM 9562  C CG   . ASN A 1 115 ? -13.764 -6.478  -11.426 1.00 0.00 ? 115 ASN A CG   5  
ATOM 9563  O OD1  . ASN A 1 115 ? -14.041 -6.449  -10.226 1.00 0.00 ? 115 ASN A OD1  5  
ATOM 9564  N ND2  . ASN A 1 115 ? -14.299 -7.364  -12.250 1.00 0.00 ? 115 ASN A ND2  5  
ATOM 9565  H H    . ASN A 1 115 ? -12.482 -2.787  -13.813 1.00 0.00 ? 115 ASN A H    5  
ATOM 9566  H HA   . ASN A 1 115 ? -14.014 -4.413  -13.366 1.00 0.00 ? 115 ASN A HA   5  
ATOM 9567  H HB2  . ASN A 1 115 ? -12.268 -5.989  -12.849 1.00 0.00 ? 115 ASN A HB2  5  
ATOM 9568  H HB3  . ASN A 1 115 ? -12.025 -5.272  -11.262 1.00 0.00 ? 115 ASN A HB3  5  
ATOM 9569  H HD21 . ASN A 1 115 ? -14.030 -7.348  -13.194 1.00 0.00 ? 115 ASN A HD21 5  
ATOM 9570  H HD22 . ASN A 1 115 ? -14.938 -8.014  -11.880 1.00 0.00 ? 115 ASN A HD22 5  
ATOM 9571  N N    . SER A 1 116 ? -13.641 -3.006  -10.419 1.00 0.00 ? 116 SER A N    5  
ATOM 9572  C CA   . SER A 1 116 ? -14.334 -2.333  -9.334  1.00 0.00 ? 116 SER A CA   5  
ATOM 9573  C C    . SER A 1 116 ? -14.704 -0.902  -9.722  1.00 0.00 ? 116 SER A C    5  
ATOM 9574  O O    . SER A 1 116 ? -15.087 -0.091  -8.880  1.00 0.00 ? 116 SER A O    5  
ATOM 9575  C CB   . SER A 1 116 ? -13.424 -2.331  -8.108  1.00 0.00 ? 116 SER A CB   5  
ATOM 9576  O OG   . SER A 1 116 ? -12.093 -2.002  -8.483  1.00 0.00 ? 116 SER A OG   5  
ATOM 9577  H H    . SER A 1 116 ? -12.657 -3.038  -10.400 1.00 0.00 ? 116 SER A H    5  
ATOM 9578  H HA   . SER A 1 116 ? -15.233 -2.886  -9.108  1.00 0.00 ? 116 SER A HA   5  
ATOM 9579  H HB2  . SER A 1 116 ? -13.779 -1.598  -7.398  1.00 0.00 ? 116 SER A HB2  5  
ATOM 9580  H HB3  . SER A 1 116 ? -13.428 -3.310  -7.652  1.00 0.00 ? 116 SER A HB3  5  
ATOM 9581  H HG   . SER A 1 116 ? -12.094 -1.160  -8.956  1.00 0.00 ? 116 SER A HG   5  
ATOM 9582  N N    . SER A 1 117 ? -14.579 -0.604  -11.007 1.00 0.00 ? 117 SER A N    5  
ATOM 9583  C CA   . SER A 1 117 ? -14.866 0.720   -11.524 1.00 0.00 ? 117 SER A CA   5  
ATOM 9584  C C    . SER A 1 117 ? -16.370 0.974   -11.549 1.00 0.00 ? 117 SER A C    5  
ATOM 9585  O O    . SER A 1 117 ? -17.110 0.323   -12.288 1.00 0.00 ? 117 SER A O    5  
ATOM 9586  C CB   . SER A 1 117 ? -14.272 0.846   -12.923 1.00 0.00 ? 117 SER A CB   5  
ATOM 9587  O OG   . SER A 1 117 ? -12.925 0.402   -12.923 1.00 0.00 ? 117 SER A OG   5  
ATOM 9588  H H    . SER A 1 117 ? -14.291 -1.303  -11.630 1.00 0.00 ? 117 SER A H    5  
ATOM 9589  H HA   . SER A 1 117 ? -14.397 1.444   -10.875 1.00 0.00 ? 117 SER A HA   5  
ATOM 9590  H HB2  . SER A 1 117 ? -14.841 0.241   -13.614 1.00 0.00 ? 117 SER A HB2  5  
ATOM 9591  H HB3  . SER A 1 117 ? -14.301 1.878   -13.237 1.00 0.00 ? 117 SER A HB3  5  
ATOM 9592  H HG   . SER A 1 117 ? -12.574 0.445   -12.024 1.00 0.00 ? 117 SER A HG   5  
ATOM 9593  N N    . GLN A 1 118 ? -16.814 1.912   -10.725 1.00 0.00 ? 118 GLN A N    5  
ATOM 9594  C CA   . GLN A 1 118 ? -18.233 2.200   -10.589 1.00 0.00 ? 118 GLN A CA   5  
ATOM 9595  C C    . GLN A 1 118 ? -18.691 3.194   -11.652 1.00 0.00 ? 118 GLN A C    5  
ATOM 9596  O O    . GLN A 1 118 ? -19.755 3.022   -12.251 1.00 0.00 ? 118 GLN A O    5  
ATOM 9597  C CB   . GLN A 1 118 ? -18.526 2.749   -9.189  1.00 0.00 ? 118 GLN A CB   5  
ATOM 9598  C CG   . GLN A 1 118 ? -19.993 3.065   -8.948  1.00 0.00 ? 118 GLN A CG   5  
ATOM 9599  C CD   . GLN A 1 118 ? -20.256 3.609   -7.556  1.00 0.00 ? 118 GLN A CD   5  
ATOM 9600  O OE1  . GLN A 1 118 ? -21.336 3.416   -6.998  1.00 0.00 ? 118 GLN A OE1  5  
ATOM 9601  N NE2  . GLN A 1 118 ? -19.274 4.289   -6.986  1.00 0.00 ? 118 GLN A NE2  5  
ATOM 9602  H H    . GLN A 1 118 ? -16.169 2.432   -10.199 1.00 0.00 ? 118 GLN A H    5  
ATOM 9603  H HA   . GLN A 1 118 ? -18.771 1.275   -10.724 1.00 0.00 ? 118 GLN A HA   5  
ATOM 9604  H HB2  . GLN A 1 118 ? -18.212 2.019   -8.456  1.00 0.00 ? 118 GLN A HB2  5  
ATOM 9605  H HB3  . GLN A 1 118 ? -17.958 3.656   -9.045  1.00 0.00 ? 118 GLN A HB3  5  
ATOM 9606  H HG2  . GLN A 1 118 ? -20.313 3.799   -9.671  1.00 0.00 ? 118 GLN A HG2  5  
ATOM 9607  H HG3  . GLN A 1 118 ? -20.569 2.159   -9.078  1.00 0.00 ? 118 GLN A HG3  5  
ATOM 9608  H HE21 . GLN A 1 118 ? -18.437 4.404   -7.483  1.00 0.00 ? 118 GLN A HE21 5  
ATOM 9609  H HE22 . GLN A 1 118 ? -19.424 4.656   -6.086  1.00 0.00 ? 118 GLN A HE22 5  
ATOM 9610  N N    . GLU A 1 119 ? -17.868 4.216   -11.875 1.00 0.00 ? 119 GLU A N    5  
ATOM 9611  C CA   . GLU A 1 119 ? -18.159 5.281   -12.833 1.00 0.00 ? 119 GLU A CA   5  
ATOM 9612  C C    . GLU A 1 119 ? -19.332 6.120   -12.338 1.00 0.00 ? 119 GLU A C    5  
ATOM 9613  O O    . GLU A 1 119 ? -19.082 7.122   -11.631 1.00 0.00 ? 119 GLU A O    5  
ATOM 9614  C CB   . GLU A 1 119 ? -18.444 4.708   -14.231 1.00 0.00 ? 119 GLU A CB   5  
ATOM 9615  C CG   . GLU A 1 119 ? -18.519 5.758   -15.328 1.00 0.00 ? 119 GLU A CG   5  
ATOM 9616  C CD   . GLU A 1 119 ? -17.216 6.510   -15.504 1.00 0.00 ? 119 GLU A CD   5  
ATOM 9617  O OE1  . GLU A 1 119 ? -16.267 5.939   -16.083 1.00 0.00 ? 119 GLU A OE1  5  
ATOM 9618  O OE2  . GLU A 1 119 ? -17.140 7.680   -15.077 1.00 0.00 ? 119 GLU A OE2  5  
ATOM 9619  O OXT  . GLU A 1 119 ? -20.496 5.771   -12.624 1.00 0.00 ? 119 GLU A OXT  5  
ATOM 9620  H H    . GLU A 1 119 ? -17.033 4.266   -11.358 1.00 0.00 ? 119 GLU A H    5  
ATOM 9621  H HA   . GLU A 1 119 ? -17.285 5.913   -12.888 1.00 0.00 ? 119 GLU A HA   5  
ATOM 9622  H HB2  . GLU A 1 119 ? -17.663 4.008   -14.488 1.00 0.00 ? 119 GLU A HB2  5  
ATOM 9623  H HB3  . GLU A 1 119 ? -19.387 4.182   -14.203 1.00 0.00 ? 119 GLU A HB3  5  
ATOM 9624  H HG2  . GLU A 1 119 ? -18.764 5.270   -16.258 1.00 0.00 ? 119 GLU A HG2  5  
ATOM 9625  H HG3  . GLU A 1 119 ? -19.296 6.465   -15.077 1.00 0.00 ? 119 GLU A HG3  5  
ATOM 9626  N N    . GLY A 1 1   ? -5.144  21.156  -1.574  1.00 0.00 ? 1   GLY A N    6  
ATOM 9627  C CA   . GLY A 1 1   ? -6.443  21.168  -0.862  1.00 0.00 ? 1   GLY A CA   6  
ATOM 9628  C C    . GLY A 1 1   ? -6.761  19.821  -0.255  1.00 0.00 ? 1   GLY A C    6  
ATOM 9629  O O    . GLY A 1 1   ? -5.936  18.909  -0.301  1.00 0.00 ? 1   GLY A O    6  
ATOM 9630  H H1   . GLY A 1 1   ? -4.941  22.100  -1.966  1.00 0.00 ? 1   GLY A H1   6  
ATOM 9631  H H2   . GLY A 1 1   ? -5.172  20.473  -2.356  1.00 0.00 ? 1   GLY A H2   6  
ATOM 9632  H H3   . GLY A 1 1   ? -4.376  20.891  -0.921  1.00 0.00 ? 1   GLY A H3   6  
ATOM 9633  H HA2  . GLY A 1 1   ? -6.404  21.908  -0.077  1.00 0.00 ? 1   GLY A HA2  6  
ATOM 9634  H HA3  . GLY A 1 1   ? -7.224  21.434  -1.559  1.00 0.00 ? 1   GLY A HA3  6  
ATOM 9635  N N    . ALA A 1 2   ? -7.951  19.688  0.310   1.00 0.00 ? 2   ALA A N    6  
ATOM 9636  C CA   . ALA A 1 2   ? -8.356  18.451  0.961   1.00 0.00 ? 2   ALA A CA   6  
ATOM 9637  C C    . ALA A 1 2   ? -9.351  17.691  0.097   1.00 0.00 ? 2   ALA A C    6  
ATOM 9638  O O    . ALA A 1 2   ? -9.809  18.210  -0.926  1.00 0.00 ? 2   ALA A O    6  
ATOM 9639  C CB   . ALA A 1 2   ? -8.962  18.749  2.324   1.00 0.00 ? 2   ALA A CB   6  
ATOM 9640  H H    . ALA A 1 2   ? -8.582  20.447  0.285   1.00 0.00 ? 2   ALA A H    6  
ATOM 9641  H HA   . ALA A 1 2   ? -7.478  17.839  1.105   1.00 0.00 ? 2   ALA A HA   6  
ATOM 9642  H HB1  . ALA A 1 2   ? -8.241  19.272  2.933   1.00 0.00 ? 2   ALA A HB1  6  
ATOM 9643  H HB2  . ALA A 1 2   ? -9.240  17.823  2.808   1.00 0.00 ? 2   ALA A HB2  6  
ATOM 9644  H HB3  . ALA A 1 2   ? -9.840  19.366  2.199   1.00 0.00 ? 2   ALA A HB3  6  
ATOM 9645  N N    . MET A 1 3   ? -9.667  16.462  0.512   1.00 0.00 ? 3   MET A N    6  
ATOM 9646  C CA   . MET A 1 3   ? -10.628 15.598  -0.185  1.00 0.00 ? 3   MET A CA   6  
ATOM 9647  C C    . MET A 1 3   ? -10.093 15.117  -1.527  1.00 0.00 ? 3   MET A C    6  
ATOM 9648  O O    . MET A 1 3   ? -9.863  13.927  -1.708  1.00 0.00 ? 3   MET A O    6  
ATOM 9649  C CB   . MET A 1 3   ? -11.982 16.293  -0.371  1.00 0.00 ? 3   MET A CB   6  
ATOM 9650  C CG   . MET A 1 3   ? -12.832 16.316  0.888   1.00 0.00 ? 3   MET A CG   6  
ATOM 9651  S SD   . MET A 1 3   ? -13.278 14.660  1.447   1.00 0.00 ? 3   MET A SD   6  
ATOM 9652  C CE   . MET A 1 3   ? -14.351 15.050  2.826   1.00 0.00 ? 3   MET A CE   6  
ATOM 9653  H H    . MET A 1 3   ? -9.222  16.111  1.313   1.00 0.00 ? 3   MET A H    6  
ATOM 9654  H HA   . MET A 1 3   ? -10.779 14.730  0.440   1.00 0.00 ? 3   MET A HA   6  
ATOM 9655  H HB2  . MET A 1 3   ? -11.809 17.312  -0.684  1.00 0.00 ? 3   MET A HB2  6  
ATOM 9656  H HB3  . MET A 1 3   ? -12.535 15.776  -1.142  1.00 0.00 ? 3   MET A HB3  6  
ATOM 9657  H HG2  . MET A 1 3   ? -12.277 16.809  1.672   1.00 0.00 ? 3   MET A HG2  6  
ATOM 9658  H HG3  . MET A 1 3   ? -13.738 16.870  0.687   1.00 0.00 ? 3   MET A HG3  6  
ATOM 9659  H HE1  . MET A 1 3   ? -14.704 14.134  3.277   1.00 0.00 ? 3   MET A HE1  6  
ATOM 9660  H HE2  . MET A 1 3   ? -15.194 15.625  2.472   1.00 0.00 ? 3   MET A HE2  6  
ATOM 9661  H HE3  . MET A 1 3   ? -13.804 15.625  3.558   1.00 0.00 ? 3   MET A HE3  6  
ATOM 9662  N N    . ASP A 1 4   ? -9.905  16.038  -2.463  1.00 0.00 ? 4   ASP A N    6  
ATOM 9663  C CA   . ASP A 1 4   ? -9.397  15.694  -3.788  1.00 0.00 ? 4   ASP A CA   6  
ATOM 9664  C C    . ASP A 1 4   ? -7.937  16.094  -3.937  1.00 0.00 ? 4   ASP A C    6  
ATOM 9665  O O    . ASP A 1 4   ? -7.239  15.592  -4.819  1.00 0.00 ? 4   ASP A O    6  
ATOM 9666  C CB   . ASP A 1 4   ? -10.229 16.373  -4.879  1.00 0.00 ? 4   ASP A CB   6  
ATOM 9667  C CG   . ASP A 1 4   ? -11.642 15.831  -4.974  1.00 0.00 ? 4   ASP A CG   6  
ATOM 9668  O OD1  . ASP A 1 4   ? -11.835 14.743  -5.559  1.00 0.00 ? 4   ASP A OD1  6  
ATOM 9669  O OD2  . ASP A 1 4   ? -12.576 16.503  -4.483  1.00 0.00 ? 4   ASP A OD2  6  
ATOM 9670  H H    . ASP A 1 4   ? -10.119 16.976  -2.258  1.00 0.00 ? 4   ASP A H    6  
ATOM 9671  H HA   . ASP A 1 4   ? -9.473  14.623  -3.903  1.00 0.00 ? 4   ASP A HA   6  
ATOM 9672  H HB2  . ASP A 1 4   ? -10.284 17.431  -4.670  1.00 0.00 ? 4   ASP A HB2  6  
ATOM 9673  H HB3  . ASP A 1 4   ? -9.742  16.226  -5.832  1.00 0.00 ? 4   ASP A HB3  6  
ATOM 9674  N N    . ASN A 1 5   ? -7.490  16.998  -3.062  1.00 0.00 ? 5   ASN A N    6  
ATOM 9675  C CA   . ASN A 1 5   ? -6.124  17.536  -3.086  1.00 0.00 ? 5   ASN A CA   6  
ATOM 9676  C C    . ASN A 1 5   ? -5.924  18.427  -4.307  1.00 0.00 ? 5   ASN A C    6  
ATOM 9677  O O    . ASN A 1 5   ? -5.934  19.655  -4.193  1.00 0.00 ? 5   ASN A O    6  
ATOM 9678  C CB   . ASN A 1 5   ? -5.062  16.421  -3.056  1.00 0.00 ? 5   ASN A CB   6  
ATOM 9679  C CG   . ASN A 1 5   ? -4.149  16.505  -1.841  1.00 0.00 ? 5   ASN A CG   6  
ATOM 9680  O OD1  . ASN A 1 5   ? -3.073  17.097  -1.898  1.00 0.00 ? 5   ASN A OD1  6  
ATOM 9681  N ND2  . ASN A 1 5   ? -4.574  15.916  -0.731  1.00 0.00 ? 5   ASN A ND2  6  
ATOM 9682  H H    . ASN A 1 5   ? -8.106  17.328  -2.381  1.00 0.00 ? 5   ASN A H    6  
ATOM 9683  H HA   . ASN A 1 5   ? -6.009  18.147  -2.202  1.00 0.00 ? 5   ASN A HA   6  
ATOM 9684  H HB2  . ASN A 1 5   ? -5.549  15.459  -3.051  1.00 0.00 ? 5   ASN A HB2  6  
ATOM 9685  H HB3  . ASN A 1 5   ? -4.452  16.501  -3.944  1.00 0.00 ? 5   ASN A HB3  6  
ATOM 9686  H HD21 . ASN A 1 5   ? -5.446  15.464  -0.748  1.00 0.00 ? 5   ASN A HD21 6  
ATOM 9687  H HD22 . ASN A 1 5   ? -4.004  15.967  0.065   1.00 0.00 ? 5   ASN A HD22 6  
ATOM 9688  N N    . VAL A 1 6   ? -5.778  17.799  -5.467  1.00 0.00 ? 6   VAL A N    6  
ATOM 9689  C CA   . VAL A 1 6   ? -5.589  18.501  -6.727  1.00 0.00 ? 6   VAL A CA   6  
ATOM 9690  C C    . VAL A 1 6   ? -5.483  17.454  -7.847  1.00 0.00 ? 6   VAL A C    6  
ATOM 9691  O O    . VAL A 1 6   ? -5.734  16.275  -7.595  1.00 0.00 ? 6   VAL A O    6  
ATOM 9692  C CB   . VAL A 1 6   ? -4.336  19.425  -6.669  1.00 0.00 ? 6   VAL A CB   6  
ATOM 9693  C CG1  . VAL A 1 6   ? -3.053  18.685  -7.016  1.00 0.00 ? 6   VAL A CG1  6  
ATOM 9694  C CG2  . VAL A 1 6   ? -4.522  20.663  -7.534  1.00 0.00 ? 6   VAL A CG2  6  
ATOM 9695  H H    . VAL A 1 6   ? -5.815  16.816  -5.482  1.00 0.00 ? 6   VAL A H    6  
ATOM 9696  H HA   . VAL A 1 6   ? -6.464  19.116  -6.902  1.00 0.00 ? 6   VAL A HA   6  
ATOM 9697  H HB   . VAL A 1 6   ? -4.239  19.762  -5.646  1.00 0.00 ? 6   VAL A HB   6  
ATOM 9698  H HG11 . VAL A 1 6   ? -3.140  18.252  -8.000  1.00 0.00 ? 6   VAL A HG11 6  
ATOM 9699  H HG12 . VAL A 1 6   ? -2.883  17.902  -6.291  1.00 0.00 ? 6   VAL A HG12 6  
ATOM 9700  H HG13 . VAL A 1 6   ? -2.224  19.376  -6.998  1.00 0.00 ? 6   VAL A HG13 6  
ATOM 9701  H HG21 . VAL A 1 6   ? -4.479  20.394  -8.575  1.00 0.00 ? 6   VAL A HG21 6  
ATOM 9702  H HG22 . VAL A 1 6   ? -3.742  21.378  -7.314  1.00 0.00 ? 6   VAL A HG22 6  
ATOM 9703  H HG23 . VAL A 1 6   ? -5.484  21.105  -7.317  1.00 0.00 ? 6   VAL A HG23 6  
ATOM 9704  N N    . CYS A 1 7   ? -5.153  17.863  -9.068  1.00 0.00 ? 7   CYS A N    6  
ATOM 9705  C CA   . CYS A 1 7   ? -4.974  16.929  -10.177 1.00 0.00 ? 7   CYS A CA   6  
ATOM 9706  C C    . CYS A 1 7   ? -3.834  15.942  -9.895  1.00 0.00 ? 7   CYS A C    6  
ATOM 9707  O O    . CYS A 1 7   ? -2.667  16.209  -10.196 1.00 0.00 ? 7   CYS A O    6  
ATOM 9708  C CB   . CYS A 1 7   ? -4.705  17.713  -11.463 1.00 0.00 ? 7   CYS A CB   6  
ATOM 9709  S SG   . CYS A 1 7   ? -3.567  19.104  -11.251 1.00 0.00 ? 7   CYS A SG   6  
ATOM 9710  H H    . CYS A 1 7   ? -5.023  18.815  -9.234  1.00 0.00 ? 7   CYS A H    6  
ATOM 9711  H HA   . CYS A 1 7   ? -5.893  16.372  -10.292 1.00 0.00 ? 7   CYS A HA   6  
ATOM 9712  H HB2  . CYS A 1 7   ? -4.278  17.048  -12.201 1.00 0.00 ? 7   CYS A HB2  6  
ATOM 9713  H HB3  . CYS A 1 7   ? -5.638  18.105  -11.839 1.00 0.00 ? 7   CYS A HB3  6  
ATOM 9714  H HG   . CYS A 1 7   ? -2.370  18.606  -10.952 1.00 0.00 ? 7   CYS A HG   6  
ATOM 9715  N N    . GLN A 1 8   ? -4.181  14.804  -9.310  1.00 0.00 ? 8   GLN A N    6  
ATOM 9716  C CA   . GLN A 1 8   ? -3.198  13.798  -8.935  1.00 0.00 ? 8   GLN A CA   6  
ATOM 9717  C C    . GLN A 1 8   ? -3.337  12.547  -9.804  1.00 0.00 ? 8   GLN A C    6  
ATOM 9718  O O    . GLN A 1 8   ? -4.448  12.122  -10.126 1.00 0.00 ? 8   GLN A O    6  
ATOM 9719  C CB   . GLN A 1 8   ? -3.370  13.412  -7.460  1.00 0.00 ? 8   GLN A CB   6  
ATOM 9720  C CG   . GLN A 1 8   ? -3.187  14.569  -6.481  1.00 0.00 ? 8   GLN A CG   6  
ATOM 9721  C CD   . GLN A 1 8   ? -1.746  15.039  -6.351  1.00 0.00 ? 8   GLN A CD   6  
ATOM 9722  O OE1  . GLN A 1 8   ? -1.484  16.222  -6.156  1.00 0.00 ? 8   GLN A OE1  6  
ATOM 9723  N NE2  . GLN A 1 8   ? -0.804  14.117  -6.396  1.00 0.00 ? 8   GLN A NE2  6  
ATOM 9724  H H    . GLN A 1 8   ? -5.130  14.639  -9.115  1.00 0.00 ? 8   GLN A H    6  
ATOM 9725  H HA   . GLN A 1 8   ? -2.214  14.221  -9.077  1.00 0.00 ? 8   GLN A HA   6  
ATOM 9726  H HB2  . GLN A 1 8   ? -4.362  13.009  -7.324  1.00 0.00 ? 8   GLN A HB2  6  
ATOM 9727  H HB3  . GLN A 1 8   ? -2.648  12.648  -7.224  1.00 0.00 ? 8   GLN A HB3  6  
ATOM 9728  H HG2  . GLN A 1 8   ? -3.787  15.402  -6.818  1.00 0.00 ? 8   GLN A HG2  6  
ATOM 9729  H HG3  . GLN A 1 8   ? -3.536  14.254  -5.507  1.00 0.00 ? 8   GLN A HG3  6  
ATOM 9730  H HE21 . GLN A 1 8   ? -1.073  13.186  -6.497  1.00 0.00 ? 8   GLN A HE21 6  
ATOM 9731  H HE22 . GLN A 1 8   ? 0.134   14.412  -6.339  1.00 0.00 ? 8   GLN A HE22 6  
ATOM 9732  N N    . PRO A 1 9   ? -2.199  11.968  -10.218 1.00 0.00 ? 9   PRO A N    6  
ATOM 9733  C CA   . PRO A 1 9   ? -2.156  10.662  -10.895 1.00 0.00 ? 9   PRO A CA   6  
ATOM 9734  C C    . PRO A 1 9   ? -2.708  9.543   -10.009 1.00 0.00 ? 9   PRO A C    6  
ATOM 9735  O O    . PRO A 1 9   ? -2.697  9.660   -8.784  1.00 0.00 ? 9   PRO A O    6  
ATOM 9736  C CB   . PRO A 1 9   ? -0.663  10.440  -11.162 1.00 0.00 ? 9   PRO A CB   6  
ATOM 9737  C CG   . PRO A 1 9   ? -0.046  11.794  -11.086 1.00 0.00 ? 9   PRO A CG   6  
ATOM 9738  C CD   . PRO A 1 9   ? -0.864  12.565  -10.091 1.00 0.00 ? 9   PRO A CD   6  
ATOM 9739  H HA   . PRO A 1 9   ? -2.698  10.682  -11.830 1.00 0.00 ? 9   PRO A HA   6  
ATOM 9740  H HB2  . PRO A 1 9   ? -0.257  9.778   -10.412 1.00 0.00 ? 9   PRO A HB2  6  
ATOM 9741  H HB3  . PRO A 1 9   ? -0.533  10.002  -12.142 1.00 0.00 ? 9   PRO A HB3  6  
ATOM 9742  H HG2  . PRO A 1 9   ? 0.976   11.712  -10.749 1.00 0.00 ? 9   PRO A HG2  6  
ATOM 9743  H HG3  . PRO A 1 9   ? -0.086  12.271  -12.054 1.00 0.00 ? 9   PRO A HG3  6  
ATOM 9744  H HD2  . PRO A 1 9   ? -0.478  12.427  -9.089  1.00 0.00 ? 9   PRO A HD2  6  
ATOM 9745  H HD3  . PRO A 1 9   ? -0.884  13.613  -10.349 1.00 0.00 ? 9   PRO A HD3  6  
ATOM 9746  N N    . THR A 1 10  ? -3.156  8.450   -10.623 1.00 0.00 ? 10  THR A N    6  
ATOM 9747  C CA   . THR A 1 10  ? -3.887  7.407   -9.909  1.00 0.00 ? 10  THR A CA   6  
ATOM 9748  C C    . THR A 1 10  ? -2.942  6.350   -9.323  1.00 0.00 ? 10  THR A C    6  
ATOM 9749  O O    . THR A 1 10  ? -3.365  5.259   -8.936  1.00 0.00 ? 10  THR A O    6  
ATOM 9750  C CB   . THR A 1 10  ? -4.904  6.736   -10.854 1.00 0.00 ? 10  THR A CB   6  
ATOM 9751  O OG1  . THR A 1 10  ? -5.463  7.725   -11.733 1.00 0.00 ? 10  THR A OG1  6  
ATOM 9752  C CG2  . THR A 1 10  ? -6.028  6.067   -10.078 1.00 0.00 ? 10  THR A CG2  6  
ATOM 9753  H H    . THR A 1 10  ? -2.982  8.330   -11.580 1.00 0.00 ? 10  THR A H    6  
ATOM 9754  H HA   . THR A 1 10  ? -4.431  7.874   -9.103  1.00 0.00 ? 10  THR A HA   6  
ATOM 9755  H HB   . THR A 1 10  ? -4.394  5.987   -11.441 1.00 0.00 ? 10  THR A HB   6  
ATOM 9756  H HG1  . THR A 1 10  ? -5.635  7.320   -12.598 1.00 0.00 ? 10  THR A HG1  6  
ATOM 9757  H HG21 . THR A 1 10  ? -6.711  5.595   -10.769 1.00 0.00 ? 10  THR A HG21 6  
ATOM 9758  H HG22 . THR A 1 10  ? -6.557  6.810   -9.499  1.00 0.00 ? 10  THR A HG22 6  
ATOM 9759  H HG23 . THR A 1 10  ? -5.615  5.322   -9.415  1.00 0.00 ? 10  THR A HG23 6  
ATOM 9760  N N    . GLU A 1 11  ? -1.666  6.683   -9.247  1.00 0.00 ? 11  GLU A N    6  
ATOM 9761  C CA   . GLU A 1 11  ? -0.677  5.785   -8.667  1.00 0.00 ? 11  GLU A CA   6  
ATOM 9762  C C    . GLU A 1 11  ? 0.130   6.525   -7.613  1.00 0.00 ? 11  GLU A C    6  
ATOM 9763  O O    . GLU A 1 11  ? 0.579   7.640   -7.862  1.00 0.00 ? 11  GLU A O    6  
ATOM 9764  C CB   . GLU A 1 11  ? 0.271   5.288   -9.754  1.00 0.00 ? 11  GLU A CB   6  
ATOM 9765  C CG   . GLU A 1 11  ? -0.426  4.681   -10.958 1.00 0.00 ? 11  GLU A CG   6  
ATOM 9766  C CD   . GLU A 1 11  ? 0.475   4.637   -12.173 1.00 0.00 ? 11  GLU A CD   6  
ATOM 9767  O OE1  . GLU A 1 11  ? 1.217   3.648   -12.337 1.00 0.00 ? 11  GLU A OE1  6  
ATOM 9768  O OE2  . GLU A 1 11  ? 0.461   5.607   -12.962 1.00 0.00 ? 11  GLU A OE2  6  
ATOM 9769  H H    . GLU A 1 11  ? -1.376  7.551   -9.590  1.00 0.00 ? 11  GLU A H    6  
ATOM 9770  H HA   . GLU A 1 11  ? -1.189  4.949   -8.217  1.00 0.00 ? 11  GLU A HA   6  
ATOM 9771  H HB2  . GLU A 1 11  ? 0.869   6.119   -10.097 1.00 0.00 ? 11  GLU A HB2  6  
ATOM 9772  H HB3  . GLU A 1 11  ? 0.923   4.540   -9.329  1.00 0.00 ? 11  GLU A HB3  6  
ATOM 9773  H HG2  . GLU A 1 11  ? -0.730  3.674   -10.714 1.00 0.00 ? 11  GLU A HG2  6  
ATOM 9774  H HG3  . GLU A 1 11  ? -1.296  5.276   -11.193 1.00 0.00 ? 11  GLU A HG3  6  
ATOM 9775  N N    . PHE A 1 12  ? 0.342   5.915   -6.456  1.00 0.00 ? 12  PHE A N    6  
ATOM 9776  C CA   . PHE A 1 12  ? 1.132   6.559   -5.414  1.00 0.00 ? 12  PHE A CA   6  
ATOM 9777  C C    . PHE A 1 12  ? 2.154   5.596   -4.832  1.00 0.00 ? 12  PHE A C    6  
ATOM 9778  O O    . PHE A 1 12  ? 1.872   4.415   -4.642  1.00 0.00 ? 12  PHE A O    6  
ATOM 9779  C CB   . PHE A 1 12  ? 0.245   7.149   -4.300  1.00 0.00 ? 12  PHE A CB   6  
ATOM 9780  C CG   . PHE A 1 12  ? -0.421  6.156   -3.374  1.00 0.00 ? 12  PHE A CG   6  
ATOM 9781  C CD1  . PHE A 1 12  ? -1.645  5.593   -3.695  1.00 0.00 ? 12  PHE A CD1  6  
ATOM 9782  C CD2  . PHE A 1 12  ? 0.163   5.821   -2.160  1.00 0.00 ? 12  PHE A CD2  6  
ATOM 9783  C CE1  . PHE A 1 12  ? -2.275  4.716   -2.827  1.00 0.00 ? 12  PHE A CE1  6  
ATOM 9784  C CE2  . PHE A 1 12  ? -0.456  4.940   -1.291  1.00 0.00 ? 12  PHE A CE2  6  
ATOM 9785  C CZ   . PHE A 1 12  ? -1.679  4.389   -1.624  1.00 0.00 ? 12  PHE A CZ   6  
ATOM 9786  H H    . PHE A 1 12  ? -0.027  5.016   -6.301  1.00 0.00 ? 12  PHE A H    6  
ATOM 9787  H HA   . PHE A 1 12  ? 1.671   7.369   -5.884  1.00 0.00 ? 12  PHE A HA   6  
ATOM 9788  H HB2  . PHE A 1 12  ? 0.852   7.797   -3.686  1.00 0.00 ? 12  PHE A HB2  6  
ATOM 9789  H HB3  . PHE A 1 12  ? -0.535  7.740   -4.759  1.00 0.00 ? 12  PHE A HB3  6  
ATOM 9790  H HD1  . PHE A 1 12  ? -2.113  5.844   -4.636  1.00 0.00 ? 12  PHE A HD1  6  
ATOM 9791  H HD2  . PHE A 1 12  ? 1.120   6.250   -1.898  1.00 0.00 ? 12  PHE A HD2  6  
ATOM 9792  H HE1  . PHE A 1 12  ? -3.229  4.285   -3.091  1.00 0.00 ? 12  PHE A HE1  6  
ATOM 9793  H HE2  . PHE A 1 12  ? 0.014   4.687   -0.352  1.00 0.00 ? 12  PHE A HE2  6  
ATOM 9794  H HZ   . PHE A 1 12  ? -2.171  3.704   -0.940  1.00 0.00 ? 12  PHE A HZ   6  
ATOM 9795  N N    . ILE A 1 13  ? 3.348   6.099   -4.583  1.00 0.00 ? 13  ILE A N    6  
ATOM 9796  C CA   . ILE A 1 13  ? 4.378   5.313   -3.935  1.00 0.00 ? 13  ILE A CA   6  
ATOM 9797  C C    . ILE A 1 13  ? 4.385   5.622   -2.441  1.00 0.00 ? 13  ILE A C    6  
ATOM 9798  O O    . ILE A 1 13  ? 4.139   6.759   -2.027  1.00 0.00 ? 13  ILE A O    6  
ATOM 9799  C CB   . ILE A 1 13  ? 5.777   5.580   -4.549  1.00 0.00 ? 13  ILE A CB   6  
ATOM 9800  C CG1  . ILE A 1 13  ? 6.809   4.596   -3.982  1.00 0.00 ? 13  ILE A CG1  6  
ATOM 9801  C CG2  . ILE A 1 13  ? 6.206   7.018   -4.295  1.00 0.00 ? 13  ILE A CG2  6  
ATOM 9802  C CD1  . ILE A 1 13  ? 8.184   4.726   -4.605  1.00 0.00 ? 13  ILE A CD1  6  
ATOM 9803  H H    . ILE A 1 13  ? 3.543   7.024   -4.841  1.00 0.00 ? 13  ILE A H    6  
ATOM 9804  H HA   . ILE A 1 13  ? 4.137   4.268   -4.072  1.00 0.00 ? 13  ILE A HA   6  
ATOM 9805  H HB   . ILE A 1 13  ? 5.703   5.437   -5.618  1.00 0.00 ? 13  ILE A HB   6  
ATOM 9806  H HG12 . ILE A 1 13  ? 6.911   4.765   -2.921  1.00 0.00 ? 13  ILE A HG12 6  
ATOM 9807  H HG13 . ILE A 1 13  ? 6.463   3.586   -4.150  1.00 0.00 ? 13  ILE A HG13 6  
ATOM 9808  H HG21 . ILE A 1 13  ? 6.230   7.201   -3.231  1.00 0.00 ? 13  ILE A HG21 6  
ATOM 9809  H HG22 . ILE A 1 13  ? 5.502   7.690   -4.762  1.00 0.00 ? 13  ILE A HG22 6  
ATOM 9810  H HG23 . ILE A 1 13  ? 7.188   7.180   -4.711  1.00 0.00 ? 13  ILE A HG23 6  
ATOM 9811  H HD11 . ILE A 1 13  ? 8.120   4.523   -5.665  1.00 0.00 ? 13  ILE A HD11 6  
ATOM 9812  H HD12 . ILE A 1 13  ? 8.855   4.017   -4.144  1.00 0.00 ? 13  ILE A HD12 6  
ATOM 9813  H HD13 . ILE A 1 13  ? 8.556   5.728   -4.452  1.00 0.00 ? 13  ILE A HD13 6  
ATOM 9814  N N    . SER A 1 14  ? 4.625   4.608   -1.640  1.00 0.00 ? 14  SER A N    6  
ATOM 9815  C CA   . SER A 1 14  ? 4.600   4.764   -0.203  1.00 0.00 ? 14  SER A CA   6  
ATOM 9816  C C    . SER A 1 14  ? 5.752   4.015   0.447   1.00 0.00 ? 14  SER A C    6  
ATOM 9817  O O    . SER A 1 14  ? 6.147   2.937   0.001   1.00 0.00 ? 14  SER A O    6  
ATOM 9818  C CB   . SER A 1 14  ? 3.264   4.264   0.356   1.00 0.00 ? 14  SER A CB   6  
ATOM 9819  O OG   . SER A 1 14  ? 3.191   4.448   1.763   1.00 0.00 ? 14  SER A OG   6  
ATOM 9820  H H    . SER A 1 14  ? 4.815   3.726   -2.032  1.00 0.00 ? 14  SER A H    6  
ATOM 9821  H HA   . SER A 1 14  ? 4.701   5.815   0.018   1.00 0.00 ? 14  SER A HA   6  
ATOM 9822  H HB2  . SER A 1 14  ? 2.456   4.812   -0.108  1.00 0.00 ? 14  SER A HB2  6  
ATOM 9823  H HB3  . SER A 1 14  ? 3.159   3.209   0.136   1.00 0.00 ? 14  SER A HB3  6  
ATOM 9824  H HG   . SER A 1 14  ? 3.482   5.340   1.983   1.00 0.00 ? 14  SER A HG   6  
ATOM 9825  N N    . ARG A 1 15  ? 6.291   4.600   1.501   1.00 0.00 ? 15  ARG A N    6  
ATOM 9826  C CA   . ARG A 1 15  ? 7.290   3.941   2.315   1.00 0.00 ? 15  ARG A CA   6  
ATOM 9827  C C    . ARG A 1 15  ? 6.668   3.675   3.670   1.00 0.00 ? 15  ARG A C    6  
ATOM 9828  O O    . ARG A 1 15  ? 6.293   4.612   4.381   1.00 0.00 ? 15  ARG A O    6  
ATOM 9829  C CB   . ARG A 1 15  ? 8.548   4.804   2.469   1.00 0.00 ? 15  ARG A CB   6  
ATOM 9830  C CG   . ARG A 1 15  ? 9.225   5.159   1.154   1.00 0.00 ? 15  ARG A CG   6  
ATOM 9831  C CD   . ARG A 1 15  ? 10.523  5.924   1.383   1.00 0.00 ? 15  ARG A CD   6  
ATOM 9832  N NE   . ARG A 1 15  ? 11.124  6.371   0.127   1.00 0.00 ? 15  ARG A NE   6  
ATOM 9833  C CZ   . ARG A 1 15  ? 12.437  6.511   -0.066  1.00 0.00 ? 15  ARG A CZ   6  
ATOM 9834  N NH1  . ARG A 1 15  ? 13.301  6.206   0.893   1.00 0.00 ? 15  ARG A NH1  6  
ATOM 9835  N NH2  . ARG A 1 15  ? 12.898  6.955   -1.228  1.00 0.00 ? 15  ARG A NH2  6  
ATOM 9836  H H    . ARG A 1 15  ? 5.979   5.488   1.771   1.00 0.00 ? 15  ARG A H    6  
ATOM 9837  H HA   . ARG A 1 15  ? 7.547   3.003   1.846   1.00 0.00 ? 15  ARG A HA   6  
ATOM 9838  H HB2  . ARG A 1 15  ? 8.280   5.722   2.969   1.00 0.00 ? 15  ARG A HB2  6  
ATOM 9839  H HB3  . ARG A 1 15  ? 9.260   4.270   3.081   1.00 0.00 ? 15  ARG A HB3  6  
ATOM 9840  H HG2  . ARG A 1 15  ? 9.447   4.249   0.618   1.00 0.00 ? 15  ARG A HG2  6  
ATOM 9841  H HG3  . ARG A 1 15  ? 8.556   5.771   0.567   1.00 0.00 ? 15  ARG A HG3  6  
ATOM 9842  H HD2  . ARG A 1 15  ? 10.314  6.788   1.996   1.00 0.00 ? 15  ARG A HD2  6  
ATOM 9843  H HD3  . ARG A 1 15  ? 11.220  5.279   1.895   1.00 0.00 ? 15  ARG A HD3  6  
ATOM 9844  H HE   . ARG A 1 15  ? 10.506  6.594   -0.615  1.00 0.00 ? 15  ARG A HE   6  
ATOM 9845  H HH11 . ARG A 1 15  ? 12.976  5.860   1.781   1.00 0.00 ? 15  ARG A HH11 6  
ATOM 9846  H HH12 . ARG A 1 15  ? 14.285  6.320   0.739   1.00 0.00 ? 15  ARG A HH12 6  
ATOM 9847  H HH21 . ARG A 1 15  ? 12.263  7.192   -1.973  1.00 0.00 ? 15  ARG A HH21 6  
ATOM 9848  H HH22 . ARG A 1 15  ? 13.891  7.056   -1.367  1.00 0.00 ? 15  ARG A HH22 6  
ATOM 9849  N N    . HIS A 1 16  ? 6.515   2.412   4.023   1.00 0.00 ? 16  HIS A N    6  
ATOM 9850  C CA   . HIS A 1 16  ? 5.790   2.076   5.234   1.00 0.00 ? 16  HIS A CA   6  
ATOM 9851  C C    . HIS A 1 16  ? 6.570   1.134   6.125   1.00 0.00 ? 16  HIS A C    6  
ATOM 9852  O O    . HIS A 1 16  ? 7.507   0.460   5.693   1.00 0.00 ? 16  HIS A O    6  
ATOM 9853  C CB   . HIS A 1 16  ? 4.402   1.497   4.909   1.00 0.00 ? 16  HIS A CB   6  
ATOM 9854  C CG   . HIS A 1 16  ? 4.375   0.182   4.182   1.00 0.00 ? 16  HIS A CG   6  
ATOM 9855  N ND1  . HIS A 1 16  ? 3.494   -0.077  3.155   1.00 0.00 ? 16  HIS A ND1  6  
ATOM 9856  C CD2  . HIS A 1 16  ? 5.063   -0.969  4.376   1.00 0.00 ? 16  HIS A CD2  6  
ATOM 9857  C CE1  . HIS A 1 16  ? 3.637   -1.326  2.758   1.00 0.00 ? 16  HIS A CE1  6  
ATOM 9858  N NE2  . HIS A 1 16  ? 4.582   -1.890  3.481   1.00 0.00 ? 16  HIS A NE2  6  
ATOM 9859  H H    . HIS A 1 16  ? 6.915   1.699   3.473   1.00 0.00 ? 16  HIS A H    6  
ATOM 9860  H HA   . HIS A 1 16  ? 5.646   2.994   5.778   1.00 0.00 ? 16  HIS A HA   6  
ATOM 9861  H HB2  . HIS A 1 16  ? 3.857   1.361   5.830   1.00 0.00 ? 16  HIS A HB2  6  
ATOM 9862  H HB3  . HIS A 1 16  ? 3.877   2.210   4.302   1.00 0.00 ? 16  HIS A HB3  6  
ATOM 9863  H HD1  . HIS A 1 16  ? 2.865   0.568   2.761   1.00 0.00 ? 16  HIS A HD1  6  
ATOM 9864  H HD2  . HIS A 1 16  ? 5.855   -1.125  5.089   1.00 0.00 ? 16  HIS A HD2  6  
ATOM 9865  H HE1  . HIS A 1 16  ? 3.064   -1.807  1.982   1.00 0.00 ? 16  HIS A HE1  6  
ATOM 9866  H HE2  . HIS A 1 16  ? 4.785   -2.849  3.491   1.00 0.00 ? 16  HIS A HE2  6  
ATOM 9867  N N    . ASN A 1 17  ? 6.139   1.084   7.368   1.00 0.00 ? 17  ASN A N    6  
ATOM 9868  C CA   . ASN A 1 17  ? 6.722   0.208   8.360   1.00 0.00 ? 17  ASN A CA   6  
ATOM 9869  C C    . ASN A 1 17  ? 6.315   -1.223  8.039   1.00 0.00 ? 17  ASN A C    6  
ATOM 9870  O O    . ASN A 1 17  ? 5.212   -1.455  7.531   1.00 0.00 ? 17  ASN A O    6  
ATOM 9871  C CB   . ASN A 1 17  ? 6.251   0.630   9.760   1.00 0.00 ? 17  ASN A CB   6  
ATOM 9872  C CG   . ASN A 1 17  ? 5.793   -0.531  10.622  1.00 0.00 ? 17  ASN A CG   6  
ATOM 9873  O OD1  . ASN A 1 17  ? 4.633   -0.927  10.571  1.00 0.00 ? 17  ASN A OD1  6  
ATOM 9874  N ND2  . ASN A 1 17  ? 6.690   -1.084  11.420  1.00 0.00 ? 17  ASN A ND2  6  
ATOM 9875  H H    . ASN A 1 17  ? 5.361   1.635   7.619   1.00 0.00 ? 17  ASN A H    6  
ATOM 9876  H HA   . ASN A 1 17  ? 7.797   0.293   8.300   1.00 0.00 ? 17  ASN A HA   6  
ATOM 9877  H HB2  . ASN A 1 17  ? 7.062   1.127   10.268  1.00 0.00 ? 17  ASN A HB2  6  
ATOM 9878  H HB3  . ASN A 1 17  ? 5.424   1.320   9.654   1.00 0.00 ? 17  ASN A HB3  6  
ATOM 9879  H HD21 . ASN A 1 17  ? 7.607   -0.726  11.417  1.00 0.00 ? 17  ASN A HD21 6  
ATOM 9880  H HD22 . ASN A 1 17  ? 6.395   -1.819  12.007  1.00 0.00 ? 17  ASN A HD22 6  
ATOM 9881  N N    . ILE A 1 18  ? 7.222   -2.158  8.329   1.00 0.00 ? 18  ILE A N    6  
ATOM 9882  C CA   . ILE A 1 18  ? 7.106   -3.564  7.919   1.00 0.00 ? 18  ILE A CA   6  
ATOM 9883  C C    . ILE A 1 18  ? 5.760   -4.198  8.259   1.00 0.00 ? 18  ILE A C    6  
ATOM 9884  O O    . ILE A 1 18  ? 5.356   -5.168  7.625   1.00 0.00 ? 18  ILE A O    6  
ATOM 9885  C CB   . ILE A 1 18  ? 8.227   -4.419  8.544   1.00 0.00 ? 18  ILE A CB   6  
ATOM 9886  C CG1  . ILE A 1 18  ? 8.256   -4.242  10.068  1.00 0.00 ? 18  ILE A CG1  6  
ATOM 9887  C CG2  . ILE A 1 18  ? 9.573   -4.055  7.931   1.00 0.00 ? 18  ILE A CG2  6  
ATOM 9888  C CD1  . ILE A 1 18  ? 9.281   -5.113  10.763  1.00 0.00 ? 18  ILE A CD1  6  
ATOM 9889  H H    . ILE A 1 18  ? 8.019   -1.885  8.845   1.00 0.00 ? 18  ILE A H    6  
ATOM 9890  H HA   . ILE A 1 18  ? 7.232   -3.596  6.849   1.00 0.00 ? 18  ILE A HA   6  
ATOM 9891  H HB   . ILE A 1 18  ? 8.025   -5.455  8.314   1.00 0.00 ? 18  ILE A HB   6  
ATOM 9892  H HG12 . ILE A 1 18  ? 8.488   -3.213  10.297  1.00 0.00 ? 18  ILE A HG12 6  
ATOM 9893  H HG13 . ILE A 1 18  ? 7.284   -4.487  10.473  1.00 0.00 ? 18  ILE A HG13 6  
ATOM 9894  H HG21 . ILE A 1 18  ? 10.348  -4.657  8.381   1.00 0.00 ? 18  ILE A HG21 6  
ATOM 9895  H HG22 . ILE A 1 18  ? 9.779   -3.011  8.109   1.00 0.00 ? 18  ILE A HG22 6  
ATOM 9896  H HG23 . ILE A 1 18  ? 9.546   -4.242  6.867   1.00 0.00 ? 18  ILE A HG23 6  
ATOM 9897  H HD11 . ILE A 1 18  ? 10.267  -4.872  10.394  1.00 0.00 ? 18  ILE A HD11 6  
ATOM 9898  H HD12 . ILE A 1 18  ? 9.065   -6.151  10.562  1.00 0.00 ? 18  ILE A HD12 6  
ATOM 9899  H HD13 . ILE A 1 18  ? 9.242   -4.937  11.828  1.00 0.00 ? 18  ILE A HD13 6  
ATOM 9900  N N    . GLU A 1 19  ? 5.073   -3.651  9.250   1.00 0.00 ? 19  GLU A N    6  
ATOM 9901  C CA   . GLU A 1 19  ? 3.784   -4.181  9.678   1.00 0.00 ? 19  GLU A CA   6  
ATOM 9902  C C    . GLU A 1 19  ? 2.663   -3.721  8.752   1.00 0.00 ? 19  GLU A C    6  
ATOM 9903  O O    . GLU A 1 19  ? 1.534   -4.200  8.847   1.00 0.00 ? 19  GLU A O    6  
ATOM 9904  C CB   . GLU A 1 19  ? 3.502   -3.735  11.106  1.00 0.00 ? 19  GLU A CB   6  
ATOM 9905  C CG   . GLU A 1 19  ? 4.578   -4.169  12.075  1.00 0.00 ? 19  GLU A CG   6  
ATOM 9906  C CD   . GLU A 1 19  ? 4.505   -3.439  13.393  1.00 0.00 ? 19  GLU A CD   6  
ATOM 9907  O OE1  . GLU A 1 19  ? 3.745   -3.876  14.276  1.00 0.00 ? 19  GLU A OE1  6  
ATOM 9908  O OE2  . GLU A 1 19  ? 5.210   -2.422  13.551  1.00 0.00 ? 19  GLU A OE2  6  
ATOM 9909  H H    . GLU A 1 19  ? 5.442   -2.868  9.711   1.00 0.00 ? 19  GLU A H    6  
ATOM 9910  H HA   . GLU A 1 19  ? 3.843   -5.256  9.650   1.00 0.00 ? 19  GLU A HA   6  
ATOM 9911  H HB2  . GLU A 1 19  ? 3.429   -2.657  11.132  1.00 0.00 ? 19  GLU A HB2  6  
ATOM 9912  H HB3  . GLU A 1 19  ? 2.563   -4.160  11.429  1.00 0.00 ? 19  GLU A HB3  6  
ATOM 9913  H HG2  . GLU A 1 19  ? 4.468   -5.225  12.258  1.00 0.00 ? 19  GLU A HG2  6  
ATOM 9914  H HG3  . GLU A 1 19  ? 5.541   -3.979  11.626  1.00 0.00 ? 19  GLU A HG3  6  
ATOM 9915  N N    . GLY A 1 20  ? 2.983   -2.799  7.854   1.00 0.00 ? 20  GLY A N    6  
ATOM 9916  C CA   . GLY A 1 20  ? 1.997   -2.281  6.937   1.00 0.00 ? 20  GLY A CA   6  
ATOM 9917  C C    . GLY A 1 20  ? 1.541   -0.891  7.322   1.00 0.00 ? 20  GLY A C    6  
ATOM 9918  O O    . GLY A 1 20  ? 0.578   -0.367  6.759   1.00 0.00 ? 20  GLY A O    6  
ATOM 9919  H H    . GLY A 1 20  ? 3.909   -2.470  7.807   1.00 0.00 ? 20  GLY A H    6  
ATOM 9920  H HA2  . GLY A 1 20  ? 2.421   -2.250  5.944   1.00 0.00 ? 20  GLY A HA2  6  
ATOM 9921  H HA3  . GLY A 1 20  ? 1.142   -2.943  6.932   1.00 0.00 ? 20  GLY A HA3  6  
ATOM 9922  N N    . ILE A 1 21  ? 2.247   -0.278  8.265   1.00 0.00 ? 21  ILE A N    6  
ATOM 9923  C CA   . ILE A 1 21  ? 1.841   1.020   8.798   1.00 0.00 ? 21  ILE A CA   6  
ATOM 9924  C C    . ILE A 1 21  ? 2.406   2.142   7.942   1.00 0.00 ? 21  ILE A C    6  
ATOM 9925  O O    . ILE A 1 21  ? 3.618   2.224   7.742   1.00 0.00 ? 21  ILE A O    6  
ATOM 9926  C CB   . ILE A 1 21  ? 2.313   1.214   10.260  1.00 0.00 ? 21  ILE A CB   6  
ATOM 9927  C CG1  . ILE A 1 21  ? 1.742   0.117   11.166  1.00 0.00 ? 21  ILE A CG1  6  
ATOM 9928  C CG2  . ILE A 1 21  ? 1.913   2.592   10.776  1.00 0.00 ? 21  ILE A CG2  6  
ATOM 9929  C CD1  . ILE A 1 21  ? 0.233   0.143   11.285  1.00 0.00 ? 21  ILE A CD1  6  
ATOM 9930  H H    . ILE A 1 21  ? 3.075   -0.695  8.601   1.00 0.00 ? 21  ILE A H    6  
ATOM 9931  H HA   . ILE A 1 21  ? 0.762   1.068   8.779   1.00 0.00 ? 21  ILE A HA   6  
ATOM 9932  H HB   . ILE A 1 21  ? 3.391   1.154   10.275  1.00 0.00 ? 21  ILE A HB   6  
ATOM 9933  H HG12 . ILE A 1 21  ? 2.025   -0.847  10.773  1.00 0.00 ? 21  ILE A HG12 6  
ATOM 9934  H HG13 . ILE A 1 21  ? 2.155   0.229   12.158  1.00 0.00 ? 21  ILE A HG13 6  
ATOM 9935  H HG21 . ILE A 1 21  ? 0.840   2.705   10.707  1.00 0.00 ? 21  ILE A HG21 6  
ATOM 9936  H HG22 . ILE A 1 21  ? 2.392   3.355   10.181  1.00 0.00 ? 21  ILE A HG22 6  
ATOM 9937  H HG23 . ILE A 1 21  ? 2.216   2.696   11.808  1.00 0.00 ? 21  ILE A HG23 6  
ATOM 9938  H HD11 . ILE A 1 21  ? -0.078  1.088   11.705  1.00 0.00 ? 21  ILE A HD11 6  
ATOM 9939  H HD12 . ILE A 1 21  ? -0.095  -0.662  11.927  1.00 0.00 ? 21  ILE A HD12 6  
ATOM 9940  H HD13 . ILE A 1 21  ? -0.207  0.025   10.305  1.00 0.00 ? 21  ILE A HD13 6  
ATOM 9941  N N    . PHE A 1 22  ? 1.530   3.002   7.438   1.00 0.00 ? 22  PHE A N    6  
ATOM 9942  C CA   . PHE A 1 22  ? 1.947   4.088   6.564   1.00 0.00 ? 22  PHE A CA   6  
ATOM 9943  C C    . PHE A 1 22  ? 2.761   5.127   7.324   1.00 0.00 ? 22  PHE A C    6  
ATOM 9944  O O    . PHE A 1 22  ? 2.343   5.623   8.373   1.00 0.00 ? 22  PHE A O    6  
ATOM 9945  C CB   . PHE A 1 22  ? 0.738   4.744   5.899   1.00 0.00 ? 22  PHE A CB   6  
ATOM 9946  C CG   . PHE A 1 22  ? 0.077   3.866   4.878   1.00 0.00 ? 22  PHE A CG   6  
ATOM 9947  C CD1  . PHE A 1 22  ? 0.646   3.700   3.627   1.00 0.00 ? 22  PHE A CD1  6  
ATOM 9948  C CD2  . PHE A 1 22  ? -1.109  3.212   5.164   1.00 0.00 ? 22  PHE A CD2  6  
ATOM 9949  C CE1  . PHE A 1 22  ? 0.048   2.899   2.676   1.00 0.00 ? 22  PHE A CE1  6  
ATOM 9950  C CE2  . PHE A 1 22  ? -1.714  2.407   4.218   1.00 0.00 ? 22  PHE A CE2  6  
ATOM 9951  C CZ   . PHE A 1 22  ? -1.134  2.250   2.971   1.00 0.00 ? 22  PHE A CZ   6  
ATOM 9952  H H    . PHE A 1 22  ? 0.579   2.915   7.672   1.00 0.00 ? 22  PHE A H    6  
ATOM 9953  H HA   . PHE A 1 22  ? 2.574   3.664   5.793   1.00 0.00 ? 22  PHE A HA   6  
ATOM 9954  H HB2  . PHE A 1 22  ? 0.006   4.985   6.654   1.00 0.00 ? 22  PHE A HB2  6  
ATOM 9955  H HB3  . PHE A 1 22  ? 1.052   5.651   5.405   1.00 0.00 ? 22  PHE A HB3  6  
ATOM 9956  H HD1  . PHE A 1 22  ? 1.573   4.206   3.395   1.00 0.00 ? 22  PHE A HD1  6  
ATOM 9957  H HD2  . PHE A 1 22  ? -1.562  3.335   6.137   1.00 0.00 ? 22  PHE A HD2  6  
ATOM 9958  H HE1  . PHE A 1 22  ? 0.505   2.781   1.702   1.00 0.00 ? 22  PHE A HE1  6  
ATOM 9959  H HE2  . PHE A 1 22  ? -2.638  1.898   4.453   1.00 0.00 ? 22  PHE A HE2  6  
ATOM 9960  H HZ   . PHE A 1 22  ? -1.606  1.622   2.229   1.00 0.00 ? 22  PHE A HZ   6  
ATOM 9961  N N    . THR A 1 23  ? 3.933   5.433   6.787   1.00 0.00 ? 23  THR A N    6  
ATOM 9962  C CA   . THR A 1 23  ? 4.834   6.400   7.383   1.00 0.00 ? 23  THR A CA   6  
ATOM 9963  C C    . THR A 1 23  ? 5.052   7.571   6.425   1.00 0.00 ? 23  THR A C    6  
ATOM 9964  O O    . THR A 1 23  ? 5.081   8.731   6.836   1.00 0.00 ? 23  THR A O    6  
ATOM 9965  C CB   . THR A 1 23  ? 6.191   5.746   7.732   1.00 0.00 ? 23  THR A CB   6  
ATOM 9966  O OG1  . THR A 1 23  ? 5.975   4.593   8.557   1.00 0.00 ? 23  THR A OG1  6  
ATOM 9967  C CG2  . THR A 1 23  ? 7.103   6.722   8.458   1.00 0.00 ? 23  THR A CG2  6  
ATOM 9968  H H    . THR A 1 23  ? 4.200   4.991   5.962   1.00 0.00 ? 23  THR A H    6  
ATOM 9969  H HA   . THR A 1 23  ? 4.385   6.765   8.295   1.00 0.00 ? 23  THR A HA   6  
ATOM 9970  H HB   . THR A 1 23  ? 6.673   5.441   6.814   1.00 0.00 ? 23  THR A HB   6  
ATOM 9971  H HG1  . THR A 1 23  ? 5.272   4.788   9.197   1.00 0.00 ? 23  THR A HG1  6  
ATOM 9972  H HG21 . THR A 1 23  ? 8.034   6.230   8.705   1.00 0.00 ? 23  THR A HG21 6  
ATOM 9973  H HG22 . THR A 1 23  ? 6.622   7.058   9.365   1.00 0.00 ? 23  THR A HG22 6  
ATOM 9974  H HG23 . THR A 1 23  ? 7.302   7.570   7.820   1.00 0.00 ? 23  THR A HG23 6  
ATOM 9975  N N    . PHE A 1 24  ? 5.196   7.254   5.141   1.00 0.00 ? 24  PHE A N    6  
ATOM 9976  C CA   . PHE A 1 24  ? 5.344   8.267   4.104   1.00 0.00 ? 24  PHE A CA   6  
ATOM 9977  C C    . PHE A 1 24  ? 4.427   7.957   2.926   1.00 0.00 ? 24  PHE A C    6  
ATOM 9978  O O    . PHE A 1 24  ? 4.508   6.878   2.334   1.00 0.00 ? 24  PHE A O    6  
ATOM 9979  C CB   . PHE A 1 24  ? 6.803   8.335   3.635   1.00 0.00 ? 24  PHE A CB   6  
ATOM 9980  C CG   . PHE A 1 24  ? 7.008   9.192   2.416   1.00 0.00 ? 24  PHE A CG   6  
ATOM 9981  C CD1  . PHE A 1 24  ? 6.903   10.572  2.493   1.00 0.00 ? 24  PHE A CD1  6  
ATOM 9982  C CD2  . PHE A 1 24  ? 7.307   8.613   1.190   1.00 0.00 ? 24  PHE A CD2  6  
ATOM 9983  C CE1  . PHE A 1 24  ? 7.091   11.358  1.372   1.00 0.00 ? 24  PHE A CE1  6  
ATOM 9984  C CE2  . PHE A 1 24  ? 7.495   9.393   0.067   1.00 0.00 ? 24  PHE A CE2  6  
ATOM 9985  C CZ   . PHE A 1 24  ? 7.386   10.767  0.159   1.00 0.00 ? 24  PHE A CZ   6  
ATOM 9986  H H    . PHE A 1 24  ? 5.222   6.309   4.879   1.00 0.00 ? 24  PHE A H    6  
ATOM 9987  H HA   . PHE A 1 24  ? 5.064   9.220   4.528   1.00 0.00 ? 24  PHE A HA   6  
ATOM 9988  H HB2  . PHE A 1 24  ? 7.411   8.741   4.429   1.00 0.00 ? 24  PHE A HB2  6  
ATOM 9989  H HB3  . PHE A 1 24  ? 7.146   7.337   3.402   1.00 0.00 ? 24  PHE A HB3  6  
ATOM 9990  H HD1  . PHE A 1 24  ? 6.670   11.032  3.442   1.00 0.00 ? 24  PHE A HD1  6  
ATOM 9991  H HD2  . PHE A 1 24  ? 7.393   7.540   1.119   1.00 0.00 ? 24  PHE A HD2  6  
ATOM 9992  H HE1  . PHE A 1 24  ? 7.006   12.433  1.444   1.00 0.00 ? 24  PHE A HE1  6  
ATOM 9993  H HE2  . PHE A 1 24  ? 7.726   8.932   -0.882  1.00 0.00 ? 24  PHE A HE2  6  
ATOM 9994  H HZ   . PHE A 1 24  ? 7.533   11.379  -0.718  1.00 0.00 ? 24  PHE A HZ   6  
ATOM 9995  N N    . VAL A 1 25  ? 3.545   8.894   2.601   1.00 0.00 ? 25  VAL A N    6  
ATOM 9996  C CA   . VAL A 1 25  ? 2.611   8.729   1.493   1.00 0.00 ? 25  VAL A CA   6  
ATOM 9997  C C    . VAL A 1 25  ? 2.610   9.967   0.597   1.00 0.00 ? 25  VAL A C    6  
ATOM 9998  O O    . VAL A 1 25  ? 2.663   11.097  1.083   1.00 0.00 ? 25  VAL A O    6  
ATOM 9999  C CB   . VAL A 1 25  ? 1.171   8.482   1.998   1.00 0.00 ? 25  VAL A CB   6  
ATOM 10000 C CG1  . VAL A 1 25  ? 0.208   8.320   0.831   1.00 0.00 ? 25  VAL A CG1  6  
ATOM 10001 C CG2  . VAL A 1 25  ? 1.113   7.264   2.908   1.00 0.00 ? 25  VAL A CG2  6  
ATOM 10002 H H    . VAL A 1 25  ? 3.511   9.723   3.128   1.00 0.00 ? 25  VAL A H    6  
ATOM 10003 H HA   . VAL A 1 25  ? 2.923   7.872   0.913   1.00 0.00 ? 25  VAL A HA   6  
ATOM 10004 H HB   . VAL A 1 25  ? 0.865   9.345   2.571   1.00 0.00 ? 25  VAL A HB   6  
ATOM 10005 H HG11 . VAL A 1 25  ? -0.790  8.149   1.209   1.00 0.00 ? 25  VAL A HG11 6  
ATOM 10006 H HG12 . VAL A 1 25  ? 0.511   7.479   0.227   1.00 0.00 ? 25  VAL A HG12 6  
ATOM 10007 H HG13 . VAL A 1 25  ? 0.215   9.219   0.227   1.00 0.00 ? 25  VAL A HG13 6  
ATOM 10008 H HG21 . VAL A 1 25  ? 1.776   7.408   3.748   1.00 0.00 ? 25  VAL A HG21 6  
ATOM 10009 H HG22 . VAL A 1 25  ? 1.417   6.386   2.355   1.00 0.00 ? 25  VAL A HG22 6  
ATOM 10010 H HG23 . VAL A 1 25  ? 0.103   7.131   3.266   1.00 0.00 ? 25  VAL A HG23 6  
ATOM 10011 N N    . ASP A 1 26  ? 2.570   9.742   -0.712  1.00 0.00 ? 26  ASP A N    6  
ATOM 10012 C CA   . ASP A 1 26  ? 2.458   10.817  -1.693  1.00 0.00 ? 26  ASP A CA   6  
ATOM 10013 C C    . ASP A 1 26  ? 0.986   11.186  -1.911  1.00 0.00 ? 26  ASP A C    6  
ATOM 10014 O O    . ASP A 1 26  ? 0.101   10.335  -1.801  1.00 0.00 ? 26  ASP A O    6  
ATOM 10015 C CB   . ASP A 1 26  ? 3.088   10.359  -3.012  1.00 0.00 ? 26  ASP A CB   6  
ATOM 10016 C CG   . ASP A 1 26  ? 3.139   11.450  -4.060  1.00 0.00 ? 26  ASP A CG   6  
ATOM 10017 O OD1  . ASP A 1 26  ? 2.089   11.738  -4.674  1.00 0.00 ? 26  ASP A OD1  6  
ATOM 10018 O OD2  . ASP A 1 26  ? 4.237   12.001  -4.301  1.00 0.00 ? 26  ASP A OD2  6  
ATOM 10019 H H    . ASP A 1 26  ? 2.641   8.822   -1.048  1.00 0.00 ? 26  ASP A H    6  
ATOM 10020 H HA   . ASP A 1 26  ? 2.992   11.677  -1.316  1.00 0.00 ? 26  ASP A HA   6  
ATOM 10021 H HB2  . ASP A 1 26  ? 4.099   10.028  -2.822  1.00 0.00 ? 26  ASP A HB2  6  
ATOM 10022 H HB3  . ASP A 1 26  ? 2.514   9.535   -3.408  1.00 0.00 ? 26  ASP A HB3  6  
ATOM 10023 N N    . HIS A 1 27  ? 0.739   12.466  -2.209  1.00 0.00 ? 27  HIS A N    6  
ATOM 10024 C CA   . HIS A 1 27  ? -0.618  13.009  -2.390  1.00 0.00 ? 27  HIS A CA   6  
ATOM 10025 C C    . HIS A 1 27  ? -1.415  12.268  -3.454  1.00 0.00 ? 27  HIS A C    6  
ATOM 10026 O O    . HIS A 1 27  ? -2.636  12.386  -3.505  1.00 0.00 ? 27  HIS A O    6  
ATOM 10027 C CB   . HIS A 1 27  ? -0.569  14.487  -2.769  1.00 0.00 ? 27  HIS A CB   6  
ATOM 10028 C CG   . HIS A 1 27  ? -0.160  15.406  -1.661  1.00 0.00 ? 27  HIS A CG   6  
ATOM 10029 N ND1  . HIS A 1 27  ? 0.756   16.415  -1.830  1.00 0.00 ? 27  HIS A ND1  6  
ATOM 10030 C CD2  . HIS A 1 27  ? -0.561  15.482  -0.372  1.00 0.00 ? 27  HIS A CD2  6  
ATOM 10031 C CE1  . HIS A 1 27  ? 0.906   17.067  -0.693  1.00 0.00 ? 27  HIS A CE1  6  
ATOM 10032 N NE2  . HIS A 1 27  ? 0.116   16.520  0.209   1.00 0.00 ? 27  HIS A NE2  6  
ATOM 10033 H H    . HIS A 1 27  ? 1.504   13.074  -2.311  1.00 0.00 ? 27  HIS A H    6  
ATOM 10034 H HA   . HIS A 1 27  ? -1.140  12.913  -1.452  1.00 0.00 ? 27  HIS A HA   6  
ATOM 10035 H HB2  . HIS A 1 27  ? 0.139   14.609  -3.571  1.00 0.00 ? 27  HIS A HB2  6  
ATOM 10036 H HB3  . HIS A 1 27  ? -1.547  14.791  -3.110  1.00 0.00 ? 27  HIS A HB3  6  
ATOM 10037 H HD1  . HIS A 1 27  ? 1.217   16.639  -2.673  1.00 0.00 ? 27  HIS A HD1  6  
ATOM 10038 H HD2  . HIS A 1 27  ? -1.294  14.848  0.108   1.00 0.00 ? 27  HIS A HD2  6  
ATOM 10039 H HE1  . HIS A 1 27  ? 1.564   17.908  -0.531  1.00 0.00 ? 27  HIS A HE1  6  
ATOM 10040 H HE2  . HIS A 1 27  ? 0.207   16.659  1.186   1.00 0.00 ? 27  HIS A HE2  6  
ATOM 10041 N N    . ARG A 1 28  ? -0.732  11.514  -4.304  1.00 0.00 ? 28  ARG A N    6  
ATOM 10042 C CA   . ARG A 1 28  ? -1.397  10.705  -5.316  1.00 0.00 ? 28  ARG A CA   6  
ATOM 10043 C C    . ARG A 1 28  ? -2.302  9.644   -4.679  1.00 0.00 ? 28  ARG A C    6  
ATOM 10044 O O    . ARG A 1 28  ? -3.128  9.039   -5.359  1.00 0.00 ? 28  ARG A O    6  
ATOM 10045 C CB   . ARG A 1 28  ? -0.357  10.070  -6.233  1.00 0.00 ? 28  ARG A CB   6  
ATOM 10046 C CG   . ARG A 1 28  ? 0.133   11.016  -7.312  1.00 0.00 ? 28  ARG A CG   6  
ATOM 10047 C CD   . ARG A 1 28  ? 1.424   10.537  -7.955  1.00 0.00 ? 28  ARG A CD   6  
ATOM 10048 N NE   . ARG A 1 28  ? 2.595   10.891  -7.158  1.00 0.00 ? 28  ARG A NE   6  
ATOM 10049 C CZ   . ARG A 1 28  ? 3.850   10.807  -7.593  1.00 0.00 ? 28  ARG A CZ   6  
ATOM 10050 N NH1  . ARG A 1 28  ? 4.113   10.321  -8.803  1.00 0.00 ? 28  ARG A NH1  6  
ATOM 10051 N NH2  . ARG A 1 28  ? 4.846   11.204  -6.812  1.00 0.00 ? 28  ARG A NH2  6  
ATOM 10052 H H    . ARG A 1 28  ? 0.255   11.509  -4.255  1.00 0.00 ? 28  ARG A H    6  
ATOM 10053 H HA   . ARG A 1 28  ? -2.015  11.370  -5.904  1.00 0.00 ? 28  ARG A HA   6  
ATOM 10054 H HB2  . ARG A 1 28  ? 0.493   9.761   -5.643  1.00 0.00 ? 28  ARG A HB2  6  
ATOM 10055 H HB3  . ARG A 1 28  ? -0.789  9.204   -6.712  1.00 0.00 ? 28  ARG A HB3  6  
ATOM 10056 H HG2  . ARG A 1 28  ? -0.627  11.095  -8.077  1.00 0.00 ? 28  ARG A HG2  6  
ATOM 10057 H HG3  . ARG A 1 28  ? 0.300   11.988  -6.872  1.00 0.00 ? 28  ARG A HG3  6  
ATOM 10058 H HD2  . ARG A 1 28  ? 1.383   9.462   -8.056  1.00 0.00 ? 28  ARG A HD2  6  
ATOM 10059 H HD3  . ARG A 1 28  ? 1.514   10.988  -8.932  1.00 0.00 ? 28  ARG A HD3  6  
ATOM 10060 H HE   . ARG A 1 28  ? 2.430   11.237  -6.241  1.00 0.00 ? 28  ARG A HE   6  
ATOM 10061 H HH11 . ARG A 1 28  ? 3.362   10.009  -9.404  1.00 0.00 ? 28  ARG A HH11 6  
ATOM 10062 H HH12 . ARG A 1 28  ? 5.066   10.261  -9.129  1.00 0.00 ? 28  ARG A HH12 6  
ATOM 10063 H HH21 . ARG A 1 28  ? 4.649   11.569  -5.888  1.00 0.00 ? 28  ARG A HH21 6  
ATOM 10064 H HH22 . ARG A 1 28  ? 5.796   11.149  -7.129  1.00 0.00 ? 28  ARG A HH22 6  
ATOM 10065 N N    . CYS A 1 29  ? -2.149  9.452   -3.368  1.00 0.00 ? 29  CYS A N    6  
ATOM 10066 C CA   . CYS A 1 29  ? -3.017  8.568   -2.591  1.00 0.00 ? 29  CYS A CA   6  
ATOM 10067 C C    . CYS A 1 29  ? -4.493  8.911   -2.790  1.00 0.00 ? 29  CYS A C    6  
ATOM 10068 O O    . CYS A 1 29  ? -5.356  8.029   -2.812  1.00 0.00 ? 29  CYS A O    6  
ATOM 10069 C CB   . CYS A 1 29  ? -2.656  8.668   -1.109  1.00 0.00 ? 29  CYS A CB   6  
ATOM 10070 S SG   . CYS A 1 29  ? -3.726  7.703   -0.024  1.00 0.00 ? 29  CYS A SG   6  
ATOM 10071 H H    . CYS A 1 29  ? -1.414  9.912   -2.906  1.00 0.00 ? 29  CYS A H    6  
ATOM 10072 H HA   . CYS A 1 29  ? -2.849  7.563   -2.918  1.00 0.00 ? 29  CYS A HA   6  
ATOM 10073 H HB2  . CYS A 1 29  ? -1.644  8.317   -0.967  1.00 0.00 ? 29  CYS A HB2  6  
ATOM 10074 H HB3  . CYS A 1 29  ? -2.719  9.700   -0.800  1.00 0.00 ? 29  CYS A HB3  6  
ATOM 10075 H HG   . CYS A 1 29  ? -4.942  8.226   -0.096  1.00 0.00 ? 29  CYS A HG   6  
ATOM 10076 N N    . VAL A 1 30  ? -4.767  10.196  -2.953  1.00 0.00 ? 30  VAL A N    6  
ATOM 10077 C CA   . VAL A 1 30  ? -6.130  10.688  -3.091  1.00 0.00 ? 30  VAL A CA   6  
ATOM 10078 C C    . VAL A 1 30  ? -6.774  10.177  -4.369  1.00 0.00 ? 30  VAL A C    6  
ATOM 10079 O O    . VAL A 1 30  ? -7.930  9.762   -4.374  1.00 0.00 ? 30  VAL A O    6  
ATOM 10080 C CB   . VAL A 1 30  ? -6.148  12.220  -3.122  1.00 0.00 ? 30  VAL A CB   6  
ATOM 10081 C CG1  . VAL A 1 30  ? -7.572  12.735  -3.195  1.00 0.00 ? 30  VAL A CG1  6  
ATOM 10082 C CG2  . VAL A 1 30  ? -5.407  12.801  -1.928  1.00 0.00 ? 30  VAL A CG2  6  
ATOM 10083 H H    . VAL A 1 30  ? -4.028  10.836  -2.991  1.00 0.00 ? 30  VAL A H    6  
ATOM 10084 H HA   . VAL A 1 30  ? -6.712  10.351  -2.241  1.00 0.00 ? 30  VAL A HA   6  
ATOM 10085 H HB   . VAL A 1 30  ? -5.639  12.534  -4.016  1.00 0.00 ? 30  VAL A HB   6  
ATOM 10086 H HG11 . VAL A 1 30  ? -8.021  12.417  -4.126  1.00 0.00 ? 30  VAL A HG11 6  
ATOM 10087 H HG12 . VAL A 1 30  ? -7.569  13.814  -3.145  1.00 0.00 ? 30  VAL A HG12 6  
ATOM 10088 H HG13 . VAL A 1 30  ? -8.141  12.336  -2.368  1.00 0.00 ? 30  VAL A HG13 6  
ATOM 10089 H HG21 . VAL A 1 30  ? -5.867  12.456  -1.013  1.00 0.00 ? 30  VAL A HG21 6  
ATOM 10090 H HG22 . VAL A 1 30  ? -5.447  13.880  -1.964  1.00 0.00 ? 30  VAL A HG22 6  
ATOM 10091 H HG23 . VAL A 1 30  ? -4.376  12.480  -1.954  1.00 0.00 ? 30  VAL A HG23 6  
ATOM 10092 N N    . ALA A 1 31  ? -6.022  10.208  -5.452  1.00 0.00 ? 31  ALA A N    6  
ATOM 10093 C CA   . ALA A 1 31  ? -6.558  9.788   -6.733  1.00 0.00 ? 31  ALA A CA   6  
ATOM 10094 C C    . ALA A 1 31  ? -6.769  8.283   -6.753  1.00 0.00 ? 31  ALA A C    6  
ATOM 10095 O O    . ALA A 1 31  ? -7.807  7.800   -7.206  1.00 0.00 ? 31  ALA A O    6  
ATOM 10096 C CB   . ALA A 1 31  ? -5.644  10.216  -7.866  1.00 0.00 ? 31  ALA A CB   6  
ATOM 10097 H H    . ALA A 1 31  ? -5.088  10.502  -5.385  1.00 0.00 ? 31  ALA A H    6  
ATOM 10098 H HA   . ALA A 1 31  ? -7.513  10.276  -6.867  1.00 0.00 ? 31  ALA A HA   6  
ATOM 10099 H HB1  . ALA A 1 31  ? -5.480  11.282  -7.815  1.00 0.00 ? 31  ALA A HB1  6  
ATOM 10100 H HB2  . ALA A 1 31  ? -6.103  9.968   -8.812  1.00 0.00 ? 31  ALA A HB2  6  
ATOM 10101 H HB3  . ALA A 1 31  ? -4.698  9.703   -7.778  1.00 0.00 ? 31  ALA A HB3  6  
ATOM 10102 N N    . THR A 1 32  ? -5.768  7.550   -6.286  1.00 0.00 ? 32  THR A N    6  
ATOM 10103 C CA   . THR A 1 32  ? -5.850  6.106   -6.189  1.00 0.00 ? 32  THR A CA   6  
ATOM 10104 C C    . THR A 1 32  ? -6.980  5.631   -5.270  1.00 0.00 ? 32  THR A C    6  
ATOM 10105 O O    . THR A 1 32  ? -7.861  4.888   -5.704  1.00 0.00 ? 32  THR A O    6  
ATOM 10106 C CB   . THR A 1 32  ? -4.520  5.531   -5.678  1.00 0.00 ? 32  THR A CB   6  
ATOM 10107 O OG1  . THR A 1 32  ? -3.428  6.177   -6.342  1.00 0.00 ? 32  THR A OG1  6  
ATOM 10108 C CG2  . THR A 1 32  ? -4.445  4.037   -5.931  1.00 0.00 ? 32  THR A CG2  6  
ATOM 10109 H H    . THR A 1 32  ? -4.908  7.977   -6.075  1.00 0.00 ? 32  THR A H    6  
ATOM 10110 H HA   . THR A 1 32  ? -6.022  5.717   -7.180  1.00 0.00 ? 32  THR A HA   6  
ATOM 10111 H HB   . THR A 1 32  ? -4.447  5.708   -4.615  1.00 0.00 ? 32  THR A HB   6  
ATOM 10112 H HG1  . THR A 1 32  ? -3.320  5.795   -7.222  1.00 0.00 ? 32  THR A HG1  6  
ATOM 10113 H HG21 . THR A 1 32  ? -4.522  3.847   -6.991  1.00 0.00 ? 32  THR A HG21 6  
ATOM 10114 H HG22 . THR A 1 32  ? -5.257  3.543   -5.417  1.00 0.00 ? 32  THR A HG22 6  
ATOM 10115 H HG23 . THR A 1 32  ? -3.503  3.659   -5.565  1.00 0.00 ? 32  THR A HG23 6  
ATOM 10116 N N    . VAL A 1 33  ? -6.962  6.053   -4.005  1.00 0.00 ? 33  VAL A N    6  
ATOM 10117 C CA   . VAL A 1 33  ? -7.838  5.450   -3.003  1.00 0.00 ? 33  VAL A CA   6  
ATOM 10118 C C    . VAL A 1 33  ? -8.540  6.488   -2.128  1.00 0.00 ? 33  VAL A C    6  
ATOM 10119 O O    . VAL A 1 33  ? -8.995  6.182   -1.026  1.00 0.00 ? 33  VAL A O    6  
ATOM 10120 C CB   . VAL A 1 33  ? -7.058  4.467   -2.106  1.00 0.00 ? 33  VAL A CB   6  
ATOM 10121 C CG1  . VAL A 1 33  ? -6.511  3.314   -2.932  1.00 0.00 ? 33  VAL A CG1  6  
ATOM 10122 C CG2  . VAL A 1 33  ? -5.935  5.180   -1.366  1.00 0.00 ? 33  VAL A CG2  6  
ATOM 10123 H H    . VAL A 1 33  ? -6.370  6.796   -3.740  1.00 0.00 ? 33  VAL A H    6  
ATOM 10124 H HA   . VAL A 1 33  ? -8.591  4.885   -3.531  1.00 0.00 ? 33  VAL A HA   6  
ATOM 10125 H HB   . VAL A 1 33  ? -7.741  4.063   -1.374  1.00 0.00 ? 33  VAL A HB   6  
ATOM 10126 H HG11 . VAL A 1 33  ? -7.330  2.777   -3.388  1.00 0.00 ? 33  VAL A HG11 6  
ATOM 10127 H HG12 . VAL A 1 33  ? -5.953  2.647   -2.291  1.00 0.00 ? 33  VAL A HG12 6  
ATOM 10128 H HG13 . VAL A 1 33  ? -5.861  3.699   -3.704  1.00 0.00 ? 33  VAL A HG13 6  
ATOM 10129 H HG21 . VAL A 1 33  ? -5.248  5.609   -2.081  1.00 0.00 ? 33  VAL A HG21 6  
ATOM 10130 H HG22 . VAL A 1 33  ? -5.410  4.471   -0.744  1.00 0.00 ? 33  VAL A HG22 6  
ATOM 10131 H HG23 . VAL A 1 33  ? -6.348  5.964   -0.750  1.00 0.00 ? 33  VAL A HG23 6  
ATOM 10132 N N    . GLY A 1 34  ? -8.610  7.715   -2.614  1.00 0.00 ? 34  GLY A N    6  
ATOM 10133 C CA   . GLY A 1 34  ? -9.399  8.742   -1.947  1.00 0.00 ? 34  GLY A CA   6  
ATOM 10134 C C    . GLY A 1 34  ? -8.756  9.326   -0.699  1.00 0.00 ? 34  GLY A C    6  
ATOM 10135 O O    . GLY A 1 34  ? -9.081  10.445  -0.299  1.00 0.00 ? 34  GLY A O    6  
ATOM 10136 H H    . GLY A 1 34  ? -8.142  7.918   -3.452  1.00 0.00 ? 34  GLY A H    6  
ATOM 10137 H HA2  . GLY A 1 34  ? -9.584  9.543   -2.645  1.00 0.00 ? 34  GLY A HA2  6  
ATOM 10138 H HA3  . GLY A 1 34  ? -10.345 8.306   -1.666  1.00 0.00 ? 34  GLY A HA3  6  
ATOM 10139 N N    . TYR A 1 35  ? -7.857  8.585   -0.076  1.00 0.00 ? 35  TYR A N    6  
ATOM 10140 C CA   . TYR A 1 35  ? -7.287  9.010   1.191   1.00 0.00 ? 35  TYR A CA   6  
ATOM 10141 C C    . TYR A 1 35  ? -6.231  10.064  0.977   1.00 0.00 ? 35  TYR A C    6  
ATOM 10142 O O    . TYR A 1 35  ? -5.565  10.097  -0.054  1.00 0.00 ? 35  TYR A O    6  
ATOM 10143 C CB   . TYR A 1 35  ? -6.668  7.849   1.972   1.00 0.00 ? 35  TYR A CB   6  
ATOM 10144 C CG   . TYR A 1 35  ? -7.664  6.830   2.471   1.00 0.00 ? 35  TYR A CG   6  
ATOM 10145 C CD1  . TYR A 1 35  ? -8.844  7.234   3.076   1.00 0.00 ? 35  TYR A CD1  6  
ATOM 10146 C CD2  . TYR A 1 35  ? -7.415  5.467   2.364   1.00 0.00 ? 35  TYR A CD2  6  
ATOM 10147 C CE1  . TYR A 1 35  ? -9.751  6.314   3.558   1.00 0.00 ? 35  TYR A CE1  6  
ATOM 10148 C CE2  . TYR A 1 35  ? -8.317  4.540   2.842   1.00 0.00 ? 35  TYR A CE2  6  
ATOM 10149 C CZ   . TYR A 1 35  ? -9.485  4.971   3.439   1.00 0.00 ? 35  TYR A CZ   6  
ATOM 10150 O OH   . TYR A 1 35  ? -10.393 4.053   3.915   1.00 0.00 ? 35  TYR A OH   6  
ATOM 10151 H H    . TYR A 1 35  ? -7.558  7.752   -0.493  1.00 0.00 ? 35  TYR A H    6  
ATOM 10152 H HA   . TYR A 1 35  ? -8.084  9.439   1.780   1.00 0.00 ? 35  TYR A HA   6  
ATOM 10153 H HB2  . TYR A 1 35  ? -5.953  7.343   1.347   1.00 0.00 ? 35  TYR A HB2  6  
ATOM 10154 H HB3  . TYR A 1 35  ? -6.151  8.251   2.833   1.00 0.00 ? 35  TYR A HB3  6  
ATOM 10155 H HD1  . TYR A 1 35  ? -9.051  8.291   3.169   1.00 0.00 ? 35  TYR A HD1  6  
ATOM 10156 H HD2  . TYR A 1 35  ? -6.502  5.134   1.896   1.00 0.00 ? 35  TYR A HD2  6  
ATOM 10157 H HE1  . TYR A 1 35  ? -10.665 6.650   4.026   1.00 0.00 ? 35  TYR A HE1  6  
ATOM 10158 H HE2  . TYR A 1 35  ? -8.101  3.482   2.753   1.00 0.00 ? 35  TYR A HE2  6  
ATOM 10159 H HH   . TYR A 1 35  ? -9.920  3.282   4.244   1.00 0.00 ? 35  TYR A HH   6  
ATOM 10160 N N    . GLN A 1 36  ? -6.078  10.921  1.958   1.00 0.00 ? 36  GLN A N    6  
ATOM 10161 C CA   . GLN A 1 36  ? -5.014  11.892  1.929   1.00 0.00 ? 36  GLN A CA   6  
ATOM 10162 C C    . GLN A 1 36  ? -3.822  11.268  2.624   1.00 0.00 ? 36  GLN A C    6  
ATOM 10163 O O    . GLN A 1 36  ? -4.014  10.511  3.573   1.00 0.00 ? 36  GLN A O    6  
ATOM 10164 C CB   . GLN A 1 36  ? -5.407  13.191  2.648   1.00 0.00 ? 36  GLN A CB   6  
ATOM 10165 C CG   . GLN A 1 36  ? -6.854  13.620  2.446   1.00 0.00 ? 36  GLN A CG   6  
ATOM 10166 C CD   . GLN A 1 36  ? -7.194  13.944  1.008   1.00 0.00 ? 36  GLN A CD   6  
ATOM 10167 O OE1  . GLN A 1 36  ? -7.017  15.075  0.555   1.00 0.00 ? 36  GLN A OE1  6  
ATOM 10168 N NE2  . GLN A 1 36  ? -7.691  12.961  0.281   1.00 0.00 ? 36  GLN A NE2  6  
ATOM 10169 H H    . GLN A 1 36  ? -6.668  10.863  2.738   1.00 0.00 ? 36  GLN A H    6  
ATOM 10170 H HA   . GLN A 1 36  ? -4.762  12.091  0.893   1.00 0.00 ? 36  GLN A HA   6  
ATOM 10171 H HB2  . GLN A 1 36  ? -5.243  13.061  3.707   1.00 0.00 ? 36  GLN A HB2  6  
ATOM 10172 H HB3  . GLN A 1 36  ? -4.770  13.990  2.295   1.00 0.00 ? 36  GLN A HB3  6  
ATOM 10173 H HG2  . GLN A 1 36  ? -7.498  12.818  2.775   1.00 0.00 ? 36  GLN A HG2  6  
ATOM 10174 H HG3  . GLN A 1 36  ? -7.041  14.496  3.050   1.00 0.00 ? 36  GLN A HG3  6  
ATOM 10175 H HE21 . GLN A 1 36  ? -7.804  12.083  0.702   1.00 0.00 ? 36  GLN A HE21 6  
ATOM 10176 H HE22 . GLN A 1 36  ? -7.949  13.152  -0.648  1.00 0.00 ? 36  GLN A HE22 6  
ATOM 10177 N N    . PRO A 1 37  ? -2.596  11.542  2.171   1.00 0.00 ? 37  PRO A N    6  
ATOM 10178 C CA   . PRO A 1 37  ? -1.394  10.926  2.741   1.00 0.00 ? 37  PRO A CA   6  
ATOM 10179 C C    . PRO A 1 37  ? -1.394  10.949  4.260   1.00 0.00 ? 37  PRO A C    6  
ATOM 10180 O O    . PRO A 1 37  ? -1.141  9.935   4.913   1.00 0.00 ? 37  PRO A O    6  
ATOM 10181 C CB   . PRO A 1 37  ? -0.273  11.799  2.196   1.00 0.00 ? 37  PRO A CB   6  
ATOM 10182 C CG   . PRO A 1 37  ? -0.790  12.281  0.891   1.00 0.00 ? 37  PRO A CG   6  
ATOM 10183 C CD   . PRO A 1 37  ? -2.272  12.468  1.074   1.00 0.00 ? 37  PRO A CD   6  
ATOM 10184 H HA   . PRO A 1 37  ? -1.267  9.916   2.397   1.00 0.00 ? 37  PRO A HA   6  
ATOM 10185 H HB2  . PRO A 1 37  ? -0.085  12.616  2.876   1.00 0.00 ? 37  PRO A HB2  6  
ATOM 10186 H HB3  . PRO A 1 37  ? 0.621   11.213  2.071   1.00 0.00 ? 37  PRO A HB3  6  
ATOM 10187 H HG2  . PRO A 1 37  ? -0.320  13.220  0.637   1.00 0.00 ? 37  PRO A HG2  6  
ATOM 10188 H HG3  . PRO A 1 37  ? -0.598  11.543  0.126   1.00 0.00 ? 37  PRO A HG3  6  
ATOM 10189 H HD2  . PRO A 1 37  ? -2.492  13.488  1.354   1.00 0.00 ? 37  PRO A HD2  6  
ATOM 10190 H HD3  . PRO A 1 37  ? -2.802  12.199  0.174   1.00 0.00 ? 37  PRO A HD3  6  
ATOM 10191 N N    . GLN A 1 38  ? -1.738  12.106  4.803   1.00 0.00 ? 38  GLN A N    6  
ATOM 10192 C CA   . GLN A 1 38  ? -1.726  12.325  6.239   1.00 0.00 ? 38  GLN A CA   6  
ATOM 10193 C C    . GLN A 1 38  ? -2.731  11.412  6.944   1.00 0.00 ? 38  GLN A C    6  
ATOM 10194 O O    . GLN A 1 38  ? -2.476  10.934  8.051   1.00 0.00 ? 38  GLN A O    6  
ATOM 10195 C CB   . GLN A 1 38  ? -2.038  13.794  6.545   1.00 0.00 ? 38  GLN A CB   6  
ATOM 10196 C CG   . GLN A 1 38  ? -1.298  14.788  5.652   1.00 0.00 ? 38  GLN A CG   6  
ATOM 10197 C CD   . GLN A 1 38  ? 0.164   14.435  5.435   1.00 0.00 ? 38  GLN A CD   6  
ATOM 10198 O OE1  . GLN A 1 38  ? 0.513   13.751  4.476   1.00 0.00 ? 38  GLN A OE1  6  
ATOM 10199 N NE2  . GLN A 1 38  ? 1.024   14.897  6.314   1.00 0.00 ? 38  GLN A NE2  6  
ATOM 10200 H H    . GLN A 1 38  ? -1.988  12.843  4.210   1.00 0.00 ? 38  GLN A H    6  
ATOM 10201 H HA   . GLN A 1 38  ? -0.734  12.097  6.599   1.00 0.00 ? 38  GLN A HA   6  
ATOM 10202 H HB2  . GLN A 1 38  ? -3.099  13.956  6.413   1.00 0.00 ? 38  GLN A HB2  6  
ATOM 10203 H HB3  . GLN A 1 38  ? -1.777  14.001  7.572   1.00 0.00 ? 38  GLN A HB3  6  
ATOM 10204 H HG2  . GLN A 1 38  ? -1.788  14.816  4.689   1.00 0.00 ? 38  GLN A HG2  6  
ATOM 10205 H HG3  . GLN A 1 38  ? -1.351  15.765  6.106   1.00 0.00 ? 38  GLN A HG3  6  
ATOM 10206 H HE21 . GLN A 1 38  ? 0.687   15.445  7.058   1.00 0.00 ? 38  GLN A HE21 6  
ATOM 10207 H HE22 . GLN A 1 38  ? 1.973   14.671  6.190   1.00 0.00 ? 38  GLN A HE22 6  
ATOM 10208 N N    . GLU A 1 39  ? -3.853  11.149  6.277   1.00 0.00 ? 39  GLU A N    6  
ATOM 10209 C CA   . GLU A 1 39  ? -4.934  10.358  6.859   1.00 0.00 ? 39  GLU A CA   6  
ATOM 10210 C C    . GLU A 1 39  ? -4.501  8.912   7.048   1.00 0.00 ? 39  GLU A C    6  
ATOM 10211 O O    . GLU A 1 39  ? -4.993  8.216   7.937   1.00 0.00 ? 39  GLU A O    6  
ATOM 10212 C CB   . GLU A 1 39  ? -6.178  10.413  5.966   1.00 0.00 ? 39  GLU A CB   6  
ATOM 10213 C CG   . GLU A 1 39  ? -6.719  11.817  5.753   1.00 0.00 ? 39  GLU A CG   6  
ATOM 10214 C CD   . GLU A 1 39  ? -7.261  12.443  7.024   1.00 0.00 ? 39  GLU A CD   6  
ATOM 10215 O OE1  . GLU A 1 39  ? -6.480  13.076  7.764   1.00 0.00 ? 39  GLU A OE1  6  
ATOM 10216 O OE2  . GLU A 1 39  ? -8.475  12.313  7.282   1.00 0.00 ? 39  GLU A OE2  6  
ATOM 10217 H H    . GLU A 1 39  ? -3.954  11.493  5.365   1.00 0.00 ? 39  GLU A H    6  
ATOM 10218 H HA   . GLU A 1 39  ? -5.174  10.780  7.824   1.00 0.00 ? 39  GLU A HA   6  
ATOM 10219 H HB2  . GLU A 1 39  ? -5.930  9.999   5.001   1.00 0.00 ? 39  GLU A HB2  6  
ATOM 10220 H HB3  . GLU A 1 39  ? -6.957  9.816   6.415   1.00 0.00 ? 39  GLU A HB3  6  
ATOM 10221 H HG2  . GLU A 1 39  ? -5.922  12.441  5.379   1.00 0.00 ? 39  GLU A HG2  6  
ATOM 10222 H HG3  . GLU A 1 39  ? -7.514  11.775  5.020   1.00 0.00 ? 39  GLU A HG3  6  
ATOM 10223 N N    . LEU A 1 40  ? -3.577  8.469   6.207   1.00 0.00 ? 40  LEU A N    6  
ATOM 10224 C CA   . LEU A 1 40  ? -3.073  7.107   6.278   1.00 0.00 ? 40  LEU A CA   6  
ATOM 10225 C C    . LEU A 1 40  ? -2.015  6.963   7.361   1.00 0.00 ? 40  LEU A C    6  
ATOM 10226 O O    . LEU A 1 40  ? -1.819  5.876   7.903   1.00 0.00 ? 40  LEU A O    6  
ATOM 10227 C CB   . LEU A 1 40  ? -2.490  6.680   4.932   1.00 0.00 ? 40  LEU A CB   6  
ATOM 10228 C CG   . LEU A 1 40  ? -3.514  6.386   3.839   1.00 0.00 ? 40  LEU A CG   6  
ATOM 10229 C CD1  . LEU A 1 40  ? -2.814  5.895   2.583   1.00 0.00 ? 40  LEU A CD1  6  
ATOM 10230 C CD2  . LEU A 1 40  ? -4.523  5.356   4.321   1.00 0.00 ? 40  LEU A CD2  6  
ATOM 10231 H H    . LEU A 1 40  ? -3.222  9.073   5.519   1.00 0.00 ? 40  LEU A H    6  
ATOM 10232 H HA   . LEU A 1 40  ? -3.903  6.460   6.518   1.00 0.00 ? 40  LEU A HA   6  
ATOM 10233 H HB2  . LEU A 1 40  ? -1.839  7.467   4.581   1.00 0.00 ? 40  LEU A HB2  6  
ATOM 10234 H HB3  . LEU A 1 40  ? -1.900  5.794   5.088   1.00 0.00 ? 40  LEU A HB3  6  
ATOM 10235 H HG   . LEU A 1 40  ? -4.049  7.294   3.596   1.00 0.00 ? 40  LEU A HG   6  
ATOM 10236 H HD11 . LEU A 1 40  ? -3.546  5.696   1.814   1.00 0.00 ? 40  LEU A HD11 6  
ATOM 10237 H HD12 . LEU A 1 40  ? -2.270  4.988   2.806   1.00 0.00 ? 40  LEU A HD12 6  
ATOM 10238 H HD13 . LEU A 1 40  ? -2.124  6.651   2.237   1.00 0.00 ? 40  LEU A HD13 6  
ATOM 10239 H HD21 . LEU A 1 40  ? -5.243  5.163   3.540   1.00 0.00 ? 40  LEU A HD21 6  
ATOM 10240 H HD22 . LEU A 1 40  ? -5.031  5.733   5.197   1.00 0.00 ? 40  LEU A HD22 6  
ATOM 10241 H HD23 . LEU A 1 40  ? -4.010  4.439   4.571   1.00 0.00 ? 40  LEU A HD23 6  
ATOM 10242 N N    . LEU A 1 41  ? -1.323  8.055   7.666   1.00 0.00 ? 41  LEU A N    6  
ATOM 10243 C CA   . LEU A 1 41  ? -0.266  8.021   8.668   1.00 0.00 ? 41  LEU A CA   6  
ATOM 10244 C C    . LEU A 1 41  ? -0.847  7.683   10.035  1.00 0.00 ? 41  LEU A C    6  
ATOM 10245 O O    . LEU A 1 41  ? -1.521  8.504   10.661  1.00 0.00 ? 41  LEU A O    6  
ATOM 10246 C CB   . LEU A 1 41  ? 0.481   9.355   8.730   1.00 0.00 ? 41  LEU A CB   6  
ATOM 10247 C CG   . LEU A 1 41  ? 0.907   9.934   7.379   1.00 0.00 ? 41  LEU A CG   6  
ATOM 10248 C CD1  . LEU A 1 41  ? 1.658   11.239  7.574   1.00 0.00 ? 41  LEU A CD1  6  
ATOM 10249 C CD2  . LEU A 1 41  ? 1.763   8.940   6.609   1.00 0.00 ? 41  LEU A CD2  6  
ATOM 10250 H H    . LEU A 1 41  ? -1.522  8.895   7.195   1.00 0.00 ? 41  LEU A H    6  
ATOM 10251 H HA   . LEU A 1 41  ? 0.429   7.243   8.386   1.00 0.00 ? 41  LEU A HA   6  
ATOM 10252 H HB2  . LEU A 1 41  ? -0.150  10.076  9.228   1.00 0.00 ? 41  LEU A HB2  6  
ATOM 10253 H HB3  . LEU A 1 41  ? 1.372   9.207   9.323   1.00 0.00 ? 41  LEU A HB3  6  
ATOM 10254 H HG   . LEU A 1 41  ? 0.023   10.143  6.791   1.00 0.00 ? 41  LEU A HG   6  
ATOM 10255 H HD11 . LEU A 1 41  ? 2.559   11.052  8.141   1.00 0.00 ? 41  LEU A HD11 6  
ATOM 10256 H HD12 . LEU A 1 41  ? 1.034   11.938  8.110   1.00 0.00 ? 41  LEU A HD12 6  
ATOM 10257 H HD13 . LEU A 1 41  ? 1.918   11.652  6.612   1.00 0.00 ? 41  LEU A HD13 6  
ATOM 10258 H HD21 . LEU A 1 41  ? 2.629   8.681   7.198   1.00 0.00 ? 41  LEU A HD21 6  
ATOM 10259 H HD22 . LEU A 1 41  ? 2.081   9.387   5.678   1.00 0.00 ? 41  LEU A HD22 6  
ATOM 10260 H HD23 . LEU A 1 41  ? 1.187   8.052   6.403   1.00 0.00 ? 41  LEU A HD23 6  
ATOM 10261 N N    . GLY A 1 42  ? -0.596  6.461   10.478  1.00 0.00 ? 42  GLY A N    6  
ATOM 10262 C CA   . GLY A 1 42  ? -1.147  5.992   11.732  1.00 0.00 ? 42  GLY A CA   6  
ATOM 10263 C C    . GLY A 1 42  ? -2.012  4.766   11.538  1.00 0.00 ? 42  GLY A C    6  
ATOM 10264 O O    . GLY A 1 42  ? -2.288  4.029   12.485  1.00 0.00 ? 42  GLY A O    6  
ATOM 10265 H H    . GLY A 1 42  ? -0.028  5.867   9.945   1.00 0.00 ? 42  GLY A H    6  
ATOM 10266 H HA2  . GLY A 1 42  ? -0.338  5.748   12.405  1.00 0.00 ? 42  GLY A HA2  6  
ATOM 10267 H HA3  . GLY A 1 42  ? -1.746  6.777   12.169  1.00 0.00 ? 42  GLY A HA3  6  
ATOM 10268 N N    . LYS A 1 43  ? -2.445  4.545   10.304  1.00 0.00 ? 43  LYS A N    6  
ATOM 10269 C CA   . LYS A 1 43  ? -3.255  3.388   9.971   1.00 0.00 ? 43  LYS A CA   6  
ATOM 10270 C C    . LYS A 1 43  ? -2.433  2.354   9.212   1.00 0.00 ? 43  LYS A C    6  
ATOM 10271 O O    . LYS A 1 43  ? -1.410  2.678   8.601   1.00 0.00 ? 43  LYS A O    6  
ATOM 10272 C CB   . LYS A 1 43  ? -4.447  3.817   9.117   1.00 0.00 ? 43  LYS A CB   6  
ATOM 10273 C CG   . LYS A 1 43  ? -5.432  4.728   9.834   1.00 0.00 ? 43  LYS A CG   6  
ATOM 10274 C CD   . LYS A 1 43  ? -6.446  3.948   10.666  1.00 0.00 ? 43  LYS A CD   6  
ATOM 10275 C CE   . LYS A 1 43  ? -5.839  3.391   11.947  1.00 0.00 ? 43  LYS A CE   6  
ATOM 10276 N NZ   . LYS A 1 43  ? -6.835  2.644   12.765  1.00 0.00 ? 43  LYS A NZ   6  
ATOM 10277 H H    . LYS A 1 43  ? -2.212  5.177   9.589   1.00 0.00 ? 43  LYS A H    6  
ATOM 10278 H HA   . LYS A 1 43  ? -3.615  2.951   10.890  1.00 0.00 ? 43  LYS A HA   6  
ATOM 10279 H HB2  . LYS A 1 43  ? -4.077  4.341   8.248   1.00 0.00 ? 43  LYS A HB2  6  
ATOM 10280 H HB3  . LYS A 1 43  ? -4.978  2.934   8.793   1.00 0.00 ? 43  LYS A HB3  6  
ATOM 10281 H HG2  . LYS A 1 43  ? -4.880  5.386   10.490  1.00 0.00 ? 43  LYS A HG2  6  
ATOM 10282 H HG3  . LYS A 1 43  ? -5.956  5.316   9.098   1.00 0.00 ? 43  LYS A HG3  6  
ATOM 10283 H HD2  . LYS A 1 43  ? -7.260  4.607   10.927  1.00 0.00 ? 43  LYS A HD2  6  
ATOM 10284 H HD3  . LYS A 1 43  ? -6.825  3.130   10.071  1.00 0.00 ? 43  LYS A HD3  6  
ATOM 10285 H HE2  . LYS A 1 43  ? -5.032  2.723   11.685  1.00 0.00 ? 43  LYS A HE2  6  
ATOM 10286 H HE3  . LYS A 1 43  ? -5.449  4.212   12.529  1.00 0.00 ? 43  LYS A HE3  6  
ATOM 10287 H HZ1  . LYS A 1 43  ? -7.724  3.187   12.833  1.00 0.00 ? 43  LYS A HZ1  6  
ATOM 10288 H HZ2  . LYS A 1 43  ? -6.463  2.491   13.728  1.00 0.00 ? 43  LYS A HZ2  6  
ATOM 10289 H HZ3  . LYS A 1 43  ? -7.038  1.713   12.333  1.00 0.00 ? 43  LYS A HZ3  6  
ATOM 10290 N N    . ASN A 1 44  ? -2.881  1.111   9.270   1.00 0.00 ? 44  ASN A N    6  
ATOM 10291 C CA   . ASN A 1 44  ? -2.248  0.021   8.543   1.00 0.00 ? 44  ASN A CA   6  
ATOM 10292 C C    . ASN A 1 44  ? -2.969  -0.174  7.218   1.00 0.00 ? 44  ASN A C    6  
ATOM 10293 O O    . ASN A 1 44  ? -4.172  0.069   7.117   1.00 0.00 ? 44  ASN A O    6  
ATOM 10294 C CB   . ASN A 1 44  ? -2.323  -1.268  9.381   1.00 0.00 ? 44  ASN A CB   6  
ATOM 10295 C CG   . ASN A 1 44  ? -1.365  -2.357  8.911   1.00 0.00 ? 44  ASN A CG   6  
ATOM 10296 O OD1  . ASN A 1 44  ? -1.170  -2.558  7.717   1.00 0.00 ? 44  ASN A OD1  6  
ATOM 10297 N ND2  . ASN A 1 44  ? -0.746  -3.056  9.853   1.00 0.00 ? 44  ASN A ND2  6  
ATOM 10298 H H    . ASN A 1 44  ? -3.662  0.910   9.823   1.00 0.00 ? 44  ASN A H    6  
ATOM 10299 H HA   . ASN A 1 44  ? -1.215  0.279   8.362   1.00 0.00 ? 44  ASN A HA   6  
ATOM 10300 H HB2  . ASN A 1 44  ? -2.094  -1.038  10.410  1.00 0.00 ? 44  ASN A HB2  6  
ATOM 10301 H HB3  . ASN A 1 44  ? -3.333  -1.661  9.320   1.00 0.00 ? 44  ASN A HB3  6  
ATOM 10302 H HD21 . ASN A 1 44  ? -0.932  -2.846  10.798  1.00 0.00 ? 44  ASN A HD21 6  
ATOM 10303 H HD22 . ASN A 1 44  ? -0.108  -3.749  9.569   1.00 0.00 ? 44  ASN A HD22 6  
ATOM 10304 N N    . ILE A 1 45  ? -2.234  -0.599  6.200   1.00 0.00 ? 45  ILE A N    6  
ATOM 10305 C CA   . ILE A 1 45  ? -2.829  -0.932  4.913   1.00 0.00 ? 45  ILE A CA   6  
ATOM 10306 C C    . ILE A 1 45  ? -3.809  -2.098  5.077   1.00 0.00 ? 45  ILE A C    6  
ATOM 10307 O O    . ILE A 1 45  ? -4.743  -2.256  4.296   1.00 0.00 ? 45  ILE A O    6  
ATOM 10308 C CB   . ILE A 1 45  ? -1.741  -1.285  3.867   1.00 0.00 ? 45  ILE A CB   6  
ATOM 10309 C CG1  . ILE A 1 45  ? -2.368  -1.544  2.495   1.00 0.00 ? 45  ILE A CG1  6  
ATOM 10310 C CG2  . ILE A 1 45  ? -0.928  -2.490  4.319   1.00 0.00 ? 45  ILE A CG2  6  
ATOM 10311 C CD1  . ILE A 1 45  ? -1.354  -1.791  1.398   1.00 0.00 ? 45  ILE A CD1  6  
ATOM 10312 H H    . ILE A 1 45  ? -1.262  -0.693  6.320   1.00 0.00 ? 45  ILE A H    6  
ATOM 10313 H HA   . ILE A 1 45  ? -3.374  -0.066  4.556   1.00 0.00 ? 45  ILE A HA   6  
ATOM 10314 H HB   . ILE A 1 45  ? -1.067  -0.443  3.789   1.00 0.00 ? 45  ILE A HB   6  
ATOM 10315 H HG12 . ILE A 1 45  ? -3.005  -2.414  2.558   1.00 0.00 ? 45  ILE A HG12 6  
ATOM 10316 H HG13 . ILE A 1 45  ? -2.964  -0.689  2.210   1.00 0.00 ? 45  ILE A HG13 6  
ATOM 10317 H HG21 . ILE A 1 45  ? -0.425  -2.259  5.247   1.00 0.00 ? 45  ILE A HG21 6  
ATOM 10318 H HG22 . ILE A 1 45  ? -0.196  -2.734  3.563   1.00 0.00 ? 45  ILE A HG22 6  
ATOM 10319 H HG23 . ILE A 1 45  ? -1.586  -3.334  4.466   1.00 0.00 ? 45  ILE A HG23 6  
ATOM 10320 H HD11 . ILE A 1 45  ? -1.869  -1.935  0.458   1.00 0.00 ? 45  ILE A HD11 6  
ATOM 10321 H HD12 . ILE A 1 45  ? -0.779  -2.676  1.630   1.00 0.00 ? 45  ILE A HD12 6  
ATOM 10322 H HD13 . ILE A 1 45  ? -0.691  -0.943  1.320   1.00 0.00 ? 45  ILE A HD13 6  
ATOM 10323 N N    . VAL A 1 46  ? -3.599  -2.888  6.129   1.00 0.00 ? 46  VAL A N    6  
ATOM 10324 C CA   . VAL A 1 46  ? -4.483  -3.999  6.456   1.00 0.00 ? 46  VAL A CA   6  
ATOM 10325 C C    . VAL A 1 46  ? -5.826  -3.480  6.989   1.00 0.00 ? 46  VAL A C    6  
ATOM 10326 O O    . VAL A 1 46  ? -6.859  -4.125  6.814   1.00 0.00 ? 46  VAL A O    6  
ATOM 10327 C CB   . VAL A 1 46  ? -3.825  -4.937  7.495   1.00 0.00 ? 46  VAL A CB   6  
ATOM 10328 C CG1  . VAL A 1 46  ? -4.768  -6.058  7.910   1.00 0.00 ? 46  VAL A CG1  6  
ATOM 10329 C CG2  . VAL A 1 46  ? -2.528  -5.512  6.937   1.00 0.00 ? 46  VAL A CG2  6  
ATOM 10330 H H    . VAL A 1 46  ? -2.818  -2.720  6.703   1.00 0.00 ? 46  VAL A H    6  
ATOM 10331 H HA   . VAL A 1 46  ? -4.658  -4.561  5.551   1.00 0.00 ? 46  VAL A HA   6  
ATOM 10332 H HB   . VAL A 1 46  ? -3.583  -4.353  8.370   1.00 0.00 ? 46  VAL A HB   6  
ATOM 10333 H HG11 . VAL A 1 46  ? -5.691  -5.636  8.282   1.00 0.00 ? 46  VAL A HG11 6  
ATOM 10334 H HG12 . VAL A 1 46  ? -4.305  -6.649  8.687   1.00 0.00 ? 46  VAL A HG12 6  
ATOM 10335 H HG13 . VAL A 1 46  ? -4.978  -6.689  7.058   1.00 0.00 ? 46  VAL A HG13 6  
ATOM 10336 H HG21 . VAL A 1 46  ? -1.847  -4.707  6.709   1.00 0.00 ? 46  VAL A HG21 6  
ATOM 10337 H HG22 . VAL A 1 46  ? -2.740  -6.073  6.037   1.00 0.00 ? 46  VAL A HG22 6  
ATOM 10338 H HG23 . VAL A 1 46  ? -2.080  -6.166  7.672   1.00 0.00 ? 46  VAL A HG23 6  
ATOM 10339 N N    . GLU A 1 47  ? -5.805  -2.299  7.608   1.00 0.00 ? 47  GLU A N    6  
ATOM 10340 C CA   . GLU A 1 47  ? -7.020  -1.671  8.130   1.00 0.00 ? 47  GLU A CA   6  
ATOM 10341 C C    . GLU A 1 47  ? -8.018  -1.427  7.007   1.00 0.00 ? 47  GLU A C    6  
ATOM 10342 O O    . GLU A 1 47  ? -9.230  -1.548  7.186   1.00 0.00 ? 47  GLU A O    6  
ATOM 10343 C CB   . GLU A 1 47  ? -6.688  -0.334  8.796   1.00 0.00 ? 47  GLU A CB   6  
ATOM 10344 C CG   . GLU A 1 47  ? -5.876  -0.458  10.071  1.00 0.00 ? 47  GLU A CG   6  
ATOM 10345 C CD   . GLU A 1 47  ? -6.722  -0.843  11.263  1.00 0.00 ? 47  GLU A CD   6  
ATOM 10346 O OE1  . GLU A 1 47  ? -7.048  -2.036  11.411  1.00 0.00 ? 47  GLU A OE1  6  
ATOM 10347 O OE2  . GLU A 1 47  ? -7.056  0.054   12.064  1.00 0.00 ? 47  GLU A OE2  6  
ATOM 10348 H H    . GLU A 1 47  ? -4.950  -1.831  7.711   1.00 0.00 ? 47  GLU A H    6  
ATOM 10349 H HA   . GLU A 1 47  ? -7.459  -2.334  8.860   1.00 0.00 ? 47  GLU A HA   6  
ATOM 10350 H HB2  . GLU A 1 47  ? -6.127  0.268   8.097   1.00 0.00 ? 47  GLU A HB2  6  
ATOM 10351 H HB3  . GLU A 1 47  ? -7.612  0.175   9.032   1.00 0.00 ? 47  GLU A HB3  6  
ATOM 10352 H HG2  . GLU A 1 47  ? -5.118  -1.214  9.929   1.00 0.00 ? 47  GLU A HG2  6  
ATOM 10353 H HG3  . GLU A 1 47  ? -5.401  0.492   10.275  1.00 0.00 ? 47  GLU A HG3  6  
ATOM 10354 N N    . PHE A 1 48  ? -7.494  -1.081  5.845   1.00 0.00 ? 48  PHE A N    6  
ATOM 10355 C CA   . PHE A 1 48  ? -8.327  -0.766  4.700   1.00 0.00 ? 48  PHE A CA   6  
ATOM 10356 C C    . PHE A 1 48  ? -8.219  -1.860  3.654   1.00 0.00 ? 48  PHE A C    6  
ATOM 10357 O O    . PHE A 1 48  ? -8.553  -1.658  2.489   1.00 0.00 ? 48  PHE A O    6  
ATOM 10358 C CB   . PHE A 1 48  ? -7.929  0.583   4.112   1.00 0.00 ? 48  PHE A CB   6  
ATOM 10359 C CG   . PHE A 1 48  ? -7.935  1.689   5.128   1.00 0.00 ? 48  PHE A CG   6  
ATOM 10360 C CD1  . PHE A 1 48  ? -9.104  2.033   5.792   1.00 0.00 ? 48  PHE A CD1  6  
ATOM 10361 C CD2  . PHE A 1 48  ? -6.770  2.375   5.428   1.00 0.00 ? 48  PHE A CD2  6  
ATOM 10362 C CE1  . PHE A 1 48  ? -9.110  3.044   6.732   1.00 0.00 ? 48  PHE A CE1  6  
ATOM 10363 C CE2  . PHE A 1 48  ? -6.771  3.386   6.368   1.00 0.00 ? 48  PHE A CE2  6  
ATOM 10364 C CZ   . PHE A 1 48  ? -7.941  3.721   7.020   1.00 0.00 ? 48  PHE A CZ   6  
ATOM 10365 H H    . PHE A 1 48  ? -6.518  -1.049  5.751   1.00 0.00 ? 48  PHE A H    6  
ATOM 10366 H HA   . PHE A 1 48  ? -9.350  -0.712  5.039   1.00 0.00 ? 48  PHE A HA   6  
ATOM 10367 H HB2  . PHE A 1 48  ? -6.935  0.511   3.697   1.00 0.00 ? 48  PHE A HB2  6  
ATOM 10368 H HB3  . PHE A 1 48  ? -8.625  0.844   3.329   1.00 0.00 ? 48  PHE A HB3  6  
ATOM 10369 H HD1  . PHE A 1 48  ? -10.019 1.503   5.569   1.00 0.00 ? 48  PHE A HD1  6  
ATOM 10370 H HD2  . PHE A 1 48  ? -5.854  2.113   4.917   1.00 0.00 ? 48  PHE A HD2  6  
ATOM 10371 H HE1  . PHE A 1 48  ? -10.025 3.305   7.244   1.00 0.00 ? 48  PHE A HE1  6  
ATOM 10372 H HE2  . PHE A 1 48  ? -5.857  3.915   6.594   1.00 0.00 ? 48  PHE A HE2  6  
ATOM 10373 H HZ   . PHE A 1 48  ? -7.944  4.511   7.754   1.00 0.00 ? 48  PHE A HZ   6  
ATOM 10374 N N    . CYS A 1 49  ? -7.755  -3.020  4.083   1.00 0.00 ? 49  CYS A N    6  
ATOM 10375 C CA   . CYS A 1 49  ? -7.660  -4.168  3.204   1.00 0.00 ? 49  CYS A CA   6  
ATOM 10376 C C    . CYS A 1 49  ? -8.921  -5.016  3.307   1.00 0.00 ? 49  CYS A C    6  
ATOM 10377 O O    . CYS A 1 49  ? -9.449  -5.231  4.402   1.00 0.00 ? 49  CYS A O    6  
ATOM 10378 C CB   . CYS A 1 49  ? -6.435  -5.012  3.559   1.00 0.00 ? 49  CYS A CB   6  
ATOM 10379 S SG   . CYS A 1 49  ? -6.260  -6.500  2.551   1.00 0.00 ? 49  CYS A SG   6  
ATOM 10380 H H    . CYS A 1 49  ? -7.466  -3.109  5.023   1.00 0.00 ? 49  CYS A H    6  
ATOM 10381 H HA   . CYS A 1 49  ? -7.560  -3.806  2.193   1.00 0.00 ? 49  CYS A HA   6  
ATOM 10382 H HB2  . CYS A 1 49  ? -5.545  -4.416  3.422   1.00 0.00 ? 49  CYS A HB2  6  
ATOM 10383 H HB3  . CYS A 1 49  ? -6.503  -5.319  4.593   1.00 0.00 ? 49  CYS A HB3  6  
ATOM 10384 H HG   . CYS A 1 49  ? -6.779  -7.509  3.242   1.00 0.00 ? 49  CYS A HG   6  
ATOM 10385 N N    . HIS A 1 50  ? -9.429  -5.438  2.148   1.00 0.00 ? 50  HIS A N    6  
ATOM 10386 C CA   . HIS A 1 50  ? -10.559 -6.364  2.073   1.00 0.00 ? 50  HIS A CA   6  
ATOM 10387 C C    . HIS A 1 50  ? -10.361 -7.512  3.061   1.00 0.00 ? 50  HIS A C    6  
ATOM 10388 O O    . HIS A 1 50  ? -9.374  -8.226  2.979   1.00 0.00 ? 50  HIS A O    6  
ATOM 10389 C CB   . HIS A 1 50  ? -10.682 -6.901  0.640   1.00 0.00 ? 50  HIS A CB   6  
ATOM 10390 C CG   . HIS A 1 50  ? -11.831 -7.841  0.414   1.00 0.00 ? 50  HIS A CG   6  
ATOM 10391 N ND1  . HIS A 1 50  ? -11.663 -9.174  0.104   1.00 0.00 ? 50  HIS A ND1  6  
ATOM 10392 C CD2  . HIS A 1 50  ? -13.168 -7.626  0.414   1.00 0.00 ? 50  HIS A CD2  6  
ATOM 10393 C CE1  . HIS A 1 50  ? -12.844 -9.737  -0.075  1.00 0.00 ? 50  HIS A CE1  6  
ATOM 10394 N NE2  . HIS A 1 50  ? -13.770 -8.820  0.109   1.00 0.00 ? 50  HIS A NE2  6  
ATOM 10395 H H    . HIS A 1 50  ? -9.046  -5.083  1.315   1.00 0.00 ? 50  HIS A H    6  
ATOM 10396 H HA   . HIS A 1 50  ? -11.458 -5.822  2.332   1.00 0.00 ? 50  HIS A HA   6  
ATOM 10397 H HB2  . HIS A 1 50  ? -10.806 -6.066  -0.033  1.00 0.00 ? 50  HIS A HB2  6  
ATOM 10398 H HB3  . HIS A 1 50  ? -9.771  -7.424  0.386   1.00 0.00 ? 50  HIS A HB3  6  
ATOM 10399 H HD1  . HIS A 1 50  ? -10.790 -9.644  0.013   1.00 0.00 ? 50  HIS A HD1  6  
ATOM 10400 H HD2  . HIS A 1 50  ? -13.666 -6.689  0.617   1.00 0.00 ? 50  HIS A HD2  6  
ATOM 10401 H HE1  . HIS A 1 50  ? -13.018 -10.772 -0.323  1.00 0.00 ? 50  HIS A HE1  6  
ATOM 10402 H HE2  . HIS A 1 50  ? -14.739 -8.957  -0.029  1.00 0.00 ? 50  HIS A HE2  6  
ATOM 10403 N N    . PRO A 1 51  ? -11.319 -7.706  3.990   1.00 0.00 ? 51  PRO A N    6  
ATOM 10404 C CA   . PRO A 1 51  ? -11.180 -8.621  5.143   1.00 0.00 ? 51  PRO A CA   6  
ATOM 10405 C C    . PRO A 1 51  ? -10.688 -10.024 4.785   1.00 0.00 ? 51  PRO A C    6  
ATOM 10406 O O    . PRO A 1 51  ? -10.065 -10.691 5.605   1.00 0.00 ? 51  PRO A O    6  
ATOM 10407 C CB   . PRO A 1 51  ? -12.598 -8.695  5.731   1.00 0.00 ? 51  PRO A CB   6  
ATOM 10408 C CG   . PRO A 1 51  ? -13.487 -8.024  4.734   1.00 0.00 ? 51  PRO A CG   6  
ATOM 10409 C CD   . PRO A 1 51  ? -12.627 -7.040  4.004   1.00 0.00 ? 51  PRO A CD   6  
ATOM 10410 H HA   . PRO A 1 51  ? -10.516 -8.204  5.885   1.00 0.00 ? 51  PRO A HA   6  
ATOM 10411 H HB2  . PRO A 1 51  ? -12.874 -9.730  5.868   1.00 0.00 ? 51  PRO A HB2  6  
ATOM 10412 H HB3  . PRO A 1 51  ? -12.619 -8.185  6.682   1.00 0.00 ? 51  PRO A HB3  6  
ATOM 10413 H HG2  . PRO A 1 51  ? -13.885 -8.754  4.047   1.00 0.00 ? 51  PRO A HG2  6  
ATOM 10414 H HG3  . PRO A 1 51  ? -14.291 -7.512  5.245   1.00 0.00 ? 51  PRO A HG3  6  
ATOM 10415 H HD2  . PRO A 1 51  ? -12.995 -6.886  3.000   1.00 0.00 ? 51  PRO A HD2  6  
ATOM 10416 H HD3  . PRO A 1 51  ? -12.580 -6.104  4.542   1.00 0.00 ? 51  PRO A HD3  6  
ATOM 10417 N N    . GLU A 1 52  ? -10.950 -10.465 3.565   1.00 0.00 ? 52  GLU A N    6  
ATOM 10418 C CA   . GLU A 1 52  ? -10.568 -11.805 3.134   1.00 0.00 ? 52  GLU A CA   6  
ATOM 10419 C C    . GLU A 1 52  ? -9.163  -11.823 2.550   1.00 0.00 ? 52  GLU A C    6  
ATOM 10420 O O    . GLU A 1 52  ? -8.638  -12.882 2.210   1.00 0.00 ? 52  GLU A O    6  
ATOM 10421 C CB   . GLU A 1 52  ? -11.554 -12.331 2.102   1.00 0.00 ? 52  GLU A CB   6  
ATOM 10422 C CG   . GLU A 1 52  ? -12.960 -12.506 2.640   1.00 0.00 ? 52  GLU A CG   6  
ATOM 10423 C CD   . GLU A 1 52  ? -13.927 -12.962 1.572   1.00 0.00 ? 52  GLU A CD   6  
ATOM 10424 O OE1  . GLU A 1 52  ? -13.914 -14.161 1.220   1.00 0.00 ? 52  GLU A OE1  6  
ATOM 10425 O OE2  . GLU A 1 52  ? -14.697 -12.121 1.071   1.00 0.00 ? 52  GLU A OE2  6  
ATOM 10426 H H    . GLU A 1 52  ? -11.397 -9.873  2.926   1.00 0.00 ? 52  GLU A H    6  
ATOM 10427 H HA   . GLU A 1 52  ? -10.594 -12.449 3.996   1.00 0.00 ? 52  GLU A HA   6  
ATOM 10428 H HB2  . GLU A 1 52  ? -11.590 -11.640 1.279   1.00 0.00 ? 52  GLU A HB2  6  
ATOM 10429 H HB3  . GLU A 1 52  ? -11.207 -13.289 1.743   1.00 0.00 ? 52  GLU A HB3  6  
ATOM 10430 H HG2  . GLU A 1 52  ? -12.942 -13.244 3.428   1.00 0.00 ? 52  GLU A HG2  6  
ATOM 10431 H HG3  . GLU A 1 52  ? -13.302 -11.562 3.037   1.00 0.00 ? 52  GLU A HG3  6  
ATOM 10432 N N    . ASP A 1 53  ? -8.556  -10.649 2.434   1.00 0.00 ? 53  ASP A N    6  
ATOM 10433 C CA   . ASP A 1 53  ? -7.278  -10.502 1.743   1.00 0.00 ? 53  ASP A CA   6  
ATOM 10434 C C    . ASP A 1 53  ? -6.170  -10.217 2.747   1.00 0.00 ? 53  ASP A C    6  
ATOM 10435 O O    . ASP A 1 53  ? -5.014  -10.027 2.372   1.00 0.00 ? 53  ASP A O    6  
ATOM 10436 C CB   . ASP A 1 53  ? -7.336  -9.346  0.734   1.00 0.00 ? 53  ASP A CB   6  
ATOM 10437 C CG   . ASP A 1 53  ? -8.354  -9.539  -0.380  1.00 0.00 ? 53  ASP A CG   6  
ATOM 10438 O OD1  . ASP A 1 53  ? -9.342  -10.275 -0.188  1.00 0.00 ? 53  ASP A OD1  6  
ATOM 10439 O OD2  . ASP A 1 53  ? -8.179  -8.940  -1.459  1.00 0.00 ? 53  ASP A OD2  6  
ATOM 10440 H H    . ASP A 1 53  ? -8.948  -9.856  2.863   1.00 0.00 ? 53  ASP A H    6  
ATOM 10441 H HA   . ASP A 1 53  ? -7.064  -11.424 1.220   1.00 0.00 ? 53  ASP A HA   6  
ATOM 10442 H HB2  . ASP A 1 53  ? -7.585  -8.442  1.263   1.00 0.00 ? 53  ASP A HB2  6  
ATOM 10443 H HB3  . ASP A 1 53  ? -6.359  -9.232  0.284   1.00 0.00 ? 53  ASP A HB3  6  
ATOM 10444 N N    . GLN A 1 54  ? -6.542  -10.172 4.021   1.00 0.00 ? 54  GLN A N    6  
ATOM 10445 C CA   . GLN A 1 54  ? -5.614  -9.894  5.107   1.00 0.00 ? 54  GLN A CA   6  
ATOM 10446 C C    . GLN A 1 54  ? -4.401  -10.820 5.077   1.00 0.00 ? 54  GLN A C    6  
ATOM 10447 O O    . GLN A 1 54  ? -3.258  -10.362 5.149   1.00 0.00 ? 54  GLN A O    6  
ATOM 10448 C CB   . GLN A 1 54  ? -6.356  -10.031 6.432   1.00 0.00 ? 54  GLN A CB   6  
ATOM 10449 C CG   . GLN A 1 54  ? -6.878  -8.728  7.027   1.00 0.00 ? 54  GLN A CG   6  
ATOM 10450 C CD   . GLN A 1 54  ? -7.662  -7.833  6.075   1.00 0.00 ? 54  GLN A CD   6  
ATOM 10451 O OE1  . GLN A 1 54  ? -7.438  -7.811  4.875   1.00 0.00 ? 54  GLN A OE1  6  
ATOM 10452 N NE2  . GLN A 1 54  ? -8.587  -7.066  6.625   1.00 0.00 ? 54  GLN A NE2  6  
ATOM 10453 H H    . GLN A 1 54  ? -7.484  -10.314 4.246   1.00 0.00 ? 54  GLN A H    6  
ATOM 10454 H HA   . GLN A 1 54  ? -5.276  -8.875  5.001   1.00 0.00 ? 54  GLN A HA   6  
ATOM 10455 H HB2  . GLN A 1 54  ? -7.200  -10.687 6.285   1.00 0.00 ? 54  GLN A HB2  6  
ATOM 10456 H HB3  . GLN A 1 54  ? -5.690  -10.484 7.152   1.00 0.00 ? 54  GLN A HB3  6  
ATOM 10457 H HG2  . GLN A 1 54  ? -7.536  -8.988  7.830   1.00 0.00 ? 54  GLN A HG2  6  
ATOM 10458 H HG3  . GLN A 1 54  ? -6.040  -8.166  7.416   1.00 0.00 ? 54  GLN A HG3  6  
ATOM 10459 H HE21 . GLN A 1 54  ? -8.714  -7.112  7.594   1.00 0.00 ? 54  GLN A HE21 6  
ATOM 10460 H HE22 . GLN A 1 54  ? -9.098  -6.465  6.036   1.00 0.00 ? 54  GLN A HE22 6  
ATOM 10461 N N    . GLN A 1 55  ? -4.641  -12.121 4.966   1.00 0.00 ? 55  GLN A N    6  
ATOM 10462 C CA   . GLN A 1 55  ? -3.548  -13.077 4.898   1.00 0.00 ? 55  GLN A CA   6  
ATOM 10463 C C    . GLN A 1 55  ? -2.859  -13.027 3.545   1.00 0.00 ? 55  GLN A C    6  
ATOM 10464 O O    . GLN A 1 55  ? -1.668  -13.293 3.449   1.00 0.00 ? 55  GLN A O    6  
ATOM 10465 C CB   . GLN A 1 55  ? -4.028  -14.495 5.206   1.00 0.00 ? 55  GLN A CB   6  
ATOM 10466 C CG   . GLN A 1 55  ? -4.011  -14.812 6.694   1.00 0.00 ? 55  GLN A CG   6  
ATOM 10467 C CD   . GLN A 1 55  ? -2.619  -15.140 7.220   1.00 0.00 ? 55  GLN A CD   6  
ATOM 10468 O OE1  . GLN A 1 55  ? -2.477  -15.837 8.222   1.00 0.00 ? 55  GLN A OE1  6  
ATOM 10469 N NE2  . GLN A 1 55  ? -1.583  -14.672 6.537   1.00 0.00 ? 55  GLN A NE2  6  
ATOM 10470 H H    . GLN A 1 55  ? -5.572  -12.444 4.927   1.00 0.00 ? 55  GLN A H    6  
ATOM 10471 H HA   . GLN A 1 55  ? -2.827  -12.790 5.651   1.00 0.00 ? 55  GLN A HA   6  
ATOM 10472 H HB2  . GLN A 1 55  ? -5.040  -14.608 4.844   1.00 0.00 ? 55  GLN A HB2  6  
ATOM 10473 H HB3  . GLN A 1 55  ? -3.389  -15.200 4.700   1.00 0.00 ? 55  GLN A HB3  6  
ATOM 10474 H HG2  . GLN A 1 55  ? -4.387  -13.955 7.233   1.00 0.00 ? 55  GLN A HG2  6  
ATOM 10475 H HG3  . GLN A 1 55  ? -4.657  -15.659 6.874   1.00 0.00 ? 55  GLN A HG3  6  
ATOM 10476 H HE21 . GLN A 1 55  ? -1.759  -14.145 5.731   1.00 0.00 ? 55  GLN A HE21 6  
ATOM 10477 H HE22 . GLN A 1 55  ? -0.681  -14.885 6.859   1.00 0.00 ? 55  GLN A HE22 6  
ATOM 10478 N N    . LEU A 1 56  ? -3.613  -12.681 2.510   1.00 0.00 ? 56  LEU A N    6  
ATOM 10479 C CA   . LEU A 1 56  ? -3.057  -12.494 1.178   1.00 0.00 ? 56  LEU A CA   6  
ATOM 10480 C C    . LEU A 1 56  ? -1.982  -11.417 1.201   1.00 0.00 ? 56  LEU A C    6  
ATOM 10481 O O    . LEU A 1 56  ? -0.875  -11.616 0.698   1.00 0.00 ? 56  LEU A O    6  
ATOM 10482 C CB   . LEU A 1 56  ? -4.168  -12.121 0.191   1.00 0.00 ? 56  LEU A CB   6  
ATOM 10483 C CG   . LEU A 1 56  ? -3.715  -11.831 -1.239  1.00 0.00 ? 56  LEU A CG   6  
ATOM 10484 C CD1  . LEU A 1 56  ? -3.062  -13.058 -1.855  1.00 0.00 ? 56  LEU A CD1  6  
ATOM 10485 C CD2  . LEU A 1 56  ? -4.899  -11.380 -2.074  1.00 0.00 ? 56  LEU A CD2  6  
ATOM 10486 H H    . LEU A 1 56  ? -4.582  -12.568 2.643   1.00 0.00 ? 56  LEU A H    6  
ATOM 10487 H HA   . LEU A 1 56  ? -2.610  -13.425 0.872   1.00 0.00 ? 56  LEU A HA   6  
ATOM 10488 H HB2  . LEU A 1 56  ? -4.876  -12.936 0.160   1.00 0.00 ? 56  LEU A HB2  6  
ATOM 10489 H HB3  . LEU A 1 56  ? -4.673  -11.245 0.567   1.00 0.00 ? 56  LEU A HB3  6  
ATOM 10490 H HG   . LEU A 1 56  ? -2.988  -11.034 -1.228  1.00 0.00 ? 56  LEU A HG   6  
ATOM 10491 H HD11 . LEU A 1 56  ? -3.761  -13.880 -1.841  1.00 0.00 ? 56  LEU A HD11 6  
ATOM 10492 H HD12 . LEU A 1 56  ? -2.182  -13.321 -1.287  1.00 0.00 ? 56  LEU A HD12 6  
ATOM 10493 H HD13 . LEU A 1 56  ? -2.782  -12.842 -2.876  1.00 0.00 ? 56  LEU A HD13 6  
ATOM 10494 H HD21 . LEU A 1 56  ? -4.569  -11.165 -3.080  1.00 0.00 ? 56  LEU A HD21 6  
ATOM 10495 H HD22 . LEU A 1 56  ? -5.330  -10.491 -1.639  1.00 0.00 ? 56  LEU A HD22 6  
ATOM 10496 H HD23 . LEU A 1 56  ? -5.640  -12.164 -2.099  1.00 0.00 ? 56  LEU A HD23 6  
ATOM 10497 N N    . LEU A 1 57  ? -2.307  -10.280 1.804   1.00 0.00 ? 57  LEU A N    6  
ATOM 10498 C CA   . LEU A 1 57  ? -1.338  -9.208  1.973   1.00 0.00 ? 57  LEU A CA   6  
ATOM 10499 C C    . LEU A 1 57  ? -0.232  -9.632  2.924   1.00 0.00 ? 57  LEU A C    6  
ATOM 10500 O O    . LEU A 1 57  ? 0.946   -9.494  2.607   1.00 0.00 ? 57  LEU A O    6  
ATOM 10501 C CB   . LEU A 1 57  ? -1.994  -7.927  2.495   1.00 0.00 ? 57  LEU A CB   6  
ATOM 10502 C CG   . LEU A 1 57  ? -2.646  -7.041  1.438   1.00 0.00 ? 57  LEU A CG   6  
ATOM 10503 C CD1  . LEU A 1 57  ? -3.095  -5.732  2.064   1.00 0.00 ? 57  LEU A CD1  6  
ATOM 10504 C CD2  . LEU A 1 57  ? -1.677  -6.783  0.297   1.00 0.00 ? 57  LEU A CD2  6  
ATOM 10505 H H    . LEU A 1 57  ? -3.226  -10.162 2.139   1.00 0.00 ? 57  LEU A H    6  
ATOM 10506 H HA   . LEU A 1 57  ? -0.903  -9.007  1.005   1.00 0.00 ? 57  LEU A HA   6  
ATOM 10507 H HB2  . LEU A 1 57  ? -2.749  -8.203  3.217   1.00 0.00 ? 57  LEU A HB2  6  
ATOM 10508 H HB3  . LEU A 1 57  ? -1.238  -7.344  3.001   1.00 0.00 ? 57  LEU A HB3  6  
ATOM 10509 H HG   . LEU A 1 57  ? -3.516  -7.541  1.036   1.00 0.00 ? 57  LEU A HG   6  
ATOM 10510 H HD11 . LEU A 1 57  ? -3.599  -5.130  1.323   1.00 0.00 ? 57  LEU A HD11 6  
ATOM 10511 H HD12 . LEU A 1 57  ? -2.232  -5.197  2.434   1.00 0.00 ? 57  LEU A HD12 6  
ATOM 10512 H HD13 . LEU A 1 57  ? -3.770  -5.937  2.881   1.00 0.00 ? 57  LEU A HD13 6  
ATOM 10513 H HD21 . LEU A 1 57  ? -2.148  -6.152  -0.442  1.00 0.00 ? 57  LEU A HD21 6  
ATOM 10514 H HD22 . LEU A 1 57  ? -1.397  -7.723  -0.158  1.00 0.00 ? 57  LEU A HD22 6  
ATOM 10515 H HD23 . LEU A 1 57  ? -0.793  -6.293  0.678   1.00 0.00 ? 57  LEU A HD23 6  
ATOM 10516 N N    . ARG A 1 58  ? -0.623  -10.167 4.079   1.00 0.00 ? 58  ARG A N    6  
ATOM 10517 C CA   . ARG A 1 58  ? 0.330   -10.550 5.117   1.00 0.00 ? 58  ARG A CA   6  
ATOM 10518 C C    . ARG A 1 58  ? 1.387   -11.499 4.560   1.00 0.00 ? 58  ARG A C    6  
ATOM 10519 O O    . ARG A 1 58  ? 2.580   -11.259 4.704   1.00 0.00 ? 58  ARG A O    6  
ATOM 10520 C CB   . ARG A 1 58  ? -0.405  -11.211 6.290   1.00 0.00 ? 58  ARG A CB   6  
ATOM 10521 C CG   . ARG A 1 58  ? 0.490   -11.530 7.479   1.00 0.00 ? 58  ARG A CG   6  
ATOM 10522 C CD   . ARG A 1 58  ? -0.285  -12.230 8.586   1.00 0.00 ? 58  ARG A CD   6  
ATOM 10523 N NE   . ARG A 1 58  ? 0.552   -12.494 9.749   1.00 0.00 ? 58  ARG A NE   6  
ATOM 10524 C CZ   . ARG A 1 58  ? 0.501   -13.609 10.475  1.00 0.00 ? 58  ARG A CZ   6  
ATOM 10525 N NH1  . ARG A 1 58  ? -0.364  -14.574 10.179  1.00 0.00 ? 58  ARG A NH1  6  
ATOM 10526 N NH2  . ARG A 1 58  ? 1.319   -13.748 11.507  1.00 0.00 ? 58  ARG A NH2  6  
ATOM 10527 H H    . ARG A 1 58  ? -1.583  -10.308 4.239   1.00 0.00 ? 58  ARG A H    6  
ATOM 10528 H HA   . ARG A 1 58  ? 0.816   -9.654  5.467   1.00 0.00 ? 58  ARG A HA   6  
ATOM 10529 H HB2  . ARG A 1 58  ? -1.189  -10.549 6.627   1.00 0.00 ? 58  ARG A HB2  6  
ATOM 10530 H HB3  . ARG A 1 58  ? -0.849  -12.132 5.946   1.00 0.00 ? 58  ARG A HB3  6  
ATOM 10531 H HG2  . ARG A 1 58  ? 1.291   -12.175 7.151   1.00 0.00 ? 58  ARG A HG2  6  
ATOM 10532 H HG3  . ARG A 1 58  ? 0.901   -10.609 7.864   1.00 0.00 ? 58  ARG A HG3  6  
ATOM 10533 H HD2  . ARG A 1 58  ? -1.112  -11.604 8.882   1.00 0.00 ? 58  ARG A HD2  6  
ATOM 10534 H HD3  . ARG A 1 58  ? -0.661  -13.167 8.206   1.00 0.00 ? 58  ARG A HD3  6  
ATOM 10535 H HE   . ARG A 1 58  ? 1.195   -11.789 10.008  1.00 0.00 ? 58  ARG A HE   6  
ATOM 10536 H HH11 . ARG A 1 58  ? -0.991  -14.470 9.408   1.00 0.00 ? 58  ARG A HH11 6  
ATOM 10537 H HH12 . ARG A 1 58  ? -0.395  -15.418 10.736  1.00 0.00 ? 58  ARG A HH12 6  
ATOM 10538 H HH21 . ARG A 1 58  ? 1.967   -13.011 11.739  1.00 0.00 ? 58  ARG A HH21 6  
ATOM 10539 H HH22 . ARG A 1 58  ? 1.298   -14.591 12.063  1.00 0.00 ? 58  ARG A HH22 6  
ATOM 10540 N N    . ASP A 1 59  ? 0.936   -12.553 3.893   1.00 0.00 ? 59  ASP A N    6  
ATOM 10541 C CA   . ASP A 1 59  ? 1.828   -13.567 3.343   1.00 0.00 ? 59  ASP A CA   6  
ATOM 10542 C C    . ASP A 1 59  ? 2.751   -12.969 2.303   1.00 0.00 ? 59  ASP A C    6  
ATOM 10543 O O    . ASP A 1 59  ? 3.945   -13.249 2.285   1.00 0.00 ? 59  ASP A O    6  
ATOM 10544 C CB   . ASP A 1 59  ? 1.021   -14.684 2.693   1.00 0.00 ? 59  ASP A CB   6  
ATOM 10545 C CG   . ASP A 1 59  ? 1.889   -15.830 2.214   1.00 0.00 ? 59  ASP A CG   6  
ATOM 10546 O OD1  . ASP A 1 59  ? 2.373   -15.780 1.063   1.00 0.00 ? 59  ASP A OD1  6  
ATOM 10547 O OD2  . ASP A 1 59  ? 2.086   -16.790 2.990   1.00 0.00 ? 59  ASP A OD2  6  
ATOM 10548 H H    . ASP A 1 59  ? -0.032  -12.652 3.761   1.00 0.00 ? 59  ASP A H    6  
ATOM 10549 H HA   . ASP A 1 59  ? 2.419   -13.976 4.148   1.00 0.00 ? 59  ASP A HA   6  
ATOM 10550 H HB2  . ASP A 1 59  ? 0.315   -15.064 3.404   1.00 0.00 ? 59  ASP A HB2  6  
ATOM 10551 H HB3  . ASP A 1 59  ? 0.488   -14.283 1.845   1.00 0.00 ? 59  ASP A HB3  6  
ATOM 10552 N N    . SER A 1 60  ? 2.187   -12.134 1.448   1.00 0.00 ? 60  SER A N    6  
ATOM 10553 C CA   . SER A 1 60  ? 2.922   -11.560 0.334   1.00 0.00 ? 60  SER A CA   6  
ATOM 10554 C C    . SER A 1 60  ? 3.933   -10.531 0.823   1.00 0.00 ? 60  SER A C    6  
ATOM 10555 O O    . SER A 1 60  ? 5.006   -10.375 0.236   1.00 0.00 ? 60  SER A O    6  
ATOM 10556 C CB   . SER A 1 60  ? 1.946   -10.940 -0.658  1.00 0.00 ? 60  SER A CB   6  
ATOM 10557 O OG   . SER A 1 60  ? 1.055   -11.920 -1.164  1.00 0.00 ? 60  SER A OG   6  
ATOM 10558 H H    . SER A 1 60  ? 1.248   -11.885 1.579   1.00 0.00 ? 60  SER A H    6  
ATOM 10559 H HA   . SER A 1 60  ? 3.456   -12.361 -0.155  1.00 0.00 ? 60  SER A HA   6  
ATOM 10560 H HB2  . SER A 1 60  ? 1.366   -10.180 -0.157  1.00 0.00 ? 60  SER A HB2  6  
ATOM 10561 H HB3  . SER A 1 60  ? 2.492   -10.501 -1.478  1.00 0.00 ? 60  SER A HB3  6  
ATOM 10562 H HG   . SER A 1 60  ? 0.195   -11.821 -0.727  1.00 0.00 ? 60  SER A HG   6  
ATOM 10563 N N    . PHE A 1 61  ? 3.598   -9.847  1.907   1.00 0.00 ? 61  PHE A N    6  
ATOM 10564 C CA   . PHE A 1 61  ? 4.527   -8.927  2.537   1.00 0.00 ? 61  PHE A CA   6  
ATOM 10565 C C    . PHE A 1 61  ? 5.655   -9.717  3.188   1.00 0.00 ? 61  PHE A C    6  
ATOM 10566 O O    . PHE A 1 61  ? 6.802   -9.282  3.222   1.00 0.00 ? 61  PHE A O    6  
ATOM 10567 C CB   . PHE A 1 61  ? 3.811   -8.043  3.569   1.00 0.00 ? 61  PHE A CB   6  
ATOM 10568 C CG   . PHE A 1 61  ? 2.897   -7.002  2.962   1.00 0.00 ? 61  PHE A CG   6  
ATOM 10569 C CD1  . PHE A 1 61  ? 3.087   -6.566  1.655   1.00 0.00 ? 61  PHE A CD1  6  
ATOM 10570 C CD2  . PHE A 1 61  ? 1.853   -6.453  3.699   1.00 0.00 ? 61  PHE A CD2  6  
ATOM 10571 C CE1  . PHE A 1 61  ? 2.259   -5.609  1.101   1.00 0.00 ? 61  PHE A CE1  6  
ATOM 10572 C CE2  . PHE A 1 61  ? 1.022   -5.493  3.145   1.00 0.00 ? 61  PHE A CE2  6  
ATOM 10573 C CZ   . PHE A 1 61  ? 1.227   -5.074  1.846   1.00 0.00 ? 61  PHE A CZ   6  
ATOM 10574 H H    . PHE A 1 61  ? 2.699   -9.959  2.294   1.00 0.00 ? 61  PHE A H    6  
ATOM 10575 H HA   . PHE A 1 61  ? 4.948   -8.297  1.764   1.00 0.00 ? 61  PHE A HA   6  
ATOM 10576 H HB2  . PHE A 1 61  ? 3.213   -8.673  4.210   1.00 0.00 ? 61  PHE A HB2  6  
ATOM 10577 H HB3  . PHE A 1 61  ? 4.549   -7.533  4.166   1.00 0.00 ? 61  PHE A HB3  6  
ATOM 10578 H HD1  . PHE A 1 61  ? 3.891   -6.985  1.069   1.00 0.00 ? 61  PHE A HD1  6  
ATOM 10579 H HD2  . PHE A 1 61  ? 1.692   -6.779  4.715   1.00 0.00 ? 61  PHE A HD2  6  
ATOM 10580 H HE1  . PHE A 1 61  ? 2.420   -5.279  0.084   1.00 0.00 ? 61  PHE A HE1  6  
ATOM 10581 H HE2  . PHE A 1 61  ? 0.210   -5.072  3.729   1.00 0.00 ? 61  PHE A HE2  6  
ATOM 10582 H HZ   . PHE A 1 61  ? 0.581   -4.326  1.412   1.00 0.00 ? 61  PHE A HZ   6  
ATOM 10583 N N    . GLN A 1 62  ? 5.323   -10.906 3.672   1.00 0.00 ? 62  GLN A N    6  
ATOM 10584 C CA   . GLN A 1 62  ? 6.317   -11.796 4.243   1.00 0.00 ? 62  GLN A CA   6  
ATOM 10585 C C    . GLN A 1 62  ? 7.180   -12.390 3.138   1.00 0.00 ? 62  GLN A C    6  
ATOM 10586 O O    . GLN A 1 62  ? 8.345   -12.711 3.357   1.00 0.00 ? 62  GLN A O    6  
ATOM 10587 C CB   . GLN A 1 62  ? 5.642   -12.917 5.037   1.00 0.00 ? 62  GLN A CB   6  
ATOM 10588 C CG   . GLN A 1 62  ? 4.843   -12.435 6.233   1.00 0.00 ? 62  GLN A CG   6  
ATOM 10589 C CD   . GLN A 1 62  ? 5.706   -11.828 7.326   1.00 0.00 ? 62  GLN A CD   6  
ATOM 10590 O OE1  . GLN A 1 62  ? 5.271   -10.940 8.055   1.00 0.00 ? 62  GLN A OE1  6  
ATOM 10591 N NE2  . GLN A 1 62  ? 6.933   -12.310 7.460   1.00 0.00 ? 62  GLN A NE2  6  
ATOM 10592 H H    . GLN A 1 62  ? 4.387   -11.192 3.642   1.00 0.00 ? 62  GLN A H    6  
ATOM 10593 H HA   . GLN A 1 62  ? 6.943   -11.218 4.905   1.00 0.00 ? 62  GLN A HA   6  
ATOM 10594 H HB2  . GLN A 1 62  ? 4.973   -13.452 4.378   1.00 0.00 ? 62  GLN A HB2  6  
ATOM 10595 H HB3  . GLN A 1 62  ? 6.401   -13.598 5.388   1.00 0.00 ? 62  GLN A HB3  6  
ATOM 10596 H HG2  . GLN A 1 62  ? 4.137   -11.689 5.896   1.00 0.00 ? 62  GLN A HG2  6  
ATOM 10597 H HG3  . GLN A 1 62  ? 4.302   -13.273 6.644   1.00 0.00 ? 62  GLN A HG3  6  
ATOM 10598 H HE21 . GLN A 1 62  ? 7.222   -13.027 6.855   1.00 0.00 ? 62  GLN A HE21 6  
ATOM 10599 H HE22 . GLN A 1 62  ? 7.501   -11.935 8.162   1.00 0.00 ? 62  GLN A HE22 6  
ATOM 10600 N N    . GLN A 1 63  ? 6.596   -12.534 1.948   1.00 0.00 ? 63  GLN A N    6  
ATOM 10601 C CA   . GLN A 1 63  ? 7.328   -13.034 0.791   1.00 0.00 ? 63  GLN A CA   6  
ATOM 10602 C C    . GLN A 1 63  ? 8.483   -12.105 0.450   1.00 0.00 ? 63  GLN A C    6  
ATOM 10603 O O    . GLN A 1 63  ? 9.608   -12.550 0.252   1.00 0.00 ? 63  GLN A O    6  
ATOM 10604 C CB   . GLN A 1 63  ? 6.418   -13.173 -0.426  1.00 0.00 ? 63  GLN A CB   6  
ATOM 10605 C CG   . GLN A 1 63  ? 5.318   -14.202 -0.256  1.00 0.00 ? 63  GLN A CG   6  
ATOM 10606 C CD   . GLN A 1 63  ? 5.830   -15.606 0.002   1.00 0.00 ? 63  GLN A CD   6  
ATOM 10607 O OE1  . GLN A 1 63  ? 6.935   -15.972 -0.405  1.00 0.00 ? 63  GLN A OE1  6  
ATOM 10608 N NE2  . GLN A 1 63  ? 5.009   -16.409 0.657   1.00 0.00 ? 63  GLN A NE2  6  
ATOM 10609 H H    . GLN A 1 63  ? 5.644   -12.317 1.854   1.00 0.00 ? 63  GLN A H    6  
ATOM 10610 H HA   . GLN A 1 63  ? 7.713   -14.005 1.043   1.00 0.00 ? 63  GLN A HA   6  
ATOM 10611 H HB2  . GLN A 1 63  ? 5.956   -12.218 -0.626  1.00 0.00 ? 63  GLN A HB2  6  
ATOM 10612 H HB3  . GLN A 1 63  ? 7.017   -13.456 -1.276  1.00 0.00 ? 63  GLN A HB3  6  
ATOM 10613 H HG2  . GLN A 1 63  ? 4.717   -13.909 0.586   1.00 0.00 ? 63  GLN A HG2  6  
ATOM 10614 H HG3  . GLN A 1 63  ? 4.710   -14.212 -1.148  1.00 0.00 ? 63  GLN A HG3  6  
ATOM 10615 H HE21 . GLN A 1 63  ? 4.128   -16.053 0.930   1.00 0.00 ? 63  GLN A HE21 6  
ATOM 10616 H HE22 . GLN A 1 63  ? 5.306   -17.325 0.849   1.00 0.00 ? 63  GLN A HE22 6  
ATOM 10617 N N    . VAL A 1 64  ? 8.202   -10.808 0.393   1.00 0.00 ? 64  VAL A N    6  
ATOM 10618 C CA   . VAL A 1 64  ? 9.229   -9.830  0.063   1.00 0.00 ? 64  VAL A CA   6  
ATOM 10619 C C    . VAL A 1 64  ? 10.233  -9.677  1.209   1.00 0.00 ? 64  VAL A C    6  
ATOM 10620 O O    . VAL A 1 64  ? 11.379  -9.281  0.991   1.00 0.00 ? 64  VAL A O    6  
ATOM 10621 C CB   . VAL A 1 64  ? 8.632   -8.456  -0.320  1.00 0.00 ? 64  VAL A CB   6  
ATOM 10622 C CG1  . VAL A 1 64  ? 8.003   -7.760  0.878   1.00 0.00 ? 64  VAL A CG1  6  
ATOM 10623 C CG2  . VAL A 1 64  ? 9.689   -7.573  -0.961  1.00 0.00 ? 64  VAL A CG2  6  
ATOM 10624 H H    . VAL A 1 64  ? 7.278   -10.509 0.555   1.00 0.00 ? 64  VAL A H    6  
ATOM 10625 H HA   . VAL A 1 64  ? 9.762   -10.208 -0.799  1.00 0.00 ? 64  VAL A HA   6  
ATOM 10626 H HB   . VAL A 1 64  ? 7.853   -8.625  -1.050  1.00 0.00 ? 64  VAL A HB   6  
ATOM 10627 H HG11 . VAL A 1 64  ? 7.601   -6.807  0.568   1.00 0.00 ? 64  VAL A HG11 6  
ATOM 10628 H HG12 . VAL A 1 64  ? 8.756   -7.602  1.639   1.00 0.00 ? 64  VAL A HG12 6  
ATOM 10629 H HG13 . VAL A 1 64  ? 7.211   -8.375  1.277   1.00 0.00 ? 64  VAL A HG13 6  
ATOM 10630 H HG21 . VAL A 1 64  ? 9.258   -6.614  -1.203  1.00 0.00 ? 64  VAL A HG21 6  
ATOM 10631 H HG22 . VAL A 1 64  ? 10.049  -8.044  -1.864  1.00 0.00 ? 64  VAL A HG22 6  
ATOM 10632 H HG23 . VAL A 1 64  ? 10.508  -7.437  -0.274  1.00 0.00 ? 64  VAL A HG23 6  
ATOM 10633 N N    . VAL A 1 65  ? 9.810   -10.004 2.429   1.00 0.00 ? 65  VAL A N    6  
ATOM 10634 C CA   . VAL A 1 65  ? 10.727  -10.039 3.565   1.00 0.00 ? 65  VAL A CA   6  
ATOM 10635 C C    . VAL A 1 65  ? 11.660  -11.248 3.438   1.00 0.00 ? 65  VAL A C    6  
ATOM 10636 O O    . VAL A 1 65  ? 12.776  -11.250 3.952   1.00 0.00 ? 65  VAL A O    6  
ATOM 10637 C CB   . VAL A 1 65  ? 9.966   -10.080 4.915   1.00 0.00 ? 65  VAL A CB   6  
ATOM 10638 C CG1  . VAL A 1 65  ? 10.918  -10.240 6.090   1.00 0.00 ? 65  VAL A CG1  6  
ATOM 10639 C CG2  . VAL A 1 65  ? 9.134   -8.819  5.089   1.00 0.00 ? 65  VAL A CG2  6  
ATOM 10640 H H    . VAL A 1 65  ? 8.861   -10.221 2.570   1.00 0.00 ? 65  VAL A H    6  
ATOM 10641 H HA   . VAL A 1 65  ? 11.324  -9.136  3.538   1.00 0.00 ? 65  VAL A HA   6  
ATOM 10642 H HB   . VAL A 1 65  ? 9.295   -10.927 4.904   1.00 0.00 ? 65  VAL A HB   6  
ATOM 10643 H HG11 . VAL A 1 65  ? 10.357  -10.240 7.012   1.00 0.00 ? 65  VAL A HG11 6  
ATOM 10644 H HG12 . VAL A 1 65  ? 11.622  -9.423  6.097   1.00 0.00 ? 65  VAL A HG12 6  
ATOM 10645 H HG13 . VAL A 1 65  ? 11.453  -11.174 5.994   1.00 0.00 ? 65  VAL A HG13 6  
ATOM 10646 H HG21 . VAL A 1 65  ? 8.436   -8.732  4.269   1.00 0.00 ? 65  VAL A HG21 6  
ATOM 10647 H HG22 . VAL A 1 65  ? 9.785   -7.957  5.102   1.00 0.00 ? 65  VAL A HG22 6  
ATOM 10648 H HG23 . VAL A 1 65  ? 8.589   -8.873  6.020   1.00 0.00 ? 65  VAL A HG23 6  
ATOM 10649 N N    . LYS A 1 66  ? 11.190  -12.268 2.731   1.00 0.00 ? 66  LYS A N    6  
ATOM 10650 C CA   . LYS A 1 66  ? 12.004  -13.439 2.429   1.00 0.00 ? 66  LYS A CA   6  
ATOM 10651 C C    . LYS A 1 66  ? 12.890  -13.172 1.213   1.00 0.00 ? 66  LYS A C    6  
ATOM 10652 O O    . LYS A 1 66  ? 14.049  -13.585 1.169   1.00 0.00 ? 66  LYS A O    6  
ATOM 10653 C CB   . LYS A 1 66  ? 11.114  -14.655 2.163   1.00 0.00 ? 66  LYS A CB   6  
ATOM 10654 C CG   . LYS A 1 66  ? 10.326  -15.120 3.376   1.00 0.00 ? 66  LYS A CG   6  
ATOM 10655 C CD   . LYS A 1 66  ? 9.344   -16.224 3.014   1.00 0.00 ? 66  LYS A CD   6  
ATOM 10656 C CE   . LYS A 1 66  ? 8.668   -16.809 4.245   1.00 0.00 ? 66  LYS A CE   6  
ATOM 10657 N NZ   . LYS A 1 66  ? 7.773   -15.827 4.905   1.00 0.00 ? 66  LYS A NZ   6  
ATOM 10658 H H    . LYS A 1 66  ? 10.265  -12.235 2.406   1.00 0.00 ? 66  LYS A H    6  
ATOM 10659 H HA   . LYS A 1 66  ? 12.630  -13.641 3.284   1.00 0.00 ? 66  LYS A HA   6  
ATOM 10660 H HB2  . LYS A 1 66  ? 10.414  -14.404 1.381   1.00 0.00 ? 66  LYS A HB2  6  
ATOM 10661 H HB3  . LYS A 1 66  ? 11.734  -15.472 1.829   1.00 0.00 ? 66  LYS A HB3  6  
ATOM 10662 H HG2  . LYS A 1 66  ? 11.017  -15.493 4.119   1.00 0.00 ? 66  LYS A HG2  6  
ATOM 10663 H HG3  . LYS A 1 66  ? 9.780   -14.279 3.782   1.00 0.00 ? 66  LYS A HG3  6  
ATOM 10664 H HD2  . LYS A 1 66  ? 8.582   -15.808 2.368   1.00 0.00 ? 66  LYS A HD2  6  
ATOM 10665 H HD3  . LYS A 1 66  ? 9.872   -17.009 2.494   1.00 0.00 ? 66  LYS A HD3  6  
ATOM 10666 H HE2  . LYS A 1 66  ? 8.085   -17.666 3.944   1.00 0.00 ? 66  LYS A HE2  6  
ATOM 10667 H HE3  . LYS A 1 66  ? 9.427   -17.121 4.946   1.00 0.00 ? 66  LYS A HE3  6  
ATOM 10668 H HZ1  . LYS A 1 66  ? 7.361   -16.240 5.774   1.00 0.00 ? 66  LYS A HZ1  6  
ATOM 10669 H HZ2  . LYS A 1 66  ? 6.994   -15.562 4.262   1.00 0.00 ? 66  LYS A HZ2  6  
ATOM 10670 H HZ3  . LYS A 1 66  ? 8.305   -14.970 5.162   1.00 0.00 ? 66  LYS A HZ3  6  
ATOM 10671 N N    . LEU A 1 67  ? 12.321  -12.489 0.227   1.00 0.00 ? 67  LEU A N    6  
ATOM 10672 C CA   . LEU A 1 67  ? 13.033  -12.154 -1.001  1.00 0.00 ? 67  LEU A CA   6  
ATOM 10673 C C    . LEU A 1 67  ? 14.152  -11.156 -0.740  1.00 0.00 ? 67  LEU A C    6  
ATOM 10674 O O    . LEU A 1 67  ? 15.304  -11.399 -1.104  1.00 0.00 ? 67  LEU A O    6  
ATOM 10675 C CB   . LEU A 1 67  ? 12.069  -11.572 -2.038  1.00 0.00 ? 67  LEU A CB   6  
ATOM 10676 C CG   . LEU A 1 67  ? 11.051  -12.556 -2.610  1.00 0.00 ? 67  LEU A CG   6  
ATOM 10677 C CD1  . LEU A 1 67  ? 10.191  -11.866 -3.650  1.00 0.00 ? 67  LEU A CD1  6  
ATOM 10678 C CD2  . LEU A 1 67  ? 11.751  -13.765 -3.216  1.00 0.00 ? 67  LEU A CD2  6  
ATOM 10679 H H    . LEU A 1 67  ? 11.384  -12.215 0.321   1.00 0.00 ? 67  LEU A H    6  
ATOM 10680 H HA   . LEU A 1 67  ? 13.460  -13.062 -1.394  1.00 0.00 ? 67  LEU A HA   6  
ATOM 10681 H HB2  . LEU A 1 67  ? 11.521  -10.750 -1.581  1.00 0.00 ? 67  LEU A HB2  6  
ATOM 10682 H HB3  . LEU A 1 67  ? 12.655  -11.180 -2.855  1.00 0.00 ? 67  LEU A HB3  6  
ATOM 10683 H HG   . LEU A 1 67  ? 10.404  -12.900 -1.816  1.00 0.00 ? 67  LEU A HG   6  
ATOM 10684 H HD11 . LEU A 1 67  ? 9.486   -12.573 -4.061  1.00 0.00 ? 67  LEU A HD11 6  
ATOM 10685 H HD12 . LEU A 1 67  ? 10.820  -11.483 -4.441  1.00 0.00 ? 67  LEU A HD12 6  
ATOM 10686 H HD13 . LEU A 1 67  ? 9.655   -11.050 -3.190  1.00 0.00 ? 67  LEU A HD13 6  
ATOM 10687 H HD21 . LEU A 1 67  ? 11.012  -14.454 -3.597  1.00 0.00 ? 67  LEU A HD21 6  
ATOM 10688 H HD22 . LEU A 1 67  ? 12.345  -14.255 -2.459  1.00 0.00 ? 67  LEU A HD22 6  
ATOM 10689 H HD23 . LEU A 1 67  ? 12.391  -13.441 -4.024  1.00 0.00 ? 67  LEU A HD23 6  
ATOM 10690 N N    . LYS A 1 68  ? 13.794  -10.046 -0.105  1.00 0.00 ? 68  LYS A N    6  
ATOM 10691 C CA   . LYS A 1 68  ? 14.736  -8.968  0.198   1.00 0.00 ? 68  LYS A CA   6  
ATOM 10692 C C    . LYS A 1 68  ? 15.385  -8.409  -1.058  1.00 0.00 ? 68  LYS A C    6  
ATOM 10693 O O    . LYS A 1 68  ? 16.416  -8.903  -1.524  1.00 0.00 ? 68  LYS A O    6  
ATOM 10694 C CB   . LYS A 1 68  ? 15.807  -9.436  1.175   1.00 0.00 ? 68  LYS A CB   6  
ATOM 10695 C CG   . LYS A 1 68  ? 15.254  -9.756  2.542   1.00 0.00 ? 68  LYS A CG   6  
ATOM 10696 C CD   . LYS A 1 68  ? 16.330  -10.248 3.479   1.00 0.00 ? 68  LYS A CD   6  
ATOM 10697 C CE   . LYS A 1 68  ? 15.754  -10.516 4.850   1.00 0.00 ? 68  LYS A CE   6  
ATOM 10698 N NZ   . LYS A 1 68  ? 16.780  -11.023 5.794   1.00 0.00 ? 68  LYS A NZ   6  
ATOM 10699 H H    . LYS A 1 68  ? 12.860  -9.962  0.184   1.00 0.00 ? 68  LYS A H    6  
ATOM 10700 H HA   . LYS A 1 68  ? 14.171  -8.177  0.666   1.00 0.00 ? 68  LYS A HA   6  
ATOM 10701 H HB2  . LYS A 1 68  ? 16.280  -10.325 0.781   1.00 0.00 ? 68  LYS A HB2  6  
ATOM 10702 H HB3  . LYS A 1 68  ? 16.548  -8.659  1.283   1.00 0.00 ? 68  LYS A HB3  6  
ATOM 10703 H HG2  . LYS A 1 68  ? 14.813  -8.863  2.957   1.00 0.00 ? 68  LYS A HG2  6  
ATOM 10704 H HG3  . LYS A 1 68  ? 14.497  -10.522 2.442   1.00 0.00 ? 68  LYS A HG3  6  
ATOM 10705 H HD2  . LYS A 1 68  ? 16.753  -11.162 3.088   1.00 0.00 ? 68  LYS A HD2  6  
ATOM 10706 H HD3  . LYS A 1 68  ? 17.100  -9.494  3.560   1.00 0.00 ? 68  LYS A HD3  6  
ATOM 10707 H HE2  . LYS A 1 68  ? 15.341  -9.592  5.232   1.00 0.00 ? 68  LYS A HE2  6  
ATOM 10708 H HE3  . LYS A 1 68  ? 14.967  -11.248 4.754   1.00 0.00 ? 68  LYS A HE3  6  
ATOM 10709 H HZ1  . LYS A 1 68  ? 17.574  -10.349 5.852   1.00 0.00 ? 68  LYS A HZ1  6  
ATOM 10710 H HZ2  . LYS A 1 68  ? 17.140  -11.943 5.475   1.00 0.00 ? 68  LYS A HZ2  6  
ATOM 10711 H HZ3  . LYS A 1 68  ? 16.371  -11.134 6.749   1.00 0.00 ? 68  LYS A HZ3  6  
ATOM 10712 N N    . GLY A 1 69  ? 14.774  -7.375  -1.598  1.00 0.00 ? 69  GLY A N    6  
ATOM 10713 C CA   . GLY A 1 69  ? 15.328  -6.709  -2.759  1.00 0.00 ? 69  GLY A CA   6  
ATOM 10714 C C    . GLY A 1 69  ? 14.549  -6.997  -4.021  1.00 0.00 ? 69  GLY A C    6  
ATOM 10715 O O    . GLY A 1 69  ? 14.661  -6.266  -5.003  1.00 0.00 ? 69  GLY A O    6  
ATOM 10716 H H    . GLY A 1 69  ? 13.944  -7.051  -1.198  1.00 0.00 ? 69  GLY A H    6  
ATOM 10717 H HA2  . GLY A 1 69  ? 15.325  -5.642  -2.582  1.00 0.00 ? 69  GLY A HA2  6  
ATOM 10718 H HA3  . GLY A 1 69  ? 16.348  -7.035  -2.894  1.00 0.00 ? 69  GLY A HA3  6  
ATOM 10719 N N    . GLN A 1 70  ? 13.751  -8.055  -3.997  1.00 0.00 ? 70  GLN A N    6  
ATOM 10720 C CA   . GLN A 1 70  ? 12.980  -8.444  -5.161  1.00 0.00 ? 70  GLN A CA   6  
ATOM 10721 C C    . GLN A 1 70  ? 11.568  -7.896  -5.048  1.00 0.00 ? 70  GLN A C    6  
ATOM 10722 O O    . GLN A 1 70  ? 11.000  -7.856  -3.957  1.00 0.00 ? 70  GLN A O    6  
ATOM 10723 C CB   . GLN A 1 70  ? 12.938  -9.966  -5.287  1.00 0.00 ? 70  GLN A CB   6  
ATOM 10724 C CG   . GLN A 1 70  ? 14.307  -10.628 -5.256  1.00 0.00 ? 70  GLN A CG   6  
ATOM 10725 C CD   . GLN A 1 70  ? 15.192  -10.209 -6.415  1.00 0.00 ? 70  GLN A CD   6  
ATOM 10726 O OE1  . GLN A 1 70  ? 15.926  -9.225  -6.326  1.00 0.00 ? 70  GLN A OE1  6  
ATOM 10727 N NE2  . GLN A 1 70  ? 15.134  -10.955 -7.505  1.00 0.00 ? 70  GLN A NE2  6  
ATOM 10728 H H    . GLN A 1 70  ? 13.664  -8.577  -3.174  1.00 0.00 ? 70  GLN A H    6  
ATOM 10729 H HA   . GLN A 1 70  ? 13.453  -8.025  -6.036  1.00 0.00 ? 70  GLN A HA   6  
ATOM 10730 H HB2  . GLN A 1 70  ? 12.350  -10.364 -4.475  1.00 0.00 ? 70  GLN A HB2  6  
ATOM 10731 H HB3  . GLN A 1 70  ? 12.461  -10.220 -6.216  1.00 0.00 ? 70  GLN A HB3  6  
ATOM 10732 H HG2  . GLN A 1 70  ? 14.800  -10.359 -4.335  1.00 0.00 ? 70  GLN A HG2  6  
ATOM 10733 H HG3  . GLN A 1 70  ? 14.177  -11.699 -5.292  1.00 0.00 ? 70  GLN A HG3  6  
ATOM 10734 H HE21 . GLN A 1 70  ? 14.527  -11.735 -7.506  1.00 0.00 ? 70  GLN A HE21 6  
ATOM 10735 H HE22 . GLN A 1 70  ? 15.702  -10.709 -8.264  1.00 0.00 ? 70  GLN A HE22 6  
ATOM 10736 N N    . VAL A 1 71  ? 11.012  -7.471  -6.172  1.00 0.00 ? 71  VAL A N    6  
ATOM 10737 C CA   . VAL A 1 71  ? 9.673   -6.915  -6.194  1.00 0.00 ? 71  VAL A CA   6  
ATOM 10738 C C    . VAL A 1 71  ? 8.621   -8.021  -6.109  1.00 0.00 ? 71  VAL A C    6  
ATOM 10739 O O    . VAL A 1 71  ? 8.644   -8.992  -6.871  1.00 0.00 ? 71  VAL A O    6  
ATOM 10740 C CB   . VAL A 1 71  ? 9.443   -6.050  -7.458  1.00 0.00 ? 71  VAL A CB   6  
ATOM 10741 C CG1  . VAL A 1 71  ? 9.719   -6.841  -8.731  1.00 0.00 ? 71  VAL A CG1  6  
ATOM 10742 C CG2  . VAL A 1 71  ? 8.032   -5.482  -7.474  1.00 0.00 ? 71  VAL A CG2  6  
ATOM 10743 H H    . VAL A 1 71  ? 11.523  -7.518  -7.005  1.00 0.00 ? 71  VAL A H    6  
ATOM 10744 H HA   . VAL A 1 71  ? 9.568   -6.275  -5.329  1.00 0.00 ? 71  VAL A HA   6  
ATOM 10745 H HB   . VAL A 1 71  ? 10.134  -5.221  -7.426  1.00 0.00 ? 71  VAL A HB   6  
ATOM 10746 H HG11 . VAL A 1 71  ? 9.554   -6.207  -9.589  1.00 0.00 ? 71  VAL A HG11 6  
ATOM 10747 H HG12 . VAL A 1 71  ? 9.054   -7.689  -8.778  1.00 0.00 ? 71  VAL A HG12 6  
ATOM 10748 H HG13 . VAL A 1 71  ? 10.742  -7.185  -8.726  1.00 0.00 ? 71  VAL A HG13 6  
ATOM 10749 H HG21 . VAL A 1 71  ? 7.915   -4.834  -8.329  1.00 0.00 ? 71  VAL A HG21 6  
ATOM 10750 H HG22 . VAL A 1 71  ? 7.859   -4.919  -6.568  1.00 0.00 ? 71  VAL A HG22 6  
ATOM 10751 H HG23 . VAL A 1 71  ? 7.320   -6.291  -7.536  1.00 0.00 ? 71  VAL A HG23 6  
ATOM 10752 N N    . LEU A 1 72  ? 7.715   -7.876  -5.154  1.00 0.00 ? 72  LEU A N    6  
ATOM 10753 C CA   . LEU A 1 72  ? 6.637   -8.836  -4.965  1.00 0.00 ? 72  LEU A CA   6  
ATOM 10754 C C    . LEU A 1 72  ? 5.301   -8.118  -5.110  1.00 0.00 ? 72  LEU A C    6  
ATOM 10755 O O    . LEU A 1 72  ? 4.946   -7.293  -4.275  1.00 0.00 ? 72  LEU A O    6  
ATOM 10756 C CB   . LEU A 1 72  ? 6.761   -9.465  -3.571  1.00 0.00 ? 72  LEU A CB   6  
ATOM 10757 C CG   . LEU A 1 72  ? 6.198   -10.884 -3.415  1.00 0.00 ? 72  LEU A CG   6  
ATOM 10758 C CD1  . LEU A 1 72  ? 4.691   -10.911 -3.623  1.00 0.00 ? 72  LEU A CD1  6  
ATOM 10759 C CD2  . LEU A 1 72  ? 6.891   -11.836 -4.379  1.00 0.00 ? 72  LEU A CD2  6  
ATOM 10760 H H    . LEU A 1 72  ? 7.771   -7.095  -4.556  1.00 0.00 ? 72  LEU A H    6  
ATOM 10761 H HA   . LEU A 1 72  ? 6.721   -9.603  -5.720  1.00 0.00 ? 72  LEU A HA   6  
ATOM 10762 H HB2  . LEU A 1 72  ? 7.808   -9.490  -3.307  1.00 0.00 ? 72  LEU A HB2  6  
ATOM 10763 H HB3  . LEU A 1 72  ? 6.250   -8.823  -2.868  1.00 0.00 ? 72  LEU A HB3  6  
ATOM 10764 H HG   . LEU A 1 72  ? 6.397   -11.226 -2.412  1.00 0.00 ? 72  LEU A HG   6  
ATOM 10765 H HD11 . LEU A 1 72  ? 4.457   -10.536 -4.609  1.00 0.00 ? 72  LEU A HD11 6  
ATOM 10766 H HD12 . LEU A 1 72  ? 4.213   -10.289 -2.880  1.00 0.00 ? 72  LEU A HD12 6  
ATOM 10767 H HD13 . LEU A 1 72  ? 4.333   -11.925 -3.529  1.00 0.00 ? 72  LEU A HD13 6  
ATOM 10768 H HD21 . LEU A 1 72  ? 6.682   -11.535 -5.395  1.00 0.00 ? 72  LEU A HD21 6  
ATOM 10769 H HD22 . LEU A 1 72  ? 6.529   -12.840 -4.217  1.00 0.00 ? 72  LEU A HD22 6  
ATOM 10770 H HD23 . LEU A 1 72  ? 7.961   -11.804 -4.208  1.00 0.00 ? 72  LEU A HD23 6  
ATOM 10771 N N    . SER A 1 73  ? 4.548   -8.445  -6.140  1.00 0.00 ? 73  SER A N    6  
ATOM 10772 C CA   . SER A 1 73  ? 3.329   -7.710  -6.431  1.00 0.00 ? 73  SER A CA   6  
ATOM 10773 C C    . SER A 1 73  ? 2.110   -8.488  -5.962  1.00 0.00 ? 73  SER A C    6  
ATOM 10774 O O    . SER A 1 73  ? 1.855   -9.604  -6.416  1.00 0.00 ? 73  SER A O    6  
ATOM 10775 C CB   . SER A 1 73  ? 3.246   -7.425  -7.932  1.00 0.00 ? 73  SER A CB   6  
ATOM 10776 O OG   . SER A 1 73  ? 2.238   -6.476  -8.221  1.00 0.00 ? 73  SER A OG   6  
ATOM 10777 H H    . SER A 1 73  ? 4.796   -9.212  -6.703  1.00 0.00 ? 73  SER A H    6  
ATOM 10778 H HA   . SER A 1 73  ? 3.361   -6.773  -5.899  1.00 0.00 ? 73  SER A HA   6  
ATOM 10779 H HB2  . SER A 1 73  ? 4.192   -7.038  -8.276  1.00 0.00 ? 73  SER A HB2  6  
ATOM 10780 H HB3  . SER A 1 73  ? 3.021   -8.342  -8.456  1.00 0.00 ? 73  SER A HB3  6  
ATOM 10781 H HG   . SER A 1 73  ? 2.410   -6.080  -9.084  1.00 0.00 ? 73  SER A HG   6  
ATOM 10782 N N    . VAL A 1 74  ? 1.349   -7.877  -5.068  1.00 0.00 ? 74  VAL A N    6  
ATOM 10783 C CA   . VAL A 1 74  ? 0.166   -8.501  -4.505  1.00 0.00 ? 74  VAL A CA   6  
ATOM 10784 C C    . VAL A 1 74  ? -1.057  -7.658  -4.773  1.00 0.00 ? 74  VAL A C    6  
ATOM 10785 O O    . VAL A 1 74  ? -1.039  -6.433  -4.664  1.00 0.00 ? 74  VAL A O    6  
ATOM 10786 C CB   . VAL A 1 74  ? 0.330   -8.767  -2.988  1.00 0.00 ? 74  VAL A CB   6  
ATOM 10787 C CG1  . VAL A 1 74  ? 0.682   -7.489  -2.243  1.00 0.00 ? 74  VAL A CG1  6  
ATOM 10788 C CG2  . VAL A 1 74  ? -0.923  -9.406  -2.401  1.00 0.00 ? 74  VAL A CG2  6  
ATOM 10789 H H    . VAL A 1 74  ? 1.590   -6.967  -4.777  1.00 0.00 ? 74  VAL A H    6  
ATOM 10790 H HA   . VAL A 1 74  ? 0.013   -9.447  -5.004  1.00 0.00 ? 74  VAL A HA   6  
ATOM 10791 H HB   . VAL A 1 74  ? 1.148   -9.460  -2.857  1.00 0.00 ? 74  VAL A HB   6  
ATOM 10792 H HG11 . VAL A 1 74  ? 0.869   -7.717  -1.204  1.00 0.00 ? 74  VAL A HG11 6  
ATOM 10793 H HG12 . VAL A 1 74  ? -0.142  -6.793  -2.317  1.00 0.00 ? 74  VAL A HG12 6  
ATOM 10794 H HG13 . VAL A 1 74  ? 1.565   -7.048  -2.680  1.00 0.00 ? 74  VAL A HG13 6  
ATOM 10795 H HG21 . VAL A 1 74  ? -1.093  -10.363 -2.871  1.00 0.00 ? 74  VAL A HG21 6  
ATOM 10796 H HG22 . VAL A 1 74  ? -1.770  -8.761  -2.577  1.00 0.00 ? 74  VAL A HG22 6  
ATOM 10797 H HG23 . VAL A 1 74  ? -0.791  -9.547  -1.337  1.00 0.00 ? 74  VAL A HG23 6  
ATOM 10798 N N    . MET A 1 75  ? -2.112  -8.340  -5.143  1.00 0.00 ? 75  MET A N    6  
ATOM 10799 C CA   . MET A 1 75  ? -3.316  -7.699  -5.601  1.00 0.00 ? 75  MET A CA   6  
ATOM 10800 C C    . MET A 1 75  ? -4.457  -7.948  -4.625  1.00 0.00 ? 75  MET A C    6  
ATOM 10801 O O    . MET A 1 75  ? -4.743  -9.091  -4.270  1.00 0.00 ? 75  MET A O    6  
ATOM 10802 C CB   . MET A 1 75  ? -3.666  -8.236  -6.983  1.00 0.00 ? 75  MET A CB   6  
ATOM 10803 C CG   . MET A 1 75  ? -4.767  -7.461  -7.652  1.00 0.00 ? 75  MET A CG   6  
ATOM 10804 S SD   . MET A 1 75  ? -5.300  -8.211  -9.203  1.00 0.00 ? 75  MET A SD   6  
ATOM 10805 C CE   . MET A 1 75  ? -6.543  -7.041  -9.750  1.00 0.00 ? 75  MET A CE   6  
ATOM 10806 H H    . MET A 1 75  ? -2.079  -9.318  -5.091  1.00 0.00 ? 75  MET A H    6  
ATOM 10807 H HA   . MET A 1 75  ? -3.132  -6.638  -5.670  1.00 0.00 ? 75  MET A HA   6  
ATOM 10808 H HB2  . MET A 1 75  ? -2.789  -8.193  -7.610  1.00 0.00 ? 75  MET A HB2  6  
ATOM 10809 H HB3  . MET A 1 75  ? -3.984  -9.265  -6.889  1.00 0.00 ? 75  MET A HB3  6  
ATOM 10810 H HG2  . MET A 1 75  ? -5.594  -7.419  -6.974  1.00 0.00 ? 75  MET A HG2  6  
ATOM 10811 H HG3  . MET A 1 75  ? -4.411  -6.461  -7.849  1.00 0.00 ? 75  MET A HG3  6  
ATOM 10812 H HE1  . MET A 1 75  ? -6.985  -7.392  -10.670 1.00 0.00 ? 75  MET A HE1  6  
ATOM 10813 H HE2  . MET A 1 75  ? -6.084  -6.078  -9.916  1.00 0.00 ? 75  MET A HE2  6  
ATOM 10814 H HE3  . MET A 1 75  ? -7.309  -6.952  -8.993  1.00 0.00 ? 75  MET A HE3  6  
ATOM 10815 N N    . PHE A 1 76  ? -5.114  -6.877  -4.215  1.00 0.00 ? 76  PHE A N    6  
ATOM 10816 C CA   . PHE A 1 76  ? -6.163  -6.949  -3.204  1.00 0.00 ? 76  PHE A CA   6  
ATOM 10817 C C    . PHE A 1 76  ? -7.163  -5.822  -3.413  1.00 0.00 ? 76  PHE A C    6  
ATOM 10818 O O    . PHE A 1 76  ? -7.011  -5.015  -4.333  1.00 0.00 ? 76  PHE A O    6  
ATOM 10819 C CB   . PHE A 1 76  ? -5.554  -6.874  -1.796  1.00 0.00 ? 76  PHE A CB   6  
ATOM 10820 C CG   . PHE A 1 76  ? -4.919  -5.555  -1.471  1.00 0.00 ? 76  PHE A CG   6  
ATOM 10821 C CD1  . PHE A 1 76  ? -3.701  -5.202  -2.028  1.00 0.00 ? 76  PHE A CD1  6  
ATOM 10822 C CD2  . PHE A 1 76  ? -5.534  -4.675  -0.596  1.00 0.00 ? 76  PHE A CD2  6  
ATOM 10823 C CE1  . PHE A 1 76  ? -3.111  -3.995  -1.720  1.00 0.00 ? 76  PHE A CE1  6  
ATOM 10824 C CE2  . PHE A 1 76  ? -4.949  -3.465  -0.288  1.00 0.00 ? 76  PHE A CE2  6  
ATOM 10825 C CZ   . PHE A 1 76  ? -3.735  -3.124  -0.850  1.00 0.00 ? 76  PHE A CZ   6  
ATOM 10826 H H    . PHE A 1 76  ? -4.904  -6.008  -4.629  1.00 0.00 ? 76  PHE A H    6  
ATOM 10827 H HA   . PHE A 1 76  ? -6.670  -7.895  -3.317  1.00 0.00 ? 76  PHE A HA   6  
ATOM 10828 H HB2  . PHE A 1 76  ? -6.331  -7.052  -1.067  1.00 0.00 ? 76  PHE A HB2  6  
ATOM 10829 H HB3  . PHE A 1 76  ? -4.797  -7.639  -1.700  1.00 0.00 ? 76  PHE A HB3  6  
ATOM 10830 H HD1  . PHE A 1 76  ? -3.216  -5.882  -2.714  1.00 0.00 ? 76  PHE A HD1  6  
ATOM 10831 H HD2  . PHE A 1 76  ? -6.485  -4.943  -0.160  1.00 0.00 ? 76  PHE A HD2  6  
ATOM 10832 H HE1  . PHE A 1 76  ? -2.161  -3.732  -2.160  1.00 0.00 ? 76  PHE A HE1  6  
ATOM 10833 H HE2  . PHE A 1 76  ? -5.438  -2.787  0.394   1.00 0.00 ? 76  PHE A HE2  6  
ATOM 10834 H HZ   . PHE A 1 76  ? -3.273  -2.179  -0.606  1.00 0.00 ? 76  PHE A HZ   6  
ATOM 10835 N N    . ARG A 1 77  ? -8.192  -5.769  -2.575  1.00 0.00 ? 77  ARG A N    6  
ATOM 10836 C CA   . ARG A 1 77  ? -9.175  -4.695  -2.648  1.00 0.00 ? 77  ARG A CA   6  
ATOM 10837 C C    . ARG A 1 77  ? -8.869  -3.643  -1.591  1.00 0.00 ? 77  ARG A C    6  
ATOM 10838 O O    . ARG A 1 77  ? -8.915  -3.928  -0.391  1.00 0.00 ? 77  ARG A O    6  
ATOM 10839 C CB   . ARG A 1 77  ? -10.598 -5.221  -2.449  1.00 0.00 ? 77  ARG A CB   6  
ATOM 10840 C CG   . ARG A 1 77  ? -11.013 -6.295  -3.441  1.00 0.00 ? 77  ARG A CG   6  
ATOM 10841 C CD   . ARG A 1 77  ? -12.482 -6.650  -3.280  1.00 0.00 ? 77  ARG A CD   6  
ATOM 10842 N NE   . ARG A 1 77  ? -12.853 -7.840  -4.040  1.00 0.00 ? 77  ARG A NE   6  
ATOM 10843 C CZ   . ARG A 1 77  ? -14.043 -8.009  -4.616  1.00 0.00 ? 77  ARG A CZ   6  
ATOM 10844 N NH1  . ARG A 1 77  ? -14.954 -7.044  -4.566  1.00 0.00 ? 77  ARG A NH1  6  
ATOM 10845 N NH2  . ARG A 1 77  ? -14.321 -9.146  -5.242  1.00 0.00 ? 77  ARG A NH2  6  
ATOM 10846 H H    . ARG A 1 77  ? -8.277  -6.444  -1.867  1.00 0.00 ? 77  ARG A H    6  
ATOM 10847 H HA   . ARG A 1 77  ? -9.100  -4.239  -3.625  1.00 0.00 ? 77  ARG A HA   6  
ATOM 10848 H HB2  . ARG A 1 77  ? -10.681 -5.631  -1.453  1.00 0.00 ? 77  ARG A HB2  6  
ATOM 10849 H HB3  . ARG A 1 77  ? -11.288 -4.394  -2.542  1.00 0.00 ? 77  ARG A HB3  6  
ATOM 10850 H HG2  . ARG A 1 77  ? -10.848 -5.931  -4.444  1.00 0.00 ? 77  ARG A HG2  6  
ATOM 10851 H HG3  . ARG A 1 77  ? -10.417 -7.181  -3.271  1.00 0.00 ? 77  ARG A HG3  6  
ATOM 10852 H HD2  . ARG A 1 77  ? -12.682 -6.829  -2.234  1.00 0.00 ? 77  ARG A HD2  6  
ATOM 10853 H HD3  . ARG A 1 77  ? -13.078 -5.816  -3.621  1.00 0.00 ? 77  ARG A HD3  6  
ATOM 10854 H HE   . ARG A 1 77  ? -12.183 -8.561  -4.103  1.00 0.00 ? 77  ARG A HE   6  
ATOM 10855 H HH11 . ARG A 1 77  ? -14.752 -6.182  -4.096  1.00 0.00 ? 77  ARG A HH11 6  
ATOM 10856 H HH12 . ARG A 1 77  ? -15.858 -7.176  -4.998  1.00 0.00 ? 77  ARG A HH12 6  
ATOM 10857 H HH21 . ARG A 1 77  ? -13.636 -9.883  -5.280  1.00 0.00 ? 77  ARG A HH21 6  
ATOM 10858 H HH22 . ARG A 1 77  ? -15.216 -9.274  -5.678  1.00 0.00 ? 77  ARG A HH22 6  
ATOM 10859 N N    . PHE A 1 78  ? -8.559  -2.439  -2.041  1.00 0.00 ? 78  PHE A N    6  
ATOM 10860 C CA   . PHE A 1 78  ? -8.217  -1.345  -1.148  1.00 0.00 ? 78  PHE A CA   6  
ATOM 10861 C C    . PHE A 1 78  ? -9.467  -0.531  -0.860  1.00 0.00 ? 78  PHE A C    6  
ATOM 10862 O O    . PHE A 1 78  ? -10.200 -0.170  -1.784  1.00 0.00 ? 78  PHE A O    6  
ATOM 10863 C CB   . PHE A 1 78  ? -7.155  -0.458  -1.807  1.00 0.00 ? 78  PHE A CB   6  
ATOM 10864 C CG   . PHE A 1 78  ? -6.343  0.395   -0.863  1.00 0.00 ? 78  PHE A CG   6  
ATOM 10865 C CD1  . PHE A 1 78  ? -6.895  1.499   -0.226  1.00 0.00 ? 78  PHE A CD1  6  
ATOM 10866 C CD2  . PHE A 1 78  ? -5.008  0.102   -0.639  1.00 0.00 ? 78  PHE A CD2  6  
ATOM 10867 C CE1  . PHE A 1 78  ? -6.128  2.284   0.619   1.00 0.00 ? 78  PHE A CE1  6  
ATOM 10868 C CE2  . PHE A 1 78  ? -4.237  0.886   0.196   1.00 0.00 ? 78  PHE A CE2  6  
ATOM 10869 C CZ   . PHE A 1 78  ? -4.796  1.976   0.826   1.00 0.00 ? 78  PHE A CZ   6  
ATOM 10870 H H    . PHE A 1 78  ? -8.584  -2.268  -3.009  1.00 0.00 ? 78  PHE A H    6  
ATOM 10871 H HA   . PHE A 1 78  ? -7.831  -1.754  -0.227  1.00 0.00 ? 78  PHE A HA   6  
ATOM 10872 H HB2  . PHE A 1 78  ? -6.466  -1.089  -2.347  1.00 0.00 ? 78  PHE A HB2  6  
ATOM 10873 H HB3  . PHE A 1 78  ? -7.643  0.199   -2.510  1.00 0.00 ? 78  PHE A HB3  6  
ATOM 10874 H HD1  . PHE A 1 78  ? -7.936  1.747   -0.390  1.00 0.00 ? 78  PHE A HD1  6  
ATOM 10875 H HD2  . PHE A 1 78  ? -4.565  -0.752  -1.129  1.00 0.00 ? 78  PHE A HD2  6  
ATOM 10876 H HE1  . PHE A 1 78  ? -6.568  3.140   1.110   1.00 0.00 ? 78  PHE A HE1  6  
ATOM 10877 H HE2  . PHE A 1 78  ? -3.197  0.642   0.361   1.00 0.00 ? 78  PHE A HE2  6  
ATOM 10878 H HZ   . PHE A 1 78  ? -4.188  2.597   1.471   1.00 0.00 ? 78  PHE A HZ   6  
ATOM 10879 N N    . ARG A 1 79  ? -9.731  -0.275  0.408   1.00 0.00 ? 79  ARG A N    6  
ATOM 10880 C CA   . ARG A 1 79  ? -10.888 0.515   0.782   1.00 0.00 ? 79  ARG A CA   6  
ATOM 10881 C C    . ARG A 1 79  ? -10.624 1.990   0.542   1.00 0.00 ? 79  ARG A C    6  
ATOM 10882 O O    . ARG A 1 79  ? -9.952  2.646   1.329   1.00 0.00 ? 79  ARG A O    6  
ATOM 10883 C CB   . ARG A 1 79  ? -11.254 0.306   2.244   1.00 0.00 ? 79  ARG A CB   6  
ATOM 10884 C CG   . ARG A 1 79  ? -12.671 0.744   2.564   1.00 0.00 ? 79  ARG A CG   6  
ATOM 10885 C CD   . ARG A 1 79  ? -12.805 1.157   4.014   1.00 0.00 ? 79  ARG A CD   6  
ATOM 10886 N NE   . ARG A 1 79  ? -12.173 0.193   4.922   1.00 0.00 ? 79  ARG A NE   6  
ATOM 10887 C CZ   . ARG A 1 79  ? -12.578 -0.041  6.173   1.00 0.00 ? 79  ARG A CZ   6  
ATOM 10888 N NH1  . ARG A 1 79  ? -13.578 0.657   6.692   1.00 0.00 ? 79  ARG A NH1  6  
ATOM 10889 N NH2  . ARG A 1 79  ? -11.955 -0.952  6.911   1.00 0.00 ? 79  ARG A NH2  6  
ATOM 10890 H H    . ARG A 1 79  ? -9.140  -0.633  1.109   1.00 0.00 ? 79  ARG A H    6  
ATOM 10891 H HA   . ARG A 1 79  ? -11.716 0.203   0.163   1.00 0.00 ? 79  ARG A HA   6  
ATOM 10892 H HB2  . ARG A 1 79  ? -11.160 -0.742  2.486   1.00 0.00 ? 79  ARG A HB2  6  
ATOM 10893 H HB3  . ARG A 1 79  ? -10.577 0.874   2.862   1.00 0.00 ? 79  ARG A HB3  6  
ATOM 10894 H HG2  . ARG A 1 79  ? -12.929 1.583   1.934   1.00 0.00 ? 79  ARG A HG2  6  
ATOM 10895 H HG3  . ARG A 1 79  ? -13.345 -0.077  2.367   1.00 0.00 ? 79  ARG A HG3  6  
ATOM 10896 H HD2  . ARG A 1 79  ? -12.337 2.119   4.133   1.00 0.00 ? 79  ARG A HD2  6  
ATOM 10897 H HD3  . ARG A 1 79  ? -13.855 1.234   4.254   1.00 0.00 ? 79  ARG A HD3  6  
ATOM 10898 H HE   . ARG A 1 79  ? -11.410 -0.314  4.572   1.00 0.00 ? 79  ARG A HE   6  
ATOM 10899 H HH11 . ARG A 1 79  ? -14.032 1.371   6.151   1.00 0.00 ? 79  ARG A HH11 6  
ATOM 10900 H HH12 . ARG A 1 79  ? -13.897 0.469   7.632   1.00 0.00 ? 79  ARG A HH12 6  
ATOM 10901 H HH21 . ARG A 1 79  ? -11.175 -1.464  6.538   1.00 0.00 ? 79  ARG A HH21 6  
ATOM 10902 H HH22 . ARG A 1 79  ? -12.262 -1.143  7.858   1.00 0.00 ? 79  ARG A HH22 6  
ATOM 10903 N N    . SER A 1 80  ? -11.138 2.485   -0.562  1.00 0.00 ? 80  SER A N    6  
ATOM 10904 C CA   . SER A 1 80  ? -11.043 3.890   -0.909  1.00 0.00 ? 80  SER A CA   6  
ATOM 10905 C C    . SER A 1 80  ? -11.915 4.747   0.025   1.00 0.00 ? 80  SER A C    6  
ATOM 10906 O O    . SER A 1 80  ? -12.649 4.229   0.875   1.00 0.00 ? 80  SER A O    6  
ATOM 10907 C CB   . SER A 1 80  ? -11.466 4.047   -2.365  1.00 0.00 ? 80  SER A CB   6  
ATOM 10908 O OG   . SER A 1 80  ? -11.460 5.401   -2.784  1.00 0.00 ? 80  SER A OG   6  
ATOM 10909 H H    . SER A 1 80  ? -11.580 1.872   -1.184  1.00 0.00 ? 80  SER A H    6  
ATOM 10910 H HA   . SER A 1 80  ? -10.012 4.193   -0.804  1.00 0.00 ? 80  SER A HA   6  
ATOM 10911 H HB2  . SER A 1 80  ? -10.790 3.489   -2.995  1.00 0.00 ? 80  SER A HB2  6  
ATOM 10912 H HB3  . SER A 1 80  ? -12.466 3.654   -2.474  1.00 0.00 ? 80  SER A HB3  6  
ATOM 10913 H HG   . SER A 1 80  ? -12.345 5.637   -3.082  1.00 0.00 ? 80  SER A HG   6  
ATOM 10914 N N    . LYS A 1 81  ? -11.828 6.067   -0.154  1.00 0.00 ? 81  LYS A N    6  
ATOM 10915 C CA   . LYS A 1 81  ? -12.418 7.042   0.764   1.00 0.00 ? 81  LYS A CA   6  
ATOM 10916 C C    . LYS A 1 81  ? -13.947 7.012   0.770   1.00 0.00 ? 81  LYS A C    6  
ATOM 10917 O O    . LYS A 1 81  ? -14.568 7.554   1.683   1.00 0.00 ? 81  LYS A O    6  
ATOM 10918 C CB   . LYS A 1 81  ? -11.938 8.454   0.405   1.00 0.00 ? 81  LYS A CB   6  
ATOM 10919 C CG   . LYS A 1 81  ? -12.348 9.523   1.407   1.00 0.00 ? 81  LYS A CG   6  
ATOM 10920 C CD   . LYS A 1 81  ? -11.706 9.286   2.762   1.00 0.00 ? 81  LYS A CD   6  
ATOM 10921 C CE   . LYS A 1 81  ? -12.223 10.260  3.806   1.00 0.00 ? 81  LYS A CE   6  
ATOM 10922 N NZ   . LYS A 1 81  ? -13.643 9.996   4.163   1.00 0.00 ? 81  LYS A NZ   6  
ATOM 10923 H H    . LYS A 1 81  ? -11.337 6.407   -0.935  1.00 0.00 ? 81  LYS A H    6  
ATOM 10924 H HA   . LYS A 1 81  ? -12.069 6.805   1.757   1.00 0.00 ? 81  LYS A HA   6  
ATOM 10925 H HB2  . LYS A 1 81  ? -10.859 8.448   0.341   1.00 0.00 ? 81  LYS A HB2  6  
ATOM 10926 H HB3  . LYS A 1 81  ? -12.343 8.724   -0.561  1.00 0.00 ? 81  LYS A HB3  6  
ATOM 10927 H HG2  . LYS A 1 81  ? -12.038 10.488  1.038   1.00 0.00 ? 81  LYS A HG2  6  
ATOM 10928 H HG3  . LYS A 1 81  ? -13.423 9.506   1.519   1.00 0.00 ? 81  LYS A HG3  6  
ATOM 10929 H HD2  . LYS A 1 81  ? -11.931 8.280   3.083   1.00 0.00 ? 81  LYS A HD2  6  
ATOM 10930 H HD3  . LYS A 1 81  ? -10.638 9.405   2.670   1.00 0.00 ? 81  LYS A HD3  6  
ATOM 10931 H HE2  . LYS A 1 81  ? -11.616 10.169  4.695   1.00 0.00 ? 81  LYS A HE2  6  
ATOM 10932 H HE3  . LYS A 1 81  ? -12.140 11.263  3.416   1.00 0.00 ? 81  LYS A HE3  6  
ATOM 10933 H HZ1  . LYS A 1 81  ? -13.747 9.020   4.520   1.00 0.00 ? 81  LYS A HZ1  6  
ATOM 10934 H HZ2  . LYS A 1 81  ? -14.258 10.115  3.329   1.00 0.00 ? 81  LYS A HZ2  6  
ATOM 10935 H HZ3  . LYS A 1 81  ? -13.951 10.658  4.906   1.00 0.00 ? 81  LYS A HZ3  6  
ATOM 10936 N N    . ASN A 1 82  ? -14.556 6.378   -0.223  1.00 0.00 ? 82  ASN A N    6  
ATOM 10937 C CA   . ASN A 1 82  ? -16.014 6.303   -0.278  1.00 0.00 ? 82  ASN A CA   6  
ATOM 10938 C C    . ASN A 1 82  ? -16.449 4.929   0.185   1.00 0.00 ? 82  ASN A C    6  
ATOM 10939 O O    . ASN A 1 82  ? -17.581 4.503   -0.045  1.00 0.00 ? 82  ASN A O    6  
ATOM 10940 C CB   . ASN A 1 82  ? -16.552 6.565   -1.688  1.00 0.00 ? 82  ASN A CB   6  
ATOM 10941 C CG   . ASN A 1 82  ? -15.942 7.788   -2.329  1.00 0.00 ? 82  ASN A CG   6  
ATOM 10942 O OD1  . ASN A 1 82  ? -16.426 8.909   -2.151  1.00 0.00 ? 82  ASN A OD1  6  
ATOM 10943 N ND2  . ASN A 1 82  ? -14.882 7.573   -3.089  1.00 0.00 ? 82  ASN A ND2  6  
ATOM 10944 H H    . ASN A 1 82  ? -14.025 5.909   -0.906  1.00 0.00 ? 82  ASN A H    6  
ATOM 10945 H HA   . ASN A 1 82  ? -16.411 7.044   0.400   1.00 0.00 ? 82  ASN A HA   6  
ATOM 10946 H HB2  . ASN A 1 82  ? -16.334 5.711   -2.315  1.00 0.00 ? 82  ASN A HB2  6  
ATOM 10947 H HB3  . ASN A 1 82  ? -17.621 6.702   -1.638  1.00 0.00 ? 82  ASN A HB3  6  
ATOM 10948 H HD21 . ASN A 1 82  ? -14.572 6.642   -3.187  1.00 0.00 ? 82  ASN A HD21 6  
ATOM 10949 H HD22 . ASN A 1 82  ? -14.453 8.337   -3.520  1.00 0.00 ? 82  ASN A HD22 6  
ATOM 10950 N N    . GLN A 1 83  ? -15.505 4.237   0.818   1.00 0.00 ? 83  GLN A N    6  
ATOM 10951 C CA   . GLN A 1 83  ? -15.744 2.935   1.418   1.00 0.00 ? 83  GLN A CA   6  
ATOM 10952 C C    . GLN A 1 83  ? -15.980 1.874   0.352   1.00 0.00 ? 83  GLN A C    6  
ATOM 10953 O O    . GLN A 1 83  ? -16.601 0.842   0.613   1.00 0.00 ? 83  GLN A O    6  
ATOM 10954 C CB   . GLN A 1 83  ? -16.909 2.985   2.420   1.00 0.00 ? 83  GLN A CB   6  
ATOM 10955 C CG   . GLN A 1 83  ? -16.558 3.655   3.747   1.00 0.00 ? 83  GLN A CG   6  
ATOM 10956 C CD   . GLN A 1 83  ? -16.214 5.130   3.611   1.00 0.00 ? 83  GLN A CD   6  
ATOM 10957 O OE1  . GLN A 1 83  ? -17.086 5.996   3.677   1.00 0.00 ? 83  GLN A OE1  6  
ATOM 10958 N NE2  . GLN A 1 83  ? -14.934 5.421   3.440   1.00 0.00 ? 83  GLN A NE2  6  
ATOM 10959 H H    . GLN A 1 83  ? -14.602 4.622   0.875   1.00 0.00 ? 83  GLN A H    6  
ATOM 10960 H HA   . GLN A 1 83  ? -14.848 2.668   1.958   1.00 0.00 ? 83  GLN A HA   6  
ATOM 10961 H HB2  . GLN A 1 83  ? -17.728 3.530   1.974   1.00 0.00 ? 83  GLN A HB2  6  
ATOM 10962 H HB3  . GLN A 1 83  ? -17.232 1.974   2.628   1.00 0.00 ? 83  GLN A HB3  6  
ATOM 10963 H HG2  . GLN A 1 83  ? -17.395 3.559   4.415   1.00 0.00 ? 83  GLN A HG2  6  
ATOM 10964 H HG3  . GLN A 1 83  ? -15.704 3.145   4.171   1.00 0.00 ? 83  GLN A HG3  6  
ATOM 10965 H HE21 . GLN A 1 83  ? -14.290 4.683   3.420   1.00 0.00 ? 83  GLN A HE21 6  
ATOM 10966 H HE22 . GLN A 1 83  ? -14.684 6.366   3.318   1.00 0.00 ? 83  GLN A HE22 6  
ATOM 10967 N N    . GLU A 1 84  ? -15.485 2.121   -0.856  1.00 0.00 ? 84  GLU A N    6  
ATOM 10968 C CA   . GLU A 1 84  ? -15.526 1.115   -1.888  1.00 0.00 ? 84  GLU A CA   6  
ATOM 10969 C C    . GLU A 1 84  ? -14.250 0.289   -1.847  1.00 0.00 ? 84  GLU A C    6  
ATOM 10970 O O    . GLU A 1 84  ? -13.219 0.748   -1.355  1.00 0.00 ? 84  GLU A O    6  
ATOM 10971 C CB   . GLU A 1 84  ? -15.727 1.727   -3.276  1.00 0.00 ? 84  GLU A CB   6  
ATOM 10972 C CG   . GLU A 1 84  ? -14.623 2.668   -3.717  1.00 0.00 ? 84  GLU A CG   6  
ATOM 10973 C CD   . GLU A 1 84  ? -14.912 4.119   -3.378  1.00 0.00 ? 84  GLU A CD   6  
ATOM 10974 O OE1  . GLU A 1 84  ? -15.724 4.747   -4.085  1.00 0.00 ? 84  GLU A OE1  6  
ATOM 10975 O OE2  . GLU A 1 84  ? -14.323 4.638   -2.404  1.00 0.00 ? 84  GLU A OE2  6  
ATOM 10976 H H    . GLU A 1 84  ? -15.086 2.994   -1.058  1.00 0.00 ? 84  GLU A H    6  
ATOM 10977 H HA   . GLU A 1 84  ? -16.352 0.468   -1.668  1.00 0.00 ? 84  GLU A HA   6  
ATOM 10978 H HB2  . GLU A 1 84  ? -15.787 0.931   -3.989  1.00 0.00 ? 84  GLU A HB2  6  
ATOM 10979 H HB3  . GLU A 1 84  ? -16.655 2.275   -3.285  1.00 0.00 ? 84  GLU A HB3  6  
ATOM 10980 H HG2  . GLU A 1 84  ? -13.710 2.374   -3.223  1.00 0.00 ? 84  GLU A HG2  6  
ATOM 10981 H HG3  . GLU A 1 84  ? -14.501 2.576   -4.786  1.00 0.00 ? 84  GLU A HG3  6  
ATOM 10982 N N    . TRP A 1 85  ? -14.322 -0.929  -2.351  1.00 0.00 ? 85  TRP A N    6  
ATOM 10983 C CA   . TRP A 1 85  ? -13.201 -1.841  -2.302  1.00 0.00 ? 85  TRP A CA   6  
ATOM 10984 C C    . TRP A 1 85  ? -12.719 -2.135  -3.713  1.00 0.00 ? 85  TRP A C    6  
ATOM 10985 O O    . TRP A 1 85  ? -13.111 -3.127  -4.326  1.00 0.00 ? 85  TRP A O    6  
ATOM 10986 C CB   . TRP A 1 85  ? -13.619 -3.122  -1.587  1.00 0.00 ? 85  TRP A CB   6  
ATOM 10987 C CG   . TRP A 1 85  ? -14.082 -2.881  -0.179  1.00 0.00 ? 85  TRP A CG   6  
ATOM 10988 C CD1  . TRP A 1 85  ? -15.341 -2.540  0.223   1.00 0.00 ? 85  TRP A CD1  6  
ATOM 10989 C CD2  . TRP A 1 85  ? -13.289 -2.949  1.010   1.00 0.00 ? 85  TRP A CD2  6  
ATOM 10990 N NE1  . TRP A 1 85  ? -15.378 -2.399  1.590   1.00 0.00 ? 85  TRP A NE1  6  
ATOM 10991 C CE2  . TRP A 1 85  ? -14.133 -2.646  2.094   1.00 0.00 ? 85  TRP A CE2  6  
ATOM 10992 C CE3  . TRP A 1 85  ? -11.949 -3.237  1.264   1.00 0.00 ? 85  TRP A CE3  6  
ATOM 10993 C CZ2  . TRP A 1 85  ? -13.680 -2.630  3.409   1.00 0.00 ? 85  TRP A CZ2  6  
ATOM 10994 C CZ3  . TRP A 1 85  ? -11.502 -3.215  2.570   1.00 0.00 ? 85  TRP A CZ3  6  
ATOM 10995 C CH2  . TRP A 1 85  ? -12.363 -2.916  3.628   1.00 0.00 ? 85  TRP A CH2  6  
ATOM 10996 H H    . TRP A 1 85  ? -15.143 -1.231  -2.790  1.00 0.00 ? 85  TRP A H    6  
ATOM 10997 H HA   . TRP A 1 85  ? -12.403 -1.367  -1.748  1.00 0.00 ? 85  TRP A HA   6  
ATOM 10998 H HB2  . TRP A 1 85  ? -14.430 -3.583  -2.133  1.00 0.00 ? 85  TRP A HB2  6  
ATOM 10999 H HB3  . TRP A 1 85  ? -12.783 -3.795  -1.557  1.00 0.00 ? 85  TRP A HB3  6  
ATOM 11000 H HD1  . TRP A 1 85  ? -16.179 -2.403  -0.445  1.00 0.00 ? 85  TRP A HD1  6  
ATOM 11001 H HE1  . TRP A 1 85  ? -16.169 -2.156  2.118   1.00 0.00 ? 85  TRP A HE1  6  
ATOM 11002 H HE3  . TRP A 1 85  ? -11.264 -3.470  0.462   1.00 0.00 ? 85  TRP A HE3  6  
ATOM 11003 H HZ2  . TRP A 1 85  ? -14.333 -2.403  4.236   1.00 0.00 ? 85  TRP A HZ2  6  
ATOM 11004 H HZ3  . TRP A 1 85  ? -10.466 -3.438  2.786   1.00 0.00 ? 85  TRP A HZ3  6  
ATOM 11005 H HH2  . TRP A 1 85  ? -11.965 -2.913  4.632   1.00 0.00 ? 85  TRP A HH2  6  
ATOM 11006 N N    . LEU A 1 86  ? -11.873 -1.253  -4.218  1.00 0.00 ? 86  LEU A N    6  
ATOM 11007 C CA   . LEU A 1 86  ? -11.408 -1.329  -5.592  1.00 0.00 ? 86  LEU A CA   6  
ATOM 11008 C C    . LEU A 1 86  ? -10.172 -2.212  -5.701  1.00 0.00 ? 86  LEU A C    6  
ATOM 11009 O O    . LEU A 1 86  ? -9.494  -2.479  -4.707  1.00 0.00 ? 86  LEU A O    6  
ATOM 11010 C CB   . LEU A 1 86  ? -11.124 0.087   -6.122  1.00 0.00 ? 86  LEU A CB   6  
ATOM 11011 C CG   . LEU A 1 86  ? -10.435 1.046   -5.140  1.00 0.00 ? 86  LEU A CG   6  
ATOM 11012 C CD1  . LEU A 1 86  ? -8.968  0.692   -4.943  1.00 0.00 ? 86  LEU A CD1  6  
ATOM 11013 C CD2  . LEU A 1 86  ? -10.577 2.480   -5.619  1.00 0.00 ? 86  LEU A CD2  6  
ATOM 11014 H H    . LEU A 1 86  ? -11.527 -0.541  -3.636  1.00 0.00 ? 86  LEU A H    6  
ATOM 11015 H HA   . LEU A 1 86  ? -12.198 -1.770  -6.183  1.00 0.00 ? 86  LEU A HA   6  
ATOM 11016 H HB2  . LEU A 1 86  ? -10.501 -0.002  -7.001  1.00 0.00 ? 86  LEU A HB2  6  
ATOM 11017 H HB3  . LEU A 1 86  ? -12.065 0.529   -6.417  1.00 0.00 ? 86  LEU A HB3  6  
ATOM 11018 H HG   . LEU A 1 86  ? -10.922 0.968   -4.179  1.00 0.00 ? 86  LEU A HG   6  
ATOM 11019 H HD11 . LEU A 1 86  ? -8.503  1.422   -4.296  1.00 0.00 ? 86  LEU A HD11 6  
ATOM 11020 H HD12 . LEU A 1 86  ? -8.466  0.686   -5.898  1.00 0.00 ? 86  LEU A HD12 6  
ATOM 11021 H HD13 . LEU A 1 86  ? -8.891  -0.286  -4.493  1.00 0.00 ? 86  LEU A HD13 6  
ATOM 11022 H HD21 . LEU A 1 86  ? -11.624 2.743   -5.658  1.00 0.00 ? 86  LEU A HD21 6  
ATOM 11023 H HD22 . LEU A 1 86  ? -10.143 2.576   -6.602  1.00 0.00 ? 86  LEU A HD22 6  
ATOM 11024 H HD23 . LEU A 1 86  ? -10.066 3.140   -4.932  1.00 0.00 ? 86  LEU A HD23 6  
ATOM 11025 N N    . TRP A 1 87  ? -9.875  -2.656  -6.912  1.00 0.00 ? 87  TRP A N    6  
ATOM 11026 C CA   . TRP A 1 87  ? -8.756  -3.554  -7.137  1.00 0.00 ? 87  TRP A CA   6  
ATOM 11027 C C    . TRP A 1 87  ? -7.455  -2.787  -7.247  1.00 0.00 ? 87  TRP A C    6  
ATOM 11028 O O    . TRP A 1 87  ? -7.217  -2.059  -8.214  1.00 0.00 ? 87  TRP A O    6  
ATOM 11029 C CB   . TRP A 1 87  ? -8.970  -4.397  -8.387  1.00 0.00 ? 87  TRP A CB   6  
ATOM 11030 C CG   . TRP A 1 87  ? -10.019 -5.444  -8.214  1.00 0.00 ? 87  TRP A CG   6  
ATOM 11031 C CD1  . TRP A 1 87  ? -11.302 -5.414  -8.674  1.00 0.00 ? 87  TRP A CD1  6  
ATOM 11032 C CD2  . TRP A 1 87  ? -9.867  -6.679  -7.515  1.00 0.00 ? 87  TRP A CD2  6  
ATOM 11033 N NE1  . TRP A 1 87  ? -11.955 -6.569  -8.310  1.00 0.00 ? 87  TRP A NE1  6  
ATOM 11034 C CE2  . TRP A 1 87  ? -11.092 -7.360  -7.598  1.00 0.00 ? 87  TRP A CE2  6  
ATOM 11035 C CE3  . TRP A 1 87  ? -8.807  -7.276  -6.828  1.00 0.00 ? 87  TRP A CE3  6  
ATOM 11036 C CZ2  . TRP A 1 87  ? -11.285 -8.614  -7.022  1.00 0.00 ? 87  TRP A CZ2  6  
ATOM 11037 C CZ3  . TRP A 1 87  ? -8.997  -8.515  -6.258  1.00 0.00 ? 87  TRP A CZ3  6  
ATOM 11038 C CH2  . TRP A 1 87  ? -10.229 -9.174  -6.357  1.00 0.00 ? 87  TRP A CH2  6  
ATOM 11039 H H    . TRP A 1 87  ? -10.407 -2.351  -7.674  1.00 0.00 ? 87  TRP A H    6  
ATOM 11040 H HA   . TRP A 1 87  ? -8.691  -4.211  -6.282  1.00 0.00 ? 87  TRP A HA   6  
ATOM 11041 H HB2  . TRP A 1 87  ? -9.268  -3.756  -9.201  1.00 0.00 ? 87  TRP A HB2  6  
ATOM 11042 H HB3  . TRP A 1 87  ? -8.042  -4.891  -8.643  1.00 0.00 ? 87  TRP A HB3  6  
ATOM 11043 H HD1  . TRP A 1 87  ? -11.728 -4.595  -9.241  1.00 0.00 ? 87  TRP A HD1  6  
ATOM 11044 H HE1  . TRP A 1 87  ? -12.888 -6.792  -8.528  1.00 0.00 ? 87  TRP A HE1  6  
ATOM 11045 H HE3  . TRP A 1 87  ? -7.850  -6.781  -6.741  1.00 0.00 ? 87  TRP A HE3  6  
ATOM 11046 H HZ2  . TRP A 1 87  ? -12.227 -9.137  -7.091  1.00 0.00 ? 87  TRP A HZ2  6  
ATOM 11047 H HZ3  . TRP A 1 87  ? -8.189  -8.991  -5.722  1.00 0.00 ? 87  TRP A HZ3  6  
ATOM 11048 H HH2  . TRP A 1 87  ? -10.335 -10.145 -5.897  1.00 0.00 ? 87  TRP A HH2  6  
ATOM 11049 N N    . MET A 1 88  ? -6.623  -2.967  -6.249  1.00 0.00 ? 88  MET A N    6  
ATOM 11050 C CA   . MET A 1 88  ? -5.342  -2.305  -6.181  1.00 0.00 ? 88  MET A CA   6  
ATOM 11051 C C    . MET A 1 88  ? -4.237  -3.344  -6.083  1.00 0.00 ? 88  MET A C    6  
ATOM 11052 O O    . MET A 1 88  ? -4.343  -4.304  -5.315  1.00 0.00 ? 88  MET A O    6  
ATOM 11053 C CB   . MET A 1 88  ? -5.334  -1.361  -4.973  1.00 0.00 ? 88  MET A CB   6  
ATOM 11054 C CG   . MET A 1 88  ? -4.117  -1.482  -4.064  1.00 0.00 ? 88  MET A CG   6  
ATOM 11055 S SD   . MET A 1 88  ? -2.763  -0.423  -4.583  1.00 0.00 ? 88  MET A SD   6  
ATOM 11056 C CE   . MET A 1 88  ? -3.557  1.172   -4.428  1.00 0.00 ? 88  MET A CE   6  
ATOM 11057 H H    . MET A 1 88  ? -6.881  -3.575  -5.516  1.00 0.00 ? 88  MET A H    6  
ATOM 11058 H HA   . MET A 1 88  ? -5.210  -1.731  -7.085  1.00 0.00 ? 88  MET A HA   6  
ATOM 11059 H HB2  . MET A 1 88  ? -5.371  -0.345  -5.336  1.00 0.00 ? 88  MET A HB2  6  
ATOM 11060 H HB3  . MET A 1 88  ? -6.216  -1.547  -4.384  1.00 0.00 ? 88  MET A HB3  6  
ATOM 11061 H HG2  . MET A 1 88  ? -4.405  -1.210  -3.061  1.00 0.00 ? 88  MET A HG2  6  
ATOM 11062 H HG3  . MET A 1 88  ? -3.779  -2.509  -4.073  1.00 0.00 ? 88  MET A HG3  6  
ATOM 11063 H HE1  . MET A 1 88  ? -2.896  1.941   -4.800  1.00 0.00 ? 88  MET A HE1  6  
ATOM 11064 H HE2  . MET A 1 88  ? -3.781  1.362   -3.390  1.00 0.00 ? 88  MET A HE2  6  
ATOM 11065 H HE3  . MET A 1 88  ? -4.473  1.178   -5.002  1.00 0.00 ? 88  MET A HE3  6  
ATOM 11066 N N    . ARG A 1 89  ? -3.198  -3.182  -6.877  1.00 0.00 ? 89  ARG A N    6  
ATOM 11067 C CA   . ARG A 1 89  ? -2.070  -4.085  -6.802  1.00 0.00 ? 89  ARG A CA   6  
ATOM 11068 C C    . ARG A 1 89  ? -0.851  -3.337  -6.297  1.00 0.00 ? 89  ARG A C    6  
ATOM 11069 O O    . ARG A 1 89  ? -0.426  -2.343  -6.884  1.00 0.00 ? 89  ARG A O    6  
ATOM 11070 C CB   . ARG A 1 89  ? -1.773  -4.745  -8.149  1.00 0.00 ? 89  ARG A CB   6  
ATOM 11071 C CG   . ARG A 1 89  ? -0.884  -5.966  -8.010  1.00 0.00 ? 89  ARG A CG   6  
ATOM 11072 C CD   . ARG A 1 89  ? -0.795  -6.768  -9.295  1.00 0.00 ? 89  ARG A CD   6  
ATOM 11073 N NE   . ARG A 1 89  ? -0.020  -7.988  -9.092  1.00 0.00 ? 89  ARG A NE   6  
ATOM 11074 C CZ   . ARG A 1 89  ? -0.065  -9.059  -9.884  1.00 0.00 ? 89  ARG A CZ   6  
ATOM 11075 N NH1  . ARG A 1 89  ? -0.818  -9.057  -10.977 1.00 0.00 ? 89  ARG A NH1  6  
ATOM 11076 N NH2  . ARG A 1 89  ? 0.659   -10.129 -9.587  1.00 0.00 ? 89  ARG A NH2  6  
ATOM 11077 H H    . ARG A 1 89  ? -3.182  -2.431  -7.518  1.00 0.00 ? 89  ARG A H    6  
ATOM 11078 H HA   . ARG A 1 89  ? -2.322  -4.853  -6.084  1.00 0.00 ? 89  ARG A HA   6  
ATOM 11079 H HB2  . ARG A 1 89  ? -2.701  -5.044  -8.612  1.00 0.00 ? 89  ARG A HB2  6  
ATOM 11080 H HB3  . ARG A 1 89  ? -1.266  -4.033  -8.781  1.00 0.00 ? 89  ARG A HB3  6  
ATOM 11081 H HG2  . ARG A 1 89  ? 0.109   -5.643  -7.737  1.00 0.00 ? 89  ARG A HG2  6  
ATOM 11082 H HG3  . ARG A 1 89  ? -1.283  -6.599  -7.230  1.00 0.00 ? 89  ARG A HG3  6  
ATOM 11083 H HD2  . ARG A 1 89  ? -1.794  -7.030  -9.616  1.00 0.00 ? 89  ARG A HD2  6  
ATOM 11084 H HD3  . ARG A 1 89  ? -0.316  -6.165  -10.054 1.00 0.00 ? 89  ARG A HD3  6  
ATOM 11085 H HE   . ARG A 1 89  ? 0.570   -8.012  -8.305  1.00 0.00 ? 89  ARG A HE   6  
ATOM 11086 H HH11 . ARG A 1 89  ? -1.365  -8.248  -11.219 1.00 0.00 ? 89  ARG A HH11 6  
ATOM 11087 H HH12 . ARG A 1 89  ? -0.844  -9.867  -11.570 1.00 0.00 ? 89  ARG A HH12 6  
ATOM 11088 H HH21 . ARG A 1 89  ? 1.236   -10.142 -8.765  1.00 0.00 ? 89  ARG A HH21 6  
ATOM 11089 H HH22 . ARG A 1 89  ? 0.639   -10.940 -10.194 1.00 0.00 ? 89  ARG A HH22 6  
ATOM 11090 N N    . THR A 1 90  ? -0.321  -3.807  -5.191  1.00 0.00 ? 90  THR A N    6  
ATOM 11091 C CA   . THR A 1 90  ? 0.810   -3.177  -4.551  1.00 0.00 ? 90  THR A CA   6  
ATOM 11092 C C    . THR A 1 90  ? 2.086   -3.978  -4.795  1.00 0.00 ? 90  THR A C    6  
ATOM 11093 O O    . THR A 1 90  ? 2.116   -5.194  -4.590  1.00 0.00 ? 90  THR A O    6  
ATOM 11094 C CB   . THR A 1 90  ? 0.546   -3.053  -3.041  1.00 0.00 ? 90  THR A CB   6  
ATOM 11095 O OG1  . THR A 1 90  ? -0.670  -2.326  -2.832  1.00 0.00 ? 90  THR A OG1  6  
ATOM 11096 C CG2  . THR A 1 90  ? 1.689   -2.350  -2.334  1.00 0.00 ? 90  THR A CG2  6  
ATOM 11097 H H    . THR A 1 90  ? -0.707  -4.616  -4.781  1.00 0.00 ? 90  THR A H    6  
ATOM 11098 H HA   . THR A 1 90  ? 0.928   -2.184  -4.961  1.00 0.00 ? 90  THR A HA   6  
ATOM 11099 H HB   . THR A 1 90  ? 0.439   -4.047  -2.629  1.00 0.00 ? 90  THR A HB   6  
ATOM 11100 H HG1  . THR A 1 90  ? -1.111  -2.199  -3.677  1.00 0.00 ? 90  THR A HG1  6  
ATOM 11101 H HG21 . THR A 1 90  ? 2.602   -2.910  -2.483  1.00 0.00 ? 90  THR A HG21 6  
ATOM 11102 H HG22 . THR A 1 90  ? 1.475   -2.287  -1.278  1.00 0.00 ? 90  THR A HG22 6  
ATOM 11103 H HG23 . THR A 1 90  ? 1.806   -1.357  -2.739  1.00 0.00 ? 90  THR A HG23 6  
ATOM 11104 N N    . SER A 1 91  ? 3.126   -3.298  -5.248  1.00 0.00 ? 91  SER A N    6  
ATOM 11105 C CA   . SER A 1 91  ? 4.416   -3.929  -5.454  1.00 0.00 ? 91  SER A CA   6  
ATOM 11106 C C    . SER A 1 91  ? 5.287   -3.731  -4.218  1.00 0.00 ? 91  SER A C    6  
ATOM 11107 O O    . SER A 1 91  ? 5.471   -2.610  -3.748  1.00 0.00 ? 91  SER A O    6  
ATOM 11108 C CB   . SER A 1 91  ? 5.091   -3.360  -6.705  1.00 0.00 ? 91  SER A CB   6  
ATOM 11109 O OG   . SER A 1 91  ? 4.998   -1.945  -6.742  1.00 0.00 ? 91  SER A OG   6  
ATOM 11110 H H    . SER A 1 91  ? 3.032   -2.335  -5.428  1.00 0.00 ? 91  SER A H    6  
ATOM 11111 H HA   . SER A 1 91  ? 4.247   -4.987  -5.595  1.00 0.00 ? 91  SER A HA   6  
ATOM 11112 H HB2  . SER A 1 91  ? 6.136   -3.639  -6.704  1.00 0.00 ? 91  SER A HB2  6  
ATOM 11113 H HB3  . SER A 1 91  ? 4.612   -3.763  -7.585  1.00 0.00 ? 91  SER A HB3  6  
ATOM 11114 H HG   . SER A 1 91  ? 5.837   -1.577  -7.065  1.00 0.00 ? 91  SER A HG   6  
ATOM 11115 N N    . SER A 1 92  ? 5.806   -4.826  -3.691  1.00 0.00 ? 92  SER A N    6  
ATOM 11116 C CA   . SER A 1 92  ? 6.538   -4.803  -2.441  1.00 0.00 ? 92  SER A CA   6  
ATOM 11117 C C    . SER A 1 92  ? 8.036   -4.826  -2.693  1.00 0.00 ? 92  SER A C    6  
ATOM 11118 O O    . SER A 1 92  ? 8.537   -5.675  -3.428  1.00 0.00 ? 92  SER A O    6  
ATOM 11119 C CB   . SER A 1 92  ? 6.154   -6.009  -1.584  1.00 0.00 ? 92  SER A CB   6  
ATOM 11120 O OG   . SER A 1 92  ? 4.750   -6.196  -1.567  1.00 0.00 ? 92  SER A OG   6  
ATOM 11121 H H    . SER A 1 92  ? 5.708   -5.679  -4.166  1.00 0.00 ? 92  SER A H    6  
ATOM 11122 H HA   . SER A 1 92  ? 6.280   -3.898  -1.914  1.00 0.00 ? 92  SER A HA   6  
ATOM 11123 H HB2  . SER A 1 92  ? 6.628   -6.903  -1.979  1.00 0.00 ? 92  SER A HB2  6  
ATOM 11124 H HB3  . SER A 1 92  ? 6.494   -5.846  -0.570  1.00 0.00 ? 92  SER A HB3  6  
ATOM 11125 H HG   . SER A 1 92  ? 4.463   -6.549  -2.418  1.00 0.00 ? 92  SER A HG   6  
ATOM 11126 N N    . PHE A 1 93  ? 8.731   -3.877  -2.102  1.00 0.00 ? 93  PHE A N    6  
ATOM 11127 C CA   . PHE A 1 93  ? 10.177  -3.890  -2.077  1.00 0.00 ? 93  PHE A CA   6  
ATOM 11128 C C    . PHE A 1 93  ? 10.648  -3.736  -0.638  1.00 0.00 ? 93  PHE A C    6  
ATOM 11129 O O    . PHE A 1 93  ? 10.141  -2.898  0.103   1.00 0.00 ? 93  PHE A O    6  
ATOM 11130 C CB   . PHE A 1 93  ? 10.735  -2.762  -2.954  1.00 0.00 ? 93  PHE A CB   6  
ATOM 11131 C CG   . PHE A 1 93  ? 12.211  -2.511  -2.782  1.00 0.00 ? 93  PHE A CG   6  
ATOM 11132 C CD1  . PHE A 1 93  ? 12.667  -1.607  -1.835  1.00 0.00 ? 93  PHE A CD1  6  
ATOM 11133 C CD2  . PHE A 1 93  ? 13.141  -3.175  -3.567  1.00 0.00 ? 93  PHE A CD2  6  
ATOM 11134 C CE1  . PHE A 1 93  ? 14.020  -1.373  -1.671  1.00 0.00 ? 93  PHE A CE1  6  
ATOM 11135 C CE2  . PHE A 1 93  ? 14.495  -2.944  -3.410  1.00 0.00 ? 93  PHE A CE2  6  
ATOM 11136 C CZ   . PHE A 1 93  ? 14.935  -2.044  -2.461  1.00 0.00 ? 93  PHE A CZ   6  
ATOM 11137 H H    . PHE A 1 93  ? 8.256   -3.133  -1.674  1.00 0.00 ? 93  PHE A H    6  
ATOM 11138 H HA   . PHE A 1 93  ? 10.514  -4.842  -2.460  1.00 0.00 ? 93  PHE A HA   6  
ATOM 11139 H HB2  . PHE A 1 93  ? 10.564  -3.010  -3.989  1.00 0.00 ? 93  PHE A HB2  6  
ATOM 11140 H HB3  . PHE A 1 93  ? 10.210  -1.849  -2.720  1.00 0.00 ? 93  PHE A HB3  6  
ATOM 11141 H HD1  . PHE A 1 93  ? 11.952  -1.082  -1.219  1.00 0.00 ? 93  PHE A HD1  6  
ATOM 11142 H HD2  . PHE A 1 93  ? 12.800  -3.882  -4.309  1.00 0.00 ? 93  PHE A HD2  6  
ATOM 11143 H HE1  . PHE A 1 93  ? 14.364  -0.671  -0.917  1.00 0.00 ? 93  PHE A HE1  6  
ATOM 11144 H HE2  . PHE A 1 93  ? 15.207  -3.467  -4.030  1.00 0.00 ? 93  PHE A HE2  6  
ATOM 11145 H HZ   . PHE A 1 93  ? 15.992  -1.863  -2.337  1.00 0.00 ? 93  PHE A HZ   6  
ATOM 11146 N N    . THR A 1 94  ? 11.600  -4.551  -0.241  1.00 0.00 ? 94  THR A N    6  
ATOM 11147 C CA   . THR A 1 94  ? 12.169  -4.451  1.083   1.00 0.00 ? 94  THR A CA   6  
ATOM 11148 C C    . THR A 1 94  ? 13.554  -3.833  1.011   1.00 0.00 ? 94  THR A C    6  
ATOM 11149 O O    . THR A 1 94  ? 14.473  -4.410  0.428   1.00 0.00 ? 94  THR A O    6  
ATOM 11150 C CB   . THR A 1 94  ? 12.228  -5.827  1.754   1.00 0.00 ? 94  THR A CB   6  
ATOM 11151 O OG1  . THR A 1 94  ? 12.586  -6.827  0.786   1.00 0.00 ? 94  THR A OG1  6  
ATOM 11152 C CG2  . THR A 1 94  ? 10.889  -6.178  2.386   1.00 0.00 ? 94  THR A CG2  6  
ATOM 11153 H H    . THR A 1 94  ? 11.931  -5.240  -0.851  1.00 0.00 ? 94  THR A H    6  
ATOM 11154 H HA   . THR A 1 94  ? 11.528  -3.811  1.674   1.00 0.00 ? 94  THR A HA   6  
ATOM 11155 H HB   . THR A 1 94  ? 12.978  -5.800  2.528   1.00 0.00 ? 94  THR A HB   6  
ATOM 11156 H HG1  . THR A 1 94  ? 12.120  -7.649  0.988   1.00 0.00 ? 94  THR A HG1  6  
ATOM 11157 H HG21 . THR A 1 94  ? 10.626  -5.424  3.113   1.00 0.00 ? 94  THR A HG21 6  
ATOM 11158 H HG22 . THR A 1 94  ? 10.961  -7.138  2.872   1.00 0.00 ? 94  THR A HG22 6  
ATOM 11159 H HG23 . THR A 1 94  ? 10.130  -6.217  1.619   1.00 0.00 ? 94  THR A HG23 6  
ATOM 11160 N N    . PHE A 1 95  ? 13.689  -2.647  1.583   1.00 0.00 ? 95  PHE A N    6  
ATOM 11161 C CA   . PHE A 1 95  ? 14.926  -1.899  1.471   1.00 0.00 ? 95  PHE A CA   6  
ATOM 11162 C C    . PHE A 1 95  ? 15.928  -2.351  2.520   1.00 0.00 ? 95  PHE A C    6  
ATOM 11163 O O    . PHE A 1 95  ? 15.743  -2.123  3.720   1.00 0.00 ? 95  PHE A O    6  
ATOM 11164 C CB   . PHE A 1 95  ? 14.657  -0.397  1.591   1.00 0.00 ? 95  PHE A CB   6  
ATOM 11165 C CG   . PHE A 1 95  ? 15.836  0.461   1.218   1.00 0.00 ? 95  PHE A CG   6  
ATOM 11166 C CD1  . PHE A 1 95  ? 16.682  0.092   0.181   1.00 0.00 ? 95  PHE A CD1  6  
ATOM 11167 C CD2  . PHE A 1 95  ? 16.090  1.638   1.896   1.00 0.00 ? 95  PHE A CD2  6  
ATOM 11168 C CE1  . PHE A 1 95  ? 17.760  0.884   -0.167  1.00 0.00 ? 95  PHE A CE1  6  
ATOM 11169 C CE2  . PHE A 1 95  ? 17.167  2.433   1.553   1.00 0.00 ? 95  PHE A CE2  6  
ATOM 11170 C CZ   . PHE A 1 95  ? 18.004  2.055   0.520   1.00 0.00 ? 95  PHE A CZ   6  
ATOM 11171 H H    . PHE A 1 95  ? 12.944  -2.270  2.098   1.00 0.00 ? 95  PHE A H    6  
ATOM 11172 H HA   . PHE A 1 95  ? 15.339  -2.101  0.495   1.00 0.00 ? 95  PHE A HA   6  
ATOM 11173 H HB2  . PHE A 1 95  ? 13.835  -0.135  0.943   1.00 0.00 ? 95  PHE A HB2  6  
ATOM 11174 H HB3  . PHE A 1 95  ? 14.389  -0.168  2.612   1.00 0.00 ? 95  PHE A HB3  6  
ATOM 11175 H HD1  . PHE A 1 95  ? 16.493  -0.823  -0.359  1.00 0.00 ? 95  PHE A HD1  6  
ATOM 11176 H HD2  . PHE A 1 95  ? 15.439  1.933   2.705   1.00 0.00 ? 95  PHE A HD2  6  
ATOM 11177 H HE1  . PHE A 1 95  ? 18.412  0.586   -0.975  1.00 0.00 ? 95  PHE A HE1  6  
ATOM 11178 H HE2  . PHE A 1 95  ? 17.355  3.350   2.093   1.00 0.00 ? 95  PHE A HE2  6  
ATOM 11179 H HZ   . PHE A 1 95  ? 18.845  2.677   0.250   1.00 0.00 ? 95  PHE A HZ   6  
ATOM 11180 N N    . GLN A 1 96  ? 16.968  -3.021  2.056   1.00 0.00 ? 96  GLN A N    6  
ATOM 11181 C CA   . GLN A 1 96  ? 18.064  -3.417  2.916   1.00 0.00 ? 96  GLN A CA   6  
ATOM 11182 C C    . GLN A 1 96  ? 19.040  -2.268  3.054   1.00 0.00 ? 96  GLN A C    6  
ATOM 11183 O O    . GLN A 1 96  ? 19.538  -1.739  2.058   1.00 0.00 ? 96  GLN A O    6  
ATOM 11184 C CB   . GLN A 1 96  ? 18.777  -4.651  2.364   1.00 0.00 ? 96  GLN A CB   6  
ATOM 11185 C CG   . GLN A 1 96  ? 17.940  -5.916  2.415   1.00 0.00 ? 96  GLN A CG   6  
ATOM 11186 C CD   . GLN A 1 96  ? 18.671  -7.106  1.835   1.00 0.00 ? 96  GLN A CD   6  
ATOM 11187 O OE1  . GLN A 1 96  ? 18.571  -7.391  0.642   1.00 0.00 ? 96  GLN A OE1  6  
ATOM 11188 N NE2  . GLN A 1 96  ? 19.422  -7.800  2.674   1.00 0.00 ? 96  GLN A NE2  6  
ATOM 11189 H H    . GLN A 1 96  ? 17.005  -3.246  1.098   1.00 0.00 ? 96  GLN A H    6  
ATOM 11190 H HA   . GLN A 1 96  ? 17.657  -3.650  3.888   1.00 0.00 ? 96  GLN A HA   6  
ATOM 11191 H HB2  . GLN A 1 96  ? 19.052  -4.467  1.336   1.00 0.00 ? 96  GLN A HB2  6  
ATOM 11192 H HB3  . GLN A 1 96  ? 19.677  -4.818  2.942   1.00 0.00 ? 96  GLN A HB3  6  
ATOM 11193 H HG2  . GLN A 1 96  ? 17.694  -6.130  3.445   1.00 0.00 ? 96  GLN A HG2  6  
ATOM 11194 H HG3  . GLN A 1 96  ? 17.031  -5.754  1.854   1.00 0.00 ? 96  GLN A HG3  6  
ATOM 11195 H HE21 . GLN A 1 96  ? 19.463  -7.509  3.614   1.00 0.00 ? 96  GLN A HE21 6  
ATOM 11196 H HE22 . GLN A 1 96  ? 19.915  -8.572  2.325   1.00 0.00 ? 96  GLN A HE22 6  
ATOM 11197 N N    . ASN A 1 97  ? 19.295  -1.876  4.286   1.00 0.00 ? 97  ASN A N    6  
ATOM 11198 C CA   . ASN A 1 97  ? 20.167  -0.748  4.562   1.00 0.00 ? 97  ASN A CA   6  
ATOM 11199 C C    . ASN A 1 97  ? 21.593  -1.054  4.118   1.00 0.00 ? 97  ASN A C    6  
ATOM 11200 O O    . ASN A 1 97  ? 22.171  -2.069  4.516   1.00 0.00 ? 97  ASN A O    6  
ATOM 11201 C CB   . ASN A 1 97  ? 20.138  -0.412  6.049   1.00 0.00 ? 97  ASN A CB   6  
ATOM 11202 C CG   . ASN A 1 97  ? 20.833  0.895   6.349   1.00 0.00 ? 97  ASN A CG   6  
ATOM 11203 O OD1  . ASN A 1 97  ? 22.032  0.926   6.623   1.00 0.00 ? 97  ASN A OD1  6  
ATOM 11204 N ND2  . ASN A 1 97  ? 20.086  1.983   6.267   1.00 0.00 ? 97  ASN A ND2  6  
ATOM 11205 H H    . ASN A 1 97  ? 18.877  -2.357  5.034   1.00 0.00 ? 97  ASN A H    6  
ATOM 11206 H HA   . ASN A 1 97  ? 19.801  0.099   4.001   1.00 0.00 ? 97  ASN A HA   6  
ATOM 11207 H HB2  . ASN A 1 97  ? 19.112  -0.340  6.379   1.00 0.00 ? 97  ASN A HB2  6  
ATOM 11208 H HB3  . ASN A 1 97  ? 20.632  -1.198  6.597   1.00 0.00 ? 97  ASN A HB3  6  
ATOM 11209 H HD21 . ASN A 1 97  ? 19.132  1.876   6.016   1.00 0.00 ? 97  ASN A HD21 6  
ATOM 11210 H HD22 . ASN A 1 97  ? 20.501  2.848   6.457   1.00 0.00 ? 97  ASN A HD22 6  
ATOM 11211 N N    . PRO A 1 98  ? 22.170  -0.164  3.289   1.00 0.00 ? 98  PRO A N    6  
ATOM 11212 C CA   . PRO A 1 98  ? 23.476  -0.374  2.643   1.00 0.00 ? 98  PRO A CA   6  
ATOM 11213 C C    . PRO A 1 98  ? 24.609  -0.720  3.608   1.00 0.00 ? 98  PRO A C    6  
ATOM 11214 O O    . PRO A 1 98  ? 25.605  -1.322  3.205   1.00 0.00 ? 98  PRO A O    6  
ATOM 11215 C CB   . PRO A 1 98  ? 23.762  0.969   1.951   1.00 0.00 ? 98  PRO A CB   6  
ATOM 11216 C CG   . PRO A 1 98  ? 22.783  1.936   2.522   1.00 0.00 ? 98  PRO A CG   6  
ATOM 11217 C CD   . PRO A 1 98  ? 21.582  1.125   2.905   1.00 0.00 ? 98  PRO A CD   6  
ATOM 11218 H HA   . PRO A 1 98  ? 23.412  -1.148  1.891   1.00 0.00 ? 98  PRO A HA   6  
ATOM 11219 H HB2  . PRO A 1 98  ? 24.778  1.272   2.158   1.00 0.00 ? 98  PRO A HB2  6  
ATOM 11220 H HB3  . PRO A 1 98  ? 23.628  0.858   0.885   1.00 0.00 ? 98  PRO A HB3  6  
ATOM 11221 H HG2  . PRO A 1 98  ? 23.204  2.416   3.394   1.00 0.00 ? 98  PRO A HG2  6  
ATOM 11222 H HG3  . PRO A 1 98  ? 22.517  2.672   1.778   1.00 0.00 ? 98  PRO A HG3  6  
ATOM 11223 H HD2  . PRO A 1 98  ? 21.066  1.581   3.737   1.00 0.00 ? 98  PRO A HD2  6  
ATOM 11224 H HD3  . PRO A 1 98  ? 20.919  1.011   2.062   1.00 0.00 ? 98  PRO A HD3  6  
ATOM 11225 N N    . TYR A 1 99  ? 24.477  -0.336  4.871   1.00 0.00 ? 99  TYR A N    6  
ATOM 11226 C CA   . TYR A 1 99  ? 25.513  -0.619  5.852   1.00 0.00 ? 99  TYR A CA   6  
ATOM 11227 C C    . TYR A 1 99  ? 24.972  -1.382  7.050   1.00 0.00 ? 99  TYR A C    6  
ATOM 11228 O O    . TYR A 1 99  ? 25.500  -1.267  8.152   1.00 0.00 ? 99  TYR A O    6  
ATOM 11229 C CB   . TYR A 1 99  ? 26.200  0.667   6.307   1.00 0.00 ? 99  TYR A CB   6  
ATOM 11230 C CG   . TYR A 1 99  ? 25.269  1.832   6.546   1.00 0.00 ? 99  TYR A CG   6  
ATOM 11231 C CD1  . TYR A 1 99  ? 24.913  2.673   5.504   1.00 0.00 ? 99  TYR A CD1  6  
ATOM 11232 C CD2  . TYR A 1 99  ? 24.756  2.094   7.807   1.00 0.00 ? 99  TYR A CD2  6  
ATOM 11233 C CE1  . TYR A 1 99  ? 24.069  3.744   5.706   1.00 0.00 ? 99  TYR A CE1  6  
ATOM 11234 C CE2  . TYR A 1 99  ? 23.909  3.166   8.021   1.00 0.00 ? 99  TYR A CE2  6  
ATOM 11235 C CZ   . TYR A 1 99  ? 23.569  3.988   6.965   1.00 0.00 ? 99  TYR A CZ   6  
ATOM 11236 O OH   . TYR A 1 99  ? 22.725  5.059   7.166   1.00 0.00 ? 99  TYR A OH   6  
ATOM 11237 H H    . TYR A 1 99  ? 23.669  0.147   5.147   1.00 0.00 ? 99  TYR A H    6  
ATOM 11238 H HA   . TYR A 1 99  ? 26.250  -1.238  5.364   1.00 0.00 ? 99  TYR A HA   6  
ATOM 11239 H HB2  . TYR A 1 99  ? 26.728  0.476   7.229   1.00 0.00 ? 99  TYR A HB2  6  
ATOM 11240 H HB3  . TYR A 1 99  ? 26.903  0.955   5.555   1.00 0.00 ? 99  TYR A HB3  6  
ATOM 11241 H HD1  . TYR A 1 99  ? 25.305  2.477   4.517   1.00 0.00 ? 99  TYR A HD1  6  
ATOM 11242 H HD2  . TYR A 1 99  ? 25.024  1.447   8.628   1.00 0.00 ? 99  TYR A HD2  6  
ATOM 11243 H HE1  . TYR A 1 99  ? 23.807  4.388   4.879   1.00 0.00 ? 99  TYR A HE1  6  
ATOM 11244 H HE2  . TYR A 1 99  ? 23.518  3.356   9.008   1.00 0.00 ? 99  TYR A HE2  6  
ATOM 11245 H HH   . TYR A 1 99  ? 22.975  5.516   7.985   1.00 0.00 ? 99  TYR A HH   6  
ATOM 11246 N N    . SER A 1 100 ? 23.926  -2.159  6.838   1.00 0.00 ? 100 SER A N    6  
ATOM 11247 C CA   . SER A 1 100 ? 23.417  -3.001  7.903   1.00 0.00 ? 100 SER A CA   6  
ATOM 11248 C C    . SER A 1 100 ? 22.866  -4.318  7.350   1.00 0.00 ? 100 SER A C    6  
ATOM 11249 O O    . SER A 1 100 ? 22.817  -5.326  8.062   1.00 0.00 ? 100 SER A O    6  
ATOM 11250 C CB   . SER A 1 100 ? 22.341  -2.264  8.715   1.00 0.00 ? 100 SER A CB   6  
ATOM 11251 O OG   . SER A 1 100 ? 21.922  -3.029  9.836   1.00 0.00 ? 100 SER A OG   6  
ATOM 11252 H H    . SER A 1 100 ? 23.492  -2.163  5.959   1.00 0.00 ? 100 SER A H    6  
ATOM 11253 H HA   . SER A 1 100 ? 24.252  -3.217  8.551   1.00 0.00 ? 100 SER A HA   6  
ATOM 11254 H HB2  . SER A 1 100 ? 22.738  -1.324  9.066   1.00 0.00 ? 100 SER A HB2  6  
ATOM 11255 H HB3  . SER A 1 100 ? 21.485  -2.081  8.087   1.00 0.00 ? 100 SER A HB3  6  
ATOM 11256 H HG   . SER A 1 100 ? 21.184  -2.583  10.275  1.00 0.00 ? 100 SER A HG   6  
ATOM 11257 N N    . ASP A 1 101 ? 22.462  -4.305  6.072   1.00 0.00 ? 101 ASP A N    6  
ATOM 11258 C CA   . ASP A 1 101 ? 21.891  -5.477  5.389   1.00 0.00 ? 101 ASP A CA   6  
ATOM 11259 C C    . ASP A 1 101 ? 20.505  -5.839  5.913   1.00 0.00 ? 101 ASP A C    6  
ATOM 11260 O O    . ASP A 1 101 ? 19.832  -6.705  5.352   1.00 0.00 ? 101 ASP A O    6  
ATOM 11261 C CB   . ASP A 1 101 ? 22.816  -6.699  5.474   1.00 0.00 ? 101 ASP A CB   6  
ATOM 11262 C CG   . ASP A 1 101 ? 24.041  -6.561  4.595   1.00 0.00 ? 101 ASP A CG   6  
ATOM 11263 O OD1  . ASP A 1 101 ? 23.928  -6.778  3.369   1.00 0.00 ? 101 ASP A OD1  6  
ATOM 11264 O OD2  . ASP A 1 101 ? 25.124  -6.225  5.123   1.00 0.00 ? 101 ASP A OD2  6  
ATOM 11265 H H    . ASP A 1 101 ? 22.562  -3.478  5.550   1.00 0.00 ? 101 ASP A H    6  
ATOM 11266 H HA   . ASP A 1 101 ? 21.786  -5.210  4.347   1.00 0.00 ? 101 ASP A HA   6  
ATOM 11267 H HB2  . ASP A 1 101 ? 23.141  -6.823  6.495   1.00 0.00 ? 101 ASP A HB2  6  
ATOM 11268 H HB3  . ASP A 1 101 ? 22.268  -7.578  5.166   1.00 0.00 ? 101 ASP A HB3  6  
ATOM 11269 N N    . GLU A 1 102 ? 20.075  -5.178  6.978   1.00 0.00 ? 102 GLU A N    6  
ATOM 11270 C CA   . GLU A 1 102 ? 18.749  -5.399  7.528   1.00 0.00 ? 102 GLU A CA   6  
ATOM 11271 C C    . GLU A 1 102 ? 17.731  -4.585  6.745   1.00 0.00 ? 102 GLU A C    6  
ATOM 11272 O O    . GLU A 1 102 ? 18.098  -3.767  5.903   1.00 0.00 ? 102 GLU A O    6  
ATOM 11273 C CB   . GLU A 1 102 ? 18.705  -4.994  9.001   1.00 0.00 ? 102 GLU A CB   6  
ATOM 11274 C CG   . GLU A 1 102 ? 18.761  -3.492  9.216   1.00 0.00 ? 102 GLU A CG   6  
ATOM 11275 C CD   . GLU A 1 102 ? 18.448  -3.102  10.640  1.00 0.00 ? 102 GLU A CD   6  
ATOM 11276 O OE1  . GLU A 1 102 ? 17.296  -3.313  11.078  1.00 0.00 ? 102 GLU A OE1  6  
ATOM 11277 O OE2  . GLU A 1 102 ? 19.348  -2.575  11.325  1.00 0.00 ? 102 GLU A OE2  6  
ATOM 11278 H H    . GLU A 1 102 ? 20.662  -4.521  7.403   1.00 0.00 ? 102 GLU A H    6  
ATOM 11279 H HA   . GLU A 1 102 ? 18.514  -6.449  7.436   1.00 0.00 ? 102 GLU A HA   6  
ATOM 11280 H HB2  . GLU A 1 102 ? 17.791  -5.365  9.442   1.00 0.00 ? 102 GLU A HB2  6  
ATOM 11281 H HB3  . GLU A 1 102 ? 19.546  -5.440  9.511   1.00 0.00 ? 102 GLU A HB3  6  
ATOM 11282 H HG2  . GLU A 1 102 ? 19.754  -3.144  8.974   1.00 0.00 ? 102 GLU A HG2  6  
ATOM 11283 H HG3  . GLU A 1 102 ? 18.044  -3.017  8.562   1.00 0.00 ? 102 GLU A HG3  6  
ATOM 11284 N N    . ILE A 1 103 ? 16.461  -4.787  7.038   1.00 0.00 ? 103 ILE A N    6  
ATOM 11285 C CA   . ILE A 1 103 ? 15.410  -4.051  6.364   1.00 0.00 ? 103 ILE A CA   6  
ATOM 11286 C C    . ILE A 1 103 ? 14.888  -2.952  7.263   1.00 0.00 ? 103 ILE A C    6  
ATOM 11287 O O    . ILE A 1 103 ? 14.347  -3.209  8.342   1.00 0.00 ? 103 ILE A O    6  
ATOM 11288 C CB   . ILE A 1 103 ? 14.249  -4.963  5.937   1.00 0.00 ? 103 ILE A CB   6  
ATOM 11289 C CG1  . ILE A 1 103 ? 14.747  -5.967  4.910   1.00 0.00 ? 103 ILE A CG1  6  
ATOM 11290 C CG2  . ILE A 1 103 ? 13.094  -4.144  5.366   1.00 0.00 ? 103 ILE A CG2  6  
ATOM 11291 C CD1  . ILE A 1 103 ? 13.717  -6.998  4.533   1.00 0.00 ? 103 ILE A CD1  6  
ATOM 11292 H H    . ILE A 1 103 ? 16.223  -5.419  7.754   1.00 0.00 ? 103 ILE A H    6  
ATOM 11293 H HA   . ILE A 1 103 ? 15.834  -3.602  5.477   1.00 0.00 ? 103 ILE A HA   6  
ATOM 11294 H HB   . ILE A 1 103 ? 13.891  -5.493  6.808   1.00 0.00 ? 103 ILE A HB   6  
ATOM 11295 H HG12 . ILE A 1 103 ? 15.035  -5.441  4.011   1.00 0.00 ? 103 ILE A HG12 6  
ATOM 11296 H HG13 . ILE A 1 103 ? 15.604  -6.479  5.311   1.00 0.00 ? 103 ILE A HG13 6  
ATOM 11297 H HG21 . ILE A 1 103 ? 12.295  -4.807  5.067   1.00 0.00 ? 103 ILE A HG21 6  
ATOM 11298 H HG22 . ILE A 1 103 ? 13.438  -3.587  4.508   1.00 0.00 ? 103 ILE A HG22 6  
ATOM 11299 H HG23 . ILE A 1 103 ? 12.732  -3.459  6.119   1.00 0.00 ? 103 ILE A HG23 6  
ATOM 11300 H HD11 . ILE A 1 103 ? 14.134  -7.673  3.803   1.00 0.00 ? 103 ILE A HD11 6  
ATOM 11301 H HD12 . ILE A 1 103 ? 12.855  -6.499  4.112   1.00 0.00 ? 103 ILE A HD12 6  
ATOM 11302 H HD13 . ILE A 1 103 ? 13.421  -7.550  5.411   1.00 0.00 ? 103 ILE A HD13 6  
ATOM 11303 N N    . GLU A 1 104 ? 15.077  -1.730  6.821   1.00 0.00 ? 104 GLU A N    6  
ATOM 11304 C CA   . GLU A 1 104 ? 14.633  -0.577  7.570   1.00 0.00 ? 104 GLU A CA   6  
ATOM 11305 C C    . GLU A 1 104 ? 13.125  -0.403  7.454   1.00 0.00 ? 104 GLU A C    6  
ATOM 11306 O O    . GLU A 1 104 ? 12.446  -0.101  8.436   1.00 0.00 ? 104 GLU A O    6  
ATOM 11307 C CB   . GLU A 1 104 ? 15.372  0.665   7.096   1.00 0.00 ? 104 GLU A CB   6  
ATOM 11308 C CG   . GLU A 1 104 ? 15.432  0.795   5.590   1.00 0.00 ? 104 GLU A CG   6  
ATOM 11309 C CD   . GLU A 1 104 ? 16.492  1.785   5.152   1.00 0.00 ? 104 GLU A CD   6  
ATOM 11310 O OE1  . GLU A 1 104 ? 17.672  1.397   5.051   1.00 0.00 ? 104 GLU A OE1  6  
ATOM 11311 O OE2  . GLU A 1 104 ? 16.148  2.962   4.928   1.00 0.00 ? 104 GLU A OE2  6  
ATOM 11312 H H    . GLU A 1 104 ? 15.534  -1.599  5.962   1.00 0.00 ? 104 GLU A H    6  
ATOM 11313 H HA   . GLU A 1 104 ? 14.881  -0.751  8.595   1.00 0.00 ? 104 GLU A HA   6  
ATOM 11314 H HB2  . GLU A 1 104 ? 14.869  1.533   7.488   1.00 0.00 ? 104 GLU A HB2  6  
ATOM 11315 H HB3  . GLU A 1 104 ? 16.382  0.639   7.476   1.00 0.00 ? 104 GLU A HB3  6  
ATOM 11316 H HG2  . GLU A 1 104 ? 15.646  -0.178  5.165   1.00 0.00 ? 104 GLU A HG2  6  
ATOM 11317 H HG3  . GLU A 1 104 ? 14.472  1.138   5.235   1.00 0.00 ? 104 GLU A HG3  6  
ATOM 11318 N N    . TYR A 1 105 ? 12.610  -0.609  6.253   1.00 0.00 ? 105 TYR A N    6  
ATOM 11319 C CA   . TYR A 1 105 ? 11.179  -0.501  6.001   1.00 0.00 ? 105 TYR A CA   6  
ATOM 11320 C C    . TYR A 1 105 ? 10.844  -1.028  4.616   1.00 0.00 ? 105 TYR A C    6  
ATOM 11321 O O    . TYR A 1 105 ? 11.729  -1.440  3.862   1.00 0.00 ? 105 TYR A O    6  
ATOM 11322 C CB   . TYR A 1 105 ? 10.694  0.951   6.153   1.00 0.00 ? 105 TYR A CB   6  
ATOM 11323 C CG   . TYR A 1 105 ? 11.485  1.978   5.366   1.00 0.00 ? 105 TYR A CG   6  
ATOM 11324 C CD1  . TYR A 1 105 ? 11.327  2.110   3.993   1.00 0.00 ? 105 TYR A CD1  6  
ATOM 11325 C CD2  . TYR A 1 105 ? 12.387  2.822   6.004   1.00 0.00 ? 105 TYR A CD2  6  
ATOM 11326 C CE1  . TYR A 1 105 ? 12.045  3.051   3.279   1.00 0.00 ? 105 TYR A CE1  6  
ATOM 11327 C CE2  . TYR A 1 105 ? 13.106  3.767   5.298   1.00 0.00 ? 105 TYR A CE2  6  
ATOM 11328 C CZ   . TYR A 1 105 ? 12.933  3.875   3.935   1.00 0.00 ? 105 TYR A CZ   6  
ATOM 11329 O OH   . TYR A 1 105 ? 13.643  4.816   3.225   1.00 0.00 ? 105 TYR A OH   6  
ATOM 11330 H H    . TYR A 1 105 ? 13.213  -0.828  5.504   1.00 0.00 ? 105 TYR A H    6  
ATOM 11331 H HA   . TYR A 1 105 ? 10.674  -1.114  6.731   1.00 0.00 ? 105 TYR A HA   6  
ATOM 11332 H HB2  . TYR A 1 105 ? 9.668   1.013   5.824   1.00 0.00 ? 105 TYR A HB2  6  
ATOM 11333 H HB3  . TYR A 1 105 ? 10.743  1.227   7.196   1.00 0.00 ? 105 TYR A HB3  6  
ATOM 11334 H HD1  . TYR A 1 105 ? 10.631  1.464   3.478   1.00 0.00 ? 105 TYR A HD1  6  
ATOM 11335 H HD2  . TYR A 1 105 ? 12.523  2.732   7.072   1.00 0.00 ? 105 TYR A HD2  6  
ATOM 11336 H HE1  . TYR A 1 105 ? 11.910  3.136   2.210   1.00 0.00 ? 105 TYR A HE1  6  
ATOM 11337 H HE2  . TYR A 1 105 ? 13.803  4.410   5.813   1.00 0.00 ? 105 TYR A HE2  6  
ATOM 11338 H HH   . TYR A 1 105 ? 14.574  4.785   3.492   1.00 0.00 ? 105 TYR A HH   6  
ATOM 11339 N N    . ILE A 1 106 ? 9.564   -1.015  4.286   1.00 0.00 ? 106 ILE A N    6  
ATOM 11340 C CA   . ILE A 1 106 ? 9.101   -1.502  3.002   1.00 0.00 ? 106 ILE A CA   6  
ATOM 11341 C C    . ILE A 1 106 ? 8.756   -0.328  2.100   1.00 0.00 ? 106 ILE A C    6  
ATOM 11342 O O    . ILE A 1 106 ? 8.139   0.641   2.547   1.00 0.00 ? 106 ILE A O    6  
ATOM 11343 C CB   . ILE A 1 106 ? 7.856   -2.404  3.159   1.00 0.00 ? 106 ILE A CB   6  
ATOM 11344 C CG1  . ILE A 1 106 ? 8.146   -3.547  4.134   1.00 0.00 ? 106 ILE A CG1  6  
ATOM 11345 C CG2  . ILE A 1 106 ? 7.411   -2.957  1.808   1.00 0.00 ? 106 ILE A CG2  6  
ATOM 11346 C CD1  . ILE A 1 106 ? 6.957   -4.455  4.384   1.00 0.00 ? 106 ILE A CD1  6  
ATOM 11347 H H    . ILE A 1 106 ? 8.909   -0.644  4.920   1.00 0.00 ? 106 ILE A H    6  
ATOM 11348 H HA   . ILE A 1 106 ? 9.896   -2.081  2.550   1.00 0.00 ? 106 ILE A HA   6  
ATOM 11349 H HB   . ILE A 1 106 ? 7.049   -1.796  3.551   1.00 0.00 ? 106 ILE A HB   6  
ATOM 11350 H HG12 . ILE A 1 106 ? 8.946   -4.153  3.740   1.00 0.00 ? 106 ILE A HG12 6  
ATOM 11351 H HG13 . ILE A 1 106 ? 8.451   -3.131  5.085   1.00 0.00 ? 106 ILE A HG13 6  
ATOM 11352 H HG21 . ILE A 1 106 ? 8.197   -3.571  1.396   1.00 0.00 ? 106 ILE A HG21 6  
ATOM 11353 H HG22 . ILE A 1 106 ? 7.202   -2.139  1.136   1.00 0.00 ? 106 ILE A HG22 6  
ATOM 11354 H HG23 . ILE A 1 106 ? 6.520   -3.552  1.941   1.00 0.00 ? 106 ILE A HG23 6  
ATOM 11355 H HD11 . ILE A 1 106 ? 6.139   -3.874  4.786   1.00 0.00 ? 106 ILE A HD11 6  
ATOM 11356 H HD12 . ILE A 1 106 ? 7.235   -5.222  5.092   1.00 0.00 ? 106 ILE A HD12 6  
ATOM 11357 H HD13 . ILE A 1 106 ? 6.653   -4.914  3.456   1.00 0.00 ? 106 ILE A HD13 6  
ATOM 11358 N N    . ILE A 1 107 ? 9.119   -0.432  0.834   1.00 0.00 ? 107 ILE A N    6  
ATOM 11359 C CA   . ILE A 1 107 ? 8.824   0.608   -0.135  1.00 0.00 ? 107 ILE A CA   6  
ATOM 11360 C C    . ILE A 1 107 ? 7.881   0.025   -1.170  1.00 0.00 ? 107 ILE A C    6  
ATOM 11361 O O    . ILE A 1 107 ? 8.281   -0.809  -1.981  1.00 0.00 ? 107 ILE A O    6  
ATOM 11362 C CB   . ILE A 1 107 ? 10.096  1.136   -0.838  1.00 0.00 ? 107 ILE A CB   6  
ATOM 11363 C CG1  . ILE A 1 107 ? 11.108  1.640   0.193   1.00 0.00 ? 107 ILE A CG1  6  
ATOM 11364 C CG2  . ILE A 1 107 ? 9.736   2.245   -1.818  1.00 0.00 ? 107 ILE A CG2  6  
ATOM 11365 C CD1  . ILE A 1 107 ? 12.420  2.094   -0.413  1.00 0.00 ? 107 ILE A CD1  6  
ATOM 11366 H H    . ILE A 1 107 ? 9.517   -1.272  0.508   1.00 0.00 ? 107 ILE A H    6  
ATOM 11367 H HA   . ILE A 1 107 ? 8.337   1.426   0.377   1.00 0.00 ? 107 ILE A HA   6  
ATOM 11368 H HB   . ILE A 1 107 ? 10.533  0.325   -1.396  1.00 0.00 ? 107 ILE A HB   6  
ATOM 11369 H HG12 . ILE A 1 107 ? 10.680  2.478   0.725   1.00 0.00 ? 107 ILE A HG12 6  
ATOM 11370 H HG13 . ILE A 1 107 ? 11.321  0.847   0.895   1.00 0.00 ? 107 ILE A HG13 6  
ATOM 11371 H HG21 . ILE A 1 107 ? 9.243   3.048   -1.289  1.00 0.00 ? 107 ILE A HG21 6  
ATOM 11372 H HG22 . ILE A 1 107 ? 9.072   1.855   -2.576  1.00 0.00 ? 107 ILE A HG22 6  
ATOM 11373 H HG23 . ILE A 1 107 ? 10.634  2.622   -2.285  1.00 0.00 ? 107 ILE A HG23 6  
ATOM 11374 H HD11 . ILE A 1 107 ? 12.237  2.907   -1.100  1.00 0.00 ? 107 ILE A HD11 6  
ATOM 11375 H HD12 . ILE A 1 107 ? 12.872  1.270   -0.941  1.00 0.00 ? 107 ILE A HD12 6  
ATOM 11376 H HD13 . ILE A 1 107 ? 13.083  2.428   0.371   1.00 0.00 ? 107 ILE A HD13 6  
ATOM 11377 N N    . CYS A 1 108 ? 6.627   0.423   -1.118  1.00 0.00 ? 108 CYS A N    6  
ATOM 11378 C CA   . CYS A 1 108 ? 5.623   -0.173  -1.972  1.00 0.00 ? 108 CYS A CA   6  
ATOM 11379 C C    . CYS A 1 108 ? 5.062   0.837   -2.960  1.00 0.00 ? 108 CYS A C    6  
ATOM 11380 O O    . CYS A 1 108 ? 4.820   1.994   -2.615  1.00 0.00 ? 108 CYS A O    6  
ATOM 11381 C CB   . CYS A 1 108 ? 4.495   -0.762  -1.120  1.00 0.00 ? 108 CYS A CB   6  
ATOM 11382 S SG   . CYS A 1 108 ? 3.628   0.446   -0.087  1.00 0.00 ? 108 CYS A SG   6  
ATOM 11383 H H    . CYS A 1 108 ? 6.373   1.147   -0.503  1.00 0.00 ? 108 CYS A H    6  
ATOM 11384 H HA   . CYS A 1 108 ? 6.093   -0.972  -2.524  1.00 0.00 ? 108 CYS A HA   6  
ATOM 11385 H HB2  . CYS A 1 108 ? 3.764   -1.218  -1.771  1.00 0.00 ? 108 CYS A HB2  6  
ATOM 11386 H HB3  . CYS A 1 108 ? 4.906   -1.517  -0.467  1.00 0.00 ? 108 CYS A HB3  6  
ATOM 11387 H HG   . CYS A 1 108 ? 2.883   1.202   -0.890  1.00 0.00 ? 108 CYS A HG   6  
ATOM 11388 N N    . THR A 1 109 ? 4.885   0.401   -4.194  1.00 0.00 ? 109 THR A N    6  
ATOM 11389 C CA   . THR A 1 109 ? 4.178   1.194   -5.175  1.00 0.00 ? 109 THR A CA   6  
ATOM 11390 C C    . THR A 1 109 ? 2.727   0.734   -5.225  1.00 0.00 ? 109 THR A C    6  
ATOM 11391 O O    . THR A 1 109 ? 2.444   -0.450  -5.423  1.00 0.00 ? 109 THR A O    6  
ATOM 11392 C CB   . THR A 1 109 ? 4.815   1.082   -6.574  1.00 0.00 ? 109 THR A CB   6  
ATOM 11393 O OG1  . THR A 1 109 ? 6.227   1.325   -6.496  1.00 0.00 ? 109 THR A OG1  6  
ATOM 11394 C CG2  . THR A 1 109 ? 4.184   2.078   -7.536  1.00 0.00 ? 109 THR A CG2  6  
ATOM 11395 H H    . THR A 1 109 ? 5.239   -0.478  -4.450  1.00 0.00 ? 109 THR A H    6  
ATOM 11396 H HA   . THR A 1 109 ? 4.210   2.228   -4.860  1.00 0.00 ? 109 THR A HA   6  
ATOM 11397 H HB   . THR A 1 109 ? 4.647   0.083   -6.952  1.00 0.00 ? 109 THR A HB   6  
ATOM 11398 H HG1  . THR A 1 109 ? 6.699   0.573   -6.886  1.00 0.00 ? 109 THR A HG1  6  
ATOM 11399 H HG21 . THR A 1 109 ? 3.126   1.876   -7.621  1.00 0.00 ? 109 THR A HG21 6  
ATOM 11400 H HG22 . THR A 1 109 ? 4.648   1.987   -8.506  1.00 0.00 ? 109 THR A HG22 6  
ATOM 11401 H HG23 . THR A 1 109 ? 4.328   3.080   -7.159  1.00 0.00 ? 109 THR A HG23 6  
ATOM 11402 N N    . ASN A 1 110 ? 1.815   1.667   -5.044  1.00 0.00 ? 110 ASN A N    6  
ATOM 11403 C CA   . ASN A 1 110 ? 0.407   1.342   -4.950  1.00 0.00 ? 110 ASN A CA   6  
ATOM 11404 C C    . ASN A 1 110 ? -0.300  1.755   -6.230  1.00 0.00 ? 110 ASN A C    6  
ATOM 11405 O O    . ASN A 1 110 ? -0.431  2.944   -6.529  1.00 0.00 ? 110 ASN A O    6  
ATOM 11406 C CB   . ASN A 1 110 ? -0.213  2.031   -3.734  1.00 0.00 ? 110 ASN A CB   6  
ATOM 11407 C CG   . ASN A 1 110 ? 0.303   1.478   -2.416  1.00 0.00 ? 110 ASN A CG   6  
ATOM 11408 O OD1  . ASN A 1 110 ? 1.312   1.938   -1.880  1.00 0.00 ? 110 ASN A OD1  6  
ATOM 11409 N ND2  . ASN A 1 110 ? -0.389  0.483   -1.883  1.00 0.00 ? 110 ASN A ND2  6  
ATOM 11410 H H    . ASN A 1 110 ? 2.098   2.611   -5.022  1.00 0.00 ? 110 ASN A H    6  
ATOM 11411 H HA   . ASN A 1 110 ? 0.320   0.271   -4.833  1.00 0.00 ? 110 ASN A HA   6  
ATOM 11412 H HB2  . ASN A 1 110 ? 0.014   3.087   -3.772  1.00 0.00 ? 110 ASN A HB2  6  
ATOM 11413 H HB3  . ASN A 1 110 ? -1.284  1.898   -3.759  1.00 0.00 ? 110 ASN A HB3  6  
ATOM 11414 H HD21 . ASN A 1 110 ? -1.182  0.163   -2.360  1.00 0.00 ? 110 ASN A HD21 6  
ATOM 11415 H HD22 . ASN A 1 110 ? -0.079  0.108   -1.034  1.00 0.00 ? 110 ASN A HD22 6  
ATOM 11416 N N    . THR A 1 111 ? -0.742  0.769   -6.995  1.00 0.00 ? 111 THR A N    6  
ATOM 11417 C CA   . THR A 1 111 ? -1.316  1.006   -8.294  1.00 0.00 ? 111 THR A CA   6  
ATOM 11418 C C    . THR A 1 111 ? -2.764  0.553   -8.320  1.00 0.00 ? 111 THR A C    6  
ATOM 11419 O O    . THR A 1 111 ? -3.083  -0.583  -7.966  1.00 0.00 ? 111 THR A O    6  
ATOM 11420 C CB   . THR A 1 111 ? -0.525  0.253   -9.382  1.00 0.00 ? 111 THR A CB   6  
ATOM 11421 O OG1  . THR A 1 111 ? 0.870   0.569   -9.276  1.00 0.00 ? 111 THR A OG1  6  
ATOM 11422 C CG2  . THR A 1 111 ? -1.027  0.615   -10.771 1.00 0.00 ? 111 THR A CG2  6  
ATOM 11423 H H    . THR A 1 111 ? -0.698  -0.150  -6.675  1.00 0.00 ? 111 THR A H    6  
ATOM 11424 H HA   . THR A 1 111 ? -1.265  2.064   -8.502  1.00 0.00 ? 111 THR A HA   6  
ATOM 11425 H HB   . THR A 1 111 ? -0.658  -0.811  -9.232  1.00 0.00 ? 111 THR A HB   6  
ATOM 11426 H HG1  . THR A 1 111 ? 1.030   1.023   -8.440  1.00 0.00 ? 111 THR A HG1  6  
ATOM 11427 H HG21 . THR A 1 111 ? -0.490  0.039   -11.511 1.00 0.00 ? 111 THR A HG21 6  
ATOM 11428 H HG22 . THR A 1 111 ? -0.864  1.668   -10.947 1.00 0.00 ? 111 THR A HG22 6  
ATOM 11429 H HG23 . THR A 1 111 ? -2.083  0.397   -10.840 1.00 0.00 ? 111 THR A HG23 6  
ATOM 11430 N N    . ASN A 1 112 ? -3.633  1.450   -8.727  1.00 0.00 ? 112 ASN A N    6  
ATOM 11431 C CA   . ASN A 1 112 ? -5.040  1.146   -8.853  1.00 0.00 ? 112 ASN A CA   6  
ATOM 11432 C C    . ASN A 1 112 ? -5.304  0.498   -10.206 1.00 0.00 ? 112 ASN A C    6  
ATOM 11433 O O    . ASN A 1 112 ? -5.119  1.121   -11.251 1.00 0.00 ? 112 ASN A O    6  
ATOM 11434 C CB   . ASN A 1 112 ? -5.845  2.427   -8.689  1.00 0.00 ? 112 ASN A CB   6  
ATOM 11435 C CG   . ASN A 1 112 ? -7.271  2.299   -9.192  1.00 0.00 ? 112 ASN A CG   6  
ATOM 11436 O OD1  . ASN A 1 112 ? -7.587  2.672   -10.319 1.00 0.00 ? 112 ASN A OD1  6  
ATOM 11437 N ND2  . ASN A 1 112 ? -8.137  1.745   -8.361  1.00 0.00 ? 112 ASN A ND2  6  
ATOM 11438 H H    . ASN A 1 112 ? -3.312  2.342   -8.983  1.00 0.00 ? 112 ASN A H    6  
ATOM 11439 H HA   . ASN A 1 112 ? -5.307  0.450   -8.065  1.00 0.00 ? 112 ASN A HA   6  
ATOM 11440 H HB2  . ASN A 1 112 ? -5.878  2.687   -7.640  1.00 0.00 ? 112 ASN A HB2  6  
ATOM 11441 H HB3  . ASN A 1 112 ? -5.344  3.216   -9.231  1.00 0.00 ? 112 ASN A HB3  6  
ATOM 11442 H HD21 . ASN A 1 112 ? -7.813  1.455   -7.484  1.00 0.00 ? 112 ASN A HD21 6  
ATOM 11443 H HD22 . ASN A 1 112 ? -9.065  1.644   -8.659  1.00 0.00 ? 112 ASN A HD22 6  
ATOM 11444 N N    . VAL A 1 113 ? -5.714  -0.758  -10.180 1.00 0.00 ? 113 VAL A N    6  
ATOM 11445 C CA   . VAL A 1 113 ? -5.885  -1.536  -11.397 1.00 0.00 ? 113 VAL A CA   6  
ATOM 11446 C C    . VAL A 1 113 ? -7.318  -1.464  -11.903 1.00 0.00 ? 113 VAL A C    6  
ATOM 11447 O O    . VAL A 1 113 ? -7.571  -1.146  -13.064 1.00 0.00 ? 113 VAL A O    6  
ATOM 11448 C CB   . VAL A 1 113 ? -5.541  -3.017  -11.152 1.00 0.00 ? 113 VAL A CB   6  
ATOM 11449 C CG1  . VAL A 1 113 ? -5.561  -3.791  -12.458 1.00 0.00 ? 113 VAL A CG1  6  
ATOM 11450 C CG2  . VAL A 1 113 ? -4.193  -3.154  -10.459 1.00 0.00 ? 113 VAL A CG2  6  
ATOM 11451 H H    . VAL A 1 113 ? -5.913  -1.182  -9.316  1.00 0.00 ? 113 VAL A H    6  
ATOM 11452 H HA   . VAL A 1 113 ? -5.217  -1.147  -12.150 1.00 0.00 ? 113 VAL A HA   6  
ATOM 11453 H HB   . VAL A 1 113 ? -6.304  -3.433  -10.506 1.00 0.00 ? 113 VAL A HB   6  
ATOM 11454 H HG11 . VAL A 1 113 ? -5.448  -4.843  -12.254 1.00 0.00 ? 113 VAL A HG11 6  
ATOM 11455 H HG12 . VAL A 1 113 ? -4.753  -3.454  -13.089 1.00 0.00 ? 113 VAL A HG12 6  
ATOM 11456 H HG13 . VAL A 1 113 ? -6.502  -3.617  -12.956 1.00 0.00 ? 113 VAL A HG13 6  
ATOM 11457 H HG21 . VAL A 1 113 ? -3.419  -2.752  -11.096 1.00 0.00 ? 113 VAL A HG21 6  
ATOM 11458 H HG22 . VAL A 1 113 ? -3.993  -4.195  -10.261 1.00 0.00 ? 113 VAL A HG22 6  
ATOM 11459 H HG23 . VAL A 1 113 ? -4.213  -2.608  -9.527  1.00 0.00 ? 113 VAL A HG23 6  
ATOM 11460 N N    . LYS A 1 114 ? -8.246  -1.756  -11.008 1.00 0.00 ? 114 LYS A N    6  
ATOM 11461 C CA   . LYS A 1 114 ? -9.657  -1.867  -11.353 1.00 0.00 ? 114 LYS A CA   6  
ATOM 11462 C C    . LYS A 1 114 ? -10.520 -1.203  -10.292 1.00 0.00 ? 114 LYS A C    6  
ATOM 11463 O O    . LYS A 1 114 ? -10.018 -0.640  -9.318  1.00 0.00 ? 114 LYS A O    6  
ATOM 11464 C CB   . LYS A 1 114 ? -10.068 -3.338  -11.480 1.00 0.00 ? 114 LYS A CB   6  
ATOM 11465 C CG   . LYS A 1 114 ? -9.290  -4.118  -12.526 1.00 0.00 ? 114 LYS A CG   6  
ATOM 11466 C CD   . LYS A 1 114 ? -9.678  -5.588  -12.541 1.00 0.00 ? 114 LYS A CD   6  
ATOM 11467 C CE   . LYS A 1 114 ? -11.133 -5.796  -12.945 1.00 0.00 ? 114 LYS A CE   6  
ATOM 11468 N NZ   . LYS A 1 114 ? -11.397 -5.350  -14.342 1.00 0.00 ? 114 LYS A NZ   6  
ATOM 11469 H H    . LYS A 1 114 ? -7.978  -1.848  -10.073 1.00 0.00 ? 114 LYS A H    6  
ATOM 11470 H HA   . LYS A 1 114 ? -9.813  -1.370  -12.299 1.00 0.00 ? 114 LYS A HA   6  
ATOM 11471 H HB2  . LYS A 1 114 ? -9.923  -3.820  -10.525 1.00 0.00 ? 114 LYS A HB2  6  
ATOM 11472 H HB3  . LYS A 1 114 ? -11.117 -3.383  -11.736 1.00 0.00 ? 114 LYS A HB3  6  
ATOM 11473 H HG2  . LYS A 1 114 ? -9.490  -3.696  -13.500 1.00 0.00 ? 114 LYS A HG2  6  
ATOM 11474 H HG3  . LYS A 1 114 ? -8.238  -4.035  -12.306 1.00 0.00 ? 114 LYS A HG3  6  
ATOM 11475 H HD2  . LYS A 1 114 ? -9.046  -6.106  -13.245 1.00 0.00 ? 114 LYS A HD2  6  
ATOM 11476 H HD3  . LYS A 1 114 ? -9.527  -5.994  -11.553 1.00 0.00 ? 114 LYS A HD3  6  
ATOM 11477 H HE2  . LYS A 1 114 ? -11.370 -6.847  -12.861 1.00 0.00 ? 114 LYS A HE2  6  
ATOM 11478 H HE3  . LYS A 1 114 ? -11.764 -5.234  -12.273 1.00 0.00 ? 114 LYS A HE3  6  
ATOM 11479 H HZ1  . LYS A 1 114 ? -11.164 -4.339  -14.451 1.00 0.00 ? 114 LYS A HZ1  6  
ATOM 11480 H HZ2  . LYS A 1 114 ? -12.404 -5.487  -14.577 1.00 0.00 ? 114 LYS A HZ2  6  
ATOM 11481 H HZ3  . LYS A 1 114 ? -10.819 -5.904  -15.013 1.00 0.00 ? 114 LYS A HZ3  6  
ATOM 11482 N N    . ASN A 1 115 ? -11.821 -1.296  -10.491 1.00 0.00 ? 115 ASN A N    6  
ATOM 11483 C CA   . ASN A 1 115 ? -12.799 -0.721  -9.579  1.00 0.00 ? 115 ASN A CA   6  
ATOM 11484 C C    . ASN A 1 115 ? -13.771 -1.788  -9.094  1.00 0.00 ? 115 ASN A C    6  
ATOM 11485 O O    . ASN A 1 115 ? -14.267 -1.716  -7.969  1.00 0.00 ? 115 ASN A O    6  
ATOM 11486 C CB   . ASN A 1 115 ? -13.549 0.417   -10.273 1.00 0.00 ? 115 ASN A CB   6  
ATOM 11487 C CG   . ASN A 1 115 ? -14.821 0.832   -9.549  1.00 0.00 ? 115 ASN A CG   6  
ATOM 11488 O OD1  . ASN A 1 115 ? -15.910 0.345   -9.861  1.00 0.00 ? 115 ASN A OD1  6  
ATOM 11489 N ND2  . ASN A 1 115 ? -14.693 1.730   -8.582  1.00 0.00 ? 115 ASN A ND2  6  
ATOM 11490 H H    . ASN A 1 115 ? -12.139 -1.774  -11.288 1.00 0.00 ? 115 ASN A H    6  
ATOM 11491 H HA   . ASN A 1 115 ? -12.266 -0.324  -8.729  1.00 0.00 ? 115 ASN A HA   6  
ATOM 11492 H HB2  . ASN A 1 115 ? -12.897 1.271   -10.335 1.00 0.00 ? 115 ASN A HB2  6  
ATOM 11493 H HB3  . ASN A 1 115 ? -13.814 0.102   -11.273 1.00 0.00 ? 115 ASN A HB3  6  
ATOM 11494 H HD21 . ASN A 1 115 ? -13.801 2.074   -8.384  1.00 0.00 ? 115 ASN A HD21 6  
ATOM 11495 H HD22 . ASN A 1 115 ? -15.507 2.008   -8.096  1.00 0.00 ? 115 ASN A HD22 6  
ATOM 11496 N N    . SER A 1 116 ? -14.018 -2.781  -9.952  1.00 0.00 ? 116 SER A N    6  
ATOM 11497 C CA   . SER A 1 116 ? -14.924 -3.890  -9.649  1.00 0.00 ? 116 SER A CA   6  
ATOM 11498 C C    . SER A 1 116 ? -16.379 -3.428  -9.689  1.00 0.00 ? 116 SER A C    6  
ATOM 11499 O O    . SER A 1 116 ? -17.124 -3.772  -10.614 1.00 0.00 ? 116 SER A O    6  
ATOM 11500 C CB   . SER A 1 116 ? -14.586 -4.519  -8.287  1.00 0.00 ? 116 SER A CB   6  
ATOM 11501 O OG   . SER A 1 116 ? -15.453 -5.599  -7.983  1.00 0.00 ? 116 SER A OG   6  
ATOM 11502 H H    . SER A 1 116 ? -13.585 -2.762  -10.833 1.00 0.00 ? 116 SER A H    6  
ATOM 11503 H HA   . SER A 1 116 ? -14.786 -4.636  -10.417 1.00 0.00 ? 116 SER A HA   6  
ATOM 11504 H HB2  . SER A 1 116 ? -13.570 -4.886  -8.305  1.00 0.00 ? 116 SER A HB2  6  
ATOM 11505 H HB3  . SER A 1 116 ? -14.682 -3.769  -7.515  1.00 0.00 ? 116 SER A HB3  6  
ATOM 11506 H HG   . SER A 1 116 ? -15.937 -5.396  -7.169  1.00 0.00 ? 116 SER A HG   6  
ATOM 11507 N N    . SER A 1 117 ? -16.778 -2.645  -8.697  1.00 0.00 ? 117 SER A N    6  
ATOM 11508 C CA   . SER A 1 117 ? -18.141 -2.149  -8.597  1.00 0.00 ? 117 SER A CA   6  
ATOM 11509 C C    . SER A 1 117 ? -18.170 -0.885  -7.745  1.00 0.00 ? 117 SER A C    6  
ATOM 11510 O O    . SER A 1 117 ? -17.313 -0.708  -6.874  1.00 0.00 ? 117 SER A O    6  
ATOM 11511 C CB   . SER A 1 117 ? -19.057 -3.214  -7.982  1.00 0.00 ? 117 SER A CB   6  
ATOM 11512 O OG   . SER A 1 117 ? -19.007 -4.421  -8.730  1.00 0.00 ? 117 SER A OG   6  
ATOM 11513 H H    . SER A 1 117 ? -16.125 -2.374  -8.012  1.00 0.00 ? 117 SER A H    6  
ATOM 11514 H HA   . SER A 1 117 ? -18.487 -1.912  -9.591  1.00 0.00 ? 117 SER A HA   6  
ATOM 11515 H HB2  . SER A 1 117 ? -18.741 -3.420  -6.971  1.00 0.00 ? 117 SER A HB2  6  
ATOM 11516 H HB3  . SER A 1 117 ? -20.074 -2.851  -7.978  1.00 0.00 ? 117 SER A HB3  6  
ATOM 11517 H HG   . SER A 1 117 ? -18.407 -4.301  -9.481  1.00 0.00 ? 117 SER A HG   6  
ATOM 11518 N N    . GLN A 1 118 ? -19.153 -0.026  -8.015  1.00 0.00 ? 118 GLN A N    6  
ATOM 11519 C CA   . GLN A 1 118 ? -19.357 1.222   -7.277  1.00 0.00 ? 118 GLN A CA   6  
ATOM 11520 C C    . GLN A 1 118 ? -18.372 2.308   -7.712  1.00 0.00 ? 118 GLN A C    6  
ATOM 11521 O O    . GLN A 1 118 ? -17.258 2.416   -7.194  1.00 0.00 ? 118 GLN A O    6  
ATOM 11522 C CB   . GLN A 1 118 ? -19.279 1.004   -5.761  1.00 0.00 ? 118 GLN A CB   6  
ATOM 11523 C CG   . GLN A 1 118 ? -19.532 2.263   -4.948  1.00 0.00 ? 118 GLN A CG   6  
ATOM 11524 C CD   . GLN A 1 118 ? -19.281 2.062   -3.469  1.00 0.00 ? 118 GLN A CD   6  
ATOM 11525 O OE1  . GLN A 1 118 ? -19.463 0.966   -2.936  1.00 0.00 ? 118 GLN A OE1  6  
ATOM 11526 N NE2  . GLN A 1 118 ? -18.844 3.114   -2.800  1.00 0.00 ? 118 GLN A NE2  6  
ATOM 11527 H H    . GLN A 1 118 ? -19.772 -0.235  -8.751  1.00 0.00 ? 118 GLN A H    6  
ATOM 11528 H HA   . GLN A 1 118 ? -20.352 1.567   -7.515  1.00 0.00 ? 118 GLN A HA   6  
ATOM 11529 H HB2  . GLN A 1 118 ? -20.013 0.263   -5.477  1.00 0.00 ? 118 GLN A HB2  6  
ATOM 11530 H HB3  . GLN A 1 118 ? -18.296 0.633   -5.511  1.00 0.00 ? 118 GLN A HB3  6  
ATOM 11531 H HG2  . GLN A 1 118 ? -18.877 3.043   -5.306  1.00 0.00 ? 118 GLN A HG2  6  
ATOM 11532 H HG3  . GLN A 1 118 ? -20.560 2.565   -5.087  1.00 0.00 ? 118 GLN A HG3  6  
ATOM 11533 H HE21 . GLN A 1 118 ? -18.700 3.955   -3.297  1.00 0.00 ? 118 GLN A HE21 6  
ATOM 11534 H HE22 . GLN A 1 118 ? -18.681 3.019   -1.838  1.00 0.00 ? 118 GLN A HE22 6  
ATOM 11535 N N    . GLU A 1 119 ? -18.798 3.087   -8.693  1.00 0.00 ? 119 GLU A N    6  
ATOM 11536 C CA   . GLU A 1 119 ? -18.109 4.301   -9.091  1.00 0.00 ? 119 GLU A CA   6  
ATOM 11537 C C    . GLU A 1 119 ? -19.096 5.202   -9.815  1.00 0.00 ? 119 GLU A C    6  
ATOM 11538 O O    . GLU A 1 119 ? -19.423 4.904   -10.984 1.00 0.00 ? 119 GLU A O    6  
ATOM 11539 C CB   . GLU A 1 119 ? -16.906 4.019   -9.998  1.00 0.00 ? 119 GLU A CB   6  
ATOM 11540 C CG   . GLU A 1 119 ? -16.125 5.280   -10.343 1.00 0.00 ? 119 GLU A CG   6  
ATOM 11541 C CD   . GLU A 1 119 ? -15.105 5.072   -11.440 1.00 0.00 ? 119 GLU A CD   6  
ATOM 11542 O OE1  . GLU A 1 119 ? -15.515 4.865   -12.603 1.00 0.00 ? 119 GLU A OE1  6  
ATOM 11543 O OE2  . GLU A 1 119 ? -13.890 5.137   -11.157 1.00 0.00 ? 119 GLU A OE2  6  
ATOM 11544 O OXT  . GLU A 1 119 ? -19.556 6.193   -9.215  1.00 0.00 ? 119 GLU A OXT  6  
ATOM 11545 H H    . GLU A 1 119 ? -19.614 2.832   -9.176  1.00 0.00 ? 119 GLU A H    6  
ATOM 11546 H HA   . GLU A 1 119 ? -17.769 4.803   -8.196  1.00 0.00 ? 119 GLU A HA   6  
ATOM 11547 H HB2  . GLU A 1 119 ? -16.242 3.330   -9.498  1.00 0.00 ? 119 GLU A HB2  6  
ATOM 11548 H HB3  . GLU A 1 119 ? -17.256 3.572   -10.918 1.00 0.00 ? 119 GLU A HB3  6  
ATOM 11549 H HG2  . GLU A 1 119 ? -16.823 6.041   -10.665 1.00 0.00 ? 119 GLU A HG2  6  
ATOM 11550 H HG3  . GLU A 1 119 ? -15.613 5.621   -9.456  1.00 0.00 ? 119 GLU A HG3  6  
ATOM 11551 N N    . GLY A 1 1   ? 0.711   19.414  3.213   1.00 0.00 ? 1   GLY A N    7  
ATOM 11552 C CA   . GLY A 1 1   ? 0.523   18.406  4.279   1.00 0.00 ? 1   GLY A CA   7  
ATOM 11553 C C    . GLY A 1 1   ? -0.915  17.959  4.370   1.00 0.00 ? 1   GLY A C    7  
ATOM 11554 O O    . GLY A 1 1   ? -1.314  16.981  3.736   1.00 0.00 ? 1   GLY A O    7  
ATOM 11555 H H1   . GLY A 1 1   ? 1.698   19.742  3.195   1.00 0.00 ? 1   GLY A H1   7  
ATOM 11556 H H2   . GLY A 1 1   ? 0.083   20.230  3.374   1.00 0.00 ? 1   GLY A H2   7  
ATOM 11557 H H3   . GLY A 1 1   ? 0.479   18.996  2.285   1.00 0.00 ? 1   GLY A H3   7  
ATOM 11558 H HA2  . GLY A 1 1   ? 1.144   17.548  4.068   1.00 0.00 ? 1   GLY A HA2  7  
ATOM 11559 H HA3  . GLY A 1 1   ? 0.820   18.833  5.225   1.00 0.00 ? 1   GLY A HA3  7  
ATOM 11560 N N    . ALA A 1 2   ? -1.698  18.684  5.151   1.00 0.00 ? 2   ALA A N    7  
ATOM 11561 C CA   . ALA A 1 2   ? -3.111  18.390  5.297   1.00 0.00 ? 2   ALA A CA   7  
ATOM 11562 C C    . ALA A 1 2   ? -3.886  18.911  4.095   1.00 0.00 ? 2   ALA A C    7  
ATOM 11563 O O    . ALA A 1 2   ? -3.937  20.119  3.859   1.00 0.00 ? 2   ALA A O    7  
ATOM 11564 C CB   . ALA A 1 2   ? -3.648  18.999  6.584   1.00 0.00 ? 2   ALA A CB   7  
ATOM 11565 H H    . ALA A 1 2   ? -1.313  19.449  5.642   1.00 0.00 ? 2   ALA A H    7  
ATOM 11566 H HA   . ALA A 1 2   ? -3.227  17.318  5.355   1.00 0.00 ? 2   ALA A HA   7  
ATOM 11567 H HB1  . ALA A 1 2   ? -3.534  20.073  6.551   1.00 0.00 ? 2   ALA A HB1  7  
ATOM 11568 H HB2  . ALA A 1