data_1X0X
# 
_entry.id   1X0X 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1X0X         
RCSB  RCSB024240   
WWPDB D_1000024240 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1WPQ 'Crystal Structure of Homo Sapiens Glycerol-3-Phosphate Dehydrogenase 1 Complexed with NAD and Hihydroxyactone' 
unspecified 
PDB 1X0V 'Crystal Structure of Homo Sapiens Glycerol-3-Phosphate Dehydrogenase 1'                                        
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1X0X 
_pdbx_database_status.recvd_initial_deposition_date   2005-03-31 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rao, Z.' 1 
'Ou, X.'  2 
# 
_citation.id                        primary 
_citation.title                     'Crystal Structures of Human Glycerol 3-phosphate Dehydrogenase 1 (GPD1)' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            357 
_citation.page_first                858 
_citation.page_last                 869 
_citation.year                      2006 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16460752 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2005.12.074 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ou, X.'      1 
primary 'Ji, C.'      2 
primary 'Han, X.'     3 
primary 'Zhao, X.'    4 
primary 'Li, X.'      5 
primary 'Mao, Y.'     6 
primary 'Wong, L.L.'  7 
primary 'Bartlam, M.' 8 
primary 'Rao, Z.'     9 
# 
_cell.entry_id           1X0X 
_cell.length_a           116.599 
_cell.length_b           116.599 
_cell.length_c           153.742 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1X0X 
_symmetry.space_group_name_H-M             'I 41 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                98 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic' 38020.000 1   1.1.1.8 ? ? ? 
2 non-polymer syn 'SULFATE ION'                                            96.063    5   ?       ? ? ? 
3 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE                        663.425   1   ?       ? ? ? 
4 water       nat water                                                    18.015    210 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GPD-C, GPDH-C' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPLGSMASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKLTEIINTQHENVKYLPGHKLPPNVVA
VPDVVQAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIKGVDEGPNGLKLISEVIGERLGIPMSVLMGANIASE
VADEKFCETTIGCKDPAQGQLLKELMQTPNFRITVVQEVDTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEM
IAFAKLFCSGPVSSATFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGPETARELYSILQHKGL
VDKFPLFMAVYKVCYEGQPVGEFIHCLQNHPEHM
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLGSMASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKLTEIINTQHENVKYLPGHKLPPNVVA
VPDVVQAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIKGVDEGPNGLKLISEVIGERLGIPMSVLMGANIASE
VADEKFCETTIGCKDPAQGQLLKELMQTPNFRITVVQEVDTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEM
IAFAKLFCSGPVSSATFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGPETARELYSILQHKGL
VDKFPLFMAVYKVCYEGQPVGEFIHCLQNHPEHM
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   MET n 
1 7   ALA n 
1 8   SER n 
1 9   LYS n 
1 10  LYS n 
1 11  VAL n 
1 12  CYS n 
1 13  ILE n 
1 14  VAL n 
1 15  GLY n 
1 16  SER n 
1 17  GLY n 
1 18  ASN n 
1 19  TRP n 
1 20  GLY n 
1 21  SER n 
1 22  ALA n 
1 23  ILE n 
1 24  ALA n 
1 25  LYS n 
1 26  ILE n 
1 27  VAL n 
1 28  GLY n 
1 29  GLY n 
1 30  ASN n 
1 31  ALA n 
1 32  ALA n 
1 33  GLN n 
1 34  LEU n 
1 35  ALA n 
1 36  GLN n 
1 37  PHE n 
1 38  ASP n 
1 39  PRO n 
1 40  ARG n 
1 41  VAL n 
1 42  THR n 
1 43  MET n 
1 44  TRP n 
1 45  VAL n 
1 46  PHE n 
1 47  GLU n 
1 48  GLU n 
1 49  ASP n 
1 50  ILE n 
1 51  GLY n 
1 52  GLY n 
1 53  LYS n 
1 54  LYS n 
1 55  LEU n 
1 56  THR n 
1 57  GLU n 
1 58  ILE n 
1 59  ILE n 
1 60  ASN n 
1 61  THR n 
1 62  GLN n 
1 63  HIS n 
1 64  GLU n 
1 65  ASN n 
1 66  VAL n 
1 67  LYS n 
1 68  TYR n 
1 69  LEU n 
1 70  PRO n 
1 71  GLY n 
1 72  HIS n 
1 73  LYS n 
1 74  LEU n 
1 75  PRO n 
1 76  PRO n 
1 77  ASN n 
1 78  VAL n 
1 79  VAL n 
1 80  ALA n 
1 81  VAL n 
1 82  PRO n 
1 83  ASP n 
1 84  VAL n 
1 85  VAL n 
1 86  GLN n 
1 87  ALA n 
1 88  ALA n 
1 89  GLU n 
1 90  ASP n 
1 91  ALA n 
1 92  ASP n 
1 93  ILE n 
1 94  LEU n 
1 95  ILE n 
1 96  PHE n 
1 97  VAL n 
1 98  VAL n 
1 99  PRO n 
1 100 HIS n 
1 101 GLN n 
1 102 PHE n 
1 103 ILE n 
1 104 GLY n 
1 105 LYS n 
1 106 ILE n 
1 107 CYS n 
1 108 ASP n 
1 109 GLN n 
1 110 LEU n 
1 111 LYS n 
1 112 GLY n 
1 113 HIS n 
1 114 LEU n 
1 115 LYS n 
1 116 ALA n 
1 117 ASN n 
1 118 ALA n 
1 119 THR n 
1 120 GLY n 
1 121 ILE n 
1 122 SER n 
1 123 LEU n 
1 124 ILE n 
1 125 LYS n 
1 126 GLY n 
1 127 VAL n 
1 128 ASP n 
1 129 GLU n 
1 130 GLY n 
1 131 PRO n 
1 132 ASN n 
1 133 GLY n 
1 134 LEU n 
1 135 LYS n 
1 136 LEU n 
1 137 ILE n 
1 138 SER n 
1 139 GLU n 
1 140 VAL n 
1 141 ILE n 
1 142 GLY n 
1 143 GLU n 
1 144 ARG n 
1 145 LEU n 
1 146 GLY n 
1 147 ILE n 
1 148 PRO n 
1 149 MET n 
1 150 SER n 
1 151 VAL n 
1 152 LEU n 
1 153 MET n 
1 154 GLY n 
1 155 ALA n 
1 156 ASN n 
1 157 ILE n 
1 158 ALA n 
1 159 SER n 
1 160 GLU n 
1 161 VAL n 
1 162 ALA n 
1 163 ASP n 
1 164 GLU n 
1 165 LYS n 
1 166 PHE n 
1 167 CYS n 
1 168 GLU n 
1 169 THR n 
1 170 THR n 
1 171 ILE n 
1 172 GLY n 
1 173 CYS n 
1 174 LYS n 
1 175 ASP n 
1 176 PRO n 
1 177 ALA n 
1 178 GLN n 
1 179 GLY n 
1 180 GLN n 
1 181 LEU n 
1 182 LEU n 
1 183 LYS n 
1 184 GLU n 
1 185 LEU n 
1 186 MET n 
1 187 GLN n 
1 188 THR n 
1 189 PRO n 
1 190 ASN n 
1 191 PHE n 
1 192 ARG n 
1 193 ILE n 
1 194 THR n 
1 195 VAL n 
1 196 VAL n 
1 197 GLN n 
1 198 GLU n 
1 199 VAL n 
1 200 ASP n 
1 201 THR n 
1 202 VAL n 
1 203 GLU n 
1 204 ILE n 
1 205 CYS n 
1 206 GLY n 
1 207 ALA n 
1 208 LEU n 
1 209 LYS n 
1 210 ASN n 
1 211 VAL n 
1 212 VAL n 
1 213 ALA n 
1 214 VAL n 
1 215 GLY n 
1 216 ALA n 
1 217 GLY n 
1 218 PHE n 
1 219 CYS n 
1 220 ASP n 
1 221 GLY n 
1 222 LEU n 
1 223 GLY n 
1 224 PHE n 
1 225 GLY n 
1 226 ASP n 
1 227 ASN n 
1 228 THR n 
1 229 LYS n 
1 230 ALA n 
1 231 ALA n 
1 232 VAL n 
1 233 ILE n 
1 234 ARG n 
1 235 LEU n 
1 236 GLY n 
1 237 LEU n 
1 238 MET n 
1 239 GLU n 
1 240 MET n 
1 241 ILE n 
1 242 ALA n 
1 243 PHE n 
1 244 ALA n 
1 245 LYS n 
1 246 LEU n 
1 247 PHE n 
1 248 CYS n 
1 249 SER n 
1 250 GLY n 
1 251 PRO n 
1 252 VAL n 
1 253 SER n 
1 254 SER n 
1 255 ALA n 
1 256 THR n 
1 257 PHE n 
1 258 LEU n 
1 259 GLU n 
1 260 SER n 
1 261 CYS n 
1 262 GLY n 
1 263 VAL n 
1 264 ALA n 
1 265 ASP n 
1 266 LEU n 
1 267 ILE n 
1 268 THR n 
1 269 THR n 
1 270 CYS n 
1 271 TYR n 
1 272 GLY n 
1 273 GLY n 
1 274 ARG n 
1 275 ASN n 
1 276 ARG n 
1 277 LYS n 
1 278 VAL n 
1 279 ALA n 
1 280 GLU n 
1 281 ALA n 
1 282 PHE n 
1 283 ALA n 
1 284 ARG n 
1 285 THR n 
1 286 GLY n 
1 287 LYS n 
1 288 SER n 
1 289 ILE n 
1 290 GLU n 
1 291 GLN n 
1 292 LEU n 
1 293 GLU n 
1 294 LYS n 
1 295 GLU n 
1 296 LEU n 
1 297 LEU n 
1 298 ASN n 
1 299 GLY n 
1 300 GLN n 
1 301 LYS n 
1 302 LEU n 
1 303 GLN n 
1 304 GLY n 
1 305 PRO n 
1 306 GLU n 
1 307 THR n 
1 308 ALA n 
1 309 ARG n 
1 310 GLU n 
1 311 LEU n 
1 312 TYR n 
1 313 SER n 
1 314 ILE n 
1 315 LEU n 
1 316 GLN n 
1 317 HIS n 
1 318 LYS n 
1 319 GLY n 
1 320 LEU n 
1 321 VAL n 
1 322 ASP n 
1 323 LYS n 
1 324 PHE n 
1 325 PRO n 
1 326 LEU n 
1 327 PHE n 
1 328 MET n 
1 329 ALA n 
1 330 VAL n 
1 331 TYR n 
1 332 LYS n 
1 333 VAL n 
1 334 CYS n 
1 335 TYR n 
1 336 GLU n 
1 337 GLY n 
1 338 GLN n 
1 339 PRO n 
1 340 VAL n 
1 341 GLY n 
1 342 GLU n 
1 343 PHE n 
1 344 ILE n 
1 345 HIS n 
1 346 CYS n 
1 347 LEU n 
1 348 GLN n 
1 349 ASN n 
1 350 HIS n 
1 351 PRO n 
1 352 GLU n 
1 353 HIS n 
1 354 MET n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'DE3(BL21)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX-6p-1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GPDA_HUMAN 
_struct_ref.pdbx_db_accession          P21695 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKLTEIINTQHENVKYLPGHKLPPNVVAVPDVV
QAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIKGVDEGPNGLKLISEVIGERLGIPMSVLMGANIASEVADEK
FCETTIGCKDPAQGQLLKELMQTPNFRITVVQEVDTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAK
LFCSGPVSSATFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGPETARELYSILQHKGLVDKFP
LFMAVYKVCYEGQPVGEFIHCLQNHPEHM
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1X0X 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 6 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 354 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P21695 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  349 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       349 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1X0X GLY A 1 ? UNP P21695 ? ? 'CLONING ARTIFACT' -4 1 
1 1X0X PRO A 2 ? UNP P21695 ? ? 'CLONING ARTIFACT' -3 2 
1 1X0X LEU A 3 ? UNP P21695 ? ? 'CLONING ARTIFACT' -2 3 
1 1X0X GLY A 4 ? UNP P21695 ? ? 'CLONING ARTIFACT' -1 4 
1 1X0X SER A 5 ? UNP P21695 ? ? 'CLONING ARTIFACT' 0  5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                          ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                          ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                           ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                         ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                             ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                           ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                            ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                        ? 'C5 H11 N O2 S'     149.211 
NAD non-polymer         . NICOTINAMIDE-ADENINE-DINUCLEOTIDE ? 'C21 H27 N7 O14 P2' 663.425 
PHE 'L-peptide linking' y PHENYLALANINE                     ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                           ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                            ? 'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION'                     ? 'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE                         ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                          ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                            ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1X0X 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.4 
_exptl_crystal.density_percent_sol   63 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_details    
;0.1M tri-Sodium Citrate dihydrate, 0.5M Ammonium Sulfate, 1.0M Lithium Sulfate monohydrate, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 291K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2004-04-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1X0X 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.75 
_reflns.d_resolution_low             50 
_reflns.number_all                   26614 
_reflns.number_obs                   26614 
_reflns.percent_possible_obs         99.99 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.75 
_reflns_shell.d_res_low              2.85 
_reflns_shell.percent_possible_all   99.99 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1X0X 
_refine.ls_d_res_high                            2.75 
_refine.ls_d_res_low                             50 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     14124 
_refine.ls_number_reflns_obs                     13788 
_refine.ls_number_reflns_R_free                  656 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          0.188 
_refine.ls_R_factor_obs                          0.182 
_refine.ls_R_factor_R_work                       0.178 
_refine.ls_R_factor_R_free                       0.239 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2638 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         69 
_refine_hist.number_atoms_solvent             210 
_refine_hist.number_atoms_total               2917 
_refine_hist.d_res_high                       2.75 
_refine_hist.d_res_low                        50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.12 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.59 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1X0X 
_struct.title                     'Co-Structure of Homo Sapiens Glycerol-3-Phosphate Dehydrogenase 1 complex with NAD' 
_struct.pdbx_descriptor           'Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic (E.C.1.1.1.8)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1X0X 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'NAD, co-enzyme, GPD1, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 17  ? LEU A 34  ? GLY A 12  LEU A 29  1 ? 18 
HELX_P HELX_P2  2  LEU A 55  ? HIS A 63  ? LEU A 50  HIS A 58  1 ? 9  
HELX_P HELX_P3  3  ASP A 83  ? GLU A 89  ? ASP A 78  GLU A 84  1 ? 7  
HELX_P HELX_P4  4  PRO A 99  ? GLN A 101 ? PRO A 94  GLN A 96  5 ? 3  
HELX_P HELX_P5  5  PHE A 102 ? LYS A 111 ? PHE A 97  LYS A 106 1 ? 10 
HELX_P HELX_P6  6  LEU A 136 ? GLY A 146 ? LEU A 131 GLY A 141 1 ? 11 
HELX_P HELX_P7  7  ILE A 157 ? ASP A 163 ? ILE A 152 ASP A 158 1 ? 7  
HELX_P HELX_P8  8  ASP A 175 ? GLN A 187 ? ASP A 170 GLN A 182 1 ? 13 
HELX_P HELX_P9  9  GLU A 198 ? LEU A 222 ? GLU A 193 LEU A 217 1 ? 25 
HELX_P HELX_P10 10 GLY A 225 ? CYS A 248 ? GLY A 220 CYS A 243 1 ? 24 
HELX_P HELX_P11 11 SER A 253 ? GLU A 259 ? SER A 248 GLU A 254 5 ? 7  
HELX_P HELX_P12 12 GLY A 262 ? GLY A 273 ? GLY A 257 GLY A 268 1 ? 12 
HELX_P HELX_P13 13 GLY A 273 ? GLY A 286 ? GLY A 268 GLY A 281 1 ? 14 
HELX_P HELX_P14 14 SER A 288 ? LEU A 297 ? SER A 283 LEU A 292 1 ? 10 
HELX_P HELX_P15 15 GLN A 303 ? HIS A 317 ? GLN A 298 HIS A 312 1 ? 15 
HELX_P HELX_P16 16 LYS A 318 ? GLY A 319 ? LYS A 313 GLY A 314 5 ? 2  
HELX_P HELX_P17 17 LEU A 320 ? LYS A 323 ? LEU A 315 LYS A 318 5 ? 4  
HELX_P HELX_P18 18 PHE A 324 ? TYR A 335 ? PHE A 319 TYR A 330 1 ? 12 
HELX_P HELX_P19 19 PRO A 339 ? GLY A 341 ? PRO A 334 GLY A 336 5 ? 3  
HELX_P HELX_P20 20 GLU A 342 ? ASN A 349 ? GLU A 337 ASN A 344 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 2 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? anti-parallel 
A 7 8 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 78  ? VAL A 81  ? VAL A 73  VAL A 76  
A 2 VAL A 41  ? TRP A 44  ? VAL A 36  TRP A 39  
A 3 VAL A 11  ? VAL A 14  ? VAL A 6   VAL A 9   
A 4 ILE A 93  ? PHE A 96  ? ILE A 88  PHE A 91  
A 5 THR A 119 ? SER A 122 ? THR A 114 SER A 117 
A 6 MET A 149 ? MET A 153 ? MET A 144 MET A 148 
A 7 CYS A 167 ? GLY A 172 ? CYS A 162 GLY A 167 
A 8 PHE A 191 ? VAL A 196 ? PHE A 186 VAL A 191 
B 1 ASP A 49  ? ILE A 50  ? ASP A 44  ILE A 45  
B 2 LYS A 53  ? LYS A 54  ? LYS A 48  LYS A 49  
C 1 ASP A 128 ? GLY A 130 ? ASP A 123 GLY A 125 
C 2 GLY A 133 ? LYS A 135 ? GLY A 128 LYS A 130 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 79  ? O VAL A 74  N MET A 43  ? N MET A 38  
A 2 3 O THR A 42  ? O THR A 37  N ILE A 13  ? N ILE A 8   
A 3 4 N VAL A 14  ? N VAL A 9   O ILE A 95  ? O ILE A 90  
A 4 5 N PHE A 96  ? N PHE A 91  O ILE A 121 ? O ILE A 116 
A 5 6 N SER A 122 ? N SER A 117 O SER A 150 ? O SER A 145 
A 6 7 N MET A 153 ? N MET A 148 O THR A 170 ? O THR A 165 
A 7 8 N ILE A 171 ? N ILE A 166 O VAL A 196 ? O VAL A 191 
B 1 2 N ILE A 50  ? N ILE A 45  O LYS A 53  ? O LYS A 48  
C 1 2 N GLY A 130 ? N GLY A 125 O GLY A 133 ? O GLY A 128 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 1001' 
AC2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE SO4 A 1002' 
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 A 1003' 
AC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 1004' 
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 A 1005' 
AC6 Software ? ? ? ? 29 'BINDING SITE FOR RESIDUE NAD A 2001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3  LYS A 25  ? LYS A 20   . ? 1_555 ? 
2  AC1 3  HIS A 72  ? HIS A 67   . ? 1_555 ? 
3  AC1 3  LYS A 73  ? LYS A 68   . ? 1_555 ? 
4  AC2 12 LYS A 209 ? LYS A 204  . ? 1_555 ? 
5  AC2 12 ASN A 210 ? ASN A 205  . ? 1_555 ? 
6  AC2 12 THR A 269 ? THR A 264  . ? 1_555 ? 
7  AC2 12 GLY A 273 ? GLY A 268  . ? 1_555 ? 
8  AC2 12 ARG A 274 ? ARG A 269  . ? 1_555 ? 
9  AC2 12 ASN A 275 ? ASN A 270  . ? 1_555 ? 
10 AC2 12 HOH H .   ? HOH A 2010 . ? 1_555 ? 
11 AC2 12 HOH H .   ? HOH A 2022 . ? 1_555 ? 
12 AC2 12 HOH H .   ? HOH A 2039 . ? 1_555 ? 
13 AC2 12 HOH H .   ? HOH A 2049 . ? 1_555 ? 
14 AC2 12 HOH H .   ? HOH A 2076 . ? 1_555 ? 
15 AC2 12 HOH H .   ? HOH A 2134 . ? 1_555 ? 
16 AC3 6  LYS A 245 ? LYS A 240  . ? 1_555 ? 
17 AC3 6  VAL A 252 ? VAL A 247  . ? 1_555 ? 
18 AC3 6  SER A 253 ? SER A 248  . ? 1_555 ? 
19 AC3 6  SER A 254 ? SER A 249  . ? 1_555 ? 
20 AC3 6  HOH H .   ? HOH A 2175 . ? 1_555 ? 
21 AC3 6  HOH H .   ? HOH A 2179 . ? 1_555 ? 
22 AC4 3  ARG A 276 ? ARG A 271  . ? 1_555 ? 
23 AC4 3  LYS A 277 ? LYS A 272  . ? 1_555 ? 
24 AC4 3  HOH H .   ? HOH A 2017 . ? 1_555 ? 
25 AC5 5  ASN A 18  ? ASN A 13   . ? 1_555 ? 
26 AC5 5  GLN A 300 ? GLN A 295  . ? 1_555 ? 
27 AC5 5  HOH H .   ? HOH A 2065 . ? 1_555 ? 
28 AC5 5  HOH H .   ? HOH A 2096 . ? 1_555 ? 
29 AC5 5  HOH H .   ? HOH A 2211 . ? 1_555 ? 
30 AC6 29 SER A 16  ? SER A 11   . ? 1_555 ? 
31 AC6 29 GLY A 17  ? GLY A 12   . ? 1_555 ? 
32 AC6 29 ASN A 18  ? ASN A 13   . ? 1_555 ? 
33 AC6 29 TRP A 19  ? TRP A 14   . ? 1_555 ? 
34 AC6 29 GLY A 20  ? GLY A 15   . ? 1_555 ? 
35 AC6 29 PHE A 46  ? PHE A 41   . ? 1_555 ? 
36 AC6 29 TYR A 68  ? TYR A 63   . ? 1_555 ? 
37 AC6 29 VAL A 98  ? VAL A 93   . ? 1_555 ? 
38 AC6 29 PRO A 99  ? PRO A 94   . ? 1_555 ? 
39 AC6 29 PHE A 102 ? PHE A 97   . ? 1_555 ? 
40 AC6 29 ILE A 124 ? ILE A 119  . ? 1_555 ? 
41 AC6 29 LYS A 125 ? LYS A 120  . ? 1_555 ? 
42 AC6 29 ASN A 156 ? ASN A 151  . ? 1_555 ? 
43 AC6 29 ALA A 158 ? ALA A 153  . ? 1_555 ? 
44 AC6 29 ARG A 274 ? ARG A 269  . ? 1_555 ? 
45 AC6 29 GLY A 299 ? GLY A 294  . ? 1_555 ? 
46 AC6 29 GLN A 300 ? GLN A 295  . ? 1_555 ? 
47 AC6 29 LYS A 301 ? LYS A 296  . ? 1_555 ? 
48 AC6 29 GLN A 303 ? GLN A 298  . ? 1_555 ? 
49 AC6 29 HOH H .   ? HOH A 2007 . ? 1_555 ? 
50 AC6 29 HOH H .   ? HOH A 2011 . ? 1_555 ? 
51 AC6 29 HOH H .   ? HOH A 2012 . ? 1_555 ? 
52 AC6 29 HOH H .   ? HOH A 2022 . ? 1_555 ? 
53 AC6 29 HOH H .   ? HOH A 2023 . ? 1_555 ? 
54 AC6 29 HOH H .   ? HOH A 2039 . ? 1_555 ? 
55 AC6 29 HOH H .   ? HOH A 2044 . ? 1_555 ? 
56 AC6 29 HOH H .   ? HOH A 2087 . ? 1_555 ? 
57 AC6 29 HOH H .   ? HOH A 2134 . ? 1_555 ? 
58 AC6 29 HOH H .   ? HOH A 2135 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1X0X 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1X0X 
_atom_sites.fract_transf_matrix[1][1]   0.008576 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008576 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006504 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 5   ? -46.038 13.572 -94.639  1.00 64.26 ? 0    SER A N   1 
ATOM   2    C CA  . SER A 1 5   ? -46.851 13.402 -95.873  1.00 63.69 ? 0    SER A CA  1 
ATOM   3    C C   . SER A 1 5   ? -47.911 14.483 -96.090  1.00 63.79 ? 0    SER A C   1 
ATOM   4    O O   . SER A 1 5   ? -49.057 14.176 -96.425  1.00 64.61 ? 0    SER A O   1 
ATOM   5    C CB  . SER A 1 5   ? -47.515 12.029 -95.874  1.00 62.64 ? 0    SER A CB  1 
ATOM   6    O OG  . SER A 1 5   ? -46.537 11.016 -95.939  1.00 61.23 ? 0    SER A OG  1 
ATOM   7    N N   . MET A 1 6   ? -47.526 15.741 -95.882  1.00 63.31 ? 1    MET A N   1 
ATOM   8    C CA  . MET A 1 6   ? -48.412 16.882 -96.115  1.00 63.09 ? 1    MET A CA  1 
ATOM   9    C C   . MET A 1 6   ? -49.830 16.884 -95.496  1.00 60.38 ? 1    MET A C   1 
ATOM   10   O O   . MET A 1 6   ? -50.464 15.840 -95.306  1.00 60.31 ? 1    MET A O   1 
ATOM   11   C CB  . MET A 1 6   ? -48.531 17.107 -97.641  1.00 66.14 ? 1    MET A CB  1 
ATOM   12   C CG  . MET A 1 6   ? -47.254 17.604 -98.326  1.00 69.13 ? 1    MET A CG  1 
ATOM   13   S SD  . MET A 1 6   ? -46.721 19.271 -97.758  1.00 74.34 ? 1    MET A SD  1 
ATOM   14   C CE  . MET A 1 6   ? -45.646 18.842 -96.297  1.00 72.92 ? 1    MET A CE  1 
ATOM   15   N N   . ALA A 1 7   ? -50.318 18.085 -95.193  1.00 56.46 ? 2    ALA A N   1 
ATOM   16   C CA  . ALA A 1 7   ? -51.660 18.260 -94.647  1.00 52.17 ? 2    ALA A CA  1 
ATOM   17   C C   . ALA A 1 7   ? -52.570 18.692 -95.802  1.00 48.18 ? 2    ALA A C   1 
ATOM   18   O O   . ALA A 1 7   ? -52.083 19.055 -96.876  1.00 47.63 ? 2    ALA A O   1 
ATOM   19   C CB  . ALA A 1 7   ? -51.657 19.322 -93.547  1.00 52.12 ? 2    ALA A CB  1 
ATOM   20   N N   . SER A 1 8   ? -53.882 18.644 -95.589  1.00 43.54 ? 3    SER A N   1 
ATOM   21   C CA  . SER A 1 8   ? -54.802 19.033 -96.644  1.00 40.14 ? 3    SER A CA  1 
ATOM   22   C C   . SER A 1 8   ? -54.827 20.555 -96.754  1.00 38.29 ? 3    SER A C   1 
ATOM   23   O O   . SER A 1 8   ? -54.956 21.263 -95.751  1.00 37.52 ? 3    SER A O   1 
ATOM   24   C CB  . SER A 1 8   ? -56.218 18.447 -96.407  1.00 39.26 ? 3    SER A CB  1 
ATOM   25   O OG  . SER A 1 8   ? -56.875 18.953 -95.259  1.00 38.15 ? 3    SER A OG  1 
ATOM   26   N N   . LYS A 1 9   ? -54.666 21.046 -97.982  1.00 36.08 ? 4    LYS A N   1 
ATOM   27   C CA  . LYS A 1 9   ? -54.645 22.477 -98.266  1.00 34.05 ? 4    LYS A CA  1 
ATOM   28   C C   . LYS A 1 9   ? -56.050 23.072 -98.278  1.00 32.18 ? 4    LYS A C   1 
ATOM   29   O O   . LYS A 1 9   ? -56.962 22.507 -98.884  1.00 31.49 ? 4    LYS A O   1 
ATOM   30   C CB  . LYS A 1 9   ? -54.011 22.708 -99.625  1.00 35.09 ? 4    LYS A CB  1 
ATOM   31   C CG  . LYS A 1 9   ? -52.713 21.978 -99.847  1.00 36.25 ? 4    LYS A CG  1 
ATOM   32   C CD  . LYS A 1 9   ? -51.555 22.817 -99.410  1.00 38.16 ? 4    LYS A CD  1 
ATOM   33   C CE  . LYS A 1 9   ? -50.279 22.370 -100.102 1.00 38.45 ? 4    LYS A CE  1 
ATOM   34   N NZ  . LYS A 1 9   ? -49.160 23.272 -99.718  1.00 39.99 ? 4    LYS A NZ  1 
ATOM   35   N N   . LYS A 1 10  ? -56.233 24.200 -97.599  1.00 29.99 ? 5    LYS A N   1 
ATOM   36   C CA  . LYS A 1 10  ? -57.541 24.852 -97.582  1.00 28.97 ? 5    LYS A CA  1 
ATOM   37   C C   . LYS A 1 10  ? -57.642 25.788 -98.785  1.00 27.37 ? 5    LYS A C   1 
ATOM   38   O O   . LYS A 1 10  ? -56.743 26.599 -99.055  1.00 27.58 ? 5    LYS A O   1 
ATOM   39   C CB  . LYS A 1 10  ? -57.760 25.637 -96.284  1.00 29.58 ? 5    LYS A CB  1 
ATOM   40   C CG  . LYS A 1 10  ? -58.010 24.756 -95.091  1.00 31.87 ? 5    LYS A CG  1 
ATOM   41   C CD  . LYS A 1 10  ? -58.322 25.567 -93.850  1.00 34.84 ? 5    LYS A CD  1 
ATOM   42   C CE  . LYS A 1 10  ? -58.208 24.707 -92.573  1.00 37.33 ? 5    LYS A CE  1 
ATOM   43   N NZ  . LYS A 1 10  ? -56.780 24.267 -92.256  1.00 39.03 ? 5    LYS A NZ  1 
ATOM   44   N N   . VAL A 1 11  ? -58.744 25.665 -99.507  1.00 23.66 ? 6    VAL A N   1 
ATOM   45   C CA  . VAL A 1 11  ? -58.956 26.461 -100.690 1.00 21.06 ? 6    VAL A CA  1 
ATOM   46   C C   . VAL A 1 11  ? -60.008 27.547 -100.473 1.00 21.29 ? 6    VAL A C   1 
ATOM   47   O O   . VAL A 1 11  ? -61.049 27.307 -99.869  1.00 21.25 ? 6    VAL A O   1 
ATOM   48   C CB  . VAL A 1 11  ? -59.401 25.550 -101.870 1.00 19.20 ? 6    VAL A CB  1 
ATOM   49   C CG1 . VAL A 1 11  ? -59.757 26.381 -103.074 1.00 16.95 ? 6    VAL A CG1 1 
ATOM   50   C CG2 . VAL A 1 11  ? -58.297 24.568 -102.220 1.00 17.98 ? 6    VAL A CG2 1 
ATOM   51   N N   . CYS A 1 12  ? -59.716 28.754 -100.949 1.00 20.76 ? 7    CYS A N   1 
ATOM   52   C CA  . CYS A 1 12  ? -60.672 29.846 -100.869 1.00 19.86 ? 7    CYS A CA  1 
ATOM   53   C C   . CYS A 1 12  ? -60.941 30.343 -102.284 1.00 19.16 ? 7    CYS A C   1 
ATOM   54   O O   . CYS A 1 12  ? -60.009 30.663 -103.019 1.00 19.82 ? 7    CYS A O   1 
ATOM   55   C CB  . CYS A 1 12  ? -60.145 31.016 -100.033 1.00 19.47 ? 7    CYS A CB  1 
ATOM   56   S SG  . CYS A 1 12  ? -61.222 32.492 -100.203 1.00 23.75 ? 7    CYS A SG  1 
ATOM   57   N N   . ILE A 1 13  ? -62.207 30.379 -102.677 1.00 18.12 ? 8    ILE A N   1 
ATOM   58   C CA  . ILE A 1 13  ? -62.555 30.899 -103.989 1.00 18.05 ? 8    ILE A CA  1 
ATOM   59   C C   . ILE A 1 13  ? -62.997 32.351 -103.800 1.00 18.17 ? 8    ILE A C   1 
ATOM   60   O O   . ILE A 1 13  ? -64.054 32.608 -103.214 1.00 18.26 ? 8    ILE A O   1 
ATOM   61   C CB  . ILE A 1 13  ? -63.731 30.164 -104.640 1.00 17.48 ? 8    ILE A CB  1 
ATOM   62   C CG1 . ILE A 1 13  ? -63.380 28.699 -104.895 1.00 16.25 ? 8    ILE A CG1 1 
ATOM   63   C CG2 . ILE A 1 13  ? -64.102 30.888 -105.922 1.00 15.58 ? 8    ILE A CG2 1 
ATOM   64   C CD1 . ILE A 1 13  ? -64.576 27.854 -105.322 1.00 14.10 ? 8    ILE A CD1 1 
ATOM   65   N N   . VAL A 1 14  ? -62.184 33.288 -104.288 1.00 16.67 ? 9    VAL A N   1 
ATOM   66   C CA  . VAL A 1 14  ? -62.497 34.701 -104.176 1.00 15.41 ? 9    VAL A CA  1 
ATOM   67   C C   . VAL A 1 14  ? -63.300 35.095 -105.418 1.00 16.80 ? 9    VAL A C   1 
ATOM   68   O O   . VAL A 1 14  ? -62.740 35.297 -106.507 1.00 17.77 ? 9    VAL A O   1 
ATOM   69   C CB  . VAL A 1 14  ? -61.208 35.522 -104.078 1.00 13.60 ? 9    VAL A CB  1 
ATOM   70   C CG1 . VAL A 1 14  ? -61.522 36.973 -103.836 1.00 12.09 ? 9    VAL A CG1 1 
ATOM   71   C CG2 . VAL A 1 14  ? -60.355 34.973 -102.984 1.00 11.76 ? 9    VAL A CG2 1 
ATOM   72   N N   . GLY A 1 15  ? -64.618 35.193 -105.244 1.00 15.80 ? 10   GLY A N   1 
ATOM   73   C CA  . GLY A 1 15  ? -65.505 35.522 -106.343 1.00 15.74 ? 10   GLY A CA  1 
ATOM   74   C C   . GLY A 1 15  ? -66.602 34.467 -106.387 1.00 16.18 ? 10   GLY A C   1 
ATOM   75   O O   . GLY A 1 15  ? -66.415 33.362 -105.870 1.00 16.36 ? 10   GLY A O   1 
ATOM   76   N N   . SER A 1 16  ? -67.722 34.786 -107.034 1.00 15.22 ? 11   SER A N   1 
ATOM   77   C CA  . SER A 1 16  ? -68.864 33.891 -107.079 1.00 15.27 ? 11   SER A CA  1 
ATOM   78   C C   . SER A 1 16  ? -69.829 34.138 -108.240 1.00 15.75 ? 11   SER A C   1 
ATOM   79   O O   . SER A 1 16  ? -70.988 33.716 -108.181 1.00 14.78 ? 11   SER A O   1 
ATOM   80   C CB  . SER A 1 16  ? -69.625 34.060 -105.785 1.00 15.44 ? 11   SER A CB  1 
ATOM   81   O OG  . SER A 1 16  ? -69.873 35.443 -105.587 1.00 14.33 ? 11   SER A OG  1 
ATOM   82   N N   . GLY A 1 17  ? -69.355 34.808 -109.286 1.00 15.47 ? 12   GLY A N   1 
ATOM   83   C CA  . GLY A 1 17  ? -70.202 35.086 -110.425 1.00 14.56 ? 12   GLY A CA  1 
ATOM   84   C C   . GLY A 1 17  ? -70.443 33.889 -111.314 1.00 14.85 ? 12   GLY A C   1 
ATOM   85   O O   . GLY A 1 17  ? -70.375 32.742 -110.868 1.00 15.17 ? 12   GLY A O   1 
ATOM   86   N N   . ASN A 1 18  ? -70.744 34.162 -112.579 1.00 13.86 ? 13   ASN A N   1 
ATOM   87   C CA  . ASN A 1 18  ? -71.000 33.126 -113.560 1.00 13.10 ? 13   ASN A CA  1 
ATOM   88   C C   . ASN A 1 18  ? -69.830 32.097 -113.567 1.00 14.74 ? 13   ASN A C   1 
ATOM   89   O O   . ASN A 1 18  ? -70.015 30.931 -113.216 1.00 15.26 ? 13   ASN A O   1 
ATOM   90   C CB  . ASN A 1 18  ? -71.190 33.809 -114.921 1.00 11.70 ? 13   ASN A CB  1 
ATOM   91   C CG  . ASN A 1 18  ? -71.739 32.879 -115.995 1.00 11.12 ? 13   ASN A CG  1 
ATOM   92   O OD1 . ASN A 1 18  ? -71.250 32.879 -117.121 1.00 6.39  ? 13   ASN A OD1 1 
ATOM   93   N ND2 . ASN A 1 18  ? -72.762 32.096 -115.656 1.00 12.70 ? 13   ASN A ND2 1 
ATOM   94   N N   . TRP A 1 19  ? -68.629 32.521 -113.953 1.00 16.19 ? 14   TRP A N   1 
ATOM   95   C CA  . TRP A 1 19  ? -67.472 31.617 -113.964 1.00 16.97 ? 14   TRP A CA  1 
ATOM   96   C C   . TRP A 1 19  ? -67.120 31.163 -112.545 1.00 19.18 ? 14   TRP A C   1 
ATOM   97   O O   . TRP A 1 19  ? -66.811 29.992 -112.318 1.00 21.05 ? 14   TRP A O   1 
ATOM   98   C CB  . TRP A 1 19  ? -66.253 32.326 -114.560 1.00 15.32 ? 14   TRP A CB  1 
ATOM   99   C CG  . TRP A 1 19  ? -65.004 31.479 -114.815 1.00 13.15 ? 14   TRP A CG  1 
ATOM   100  C CD1 . TRP A 1 19  ? -63.704 31.917 -114.777 1.00 12.74 ? 14   TRP A CD1 1 
ATOM   101  C CD2 . TRP A 1 19  ? -64.944 30.111 -115.262 1.00 11.50 ? 14   TRP A CD2 1 
ATOM   102  N NE1 . TRP A 1 19  ? -62.852 30.920 -115.183 1.00 10.44 ? 14   TRP A NE1 1 
ATOM   103  C CE2 . TRP A 1 19  ? -63.585 29.804 -115.489 1.00 10.01 ? 14   TRP A CE2 1 
ATOM   104  C CE3 . TRP A 1 19  ? -65.909 29.121 -115.506 1.00 11.45 ? 14   TRP A CE3 1 
ATOM   105  C CZ2 . TRP A 1 19  ? -63.166 28.553 -115.943 1.00 8.64  ? 14   TRP A CZ2 1 
ATOM   106  C CZ3 . TRP A 1 19  ? -65.485 27.877 -115.961 1.00 9.74  ? 14   TRP A CZ3 1 
ATOM   107  C CH2 . TRP A 1 19  ? -64.126 27.610 -116.178 1.00 8.66  ? 14   TRP A CH2 1 
ATOM   108  N N   . GLY A 1 20  ? -67.150 32.093 -111.593 1.00 19.95 ? 15   GLY A N   1 
ATOM   109  C CA  . GLY A 1 20  ? -66.804 31.763 -110.220 1.00 19.82 ? 15   GLY A CA  1 
ATOM   110  C C   . GLY A 1 20  ? -67.630 30.637 -109.630 1.00 20.88 ? 15   GLY A C   1 
ATOM   111  O O   . GLY A 1 20  ? -67.086 29.738 -108.977 1.00 19.84 ? 15   GLY A O   1 
ATOM   112  N N   . SER A 1 21  ? -68.939 30.675 -109.863 1.00 20.67 ? 16   SER A N   1 
ATOM   113  C CA  . SER A 1 21  ? -69.816 29.654 -109.331 1.00 21.82 ? 16   SER A CA  1 
ATOM   114  C C   . SER A 1 21  ? -69.556 28.328 -110.017 1.00 22.79 ? 16   SER A C   1 
ATOM   115  O O   . SER A 1 21  ? -69.596 27.259 -109.375 1.00 23.96 ? 16   SER A O   1 
ATOM   116  C CB  . SER A 1 21  ? -71.282 30.067 -109.500 1.00 22.75 ? 16   SER A CB  1 
ATOM   117  O OG  . SER A 1 21  ? -71.619 31.117 -108.596 1.00 24.50 ? 16   SER A OG  1 
ATOM   118  N N   . ALA A 1 22  ? -69.286 28.389 -111.321 1.00 21.65 ? 17   ALA A N   1 
ATOM   119  C CA  . ALA A 1 22  ? -69.013 27.174 -112.075 1.00 20.47 ? 17   ALA A CA  1 
ATOM   120  C C   . ALA A 1 22  ? -67.724 26.564 -111.547 1.00 20.44 ? 17   ALA A C   1 
ATOM   121  O O   . ALA A 1 22  ? -67.639 25.358 -111.397 1.00 21.20 ? 17   ALA A O   1 
ATOM   122  C CB  . ALA A 1 22  ? -68.899 27.468 -113.565 1.00 17.91 ? 17   ALA A CB  1 
ATOM   123  N N   . ILE A 1 23  ? -66.735 27.399 -111.237 1.00 19.85 ? 18   ILE A N   1 
ATOM   124  C CA  . ILE A 1 23  ? -65.469 26.906 -110.719 1.00 21.13 ? 18   ILE A CA  1 
ATOM   125  C C   . ILE A 1 23  ? -65.631 26.273 -109.329 1.00 22.14 ? 18   ILE A C   1 
ATOM   126  O O   . ILE A 1 23  ? -64.867 25.383 -108.947 1.00 22.43 ? 18   ILE A O   1 
ATOM   127  C CB  . ILE A 1 23  ? -64.413 28.037 -110.671 1.00 21.03 ? 18   ILE A CB  1 
ATOM   128  C CG1 . ILE A 1 23  ? -63.188 27.617 -111.452 1.00 21.09 ? 18   ILE A CG1 1 
ATOM   129  C CG2 . ILE A 1 23  ? -63.950 28.289 -109.268 1.00 21.84 ? 18   ILE A CG2 1 
ATOM   130  C CD1 . ILE A 1 23  ? -63.478 27.358 -112.864 1.00 22.00 ? 18   ILE A CD1 1 
ATOM   131  N N   . ALA A 1 24  ? -66.631 26.732 -108.584 1.00 22.48 ? 19   ALA A N   1 
ATOM   132  C CA  . ALA A 1 24  ? -66.909 26.208 -107.257 1.00 21.71 ? 19   ALA A CA  1 
ATOM   133  C C   . ALA A 1 24  ? -67.497 24.795 -107.354 1.00 22.37 ? 19   ALA A C   1 
ATOM   134  O O   . ALA A 1 24  ? -67.328 23.986 -106.430 1.00 22.99 ? 19   ALA A O   1 
ATOM   135  C CB  . ALA A 1 24  ? -67.868 27.129 -106.529 1.00 22.41 ? 19   ALA A CB  1 
ATOM   136  N N   . LYS A 1 25  ? -68.208 24.499 -108.447 1.00 20.50 ? 20   LYS A N   1 
ATOM   137  C CA  . LYS A 1 25  ? -68.763 23.158 -108.620 1.00 19.41 ? 20   LYS A CA  1 
ATOM   138  C C   . LYS A 1 25  ? -67.586 22.211 -108.779 1.00 19.69 ? 20   LYS A C   1 
ATOM   139  O O   . LYS A 1 25  ? -67.519 21.147 -108.158 1.00 21.35 ? 20   LYS A O   1 
ATOM   140  C CB  . LYS A 1 25  ? -69.610 23.047 -109.885 1.00 18.69 ? 20   LYS A CB  1 
ATOM   141  C CG  . LYS A 1 25  ? -71.006 23.554 -109.776 1.00 23.14 ? 20   LYS A CG  1 
ATOM   142  C CD  . LYS A 1 25  ? -71.784 23.293 -111.067 1.00 26.03 ? 20   LYS A CD  1 
ATOM   143  C CE  . LYS A 1 25  ? -72.002 21.800 -111.328 1.00 27.18 ? 20   LYS A CE  1 
ATOM   144  N NZ  . LYS A 1 25  ? -72.820 21.158 -110.239 1.00 31.01 ? 20   LYS A NZ  1 
ATOM   145  N N   . ILE A 1 26  ? -66.662 22.600 -109.645 1.00 18.16 ? 21   ILE A N   1 
ATOM   146  C CA  . ILE A 1 26  ? -65.497 21.798 -109.917 1.00 17.33 ? 21   ILE A CA  1 
ATOM   147  C C   . ILE A 1 26  ? -64.626 21.630 -108.680 1.00 18.15 ? 21   ILE A C   1 
ATOM   148  O O   . ILE A 1 26  ? -64.310 20.511 -108.289 1.00 18.32 ? 21   ILE A O   1 
ATOM   149  C CB  . ILE A 1 26  ? -64.667 22.427 -111.029 1.00 16.26 ? 21   ILE A CB  1 
ATOM   150  C CG1 . ILE A 1 26  ? -65.473 22.411 -112.329 1.00 14.73 ? 21   ILE A CG1 1 
ATOM   151  C CG2 . ILE A 1 26  ? -63.339 21.685 -111.163 1.00 16.73 ? 21   ILE A CG2 1 
ATOM   152  C CD1 . ILE A 1 26  ? -64.762 23.016 -113.526 1.00 13.46 ? 21   ILE A CD1 1 
ATOM   153  N N   . VAL A 1 27  ? -64.234 22.745 -108.067 1.00 18.01 ? 22   VAL A N   1 
ATOM   154  C CA  . VAL A 1 27  ? -63.386 22.690 -106.885 1.00 16.97 ? 22   VAL A CA  1 
ATOM   155  C C   . VAL A 1 27  ? -64.084 22.010 -105.715 1.00 16.82 ? 22   VAL A C   1 
ATOM   156  O O   . VAL A 1 27  ? -63.502 21.125 -105.092 1.00 18.14 ? 22   VAL A O   1 
ATOM   157  C CB  . VAL A 1 27  ? -62.904 24.093 -106.490 1.00 15.68 ? 22   VAL A CB  1 
ATOM   158  C CG1 . VAL A 1 27  ? -62.125 24.050 -105.212 1.00 15.61 ? 22   VAL A CG1 1 
ATOM   159  C CG2 . VAL A 1 27  ? -62.029 24.622 -107.573 1.00 15.84 ? 22   VAL A CG2 1 
ATOM   160  N N   . GLY A 1 28  ? -65.323 22.404 -105.428 1.00 16.33 ? 23   GLY A N   1 
ATOM   161  C CA  . GLY A 1 28  ? -66.062 21.787 -104.340 1.00 15.82 ? 23   GLY A CA  1 
ATOM   162  C C   . GLY A 1 28  ? -66.065 20.272 -104.467 1.00 16.65 ? 23   GLY A C   1 
ATOM   163  O O   . GLY A 1 28  ? -65.857 19.547 -103.504 1.00 17.10 ? 23   GLY A O   1 
ATOM   164  N N   . GLY A 1 29  ? -66.270 19.789 -105.679 1.00 16.76 ? 24   GLY A N   1 
ATOM   165  C CA  . GLY A 1 29  ? -66.289 18.368 -105.895 1.00 18.03 ? 24   GLY A CA  1 
ATOM   166  C C   . GLY A 1 29  ? -64.938 17.699 -105.768 1.00 20.42 ? 24   GLY A C   1 
ATOM   167  O O   . GLY A 1 29  ? -64.835 16.563 -105.296 1.00 22.76 ? 24   GLY A O   1 
ATOM   168  N N   . ASN A 1 30  ? -63.878 18.374 -106.178 1.00 20.54 ? 25   ASN A N   1 
ATOM   169  C CA  . ASN A 1 30  ? -62.577 17.725 -106.095 1.00 20.22 ? 25   ASN A CA  1 
ATOM   170  C C   . ASN A 1 30  ? -62.031 17.737 -104.677 1.00 19.85 ? 25   ASN A C   1 
ATOM   171  O O   . ASN A 1 30  ? -61.407 16.769 -104.249 1.00 18.64 ? 25   ASN A O   1 
ATOM   172  C CB  . ASN A 1 30  ? -61.589 18.376 -107.072 1.00 18.32 ? 25   ASN A CB  1 
ATOM   173  C CG  . ASN A 1 30  ? -61.900 18.047 -108.515 1.00 19.69 ? 25   ASN A CG  1 
ATOM   174  O OD1 . ASN A 1 30  ? -61.297 18.602 -109.421 1.00 20.80 ? 25   ASN A OD1 1 
ATOM   175  N ND2 . ASN A 1 30  ? -62.842 17.134 -108.738 1.00 19.80 ? 25   ASN A ND2 1 
ATOM   176  N N   . ALA A 1 31  ? -62.266 18.824 -103.949 1.00 19.51 ? 26   ALA A N   1 
ATOM   177  C CA  . ALA A 1 31  ? -61.766 18.912 -102.600 1.00 19.99 ? 26   ALA A CA  1 
ATOM   178  C C   . ALA A 1 31  ? -62.468 17.839 -101.793 1.00 21.96 ? 26   ALA A C   1 
ATOM   179  O O   . ALA A 1 31  ? -61.859 17.181 -100.933 1.00 22.41 ? 26   ALA A O   1 
ATOM   180  C CB  . ALA A 1 31  ? -62.062 20.251 -102.037 1.00 19.37 ? 26   ALA A CB  1 
ATOM   181  N N   . ALA A 1 32  ? -63.749 17.652 -102.089 1.00 21.24 ? 27   ALA A N   1 
ATOM   182  C CA  . ALA A 1 32  ? -64.536 16.666 -101.379 1.00 22.52 ? 27   ALA A CA  1 
ATOM   183  C C   . ALA A 1 32  ? -64.096 15.224 -101.666 1.00 23.28 ? 27   ALA A C   1 
ATOM   184  O O   . ALA A 1 32  ? -64.311 14.323 -100.854 1.00 24.09 ? 27   ALA A O   1 
ATOM   185  C CB  . ALA A 1 32  ? -66.000 16.850 -101.725 1.00 22.41 ? 27   ALA A CB  1 
ATOM   186  N N   . GLN A 1 33  ? -63.450 15.026 -102.806 1.00 23.99 ? 28   GLN A N   1 
ATOM   187  C CA  . GLN A 1 33  ? -63.000 13.716 -103.277 1.00 24.29 ? 28   GLN A CA  1 
ATOM   188  C C   . GLN A 1 33  ? -61.517 13.406 -103.037 1.00 23.66 ? 28   GLN A C   1 
ATOM   189  O O   . GLN A 1 33  ? -61.117 12.239 -102.896 1.00 23.80 ? 28   GLN A O   1 
ATOM   190  C CB  . GLN A 1 33  ? -63.282 13.646 -104.776 1.00 27.99 ? 28   GLN A CB  1 
ATOM   191  C CG  . GLN A 1 33  ? -62.814 12.409 -105.491 1.00 34.76 ? 28   GLN A CG  1 
ATOM   192  C CD  . GLN A 1 33  ? -63.759 11.231 -105.268 1.00 41.07 ? 28   GLN A CD  1 
ATOM   193  O OE1 . GLN A 1 33  ? -64.995 11.404 -105.246 1.00 43.25 ? 28   GLN A OE1 1 
ATOM   194  N NE2 . GLN A 1 33  ? -63.192 10.025 -105.117 1.00 41.62 ? 28   GLN A NE2 1 
ATOM   195  N N   . LEU A 1 34  ? -60.704 14.454 -103.011 1.00 21.88 ? 29   LEU A N   1 
ATOM   196  C CA  . LEU A 1 34  ? -59.274 14.304 -102.842 1.00 20.32 ? 29   LEU A CA  1 
ATOM   197  C C   . LEU A 1 34  ? -58.796 14.670 -101.452 1.00 21.53 ? 29   LEU A C   1 
ATOM   198  O O   . LEU A 1 34  ? -59.135 15.723 -100.910 1.00 21.14 ? 29   LEU A O   1 
ATOM   199  C CB  . LEU A 1 34  ? -58.547 15.166 -103.870 1.00 18.11 ? 29   LEU A CB  1 
ATOM   200  C CG  . LEU A 1 34  ? -59.013 14.980 -105.307 1.00 14.63 ? 29   LEU A CG  1 
ATOM   201  C CD1 . LEU A 1 34  ? -58.187 15.838 -106.240 1.00 12.76 ? 29   LEU A CD1 1 
ATOM   202  C CD2 . LEU A 1 34  ? -58.908 13.530 -105.675 1.00 12.18 ? 29   LEU A CD2 1 
ATOM   203  N N   . ALA A 1 35  ? -57.978 13.793 -100.886 1.00 22.94 ? 30   ALA A N   1 
ATOM   204  C CA  . ALA A 1 35  ? -57.462 14.019 -99.557  1.00 23.72 ? 30   ALA A CA  1 
ATOM   205  C C   . ALA A 1 35  ? -56.589 15.263 -99.476  1.00 24.15 ? 30   ALA A C   1 
ATOM   206  O O   . ALA A 1 35  ? -56.665 15.979 -98.483  1.00 26.15 ? 30   ALA A O   1 
ATOM   207  C CB  . ALA A 1 35  ? -56.695 12.807 -99.089  1.00 21.91 ? 30   ALA A CB  1 
ATOM   208  N N   . GLN A 1 36  ? -55.780 15.533 -100.505 1.00 24.43 ? 31   GLN A N   1 
ATOM   209  C CA  . GLN A 1 36  ? -54.891 16.698 -100.475 1.00 24.47 ? 31   GLN A CA  1 
ATOM   210  C C   . GLN A 1 36  ? -55.607 18.009 -100.243 1.00 22.53 ? 31   GLN A C   1 
ATOM   211  O O   . GLN A 1 36  ? -55.015 18.943 -99.719  1.00 23.40 ? 31   GLN A O   1 
ATOM   212  C CB  . GLN A 1 36  ? -54.011 16.808 -101.738 1.00 27.29 ? 31   GLN A CB  1 
ATOM   213  C CG  . GLN A 1 36  ? -54.723 16.721 -103.066 1.00 33.09 ? 31   GLN A CG  1 
ATOM   214  C CD  . GLN A 1 36  ? -54.774 15.289 -103.621 1.00 37.81 ? 31   GLN A CD  1 
ATOM   215  O OE1 . GLN A 1 36  ? -55.080 14.324 -102.887 1.00 38.98 ? 31   GLN A OE1 1 
ATOM   216  N NE2 . GLN A 1 36  ? -54.477 15.143 -104.927 1.00 38.25 ? 31   GLN A NE2 1 
ATOM   217  N N   . PHE A 1 37  ? -56.878 18.089 -100.603 1.00 20.87 ? 32   PHE A N   1 
ATOM   218  C CA  . PHE A 1 37  ? -57.620 19.325 -100.380 1.00 20.15 ? 32   PHE A CA  1 
ATOM   219  C C   . PHE A 1 37  ? -58.696 19.209 -99.306  1.00 20.62 ? 32   PHE A C   1 
ATOM   220  O O   . PHE A 1 37  ? -59.520 18.281 -99.329  1.00 19.04 ? 32   PHE A O   1 
ATOM   221  C CB  . PHE A 1 37  ? -58.260 19.814 -101.678 1.00 18.02 ? 32   PHE A CB  1 
ATOM   222  C CG  . PHE A 1 37  ? -57.290 19.970 -102.781 1.00 17.58 ? 32   PHE A CG  1 
ATOM   223  C CD1 . PHE A 1 37  ? -57.274 19.072 -103.835 1.00 18.82 ? 32   PHE A CD1 1 
ATOM   224  C CD2 . PHE A 1 37  ? -56.324 20.956 -102.721 1.00 18.53 ? 32   PHE A CD2 1 
ATOM   225  C CE1 . PHE A 1 37  ? -56.304 19.138 -104.817 1.00 19.48 ? 32   PHE A CE1 1 
ATOM   226  C CE2 . PHE A 1 37  ? -55.348 21.041 -103.689 1.00 20.08 ? 32   PHE A CE2 1 
ATOM   227  C CZ  . PHE A 1 37  ? -55.334 20.123 -104.746 1.00 20.97 ? 32   PHE A CZ  1 
ATOM   228  N N   . ASP A 1 38  ? -58.678 20.173 -98.381  1.00 21.18 ? 33   ASP A N   1 
ATOM   229  C CA  . ASP A 1 38  ? -59.639 20.252 -97.289  1.00 21.96 ? 33   ASP A CA  1 
ATOM   230  C C   . ASP A 1 38  ? -61.061 20.404 -97.874  1.00 22.53 ? 33   ASP A C   1 
ATOM   231  O O   . ASP A 1 38  ? -61.312 21.320 -98.661  1.00 22.65 ? 33   ASP A O   1 
ATOM   232  C CB  . ASP A 1 38  ? -59.297 21.453 -96.427  1.00 23.69 ? 33   ASP A CB  1 
ATOM   233  C CG  . ASP A 1 38  ? -60.118 21.507 -95.176  1.00 28.14 ? 33   ASP A CG  1 
ATOM   234  O OD1 . ASP A 1 38  ? -61.371 21.560 -95.249  1.00 31.39 ? 33   ASP A OD1 1 
ATOM   235  O OD2 . ASP A 1 38  ? -59.506 21.491 -94.098  1.00 31.46 ? 33   ASP A OD2 1 
ATOM   236  N N   . PRO A 1 39  ? -62.008 19.521 -97.489  1.00 21.96 ? 34   PRO A N   1 
ATOM   237  C CA  . PRO A 1 39  ? -63.384 19.569 -97.990  1.00 22.18 ? 34   PRO A CA  1 
ATOM   238  C C   . PRO A 1 39  ? -64.079 20.893 -97.759  1.00 22.89 ? 34   PRO A C   1 
ATOM   239  O O   . PRO A 1 39  ? -64.975 21.265 -98.521  1.00 24.05 ? 34   PRO A O   1 
ATOM   240  C CB  . PRO A 1 39  ? -64.067 18.440 -97.237  1.00 22.65 ? 34   PRO A CB  1 
ATOM   241  C CG  . PRO A 1 39  ? -63.382 18.484 -95.929  1.00 23.18 ? 34   PRO A CG  1 
ATOM   242  C CD  . PRO A 1 39  ? -61.925 18.596 -96.352  1.00 22.24 ? 34   PRO A CD  1 
ATOM   243  N N   . ARG A 1 40  ? -63.690 21.614 -96.716  1.00 21.52 ? 35   ARG A N   1 
ATOM   244  C CA  . ARG A 1 40  ? -64.330 22.895 -96.501  1.00 22.00 ? 35   ARG A CA  1 
ATOM   245  C C   . ARG A 1 40  ? -63.808 23.937 -97.499  1.00 21.45 ? 35   ARG A C   1 
ATOM   246  O O   . ARG A 1 40  ? -62.733 24.498 -97.302  1.00 22.35 ? 35   ARG A O   1 
ATOM   247  C CB  . ARG A 1 40  ? -64.096 23.368 -95.077  1.00 23.69 ? 35   ARG A CB  1 
ATOM   248  C CG  . ARG A 1 40  ? -64.736 24.690 -94.801  1.00 25.80 ? 35   ARG A CG  1 
ATOM   249  C CD  . ARG A 1 40  ? -65.188 24.771 -93.373  1.00 31.24 ? 35   ARG A CD  1 
ATOM   250  N NE  . ARG A 1 40  ? -65.921 26.010 -93.123  1.00 34.97 ? 35   ARG A NE  1 
ATOM   251  C CZ  . ARG A 1 40  ? -65.363 27.222 -93.148  1.00 36.82 ? 35   ARG A CZ  1 
ATOM   252  N NH1 . ARG A 1 40  ? -64.056 27.354 -93.408  1.00 35.66 ? 35   ARG A NH1 1 
ATOM   253  N NH2 . ARG A 1 40  ? -66.113 28.302 -92.919  1.00 36.53 ? 35   ARG A NH2 1 
ATOM   254  N N   . VAL A 1 41  ? -64.558 24.179 -98.572  1.00 18.87 ? 36   VAL A N   1 
ATOM   255  C CA  . VAL A 1 41  ? -64.149 25.159 -99.579  1.00 18.38 ? 36   VAL A CA  1 
ATOM   256  C C   . VAL A 1 41  ? -64.945 26.446 -99.390  1.00 18.93 ? 36   VAL A C   1 
ATOM   257  O O   . VAL A 1 41  ? -66.173 26.454 -99.554  1.00 19.16 ? 36   VAL A O   1 
ATOM   258  C CB  . VAL A 1 41  ? -64.390 24.631 -101.038 1.00 17.78 ? 36   VAL A CB  1 
ATOM   259  C CG1 . VAL A 1 41  ? -63.975 25.689 -102.071 1.00 15.43 ? 36   VAL A CG1 1 
ATOM   260  C CG2 . VAL A 1 41  ? -63.609 23.345 -101.264 1.00 14.91 ? 36   VAL A CG2 1 
ATOM   261  N N   . THR A 1 42  ? -64.263 27.534 -99.043  1.00 18.43 ? 37   THR A N   1 
ATOM   262  C CA  . THR A 1 42  ? -64.972 28.794 -98.848  1.00 19.20 ? 37   THR A CA  1 
ATOM   263  C C   . THR A 1 42  ? -65.017 29.609 -100.116 1.00 19.64 ? 37   THR A C   1 
ATOM   264  O O   . THR A 1 42  ? -64.127 29.536 -100.955 1.00 21.22 ? 37   THR A O   1 
ATOM   265  C CB  . THR A 1 42  ? -64.336 29.669 -97.773  1.00 19.04 ? 37   THR A CB  1 
ATOM   266  O OG1 . THR A 1 42  ? -63.040 30.085 -98.207  1.00 18.06 ? 37   THR A OG1 1 
ATOM   267  C CG2 . THR A 1 42  ? -64.251 28.917 -96.459  1.00 17.59 ? 37   THR A CG2 1 
ATOM   268  N N   . MET A 1 43  ? -66.069 30.394 -100.253 1.00 19.72 ? 38   MET A N   1 
ATOM   269  C CA  . MET A 1 43  ? -66.237 31.219 -101.431 1.00 19.67 ? 38   MET A CA  1 
ATOM   270  C C   . MET A 1 43  ? -66.638 32.627 -101.019 1.00 19.30 ? 38   MET A C   1 
ATOM   271  O O   . MET A 1 43  ? -67.656 32.826 -100.360 1.00 18.19 ? 38   MET A O   1 
ATOM   272  C CB  . MET A 1 43  ? -67.304 30.607 -102.347 1.00 18.80 ? 38   MET A CB  1 
ATOM   273  C CG  . MET A 1 43  ? -67.598 31.438 -103.587 1.00 18.89 ? 38   MET A CG  1 
ATOM   274  S SD  . MET A 1 43  ? -68.763 30.627 -104.676 1.00 19.80 ? 38   MET A SD  1 
ATOM   275  C CE  . MET A 1 43  ? -70.207 30.612 -103.697 1.00 19.74 ? 38   MET A CE  1 
ATOM   276  N N   . TRP A 1 44  ? -65.825 33.609 -101.389 1.00 19.98 ? 39   TRP A N   1 
ATOM   277  C CA  . TRP A 1 44  ? -66.159 34.979 -101.036 1.00 20.55 ? 39   TRP A CA  1 
ATOM   278  C C   . TRP A 1 44  ? -67.298 35.454 -101.931 1.00 19.95 ? 39   TRP A C   1 
ATOM   279  O O   . TRP A 1 44  ? -67.220 35.404 -103.153 1.00 20.12 ? 39   TRP A O   1 
ATOM   280  C CB  . TRP A 1 44  ? -64.956 35.926 -101.179 1.00 20.42 ? 39   TRP A CB  1 
ATOM   281  C CG  . TRP A 1 44  ? -65.379 37.338 -100.884 1.00 20.03 ? 39   TRP A CG  1 
ATOM   282  C CD1 . TRP A 1 44  ? -65.904 37.792 -99.715  1.00 16.89 ? 39   TRP A CD1 1 
ATOM   283  C CD2 . TRP A 1 44  ? -65.529 38.411 -101.834 1.00 19.93 ? 39   TRP A CD2 1 
ATOM   284  N NE1 . TRP A 1 44  ? -66.390 39.062 -99.872  1.00 17.85 ? 39   TRP A NE1 1 
ATOM   285  C CE2 . TRP A 1 44  ? -66.177 39.472 -101.161 1.00 19.54 ? 39   TRP A CE2 1 
ATOM   286  C CE3 . TRP A 1 44  ? -65.188 38.573 -103.188 1.00 18.47 ? 39   TRP A CE3 1 
ATOM   287  C CZ2 . TRP A 1 44  ? -66.495 40.683 -101.794 1.00 19.00 ? 39   TRP A CZ2 1 
ATOM   288  C CZ3 . TRP A 1 44  ? -65.504 39.775 -103.818 1.00 18.80 ? 39   TRP A CZ3 1 
ATOM   289  C CH2 . TRP A 1 44  ? -66.152 40.815 -103.118 1.00 18.95 ? 39   TRP A CH2 1 
ATOM   290  N N   . VAL A 1 45  ? -68.373 35.900 -101.310 1.00 20.00 ? 40   VAL A N   1 
ATOM   291  C CA  . VAL A 1 45  ? -69.520 36.374 -102.061 1.00 19.72 ? 40   VAL A CA  1 
ATOM   292  C C   . VAL A 1 45  ? -69.798 37.820 -101.696 1.00 20.98 ? 40   VAL A C   1 
ATOM   293  O O   . VAL A 1 45  ? -70.007 38.149 -100.531 1.00 20.96 ? 40   VAL A O   1 
ATOM   294  C CB  . VAL A 1 45  ? -70.795 35.547 -101.760 1.00 17.73 ? 40   VAL A CB  1 
ATOM   295  C CG1 . VAL A 1 45  ? -71.959 36.100 -102.556 1.00 15.59 ? 40   VAL A CG1 1 
ATOM   296  C CG2 . VAL A 1 45  ? -70.561 34.079 -102.073 1.00 16.53 ? 40   VAL A CG2 1 
ATOM   297  N N   . PHE A 1 46  ? -69.759 38.686 -102.696 1.00 22.28 ? 41   PHE A N   1 
ATOM   298  C CA  . PHE A 1 46  ? -70.054 40.084 -102.484 1.00 24.45 ? 41   PHE A CA  1 
ATOM   299  C C   . PHE A 1 46  ? -71.560 40.113 -102.157 1.00 25.59 ? 41   PHE A C   1 
ATOM   300  O O   . PHE A 1 46  ? -72.403 39.902 -103.026 1.00 25.93 ? 41   PHE A O   1 
ATOM   301  C CB  . PHE A 1 46  ? -69.731 40.851 -103.757 1.00 24.71 ? 41   PHE A CB  1 
ATOM   302  C CG  . PHE A 1 46  ? -70.234 42.242 -103.754 1.00 27.46 ? 41   PHE A CG  1 
ATOM   303  C CD1 . PHE A 1 46  ? -71.390 42.578 -104.450 1.00 28.05 ? 41   PHE A CD1 1 
ATOM   304  C CD2 . PHE A 1 46  ? -69.564 43.234 -103.039 1.00 28.64 ? 41   PHE A CD2 1 
ATOM   305  C CE1 . PHE A 1 46  ? -71.878 43.893 -104.436 1.00 28.75 ? 41   PHE A CE1 1 
ATOM   306  C CE2 . PHE A 1 46  ? -70.046 44.553 -103.019 1.00 29.40 ? 41   PHE A CE2 1 
ATOM   307  C CZ  . PHE A 1 46  ? -71.206 44.878 -103.721 1.00 28.13 ? 41   PHE A CZ  1 
ATOM   308  N N   . GLU A 1 47  ? -71.900 40.363 -100.898 1.00 27.10 ? 42   GLU A N   1 
ATOM   309  C CA  . GLU A 1 47  ? -73.305 40.344 -100.496 1.00 29.47 ? 42   GLU A CA  1 
ATOM   310  C C   . GLU A 1 47  ? -74.256 41.144 -101.360 1.00 30.51 ? 42   GLU A C   1 
ATOM   311  O O   . GLU A 1 47  ? -73.941 42.242 -101.807 1.00 31.68 ? 42   GLU A O   1 
ATOM   312  C CB  . GLU A 1 47  ? -73.470 40.809 -99.061  1.00 28.98 ? 42   GLU A CB  1 
ATOM   313  C CG  . GLU A 1 47  ? -74.818 40.418 -98.513  1.00 30.65 ? 42   GLU A CG  1 
ATOM   314  C CD  . GLU A 1 47  ? -74.935 38.910 -98.302  1.00 32.63 ? 42   GLU A CD  1 
ATOM   315  O OE1 . GLU A 1 47  ? -74.433 38.410 -97.270  1.00 32.59 ? 42   GLU A OE1 1 
ATOM   316  O OE2 . GLU A 1 47  ? -75.516 38.226 -99.173  1.00 31.88 ? 42   GLU A OE2 1 
ATOM   317  N N   . GLU A 1 48  ? -75.437 40.588 -101.575 1.00 31.14 ? 43   GLU A N   1 
ATOM   318  C CA  . GLU A 1 48  ? -76.449 41.245 -102.383 1.00 32.88 ? 43   GLU A CA  1 
ATOM   319  C C   . GLU A 1 48  ? -77.819 41.002 -101.790 1.00 34.64 ? 43   GLU A C   1 
ATOM   320  O O   . GLU A 1 48  ? -78.036 40.000 -101.111 1.00 34.78 ? 43   GLU A O   1 
ATOM   321  C CB  . GLU A 1 48  ? -76.437 40.709 -103.811 1.00 32.37 ? 43   GLU A CB  1 
ATOM   322  C CG  . GLU A 1 48  ? -75.404 41.327 -104.730 1.00 32.88 ? 43   GLU A CG  1 
ATOM   323  C CD  . GLU A 1 48  ? -75.578 40.847 -106.163 1.00 33.28 ? 43   GLU A CD  1 
ATOM   324  O OE1 . GLU A 1 48  ? -75.057 39.775 -106.508 1.00 34.19 ? 43   GLU A OE1 1 
ATOM   325  O OE2 . GLU A 1 48  ? -76.263 41.529 -106.942 1.00 33.35 ? 43   GLU A OE2 1 
ATOM   326  N N   . ASP A 1 49  ? -78.747 41.919 -102.038 1.00 36.74 ? 44   ASP A N   1 
ATOM   327  C CA  . ASP A 1 49  ? -80.091 41.740 -101.529 1.00 39.76 ? 44   ASP A CA  1 
ATOM   328  C C   . ASP A 1 49  ? -80.969 41.170 -102.624 1.00 39.99 ? 44   ASP A C   1 
ATOM   329  O O   . ASP A 1 49  ? -81.303 41.865 -103.583 1.00 40.61 ? 44   ASP A O   1 
ATOM   330  C CB  . ASP A 1 49  ? -80.696 43.054 -101.050 1.00 42.61 ? 44   ASP A CB  1 
ATOM   331  C CG  . ASP A 1 49  ? -82.170 42.903 -100.672 1.00 47.28 ? 44   ASP A CG  1 
ATOM   332  O OD1 . ASP A 1 49  ? -82.455 42.145 -99.713  1.00 48.75 ? 44   ASP A OD1 1 
ATOM   333  O OD2 . ASP A 1 49  ? -83.047 43.524 -101.335 1.00 49.53 ? 44   ASP A OD2 1 
ATOM   334  N N   . ILE A 1 50  ? -81.328 39.899 -102.486 1.00 39.93 ? 45   ILE A N   1 
ATOM   335  C CA  . ILE A 1 50  ? -82.189 39.257 -103.458 1.00 40.69 ? 45   ILE A CA  1 
ATOM   336  C C   . ILE A 1 50  ? -83.562 39.061 -102.834 1.00 41.81 ? 45   ILE A C   1 
ATOM   337  O O   . ILE A 1 50  ? -83.802 38.081 -102.118 1.00 41.39 ? 45   ILE A O   1 
ATOM   338  C CB  . ILE A 1 50  ? -81.604 37.903 -103.916 1.00 40.15 ? 45   ILE A CB  1 
ATOM   339  C CG1 . ILE A 1 50  ? -80.599 38.138 -105.037 1.00 39.24 ? 45   ILE A CG1 1 
ATOM   340  C CG2 . ILE A 1 50  ? -82.702 36.988 -104.417 1.00 38.78 ? 45   ILE A CG2 1 
ATOM   341  C CD1 . ILE A 1 50  ? -79.427 38.963 -104.634 1.00 40.38 ? 45   ILE A CD1 1 
ATOM   342  N N   . GLY A 1 51  ? -84.454 40.016 -103.105 1.00 43.09 ? 46   GLY A N   1 
ATOM   343  C CA  . GLY A 1 51  ? -85.805 39.958 -102.576 1.00 44.08 ? 46   GLY A CA  1 
ATOM   344  C C   . GLY A 1 51  ? -85.880 39.845 -101.061 1.00 45.24 ? 46   GLY A C   1 
ATOM   345  O O   . GLY A 1 51  ? -86.626 39.021 -100.532 1.00 45.63 ? 46   GLY A O   1 
ATOM   346  N N   . GLY A 1 52  ? -85.107 40.661 -100.351 1.00 45.77 ? 47   GLY A N   1 
ATOM   347  C CA  . GLY A 1 52  ? -85.138 40.602 -98.897  1.00 46.15 ? 47   GLY A CA  1 
ATOM   348  C C   . GLY A 1 52  ? -84.092 39.690 -98.282  1.00 46.51 ? 47   GLY A C   1 
ATOM   349  O O   . GLY A 1 52  ? -83.564 39.975 -97.206  1.00 46.68 ? 47   GLY A O   1 
ATOM   350  N N   . LYS A 1 53  ? -83.792 38.584 -98.956  1.00 46.24 ? 48   LYS A N   1 
ATOM   351  C CA  . LYS A 1 53  ? -82.789 37.654 -98.455  1.00 45.09 ? 48   LYS A CA  1 
ATOM   352  C C   . LYS A 1 53  ? -81.379 38.070 -98.869  1.00 43.28 ? 48   LYS A C   1 
ATOM   353  O O   . LYS A 1 53  ? -81.184 38.745 -99.880  1.00 42.53 ? 48   LYS A O   1 
ATOM   354  C CB  . LYS A 1 53  ? -83.057 36.246 -98.985  1.00 45.99 ? 48   LYS A CB  1 
ATOM   355  C CG  . LYS A 1 53  ? -84.442 35.711 -98.701  1.00 49.23 ? 48   LYS A CG  1 
ATOM   356  C CD  . LYS A 1 53  ? -84.575 34.263 -99.178  1.00 51.91 ? 48   LYS A CD  1 
ATOM   357  C CE  . LYS A 1 53  ? -85.950 33.671 -98.878  1.00 53.35 ? 48   LYS A CE  1 
ATOM   358  N NZ  . LYS A 1 53  ? -86.286 33.724 -97.412  1.00 55.43 ? 48   LYS A NZ  1 
ATOM   359  N N   . LYS A 1 54  ? -80.397 37.673 -98.068  1.00 42.11 ? 49   LYS A N   1 
ATOM   360  C CA  . LYS A 1 54  ? -79.004 37.942 -98.385  1.00 40.44 ? 49   LYS A CA  1 
ATOM   361  C C   . LYS A 1 54  ? -78.604 36.800 -99.315  1.00 39.51 ? 49   LYS A C   1 
ATOM   362  O O   . LYS A 1 54  ? -78.975 35.651 -99.087  1.00 40.23 ? 49   LYS A O   1 
ATOM   363  C CB  . LYS A 1 54  ? -78.136 37.880 -97.137  1.00 39.59 ? 49   LYS A CB  1 
ATOM   364  C CG  . LYS A 1 54  ? -78.628 38.717 -96.027  1.00 41.38 ? 49   LYS A CG  1 
ATOM   365  C CD  . LYS A 1 54  ? -77.662 38.644 -94.885  1.00 45.10 ? 49   LYS A CD  1 
ATOM   366  C CE  . LYS A 1 54  ? -78.108 39.545 -93.750  1.00 47.81 ? 49   LYS A CE  1 
ATOM   367  N NZ  . LYS A 1 54  ? -77.130 39.521 -92.629  1.00 50.94 ? 49   LYS A NZ  1 
ATOM   368  N N   . LEU A 1 55  ? -77.858 37.114 -100.365 1.00 37.77 ? 50   LEU A N   1 
ATOM   369  C CA  . LEU A 1 55  ? -77.426 36.096 -101.303 1.00 34.91 ? 50   LEU A CA  1 
ATOM   370  C C   . LEU A 1 55  ? -76.603 35.050 -100.585 1.00 33.29 ? 50   LEU A C   1 
ATOM   371  O O   . LEU A 1 55  ? -76.713 33.873 -100.896 1.00 33.25 ? 50   LEU A O   1 
ATOM   372  C CB  . LEU A 1 55  ? -76.609 36.726 -102.428 1.00 34.93 ? 50   LEU A CB  1 
ATOM   373  C CG  . LEU A 1 55  ? -76.111 35.829 -103.561 1.00 34.67 ? 50   LEU A CG  1 
ATOM   374  C CD1 . LEU A 1 55  ? -77.252 35.012 -104.152 1.00 33.46 ? 50   LEU A CD1 1 
ATOM   375  C CD2 . LEU A 1 55  ? -75.470 36.719 -104.625 1.00 34.00 ? 50   LEU A CD2 1 
ATOM   376  N N   . THR A 1 56  ? -75.797 35.459 -99.610  1.00 32.13 ? 51   THR A N   1 
ATOM   377  C CA  . THR A 1 56  ? -74.986 34.478 -98.901  1.00 33.27 ? 51   THR A CA  1 
ATOM   378  C C   . THR A 1 56  ? -75.840 33.441 -98.166  1.00 33.76 ? 51   THR A C   1 
ATOM   379  O O   . THR A 1 56  ? -75.432 32.292 -98.005  1.00 33.65 ? 51   THR A O   1 
ATOM   380  C CB  . THR A 1 56  ? -73.992 35.131 -97.918  1.00 31.85 ? 51   THR A CB  1 
ATOM   381  O OG1 . THR A 1 56  ? -74.689 36.025 -97.054  1.00 34.23 ? 51   THR A OG1 1 
ATOM   382  C CG2 . THR A 1 56  ? -72.909 35.873 -98.672  1.00 30.75 ? 51   THR A CG2 1 
ATOM   383  N N   . GLU A 1 57  ? -77.032 33.830 -97.740  1.00 34.00 ? 52   GLU A N   1 
ATOM   384  C CA  . GLU A 1 57  ? -77.887 32.883 -97.064  1.00 35.10 ? 52   GLU A CA  1 
ATOM   385  C C   . GLU A 1 57  ? -78.568 31.953 -98.059  1.00 34.19 ? 52   GLU A C   1 
ATOM   386  O O   . GLU A 1 57  ? -78.740 30.761 -97.770  1.00 33.93 ? 52   GLU A O   1 
ATOM   387  C CB  . GLU A 1 57  ? -78.890 33.625 -96.188  1.00 38.77 ? 52   GLU A CB  1 
ATOM   388  C CG  . GLU A 1 57  ? -78.324 33.862 -94.779  1.00 44.90 ? 52   GLU A CG  1 
ATOM   389  C CD  . GLU A 1 57  ? -79.044 34.948 -93.978  1.00 47.43 ? 52   GLU A CD  1 
ATOM   390  O OE1 . GLU A 1 57  ? -80.281 35.072 -94.137  1.00 48.87 ? 52   GLU A OE1 1 
ATOM   391  O OE2 . GLU A 1 57  ? -78.367 35.663 -93.179  1.00 48.52 ? 52   GLU A OE2 1 
ATOM   392  N N   . ILE A 1 58  ? -78.929 32.482 -99.235  1.00 32.13 ? 53   ILE A N   1 
ATOM   393  C CA  . ILE A 1 58  ? -79.563 31.675 -100.292 1.00 30.62 ? 53   ILE A CA  1 
ATOM   394  C C   . ILE A 1 58  ? -78.634 30.511 -100.668 1.00 30.46 ? 53   ILE A C   1 
ATOM   395  O O   . ILE A 1 58  ? -79.041 29.345 -100.673 1.00 30.12 ? 53   ILE A O   1 
ATOM   396  C CB  . ILE A 1 58  ? -79.780 32.464 -101.599 1.00 30.63 ? 53   ILE A CB  1 
ATOM   397  C CG1 . ILE A 1 58  ? -80.466 33.796 -101.322 1.00 31.45 ? 53   ILE A CG1 1 
ATOM   398  C CG2 . ILE A 1 58  ? -80.591 31.628 -102.573 1.00 27.25 ? 53   ILE A CG2 1 
ATOM   399  C CD1 . ILE A 1 58  ? -81.841 33.661 -100.825 1.00 34.06 ? 53   ILE A CD1 1 
ATOM   400  N N   . ILE A 1 59  ? -77.387 30.862 -100.987 1.00 28.34 ? 54   ILE A N   1 
ATOM   401  C CA  . ILE A 1 59  ? -76.359 29.906 -101.374 1.00 26.93 ? 54   ILE A CA  1 
ATOM   402  C C   . ILE A 1 59  ? -76.139 28.822 -100.306 1.00 27.29 ? 54   ILE A C   1 
ATOM   403  O O   . ILE A 1 59  ? -76.206 27.619 -100.594 1.00 25.47 ? 54   ILE A O   1 
ATOM   404  C CB  . ILE A 1 59  ? -75.005 30.645 -101.667 1.00 25.95 ? 54   ILE A CB  1 
ATOM   405  C CG1 . ILE A 1 59  ? -75.134 31.533 -102.913 1.00 25.50 ? 54   ILE A CG1 1 
ATOM   406  C CG2 . ILE A 1 59  ? -73.896 29.649 -101.896 1.00 23.68 ? 54   ILE A CG2 1 
ATOM   407  C CD1 . ILE A 1 59  ? -73.975 32.518 -103.128 1.00 23.05 ? 54   ILE A CD1 1 
ATOM   408  N N   . ASN A 1 60  ? -75.888 29.244 -99.069  1.00 27.99 ? 55   ASN A N   1 
ATOM   409  C CA  . ASN A 1 60  ? -75.646 28.285 -97.994  1.00 28.77 ? 55   ASN A CA  1 
ATOM   410  C C   . ASN A 1 60  ? -76.862 27.478 -97.606  1.00 29.14 ? 55   ASN A C   1 
ATOM   411  O O   . ASN A 1 60  ? -76.751 26.504 -96.874  1.00 28.37 ? 55   ASN A O   1 
ATOM   412  C CB  . ASN A 1 60  ? -75.122 28.987 -96.760  1.00 27.25 ? 55   ASN A CB  1 
ATOM   413  C CG  . ASN A 1 60  ? -73.795 29.617 -96.996  1.00 28.85 ? 55   ASN A CG  1 
ATOM   414  O OD1 . ASN A 1 60  ? -72.966 29.088 -97.739  1.00 29.74 ? 55   ASN A OD1 1 
ATOM   415  N ND2 . ASN A 1 60  ? -73.565 30.754 -96.358  1.00 30.06 ? 55   ASN A ND2 1 
ATOM   416  N N   . THR A 1 61  ? -78.020 27.900 -98.097  1.00 29.92 ? 56   THR A N   1 
ATOM   417  C CA  . THR A 1 61  ? -79.272 27.231 -97.797  1.00 30.37 ? 56   THR A CA  1 
ATOM   418  C C   . THR A 1 61  ? -79.736 26.348 -98.945  1.00 30.72 ? 56   THR A C   1 
ATOM   419  O O   . THR A 1 61  ? -80.018 25.172 -98.759  1.00 30.16 ? 56   THR A O   1 
ATOM   420  C CB  . THR A 1 61  ? -80.367 28.269 -97.483  1.00 30.91 ? 56   THR A CB  1 
ATOM   421  O OG1 . THR A 1 61  ? -80.337 28.583 -96.084  1.00 28.46 ? 56   THR A OG1 1 
ATOM   422  C CG2 . THR A 1 61  ? -81.738 27.740 -97.874  1.00 31.51 ? 56   THR A CG2 1 
ATOM   423  N N   . GLN A 1 62  ? -79.810 26.917 -100.138 1.00 31.93 ? 57   GLN A N   1 
ATOM   424  C CA  . GLN A 1 62  ? -80.253 26.156 -101.287 1.00 33.35 ? 57   GLN A CA  1 
ATOM   425  C C   . GLN A 1 62  ? -79.120 25.643 -102.117 1.00 32.17 ? 57   GLN A C   1 
ATOM   426  O O   . GLN A 1 62  ? -79.341 24.960 -103.109 1.00 33.12 ? 57   GLN A O   1 
ATOM   427  C CB  . GLN A 1 62  ? -81.144 27.008 -102.149 1.00 35.50 ? 57   GLN A CB  1 
ATOM   428  C CG  . GLN A 1 62  ? -82.288 27.529 -101.379 1.00 42.48 ? 57   GLN A CG  1 
ATOM   429  C CD  . GLN A 1 62  ? -83.265 28.215 -102.268 1.00 47.40 ? 57   GLN A CD  1 
ATOM   430  O OE1 . GLN A 1 62  ? -82.957 29.251 -102.879 1.00 49.72 ? 57   GLN A OE1 1 
ATOM   431  N NE2 . GLN A 1 62  ? -84.463 27.639 -102.370 1.00 50.42 ? 57   GLN A NE2 1 
ATOM   432  N N   . HIS A 1 63  ? -77.903 25.979 -101.717 1.00 30.98 ? 58   HIS A N   1 
ATOM   433  C CA  . HIS A 1 63  ? -76.726 25.543 -102.445 1.00 30.26 ? 58   HIS A CA  1 
ATOM   434  C C   . HIS A 1 63  ? -76.873 25.739 -103.960 1.00 30.27 ? 58   HIS A C   1 
ATOM   435  O O   . HIS A 1 63  ? -76.816 24.786 -104.740 1.00 29.64 ? 58   HIS A O   1 
ATOM   436  C CB  . HIS A 1 63  ? -76.442 24.087 -102.086 1.00 29.03 ? 58   HIS A CB  1 
ATOM   437  C CG  . HIS A 1 63  ? -76.220 23.875 -100.618 1.00 28.94 ? 58   HIS A CG  1 
ATOM   438  N ND1 . HIS A 1 63  ? -75.179 24.466 -99.931  1.00 28.68 ? 58   HIS A ND1 1 
ATOM   439  C CD2 . HIS A 1 63  ? -76.929 23.181 -99.699  1.00 27.54 ? 58   HIS A CD2 1 
ATOM   440  C CE1 . HIS A 1 63  ? -75.258 24.145 -98.654  1.00 27.88 ? 58   HIS A CE1 1 
ATOM   441  N NE2 . HIS A 1 63  ? -76.310 23.366 -98.486  1.00 27.52 ? 58   HIS A NE2 1 
ATOM   442  N N   . GLU A 1 64  ? -77.072 26.998 -104.352 1.00 30.58 ? 59   GLU A N   1 
ATOM   443  C CA  . GLU A 1 64  ? -77.215 27.394 -105.751 1.00 31.89 ? 59   GLU A CA  1 
ATOM   444  C C   . GLU A 1 64  ? -77.119 28.911 -105.904 1.00 31.51 ? 59   GLU A C   1 
ATOM   445  O O   . GLU A 1 64  ? -77.753 29.663 -105.170 1.00 33.39 ? 59   GLU A O   1 
ATOM   446  C CB  . GLU A 1 64  ? -78.556 26.937 -106.304 1.00 32.88 ? 59   GLU A CB  1 
ATOM   447  C CG  . GLU A 1 64  ? -79.726 27.407 -105.486 1.00 37.51 ? 59   GLU A CG  1 
ATOM   448  C CD  . GLU A 1 64  ? -81.053 27.104 -106.145 1.00 41.23 ? 59   GLU A CD  1 
ATOM   449  O OE1 . GLU A 1 64  ? -82.121 27.312 -105.519 1.00 41.32 ? 59   GLU A OE1 1 
ATOM   450  O OE2 . GLU A 1 64  ? -81.023 26.659 -107.308 1.00 45.97 ? 59   GLU A OE2 1 
ATOM   451  N N   . ASN A 1 65  ? -76.302 29.375 -106.836 1.00 28.96 ? 60   ASN A N   1 
ATOM   452  C CA  . ASN A 1 65  ? -76.225 30.802 -107.048 1.00 26.74 ? 60   ASN A CA  1 
ATOM   453  C C   . ASN A 1 65  ? -76.947 30.991 -108.356 1.00 26.76 ? 60   ASN A C   1 
ATOM   454  O O   . ASN A 1 65  ? -76.354 31.346 -109.363 1.00 26.25 ? 60   ASN A O   1 
ATOM   455  C CB  . ASN A 1 65  ? -74.786 31.272 -107.172 1.00 24.92 ? 60   ASN A CB  1 
ATOM   456  C CG  . ASN A 1 65  ? -74.668 32.772 -107.073 1.00 24.28 ? 60   ASN A CG  1 
ATOM   457  O OD1 . ASN A 1 65  ? -73.578 33.308 -106.949 1.00 25.73 ? 60   ASN A OD1 1 
ATOM   458  N ND2 . ASN A 1 65  ? -75.801 33.461 -107.127 1.00 23.25 ? 60   ASN A ND2 1 
ATOM   459  N N   . VAL A 1 66  ? -78.245 30.737 -108.337 1.00 27.50 ? 61   VAL A N   1 
ATOM   460  C CA  . VAL A 1 66  ? -79.029 30.831 -109.555 1.00 28.36 ? 61   VAL A CA  1 
ATOM   461  C C   . VAL A 1 66  ? -79.005 32.165 -110.264 1.00 27.99 ? 61   VAL A C   1 
ATOM   462  O O   . VAL A 1 66  ? -79.143 32.186 -111.483 1.00 29.41 ? 61   VAL A O   1 
ATOM   463  C CB  . VAL A 1 66  ? -80.491 30.426 -109.330 1.00 29.48 ? 61   VAL A CB  1 
ATOM   464  C CG1 . VAL A 1 66  ? -80.562 28.935 -108.905 1.00 27.59 ? 61   VAL A CG1 1 
ATOM   465  C CG2 . VAL A 1 66  ? -81.128 31.385 -108.313 1.00 28.54 ? 61   VAL A CG2 1 
ATOM   466  N N   . LYS A 1 67  ? -78.846 33.272 -109.541 1.00 26.09 ? 62   LYS A N   1 
ATOM   467  C CA  . LYS A 1 67  ? -78.777 34.567 -110.221 1.00 24.89 ? 62   LYS A CA  1 
ATOM   468  C C   . LYS A 1 67  ? -77.638 34.599 -111.247 1.00 24.54 ? 62   LYS A C   1 
ATOM   469  O O   . LYS A 1 67  ? -77.802 35.127 -112.342 1.00 24.58 ? 62   LYS A O   1 
ATOM   470  C CB  . LYS A 1 67  ? -78.550 35.717 -109.244 1.00 24.35 ? 62   LYS A CB  1 
ATOM   471  C CG  . LYS A 1 67  ? -78.243 37.023 -109.979 1.00 25.18 ? 62   LYS A CG  1 
ATOM   472  C CD  . LYS A 1 67  ? -78.166 38.224 -109.041 1.00 25.51 ? 62   LYS A CD  1 
ATOM   473  C CE  . LYS A 1 67  ? -77.890 39.504 -109.810 1.00 22.85 ? 62   LYS A CE  1 
ATOM   474  N NZ  . LYS A 1 67  ? -78.112 40.675 -108.926 1.00 24.51 ? 62   LYS A NZ  1 
ATOM   475  N N   . TYR A 1 68  ? -76.490 34.037 -110.881 1.00 23.74 ? 63   TYR A N   1 
ATOM   476  C CA  . TYR A 1 68  ? -75.327 34.023 -111.747 1.00 23.81 ? 63   TYR A CA  1 
ATOM   477  C C   . TYR A 1 68  ? -75.023 32.696 -112.438 1.00 24.90 ? 63   TYR A C   1 
ATOM   478  O O   . TYR A 1 68  ? -74.245 32.655 -113.401 1.00 24.74 ? 63   TYR A O   1 
ATOM   479  C CB  . TYR A 1 68  ? -74.103 34.466 -110.961 1.00 24.88 ? 63   TYR A CB  1 
ATOM   480  C CG  . TYR A 1 68  ? -74.184 35.900 -110.493 1.00 26.31 ? 63   TYR A CG  1 
ATOM   481  C CD1 . TYR A 1 68  ? -74.546 36.213 -109.176 1.00 24.81 ? 63   TYR A CD1 1 
ATOM   482  C CD2 . TYR A 1 68  ? -73.934 36.956 -111.383 1.00 26.62 ? 63   TYR A CD2 1 
ATOM   483  C CE1 . TYR A 1 68  ? -74.660 37.530 -108.759 1.00 24.36 ? 63   TYR A CE1 1 
ATOM   484  C CE2 . TYR A 1 68  ? -74.048 38.286 -110.970 1.00 26.48 ? 63   TYR A CE2 1 
ATOM   485  C CZ  . TYR A 1 68  ? -74.415 38.560 -109.656 1.00 24.82 ? 63   TYR A CZ  1 
ATOM   486  O OH  . TYR A 1 68  ? -74.567 39.860 -109.263 1.00 23.95 ? 63   TYR A OH  1 
ATOM   487  N N   . LEU A 1 69  ? -75.600 31.607 -111.938 1.00 24.89 ? 64   LEU A N   1 
ATOM   488  C CA  . LEU A 1 69  ? -75.396 30.298 -112.550 1.00 25.30 ? 64   LEU A CA  1 
ATOM   489  C C   . LEU A 1 69  ? -76.676 29.495 -112.346 1.00 26.82 ? 64   LEU A C   1 
ATOM   490  O O   . LEU A 1 69  ? -76.753 28.633 -111.468 1.00 27.95 ? 64   LEU A O   1 
ATOM   491  C CB  . LEU A 1 69  ? -74.207 29.561 -111.927 1.00 24.07 ? 64   LEU A CB  1 
ATOM   492  C CG  . LEU A 1 69  ? -73.718 28.380 -112.784 1.00 23.08 ? 64   LEU A CG  1 
ATOM   493  C CD1 . LEU A 1 69  ? -73.138 28.895 -114.060 1.00 20.79 ? 64   LEU A CD1 1 
ATOM   494  C CD2 . LEU A 1 69  ? -72.673 27.585 -112.042 1.00 23.41 ? 64   LEU A CD2 1 
ATOM   495  N N   . PRO A 1 70  ? -77.708 29.784 -113.155 1.00 27.43 ? 65   PRO A N   1 
ATOM   496  C CA  . PRO A 1 70  ? -79.041 29.173 -113.173 1.00 27.31 ? 65   PRO A CA  1 
ATOM   497  C C   . PRO A 1 70  ? -79.049 27.700 -113.533 1.00 26.70 ? 65   PRO A C   1 
ATOM   498  O O   . PRO A 1 70  ? -78.296 27.273 -114.411 1.00 26.18 ? 65   PRO A O   1 
ATOM   499  C CB  . PRO A 1 70  ? -79.777 29.960 -114.253 1.00 28.26 ? 65   PRO A CB  1 
ATOM   500  C CG  . PRO A 1 70  ? -79.130 31.253 -114.271 1.00 29.56 ? 65   PRO A CG  1 
ATOM   501  C CD  . PRO A 1 70  ? -77.667 30.944 -114.062 1.00 28.13 ? 65   PRO A CD  1 
ATOM   502  N N   . GLY A 1 71  ? -79.928 26.946 -112.874 1.00 25.81 ? 66   GLY A N   1 
ATOM   503  C CA  . GLY A 1 71  ? -80.087 25.530 -113.164 1.00 25.34 ? 66   GLY A CA  1 
ATOM   504  C C   . GLY A 1 71  ? -78.951 24.631 -112.741 1.00 24.99 ? 66   GLY A C   1 
ATOM   505  O O   . GLY A 1 71  ? -78.769 23.532 -113.274 1.00 24.64 ? 66   GLY A O   1 
ATOM   506  N N   . HIS A 1 72  ? -78.184 25.101 -111.775 1.00 24.47 ? 67   HIS A N   1 
ATOM   507  C CA  . HIS A 1 72  ? -77.061 24.342 -111.282 1.00 25.33 ? 67   HIS A CA  1 
ATOM   508  C C   . HIS A 1 72  ? -76.946 24.469 -109.778 1.00 25.13 ? 67   HIS A C   1 
ATOM   509  O O   . HIS A 1 72  ? -77.217 25.526 -109.213 1.00 27.49 ? 67   HIS A O   1 
ATOM   510  C CB  . HIS A 1 72  ? -75.787 24.820 -111.971 1.00 25.81 ? 67   HIS A CB  1 
ATOM   511  C CG  . HIS A 1 72  ? -75.712 24.426 -113.408 1.00 27.67 ? 67   HIS A CG  1 
ATOM   512  N ND1 . HIS A 1 72  ? -75.678 23.107 -113.813 1.00 28.58 ? 67   HIS A ND1 1 
ATOM   513  C CD2 . HIS A 1 72  ? -75.698 25.166 -114.540 1.00 28.06 ? 67   HIS A CD2 1 
ATOM   514  C CE1 . HIS A 1 72  ? -75.643 23.052 -115.131 1.00 27.82 ? 67   HIS A CE1 1 
ATOM   515  N NE2 . HIS A 1 72  ? -75.654 24.288 -115.597 1.00 28.99 ? 67   HIS A NE2 1 
ATOM   516  N N   . LYS A 1 73  ? -76.582 23.384 -109.117 1.00 23.99 ? 68   LYS A N   1 
ATOM   517  C CA  . LYS A 1 73  ? -76.447 23.438 -107.678 1.00 24.54 ? 68   LYS A CA  1 
ATOM   518  C C   . LYS A 1 73  ? -74.978 23.504 -107.390 1.00 23.62 ? 68   LYS A C   1 
ATOM   519  O O   . LYS A 1 73  ? -74.155 23.205 -108.255 1.00 23.84 ? 68   LYS A O   1 
ATOM   520  C CB  . LYS A 1 73  ? -77.039 22.191 -107.019 1.00 23.65 ? 68   LYS A CB  1 
ATOM   521  C CG  . LYS A 1 73  ? -78.457 21.902 -107.441 1.00 26.44 ? 68   LYS A CG  1 
ATOM   522  C CD  . LYS A 1 73  ? -79.478 22.913 -106.913 1.00 28.95 ? 68   LYS A CD  1 
ATOM   523  C CE  . LYS A 1 73  ? -79.690 22.755 -105.405 1.00 30.89 ? 68   LYS A CE  1 
ATOM   524  N NZ  . LYS A 1 73  ? -81.083 23.097 -104.992 1.00 30.63 ? 68   LYS A NZ  1 
ATOM   525  N N   . LEU A 1 74  ? -74.641 23.929 -106.185 1.00 22.79 ? 69   LEU A N   1 
ATOM   526  C CA  . LEU A 1 74  ? -73.245 23.963 -105.805 1.00 22.64 ? 69   LEU A CA  1 
ATOM   527  C C   . LEU A 1 74  ? -73.056 22.854 -104.796 1.00 22.04 ? 69   LEU A C   1 
ATOM   528  O O   . LEU A 1 74  ? -73.982 22.487 -104.079 1.00 21.98 ? 69   LEU A O   1 
ATOM   529  C CB  . LEU A 1 74  ? -72.863 25.303 -105.183 1.00 21.68 ? 69   LEU A CB  1 
ATOM   530  C CG  . LEU A 1 74  ? -73.137 26.470 -106.123 1.00 21.92 ? 69   LEU A CG  1 
ATOM   531  C CD1 . LEU A 1 74  ? -72.802 27.768 -105.415 1.00 19.50 ? 69   LEU A CD1 1 
ATOM   532  C CD2 . LEU A 1 74  ? -72.331 26.287 -107.411 1.00 20.75 ? 69   LEU A CD2 1 
ATOM   533  N N   . PRO A 1 75  ? -71.870 22.256 -104.777 1.00 21.66 ? 70   PRO A N   1 
ATOM   534  C CA  . PRO A 1 75  ? -71.619 21.188 -103.816 1.00 21.81 ? 70   PRO A CA  1 
ATOM   535  C C   . PRO A 1 75  ? -71.912 21.787 -102.430 1.00 20.79 ? 70   PRO A C   1 
ATOM   536  O O   . PRO A 1 75  ? -71.524 22.924 -102.163 1.00 21.49 ? 70   PRO A O   1 
ATOM   537  C CB  . PRO A 1 75  ? -70.137 20.901 -104.033 1.00 22.96 ? 70   PRO A CB  1 
ATOM   538  C CG  . PRO A 1 75  ? -69.978 21.156 -105.521 1.00 22.62 ? 70   PRO A CG  1 
ATOM   539  C CD  . PRO A 1 75  ? -70.746 22.418 -105.718 1.00 21.74 ? 70   PRO A CD  1 
ATOM   540  N N   . PRO A 1 76  ? -72.589 21.038 -101.537 1.00 19.52 ? 71   PRO A N   1 
ATOM   541  C CA  . PRO A 1 76  ? -72.920 21.531 -100.190 1.00 19.22 ? 71   PRO A CA  1 
ATOM   542  C C   . PRO A 1 76  ? -71.725 22.000 -99.358  1.00 19.35 ? 71   PRO A C   1 
ATOM   543  O O   . PRO A 1 76  ? -71.889 22.776 -98.414  1.00 20.33 ? 71   PRO A O   1 
ATOM   544  C CB  . PRO A 1 76  ? -73.619 20.335 -99.544  1.00 17.29 ? 71   PRO A CB  1 
ATOM   545  C CG  . PRO A 1 76  ? -74.248 19.676 -100.687 1.00 19.21 ? 71   PRO A CG  1 
ATOM   546  C CD  . PRO A 1 76  ? -73.162 19.702 -101.742 1.00 18.64 ? 71   PRO A CD  1 
ATOM   547  N N   . ASN A 1 77  ? -70.531 21.526 -99.700  1.00 17.86 ? 72   ASN A N   1 
ATOM   548  C CA  . ASN A 1 77  ? -69.349 21.905 -98.954  1.00 17.49 ? 72   ASN A CA  1 
ATOM   549  C C   . ASN A 1 77  ? -68.750 23.253 -99.323  1.00 19.11 ? 72   ASN A C   1 
ATOM   550  O O   . ASN A 1 77  ? -67.756 23.666 -98.709  1.00 20.99 ? 72   ASN A O   1 
ATOM   551  C CB  . ASN A 1 77  ? -68.281 20.805 -99.028  1.00 15.91 ? 72   ASN A CB  1 
ATOM   552  C CG  . ASN A 1 77  ? -67.886 20.440 -100.456 1.00 15.07 ? 72   ASN A CG  1 
ATOM   553  O OD1 . ASN A 1 77  ? -68.737 20.241 -101.330 1.00 16.04 ? 72   ASN A OD1 1 
ATOM   554  N ND2 . ASN A 1 77  ? -66.590 20.315 -100.687 1.00 11.59 ? 72   ASN A ND2 1 
ATOM   555  N N   . VAL A 1 78  ? -69.329 23.951 -100.304 1.00 18.76 ? 73   VAL A N   1 
ATOM   556  C CA  . VAL A 1 78  ? -68.802 25.274 -100.643 1.00 20.13 ? 73   VAL A CA  1 
ATOM   557  C C   . VAL A 1 78  ? -69.530 26.239 -99.727  1.00 21.26 ? 73   VAL A C   1 
ATOM   558  O O   . VAL A 1 78  ? -70.748 26.313 -99.750  1.00 23.39 ? 73   VAL A O   1 
ATOM   559  C CB  . VAL A 1 78  ? -69.064 25.680 -102.111 1.00 19.91 ? 73   VAL A CB  1 
ATOM   560  C CG1 . VAL A 1 78  ? -68.687 27.153 -102.318 1.00 16.55 ? 73   VAL A CG1 1 
ATOM   561  C CG2 . VAL A 1 78  ? -68.233 24.799 -103.057 1.00 19.98 ? 73   VAL A CG2 1 
ATOM   562  N N   . VAL A 1 79  ? -68.802 26.958 -98.888  1.00 20.82 ? 74   VAL A N   1 
ATOM   563  C CA  . VAL A 1 79  ? -69.481 27.873 -97.999  1.00 20.72 ? 74   VAL A CA  1 
ATOM   564  C C   . VAL A 1 79  ? -69.440 29.302 -98.513  1.00 20.82 ? 74   VAL A C   1 
ATOM   565  O O   . VAL A 1 79  ? -68.384 29.813 -98.866  1.00 21.07 ? 74   VAL A O   1 
ATOM   566  C CB  . VAL A 1 79  ? -68.865 27.848 -96.580  1.00 21.03 ? 74   VAL A CB  1 
ATOM   567  C CG1 . VAL A 1 79  ? -69.615 28.802 -95.678  1.00 17.98 ? 74   VAL A CG1 1 
ATOM   568  C CG2 . VAL A 1 79  ? -68.935 26.456 -96.012  1.00 22.47 ? 74   VAL A CG2 1 
ATOM   569  N N   . ALA A 1 80  ? -70.601 29.939 -98.560  1.00 20.48 ? 75   ALA A N   1 
ATOM   570  C CA  . ALA A 1 80  ? -70.681 31.329 -98.967  1.00 20.87 ? 75   ALA A CA  1 
ATOM   571  C C   . ALA A 1 80  ? -70.203 32.190 -97.763  1.00 21.63 ? 75   ALA A C   1 
ATOM   572  O O   . ALA A 1 80  ? -70.656 31.997 -96.623  1.00 21.64 ? 75   ALA A O   1 
ATOM   573  C CB  . ALA A 1 80  ? -72.126 31.670 -99.342  1.00 19.60 ? 75   ALA A CB  1 
ATOM   574  N N   . VAL A 1 81  ? -69.272 33.119 -98.007  1.00 21.69 ? 76   VAL A N   1 
ATOM   575  C CA  . VAL A 1 81  ? -68.749 34.002 -96.946  1.00 20.36 ? 76   VAL A CA  1 
ATOM   576  C C   . VAL A 1 81  ? -68.582 35.456 -97.430  1.00 21.59 ? 76   VAL A C   1 
ATOM   577  O O   . VAL A 1 81  ? -67.635 35.777 -98.150  1.00 22.67 ? 76   VAL A O   1 
ATOM   578  C CB  . VAL A 1 81  ? -67.422 33.467 -96.441  1.00 17.21 ? 76   VAL A CB  1 
ATOM   579  C CG1 . VAL A 1 81  ? -66.829 34.385 -95.387  1.00 15.16 ? 76   VAL A CG1 1 
ATOM   580  C CG2 . VAL A 1 81  ? -67.648 32.093 -95.908  1.00 15.60 ? 76   VAL A CG2 1 
ATOM   581  N N   . PRO A 1 82  ? -69.495 36.355 -97.010  1.00 21.54 ? 77   PRO A N   1 
ATOM   582  C CA  . PRO A 1 82  ? -69.538 37.782 -97.354  1.00 21.51 ? 77   PRO A CA  1 
ATOM   583  C C   . PRO A 1 82  ? -68.337 38.657 -97.015  1.00 22.60 ? 77   PRO A C   1 
ATOM   584  O O   . PRO A 1 82  ? -68.130 39.686 -97.650  1.00 22.31 ? 77   PRO A O   1 
ATOM   585  C CB  . PRO A 1 82  ? -70.811 38.261 -96.662  1.00 21.54 ? 77   PRO A CB  1 
ATOM   586  C CG  . PRO A 1 82  ? -70.856 37.435 -95.450  1.00 20.88 ? 77   PRO A CG  1 
ATOM   587  C CD  . PRO A 1 82  ? -70.484 36.054 -95.958  1.00 21.27 ? 77   PRO A CD  1 
ATOM   588  N N   . ASP A 1 83  ? -67.555 38.279 -96.014  1.00 24.54 ? 78   ASP A N   1 
ATOM   589  C CA  . ASP A 1 83  ? -66.388 39.073 -95.658  1.00 27.43 ? 78   ASP A CA  1 
ATOM   590  C C   . ASP A 1 83  ? -65.162 38.421 -96.287  1.00 29.09 ? 78   ASP A C   1 
ATOM   591  O O   . ASP A 1 83  ? -64.761 37.319 -95.902  1.00 29.90 ? 78   ASP A O   1 
ATOM   592  C CB  . ASP A 1 83  ? -66.230 39.122 -94.146  1.00 30.13 ? 78   ASP A CB  1 
ATOM   593  C CG  . ASP A 1 83  ? -64.955 39.821 -93.719  1.00 33.86 ? 78   ASP A CG  1 
ATOM   594  O OD1 . ASP A 1 83  ? -64.383 39.424 -92.678  1.00 35.79 ? 78   ASP A OD1 1 
ATOM   595  O OD2 . ASP A 1 83  ? -64.529 40.772 -94.417  1.00 36.19 ? 78   ASP A OD2 1 
ATOM   596  N N   . VAL A 1 84  ? -64.550 39.101 -97.246  1.00 29.72 ? 79   VAL A N   1 
ATOM   597  C CA  . VAL A 1 84  ? -63.403 38.515 -97.922  1.00 30.47 ? 79   VAL A CA  1 
ATOM   598  C C   . VAL A 1 84  ? -62.212 38.171 -97.044  1.00 30.63 ? 79   VAL A C   1 
ATOM   599  O O   . VAL A 1 84  ? -61.485 37.233 -97.343  1.00 31.66 ? 79   VAL A O   1 
ATOM   600  C CB  . VAL A 1 84  ? -62.918 39.396 -99.101  1.00 30.34 ? 79   VAL A CB  1 
ATOM   601  C CG1 . VAL A 1 84  ? -62.388 40.726 -98.600  1.00 29.91 ? 79   VAL A CG1 1 
ATOM   602  C CG2 . VAL A 1 84  ? -61.854 38.654 -99.882  1.00 29.94 ? 79   VAL A CG2 1 
ATOM   603  N N   . VAL A 1 85  ? -61.989 38.908 -95.966  1.00 30.99 ? 80   VAL A N   1 
ATOM   604  C CA  . VAL A 1 85  ? -60.844 38.569 -95.133  1.00 31.52 ? 80   VAL A CA  1 
ATOM   605  C C   . VAL A 1 85  ? -61.107 37.253 -94.453  1.00 31.80 ? 80   VAL A C   1 
ATOM   606  O O   . VAL A 1 85  ? -60.229 36.403 -94.366  1.00 31.92 ? 80   VAL A O   1 
ATOM   607  C CB  . VAL A 1 85  ? -60.562 39.627 -94.069  1.00 30.96 ? 80   VAL A CB  1 
ATOM   608  C CG1 . VAL A 1 85  ? -59.633 39.054 -93.003  1.00 29.38 ? 80   VAL A CG1 1 
ATOM   609  C CG2 . VAL A 1 85  ? -59.911 40.830 -94.727  1.00 31.33 ? 80   VAL A CG2 1 
ATOM   610  N N   . GLN A 1 86  ? -62.329 37.092 -93.969  1.00 32.44 ? 81   GLN A N   1 
ATOM   611  C CA  . GLN A 1 86  ? -62.700 35.862 -93.311  1.00 33.35 ? 81   GLN A CA  1 
ATOM   612  C C   . GLN A 1 86  ? -62.609 34.700 -94.270  1.00 32.69 ? 81   GLN A C   1 
ATOM   613  O O   . GLN A 1 86  ? -62.107 33.644 -93.914  1.00 34.15 ? 81   GLN A O   1 
ATOM   614  C CB  . GLN A 1 86  ? -64.120 35.940 -92.777  1.00 35.45 ? 81   GLN A CB  1 
ATOM   615  C CG  . GLN A 1 86  ? -64.262 36.790 -91.549  1.00 41.66 ? 81   GLN A CG  1 
ATOM   616  C CD  . GLN A 1 86  ? -65.573 36.541 -90.823  1.00 45.52 ? 81   GLN A CD  1 
ATOM   617  O OE1 . GLN A 1 86  ? -65.937 37.281 -89.908  1.00 48.21 ? 81   GLN A OE1 1 
ATOM   618  N NE2 . GLN A 1 86  ? -66.289 35.488 -91.224  1.00 47.62 ? 81   GLN A NE2 1 
ATOM   619  N N   . ALA A 1 87  ? -63.097 34.889 -95.488  1.00 29.90 ? 82   ALA A N   1 
ATOM   620  C CA  . ALA A 1 87  ? -63.075 33.811 -96.454  1.00 27.49 ? 82   ALA A CA  1 
ATOM   621  C C   . ALA A 1 87  ? -61.681 33.335 -96.767  1.00 26.94 ? 82   ALA A C   1 
ATOM   622  O O   . ALA A 1 87  ? -61.470 32.149 -96.992  1.00 26.62 ? 82   ALA A O   1 
ATOM   623  C CB  . ALA A 1 87  ? -63.749 34.243 -97.722  1.00 28.59 ? 82   ALA A CB  1 
ATOM   624  N N   . ALA A 1 88  ? -60.727 34.255 -96.763  1.00 26.93 ? 83   ALA A N   1 
ATOM   625  C CA  . ALA A 1 88  ? -59.352 33.926 -97.114  1.00 28.22 ? 83   ALA A CA  1 
ATOM   626  C C   . ALA A 1 88  ? -58.339 33.634 -95.991  1.00 29.58 ? 83   ALA A C   1 
ATOM   627  O O   . ALA A 1 88  ? -57.259 33.099 -96.276  1.00 28.91 ? 83   ALA A O   1 
ATOM   628  C CB  . ALA A 1 88  ? -58.810 35.015 -98.028  1.00 25.70 ? 83   ALA A CB  1 
ATOM   629  N N   . GLU A 1 89  ? -58.684 33.977 -94.745  1.00 31.41 ? 84   GLU A N   1 
ATOM   630  C CA  . GLU A 1 89  ? -57.826 33.784 -93.559  1.00 33.70 ? 84   GLU A CA  1 
ATOM   631  C C   . GLU A 1 89  ? -56.967 32.520 -93.473  1.00 34.72 ? 84   GLU A C   1 
ATOM   632  O O   . GLU A 1 89  ? -55.754 32.605 -93.271  1.00 35.31 ? 84   GLU A O   1 
ATOM   633  C CB  . GLU A 1 89  ? -58.668 33.822 -92.283  1.00 35.36 ? 84   GLU A CB  1 
ATOM   634  C CG  . GLU A 1 89  ? -58.860 35.175 -91.649  1.00 36.88 ? 84   GLU A CG  1 
ATOM   635  C CD  . GLU A 1 89  ? -59.915 35.140 -90.551  1.00 39.38 ? 84   GLU A CD  1 
ATOM   636  O OE1 . GLU A 1 89  ? -60.091 36.181 -89.892  1.00 43.05 ? 84   GLU A OE1 1 
ATOM   637  O OE2 . GLU A 1 89  ? -60.576 34.092 -90.343  1.00 39.03 ? 84   GLU A OE2 1 
ATOM   638  N N   . ASP A 1 90  ? -57.591 31.351 -93.600  1.00 34.68 ? 85   ASP A N   1 
ATOM   639  C CA  . ASP A 1 90  ? -56.847 30.105 -93.490  1.00 35.24 ? 85   ASP A CA  1 
ATOM   640  C C   . ASP A 1 90  ? -56.551 29.419 -94.792  1.00 33.49 ? 85   ASP A C   1 
ATOM   641  O O   . ASP A 1 90  ? -56.150 28.262 -94.792  1.00 34.21 ? 85   ASP A O   1 
ATOM   642  C CB  . ASP A 1 90  ? -57.605 29.121 -92.615  1.00 39.46 ? 85   ASP A CB  1 
ATOM   643  C CG  . ASP A 1 90  ? -58.185 29.775 -91.398  1.00 44.38 ? 85   ASP A CG  1 
ATOM   644  O OD1 . ASP A 1 90  ? -57.408 30.370 -90.618  1.00 47.45 ? 85   ASP A OD1 1 
ATOM   645  O OD2 . ASP A 1 90  ? -59.421 29.704 -91.227  1.00 47.76 ? 85   ASP A OD2 1 
ATOM   646  N N   . ALA A 1 91  ? -56.729 30.112 -95.902  1.00 31.68 ? 86   ALA A N   1 
ATOM   647  C CA  . ALA A 1 91  ? -56.507 29.484 -97.187  1.00 29.80 ? 86   ALA A CA  1 
ATOM   648  C C   . ALA A 1 91  ? -55.052 29.259 -97.535  1.00 29.32 ? 86   ALA A C   1 
ATOM   649  O O   . ALA A 1 91  ? -54.185 30.046 -97.167  1.00 27.82 ? 86   ALA A O   1 
ATOM   650  C CB  . ALA A 1 91  ? -57.174 30.289 -98.266  1.00 30.56 ? 86   ALA A CB  1 
ATOM   651  N N   . ASP A 1 92  ? -54.803 28.157 -98.241  1.00 28.99 ? 87   ASP A N   1 
ATOM   652  C CA  . ASP A 1 92  ? -53.467 27.791 -98.703  1.00 28.63 ? 87   ASP A CA  1 
ATOM   653  C C   . ASP A 1 92  ? -53.397 28.063 -100.196 1.00 28.11 ? 87   ASP A C   1 
ATOM   654  O O   . ASP A 1 92  ? -52.335 28.374 -100.740 1.00 28.41 ? 87   ASP A O   1 
ATOM   655  C CB  . ASP A 1 92  ? -53.203 26.317 -98.430  1.00 29.62 ? 87   ASP A CB  1 
ATOM   656  C CG  . ASP A 1 92  ? -53.086 26.031 -96.971  1.00 30.83 ? 87   ASP A CG  1 
ATOM   657  O OD1 . ASP A 1 92  ? -52.212 26.661 -96.342  1.00 32.27 ? 87   ASP A OD1 1 
ATOM   658  O OD2 . ASP A 1 92  ? -53.856 25.199 -96.449  1.00 32.15 ? 87   ASP A OD2 1 
ATOM   659  N N   . ILE A 1 93  ? -54.551 27.921 -100.846 1.00 27.16 ? 88   ILE A N   1 
ATOM   660  C CA  . ILE A 1 93  ? -54.700 28.177 -102.266 1.00 25.23 ? 88   ILE A CA  1 
ATOM   661  C C   . ILE A 1 93  ? -55.843 29.175 -102.368 1.00 24.06 ? 88   ILE A C   1 
ATOM   662  O O   . ILE A 1 93  ? -56.913 28.967 -101.785 1.00 22.78 ? 88   ILE A O   1 
ATOM   663  C CB  . ILE A 1 93  ? -55.139 26.930 -103.063 1.00 26.45 ? 88   ILE A CB  1 
ATOM   664  C CG1 . ILE A 1 93  ? -54.454 25.660 -102.545 1.00 25.97 ? 88   ILE A CG1 1 
ATOM   665  C CG2 . ILE A 1 93  ? -54.836 27.146 -104.543 1.00 25.91 ? 88   ILE A CG2 1 
ATOM   666  C CD1 . ILE A 1 93  ? -53.026 25.490 -102.961 1.00 28.75 ? 88   ILE A CD1 1 
ATOM   667  N N   . LEU A 1 94  ? -55.606 30.267 -103.090 1.00 23.26 ? 89   LEU A N   1 
ATOM   668  C CA  . LEU A 1 94  ? -56.628 31.283 -103.295 1.00 21.80 ? 89   LEU A CA  1 
ATOM   669  C C   . LEU A 1 94  ? -56.899 31.431 -104.775 1.00 20.90 ? 89   LEU A C   1 
ATOM   670  O O   . LEU A 1 94  ? -56.026 31.859 -105.522 1.00 21.10 ? 89   LEU A O   1 
ATOM   671  C CB  . LEU A 1 94  ? -56.186 32.632 -102.728 1.00 22.28 ? 89   LEU A CB  1 
ATOM   672  C CG  . LEU A 1 94  ? -56.010 32.691 -101.207 1.00 24.69 ? 89   LEU A CG  1 
ATOM   673  C CD1 . LEU A 1 94  ? -54.598 32.266 -100.885 1.00 25.36 ? 89   LEU A CD1 1 
ATOM   674  C CD2 . LEU A 1 94  ? -56.269 34.086 -100.667 1.00 24.08 ? 89   LEU A CD2 1 
ATOM   675  N N   . ILE A 1 95  ? -58.094 31.046 -105.210 1.00 20.14 ? 90   ILE A N   1 
ATOM   676  C CA  . ILE A 1 95  ? -58.451 31.187 -106.612 1.00 19.92 ? 90   ILE A CA  1 
ATOM   677  C C   . ILE A 1 95  ? -59.057 32.569 -106.783 1.00 20.18 ? 90   ILE A C   1 
ATOM   678  O O   . ILE A 1 95  ? -60.110 32.867 -106.204 1.00 20.52 ? 90   ILE A O   1 
ATOM   679  C CB  . ILE A 1 95  ? -59.510 30.167 -107.051 1.00 20.88 ? 90   ILE A CB  1 
ATOM   680  C CG1 . ILE A 1 95  ? -58.897 28.780 -107.183 1.00 21.34 ? 90   ILE A CG1 1 
ATOM   681  C CG2 . ILE A 1 95  ? -60.073 30.557 -108.403 1.00 22.34 ? 90   ILE A CG2 1 
ATOM   682  C CD1 . ILE A 1 95  ? -59.288 27.844 -106.102 1.00 24.54 ? 90   ILE A CD1 1 
ATOM   683  N N   . PHE A 1 96  ? -58.406 33.425 -107.563 1.00 19.20 ? 91   PHE A N   1 
ATOM   684  C CA  . PHE A 1 96  ? -58.949 34.769 -107.766 1.00 18.56 ? 91   PHE A CA  1 
ATOM   685  C C   . PHE A 1 96  ? -59.814 34.786 -109.026 1.00 17.77 ? 91   PHE A C   1 
ATOM   686  O O   . PHE A 1 96  ? -59.308 34.662 -110.130 1.00 19.55 ? 91   PHE A O   1 
ATOM   687  C CB  . PHE A 1 96  ? -57.812 35.808 -107.848 1.00 17.60 ? 91   PHE A CB  1 
ATOM   688  C CG  . PHE A 1 96  ? -57.049 35.972 -106.554 1.00 16.94 ? 91   PHE A CG  1 
ATOM   689  C CD1 . PHE A 1 96  ? -55.871 35.269 -106.326 1.00 16.92 ? 91   PHE A CD1 1 
ATOM   690  C CD2 . PHE A 1 96  ? -57.536 36.798 -105.544 1.00 16.79 ? 91   PHE A CD2 1 
ATOM   691  C CE1 . PHE A 1 96  ? -55.193 35.382 -105.112 1.00 15.62 ? 91   PHE A CE1 1 
ATOM   692  C CE2 . PHE A 1 96  ? -56.865 36.918 -104.325 1.00 16.20 ? 91   PHE A CE2 1 
ATOM   693  C CZ  . PHE A 1 96  ? -55.694 36.209 -104.109 1.00 15.32 ? 91   PHE A CZ  1 
ATOM   694  N N   . VAL A 1 97  ? -61.122 34.933 -108.860 1.00 16.49 ? 92   VAL A N   1 
ATOM   695  C CA  . VAL A 1 97  ? -62.022 34.919 -110.005 1.00 15.25 ? 92   VAL A CA  1 
ATOM   696  C C   . VAL A 1 97  ? -63.186 35.919 -109.837 1.00 16.67 ? 92   VAL A C   1 
ATOM   697  O O   . VAL A 1 97  ? -64.280 35.575 -109.367 1.00 16.78 ? 92   VAL A O   1 
ATOM   698  C CB  . VAL A 1 97  ? -62.549 33.462 -110.223 1.00 13.19 ? 92   VAL A CB  1 
ATOM   699  C CG1 . VAL A 1 97  ? -63.253 32.976 -108.965 1.00 11.82 ? 92   VAL A CG1 1 
ATOM   700  C CG2 . VAL A 1 97  ? -63.474 33.391 -111.413 1.00 10.40 ? 92   VAL A CG2 1 
ATOM   701  N N   . VAL A 1 98  ? -62.920 37.174 -110.184 1.00 16.39 ? 93   VAL A N   1 
ATOM   702  C CA  . VAL A 1 98  ? -63.926 38.229 -110.121 1.00 17.20 ? 93   VAL A CA  1 
ATOM   703  C C   . VAL A 1 98  ? -63.625 39.198 -111.256 1.00 17.77 ? 93   VAL A C   1 
ATOM   704  O O   . VAL A 1 98  ? -62.494 39.266 -111.746 1.00 17.78 ? 93   VAL A O   1 
ATOM   705  C CB  . VAL A 1 98  ? -63.901 39.020 -108.763 1.00 17.60 ? 93   VAL A CB  1 
ATOM   706  C CG1 . VAL A 1 98  ? -64.223 38.086 -107.616 1.00 18.87 ? 93   VAL A CG1 1 
ATOM   707  C CG2 . VAL A 1 98  ? -62.535 39.693 -108.533 1.00 16.77 ? 93   VAL A CG2 1 
ATOM   708  N N   . PRO A 1 99  ? -64.632 39.956 -111.700 1.00 17.78 ? 94   PRO A N   1 
ATOM   709  C CA  . PRO A 1 99  ? -64.437 40.920 -112.784 1.00 17.88 ? 94   PRO A CA  1 
ATOM   710  C C   . PRO A 1 99  ? -63.270 41.875 -112.489 1.00 19.50 ? 94   PRO A C   1 
ATOM   711  O O   . PRO A 1 99  ? -63.038 42.236 -111.338 1.00 20.19 ? 94   PRO A O   1 
ATOM   712  C CB  . PRO A 1 99  ? -65.775 41.625 -112.839 1.00 17.21 ? 94   PRO A CB  1 
ATOM   713  C CG  . PRO A 1 99  ? -66.725 40.524 -112.490 1.00 18.05 ? 94   PRO A CG  1 
ATOM   714  C CD  . PRO A 1 99  ? -66.048 39.879 -111.309 1.00 17.28 ? 94   PRO A CD  1 
ATOM   715  N N   . HIS A 1 100 ? -62.548 42.283 -113.534 1.00 21.01 ? 95   HIS A N   1 
ATOM   716  C CA  . HIS A 1 100 ? -61.384 43.159 -113.408 1.00 22.64 ? 95   HIS A CA  1 
ATOM   717  C C   . HIS A 1 100 ? -61.572 44.341 -112.450 1.00 21.65 ? 95   HIS A C   1 
ATOM   718  O O   . HIS A 1 100 ? -60.735 44.576 -111.581 1.00 20.60 ? 95   HIS A O   1 
ATOM   719  C CB  . HIS A 1 100 ? -60.970 43.664 -114.805 1.00 26.44 ? 95   HIS A CB  1 
ATOM   720  C CG  . HIS A 1 100 ? -59.687 44.446 -114.828 1.00 31.68 ? 95   HIS A CG  1 
ATOM   721  N ND1 . HIS A 1 100 ? -59.161 45.058 -113.709 1.00 34.68 ? 95   HIS A ND1 1 
ATOM   722  C CD2 . HIS A 1 100 ? -58.849 44.756 -115.848 1.00 34.43 ? 95   HIS A CD2 1 
ATOM   723  C CE1 . HIS A 1 100 ? -58.058 45.711 -114.036 1.00 34.89 ? 95   HIS A CE1 1 
ATOM   724  N NE2 . HIS A 1 100 ? -57.845 45.544 -115.329 1.00 35.19 ? 95   HIS A NE2 1 
ATOM   725  N N   . GLN A 1 101 ? -62.665 45.082 -112.599 1.00 22.31 ? 96   GLN A N   1 
ATOM   726  C CA  . GLN A 1 101 ? -62.915 46.250 -111.754 1.00 23.51 ? 96   GLN A CA  1 
ATOM   727  C C   . GLN A 1 101 ? -62.845 46.039 -110.231 1.00 24.60 ? 96   GLN A C   1 
ATOM   728  O O   . GLN A 1 101 ? -62.604 46.985 -109.485 1.00 25.20 ? 96   GLN A O   1 
ATOM   729  C CB  . GLN A 1 101 ? -64.268 46.875 -112.109 1.00 23.04 ? 96   GLN A CB  1 
ATOM   730  C CG  . GLN A 1 101 ? -65.425 45.894 -112.219 1.00 26.77 ? 96   GLN A CG  1 
ATOM   731  C CD  . GLN A 1 101 ? -65.698 45.388 -113.665 1.00 30.92 ? 96   GLN A CD  1 
ATOM   732  O OE1 . GLN A 1 101 ? -66.835 45.492 -114.164 1.00 30.72 ? 96   GLN A OE1 1 
ATOM   733  N NE2 . GLN A 1 101 ? -64.666 44.837 -114.329 1.00 30.35 ? 96   GLN A NE2 1 
ATOM   734  N N   . PHE A 1 102 ? -62.998 44.808 -109.759 1.00 24.74 ? 97   PHE A N   1 
ATOM   735  C CA  . PHE A 1 102 ? -63.021 44.589 -108.323 1.00 25.28 ? 97   PHE A CA  1 
ATOM   736  C C   . PHE A 1 102 ? -61.805 44.054 -107.562 1.00 25.36 ? 97   PHE A C   1 
ATOM   737  O O   . PHE A 1 102 ? -61.823 44.082 -106.337 1.00 25.30 ? 97   PHE A O   1 
ATOM   738  C CB  . PHE A 1 102 ? -64.259 43.741 -107.992 1.00 25.39 ? 97   PHE A CB  1 
ATOM   739  C CG  . PHE A 1 102 ? -65.516 44.229 -108.676 1.00 25.90 ? 97   PHE A CG  1 
ATOM   740  C CD1 . PHE A 1 102 ? -66.210 43.407 -109.571 1.00 27.42 ? 97   PHE A CD1 1 
ATOM   741  C CD2 . PHE A 1 102 ? -65.964 45.531 -108.489 1.00 24.03 ? 97   PHE A CD2 1 
ATOM   742  C CE1 . PHE A 1 102 ? -67.327 43.884 -110.272 1.00 26.37 ? 97   PHE A CE1 1 
ATOM   743  C CE2 . PHE A 1 102 ? -67.078 46.014 -109.185 1.00 24.85 ? 97   PHE A CE2 1 
ATOM   744  C CZ  . PHE A 1 102 ? -67.758 45.191 -110.078 1.00 24.83 ? 97   PHE A CZ  1 
ATOM   745  N N   . ILE A 1 103 ? -60.751 43.602 -108.241 1.00 25.36 ? 98   ILE A N   1 
ATOM   746  C CA  . ILE A 1 103 ? -59.592 43.057 -107.517 1.00 26.27 ? 98   ILE A CA  1 
ATOM   747  C C   . ILE A 1 103 ? -58.784 44.032 -106.712 1.00 26.86 ? 98   ILE A C   1 
ATOM   748  O O   . ILE A 1 103 ? -58.323 43.687 -105.632 1.00 28.82 ? 98   ILE A O   1 
ATOM   749  C CB  . ILE A 1 103 ? -58.576 42.387 -108.417 1.00 26.13 ? 98   ILE A CB  1 
ATOM   750  C CG1 . ILE A 1 103 ? -59.005 42.593 -109.847 1.00 27.75 ? 98   ILE A CG1 1 
ATOM   751  C CG2 . ILE A 1 103 ? -58.376 40.919 -107.994 1.00 23.57 ? 98   ILE A CG2 1 
ATOM   752  C CD1 . ILE A 1 103 ? -57.863 42.745 -110.785 1.00 34.25 ? 98   ILE A CD1 1 
ATOM   753  N N   . GLY A 1 104 ? -58.561 45.226 -107.241 1.00 26.62 ? 99   GLY A N   1 
ATOM   754  C CA  . GLY A 1 104 ? -57.788 46.188 -106.489 1.00 25.82 ? 99   GLY A CA  1 
ATOM   755  C C   . GLY A 1 104 ? -58.275 46.279 -105.058 1.00 26.97 ? 99   GLY A C   1 
ATOM   756  O O   . GLY A 1 104 ? -57.508 46.022 -104.120 1.00 25.66 ? 99   GLY A O   1 
ATOM   757  N N   . LYS A 1 105 ? -59.550 46.627 -104.883 1.00 27.07 ? 100  LYS A N   1 
ATOM   758  C CA  . LYS A 1 105 ? -60.111 46.740 -103.546 1.00 29.54 ? 100  LYS A CA  1 
ATOM   759  C C   . LYS A 1 105 ? -59.954 45.446 -102.732 1.00 30.27 ? 100  LYS A C   1 
ATOM   760  O O   . LYS A 1 105 ? -59.527 45.487 -101.569 1.00 30.40 ? 100  LYS A O   1 
ATOM   761  C CB  . LYS A 1 105 ? -61.583 47.146 -103.611 1.00 30.88 ? 100  LYS A CB  1 
ATOM   762  C CG  . LYS A 1 105 ? -62.265 47.108 -102.247 1.00 34.82 ? 100  LYS A CG  1 
ATOM   763  C CD  . LYS A 1 105 ? -63.587 47.864 -102.196 1.00 37.59 ? 100  LYS A CD  1 
ATOM   764  C CE  . LYS A 1 105 ? -64.164 47.806 -100.787 1.00 39.59 ? 100  LYS A CE  1 
ATOM   765  N NZ  . LYS A 1 105 ? -65.511 48.435 -100.689 1.00 43.14 ? 100  LYS A NZ  1 
ATOM   766  N N   . ILE A 1 106 ? -60.301 44.309 -103.337 1.00 29.88 ? 101  ILE A N   1 
ATOM   767  C CA  . ILE A 1 106 ? -60.184 43.022 -102.668 1.00 29.91 ? 101  ILE A CA  1 
ATOM   768  C C   . ILE A 1 106 ? -58.766 42.911 -102.147 1.00 30.39 ? 101  ILE A C   1 
ATOM   769  O O   . ILE A 1 106 ? -58.549 42.464 -101.032 1.00 30.17 ? 101  ILE A O   1 
ATOM   770  C CB  . ILE A 1 106 ? -60.396 41.828 -103.627 1.00 31.33 ? 101  ILE A CB  1 
ATOM   771  C CG1 . ILE A 1 106 ? -61.757 41.919 -104.334 1.00 30.97 ? 101  ILE A CG1 1 
ATOM   772  C CG2 . ILE A 1 106 ? -60.238 40.512 -102.846 1.00 29.54 ? 101  ILE A CG2 1 
ATOM   773  C CD1 . ILE A 1 106 ? -62.904 41.574 -103.480 1.00 33.68 ? 101  ILE A CD1 1 
ATOM   774  N N   . CYS A 1 107 ? -57.799 43.311 -102.965 1.00 31.71 ? 102  CYS A N   1 
ATOM   775  C CA  . CYS A 1 107 ? -56.391 43.248 -102.569 1.00 34.30 ? 102  CYS A CA  1 
ATOM   776  C C   . CYS A 1 107 ? -56.079 44.260 -101.472 1.00 36.44 ? 102  CYS A C   1 
ATOM   777  O O   . CYS A 1 107 ? -55.255 43.993 -100.594 1.00 37.11 ? 102  CYS A O   1 
ATOM   778  C CB  . CYS A 1 107 ? -55.472 43.479 -103.774 1.00 33.27 ? 102  CYS A CB  1 
ATOM   779  S SG  . CYS A 1 107 ? -55.422 42.101 -104.945 1.00 31.69 ? 102  CYS A SG  1 
ATOM   780  N N   . ASP A 1 108 ? -56.727 45.422 -101.534 1.00 38.44 ? 103  ASP A N   1 
ATOM   781  C CA  . ASP A 1 108 ? -56.541 46.447 -100.505 1.00 40.48 ? 103  ASP A CA  1 
ATOM   782  C C   . ASP A 1 108 ? -56.854 45.722 -99.156  1.00 38.02 ? 103  ASP A C   1 
ATOM   783  O O   . ASP A 1 108 ? -56.043 45.739 -98.229  1.00 36.96 ? 103  ASP A O   1 
ATOM   784  C CB  . ASP A 1 108 ? -57.521 47.676 -100.727 1.00 46.89 ? 103  ASP A CB  1 
ATOM   785  C CG  . ASP A 1 108 ? -56.894 48.905 -101.571 1.00 51.11 ? 103  ASP A CG  1 
ATOM   786  O OD1 . ASP A 1 108 ? -55.836 49.467 -101.180 1.00 54.81 ? 103  ASP A OD1 1 
ATOM   787  O OD2 . ASP A 1 108 ? -57.484 49.342 -102.608 1.00 49.54 ? 103  ASP A OD2 1 
ATOM   788  N N   . GLN A 1 109 ? -57.996 45.039 -99.079  1.00 35.65 ? 104  GLN A N   1 
ATOM   789  C CA  . GLN A 1 109 ? -58.405 44.360 -97.846  1.00 35.39 ? 104  GLN A CA  1 
ATOM   790  C C   . GLN A 1 109 ? -57.716 43.050 -97.407  1.00 34.17 ? 104  GLN A C   1 
ATOM   791  O O   . GLN A 1 109 ? -57.676 42.742 -96.212  1.00 34.30 ? 104  GLN A O   1 
ATOM   792  C CB  . GLN A 1 109 ? -59.925 44.142 -97.852  1.00 36.10 ? 104  GLN A CB  1 
ATOM   793  C CG  . GLN A 1 109 ? -60.640 44.707 -99.069  1.00 38.99 ? 104  GLN A CG  1 
ATOM   794  C CD  . GLN A 1 109 ? -62.144 44.493 -99.024  1.00 40.03 ? 104  GLN A CD  1 
ATOM   795  O OE1 . GLN A 1 109 ? -62.823 44.537 -100.048 1.00 40.21 ? 104  GLN A OE1 1 
ATOM   796  N NE2 . GLN A 1 109 ? -62.668 44.269 -97.833  1.00 41.52 ? 104  GLN A NE2 1 
ATOM   797  N N   . LEU A 1 110 ? -57.181 42.275 -98.341  1.00 32.38 ? 105  LEU A N   1 
ATOM   798  C CA  . LEU A 1 110 ? -56.520 41.031 -97.964  1.00 30.50 ? 105  LEU A CA  1 
ATOM   799  C C   . LEU A 1 110 ? -55.059 41.240 -97.608  1.00 31.20 ? 105  LEU A C   1 
ATOM   800  O O   . LEU A 1 110 ? -54.502 40.470 -96.828  1.00 30.44 ? 105  LEU A O   1 
ATOM   801  C CB  . LEU A 1 110 ? -56.590 40.003 -99.092  1.00 29.30 ? 105  LEU A CB  1 
ATOM   802  C CG  . LEU A 1 110 ? -57.968 39.537 -99.536  1.00 26.71 ? 105  LEU A CG  1 
ATOM   803  C CD1 . LEU A 1 110 ? -57.808 38.607 -100.706 1.00 26.48 ? 105  LEU A CD1 1 
ATOM   804  C CD2 . LEU A 1 110 ? -58.686 38.879 -98.392  1.00 26.41 ? 105  LEU A CD2 1 
ATOM   805  N N   . LYS A 1 111 ? -54.433 42.263 -98.188  1.00 31.78 ? 106  LYS A N   1 
ATOM   806  C CA  . LYS A 1 111 ? -53.023 42.543 -97.910  1.00 32.60 ? 106  LYS A CA  1 
ATOM   807  C C   . LYS A 1 111 ? -52.703 42.338 -96.428  1.00 32.69 ? 106  LYS A C   1 
ATOM   808  O O   . LYS A 1 111 ? -53.300 42.965 -95.546  1.00 32.87 ? 106  LYS A O   1 
ATOM   809  C CB  . LYS A 1 111 ? -52.668 43.976 -98.310  1.00 32.78 ? 106  LYS A CB  1 
ATOM   810  C CG  . LYS A 1 111 ? -51.168 44.280 -98.300  1.00 34.73 ? 106  LYS A CG  1 
ATOM   811  C CD  . LYS A 1 111 ? -50.909 45.744 -98.677  1.00 38.05 ? 106  LYS A CD  1 
ATOM   812  C CE  . LYS A 1 111 ? -49.528 45.981 -99.313  1.00 38.62 ? 106  LYS A CE  1 
ATOM   813  N NZ  . LYS A 1 111 ? -48.416 45.689 -98.375  1.00 41.28 ? 106  LYS A NZ  1 
ATOM   814  N N   . GLY A 1 112 ? -51.777 41.432 -96.158  1.00 32.88 ? 107  GLY A N   1 
ATOM   815  C CA  . GLY A 1 112 ? -51.374 41.178 -94.789  1.00 33.55 ? 107  GLY A CA  1 
ATOM   816  C C   . GLY A 1 112 ? -52.227 40.267 -93.935  1.00 33.89 ? 107  GLY A C   1 
ATOM   817  O O   . GLY A 1 112 ? -51.931 40.107 -92.763  1.00 35.45 ? 107  GLY A O   1 
ATOM   818  N N   . HIS A 1 113 ? -53.276 39.671 -94.488  1.00 33.79 ? 108  HIS A N   1 
ATOM   819  C CA  . HIS A 1 113 ? -54.120 38.781 -93.703  1.00 32.30 ? 108  HIS A CA  1 
ATOM   820  C C   . HIS A 1 113 ? -54.135 37.374 -94.271  1.00 31.21 ? 108  HIS A C   1 
ATOM   821  O O   . HIS A 1 113 ? -55.019 36.582 -93.963  1.00 31.37 ? 108  HIS A O   1 
ATOM   822  C CB  . HIS A 1 113 ? -55.548 39.308 -93.649  1.00 34.02 ? 108  HIS A CB  1 
ATOM   823  C CG  . HIS A 1 113 ? -55.661 40.695 -93.100  1.00 37.10 ? 108  HIS A CG  1 
ATOM   824  N ND1 . HIS A 1 113 ? -55.268 41.812 -93.806  1.00 39.10 ? 108  HIS A ND1 1 
ATOM   825  C CD2 . HIS A 1 113 ? -56.131 41.148 -91.913  1.00 37.73 ? 108  HIS A CD2 1 
ATOM   826  C CE1 . HIS A 1 113 ? -55.493 42.893 -93.081  1.00 38.83 ? 108  HIS A CE1 1 
ATOM   827  N NE2 . HIS A 1 113 ? -56.017 42.517 -91.928  1.00 38.41 ? 108  HIS A NE2 1 
ATOM   828  N N   . LEU A 1 114 ? -53.147 37.055 -95.092  1.00 30.64 ? 109  LEU A N   1 
ATOM   829  C CA  . LEU A 1 114 ? -53.085 35.737 -95.710  1.00 31.19 ? 109  LEU A CA  1 
ATOM   830  C C   . LEU A 1 114 ? -52.080 34.820 -95.024  1.00 31.33 ? 109  LEU A C   1 
ATOM   831  O O   . LEU A 1 114 ? -51.096 35.286 -94.470  1.00 32.13 ? 109  LEU A O   1 
ATOM   832  C CB  . LEU A 1 114 ? -52.730 35.885 -97.199  1.00 29.86 ? 109  LEU A CB  1 
ATOM   833  C CG  . LEU A 1 114 ? -53.603 36.864 -97.995  1.00 28.84 ? 109  LEU A CG  1 
ATOM   834  C CD1 . LEU A 1 114 ? -53.150 36.884 -99.452  1.00 27.87 ? 109  LEU A CD1 1 
ATOM   835  C CD2 . LEU A 1 114 ? -55.073 36.457 -97.883  1.00 27.18 ? 109  LEU A CD2 1 
ATOM   836  N N   . LYS A 1 115 ? -52.324 33.515 -95.053  1.00 32.43 ? 110  LYS A N   1 
ATOM   837  C CA  . LYS A 1 115 ? -51.394 32.589 -94.428  1.00 33.71 ? 110  LYS A CA  1 
ATOM   838  C C   . LYS A 1 115 ? -50.001 32.722 -95.008  1.00 34.10 ? 110  LYS A C   1 
ATOM   839  O O   . LYS A 1 115 ? -49.805 33.047 -96.180  1.00 33.57 ? 110  LYS A O   1 
ATOM   840  C CB  . LYS A 1 115 ? -51.860 31.138 -94.562  1.00 35.30 ? 110  LYS A CB  1 
ATOM   841  C CG  . LYS A 1 115 ? -52.922 30.746 -93.551  1.00 37.49 ? 110  LYS A CG  1 
ATOM   842  C CD  . LYS A 1 115 ? -53.228 29.253 -93.601  1.00 40.12 ? 110  LYS A CD  1 
ATOM   843  C CE  . LYS A 1 115 ? -51.993 28.405 -93.337  1.00 40.95 ? 110  LYS A CE  1 
ATOM   844  N NZ  . LYS A 1 115 ? -52.325 26.951 -93.358  1.00 42.68 ? 110  LYS A NZ  1 
ATOM   845  N N   . ALA A 1 116 ? -49.033 32.450 -94.154  1.00 35.20 ? 111  ALA A N   1 
ATOM   846  C CA  . ALA A 1 116 ? -47.635 32.545 -94.502  1.00 35.89 ? 111  ALA A CA  1 
ATOM   847  C C   . ALA A 1 116 ? -47.242 32.038 -95.892  1.00 35.84 ? 111  ALA A C   1 
ATOM   848  O O   . ALA A 1 116 ? -46.728 32.816 -96.706  1.00 36.74 ? 111  ALA A O   1 
ATOM   849  C CB  . ALA A 1 116 ? -46.813 31.838 -93.441  1.00 36.69 ? 111  ALA A CB  1 
ATOM   850  N N   . ASN A 1 117 ? -47.469 30.758 -96.172  1.00 33.49 ? 112  ASN A N   1 
ATOM   851  C CA  . ASN A 1 117 ? -47.060 30.226 -97.462  1.00 32.97 ? 112  ASN A CA  1 
ATOM   852  C C   . ASN A 1 117 ? -48.173 30.057 -98.474  1.00 30.91 ? 112  ASN A C   1 
ATOM   853  O O   . ASN A 1 117 ? -48.156 29.113 -99.272  1.00 32.23 ? 112  ASN A O   1 
ATOM   854  C CB  . ASN A 1 117 ? -46.343 28.888 -97.272  1.00 36.08 ? 112  ASN A CB  1 
ATOM   855  C CG  . ASN A 1 117 ? -45.098 29.012 -96.408  1.00 39.53 ? 112  ASN A CG  1 
ATOM   856  O OD1 . ASN A 1 117 ? -44.154 29.731 -96.753  1.00 41.60 ? 112  ASN A OD1 1 
ATOM   857  N ND2 . ASN A 1 117 ? -45.090 28.311 -95.274  1.00 41.03 ? 112  ASN A ND2 1 
ATOM   858  N N   . ALA A 1 118 ? -49.131 30.975 -98.457  1.00 27.23 ? 113  ALA A N   1 
ATOM   859  C CA  . ALA A 1 118 ? -50.257 30.909 -99.377  1.00 23.99 ? 113  ALA A CA  1 
ATOM   860  C C   . ALA A 1 118 ? -49.857 31.193 -100.818 1.00 21.72 ? 113  ALA A C   1 
ATOM   861  O O   . ALA A 1 118 ? -48.943 31.961 -101.087 1.00 21.31 ? 113  ALA A O   1 
ATOM   862  C CB  . ALA A 1 118 ? -51.340 31.889 -98.938  1.00 23.72 ? 113  ALA A CB  1 
ATOM   863  N N   . THR A 1 119 ? -50.542 30.553 -101.748 1.00 19.82 ? 114  THR A N   1 
ATOM   864  C CA  . THR A 1 119 ? -50.287 30.786 -103.161 1.00 19.82 ? 114  THR A CA  1 
ATOM   865  C C   . THR A 1 119 ? -51.613 31.068 -103.815 1.00 18.97 ? 114  THR A C   1 
ATOM   866  O O   . THR A 1 119 ? -52.670 30.760 -103.249 1.00 18.29 ? 114  THR A O   1 
ATOM   867  C CB  . THR A 1 119 ? -49.648 29.576 -103.858 1.00 20.43 ? 114  THR A CB  1 
ATOM   868  O OG1 . THR A 1 119 ? -50.338 28.375 -103.483 1.00 21.58 ? 114  THR A OG1 1 
ATOM   869  C CG2 . THR A 1 119 ? -48.178 29.477 -103.482 1.00 20.85 ? 114  THR A CG2 1 
ATOM   870  N N   . GLY A 1 120 ? -51.558 31.669 -104.998 1.00 18.84 ? 115  GLY A N   1 
ATOM   871  C CA  . GLY A 1 120 ? -52.780 31.987 -105.716 1.00 18.40 ? 115  GLY A CA  1 
ATOM   872  C C   . GLY A 1 120 ? -52.718 31.719 -107.209 1.00 19.20 ? 115  GLY A C   1 
ATOM   873  O O   . GLY A 1 120 ? -51.640 31.637 -107.822 1.00 18.57 ? 115  GLY A O   1 
ATOM   874  N N   . ILE A 1 121 ? -53.900 31.557 -107.792 1.00 19.53 ? 116  ILE A N   1 
ATOM   875  C CA  . ILE A 1 121 ? -54.045 31.333 -109.224 1.00 19.78 ? 116  ILE A CA  1 
ATOM   876  C C   . ILE A 1 121 ? -55.121 32.318 -109.698 1.00 21.31 ? 116  ILE A C   1 
ATOM   877  O O   . ILE A 1 121 ? -56.192 32.434 -109.074 1.00 22.29 ? 116  ILE A O   1 
ATOM   878  C CB  . ILE A 1 121 ? -54.456 29.856 -109.532 1.00 18.79 ? 116  ILE A CB  1 
ATOM   879  C CG1 . ILE A 1 121 ? -54.640 29.664 -111.031 1.00 18.74 ? 116  ILE A CG1 1 
ATOM   880  C CG2 . ILE A 1 121 ? -55.740 29.493 -108.819 1.00 18.44 ? 116  ILE A CG2 1 
ATOM   881  C CD1 . ILE A 1 121 ? -54.787 28.231 -111.438 1.00 18.64 ? 116  ILE A CD1 1 
ATOM   882  N N   . SER A 1 122 ? -54.844 33.060 -110.767 1.00 20.91 ? 117  SER A N   1 
ATOM   883  C CA  . SER A 1 122 ? -55.843 34.011 -111.241 1.00 19.51 ? 117  SER A CA  1 
ATOM   884  C C   . SER A 1 122 ? -56.560 33.530 -112.476 1.00 18.95 ? 117  SER A C   1 
ATOM   885  O O   . SER A 1 122 ? -55.948 33.001 -113.395 1.00 19.43 ? 117  SER A O   1 
ATOM   886  C CB  . SER A 1 122 ? -55.229 35.367 -111.542 1.00 20.36 ? 117  SER A CB  1 
ATOM   887  O OG  . SER A 1 122 ? -56.230 36.261 -112.011 1.00 22.24 ? 117  SER A OG  1 
ATOM   888  N N   . LEU A 1 123 ? -57.867 33.732 -112.491 1.00 17.37 ? 118  LEU A N   1 
ATOM   889  C CA  . LEU A 1 123 ? -58.688 33.332 -113.609 1.00 17.16 ? 118  LEU A CA  1 
ATOM   890  C C   . LEU A 1 123 ? -59.223 34.583 -114.280 1.00 17.24 ? 118  LEU A C   1 
ATOM   891  O O   . LEU A 1 123 ? -60.106 34.504 -115.135 1.00 18.06 ? 118  LEU A O   1 
ATOM   892  C CB  . LEU A 1 123 ? -59.867 32.491 -113.120 1.00 16.06 ? 118  LEU A CB  1 
ATOM   893  C CG  . LEU A 1 123 ? -59.602 31.040 -112.726 1.00 17.25 ? 118  LEU A CG  1 
ATOM   894  C CD1 . LEU A 1 123 ? -58.678 30.983 -111.523 1.00 18.28 ? 118  LEU A CD1 1 
ATOM   895  C CD2 . LEU A 1 123 ? -60.925 30.354 -112.429 1.00 17.33 ? 118  LEU A CD2 1 
ATOM   896  N N   . ILE A 1 124 ? -58.680 35.737 -113.912 1.00 16.84 ? 119  ILE A N   1 
ATOM   897  C CA  . ILE A 1 124 ? -59.200 36.985 -114.444 1.00 16.39 ? 119  ILE A CA  1 
ATOM   898  C C   . ILE A 1 124 ? -58.737 37.389 -115.829 1.00 16.96 ? 119  ILE A C   1 
ATOM   899  O O   . ILE A 1 124 ? -57.538 37.366 -116.127 1.00 16.93 ? 119  ILE A O   1 
ATOM   900  C CB  . ILE A 1 124 ? -58.926 38.128 -113.480 1.00 14.41 ? 119  ILE A CB  1 
ATOM   901  C CG1 . ILE A 1 124 ? -59.172 37.647 -112.047 1.00 12.54 ? 119  ILE A CG1 1 
ATOM   902  C CG2 . ILE A 1 124 ? -59.800 39.301 -113.845 1.00 12.97 ? 119  ILE A CG2 1 
ATOM   903  C CD1 . ILE A 1 124 ? -59.067 38.713 -110.979 1.00 12.60 ? 119  ILE A CD1 1 
ATOM   904  N N   . LYS A 1 125 ? -59.705 37.778 -116.663 1.00 16.84 ? 120  LYS A N   1 
ATOM   905  C CA  . LYS A 1 125 ? -59.428 38.184 -118.036 1.00 16.55 ? 120  LYS A CA  1 
ATOM   906  C C   . LYS A 1 125 ? -59.467 39.697 -118.216 1.00 17.20 ? 120  LYS A C   1 
ATOM   907  O O   . LYS A 1 125 ? -60.515 40.324 -118.109 1.00 15.09 ? 120  LYS A O   1 
ATOM   908  C CB  . LYS A 1 125 ? -60.383 37.458 -118.981 1.00 13.20 ? 120  LYS A CB  1 
ATOM   909  C CG  . LYS A 1 125 ? -59.942 36.020 -119.146 1.00 14.23 ? 120  LYS A CG  1 
ATOM   910  C CD  . LYS A 1 125 ? -60.980 35.102 -119.757 1.00 15.46 ? 120  LYS A CD  1 
ATOM   911  C CE  . LYS A 1 125 ? -60.403 33.680 -119.929 1.00 15.68 ? 120  LYS A CE  1 
ATOM   912  N NZ  . LYS A 1 125 ? -61.377 32.667 -120.478 1.00 12.64 ? 120  LYS A NZ  1 
ATOM   913  N N   . GLY A 1 126 ? -58.284 40.256 -118.469 1.00 17.97 ? 121  GLY A N   1 
ATOM   914  C CA  . GLY A 1 126 ? -58.109 41.684 -118.644 1.00 20.01 ? 121  GLY A CA  1 
ATOM   915  C C   . GLY A 1 126 ? -56.650 42.028 -118.370 1.00 21.51 ? 121  GLY A C   1 
ATOM   916  O O   . GLY A 1 126 ? -55.849 41.127 -118.116 1.00 20.71 ? 121  GLY A O   1 
ATOM   917  N N   . VAL A 1 127 ? -56.230 43.373 -118.352 1.00 23.00 ? 122  VAL A N   1 
ATOM   918  C CA  . VAL A 1 127 ? -54.800 43.903 -118.094 1.00 25.07 ? 122  VAL A CA  1 
ATOM   919  C C   . VAL A 1 127 ? -54.792 45.309 -117.371 1.00 27.77 ? 122  VAL A C   1 
ATOM   920  O O   . VAL A 1 127 ? -55.779 46.022 -117.533 1.00 27.72 ? 122  VAL A O   1 
ATOM   921  C CB  . VAL A 1 127 ? -54.068 43.963 -119.441 1.00 24.50 ? 122  VAL A CB  1 
ATOM   922  C CG1 . VAL A 1 127 ? -54.030 42.614 -120.134 1.00 25.37 ? 122  VAL A CG1 1 
ATOM   923  C CG2 . VAL A 1 127 ? -54.702 45.011 -120.332 1.00 23.62 ? 122  VAL A CG2 1 
ATOM   924  N N   . ASP A 1 128 ? -53.770 45.674 -116.603 1.00 31.00 ? 123  ASP A N   1 
ATOM   925  C CA  . ASP A 1 128 ? -53.671 46.985 -116.086 1.00 34.16 ? 123  ASP A CA  1 
ATOM   926  C C   . ASP A 1 128 ? -52.477 47.471 -116.737 1.00 36.59 ? 123  ASP A C   1 
ATOM   927  O O   . ASP A 1 128 ? -51.739 46.810 -117.452 1.00 35.39 ? 123  ASP A O   1 
ATOM   928  C CB  . ASP A 1 128 ? -53.394 47.113 -114.565 1.00 33.54 ? 123  ASP A CB  1 
ATOM   929  C CG  . ASP A 1 128 ? -54.597 46.698 -113.757 1.00 20.00 ? 123  ASP A CG  1 
ATOM   930  O OD1 . ASP A 1 128 ? -55.508 46.094 -114.368 1.00 20.00 ? 123  ASP A OD1 1 
ATOM   931  O OD2 . ASP A 1 128 ? -54.641 46.980 -112.549 1.00 20.00 ? 123  ASP A OD2 1 
ATOM   932  N N   . GLU A 1 129 ? -52.347 48.676 -116.440 1.00 39.87 ? 124  GLU A N   1 
ATOM   933  C CA  . GLU A 1 129 ? -51.190 49.379 -116.947 1.00 43.84 ? 124  GLU A CA  1 
ATOM   934  C C   . GLU A 1 129 ? -50.346 49.841 -115.785 1.00 46.93 ? 124  GLU A C   1 
ATOM   935  O O   . GLU A 1 129 ? -50.862 50.286 -114.759 1.00 46.05 ? 124  GLU A O   1 
ATOM   936  C CB  . GLU A 1 129 ? -51.609 50.576 -117.782 1.00 44.42 ? 124  GLU A CB  1 
ATOM   937  C CG  . GLU A 1 129 ? -50.528 50.996 -118.746 1.00 45.88 ? 124  GLU A CG  1 
ATOM   938  C CD  . GLU A 1 129 ? -50.805 52.335 -119.399 1.00 46.17 ? 124  GLU A CD  1 
ATOM   939  O OE1 . GLU A 1 129 ? -51.965 52.808 -119.320 1.00 43.72 ? 124  GLU A OE1 1 
ATOM   940  O OE2 . GLU A 1 129 ? -49.852 52.892 -119.993 1.00 45.45 ? 124  GLU A OE2 1 
ATOM   941  N N   . GLY A 1 130 ? -49.038 49.731 -115.956 1.00 51.05 ? 125  GLY A N   1 
ATOM   942  C CA  . GLY A 1 130 ? -48.138 50.121 -114.896 1.00 56.07 ? 125  GLY A CA  1 
ATOM   943  C C   . GLY A 1 130 ? -47.387 51.402 -115.158 1.00 59.56 ? 125  GLY A C   1 
ATOM   944  O O   . GLY A 1 130 ? -47.419 51.937 -116.274 1.00 58.65 ? 125  GLY A O   1 
ATOM   945  N N   . PRO A 1 131 ? -46.691 51.918 -114.128 1.00 63.13 ? 126  PRO A N   1 
ATOM   946  C CA  . PRO A 1 131 ? -45.915 53.155 -114.243 1.00 64.68 ? 126  PRO A CA  1 
ATOM   947  C C   . PRO A 1 131 ? -45.104 53.111 -115.520 1.00 65.52 ? 126  PRO A C   1 
ATOM   948  O O   . PRO A 1 131 ? -44.671 54.145 -116.015 1.00 66.22 ? 126  PRO A O   1 
ATOM   949  C CB  . PRO A 1 131 ? -45.044 53.138 -112.991 1.00 65.54 ? 126  PRO A CB  1 
ATOM   950  C CG  . PRO A 1 131 ? -45.957 52.473 -111.972 1.00 66.46 ? 126  PRO A CG  1 
ATOM   951  C CD  . PRO A 1 131 ? -46.527 51.314 -112.787 1.00 65.28 ? 126  PRO A CD  1 
ATOM   952  N N   . ASN A 1 132 ? -44.902 51.907 -116.050 1.00 66.38 ? 127  ASN A N   1 
ATOM   953  C CA  . ASN A 1 132 ? -44.165 51.751 -117.293 1.00 67.23 ? 127  ASN A CA  1 
ATOM   954  C C   . ASN A 1 132 ? -44.560 50.544 -118.146 1.00 65.31 ? 127  ASN A C   1 
ATOM   955  O O   . ASN A 1 132 ? -43.866 49.520 -118.160 1.00 65.59 ? 127  ASN A O   1 
ATOM   956  C CB  . ASN A 1 132 ? -42.655 51.728 -117.026 1.00 71.35 ? 127  ASN A CB  1 
ATOM   957  C CG  . ASN A 1 132 ? -41.947 52.974 -117.579 1.00 75.06 ? 127  ASN A CG  1 
ATOM   958  O OD1 . ASN A 1 132 ? -42.124 54.091 -117.066 1.00 77.24 ? 127  ASN A OD1 1 
ATOM   959  N ND2 . ASN A 1 132 ? -41.155 52.787 -118.639 1.00 76.29 ? 127  ASN A ND2 1 
ATOM   960  N N   . GLY A 1 133 ? -45.681 50.685 -118.855 1.00 62.54 ? 128  GLY A N   1 
ATOM   961  C CA  . GLY A 1 133 ? -46.170 49.639 -119.745 1.00 57.66 ? 128  GLY A CA  1 
ATOM   962  C C   . GLY A 1 133 ? -47.286 48.744 -119.231 1.00 53.82 ? 128  GLY A C   1 
ATOM   963  O O   . GLY A 1 133 ? -48.070 49.099 -118.343 1.00 53.93 ? 128  GLY A O   1 
ATOM   964  N N   . LEU A 1 134 ? -47.358 47.562 -119.821 1.00 49.41 ? 129  LEU A N   1 
ATOM   965  C CA  . LEU A 1 134 ? -48.348 46.574 -119.438 1.00 44.74 ? 129  LEU A CA  1 
ATOM   966  C C   . LEU A 1 134 ? -48.026 46.018 -118.049 1.00 42.11 ? 129  LEU A C   1 
ATOM   967  O O   . LEU A 1 134 ? -46.868 45.796 -117.706 1.00 40.16 ? 129  LEU A O   1 
ATOM   968  C CB  . LEU A 1 134 ? -48.355 45.436 -120.466 1.00 43.02 ? 129  LEU A CB  1 
ATOM   969  C CG  . LEU A 1 134 ? -49.059 44.129 -120.142 1.00 40.19 ? 129  LEU A CG  1 
ATOM   970  C CD1 . LEU A 1 134 ? -50.556 44.327 -120.133 1.00 41.31 ? 129  LEU A CD1 1 
ATOM   971  C CD2 . LEU A 1 134 ? -48.674 43.129 -121.177 1.00 39.15 ? 129  LEU A CD2 1 
ATOM   972  N N   . LYS A 1 135 ? -49.067 45.822 -117.251 1.00 40.06 ? 130  LYS A N   1 
ATOM   973  C CA  . LYS A 1 135 ? -48.930 45.251 -115.922 1.00 37.07 ? 130  LYS A CA  1 
ATOM   974  C C   . LYS A 1 135 ? -50.048 44.224 -115.827 1.00 34.28 ? 130  LYS A C   1 
ATOM   975  O O   . LYS A 1 135 ? -51.232 44.584 -115.859 1.00 33.97 ? 130  LYS A O   1 
ATOM   976  C CB  . LYS A 1 135 ? -49.119 46.313 -114.846 1.00 39.31 ? 130  LYS A CB  1 
ATOM   977  C CG  . LYS A 1 135 ? -48.455 45.962 -113.536 1.00 42.26 ? 130  LYS A CG  1 
ATOM   978  C CD  . LYS A 1 135 ? -48.843 46.954 -112.469 1.00 45.88 ? 130  LYS A CD  1 
ATOM   979  C CE  . LYS A 1 135 ? -47.803 47.003 -111.352 1.00 49.38 ? 130  LYS A CE  1 
ATOM   980  N NZ  . LYS A 1 135 ? -46.546 47.739 -111.743 1.00 52.16 ? 130  LYS A NZ  1 
ATOM   981  N N   . LEU A 1 136 ? -49.672 42.950 -115.735 1.00 31.05 ? 131  LEU A N   1 
ATOM   982  C CA  . LEU A 1 136 ? -50.641 41.859 -115.640 1.00 27.75 ? 131  LEU A CA  1 
ATOM   983  C C   . LEU A 1 136 ? -51.377 41.841 -114.302 1.00 26.23 ? 131  LEU A C   1 
ATOM   984  O O   . LEU A 1 136 ? -50.797 42.143 -113.250 1.00 25.40 ? 131  LEU A O   1 
ATOM   985  C CB  . LEU A 1 136 ? -49.941 40.520 -115.827 1.00 27.21 ? 131  LEU A CB  1 
ATOM   986  C CG  . LEU A 1 136 ? -49.226 40.319 -117.155 1.00 26.93 ? 131  LEU A CG  1 
ATOM   987  C CD1 . LEU A 1 136 ? -48.384 39.037 -117.133 1.00 26.00 ? 131  LEU A CD1 1 
ATOM   988  C CD2 . LEU A 1 136 ? -50.268 40.263 -118.237 1.00 26.38 ? 131  LEU A CD2 1 
ATOM   989  N N   . ILE A 1 137 ? -52.659 41.488 -114.352 1.00 23.94 ? 132  ILE A N   1 
ATOM   990  C CA  . ILE A 1 137 ? -53.477 41.403 -113.153 1.00 21.78 ? 132  ILE A CA  1 
ATOM   991  C C   . ILE A 1 137 ? -52.888 40.398 -112.141 1.00 22.32 ? 132  ILE A C   1 
ATOM   992  O O   . ILE A 1 137 ? -52.878 40.658 -110.943 1.00 23.20 ? 132  ILE A O   1 
ATOM   993  C CB  . ILE A 1 137 ? -54.907 41.003 -113.527 1.00 19.92 ? 132  ILE A CB  1 
ATOM   994  C CG1 . ILE A 1 137 ? -55.509 42.076 -114.424 1.00 18.07 ? 132  ILE A CG1 1 
ATOM   995  C CG2 . ILE A 1 137 ? -55.744 40.804 -112.285 1.00 17.55 ? 132  ILE A CG2 1 
ATOM   996  C CD1 . ILE A 1 137 ? -56.804 41.653 -115.058 1.00 17.23 ? 132  ILE A CD1 1 
ATOM   997  N N   . SER A 1 138 ? -52.383 39.261 -112.605 1.00 21.54 ? 133  SER A N   1 
ATOM   998  C CA  . SER A 1 138 ? -51.805 38.307 -111.671 1.00 22.49 ? 133  SER A CA  1 
ATOM   999  C C   . SER A 1 138 ? -50.590 38.920 -110.980 1.00 23.75 ? 133  SER A C   1 
ATOM   1000 O O   . SER A 1 138 ? -50.297 38.607 -109.829 1.00 23.68 ? 133  SER A O   1 
ATOM   1001 C CB  . SER A 1 138 ? -51.401 37.020 -112.384 1.00 20.68 ? 133  SER A CB  1 
ATOM   1002 O OG  . SER A 1 138 ? -50.468 37.286 -113.400 1.00 21.22 ? 133  SER A OG  1 
ATOM   1003 N N   . GLU A 1 139 ? -49.890 39.797 -111.688 1.00 25.27 ? 134  GLU A N   1 
ATOM   1004 C CA  . GLU A 1 139 ? -48.728 40.467 -111.127 1.00 27.20 ? 134  GLU A CA  1 
ATOM   1005 C C   . GLU A 1 139 ? -49.182 41.453 -110.081 1.00 27.74 ? 134  GLU A C   1 
ATOM   1006 O O   . GLU A 1 139 ? -48.594 41.537 -109.008 1.00 28.79 ? 134  GLU A O   1 
ATOM   1007 C CB  . GLU A 1 139 ? -47.948 41.190 -112.211 1.00 29.00 ? 134  GLU A CB  1 
ATOM   1008 C CG  . GLU A 1 139 ? -47.151 40.234 -113.073 1.00 33.67 ? 134  GLU A CG  1 
ATOM   1009 C CD  . GLU A 1 139 ? -46.309 40.943 -114.108 1.00 36.63 ? 134  GLU A CD  1 
ATOM   1010 O OE1 . GLU A 1 139 ? -45.485 40.252 -114.757 1.00 39.10 ? 134  GLU A OE1 1 
ATOM   1011 O OE2 . GLU A 1 139 ? -46.476 42.178 -114.273 1.00 37.81 ? 134  GLU A OE2 1 
ATOM   1012 N N   . VAL A 1 140 ? -50.235 42.198 -110.397 1.00 27.57 ? 135  VAL A N   1 
ATOM   1013 C CA  . VAL A 1 140 ? -50.791 43.163 -109.465 1.00 27.69 ? 135  VAL A CA  1 
ATOM   1014 C C   . VAL A 1 140 ? -51.181 42.411 -108.190 1.00 28.23 ? 135  VAL A C   1 
ATOM   1015 O O   . VAL A 1 140 ? -50.737 42.775 -107.101 1.00 29.05 ? 135  VAL A O   1 
ATOM   1016 C CB  . VAL A 1 140 ? -52.040 43.853 -110.058 1.00 28.34 ? 135  VAL A CB  1 
ATOM   1017 C CG1 . VAL A 1 140 ? -52.767 44.639 -108.985 1.00 26.90 ? 135  VAL A CG1 1 
ATOM   1018 C CG2 . VAL A 1 140 ? -51.633 44.760 -111.210 1.00 27.72 ? 135  VAL A CG2 1 
ATOM   1019 N N   . ILE A 1 141 ? -51.997 41.361 -108.333 1.00 27.68 ? 136  ILE A N   1 
ATOM   1020 C CA  . ILE A 1 141 ? -52.436 40.542 -107.196 1.00 25.53 ? 136  ILE A CA  1 
ATOM   1021 C C   . ILE A 1 141 ? -51.245 39.961 -106.450 1.00 25.56 ? 136  ILE A C   1 
ATOM   1022 O O   . ILE A 1 141 ? -51.202 39.983 -105.225 1.00 25.09 ? 136  ILE A O   1 
ATOM   1023 C CB  . ILE A 1 141 ? -53.274 39.339 -107.636 1.00 24.05 ? 136  ILE A CB  1 
ATOM   1024 C CG1 . ILE A 1 141 ? -54.561 39.801 -108.320 1.00 23.11 ? 136  ILE A CG1 1 
ATOM   1025 C CG2 . ILE A 1 141 ? -53.558 38.462 -106.430 1.00 23.33 ? 136  ILE A CG2 1 
ATOM   1026 C CD1 . ILE A 1 141 ? -55.318 38.694 -109.031 1.00 19.53 ? 136  ILE A CD1 1 
ATOM   1027 N N   . GLY A 1 142 ? -50.288 39.429 -107.195 1.00 24.24 ? 137  GLY A N   1 
ATOM   1028 C CA  . GLY A 1 142 ? -49.129 38.834 -106.567 1.00 27.17 ? 137  GLY A CA  1 
ATOM   1029 C C   . GLY A 1 142 ? -48.255 39.771 -105.740 1.00 28.60 ? 137  GLY A C   1 
ATOM   1030 O O   . GLY A 1 142 ? -47.753 39.392 -104.677 1.00 27.31 ? 137  GLY A O   1 
ATOM   1031 N N   . GLU A 1 143 ? -48.064 40.991 -106.230 1.00 30.27 ? 138  GLU A N   1 
ATOM   1032 C CA  . GLU A 1 143 ? -47.235 41.970 -105.539 1.00 31.72 ? 138  GLU A CA  1 
ATOM   1033 C C   . GLU A 1 143 ? -47.910 42.633 -104.345 1.00 31.92 ? 138  GLU A C   1 
ATOM   1034 O O   . GLU A 1 143 ? -47.271 42.875 -103.334 1.00 33.34 ? 138  GLU A O   1 
ATOM   1035 C CB  . GLU A 1 143 ? -46.766 43.029 -106.521 1.00 32.62 ? 138  GLU A CB  1 
ATOM   1036 C CG  . GLU A 1 143 ? -45.878 42.467 -107.609 1.00 37.33 ? 138  GLU A CG  1 
ATOM   1037 C CD  . GLU A 1 143 ? -45.540 43.495 -108.675 1.00 40.37 ? 138  GLU A CD  1 
ATOM   1038 O OE1 . GLU A 1 143 ? -45.368 44.681 -108.318 1.00 42.47 ? 138  GLU A OE1 1 
ATOM   1039 O OE2 . GLU A 1 143 ? -45.432 43.117 -109.866 1.00 42.79 ? 138  GLU A OE2 1 
ATOM   1040 N N   . ARG A 1 144 ? -49.194 42.931 -104.436 1.00 31.64 ? 139  ARG A N   1 
ATOM   1041 C CA  . ARG A 1 144 ? -49.859 43.551 -103.301 1.00 32.02 ? 139  ARG A CA  1 
ATOM   1042 C C   . ARG A 1 144 ? -49.978 42.577 -102.128 1.00 32.22 ? 139  ARG A C   1 
ATOM   1043 O O   . ARG A 1 144 ? -49.690 42.935 -100.982 1.00 32.32 ? 139  ARG A O   1 
ATOM   1044 C CB  . ARG A 1 144 ? -51.247 44.027 -103.702 1.00 33.12 ? 139  ARG A CB  1 
ATOM   1045 C CG  . ARG A 1 144 ? -51.221 44.863 -104.939 1.00 36.18 ? 139  ARG A CG  1 
ATOM   1046 C CD  . ARG A 1 144 ? -51.440 46.309 -104.610 1.00 40.10 ? 139  ARG A CD  1 
ATOM   1047 N NE  . ARG A 1 144 ? -52.854 46.629 -104.418 1.00 40.42 ? 139  ARG A NE  1 
ATOM   1048 C CZ  . ARG A 1 144 ? -53.395 46.994 -103.260 1.00 41.21 ? 139  ARG A CZ  1 
ATOM   1049 N NH1 . ARG A 1 144 ? -52.655 47.087 -102.148 1.00 39.53 ? 139  ARG A NH1 1 
ATOM   1050 N NH2 . ARG A 1 144 ? -54.685 47.298 -103.234 1.00 40.63 ? 139  ARG A NH2 1 
ATOM   1051 N N   . LEU A 1 145 ? -50.394 41.344 -102.424 1.00 31.71 ? 140  LEU A N   1 
ATOM   1052 C CA  . LEU A 1 145 ? -50.590 40.315 -101.409 1.00 29.41 ? 140  LEU A CA  1 
ATOM   1053 C C   . LEU A 1 145 ? -49.329 39.539 -101.097 1.00 28.36 ? 140  LEU A C   1 
ATOM   1054 O O   . LEU A 1 145 ? -49.303 38.759 -100.157 1.00 29.73 ? 140  LEU A O   1 
ATOM   1055 C CB  . LEU A 1 145 ? -51.662 39.328 -101.861 1.00 29.53 ? 140  LEU A CB  1 
ATOM   1056 C CG  . LEU A 1 145 ? -53.032 39.883 -102.248 1.00 30.45 ? 140  LEU A CG  1 
ATOM   1057 C CD1 . LEU A 1 145 ? -53.897 38.750 -102.788 1.00 28.63 ? 140  LEU A CD1 1 
ATOM   1058 C CD2 . LEU A 1 145 ? -53.680 40.553 -101.040 1.00 30.83 ? 140  LEU A CD2 1 
ATOM   1059 N N   . GLY A 1 146 ? -48.287 39.731 -101.888 1.00 26.63 ? 141  GLY A N   1 
ATOM   1060 C CA  . GLY A 1 146 ? -47.054 39.013 -101.637 1.00 23.83 ? 141  GLY A CA  1 
ATOM   1061 C C   . GLY A 1 146 ? -47.143 37.496 -101.713 1.00 22.91 ? 141  GLY A C   1 
ATOM   1062 O O   . GLY A 1 146 ? -46.669 36.816 -100.812 1.00 23.38 ? 141  GLY A O   1 
ATOM   1063 N N   . ILE A 1 147 ? -47.735 36.949 -102.771 1.00 20.85 ? 142  ILE A N   1 
ATOM   1064 C CA  . ILE A 1 147 ? -47.829 35.496 -102.899 1.00 20.56 ? 142  ILE A CA  1 
ATOM   1065 C C   . ILE A 1 147 ? -47.481 35.077 -104.324 1.00 21.17 ? 142  ILE A C   1 
ATOM   1066 O O   . ILE A 1 147 ? -47.613 35.876 -105.250 1.00 22.80 ? 142  ILE A O   1 
ATOM   1067 C CB  . ILE A 1 147 ? -49.232 35.024 -102.559 1.00 19.83 ? 142  ILE A CB  1 
ATOM   1068 C CG1 . ILE A 1 147 ? -50.228 35.636 -103.543 1.00 19.61 ? 142  ILE A CG1 1 
ATOM   1069 C CG2 . ILE A 1 147 ? -49.575 35.439 -101.127 1.00 20.05 ? 142  ILE A CG2 1 
ATOM   1070 C CD1 . ILE A 1 147 ? -51.691 35.479 -103.133 1.00 20.02 ? 142  ILE A CD1 1 
ATOM   1071 N N   . PRO A 1 148 ? -46.999 33.833 -104.518 1.00 21.01 ? 143  PRO A N   1 
ATOM   1072 C CA  . PRO A 1 148 ? -46.621 33.281 -105.831 1.00 19.97 ? 143  PRO A CA  1 
ATOM   1073 C C   . PRO A 1 148 ? -47.902 33.142 -106.621 1.00 20.00 ? 143  PRO A C   1 
ATOM   1074 O O   . PRO A 1 148 ? -48.948 32.830 -106.049 1.00 20.01 ? 143  PRO A O   1 
ATOM   1075 C CB  . PRO A 1 148 ? -46.045 31.910 -105.496 1.00 20.61 ? 143  PRO A CB  1 
ATOM   1076 C CG  . PRO A 1 148 ? -45.703 32.004 -104.055 1.00 22.03 ? 143  PRO A CG  1 
ATOM   1077 C CD  . PRO A 1 148 ? -46.788 32.836 -103.461 1.00 21.11 ? 143  PRO A CD  1 
ATOM   1078 N N   . MET A 1 149 ? -47.830 33.317 -107.932 1.00 19.72 ? 144  MET A N   1 
ATOM   1079 C CA  . MET A 1 149 ? -49.044 33.273 -108.723 1.00 18.73 ? 144  MET A CA  1 
ATOM   1080 C C   . MET A 1 149 ? -49.077 32.458 -110.003 1.00 18.43 ? 144  MET A C   1 
ATOM   1081 O O   . MET A 1 149 ? -48.101 32.355 -110.731 1.00 17.97 ? 144  MET A O   1 
ATOM   1082 C CB  . MET A 1 149 ? -49.441 34.702 -109.055 1.00 19.11 ? 144  MET A CB  1 
ATOM   1083 C CG  . MET A 1 149 ? -49.933 35.499 -107.889 1.00 19.31 ? 144  MET A CG  1 
ATOM   1084 S SD  . MET A 1 149 ? -51.697 35.399 -107.831 1.00 24.78 ? 144  MET A SD  1 
ATOM   1085 C CE  . MET A 1 149 ? -51.924 34.913 -106.240 1.00 25.75 ? 144  MET A CE  1 
ATOM   1086 N N   . SER A 1 150 ? -50.240 31.885 -110.266 1.00 18.08 ? 145  SER A N   1 
ATOM   1087 C CA  . SER A 1 150 ? -50.464 31.132 -111.487 1.00 18.69 ? 145  SER A CA  1 
ATOM   1088 C C   . SER A 1 150 ? -51.692 31.724 -112.201 1.00 17.92 ? 145  SER A C   1 
ATOM   1089 O O   . SER A 1 150 ? -52.323 32.675 -111.714 1.00 17.38 ? 145  SER A O   1 
ATOM   1090 C CB  . SER A 1 150 ? -50.706 29.654 -111.167 1.00 18.81 ? 145  SER A CB  1 
ATOM   1091 O OG  . SER A 1 150 ? -49.547 29.074 -110.613 1.00 21.72 ? 145  SER A OG  1 
ATOM   1092 N N   . VAL A 1 151 ? -52.023 31.172 -113.361 1.00 16.86 ? 146  VAL A N   1 
ATOM   1093 C CA  . VAL A 1 151 ? -53.198 31.626 -114.092 1.00 17.17 ? 146  VAL A CA  1 
ATOM   1094 C C   . VAL A 1 151 ? -53.887 30.441 -114.762 1.00 17.57 ? 146  VAL A C   1 
ATOM   1095 O O   . VAL A 1 151 ? -53.231 29.497 -115.211 1.00 20.16 ? 146  VAL A O   1 
ATOM   1096 C CB  . VAL A 1 151 ? -52.860 32.673 -115.205 1.00 15.90 ? 146  VAL A CB  1 
ATOM   1097 C CG1 . VAL A 1 151 ? -52.347 33.971 -114.587 1.00 14.05 ? 146  VAL A CG1 1 
ATOM   1098 C CG2 . VAL A 1 151 ? -51.865 32.075 -116.200 1.00 15.79 ? 146  VAL A CG2 1 
ATOM   1099 N N   . LEU A 1 152 ? -55.211 30.479 -114.807 1.00 15.75 ? 147  LEU A N   1 
ATOM   1100 C CA  . LEU A 1 152 ? -55.963 29.435 -115.470 1.00 14.66 ? 147  LEU A CA  1 
ATOM   1101 C C   . LEU A 1 152 ? -56.747 30.161 -116.562 1.00 15.07 ? 147  LEU A C   1 
ATOM   1102 O O   . LEU A 1 152 ? -57.568 31.050 -116.293 1.00 14.01 ? 147  LEU A O   1 
ATOM   1103 C CB  . LEU A 1 152 ? -56.898 28.709 -114.495 1.00 13.78 ? 147  LEU A CB  1 
ATOM   1104 C CG  . LEU A 1 152 ? -57.510 27.462 -115.137 1.00 13.77 ? 147  LEU A CG  1 
ATOM   1105 C CD1 . LEU A 1 152 ? -57.898 26.461 -114.095 1.00 11.83 ? 147  LEU A CD1 1 
ATOM   1106 C CD2 . LEU A 1 152 ? -58.695 27.863 -115.988 1.00 12.35 ? 147  LEU A CD2 1 
ATOM   1107 N N   . MET A 1 153 ? -56.458 29.790 -117.803 1.00 14.20 ? 148  MET A N   1 
ATOM   1108 C CA  . MET A 1 153 ? -57.086 30.408 -118.953 1.00 13.02 ? 148  MET A CA  1 
ATOM   1109 C C   . MET A 1 153 ? -57.341 29.368 -120.043 1.00 13.06 ? 148  MET A C   1 
ATOM   1110 O O   . MET A 1 153 ? -56.453 28.601 -120.401 1.00 12.64 ? 148  MET A O   1 
ATOM   1111 C CB  . MET A 1 153 ? -56.168 31.497 -119.524 1.00 12.55 ? 148  MET A CB  1 
ATOM   1112 C CG  . MET A 1 153 ? -55.701 32.572 -118.552 1.00 10.63 ? 148  MET A CG  1 
ATOM   1113 S SD  . MET A 1 153 ? -56.914 33.833 -118.241 1.00 11.79 ? 148  MET A SD  1 
ATOM   1114 C CE  . MET A 1 153 ? -56.502 34.314 -116.629 1.00 11.86 ? 148  MET A CE  1 
ATOM   1115 N N   . GLY A 1 154 ? -58.560 29.369 -120.576 1.00 13.01 ? 149  GLY A N   1 
ATOM   1116 C CA  . GLY A 1 154 ? -58.919 28.455 -121.636 1.00 10.73 ? 149  GLY A CA  1 
ATOM   1117 C C   . GLY A 1 154 ? -60.285 28.801 -122.188 1.00 11.02 ? 149  GLY A C   1 
ATOM   1118 O O   . GLY A 1 154 ? -60.927 29.745 -121.724 1.00 9.56  ? 149  GLY A O   1 
ATOM   1119 N N   . ALA A 1 155 ? -60.718 28.043 -123.195 1.00 12.08 ? 150  ALA A N   1 
ATOM   1120 C CA  . ALA A 1 155 ? -62.026 28.240 -123.796 1.00 12.82 ? 150  ALA A CA  1 
ATOM   1121 C C   . ALA A 1 155 ? -63.020 27.609 -122.809 1.00 13.04 ? 150  ALA A C   1 
ATOM   1122 O O   . ALA A 1 155 ? -63.313 26.404 -122.875 1.00 12.66 ? 150  ALA A O   1 
ATOM   1123 C CB  . ALA A 1 155 ? -62.080 27.542 -125.149 1.00 13.86 ? 150  ALA A CB  1 
ATOM   1124 N N   . ASN A 1 156 ? -63.532 28.427 -121.895 1.00 12.38 ? 151  ASN A N   1 
ATOM   1125 C CA  . ASN A 1 156 ? -64.439 27.920 -120.874 1.00 13.33 ? 151  ASN A CA  1 
ATOM   1126 C C   . ASN A 1 156 ? -65.776 28.658 -120.660 1.00 12.70 ? 151  ASN A C   1 
ATOM   1127 O O   . ASN A 1 156 ? -65.999 29.178 -119.585 1.00 13.11 ? 151  ASN A O   1 
ATOM   1128 C CB  . ASN A 1 156 ? -63.687 27.870 -119.531 1.00 14.36 ? 151  ASN A CB  1 
ATOM   1129 C CG  . ASN A 1 156 ? -62.290 27.238 -119.650 1.00 17.96 ? 151  ASN A CG  1 
ATOM   1130 O OD1 . ASN A 1 156 ? -62.156 26.204 -120.340 1.00 19.51 ? 151  ASN A OD1 1 
ATOM   1131 N ND2 . ASN A 1 156 ? -61.323 27.755 -119.043 1.00 16.98 ? 151  ASN A ND2 1 
ATOM   1132 N N   . ILE A 1 157 ? -66.661 28.723 -121.650 1.00 11.55 ? 152  ILE A N   1 
ATOM   1133 C CA  . ILE A 1 157 ? -67.943 29.382 -121.433 1.00 12.15 ? 152  ILE A CA  1 
ATOM   1134 C C   . ILE A 1 157 ? -68.462 28.678 -120.162 1.00 12.98 ? 152  ILE A C   1 
ATOM   1135 O O   . ILE A 1 157 ? -68.512 27.448 -120.111 1.00 13.00 ? 152  ILE A O   1 
ATOM   1136 C CB  . ILE A 1 157 ? -68.907 29.115 -122.623 1.00 14.39 ? 152  ILE A CB  1 
ATOM   1137 C CG1 . ILE A 1 157 ? -68.331 29.698 -123.920 1.00 13.60 ? 152  ILE A CG1 1 
ATOM   1138 C CG2 . ILE A 1 157 ? -70.299 29.672 -122.332 1.00 13.58 ? 152  ILE A CG2 1 
ATOM   1139 C CD1 . ILE A 1 157 ? -68.466 31.153 -124.045 1.00 15.18 ? 152  ILE A CD1 1 
ATOM   1140 N N   . ALA A 1 158 ? -68.832 29.447 -119.140 1.00 13.20 ? 153  ALA A N   1 
ATOM   1141 C CA  . ALA A 1 158 ? -69.277 28.882 -117.869 1.00 13.60 ? 153  ALA A CA  1 
ATOM   1142 C C   . ALA A 1 158 ? -70.477 27.936 -117.943 1.00 15.10 ? 153  ALA A C   1 
ATOM   1143 O O   . ALA A 1 158 ? -70.409 26.812 -117.443 1.00 16.26 ? 153  ALA A O   1 
ATOM   1144 C CB  . ALA A 1 158 ? -69.550 29.994 -116.890 1.00 14.07 ? 153  ALA A CB  1 
ATOM   1145 N N   . SER A 1 159 ? -71.572 28.378 -118.551 1.00 14.56 ? 154  SER A N   1 
ATOM   1146 C CA  . SER A 1 159 ? -72.756 27.538 -118.691 1.00 13.28 ? 154  SER A CA  1 
ATOM   1147 C C   . SER A 1 159 ? -72.401 26.174 -119.270 1.00 12.72 ? 154  SER A C   1 
ATOM   1148 O O   . SER A 1 159 ? -72.935 25.154 -118.832 1.00 12.60 ? 154  SER A O   1 
ATOM   1149 C CB  . SER A 1 159 ? -73.770 28.202 -119.605 1.00 14.77 ? 154  SER A CB  1 
ATOM   1150 O OG  . SER A 1 159 ? -73.261 28.316 -120.924 1.00 19.44 ? 154  SER A OG  1 
ATOM   1151 N N   . GLU A 1 160 ? -71.519 26.138 -120.263 1.00 11.94 ? 155  GLU A N   1 
ATOM   1152 C CA  . GLU A 1 160 ? -71.146 24.846 -120.826 1.00 14.12 ? 155  GLU A CA  1 
ATOM   1153 C C   . GLU A 1 160 ? -70.301 24.029 -119.835 1.00 15.26 ? 155  GLU A C   1 
ATOM   1154 O O   . GLU A 1 160 ? -70.495 22.834 -119.685 1.00 15.15 ? 155  GLU A O   1 
ATOM   1155 C CB  . GLU A 1 160 ? -70.416 25.017 -122.153 1.00 13.77 ? 155  GLU A CB  1 
ATOM   1156 C CG  . GLU A 1 160 ? -71.300 25.543 -123.260 1.00 14.39 ? 155  GLU A CG  1 
ATOM   1157 C CD  . GLU A 1 160 ? -70.611 25.486 -124.603 1.00 17.27 ? 155  GLU A CD  1 
ATOM   1158 O OE1 . GLU A 1 160 ? -69.497 24.908 -124.672 1.00 18.88 ? 155  GLU A OE1 1 
ATOM   1159 O OE2 . GLU A 1 160 ? -71.177 26.000 -125.594 1.00 16.68 ? 155  GLU A OE2 1 
ATOM   1160 N N   . VAL A 1 161 ? -69.373 24.676 -119.147 1.00 16.93 ? 156  VAL A N   1 
ATOM   1161 C CA  . VAL A 1 161 ? -68.563 23.981 -118.157 1.00 18.46 ? 156  VAL A CA  1 
ATOM   1162 C C   . VAL A 1 161 ? -69.502 23.388 -117.088 1.00 18.99 ? 156  VAL A C   1 
ATOM   1163 O O   . VAL A 1 161 ? -69.409 22.205 -116.732 1.00 17.68 ? 156  VAL A O   1 
ATOM   1164 C CB  . VAL A 1 161 ? -67.552 24.963 -117.500 1.00 18.97 ? 156  VAL A CB  1 
ATOM   1165 C CG1 . VAL A 1 161 ? -66.695 24.243 -116.468 1.00 18.63 ? 156  VAL A CG1 1 
ATOM   1166 C CG2 . VAL A 1 161 ? -66.673 25.572 -118.572 1.00 19.68 ? 156  VAL A CG2 1 
ATOM   1167 N N   . ALA A 1 162 ? -70.410 24.224 -116.586 1.00 19.63 ? 157  ALA A N   1 
ATOM   1168 C CA  . ALA A 1 162 ? -71.369 23.806 -115.570 1.00 19.81 ? 157  ALA A CA  1 
ATOM   1169 C C   . ALA A 1 162 ? -72.183 22.592 -116.043 1.00 20.36 ? 157  ALA A C   1 
ATOM   1170 O O   . ALA A 1 162 ? -72.567 21.737 -115.237 1.00 20.28 ? 157  ALA A O   1 
ATOM   1171 C CB  . ALA A 1 162 ? -72.288 24.976 -115.218 1.00 17.74 ? 157  ALA A CB  1 
ATOM   1172 N N   . ASP A 1 163 ? -72.434 22.518 -117.350 1.00 20.64 ? 158  ASP A N   1 
ATOM   1173 C CA  . ASP A 1 163 ? -73.173 21.400 -117.934 1.00 21.26 ? 158  ASP A CA  1 
ATOM   1174 C C   . ASP A 1 163 ? -72.298 20.176 -118.211 1.00 21.51 ? 158  ASP A C   1 
ATOM   1175 O O   . ASP A 1 163 ? -72.785 19.154 -118.678 1.00 21.16 ? 158  ASP A O   1 
ATOM   1176 C CB  . ASP A 1 163 ? -73.871 21.824 -119.230 1.00 21.91 ? 158  ASP A CB  1 
ATOM   1177 C CG  . ASP A 1 163 ? -75.164 22.582 -118.972 1.00 23.50 ? 158  ASP A CG  1 
ATOM   1178 O OD1 . ASP A 1 163 ? -75.885 22.227 -118.001 1.00 23.95 ? 158  ASP A OD1 1 
ATOM   1179 O OD2 . ASP A 1 163 ? -75.469 23.521 -119.741 1.00 23.55 ? 158  ASP A OD2 1 
ATOM   1180 N N   . GLU A 1 164 ? -71.008 20.295 -117.917 1.00 22.92 ? 159  GLU A N   1 
ATOM   1181 C CA  . GLU A 1 164 ? -70.049 19.220 -118.108 1.00 22.88 ? 159  GLU A CA  1 
ATOM   1182 C C   . GLU A 1 164 ? -69.787 18.808 -119.546 1.00 21.37 ? 159  GLU A C   1 
ATOM   1183 O O   . GLU A 1 164 ? -69.412 17.666 -119.803 1.00 21.96 ? 159  GLU A O   1 
ATOM   1184 C CB  . GLU A 1 164 ? -70.483 18.021 -117.285 1.00 25.24 ? 159  GLU A CB  1 
ATOM   1185 C CG  . GLU A 1 164 ? -70.204 18.226 -115.822 1.00 33.31 ? 159  GLU A CG  1 
ATOM   1186 C CD  . GLU A 1 164 ? -70.902 17.218 -114.941 1.00 38.05 ? 159  GLU A CD  1 
ATOM   1187 O OE1 . GLU A 1 164 ? -70.921 16.024 -115.315 1.00 40.77 ? 159  GLU A OE1 1 
ATOM   1188 O OE2 . GLU A 1 164 ? -71.419 17.618 -113.866 1.00 41.31 ? 159  GLU A OE2 1 
ATOM   1189 N N   . LYS A 1 165 ? -69.986 19.729 -120.483 1.00 19.42 ? 160  LYS A N   1 
ATOM   1190 C CA  . LYS A 1 165 ? -69.734 19.450 -121.887 1.00 19.01 ? 160  LYS A CA  1 
ATOM   1191 C C   . LYS A 1 165 ? -68.205 19.369 -121.949 1.00 19.80 ? 160  LYS A C   1 
ATOM   1192 O O   . LYS A 1 165 ? -67.521 20.138 -121.275 1.00 21.20 ? 160  LYS A O   1 
ATOM   1193 C CB  . LYS A 1 165 ? -70.219 20.614 -122.770 1.00 19.51 ? 160  LYS A CB  1 
ATOM   1194 C CG  . LYS A 1 165 ? -71.668 21.132 -122.555 1.00 19.20 ? 160  LYS A CG  1 
ATOM   1195 C CD  . LYS A 1 165 ? -72.689 20.351 -123.381 1.00 19.77 ? 160  LYS A CD  1 
ATOM   1196 C CE  . LYS A 1 165 ? -74.091 20.952 -123.365 1.00 17.44 ? 160  LYS A CE  1 
ATOM   1197 N NZ  . LYS A 1 165 ? -74.148 22.263 -124.052 1.00 15.95 ? 160  LYS A NZ  1 
ATOM   1198 N N   . PHE A 1 166 ? -67.649 18.466 -122.746 1.00 19.52 ? 161  PHE A N   1 
ATOM   1199 C CA  . PHE A 1 166 ? -66.190 18.368 -122.817 1.00 19.14 ? 161  PHE A CA  1 
ATOM   1200 C C   . PHE A 1 166 ? -65.460 19.658 -123.218 1.00 19.85 ? 161  PHE A C   1 
ATOM   1201 O O   . PHE A 1 166 ? -65.840 20.350 -124.176 1.00 19.45 ? 161  PHE A O   1 
ATOM   1202 C CB  . PHE A 1 166 ? -65.748 17.273 -123.788 1.00 17.30 ? 161  PHE A CB  1 
ATOM   1203 C CG  . PHE A 1 166 ? -64.259 17.154 -123.890 1.00 15.74 ? 161  PHE A CG  1 
ATOM   1204 C CD1 . PHE A 1 166 ? -63.530 16.539 -122.877 1.00 15.46 ? 161  PHE A CD1 1 
ATOM   1205 C CD2 . PHE A 1 166 ? -63.571 17.744 -124.938 1.00 15.31 ? 161  PHE A CD2 1 
ATOM   1206 C CE1 . PHE A 1 166 ? -62.128 16.520 -122.899 1.00 14.65 ? 161  PHE A CE1 1 
ATOM   1207 C CE2 . PHE A 1 166 ? -62.161 17.731 -124.970 1.00 15.37 ? 161  PHE A CE2 1 
ATOM   1208 C CZ  . PHE A 1 166 ? -61.443 17.122 -123.954 1.00 13.20 ? 161  PHE A CZ  1 
ATOM   1209 N N   . CYS A 1 167 ? -64.384 19.951 -122.498 1.00 19.86 ? 162  CYS A N   1 
ATOM   1210 C CA  . CYS A 1 167 ? -63.584 21.130 -122.772 1.00 20.82 ? 162  CYS A CA  1 
ATOM   1211 C C   . CYS A 1 167 ? -62.272 21.082 -122.032 1.00 20.50 ? 162  CYS A C   1 
ATOM   1212 O O   . CYS A 1 167 ? -62.063 20.241 -121.168 1.00 21.23 ? 162  CYS A O   1 
ATOM   1213 C CB  . CYS A 1 167 ? -64.339 22.401 -122.397 1.00 21.78 ? 162  CYS A CB  1 
ATOM   1214 S SG  . CYS A 1 167 ? -64.647 22.597 -120.675 1.00 25.29 ? 162  CYS A SG  1 
ATOM   1215 N N   . GLU A 1 168 ? -61.383 22.000 -122.382 1.00 20.55 ? 163  GLU A N   1 
ATOM   1216 C CA  . GLU A 1 168 ? -60.060 22.056 -121.785 1.00 19.27 ? 163  GLU A CA  1 
ATOM   1217 C C   . GLU A 1 168 ? -59.682 23.460 -121.345 1.00 17.69 ? 163  GLU A C   1 
ATOM   1218 O O   . GLU A 1 168 ? -60.395 24.411 -121.622 1.00 18.43 ? 163  GLU A O   1 
ATOM   1219 C CB  . GLU A 1 168 ? -59.041 21.531 -122.790 1.00 18.74 ? 163  GLU A CB  1 
ATOM   1220 C CG  . GLU A 1 168 ? -59.590 21.400 -124.173 1.00 18.40 ? 163  GLU A CG  1 
ATOM   1221 C CD  . GLU A 1 168 ? -58.543 21.010 -125.176 1.00 21.69 ? 163  GLU A CD  1 
ATOM   1222 O OE1 . GLU A 1 168 ? -57.912 19.928 -125.019 1.00 21.45 ? 163  GLU A OE1 1 
ATOM   1223 O OE2 . GLU A 1 168 ? -58.344 21.798 -126.127 1.00 22.54 ? 163  GLU A OE2 1 
ATOM   1224 N N   . THR A 1 169 ? -58.564 23.572 -120.641 1.00 16.43 ? 164  THR A N   1 
ATOM   1225 C CA  . THR A 1 169 ? -58.068 24.851 -120.177 1.00 16.92 ? 164  THR A CA  1 
ATOM   1226 C C   . THR A 1 169 ? -56.552 24.763 -120.024 1.00 17.19 ? 164  THR A C   1 
ATOM   1227 O O   . THR A 1 169 ? -55.982 23.669 -119.987 1.00 17.51 ? 164  THR A O   1 
ATOM   1228 C CB  . THR A 1 169 ? -58.704 25.265 -118.823 1.00 17.49 ? 164  THR A CB  1 
ATOM   1229 O OG1 . THR A 1 169 ? -58.627 26.688 -118.684 1.00 17.92 ? 164  THR A OG1 1 
ATOM   1230 C CG2 . THR A 1 169 ? -57.975 24.628 -117.650 1.00 16.58 ? 164  THR A CG2 1 
ATOM   1231 N N   . THR A 1 170 ? -55.906 25.922 -119.933 1.00 16.48 ? 165  THR A N   1 
ATOM   1232 C CA  . THR A 1 170 ? -54.459 25.995 -119.808 1.00 14.45 ? 165  THR A CA  1 
ATOM   1233 C C   . THR A 1 170 ? -54.069 26.618 -118.479 1.00 15.79 ? 165  THR A C   1 
ATOM   1234 O O   . THR A 1 170 ? -54.604 27.662 -118.095 1.00 17.56 ? 165  THR A O   1 
ATOM   1235 C CB  . THR A 1 170 ? -53.859 26.872 -120.916 1.00 12.29 ? 165  THR A CB  1 
ATOM   1236 O OG1 . THR A 1 170 ? -54.318 26.422 -122.193 1.00 10.04 ? 165  THR A OG1 1 
ATOM   1237 C CG2 . THR A 1 170 ? -52.351 26.811 -120.876 1.00 11.92 ? 165  THR A CG2 1 
ATOM   1238 N N   . ILE A 1 171 ? -53.154 25.987 -117.755 1.00 15.71 ? 166  ILE A N   1 
ATOM   1239 C CA  . ILE A 1 171 ? -52.718 26.591 -116.516 1.00 16.34 ? 166  ILE A CA  1 
ATOM   1240 C C   . ILE A 1 171 ? -51.283 27.010 -116.724 1.00 18.74 ? 166  ILE A C   1 
ATOM   1241 O O   . ILE A 1 171 ? -50.439 26.205 -117.148 1.00 19.79 ? 166  ILE A O   1 
ATOM   1242 C CB  . ILE A 1 171 ? -52.810 25.643 -115.293 1.00 14.55 ? 166  ILE A CB  1 
ATOM   1243 C CG1 . ILE A 1 171 ? -54.267 25.483 -114.870 1.00 13.36 ? 166  ILE A CG1 1 
ATOM   1244 C CG2 . ILE A 1 171 ? -52.069 26.239 -114.111 1.00 11.20 ? 166  ILE A CG2 1 
ATOM   1245 C CD1 . ILE A 1 171 ? -54.462 24.606 -113.635 1.00 11.58 ? 166  ILE A CD1 1 
ATOM   1246 N N   . GLY A 1 172 ? -51.024 28.289 -116.465 1.00 19.64 ? 167  GLY A N   1 
ATOM   1247 C CA  . GLY A 1 172 ? -49.682 28.809 -116.588 1.00 20.97 ? 167  GLY A CA  1 
ATOM   1248 C C   . GLY A 1 172 ? -49.096 28.790 -115.195 1.00 22.16 ? 167  GLY A C   1 
ATOM   1249 O O   . GLY A 1 172 ? -49.657 29.378 -114.268 1.00 22.13 ? 167  GLY A O   1 
ATOM   1250 N N   . CYS A 1 173 ? -47.982 28.093 -115.028 1.00 23.13 ? 168  CYS A N   1 
ATOM   1251 C CA  . CYS A 1 173 ? -47.340 28.027 -113.722 1.00 24.49 ? 168  CYS A CA  1 
ATOM   1252 C C   . CYS A 1 173 ? -45.855 27.779 -113.893 1.00 25.34 ? 168  CYS A C   1 
ATOM   1253 O O   . CYS A 1 173 ? -45.445 26.914 -114.661 1.00 26.07 ? 168  CYS A O   1 
ATOM   1254 C CB  . CYS A 1 173 ? -47.951 26.922 -112.880 1.00 23.32 ? 168  CYS A CB  1 
ATOM   1255 S SG  . CYS A 1 173 ? -47.335 26.953 -111.220 1.00 24.31 ? 168  CYS A SG  1 
ATOM   1256 N N   . LYS A 1 174 ? -45.046 28.538 -113.170 1.00 26.53 ? 169  LYS A N   1 
ATOM   1257 C CA  . LYS A 1 174 ? -43.608 28.403 -113.288 1.00 27.76 ? 169  LYS A CA  1 
ATOM   1258 C C   . LYS A 1 174 ? -43.053 27.261 -112.470 1.00 27.18 ? 169  LYS A C   1 
ATOM   1259 O O   . LYS A 1 174 ? -42.076 26.636 -112.860 1.00 29.12 ? 169  LYS A O   1 
ATOM   1260 C CB  . LYS A 1 174 ? -42.934 29.707 -112.881 1.00 29.63 ? 169  LYS A CB  1 
ATOM   1261 C CG  . LYS A 1 174 ? -43.278 30.902 -113.763 1.00 32.23 ? 169  LYS A CG  1 
ATOM   1262 C CD  . LYS A 1 174 ? -42.925 32.204 -113.027 1.00 36.80 ? 169  LYS A CD  1 
ATOM   1263 C CE  . LYS A 1 174 ? -43.346 33.477 -113.786 1.00 38.57 ? 169  LYS A CE  1 
ATOM   1264 N NZ  . LYS A 1 174 ? -43.321 34.695 -112.897 1.00 38.68 ? 169  LYS A NZ  1 
ATOM   1265 N N   . ASP A 1 175 ? -43.682 26.985 -111.339 1.00 27.46 ? 170  ASP A N   1 
ATOM   1266 C CA  . ASP A 1 175 ? -43.241 25.919 -110.439 1.00 26.90 ? 170  ASP A CA  1 
ATOM   1267 C C   . ASP A 1 175 ? -43.888 24.587 -110.777 1.00 25.80 ? 170  ASP A C   1 
ATOM   1268 O O   . ASP A 1 175 ? -45.101 24.420 -110.628 1.00 27.25 ? 170  ASP A O   1 
ATOM   1269 C CB  . ASP A 1 175 ? -43.581 26.280 -108.986 1.00 28.08 ? 170  ASP A CB  1 
ATOM   1270 C CG  . ASP A 1 175 ? -43.074 25.250 -108.001 1.00 29.80 ? 170  ASP A CG  1 
ATOM   1271 O OD1 . ASP A 1 175 ? -41.846 25.106 -107.904 1.00 34.18 ? 170  ASP A OD1 1 
ATOM   1272 O OD2 . ASP A 1 175 ? -43.876 24.572 -107.327 1.00 30.21 ? 170  ASP A OD2 1 
ATOM   1273 N N   . PRO A 1 176 ? -43.089 23.609 -111.217 1.00 23.87 ? 171  PRO A N   1 
ATOM   1274 C CA  . PRO A 1 176 ? -43.634 22.291 -111.567 1.00 22.33 ? 171  PRO A CA  1 
ATOM   1275 C C   . PRO A 1 176 ? -44.488 21.649 -110.475 1.00 21.74 ? 171  PRO A C   1 
ATOM   1276 O O   . PRO A 1 176 ? -45.594 21.189 -110.744 1.00 21.96 ? 171  PRO A O   1 
ATOM   1277 C CB  . PRO A 1 176 ? -42.387 21.475 -111.885 1.00 20.50 ? 171  PRO A CB  1 
ATOM   1278 C CG  . PRO A 1 176 ? -41.489 22.493 -112.482 1.00 22.92 ? 171  PRO A CG  1 
ATOM   1279 C CD  . PRO A 1 176 ? -41.658 23.688 -111.541 1.00 22.68 ? 171  PRO A CD  1 
ATOM   1280 N N   . ALA A 1 177 ? -43.981 21.625 -109.245 1.00 22.22 ? 172  ALA A N   1 
ATOM   1281 C CA  . ALA A 1 177 ? -44.723 21.015 -108.156 1.00 21.67 ? 172  ALA A CA  1 
ATOM   1282 C C   . ALA A 1 177 ? -46.110 21.619 -108.048 1.00 23.02 ? 172  ALA A C   1 
ATOM   1283 O O   . ALA A 1 177 ? -47.121 20.899 -108.039 1.00 22.01 ? 172  ALA A O   1 
ATOM   1284 C CB  . ALA A 1 177 ? -43.965 21.169 -106.846 1.00 20.00 ? 172  ALA A CB  1 
ATOM   1285 N N   . GLN A 1 178 ? -46.141 22.954 -107.970 1.00 22.84 ? 173  GLN A N   1 
ATOM   1286 C CA  . GLN A 1 178 ? -47.368 23.732 -107.857 1.00 21.08 ? 173  GLN A CA  1 
ATOM   1287 C C   . GLN A 1 178 ? -48.219 23.528 -109.086 1.00 20.86 ? 173  GLN A C   1 
ATOM   1288 O O   . GLN A 1 178 ? -49.434 23.430 -108.989 1.00 21.95 ? 173  GLN A O   1 
ATOM   1289 C CB  . GLN A 1 178 ? -47.051 25.210 -107.733 1.00 21.12 ? 173  GLN A CB  1 
ATOM   1290 C CG  . GLN A 1 178 ? -48.283 26.087 -107.700 1.00 23.30 ? 173  GLN A CG  1 
ATOM   1291 C CD  . GLN A 1 178 ? -48.951 26.115 -106.339 1.00 22.88 ? 173  GLN A CD  1 
ATOM   1292 O OE1 . GLN A 1 178 ? -48.816 25.125 -105.598 1.00 24.71 ? 173  GLN A OE1 1 
ATOM   1293 N NE2 . GLN A 1 178 ? -49.617 27.119 -106.014 1.00 22.52 ? 173  GLN A NE2 1 
ATOM   1294 N N   . GLY A 1 179 ? -47.580 23.475 -110.246 1.00 19.54 ? 174  GLY A N   1 
ATOM   1295 C CA  . GLY A 1 179 ? -48.329 23.265 -111.464 1.00 19.89 ? 174  GLY A CA  1 
ATOM   1296 C C   . GLY A 1 179 ? -49.156 22.002 -111.360 1.00 20.36 ? 174  GLY A C   1 
ATOM   1297 O O   . GLY A 1 179 ? -50.339 22.002 -111.663 1.00 20.90 ? 174  GLY A O   1 
ATOM   1298 N N   . GLN A 1 180 ? -48.542 20.914 -110.920 1.00 20.93 ? 175  GLN A N   1 
ATOM   1299 C CA  . GLN A 1 180 ? -49.271 19.662 -110.793 1.00 22.25 ? 175  GLN A CA  1 
ATOM   1300 C C   . GLN A 1 180 ? -50.355 19.644 -109.710 1.00 22.66 ? 175  GLN A C   1 
ATOM   1301 O O   . GLN A 1 180 ? -51.386 19.011 -109.886 1.00 22.96 ? 175  GLN A O   1 
ATOM   1302 C CB  . GLN A 1 180 ? -48.298 18.523 -110.546 1.00 22.08 ? 175  GLN A CB  1 
ATOM   1303 C CG  . GLN A 1 180 ? -48.968 17.181 -110.383 1.00 23.07 ? 175  GLN A CG  1 
ATOM   1304 C CD  . GLN A 1 180 ? -49.783 16.767 -111.604 1.00 25.48 ? 175  GLN A CD  1 
ATOM   1305 O OE1 . GLN A 1 180 ? -49.313 16.834 -112.757 1.00 23.98 ? 175  GLN A OE1 1 
ATOM   1306 N NE2 . GLN A 1 180 ? -51.012 16.323 -111.356 1.00 26.23 ? 175  GLN A NE2 1 
ATOM   1307 N N   . LEU A 1 181 ? -50.111 20.328 -108.596 1.00 23.34 ? 176  LEU A N   1 
ATOM   1308 C CA  . LEU A 1 181 ? -51.055 20.409 -107.480 1.00 23.96 ? 176  LEU A CA  1 
ATOM   1309 C C   . LEU A 1 181 ? -52.335 21.164 -107.883 1.00 24.66 ? 176  LEU A C   1 
ATOM   1310 O O   . LEU A 1 181 ? -53.457 20.733 -107.573 1.00 23.63 ? 176  LEU A O   1 
ATOM   1311 C CB  . LEU A 1 181 ? -50.355 21.099 -106.302 1.00 25.83 ? 176  LEU A CB  1 
ATOM   1312 C CG  . LEU A 1 181 ? -51.027 21.322 -104.951 1.00 26.31 ? 176  LEU A CG  1 
ATOM   1313 C CD1 . LEU A 1 181 ? -51.861 22.558 -105.035 1.00 28.63 ? 176  LEU A CD1 1 
ATOM   1314 C CD2 . LEU A 1 181 ? -51.860 20.100 -104.547 1.00 27.13 ? 176  LEU A CD2 1 
ATOM   1315 N N   . LEU A 1 182 ? -52.161 22.296 -108.573 1.00 24.50 ? 177  LEU A N   1 
ATOM   1316 C CA  . LEU A 1 182 ? -53.289 23.095 -109.054 1.00 22.96 ? 177  LEU A CA  1 
ATOM   1317 C C   . LEU A 1 182 ? -54.108 22.303 -110.070 1.00 22.77 ? 177  LEU A C   1 
ATOM   1318 O O   . LEU A 1 182 ? -55.342 22.422 -110.118 1.00 23.67 ? 177  LEU A O   1 
ATOM   1319 C CB  . LEU A 1 182 ? -52.790 24.381 -109.700 1.00 21.76 ? 177  LEU A CB  1 
ATOM   1320 C CG  . LEU A 1 182 ? -52.325 25.415 -108.681 1.00 22.00 ? 177  LEU A CG  1 
ATOM   1321 C CD1 . LEU A 1 182 ? -51.813 26.655 -109.404 1.00 20.08 ? 177  LEU A CD1 1 
ATOM   1322 C CD2 . LEU A 1 182 ? -53.489 25.750 -107.730 1.00 21.23 ? 177  LEU A CD2 1 
ATOM   1323 N N   . LYS A 1 183 ? -53.420 21.509 -110.887 1.00 20.60 ? 178  LYS A N   1 
ATOM   1324 C CA  . LYS A 1 183 ? -54.076 20.679 -111.873 1.00 19.93 ? 178  LYS A CA  1 
ATOM   1325 C C   . LYS A 1 183 ? -54.911 19.613 -111.187 1.00 21.95 ? 178  LYS A C   1 
ATOM   1326 O O   . LYS A 1 183 ? -55.979 19.258 -111.664 1.00 24.12 ? 178  LYS A O   1 
ATOM   1327 C CB  . LYS A 1 183 ? -53.043 20.002 -112.750 1.00 21.35 ? 178  LYS A CB  1 
ATOM   1328 C CG  . LYS A 1 183 ? -53.571 18.892 -113.683 1.00 21.09 ? 178  LYS A CG  1 
ATOM   1329 C CD  . LYS A 1 183 ? -52.470 18.536 -114.651 1.00 22.17 ? 178  LYS A CD  1 
ATOM   1330 C CE  . LYS A 1 183 ? -52.866 17.514 -115.659 1.00 24.15 ? 178  LYS A CE  1 
ATOM   1331 N NZ  . LYS A 1 183 ? -51.831 17.492 -116.733 1.00 27.74 ? 178  LYS A NZ  1 
ATOM   1332 N N   . GLU A 1 184 ? -54.444 19.078 -110.071 1.00 22.17 ? 179  GLU A N   1 
ATOM   1333 C CA  . GLU A 1 184 ? -55.245 18.062 -109.416 1.00 24.18 ? 179  GLU A CA  1 
ATOM   1334 C C   . GLU A 1 184 ? -56.504 18.711 -108.867 1.00 23.61 ? 179  GLU A C   1 
ATOM   1335 O O   . GLU A 1 184 ? -57.578 18.125 -108.926 1.00 24.97 ? 179  GLU A O   1 
ATOM   1336 C CB  . GLU A 1 184 ? -54.440 17.356 -108.319 1.00 26.29 ? 179  GLU A CB  1 
ATOM   1337 C CG  . GLU A 1 184 ? -53.262 16.592 -108.903 1.00 30.69 ? 179  GLU A CG  1 
ATOM   1338 C CD  . GLU A 1 184 ? -52.244 16.106 -107.869 1.00 34.93 ? 179  GLU A CD  1 
ATOM   1339 O OE1 . GLU A 1 184 ? -51.934 16.839 -106.888 1.00 36.01 ? 179  GLU A OE1 1 
ATOM   1340 O OE2 . GLU A 1 184 ? -51.731 14.979 -108.065 1.00 36.37 ? 179  GLU A OE2 1 
ATOM   1341 N N   . LEU A 1 185 ? -56.380 19.937 -108.378 1.00 21.81 ? 180  LEU A N   1 
ATOM   1342 C CA  . LEU A 1 185 ? -57.525 20.660 -107.837 1.00 21.76 ? 180  LEU A CA  1 
ATOM   1343 C C   . LEU A 1 185 ? -58.590 21.064 -108.884 1.00 22.78 ? 180  LEU A C   1 
ATOM   1344 O O   . LEU A 1 185 ? -59.777 21.092 -108.582 1.00 22.71 ? 180  LEU A O   1 
ATOM   1345 C CB  . LEU A 1 185 ? -57.024 21.912 -107.097 1.00 21.13 ? 180  LEU A CB  1 
ATOM   1346 C CG  . LEU A 1 185 ? -58.015 22.884 -106.444 1.00 20.71 ? 180  LEU A CG  1 
ATOM   1347 C CD1 . LEU A 1 185 ? -58.710 22.214 -105.277 1.00 21.29 ? 180  LEU A CD1 1 
ATOM   1348 C CD2 . LEU A 1 185 ? -57.281 24.114 -105.948 1.00 21.79 ? 180  LEU A CD2 1 
ATOM   1349 N N   . MET A 1 186 ? -58.174 21.353 -110.117 1.00 24.11 ? 181  MET A N   1 
ATOM   1350 C CA  . MET A 1 186 ? -59.101 21.805 -111.158 1.00 24.34 ? 181  MET A CA  1 
ATOM   1351 C C   . MET A 1 186 ? -59.579 20.786 -112.207 1.00 24.17 ? 181  MET A C   1 
ATOM   1352 O O   . MET A 1 186 ? -60.704 20.871 -112.714 1.00 23.51 ? 181  MET A O   1 
ATOM   1353 C CB  . MET A 1 186 ? -58.457 22.978 -111.877 1.00 26.31 ? 181  MET A CB  1 
ATOM   1354 C CG  . MET A 1 186 ? -57.883 24.014 -110.941 1.00 28.96 ? 181  MET A CG  1 
ATOM   1355 S SD  . MET A 1 186 ? -59.206 24.919 -110.153 1.00 32.97 ? 181  MET A SD  1 
ATOM   1356 C CE  . MET A 1 186 ? -59.051 26.536 -110.900 1.00 30.99 ? 181  MET A CE  1 
ATOM   1357 N N   . GLN A 1 187 ? -58.731 19.823 -112.537 1.00 23.34 ? 182  GLN A N   1 
ATOM   1358 C CA  . GLN A 1 187 ? -59.094 18.853 -113.549 1.00 23.21 ? 182  GLN A CA  1 
ATOM   1359 C C   . GLN A 1 187 ? -60.307 17.978 -113.252 1.00 22.97 ? 182  GLN A C   1 
ATOM   1360 O O   . GLN A 1 187 ? -60.525 17.508 -112.123 1.00 23.10 ? 182  GLN A O   1 
ATOM   1361 C CB  . GLN A 1 187 ? -57.887 17.980 -113.878 1.00 24.15 ? 182  GLN A CB  1 
ATOM   1362 C CG  . GLN A 1 187 ? -58.065 17.113 -115.122 1.00 25.78 ? 182  GLN A CG  1 
ATOM   1363 C CD  . GLN A 1 187 ? -56.738 16.760 -115.777 1.00 27.49 ? 182  GLN A CD  1 
ATOM   1364 O OE1 . GLN A 1 187 ? -56.444 17.182 -116.912 1.00 25.40 ? 182  GLN A OE1 1 
ATOM   1365 N NE2 . GLN A 1 187 ? -55.918 15.990 -115.058 1.00 29.20 ? 182  GLN A NE2 1 
ATOM   1366 N N   . THR A 1 188 ? -61.094 17.772 -114.302 1.00 22.74 ? 183  THR A N   1 
ATOM   1367 C CA  . THR A 1 188 ? -62.301 16.951 -114.269 1.00 21.81 ? 183  THR A CA  1 
ATOM   1368 C C   . THR A 1 188 ? -62.247 16.038 -115.494 1.00 20.67 ? 183  THR A C   1 
ATOM   1369 O O   . THR A 1 188 ? -61.473 16.270 -116.412 1.00 20.62 ? 183  THR A O   1 
ATOM   1370 C CB  . THR A 1 188 ? -63.548 17.854 -114.346 1.00 21.47 ? 183  THR A CB  1 
ATOM   1371 O OG1 . THR A 1 188 ? -63.774 18.447 -113.065 1.00 23.26 ? 183  THR A OG1 1 
ATOM   1372 C CG2 . THR A 1 188 ? -64.765 17.091 -114.762 1.00 21.32 ? 183  THR A CG2 1 
ATOM   1373 N N   . PRO A 1 189 ? -63.034 14.962 -115.511 1.00 20.44 ? 184  PRO A N   1 
ATOM   1374 C CA  . PRO A 1 189 ? -62.940 14.142 -116.720 1.00 20.70 ? 184  PRO A CA  1 
ATOM   1375 C C   . PRO A 1 189 ? -63.425 14.918 -117.951 1.00 20.73 ? 184  PRO A C   1 
ATOM   1376 O O   . PRO A 1 189 ? -63.252 14.475 -119.084 1.00 21.14 ? 184  PRO A O   1 
ATOM   1377 C CB  . PRO A 1 189 ? -63.834 12.952 -116.391 1.00 19.41 ? 184  PRO A CB  1 
ATOM   1378 C CG  . PRO A 1 189 ? -63.626 12.788 -114.936 1.00 18.77 ? 184  PRO A CG  1 
ATOM   1379 C CD  . PRO A 1 189 ? -63.726 14.223 -114.441 1.00 20.23 ? 184  PRO A CD  1 
ATOM   1380 N N   . ASN A 1 190 ? -64.033 16.075 -117.713 1.00 21.35 ? 185  ASN A N   1 
ATOM   1381 C CA  . ASN A 1 190 ? -64.541 16.927 -118.782 1.00 21.90 ? 185  ASN A CA  1 
ATOM   1382 C C   . ASN A 1 190 ? -63.918 18.310 -118.778 1.00 21.51 ? 185  ASN A C   1 
ATOM   1383 O O   . ASN A 1 190 ? -64.307 19.169 -119.549 1.00 21.75 ? 185  ASN A O   1 
ATOM   1384 C CB  . ASN A 1 190 ? -66.055 17.055 -118.687 1.00 21.70 ? 185  ASN A CB  1 
ATOM   1385 C CG  . ASN A 1 190 ? -66.747 15.769 -119.008 1.00 24.90 ? 185  ASN A CG  1 
ATOM   1386 O OD1 . ASN A 1 190 ? -67.353 15.158 -118.138 1.00 28.05 ? 185  ASN A OD1 1 
ATOM   1387 N ND2 . ASN A 1 190 ? -66.647 15.326 -120.263 1.00 25.07 ? 185  ASN A ND2 1 
ATOM   1388 N N   . PHE A 1 191 ? -62.962 18.514 -117.887 1.00 21.84 ? 186  PHE A N   1 
ATOM   1389 C CA  . PHE A 1 191 ? -62.255 19.773 -117.767 1.00 21.07 ? 186  PHE A CA  1 
ATOM   1390 C C   . PHE A 1 191 ? -60.784 19.367 -117.781 1.00 20.59 ? 186  PHE A C   1 
ATOM   1391 O O   . PHE A 1 191 ? -60.150 19.274 -116.740 1.00 19.99 ? 186  PHE A O   1 
ATOM   1392 C CB  . PHE A 1 191 ? -62.648 20.464 -116.452 1.00 20.63 ? 186  PHE A CB  1 
ATOM   1393 C CG  . PHE A 1 191 ? -62.303 21.928 -116.411 1.00 22.52 ? 186  PHE A CG  1 
ATOM   1394 C CD1 . PHE A 1 191 ? -62.682 22.779 -117.456 1.00 22.88 ? 186  PHE A CD1 1 
ATOM   1395 C CD2 . PHE A 1 191 ? -61.558 22.458 -115.357 1.00 22.58 ? 186  PHE A CD2 1 
ATOM   1396 C CE1 . PHE A 1 191 ? -62.315 24.131 -117.451 1.00 22.18 ? 186  PHE A CE1 1 
ATOM   1397 C CE2 . PHE A 1 191 ? -61.191 23.806 -115.347 1.00 21.75 ? 186  PHE A CE2 1 
ATOM   1398 C CZ  . PHE A 1 191 ? -61.567 24.644 -116.395 1.00 21.50 ? 186  PHE A CZ  1 
ATOM   1399 N N   . ARG A 1 192 ? -60.277 19.101 -118.985 1.00 22.52 ? 187  ARG A N   1 
ATOM   1400 C CA  . ARG A 1 192 ? -58.893 18.649 -119.243 1.00 23.45 ? 187  ARG A CA  1 
ATOM   1401 C C   . ARG A 1 192 ? -57.885 19.775 -119.212 1.00 22.37 ? 187  ARG A C   1 
ATOM   1402 O O   . ARG A 1 192 ? -57.970 20.711 -120.000 1.00 22.11 ? 187  ARG A O   1 
ATOM   1403 C CB  . ARG A 1 192 ? -58.794 18.003 -120.620 1.00 26.55 ? 187  ARG A CB  1 
ATOM   1404 C CG  . ARG A 1 192 ? -59.679 16.818 -120.850 1.00 30.16 ? 187  ARG A CG  1 
ATOM   1405 C CD  . ARG A 1 192 ? -58.912 15.589 -120.541 1.00 33.28 ? 187  ARG A CD  1 
ATOM   1406 N NE  . ARG A 1 192 ? -59.006 15.287 -119.126 1.00 35.73 ? 187  ARG A NE  1 
ATOM   1407 C CZ  . ARG A 1 192 ? -58.131 14.533 -118.468 1.00 36.92 ? 187  ARG A CZ  1 
ATOM   1408 N NH1 . ARG A 1 192 ? -57.078 14.001 -119.099 1.00 34.82 ? 187  ARG A NH1 1 
ATOM   1409 N NH2 . ARG A 1 192 ? -58.328 14.301 -117.177 1.00 37.68 ? 187  ARG A NH2 1 
ATOM   1410 N N   . ILE A 1 193 ? -56.886 19.640 -118.357 1.00 21.43 ? 188  ILE A N   1 
ATOM   1411 C CA  . ILE A 1 193 ? -55.887 20.680 -118.195 1.00 20.77 ? 188  ILE A CA  1 
ATOM   1412 C C   . ILE A 1 193 ? -54.482 20.387 -118.718 1.00 21.38 ? 188  ILE A C   1 
ATOM   1413 O O   . ILE A 1 193 ? -53.969 19.267 -118.565 1.00 23.03 ? 188  ILE A O   1 
ATOM   1414 C CB  . ILE A 1 193 ? -55.797 21.034 -116.679 1.00 20.35 ? 188  ILE A CB  1 
ATOM   1415 C CG1 . ILE A 1 193 ? -57.162 21.530 -116.212 1.00 18.89 ? 188  ILE A CG1 1 
ATOM   1416 C CG2 . ILE A 1 193 ? -54.681 22.045 -116.397 1.00 17.06 ? 188  ILE A CG2 1 
ATOM   1417 C CD1 . ILE A 1 193 ? -57.275 21.653 -114.742 1.00 19.82 ? 188  ILE A CD1 1 
ATOM   1418 N N   . THR A 1 194 ? -53.872 21.389 -119.351 1.00 20.10 ? 189  THR A N   1 
ATOM   1419 C CA  . THR A 1 194 ? -52.489 21.278 -119.796 1.00 19.18 ? 189  THR A CA  1 
ATOM   1420 C C   . THR A 1 194 ? -51.810 22.391 -119.024 1.00 20.27 ? 189  THR A C   1 
ATOM   1421 O O   . THR A 1 194 ? -52.332 23.501 -118.934 1.00 19.87 ? 189  THR A O   1 
ATOM   1422 C CB  . THR A 1 194 ? -52.299 21.565 -121.269 1.00 18.92 ? 189  THR A CB  1 
ATOM   1423 O OG1 . THR A 1 194 ? -52.945 20.552 -122.034 1.00 20.30 ? 189  THR A OG1 1 
ATOM   1424 C CG2 . THR A 1 194 ? -50.815 21.584 -121.618 1.00 17.22 ? 189  THR A CG2 1 
ATOM   1425 N N   . VAL A 1 195 ? -50.658 22.088 -118.452 1.00 21.24 ? 190  VAL A N   1 
ATOM   1426 C CA  . VAL A 1 195 ? -49.917 23.059 -117.676 1.00 22.74 ? 190  VAL A CA  1 
ATOM   1427 C C   . VAL A 1 195 ? -48.713 23.516 -118.501 1.00 25.12 ? 190  VAL A C   1 
ATOM   1428 O O   . VAL A 1 195 ? -47.982 22.688 -119.031 1.00 27.18 ? 190  VAL A O   1 
ATOM   1429 C CB  . VAL A 1 195 ? -49.429 22.413 -116.362 1.00 21.67 ? 190  VAL A CB  1 
ATOM   1430 C CG1 . VAL A 1 195 ? -48.650 23.400 -115.549 1.00 21.91 ? 190  VAL A CG1 1 
ATOM   1431 C CG2 . VAL A 1 195 ? -50.607 21.883 -115.571 1.00 21.12 ? 190  VAL A CG2 1 
ATOM   1432 N N   . VAL A 1 196 ? -48.521 24.821 -118.655 1.00 25.67 ? 191  VAL A N   1 
ATOM   1433 C CA  . VAL A 1 196 ? -47.355 25.304 -119.386 1.00 27.33 ? 191  VAL A CA  1 
ATOM   1434 C C   . VAL A 1 196 ? -46.681 26.346 -118.508 1.00 30.12 ? 191  VAL A C   1 
ATOM   1435 O O   . VAL A 1 196 ? -47.283 26.855 -117.551 1.00 30.70 ? 191  VAL A O   1 
ATOM   1436 C CB  . VAL A 1 196 ? -47.703 25.911 -120.757 1.00 25.62 ? 191  VAL A CB  1 
ATOM   1437 C CG1 . VAL A 1 196 ? -48.423 24.897 -121.595 1.00 23.38 ? 191  VAL A CG1 1 
ATOM   1438 C CG2 . VAL A 1 196 ? -48.514 27.161 -120.585 1.00 28.36 ? 191  VAL A CG2 1 
ATOM   1439 N N   . GLN A 1 197 ? -45.434 26.667 -118.820 1.00 32.36 ? 192  GLN A N   1 
ATOM   1440 C CA  . GLN A 1 197 ? -44.711 27.605 -117.987 1.00 34.62 ? 192  GLN A CA  1 
ATOM   1441 C C   . GLN A 1 197 ? -44.758 29.102 -118.298 1.00 34.74 ? 192  GLN A C   1 
ATOM   1442 O O   . GLN A 1 197 ? -44.547 29.895 -117.387 1.00 34.74 ? 192  GLN A O   1 
ATOM   1443 C CB  . GLN A 1 197 ? -43.268 27.122 -117.837 1.00 37.05 ? 192  GLN A CB  1 
ATOM   1444 C CG  . GLN A 1 197 ? -43.208 25.716 -117.247 1.00 42.61 ? 192  GLN A CG  1 
ATOM   1445 C CD  . GLN A 1 197 ? -41.973 25.463 -116.388 1.00 46.86 ? 192  GLN A CD  1 
ATOM   1446 O OE1 . GLN A 1 197 ? -42.047 24.753 -115.378 1.00 48.79 ? 192  GLN A OE1 1 
ATOM   1447 N NE2 . GLN A 1 197 ? -40.830 26.034 -116.785 1.00 48.90 ? 192  GLN A NE2 1 
ATOM   1448 N N   . GLU A 1 198 ? -45.029 29.534 -119.532 1.00 35.11 ? 193  GLU A N   1 
ATOM   1449 C CA  . GLU A 1 198 ? -45.066 30.982 -119.696 1.00 35.30 ? 193  GLU A CA  1 
ATOM   1450 C C   . GLU A 1 198 ? -46.379 31.608 -119.266 1.00 33.21 ? 193  GLU A C   1 
ATOM   1451 O O   . GLU A 1 198 ? -47.270 31.879 -120.064 1.00 32.84 ? 193  GLU A O   1 
ATOM   1452 C CB  . GLU A 1 198 ? -44.636 31.457 -121.102 1.00 37.65 ? 193  GLU A CB  1 
ATOM   1453 C CG  . GLU A 1 198 ? -45.038 30.667 -122.329 1.00 41.01 ? 193  GLU A CG  1 
ATOM   1454 C CD  . GLU A 1 198 ? -44.261 31.157 -123.594 1.00 43.50 ? 193  GLU A CD  1 
ATOM   1455 O OE1 . GLU A 1 198 ? -43.071 30.774 -123.748 1.00 43.84 ? 193  GLU A OE1 1 
ATOM   1456 O OE2 . GLU A 1 198 ? -44.825 31.930 -124.419 1.00 42.33 ? 193  GLU A OE2 1 
ATOM   1457 N N   . VAL A 1 199 ? -46.467 31.820 -117.958 1.00 30.89 ? 194  VAL A N   1 
ATOM   1458 C CA  . VAL A 1 199 ? -47.624 32.407 -117.313 1.00 29.10 ? 194  VAL A CA  1 
ATOM   1459 C C   . VAL A 1 199 ? -48.082 33.643 -118.081 1.00 28.42 ? 194  VAL A C   1 
ATOM   1460 O O   . VAL A 1 199 ? -49.250 33.762 -118.446 1.00 29.18 ? 194  VAL A O   1 
ATOM   1461 C CB  . VAL A 1 199 ? -47.276 32.797 -115.852 1.00 28.78 ? 194  VAL A CB  1 
ATOM   1462 C CG1 . VAL A 1 199 ? -48.470 33.408 -115.166 1.00 28.39 ? 194  VAL A CG1 1 
ATOM   1463 C CG2 . VAL A 1 199 ? -46.814 31.569 -115.083 1.00 27.57 ? 194  VAL A CG2 1 
ATOM   1464 N N   . ASP A 1 200 ? -47.149 34.552 -118.336 1.00 27.17 ? 195  ASP A N   1 
ATOM   1465 C CA  . ASP A 1 200 ? -47.436 35.797 -119.043 1.00 25.92 ? 195  ASP A CA  1 
ATOM   1466 C C   . ASP A 1 200 ? -48.221 35.673 -120.342 1.00 24.16 ? 195  ASP A C   1 
ATOM   1467 O O   . ASP A 1 200 ? -49.277 36.284 -120.495 1.00 24.50 ? 195  ASP A O   1 
ATOM   1468 C CB  . ASP A 1 200 ? -46.131 36.557 -119.310 1.00 28.00 ? 195  ASP A CB  1 
ATOM   1469 C CG  . ASP A 1 200 ? -45.642 37.336 -118.089 1.00 29.76 ? 195  ASP A CG  1 
ATOM   1470 O OD1 . ASP A 1 200 ? -46.324 37.320 -117.042 1.00 29.04 ? 195  ASP A OD1 1 
ATOM   1471 O OD2 . ASP A 1 200 ? -44.572 37.975 -118.181 1.00 31.52 ? 195  ASP A OD2 1 
ATOM   1472 N N   . THR A 1 201 ? -47.708 34.893 -121.283 1.00 21.41 ? 196  THR A N   1 
ATOM   1473 C CA  . THR A 1 201 ? -48.374 34.718 -122.567 1.00 18.69 ? 196  THR A CA  1 
ATOM   1474 C C   . THR A 1 201 ? -49.775 34.143 -122.399 1.00 18.96 ? 196  THR A C   1 
ATOM   1475 O O   . THR A 1 201 ? -50.729 34.592 -123.039 1.00 18.73 ? 196  THR A O   1 
ATOM   1476 C CB  . THR A 1 201 ? -47.562 33.780 -123.456 1.00 17.45 ? 196  THR A CB  1 
ATOM   1477 O OG1 . THR A 1 201 ? -46.230 34.294 -123.580 1.00 16.17 ? 196  THR A OG1 1 
ATOM   1478 C CG2 . THR A 1 201 ? -48.195 33.655 -124.834 1.00 16.49 ? 196  THR A CG2 1 
ATOM   1479 N N   . VAL A 1 202 ? -49.890 33.134 -121.540 1.00 18.28 ? 197  VAL A N   1 
ATOM   1480 C CA  . VAL A 1 202 ? -51.169 32.488 -121.283 1.00 17.12 ? 197  VAL A CA  1 
ATOM   1481 C C   . VAL A 1 202 ? -52.193 33.496 -120.762 1.00 17.48 ? 197  VAL A C   1 
ATOM   1482 O O   . VAL A 1 202 ? -53.344 33.518 -121.205 1.00 16.26 ? 197  VAL A O   1 
ATOM   1483 C CB  . VAL A 1 202 ? -51.009 31.354 -120.249 1.00 16.34 ? 197  VAL A CB  1 
ATOM   1484 C CG1 . VAL A 1 202 ? -52.376 30.773 -119.882 1.00 15.28 ? 197  VAL A CG1 1 
ATOM   1485 C CG2 . VAL A 1 202 ? -50.100 30.278 -120.808 1.00 15.31 ? 197  VAL A CG2 1 
ATOM   1486 N N   . GLU A 1 203 ? -51.767 34.332 -119.818 1.00 17.07 ? 198  GLU A N   1 
ATOM   1487 C CA  . GLU A 1 203 ? -52.658 35.327 -119.240 1.00 17.16 ? 198  GLU A CA  1 
ATOM   1488 C C   . GLU A 1 203 ? -53.104 36.388 -120.247 1.00 16.74 ? 198  GLU A C   1 
ATOM   1489 O O   . GLU A 1 203 ? -54.293 36.721 -120.343 1.00 15.27 ? 198  GLU A O   1 
ATOM   1490 C CB  . GLU A 1 203 ? -51.985 36.007 -118.057 1.00 16.13 ? 198  GLU A CB  1 
ATOM   1491 C CG  . GLU A 1 203 ? -52.902 36.965 -117.348 1.00 16.07 ? 198  GLU A CG  1 
ATOM   1492 C CD  . GLU A 1 203 ? -52.305 37.476 -116.069 1.00 16.54 ? 198  GLU A CD  1 
ATOM   1493 O OE1 . GLU A 1 203 ? -51.233 36.961 -115.675 1.00 16.89 ? 198  GLU A OE1 1 
ATOM   1494 O OE2 . GLU A 1 203 ? -52.908 38.381 -115.457 1.00 15.08 ? 198  GLU A OE2 1 
ATOM   1495 N N   . ILE A 1 204 ? -52.135 36.903 -120.995 1.00 16.27 ? 199  ILE A N   1 
ATOM   1496 C CA  . ILE A 1 204 ? -52.398 37.926 -121.989 1.00 17.26 ? 199  ILE A CA  1 
ATOM   1497 C C   . ILE A 1 204 ? -53.415 37.426 -123.039 1.00 17.99 ? 199  ILE A C   1 
ATOM   1498 O O   . ILE A 1 204 ? -54.243 38.198 -123.521 1.00 18.58 ? 199  ILE A O   1 
ATOM   1499 C CB  . ILE A 1 204 ? -51.045 38.419 -122.631 1.00 16.59 ? 199  ILE A CB  1 
ATOM   1500 C CG1 . ILE A 1 204 ? -51.231 39.805 -123.198 1.00 16.54 ? 199  ILE A CG1 1 
ATOM   1501 C CG2 . ILE A 1 204 ? -50.556 37.483 -123.709 1.00 18.00 ? 199  ILE A CG2 1 
ATOM   1502 C CD1 . ILE A 1 204 ? -51.493 40.805 -122.118 1.00 16.98 ? 199  ILE A CD1 1 
ATOM   1503 N N   . CYS A 1 205 ? -53.373 36.133 -123.368 1.00 18.15 ? 200  CYS A N   1 
ATOM   1504 C CA  . CYS A 1 205 ? -54.317 35.569 -124.326 1.00 18.77 ? 200  CYS A CA  1 
ATOM   1505 C C   . CYS A 1 205 ? -55.725 35.747 -123.816 1.00 19.74 ? 200  CYS A C   1 
ATOM   1506 O O   . CYS A 1 205 ? -56.599 36.199 -124.547 1.00 21.27 ? 200  CYS A O   1 
ATOM   1507 C CB  . CYS A 1 205 ? -54.081 34.078 -124.543 1.00 17.85 ? 200  CYS A CB  1 
ATOM   1508 S SG  . CYS A 1 205 ? -52.753 33.705 -125.666 1.00 19.22 ? 200  CYS A SG  1 
ATOM   1509 N N   . GLY A 1 206 ? -55.945 35.385 -122.558 1.00 19.48 ? 201  GLY A N   1 
ATOM   1510 C CA  . GLY A 1 206 ? -57.273 35.517 -121.994 1.00 20.01 ? 201  GLY A CA  1 
ATOM   1511 C C   . GLY A 1 206 ? -57.769 36.951 -122.016 1.00 20.19 ? 201  GLY A C   1 
ATOM   1512 O O   . GLY A 1 206 ? -58.954 37.214 -122.205 1.00 21.10 ? 201  GLY A O   1 
ATOM   1513 N N   . ALA A 1 207 ? -56.846 37.884 -121.844 1.00 19.19 ? 202  ALA A N   1 
ATOM   1514 C CA  . ALA A 1 207 ? -57.187 39.285 -121.818 1.00 17.99 ? 202  ALA A CA  1 
ATOM   1515 C C   . ALA A 1 207 ? -57.573 39.821 -123.192 1.00 18.34 ? 202  ALA A C   1 
ATOM   1516 O O   . ALA A 1 207 ? -58.622 40.448 -123.353 1.00 18.62 ? 202  ALA A O   1 
ATOM   1517 C CB  . ALA A 1 207 ? -56.012 40.079 -121.255 1.00 17.45 ? 202  ALA A CB  1 
ATOM   1518 N N   . LEU A 1 208 ? -56.740 39.556 -124.192 1.00 17.74 ? 203  LEU A N   1 
ATOM   1519 C CA  . LEU A 1 208 ? -56.978 40.092 -125.527 1.00 16.35 ? 203  LEU A CA  1 
ATOM   1520 C C   . LEU A 1 208 ? -58.095 39.487 -126.358 1.00 16.06 ? 203  LEU A C   1 
ATOM   1521 O O   . LEU A 1 208 ? -58.657 40.156 -127.226 1.00 15.42 ? 203  LEU A O   1 
ATOM   1522 C CB  . LEU A 1 208 ? -55.690 40.031 -126.320 1.00 16.39 ? 203  LEU A CB  1 
ATOM   1523 C CG  . LEU A 1 208 ? -54.490 40.676 -125.630 1.00 16.96 ? 203  LEU A CG  1 
ATOM   1524 C CD1 . LEU A 1 208 ? -53.279 40.590 -126.568 1.00 15.63 ? 203  LEU A CD1 1 
ATOM   1525 C CD2 . LEU A 1 208 ? -54.818 42.117 -125.273 1.00 14.30 ? 203  LEU A CD2 1 
ATOM   1526 N N   . LYS A 1 209 ? -58.426 38.229 -126.101 1.00 14.95 ? 204  LYS A N   1 
ATOM   1527 C CA  . LYS A 1 209 ? -59.468 37.580 -126.884 1.00 14.51 ? 204  LYS A CA  1 
ATOM   1528 C C   . LYS A 1 209 ? -60.830 38.262 -126.723 1.00 15.67 ? 204  LYS A C   1 
ATOM   1529 O O   . LYS A 1 209 ? -61.658 38.215 -127.638 1.00 16.09 ? 204  LYS A O   1 
ATOM   1530 C CB  . LYS A 1 209 ? -59.562 36.081 -126.530 1.00 12.16 ? 204  LYS A CB  1 
ATOM   1531 C CG  . LYS A 1 209 ? -59.880 35.765 -125.080 1.00 9.77  ? 204  LYS A CG  1 
ATOM   1532 C CD  . LYS A 1 209 ? -61.338 35.528 -124.876 1.00 7.86  ? 204  LYS A CD  1 
ATOM   1533 C CE  . LYS A 1 209 ? -61.671 35.413 -123.400 1.00 8.39  ? 204  LYS A CE  1 
ATOM   1534 N NZ  . LYS A 1 209 ? -63.129 35.181 -123.167 1.00 7.32  ? 204  LYS A NZ  1 
ATOM   1535 N N   . ASN A 1 210 ? -61.064 38.908 -125.580 1.00 14.91 ? 205  ASN A N   1 
ATOM   1536 C CA  . ASN A 1 210 ? -62.341 39.560 -125.375 1.00 14.61 ? 205  ASN A CA  1 
ATOM   1537 C C   . ASN A 1 210 ? -62.521 40.803 -126.246 1.00 14.82 ? 205  ASN A C   1 
ATOM   1538 O O   . ASN A 1 210 ? -63.644 41.155 -126.603 1.00 13.89 ? 205  ASN A O   1 
ATOM   1539 C CB  . ASN A 1 210 ? -62.544 39.883 -123.903 1.00 15.99 ? 205  ASN A CB  1 
ATOM   1540 C CG  . ASN A 1 210 ? -63.011 38.678 -123.113 1.00 18.33 ? 205  ASN A CG  1 
ATOM   1541 O OD1 . ASN A 1 210 ? -63.729 37.810 -123.640 1.00 19.17 ? 205  ASN A OD1 1 
ATOM   1542 N ND2 . ASN A 1 210 ? -62.629 38.619 -121.843 1.00 18.19 ? 205  ASN A ND2 1 
ATOM   1543 N N   . VAL A 1 211 ? -61.416 41.455 -126.602 1.00 14.12 ? 206  VAL A N   1 
ATOM   1544 C CA  . VAL A 1 211 ? -61.478 42.626 -127.461 1.00 13.16 ? 206  VAL A CA  1 
ATOM   1545 C C   . VAL A 1 211 ? -61.858 42.119 -128.863 1.00 13.58 ? 206  VAL A C   1 
ATOM   1546 O O   . VAL A 1 211 ? -62.776 42.622 -129.499 1.00 13.60 ? 206  VAL A O   1 
ATOM   1547 C CB  . VAL A 1 211 ? -60.126 43.348 -127.479 1.00 12.26 ? 206  VAL A CB  1 
ATOM   1548 C CG1 . VAL A 1 211 ? -60.146 44.500 -128.465 1.00 11.78 ? 206  VAL A CG1 1 
ATOM   1549 C CG2 . VAL A 1 211 ? -59.825 43.858 -126.106 1.00 11.63 ? 206  VAL A CG2 1 
ATOM   1550 N N   . VAL A 1 212 ? -61.159 41.100 -129.331 1.00 14.69 ? 207  VAL A N   1 
ATOM   1551 C CA  . VAL A 1 212 ? -61.458 40.502 -130.623 1.00 15.15 ? 207  VAL A CA  1 
ATOM   1552 C C   . VAL A 1 212 ? -62.945 40.081 -130.690 1.00 15.24 ? 207  VAL A C   1 
ATOM   1553 O O   . VAL A 1 212 ? -63.636 40.331 -131.682 1.00 13.25 ? 207  VAL A O   1 
ATOM   1554 C CB  . VAL A 1 212 ? -60.562 39.268 -130.835 1.00 15.96 ? 207  VAL A CB  1 
ATOM   1555 C CG1 . VAL A 1 212 ? -60.772 38.693 -132.224 1.00 16.36 ? 207  VAL A CG1 1 
ATOM   1556 C CG2 . VAL A 1 212 ? -59.106 39.652 -130.600 1.00 14.42 ? 207  VAL A CG2 1 
ATOM   1557 N N   . ALA A 1 213 ? -63.438 39.453 -129.625 1.00 16.10 ? 208  ALA A N   1 
ATOM   1558 C CA  . ALA A 1 213 ? -64.828 39.005 -129.589 1.00 16.78 ? 208  ALA A CA  1 
ATOM   1559 C C   . ALA A 1 213 ? -65.847 40.150 -129.732 1.00 17.61 ? 208  ALA A C   1 
ATOM   1560 O O   . ALA A 1 213 ? -66.955 39.942 -130.233 1.00 18.50 ? 208  ALA A O   1 
ATOM   1561 C CB  . ALA A 1 213 ? -65.088 38.226 -128.325 1.00 14.79 ? 208  ALA A CB  1 
ATOM   1562 N N   . VAL A 1 214 ? -65.493 41.348 -129.277 1.00 16.59 ? 209  VAL A N   1 
ATOM   1563 C CA  . VAL A 1 214 ? -66.394 42.477 -129.433 1.00 16.56 ? 209  VAL A CA  1 
ATOM   1564 C C   . VAL A 1 214 ? -66.505 42.758 -130.941 1.00 17.23 ? 209  VAL A C   1 
ATOM   1565 O O   . VAL A 1 214 ? -67.583 43.084 -131.464 1.00 16.77 ? 209  VAL A O   1 
ATOM   1566 C CB  . VAL A 1 214 ? -65.843 43.727 -128.769 1.00 16.38 ? 209  VAL A CB  1 
ATOM   1567 C CG1 . VAL A 1 214 ? -66.844 44.854 -128.924 1.00 18.50 ? 209  VAL A CG1 1 
ATOM   1568 C CG2 . VAL A 1 214 ? -65.574 43.466 -127.322 1.00 16.86 ? 209  VAL A CG2 1 
ATOM   1569 N N   . GLY A 1 215 ? -65.372 42.627 -131.629 1.00 15.96 ? 210  GLY A N   1 
ATOM   1570 C CA  . GLY A 1 215 ? -65.345 42.847 -133.052 1.00 14.15 ? 210  GLY A CA  1 
ATOM   1571 C C   . GLY A 1 215 ? -66.177 41.797 -133.760 1.00 14.11 ? 210  GLY A C   1 
ATOM   1572 O O   . GLY A 1 215 ? -66.900 42.096 -134.710 1.00 13.99 ? 210  GLY A O   1 
ATOM   1573 N N   . ALA A 1 216 ? -66.077 40.553 -133.312 1.00 13.89 ? 211  ALA A N   1 
ATOM   1574 C CA  . ALA A 1 216 ? -66.844 39.491 -133.937 1.00 13.05 ? 211  ALA A CA  1 
ATOM   1575 C C   . ALA A 1 216 ? -68.346 39.794 -133.790 1.00 14.59 ? 211  ALA A C   1 
ATOM   1576 O O   . ALA A 1 216 ? -69.143 39.570 -134.727 1.00 15.13 ? 211  ALA A O   1 
ATOM   1577 C CB  . ALA A 1 216 ? -66.485 38.143 -133.315 1.00 10.09 ? 211  ALA A CB  1 
ATOM   1578 N N   . GLY A 1 217 ? -68.732 40.326 -132.630 1.00 13.80 ? 212  GLY A N   1 
ATOM   1579 C CA  . GLY A 1 217 ? -70.135 40.646 -132.402 1.00 14.20 ? 212  GLY A CA  1 
ATOM   1580 C C   . GLY A 1 217 ? -70.636 41.743 -133.329 1.00 14.16 ? 212  GLY A C   1 
ATOM   1581 O O   . GLY A 1 217 ? -71.794 41.743 -133.752 1.00 13.67 ? 212  GLY A O   1 
ATOM   1582 N N   . PHE A 1 218 ? -69.766 42.709 -133.606 1.00 13.50 ? 213  PHE A N   1 
ATOM   1583 C CA  . PHE A 1 218 ? -70.083 43.795 -134.522 1.00 12.60 ? 213  PHE A CA  1 
ATOM   1584 C C   . PHE A 1 218 ? -70.395 43.168 -135.891 1.00 12.91 ? 213  PHE A C   1 
ATOM   1585 O O   . PHE A 1 218 ? -71.428 43.445 -136.481 1.00 13.16 ? 213  PHE A O   1 
ATOM   1586 C CB  . PHE A 1 218 ? -68.876 44.746 -134.673 1.00 11.72 ? 213  PHE A CB  1 
ATOM   1587 C CG  . PHE A 1 218 ? -68.596 45.601 -133.462 1.00 11.62 ? 213  PHE A CG  1 
ATOM   1588 C CD1 . PHE A 1 218 ? -67.343 46.191 -133.298 1.00 10.40 ? 213  PHE A CD1 1 
ATOM   1589 C CD2 . PHE A 1 218 ? -69.584 45.830 -132.493 1.00 11.22 ? 213  PHE A CD2 1 
ATOM   1590 C CE1 . PHE A 1 218 ? -67.065 47.001 -132.186 1.00 10.23 ? 213  PHE A CE1 1 
ATOM   1591 C CE2 . PHE A 1 218 ? -69.324 46.635 -131.377 1.00 9.30  ? 213  PHE A CE2 1 
ATOM   1592 C CZ  . PHE A 1 218 ? -68.056 47.222 -131.224 1.00 11.47 ? 213  PHE A CZ  1 
ATOM   1593 N N   . CYS A 1 219 ? -69.513 42.304 -136.391 1.00 13.40 ? 214  CYS A N   1 
ATOM   1594 C CA  . CYS A 1 219 ? -69.747 41.717 -137.700 1.00 14.73 ? 214  CYS A CA  1 
ATOM   1595 C C   . CYS A 1 219 ? -71.037 40.924 -137.741 1.00 16.24 ? 214  CYS A C   1 
ATOM   1596 O O   . CYS A 1 219 ? -71.716 40.908 -138.768 1.00 16.75 ? 214  CYS A O   1 
ATOM   1597 C CB  . CYS A 1 219 ? -68.558 40.875 -138.132 1.00 14.40 ? 214  CYS A CB  1 
ATOM   1598 S SG  . CYS A 1 219 ? -67.090 41.887 -138.336 1.00 16.65 ? 214  CYS A SG  1 
ATOM   1599 N N   . ASP A 1 220 ? -71.379 40.264 -136.635 1.00 16.73 ? 215  ASP A N   1 
ATOM   1600 C CA  . ASP A 1 220 ? -72.645 39.541 -136.557 1.00 16.84 ? 215  ASP A CA  1 
ATOM   1601 C C   . ASP A 1 220 ? -73.766 40.601 -136.608 1.00 17.88 ? 215  ASP A C   1 
ATOM   1602 O O   . ASP A 1 220 ? -74.812 40.407 -137.255 1.00 17.21 ? 215  ASP A O   1 
ATOM   1603 C CB  . ASP A 1 220 ? -72.748 38.757 -135.246 1.00 16.93 ? 215  ASP A CB  1 
ATOM   1604 C CG  . ASP A 1 220 ? -71.842 37.552 -135.219 1.00 19.59 ? 215  ASP A CG  1 
ATOM   1605 O OD1 . ASP A 1 220 ? -71.474 37.060 -136.306 1.00 21.34 ? 215  ASP A OD1 1 
ATOM   1606 O OD2 . ASP A 1 220 ? -71.505 37.077 -134.117 1.00 21.09 ? 215  ASP A OD2 1 
ATOM   1607 N N   . GLY A 1 221 ? -73.511 41.734 -135.945 1.00 18.42 ? 216  GLY A N   1 
ATOM   1608 C CA  . GLY A 1 221 ? -74.465 42.828 -135.884 1.00 18.41 ? 216  GLY A CA  1 
ATOM   1609 C C   . GLY A 1 221 ? -74.659 43.528 -137.208 1.00 18.28 ? 216  GLY A C   1 
ATOM   1610 O O   . GLY A 1 221 ? -75.630 44.249 -137.398 1.00 18.91 ? 216  GLY A O   1 
ATOM   1611 N N   . LEU A 1 222 ? -73.728 43.319 -138.125 1.00 17.70 ? 217  LEU A N   1 
ATOM   1612 C CA  . LEU A 1 222 ? -73.821 43.937 -139.432 1.00 18.86 ? 217  LEU A CA  1 
ATOM   1613 C C   . LEU A 1 222 ? -74.375 42.929 -140.440 1.00 19.26 ? 217  LEU A C   1 
ATOM   1614 O O   . LEU A 1 222 ? -74.509 43.230 -141.625 1.00 19.90 ? 217  LEU A O   1 
ATOM   1615 C CB  . LEU A 1 222 ? -72.435 44.443 -139.879 1.00 18.34 ? 217  LEU A CB  1 
ATOM   1616 C CG  . LEU A 1 222 ? -71.821 45.574 -139.045 1.00 16.81 ? 217  LEU A CG  1 
ATOM   1617 C CD1 . LEU A 1 222 ? -70.377 45.742 -139.433 1.00 16.29 ? 217  LEU A CD1 1 
ATOM   1618 C CD2 . LEU A 1 222 ? -72.603 46.879 -139.232 1.00 15.61 ? 217  LEU A CD2 1 
ATOM   1619 N N   . GLY A 1 223 ? -74.694 41.736 -139.957 1.00 18.79 ? 218  GLY A N   1 
ATOM   1620 C CA  . GLY A 1 223 ? -75.221 40.710 -140.828 1.00 19.43 ? 218  GLY A CA  1 
ATOM   1621 C C   . GLY A 1 223 ? -74.198 39.755 -141.441 1.00 20.34 ? 218  GLY A C   1 
ATOM   1622 O O   . GLY A 1 223 ? -74.539 39.037 -142.387 1.00 22.24 ? 218  GLY A O   1 
ATOM   1623 N N   . PHE A 1 224 ? -72.963 39.702 -140.943 1.00 17.78 ? 219  PHE A N   1 
ATOM   1624 C CA  . PHE A 1 224 ? -72.019 38.781 -141.558 1.00 17.00 ? 219  PHE A CA  1 
ATOM   1625 C C   . PHE A 1 224 ? -72.099 37.366 -140.978 1.00 17.21 ? 219  PHE A C   1 
ATOM   1626 O O   . PHE A 1 224 ? -72.833 37.117 -140.008 1.00 15.32 ? 219  PHE A O   1 
ATOM   1627 C CB  . PHE A 1 224 ? -70.592 39.319 -141.479 1.00 17.28 ? 219  PHE A CB  1 
ATOM   1628 C CG  . PHE A 1 224 ? -70.386 40.588 -142.262 1.00 18.72 ? 219  PHE A CG  1 
ATOM   1629 C CD1 . PHE A 1 224 ? -70.535 41.838 -141.654 1.00 20.42 ? 219  PHE A CD1 1 
ATOM   1630 C CD2 . PHE A 1 224 ? -70.083 40.545 -143.617 1.00 19.21 ? 219  PHE A CD2 1 
ATOM   1631 C CE1 . PHE A 1 224 ? -70.389 43.024 -142.380 1.00 18.34 ? 219  PHE A CE1 1 
ATOM   1632 C CE2 . PHE A 1 224 ? -69.934 41.729 -144.355 1.00 19.48 ? 219  PHE A CE2 1 
ATOM   1633 C CZ  . PHE A 1 224 ? -70.088 42.972 -143.726 1.00 18.98 ? 219  PHE A CZ  1 
ATOM   1634 N N   . GLY A 1 225 ? -71.352 36.445 -141.594 1.00 16.77 ? 220  GLY A N   1 
ATOM   1635 C CA  . GLY A 1 225 ? -71.355 35.054 -141.165 1.00 16.23 ? 220  GLY A CA  1 
ATOM   1636 C C   . GLY A 1 225 ? -70.027 34.449 -140.741 1.00 15.13 ? 220  GLY A C   1 
ATOM   1637 O O   . GLY A 1 225 ? -69.140 35.158 -140.254 1.00 15.66 ? 220  GLY A O   1 
ATOM   1638 N N   . ASP A 1 226 ? -69.886 33.140 -140.945 1.00 13.64 ? 221  ASP A N   1 
ATOM   1639 C CA  . ASP A 1 226 ? -68.678 32.422 -140.541 1.00 13.06 ? 221  ASP A CA  1 
ATOM   1640 C C   . ASP A 1 226 ? -67.364 32.830 -141.223 1.00 12.94 ? 221  ASP A C   1 
ATOM   1641 O O   . ASP A 1 226 ? -66.357 32.989 -140.536 1.00 11.66 ? 221  ASP A O   1 
ATOM   1642 C CB  . ASP A 1 226 ? -68.902 30.914 -140.680 1.00 13.33 ? 221  ASP A CB  1 
ATOM   1643 C CG  . ASP A 1 226 ? -70.099 30.408 -139.849 1.00 15.11 ? 221  ASP A CG  1 
ATOM   1644 O OD1 . ASP A 1 226 ? -70.104 30.574 -138.604 1.00 14.82 ? 221  ASP A OD1 1 
ATOM   1645 O OD2 . ASP A 1 226 ? -71.043 29.838 -140.449 1.00 13.72 ? 221  ASP A OD2 1 
ATOM   1646 N N   . ASN A 1 227 ? -67.361 32.999 -142.548 1.00 13.02 ? 222  ASN A N   1 
ATOM   1647 C CA  . ASN A 1 227 ? -66.145 33.409 -143.268 1.00 14.53 ? 222  ASN A CA  1 
ATOM   1648 C C   . ASN A 1 227 ? -65.606 34.725 -142.681 1.00 15.14 ? 222  ASN A C   1 
ATOM   1649 O O   . ASN A 1 227 ? -64.403 34.948 -142.522 1.00 14.44 ? 222  ASN A O   1 
ATOM   1650 C CB  . ASN A 1 227 ? -66.433 33.619 -144.766 1.00 16.48 ? 222  ASN A CB  1 
ATOM   1651 C CG  . ASN A 1 227 ? -66.667 32.307 -145.531 1.00 18.51 ? 222  ASN A CG  1 
ATOM   1652 O OD1 . ASN A 1 227 ? -66.317 31.234 -145.057 1.00 20.18 ? 222  ASN A OD1 1 
ATOM   1653 N ND2 . ASN A 1 227 ? -67.244 32.406 -146.736 1.00 17.29 ? 222  ASN A ND2 1 
ATOM   1654 N N   . THR A 1 228 ? -66.525 35.609 -142.345 1.00 16.81 ? 223  THR A N   1 
ATOM   1655 C CA  . THR A 1 228 ? -66.148 36.882 -141.778 1.00 15.86 ? 223  THR A CA  1 
ATOM   1656 C C   . THR A 1 228 ? -65.654 36.681 -140.361 1.00 15.68 ? 223  THR A C   1 
ATOM   1657 O O   . THR A 1 228 ? -64.549 37.127 -140.027 1.00 16.25 ? 223  THR A O   1 
ATOM   1658 C CB  . THR A 1 228 ? -67.322 37.837 -141.806 1.00 15.46 ? 223  THR A CB  1 
ATOM   1659 O OG1 . THR A 1 228 ? -67.802 37.921 -143.159 1.00 13.18 ? 223  THR A OG1 1 
ATOM   1660 C CG2 . THR A 1 228 ? -66.892 39.224 -141.305 1.00 14.76 ? 223  THR A CG2 1 
ATOM   1661 N N   . LYS A 1 229 ? -66.444 35.993 -139.539 1.00 14.62 ? 224  LYS A N   1 
ATOM   1662 C CA  . LYS A 1 229 ? -66.017 35.745 -138.170 1.00 15.55 ? 224  LYS A CA  1 
ATOM   1663 C C   . LYS A 1 229 ? -64.650 35.059 -138.127 1.00 16.85 ? 224  LYS A C   1 
ATOM   1664 O O   . LYS A 1 229 ? -63.822 35.395 -137.284 1.00 18.31 ? 224  LYS A O   1 
ATOM   1665 C CB  . LYS A 1 229 ? -67.029 34.905 -137.396 1.00 14.11 ? 224  LYS A CB  1 
ATOM   1666 C CG  . LYS A 1 229 ? -66.606 34.679 -135.936 1.00 12.85 ? 224  LYS A CG  1 
ATOM   1667 C CD  . LYS A 1 229 ? -67.764 34.212 -135.092 1.00 13.16 ? 224  LYS A CD  1 
ATOM   1668 C CE  . LYS A 1 229 ? -68.857 35.274 -135.048 1.00 13.82 ? 224  LYS A CE  1 
ATOM   1669 N NZ  . LYS A 1 229 ? -70.127 34.778 -134.460 1.00 14.96 ? 224  LYS A NZ  1 
ATOM   1670 N N   . ALA A 1 230 ? -64.396 34.109 -139.029 1.00 17.52 ? 225  ALA A N   1 
ATOM   1671 C CA  . ALA A 1 230 ? -63.093 33.438 -139.032 1.00 17.27 ? 225  ALA A CA  1 
ATOM   1672 C C   . ALA A 1 230 ? -62.007 34.472 -139.319 1.00 17.31 ? 225  ALA A C   1 
ATOM   1673 O O   . ALA A 1 230 ? -60.945 34.448 -138.693 1.00 16.98 ? 225  ALA A O   1 
ATOM   1674 C CB  . ALA A 1 230 ? -63.052 32.345 -140.072 1.00 16.37 ? 225  ALA A CB  1 
ATOM   1675 N N   . ALA A 1 231 ? -62.275 35.386 -140.254 1.00 16.21 ? 226  ALA A N   1 
ATOM   1676 C CA  . ALA A 1 231 ? -61.299 36.426 -140.596 1.00 15.11 ? 226  ALA A CA  1 
ATOM   1677 C C   . ALA A 1 231 ? -61.008 37.252 -139.345 1.00 15.01 ? 226  ALA A C   1 
ATOM   1678 O O   . ALA A 1 231 ? -59.845 37.487 -138.994 1.00 14.01 ? 226  ALA A O   1 
ATOM   1679 C CB  . ALA A 1 231 ? -61.837 37.336 -141.729 1.00 11.93 ? 226  ALA A CB  1 
ATOM   1680 N N   . VAL A 1 232 ? -62.070 37.692 -138.674 1.00 13.93 ? 227  VAL A N   1 
ATOM   1681 C CA  . VAL A 1 232 ? -61.901 38.486 -137.474 1.00 13.90 ? 227  VAL A CA  1 
ATOM   1682 C C   . VAL A 1 232 ? -61.050 37.711 -136.453 1.00 14.48 ? 227  VAL A C   1 
ATOM   1683 O O   . VAL A 1 232 ? -60.154 38.262 -135.833 1.00 16.27 ? 227  VAL A O   1 
ATOM   1684 C CB  . VAL A 1 232 ? -63.283 38.886 -136.854 1.00 13.27 ? 227  VAL A CB  1 
ATOM   1685 C CG1 . VAL A 1 232 ? -63.085 39.597 -135.530 1.00 10.74 ? 227  VAL A CG1 1 
ATOM   1686 C CG2 . VAL A 1 232 ? -64.035 39.806 -137.806 1.00 10.99 ? 227  VAL A CG2 1 
ATOM   1687 N N   . ILE A 1 233 ? -61.303 36.425 -136.286 1.00 14.61 ? 228  ILE A N   1 
ATOM   1688 C CA  . ILE A 1 233 ? -60.515 35.663 -135.331 1.00 13.98 ? 228  ILE A CA  1 
ATOM   1689 C C   . ILE A 1 233 ? -59.055 35.566 -135.775 1.00 14.14 ? 228  ILE A C   1 
ATOM   1690 O O   . ILE A 1 233 ? -58.139 35.705 -134.955 1.00 14.68 ? 228  ILE A O   1 
ATOM   1691 C CB  . ILE A 1 233 ? -61.102 34.243 -135.123 1.00 13.08 ? 228  ILE A CB  1 
ATOM   1692 C CG1 . ILE A 1 233 ? -62.474 34.353 -134.452 1.00 10.39 ? 228  ILE A CG1 1 
ATOM   1693 C CG2 . ILE A 1 233 ? -60.143 33.392 -134.255 1.00 11.88 ? 228  ILE A CG2 1 
ATOM   1694 C CD1 . ILE A 1 233 ? -63.179 33.050 -134.292 1.00 10.63 ? 228  ILE A CD1 1 
ATOM   1695 N N   . ARG A 1 234 ? -58.842 35.343 -137.069 1.00 12.96 ? 229  ARG A N   1 
ATOM   1696 C CA  . ARG A 1 234 ? -57.498 35.225 -137.610 1.00 13.48 ? 229  ARG A CA  1 
ATOM   1697 C C   . ARG A 1 234 ? -56.694 36.530 -137.445 1.00 14.07 ? 229  ARG A C   1 
ATOM   1698 O O   . ARG A 1 234 ? -55.565 36.507 -136.963 1.00 12.77 ? 229  ARG A O   1 
ATOM   1699 C CB  . ARG A 1 234 ? -57.580 34.841 -139.080 1.00 14.12 ? 229  ARG A CB  1 
ATOM   1700 C CG  . ARG A 1 234 ? -56.318 34.276 -139.672 1.00 15.76 ? 229  ARG A CG  1 
ATOM   1701 C CD  . ARG A 1 234 ? -56.296 34.561 -141.154 1.00 16.36 ? 229  ARG A CD  1 
ATOM   1702 N NE  . ARG A 1 234 ? -54.982 35.044 -141.565 1.00 19.80 ? 229  ARG A NE  1 
ATOM   1703 C CZ  . ARG A 1 234 ? -54.784 36.159 -142.263 1.00 21.36 ? 229  ARG A CZ  1 
ATOM   1704 N NH1 . ARG A 1 234 ? -55.802 36.923 -142.638 1.00 20.71 ? 229  ARG A NH1 1 
ATOM   1705 N NH2 . ARG A 1 234 ? -53.560 36.513 -142.594 1.00 25.50 ? 229  ARG A NH2 1 
ATOM   1706 N N   . LEU A 1 235 ? -57.278 37.660 -137.841 1.00 13.95 ? 230  LEU A N   1 
ATOM   1707 C CA  . LEU A 1 235 ? -56.618 38.953 -137.723 1.00 13.08 ? 230  LEU A CA  1 
ATOM   1708 C C   . LEU A 1 235 ? -56.414 39.340 -136.254 1.00 13.90 ? 230  LEU A C   1 
ATOM   1709 O O   . LEU A 1 235 ? -55.409 39.975 -135.877 1.00 14.41 ? 230  LEU A O   1 
ATOM   1710 C CB  . LEU A 1 235 ? -57.448 40.001 -138.452 1.00 12.03 ? 230  LEU A CB  1 
ATOM   1711 C CG  . LEU A 1 235 ? -57.510 39.772 -139.965 1.00 12.05 ? 230  LEU A CG  1 
ATOM   1712 C CD1 . LEU A 1 235 ? -58.327 40.851 -140.643 1.00 11.97 ? 230  LEU A CD1 1 
ATOM   1713 C CD2 . LEU A 1 235 ? -56.102 39.802 -140.520 1.00 12.52 ? 230  LEU A CD2 1 
ATOM   1714 N N   . GLY A 1 236 ? -57.368 38.956 -135.417 1.00 13.82 ? 231  GLY A N   1 
ATOM   1715 C CA  . GLY A 1 236 ? -57.253 39.241 -133.998 1.00 13.88 ? 231  GLY A CA  1 
ATOM   1716 C C   . GLY A 1 236 ? -56.066 38.491 -133.412 1.00 15.09 ? 231  GLY A C   1 
ATOM   1717 O O   . GLY A 1 236 ? -55.313 39.034 -132.610 1.00 14.84 ? 231  GLY A O   1 
ATOM   1718 N N   . LEU A 1 237 ? -55.903 37.234 -133.818 1.00 15.66 ? 232  LEU A N   1 
ATOM   1719 C CA  . LEU A 1 237 ? -54.798 36.403 -133.345 1.00 16.24 ? 232  LEU A CA  1 
ATOM   1720 C C   . LEU A 1 237 ? -53.473 36.984 -133.827 1.00 16.57 ? 232  LEU A C   1 
ATOM   1721 O O   . LEU A 1 237 ? -52.474 36.974 -133.109 1.00 17.81 ? 232  LEU A O   1 
ATOM   1722 C CB  . LEU A 1 237 ? -54.945 34.959 -133.851 1.00 14.79 ? 232  LEU A CB  1 
ATOM   1723 C CG  . LEU A 1 237 ? -53.920 33.930 -133.355 1.00 12.58 ? 232  LEU A CG  1 
ATOM   1724 C CD1 . LEU A 1 237 ? -53.868 33.935 -131.834 1.00 10.94 ? 232  LEU A CD1 1 
ATOM   1725 C CD2 . LEU A 1 237 ? -54.301 32.557 -133.870 1.00 11.68 ? 232  LEU A CD2 1 
ATOM   1726 N N   . MET A 1 238 ? -53.468 37.491 -135.053 1.00 17.52 ? 233  MET A N   1 
ATOM   1727 C CA  . MET A 1 238 ? -52.272 38.092 -135.603 1.00 17.07 ? 233  MET A CA  1 
ATOM   1728 C C   . MET A 1 238 ? -51.908 39.274 -134.707 1.00 18.00 ? 233  MET A C   1 
ATOM   1729 O O   . MET A 1 238 ? -50.734 39.449 -134.367 1.00 19.14 ? 233  MET A O   1 
ATOM   1730 C CB  . MET A 1 238 ? -52.510 38.558 -137.029 1.00 15.12 ? 233  MET A CB  1 
ATOM   1731 C CG  . MET A 1 238 ? -51.255 39.090 -137.691 1.00 14.89 ? 233  MET A CG  1 
ATOM   1732 S SD  . MET A 1 238 ? -51.589 40.117 -139.134 1.00 14.22 ? 233  MET A SD  1 
ATOM   1733 C CE  . MET A 1 238 ? -52.154 38.936 -140.373 1.00 9.55  ? 233  MET A CE  1 
ATOM   1734 N N   . GLU A 1 239 ? -52.899 40.076 -134.302 1.00 17.78 ? 234  GLU A N   1 
ATOM   1735 C CA  . GLU A 1 239 ? -52.609 41.212 -133.423 1.00 17.39 ? 234  GLU A CA  1 
ATOM   1736 C C   . GLU A 1 239 ? -52.196 40.804 -132.009 1.00 16.45 ? 234  GLU A C   1 
ATOM   1737 O O   . GLU A 1 239 ? -51.331 41.432 -131.401 1.00 15.87 ? 234  GLU A O   1 
ATOM   1738 C CB  . GLU A 1 239 ? -53.790 42.171 -133.379 1.00 17.21 ? 234  GLU A CB  1 
ATOM   1739 C CG  . GLU A 1 239 ? -53.980 42.857 -134.711 1.00 19.67 ? 234  GLU A CG  1 
ATOM   1740 C CD  . GLU A 1 239 ? -54.808 44.130 -134.625 1.00 22.55 ? 234  GLU A CD  1 
ATOM   1741 O OE1 . GLU A 1 239 ? -55.064 44.742 -135.700 1.00 20.81 ? 234  GLU A OE1 1 
ATOM   1742 O OE2 . GLU A 1 239 ? -55.204 44.519 -133.492 1.00 22.70 ? 234  GLU A OE2 1 
ATOM   1743 N N   . MET A 1 240 ? -52.793 39.730 -131.508 1.00 15.34 ? 235  MET A N   1 
ATOM   1744 C CA  . MET A 1 240 ? -52.496 39.214 -130.179 1.00 14.97 ? 235  MET A CA  1 
ATOM   1745 C C   . MET A 1 240 ? -51.043 38.766 -130.013 1.00 15.87 ? 235  MET A C   1 
ATOM   1746 O O   . MET A 1 240 ? -50.379 39.092 -129.025 1.00 14.81 ? 235  MET A O   1 
ATOM   1747 C CB  . MET A 1 240 ? -53.421 38.043 -129.886 1.00 13.69 ? 235  MET A CB  1 
ATOM   1748 C CG  . MET A 1 240 ? -54.841 38.473 -129.652 1.00 14.20 ? 235  MET A CG  1 
ATOM   1749 S SD  . MET A 1 240 ? -55.965 37.096 -129.462 1.00 14.60 ? 235  MET A SD  1 
ATOM   1750 C CE  . MET A 1 240 ? -55.190 36.154 -128.065 1.00 11.53 ? 235  MET A CE  1 
ATOM   1751 N N   . ILE A 1 241 ? -50.558 37.995 -130.976 1.00 16.07 ? 236  ILE A N   1 
ATOM   1752 C CA  . ILE A 1 241 ? -49.194 37.508 -130.925 1.00 16.31 ? 236  ILE A CA  1 
ATOM   1753 C C   . ILE A 1 241 ? -48.241 38.688 -130.996 1.00 16.86 ? 236  ILE A C   1 
ATOM   1754 O O   . ILE A 1 241 ? -47.337 38.819 -130.167 1.00 17.30 ? 236  ILE A O   1 
ATOM   1755 C CB  . ILE A 1 241 ? -48.922 36.550 -132.092 1.00 16.98 ? 236  ILE A CB  1 
ATOM   1756 C CG1 . ILE A 1 241 ? -49.867 35.354 -131.980 1.00 15.25 ? 236  ILE A CG1 1 
ATOM   1757 C CG2 . ILE A 1 241 ? -47.447 36.117 -132.110 1.00 14.95 ? 236  ILE A CG2 1 
ATOM   1758 C CD1 . ILE A 1 241 ? -49.696 34.369 -133.092 1.00 15.17 ? 236  ILE A CD1 1 
ATOM   1759 N N   . ALA A 1 242 ? -48.458 39.554 -131.980 1.00 16.44 ? 237  ALA A N   1 
ATOM   1760 C CA  . ALA A 1 242 ? -47.628 40.741 -132.160 1.00 16.86 ? 237  ALA A CA  1 
ATOM   1761 C C   . ALA A 1 242 ? -47.612 41.596 -130.900 1.00 16.96 ? 237  ALA A C   1 
ATOM   1762 O O   . ALA A 1 242 ? -46.567 42.085 -130.495 1.00 16.29 ? 237  ALA A O   1 
ATOM   1763 C CB  . ALA A 1 242 ? -48.144 41.578 -133.353 1.00 14.82 ? 237  ALA A CB  1 
ATOM   1764 N N   . PHE A 1 243 ? -48.787 41.778 -130.297 1.00 18.23 ? 238  PHE A N   1 
ATOM   1765 C CA  . PHE A 1 243 ? -48.925 42.584 -129.098 1.00 17.91 ? 238  PHE A CA  1 
ATOM   1766 C C   . PHE A 1 243 ? -48.274 41.936 -127.908 1.00 17.98 ? 238  PHE A C   1 
ATOM   1767 O O   . PHE A 1 243 ? -47.681 42.618 -127.082 1.00 19.10 ? 238  PHE A O   1 
ATOM   1768 C CB  . PHE A 1 243 ? -50.383 42.830 -128.759 1.00 16.77 ? 238  PHE A CB  1 
ATOM   1769 C CG  . PHE A 1 243 ? -50.571 43.749 -127.588 1.00 17.42 ? 238  PHE A CG  1 
ATOM   1770 C CD1 . PHE A 1 243 ? -50.674 45.110 -127.767 1.00 18.72 ? 238  PHE A CD1 1 
ATOM   1771 C CD2 . PHE A 1 243 ? -50.635 43.249 -126.292 1.00 19.88 ? 238  PHE A CD2 1 
ATOM   1772 C CE1 . PHE A 1 243 ? -50.838 45.971 -126.668 1.00 20.53 ? 238  PHE A CE1 1 
ATOM   1773 C CE2 . PHE A 1 243 ? -50.800 44.103 -125.181 1.00 19.44 ? 238  PHE A CE2 1 
ATOM   1774 C CZ  . PHE A 1 243 ? -50.903 45.460 -125.374 1.00 18.75 ? 238  PHE A CZ  1 
ATOM   1775 N N   . ALA A 1 244 ? -48.403 40.625 -127.796 1.00 18.28 ? 239  ALA A N   1 
ATOM   1776 C CA  . ALA A 1 244 ? -47.784 39.923 -126.683 1.00 19.49 ? 239  ALA A CA  1 
ATOM   1777 C C   . ALA A 1 244 ? -46.269 40.039 -126.794 1.00 20.46 ? 239  ALA A C   1 
ATOM   1778 O O   . ALA A 1 244 ? -45.592 40.317 -125.811 1.00 20.22 ? 239  ALA A O   1 
ATOM   1779 C CB  . ALA A 1 244 ? -48.188 38.464 -126.685 1.00 18.58 ? 239  ALA A CB  1 
ATOM   1780 N N   . LYS A 1 245 ? -45.738 39.830 -127.994 1.00 22.35 ? 240  LYS A N   1 
ATOM   1781 C CA  . LYS A 1 245 ? -44.298 39.898 -128.191 1.00 23.97 ? 240  LYS A CA  1 
ATOM   1782 C C   . LYS A 1 245 ? -43.715 41.262 -127.870 1.00 26.44 ? 240  LYS A C   1 
ATOM   1783 O O   . LYS A 1 245 ? -42.629 41.339 -127.307 1.00 28.57 ? 240  LYS A O   1 
ATOM   1784 C CB  . LYS A 1 245 ? -43.922 39.486 -129.611 1.00 22.81 ? 240  LYS A CB  1 
ATOM   1785 C CG  . LYS A 1 245 ? -44.119 38.020 -129.876 1.00 20.69 ? 240  LYS A CG  1 
ATOM   1786 C CD  . LYS A 1 245 ? -43.609 37.623 -131.236 1.00 19.47 ? 240  LYS A CD  1 
ATOM   1787 C CE  . LYS A 1 245 ? -43.761 36.112 -131.426 1.00 20.45 ? 240  LYS A CE  1 
ATOM   1788 N NZ  . LYS A 1 245 ? -43.070 35.624 -132.646 1.00 21.88 ? 240  LYS A NZ  1 
ATOM   1789 N N   . LEU A 1 246 ? -44.420 42.336 -128.204 1.00 28.36 ? 241  LEU A N   1 
ATOM   1790 C CA  . LEU A 1 246 ? -43.926 43.671 -127.896 1.00 30.36 ? 241  LEU A CA  1 
ATOM   1791 C C   . LEU A 1 246 ? -43.947 44.010 -126.418 1.00 31.75 ? 241  LEU A C   1 
ATOM   1792 O O   . LEU A 1 246 ? -42.928 44.373 -125.844 1.00 33.41 ? 241  LEU A O   1 
ATOM   1793 C CB  . LEU A 1 246 ? -44.753 44.747 -128.577 1.00 31.69 ? 241  LEU A CB  1 
ATOM   1794 C CG  . LEU A 1 246 ? -44.530 45.169 -130.017 1.00 33.98 ? 241  LEU A CG  1 
ATOM   1795 C CD1 . LEU A 1 246 ? -45.212 46.540 -130.192 1.00 33.36 ? 241  LEU A CD1 1 
ATOM   1796 C CD2 . LEU A 1 246 ? -43.042 45.252 -130.334 1.00 34.61 ? 241  LEU A CD2 1 
ATOM   1797 N N   . PHE A 1 247 ? -45.116 43.895 -125.799 1.00 32.59 ? 242  PHE A N   1 
ATOM   1798 C CA  . PHE A 1 247 ? -45.267 44.284 -124.404 1.00 33.75 ? 242  PHE A CA  1 
ATOM   1799 C C   . PHE A 1 247 ? -45.037 43.309 -123.259 1.00 34.32 ? 242  PHE A C   1 
ATOM   1800 O O   . PHE A 1 247 ? -45.064 43.732 -122.104 1.00 34.07 ? 242  PHE A O   1 
ATOM   1801 C CB  . PHE A 1 247 ? -46.640 44.919 -124.214 1.00 33.03 ? 242  PHE A CB  1 
ATOM   1802 C CG  . PHE A 1 247 ? -46.867 46.108 -125.074 1.00 32.65 ? 242  PHE A CG  1 
ATOM   1803 C CD1 . PHE A 1 247 ? -47.316 45.957 -126.373 1.00 33.21 ? 242  PHE A CD1 1 
ATOM   1804 C CD2 . PHE A 1 247 ? -46.614 47.382 -124.591 1.00 33.54 ? 242  PHE A CD2 1 
ATOM   1805 C CE1 . PHE A 1 247 ? -47.513 47.061 -127.188 1.00 33.84 ? 242  PHE A CE1 1 
ATOM   1806 C CE2 . PHE A 1 247 ? -46.807 48.500 -125.393 1.00 34.31 ? 242  PHE A CE2 1 
ATOM   1807 C CZ  . PHE A 1 247 ? -47.257 48.339 -126.694 1.00 34.55 ? 242  PHE A CZ  1 
ATOM   1808 N N   . CYS A 1 248 ? -44.836 42.027 -123.550 1.00 35.33 ? 243  CYS A N   1 
ATOM   1809 C CA  . CYS A 1 248 ? -44.613 41.052 -122.487 1.00 37.00 ? 243  CYS A CA  1 
ATOM   1810 C C   . CYS A 1 248 ? -43.150 40.880 -122.152 1.00 39.28 ? 243  CYS A C   1 
ATOM   1811 O O   . CYS A 1 248 ? -42.293 40.874 -123.030 1.00 39.06 ? 243  CYS A O   1 
ATOM   1812 C CB  . CYS A 1 248 ? -45.184 39.684 -122.859 1.00 35.66 ? 243  CYS A CB  1 
ATOM   1813 S SG  . CYS A 1 248 ? -46.974 39.616 -122.829 1.00 35.55 ? 243  CYS A SG  1 
ATOM   1814 N N   . SER A 1 249 ? -42.876 40.748 -120.861 1.00 42.72 ? 244  SER A N   1 
ATOM   1815 C CA  . SER A 1 249 ? -41.520 40.538 -120.376 1.00 46.14 ? 244  SER A CA  1 
ATOM   1816 C C   . SER A 1 249 ? -41.213 39.065 -120.624 1.00 48.26 ? 244  SER A C   1 
ATOM   1817 O O   . SER A 1 249 ? -42.121 38.213 -120.674 1.00 49.39 ? 244  SER A O   1 
ATOM   1818 C CB  . SER A 1 249 ? -41.438 40.798 -118.870 1.00 46.13 ? 244  SER A CB  1 
ATOM   1819 O OG  . SER A 1 249 ? -42.304 41.849 -118.471 1.00 49.30 ? 244  SER A OG  1 
ATOM   1820 N N   . GLY A 1 250 ? -39.935 38.754 -120.771 1.00 49.76 ? 245  GLY A N   1 
ATOM   1821 C CA  . GLY A 1 250 ? -39.570 37.369 -120.988 1.00 49.89 ? 245  GLY A CA  1 
ATOM   1822 C C   . GLY A 1 250 ? -40.010 36.947 -122.364 1.00 49.34 ? 245  GLY A C   1 
ATOM   1823 O O   . GLY A 1 250 ? -40.796 37.645 -123.007 1.00 49.18 ? 245  GLY A O   1 
ATOM   1824 N N   . PRO A 1 251 ? -39.509 35.803 -122.844 1.00 48.97 ? 246  PRO A N   1 
ATOM   1825 C CA  . PRO A 1 251 ? -39.846 35.277 -124.169 1.00 47.63 ? 246  PRO A CA  1 
ATOM   1826 C C   . PRO A 1 251 ? -41.325 34.931 -124.347 1.00 45.84 ? 246  PRO A C   1 
ATOM   1827 O O   . PRO A 1 251 ? -41.970 34.391 -123.433 1.00 45.18 ? 246  PRO A O   1 
ATOM   1828 C CB  . PRO A 1 251 ? -38.954 34.044 -124.287 1.00 48.69 ? 246  PRO A CB  1 
ATOM   1829 C CG  . PRO A 1 251 ? -37.775 34.391 -123.418 1.00 50.38 ? 246  PRO A CG  1 
ATOM   1830 C CD  . PRO A 1 251 ? -38.449 34.998 -122.215 1.00 49.47 ? 246  PRO A CD  1 
ATOM   1831 N N   . VAL A 1 252 ? -41.841 35.268 -125.532 1.00 42.56 ? 247  VAL A N   1 
ATOM   1832 C CA  . VAL A 1 252 ? -43.223 34.991 -125.926 1.00 38.76 ? 247  VAL A CA  1 
ATOM   1833 C C   . VAL A 1 252 ? -43.120 34.076 -127.142 1.00 36.46 ? 247  VAL A C   1 
ATOM   1834 O O   . VAL A 1 252 ? -42.583 34.462 -128.169 1.00 36.36 ? 247  VAL A O   1 
ATOM   1835 C CB  . VAL A 1 252 ? -43.981 36.270 -126.356 1.00 37.38 ? 247  VAL A CB  1 
ATOM   1836 C CG1 . VAL A 1 252 ? -45.398 35.918 -126.741 1.00 36.54 ? 247  VAL A CG1 1 
ATOM   1837 C CG2 . VAL A 1 252 ? -43.976 37.284 -125.244 1.00 36.90 ? 247  VAL A CG2 1 
ATOM   1838 N N   . SER A 1 253 ? -43.621 32.860 -127.026 1.00 34.31 ? 248  SER A N   1 
ATOM   1839 C CA  . SER A 1 253 ? -43.552 31.931 -128.141 1.00 32.43 ? 248  SER A CA  1 
ATOM   1840 C C   . SER A 1 253 ? -44.921 31.738 -128.773 1.00 31.00 ? 248  SER A C   1 
ATOM   1841 O O   . SER A 1 253 ? -45.922 31.587 -128.077 1.00 31.55 ? 248  SER A O   1 
ATOM   1842 C CB  . SER A 1 253 ? -42.994 30.590 -127.666 1.00 32.78 ? 248  SER A CB  1 
ATOM   1843 O OG  . SER A 1 253 ? -43.609 30.197 -126.448 1.00 33.55 ? 248  SER A OG  1 
ATOM   1844 N N   . SER A 1 254 ? -44.954 31.745 -130.101 1.00 29.07 ? 249  SER A N   1 
ATOM   1845 C CA  . SER A 1 254 ? -46.198 31.586 -130.832 1.00 25.77 ? 249  SER A CA  1 
ATOM   1846 C C   . SER A 1 254 ? -46.865 30.285 -130.469 1.00 23.48 ? 249  SER A C   1 
ATOM   1847 O O   . SER A 1 254 ? -48.086 30.208 -130.406 1.00 23.40 ? 249  SER A O   1 
ATOM   1848 C CB  . SER A 1 254 ? -45.938 31.643 -132.333 1.00 26.14 ? 249  SER A CB  1 
ATOM   1849 O OG  . SER A 1 254 ? -45.660 32.970 -132.751 1.00 27.35 ? 249  SER A OG  1 
ATOM   1850 N N   . ALA A 1 255 ? -46.067 29.266 -130.195 1.00 21.01 ? 250  ALA A N   1 
ATOM   1851 C CA  . ALA A 1 255 ? -46.632 27.971 -129.852 1.00 21.05 ? 250  ALA A CA  1 
ATOM   1852 C C   . ALA A 1 255 ? -47.662 28.058 -128.725 1.00 20.39 ? 250  ALA A C   1 
ATOM   1853 O O   . ALA A 1 255 ? -48.655 27.334 -128.725 1.00 20.68 ? 250  ALA A O   1 
ATOM   1854 C CB  . ALA A 1 255 ? -45.533 27.004 -129.471 1.00 21.27 ? 250  ALA A CB  1 
ATOM   1855 N N   . THR A 1 256 ? -47.434 28.950 -127.773 1.00 18.30 ? 251  THR A N   1 
ATOM   1856 C CA  . THR A 1 256 ? -48.344 29.087 -126.656 1.00 17.45 ? 251  THR A CA  1 
ATOM   1857 C C   . THR A 1 256 ? -49.748 29.466 -127.073 1.00 17.09 ? 251  THR A C   1 
ATOM   1858 O O   . THR A 1 256 ? -50.702 29.140 -126.379 1.00 16.25 ? 251  THR A O   1 
ATOM   1859 C CB  . THR A 1 256 ? -47.843 30.134 -125.679 1.00 18.62 ? 251  THR A CB  1 
ATOM   1860 O OG1 . THR A 1 256 ? -46.503 29.814 -125.297 1.00 22.61 ? 251  THR A OG1 1 
ATOM   1861 C CG2 . THR A 1 256 ? -48.713 30.161 -124.432 1.00 20.35 ? 251  THR A CG2 1 
ATOM   1862 N N   . PHE A 1 257 ? -49.880 30.155 -128.202 1.00 16.60 ? 252  PHE A N   1 
ATOM   1863 C CA  . PHE A 1 257 ? -51.195 30.579 -128.664 1.00 15.32 ? 252  PHE A CA  1 
ATOM   1864 C C   . PHE A 1 257 ? -52.013 29.438 -129.248 1.00 14.13 ? 252  PHE A C   1 
ATOM   1865 O O   . PHE A 1 257 ? -53.197 29.597 -129.531 1.00 11.71 ? 252  PHE A O   1 
ATOM   1866 C CB  . PHE A 1 257 ? -51.059 31.698 -129.686 1.00 16.15 ? 252  PHE A CB  1 
ATOM   1867 C CG  . PHE A 1 257 ? -50.518 32.961 -129.113 1.00 19.11 ? 252  PHE A CG  1 
ATOM   1868 C CD1 . PHE A 1 257 ? -49.156 33.107 -128.878 1.00 20.17 ? 252  PHE A CD1 1 
ATOM   1869 C CD2 . PHE A 1 257 ? -51.379 34.016 -128.773 1.00 19.50 ? 252  PHE A CD2 1 
ATOM   1870 C CE1 . PHE A 1 257 ? -48.662 34.288 -128.311 1.00 20.31 ? 252  PHE A CE1 1 
ATOM   1871 C CE2 . PHE A 1 257 ? -50.889 35.196 -128.205 1.00 17.51 ? 252  PHE A CE2 1 
ATOM   1872 C CZ  . PHE A 1 257 ? -49.537 35.331 -127.976 1.00 18.73 ? 252  PHE A CZ  1 
ATOM   1873 N N   . LEU A 1 258 ? -51.370 28.287 -129.425 1.00 13.20 ? 253  LEU A N   1 
ATOM   1874 C CA  . LEU A 1 258 ? -52.051 27.121 -129.952 1.00 12.62 ? 253  LEU A CA  1 
ATOM   1875 C C   . LEU A 1 258 ? -52.609 26.301 -128.808 1.00 12.79 ? 253  LEU A C   1 
ATOM   1876 O O   . LEU A 1 258 ? -53.195 25.242 -129.010 1.00 13.81 ? 253  LEU A O   1 
ATOM   1877 C CB  . LEU A 1 258 ? -51.100 26.291 -130.811 1.00 12.45 ? 253  LEU A CB  1 
ATOM   1878 C CG  . LEU A 1 258 ? -50.506 27.046 -132.009 1.00 11.74 ? 253  LEU A CG  1 
ATOM   1879 C CD1 . LEU A 1 258 ? -49.942 26.043 -132.971 1.00 10.25 ? 253  LEU A CD1 1 
ATOM   1880 C CD2 . LEU A 1 258 ? -51.562 27.891 -132.717 1.00 8.89  ? 253  LEU A CD2 1 
ATOM   1881 N N   . GLU A 1 259 ? -52.412 26.810 -127.597 1.00 13.85 ? 254  GLU A N   1 
ATOM   1882 C CA  . GLU A 1 259 ? -52.939 26.196 -126.385 1.00 15.05 ? 254  GLU A CA  1 
ATOM   1883 C C   . GLU A 1 259 ? -54.405 26.662 -126.251 1.00 15.96 ? 254  GLU A C   1 
ATOM   1884 O O   . GLU A 1 259 ? -54.852 27.538 -127.001 1.00 16.12 ? 254  GLU A O   1 
ATOM   1885 C CB  . GLU A 1 259 ? -52.135 26.662 -125.169 1.00 15.40 ? 254  GLU A CB  1 
ATOM   1886 C CG  . GLU A 1 259 ? -50.663 26.290 -125.204 1.00 16.34 ? 254  GLU A CG  1 
ATOM   1887 C CD  . GLU A 1 259 ? -50.415 24.796 -125.002 1.00 19.19 ? 254  GLU A CD  1 
ATOM   1888 O OE1 . GLU A 1 259 ? -51.393 24.031 -124.823 1.00 18.95 ? 254  GLU A OE1 1 
ATOM   1889 O OE2 . GLU A 1 259 ? -49.234 24.381 -125.020 1.00 19.36 ? 254  GLU A OE2 1 
ATOM   1890 N N   . SER A 1 260 ? -55.153 26.093 -125.307 1.00 15.79 ? 255  SER A N   1 
ATOM   1891 C CA  . SER A 1 260 ? -56.557 26.484 -125.115 1.00 15.48 ? 255  SER A CA  1 
ATOM   1892 C C   . SER A 1 260 ? -56.720 27.998 -124.884 1.00 15.43 ? 255  SER A C   1 
ATOM   1893 O O   . SER A 1 260 ? -57.616 28.636 -125.439 1.00 15.13 ? 255  SER A O   1 
ATOM   1894 C CB  . SER A 1 260 ? -57.175 25.718 -123.927 1.00 15.70 ? 255  SER A CB  1 
ATOM   1895 O OG  . SER A 1 260 ? -58.576 25.941 -123.835 1.00 13.25 ? 255  SER A OG  1 
ATOM   1896 N N   . CYS A 1 261 ? -55.849 28.565 -124.062 1.00 14.96 ? 256  CYS A N   1 
ATOM   1897 C CA  . CYS A 1 261 ? -55.910 29.980 -123.750 1.00 15.44 ? 256  CYS A CA  1 
ATOM   1898 C C   . CYS A 1 261 ? -55.856 30.838 -125.016 1.00 15.89 ? 256  CYS A C   1 
ATOM   1899 O O   . CYS A 1 261 ? -56.287 31.993 -125.022 1.00 16.68 ? 256  CYS A O   1 
ATOM   1900 C CB  . CYS A 1 261 ? -54.740 30.346 -122.820 1.00 15.76 ? 256  CYS A CB  1 
ATOM   1901 S SG  . CYS A 1 261 ? -53.060 30.062 -123.536 1.00 17.17 ? 256  CYS A SG  1 
ATOM   1902 N N   . GLY A 1 262 ? -55.338 30.271 -126.098 1.00 15.29 ? 257  GLY A N   1 
ATOM   1903 C CA  . GLY A 1 262 ? -55.213 31.044 -127.309 1.00 14.31 ? 257  GLY A CA  1 
ATOM   1904 C C   . GLY A 1 262 ? -56.285 30.845 -128.345 1.00 15.77 ? 257  GLY A C   1 
ATOM   1905 O O   . GLY A 1 262 ? -57.403 31.338 -128.208 1.00 16.36 ? 257  GLY A O   1 
ATOM   1906 N N   . VAL A 1 263 ? -55.939 30.117 -129.398 1.00 16.14 ? 258  VAL A N   1 
ATOM   1907 C CA  . VAL A 1 263 ? -56.861 29.885 -130.489 1.00 16.84 ? 258  VAL A CA  1 
ATOM   1908 C C   . VAL A 1 263 ? -58.254 29.382 -130.071 1.00 16.93 ? 258  VAL A C   1 
ATOM   1909 O O   . VAL A 1 263 ? -59.259 29.843 -130.608 1.00 17.75 ? 258  VAL A O   1 
ATOM   1910 C CB  . VAL A 1 263 ? -56.212 28.939 -131.577 1.00 16.63 ? 258  VAL A CB  1 
ATOM   1911 C CG1 . VAL A 1 263 ? -55.836 27.600 -130.992 1.00 16.03 ? 258  VAL A CG1 1 
ATOM   1912 C CG2 . VAL A 1 263 ? -57.175 28.754 -132.740 1.00 16.67 ? 258  VAL A CG2 1 
ATOM   1913 N N   . ALA A 1 264 ? -58.317 28.466 -129.108 1.00 17.00 ? 259  ALA A N   1 
ATOM   1914 C CA  . ALA A 1 264 ? -59.596 27.907 -128.656 1.00 16.62 ? 259  ALA A CA  1 
ATOM   1915 C C   . ALA A 1 264 ? -60.488 28.892 -127.927 1.00 16.71 ? 259  ALA A C   1 
ATOM   1916 O O   . ALA A 1 264 ? -61.666 29.002 -128.256 1.00 16.26 ? 259  ALA A O   1 
ATOM   1917 C CB  . ALA A 1 264 ? -59.365 26.684 -127.769 1.00 16.07 ? 259  ALA A CB  1 
ATOM   1918 N N   . ASP A 1 265 ? -59.944 29.604 -126.935 1.00 16.54 ? 260  ASP A N   1 
ATOM   1919 C CA  . ASP A 1 265 ? -60.753 30.569 -126.186 1.00 15.49 ? 260  ASP A CA  1 
ATOM   1920 C C   . ASP A 1 265 ? -61.193 31.695 -127.091 1.00 14.72 ? 260  ASP A C   1 
ATOM   1921 O O   . ASP A 1 265 ? -62.246 32.292 -126.921 1.00 14.73 ? 260  ASP A O   1 
ATOM   1922 C CB  . ASP A 1 265 ? -59.986 31.139 -125.002 1.00 15.39 ? 260  ASP A CB  1 
ATOM   1923 C CG  . ASP A 1 265 ? -60.879 31.971 -124.083 1.00 15.95 ? 260  ASP A CG  1 
ATOM   1924 O OD1 . ASP A 1 265 ? -62.118 31.843 -124.163 1.00 16.39 ? 260  ASP A OD1 1 
ATOM   1925 O OD2 . ASP A 1 265 ? -60.352 32.748 -123.270 1.00 17.28 ? 260  ASP A OD2 1 
ATOM   1926 N N   . LEU A 1 266 ? -60.365 31.979 -128.070 1.00 14.83 ? 261  LEU A N   1 
ATOM   1927 C CA  . LEU A 1 266 ? -60.666 33.013 -129.031 1.00 16.08 ? 261  LEU A CA  1 
ATOM   1928 C C   . LEU A 1 266 ? -61.898 32.580 -129.858 1.00 16.09 ? 261  LEU A C   1 
ATOM   1929 O O   . LEU A 1 266 ? -62.788 33.383 -130.135 1.00 14.15 ? 261  LEU A O   1 
ATOM   1930 C CB  . LEU A 1 266 ? -59.422 33.210 -129.888 1.00 16.17 ? 261  LEU A CB  1 
ATOM   1931 C CG  . LEU A 1 266 ? -59.223 34.404 -130.789 1.00 17.35 ? 261  LEU A CG  1 
ATOM   1932 C CD1 . LEU A 1 266 ? -59.545 35.711 -130.087 1.00 18.15 ? 261  LEU A CD1 1 
ATOM   1933 C CD2 . LEU A 1 266 ? -57.763 34.360 -131.223 1.00 19.76 ? 261  LEU A CD2 1 
ATOM   1934 N N   . ILE A 1 267 ? -61.958 31.291 -130.197 1.00 17.43 ? 262  ILE A N   1 
ATOM   1935 C CA  . ILE A 1 267 ? -63.064 30.724 -130.983 1.00 18.09 ? 262  ILE A CA  1 
ATOM   1936 C C   . ILE A 1 267 ? -64.362 30.647 -130.197 1.00 18.65 ? 262  ILE A C   1 
ATOM   1937 O O   . ILE A 1 267 ? -65.402 31.171 -130.628 1.00 19.26 ? 262  ILE A O   1 
ATOM   1938 C CB  . ILE A 1 267 ? -62.798 29.261 -131.459 1.00 18.00 ? 262  ILE A CB  1 
ATOM   1939 C CG1 . ILE A 1 267 ? -61.592 29.184 -132.381 1.00 18.68 ? 262  ILE A CG1 1 
ATOM   1940 C CG2 . ILE A 1 267 ? -64.001 28.748 -132.226 1.00 15.88 ? 262  ILE A CG2 1 
ATOM   1941 C CD1 . ILE A 1 267 ? -61.822 29.953 -133.644 1.00 24.93 ? 262  ILE A CD1 1 
ATOM   1942 N N   . THR A 1 268 ? -64.308 29.968 -129.057 1.00 17.90 ? 263  THR A N   1 
ATOM   1943 C CA  . THR A 1 268 ? -65.504 29.793 -128.255 1.00 17.88 ? 263  THR A CA  1 
ATOM   1944 C C   . THR A 1 268 ? -66.122 31.136 -127.853 1.00 18.11 ? 263  THR A C   1 
ATOM   1945 O O   . THR A 1 268 ? -67.345 31.303 -127.872 1.00 17.47 ? 263  THR A O   1 
ATOM   1946 C CB  . THR A 1 268 ? -65.213 28.952 -127.004 1.00 16.64 ? 263  THR A CB  1 
ATOM   1947 O OG1 . THR A 1 268 ? -66.438 28.396 -126.536 1.00 18.35 ? 263  THR A OG1 1 
ATOM   1948 C CG2 . THR A 1 268 ? -64.618 29.802 -125.887 1.00 16.80 ? 263  THR A CG2 1 
ATOM   1949 N N   . THR A 1 269 ? -65.268 32.101 -127.529 1.00 17.31 ? 264  THR A N   1 
ATOM   1950 C CA  . THR A 1 269 ? -65.731 33.411 -127.110 1.00 17.09 ? 264  THR A CA  1 
ATOM   1951 C C   . THR A 1 269 ? -66.402 34.186 -128.243 1.00 17.06 ? 264  THR A C   1 
ATOM   1952 O O   . THR A 1 269 ? -67.463 34.769 -128.059 1.00 17.78 ? 264  THR A O   1 
ATOM   1953 C CB  . THR A 1 269 ? -64.569 34.226 -126.510 1.00 16.61 ? 264  THR A CB  1 
ATOM   1954 O OG1 . THR A 1 269 ? -64.049 33.540 -125.352 1.00 15.88 ? 264  THR A OG1 1 
ATOM   1955 C CG2 . THR A 1 269 ? -65.042 35.606 -126.108 1.00 15.27 ? 264  THR A CG2 1 
ATOM   1956 N N   . CYS A 1 270 ? -65.798 34.164 -129.422 1.00 16.71 ? 265  CYS A N   1 
ATOM   1957 C CA  . CYS A 1 270 ? -66.347 34.862 -130.569 1.00 14.78 ? 265  CYS A CA  1 
ATOM   1958 C C   . CYS A 1 270 ? -67.658 34.270 -131.075 1.00 16.04 ? 265  CYS A C   1 
ATOM   1959 O O   . CYS A 1 270 ? -68.370 34.899 -131.860 1.00 16.02 ? 265  CYS A O   1 
ATOM   1960 C CB  . CYS A 1 270 ? -65.306 34.893 -131.682 1.00 12.71 ? 265  CYS A CB  1 
ATOM   1961 S SG  . CYS A 1 270 ? -64.036 36.151 -131.405 1.00 11.14 ? 265  CYS A SG  1 
ATOM   1962 N N   . TYR A 1 271 ? -67.990 33.064 -130.619 1.00 17.36 ? 266  TYR A N   1 
ATOM   1963 C CA  . TYR A 1 271 ? -69.229 32.411 -131.039 1.00 16.97 ? 266  TYR A CA  1 
ATOM   1964 C C   . TYR A 1 271 ? -70.350 32.428 -130.011 1.00 18.07 ? 266  TYR A C   1 
ATOM   1965 O O   . TYR A 1 271 ? -71.521 32.539 -130.391 1.00 18.97 ? 266  TYR A O   1 
ATOM   1966 C CB  . TYR A 1 271 ? -68.967 30.965 -131.455 1.00 15.99 ? 266  TYR A CB  1 
ATOM   1967 C CG  . TYR A 1 271 ? -68.639 30.840 -132.911 1.00 14.80 ? 266  TYR A CG  1 
ATOM   1968 C CD1 . TYR A 1 271 ? -67.324 30.895 -133.361 1.00 13.86 ? 266  TYR A CD1 1 
ATOM   1969 C CD2 . TYR A 1 271 ? -69.645 30.753 -133.852 1.00 14.38 ? 266  TYR A CD2 1 
ATOM   1970 C CE1 . TYR A 1 271 ? -67.032 30.868 -134.711 1.00 13.77 ? 266  TYR A CE1 1 
ATOM   1971 C CE2 . TYR A 1 271 ? -69.356 30.731 -135.212 1.00 14.76 ? 266  TYR A CE2 1 
ATOM   1972 C CZ  . TYR A 1 271 ? -68.056 30.790 -135.632 1.00 13.34 ? 266  TYR A CZ  1 
ATOM   1973 O OH  . TYR A 1 271 ? -67.791 30.803 -136.975 1.00 12.73 ? 266  TYR A OH  1 
ATOM   1974 N N   . GLY A 1 272 ? -70.003 32.318 -128.726 1.00 17.18 ? 267  GLY A N   1 
ATOM   1975 C CA  . GLY A 1 272 ? -71.025 32.310 -127.697 1.00 17.18 ? 267  GLY A CA  1 
ATOM   1976 C C   . GLY A 1 272 ? -70.694 33.073 -126.427 1.00 17.86 ? 267  GLY A C   1 
ATOM   1977 O O   . GLY A 1 272 ? -71.297 32.823 -125.384 1.00 18.78 ? 267  GLY A O   1 
ATOM   1978 N N   . GLY A 1 273 ? -69.747 34.002 -126.495 1.00 17.72 ? 268  GLY A N   1 
ATOM   1979 C CA  . GLY A 1 273 ? -69.388 34.755 -125.304 1.00 16.81 ? 268  GLY A CA  1 
ATOM   1980 C C   . GLY A 1 273 ? -70.317 35.926 -125.029 1.00 17.61 ? 268  GLY A C   1 
ATOM   1981 O O   . GLY A 1 273 ? -71.074 36.366 -125.921 1.00 17.73 ? 268  GLY A O   1 
ATOM   1982 N N   . ARG A 1 274 ? -70.265 36.441 -123.800 1.00 15.96 ? 269  ARG A N   1 
ATOM   1983 C CA  . ARG A 1 274 ? -71.097 37.571 -123.429 1.00 14.82 ? 269  ARG A CA  1 
ATOM   1984 C C   . ARG A 1 274 ? -70.658 38.812 -124.192 1.00 15.16 ? 269  ARG A C   1 
ATOM   1985 O O   . ARG A 1 274 ? -71.482 39.597 -124.645 1.00 16.72 ? 269  ARG A O   1 
ATOM   1986 C CB  . ARG A 1 274 ? -71.041 37.783 -121.933 1.00 12.37 ? 269  ARG A CB  1 
ATOM   1987 C CG  . ARG A 1 274 ? -71.736 36.667 -121.196 1.00 11.99 ? 269  ARG A CG  1 
ATOM   1988 C CD  . ARG A 1 274 ? -71.307 36.607 -119.741 1.00 12.48 ? 269  ARG A CD  1 
ATOM   1989 N NE  . ARG A 1 274 ? -69.854 36.620 -119.601 1.00 10.61 ? 269  ARG A NE  1 
ATOM   1990 C CZ  . ARG A 1 274 ? -69.223 36.867 -118.457 1.00 10.30 ? 269  ARG A CZ  1 
ATOM   1991 N NH1 . ARG A 1 274 ? -69.914 37.110 -117.354 1.00 7.40  ? 269  ARG A NH1 1 
ATOM   1992 N NH2 . ARG A 1 274 ? -67.901 36.931 -118.431 1.00 10.67 ? 269  ARG A NH2 1 
ATOM   1993 N N   . ASN A 1 275 ? -69.360 38.986 -124.364 1.00 15.45 ? 270  ASN A N   1 
ATOM   1994 C CA  . ASN A 1 275 ? -68.867 40.129 -125.133 1.00 16.26 ? 270  ASN A CA  1 
ATOM   1995 C C   . ASN A 1 275 ? -69.439 40.140 -126.562 1.00 16.22 ? 270  ASN A C   1 
ATOM   1996 O O   . ASN A 1 275 ? -69.753 41.191 -127.089 1.00 16.89 ? 270  ASN A O   1 
ATOM   1997 C CB  . ASN A 1 275 ? -67.331 40.119 -125.209 1.00 16.10 ? 270  ASN A CB  1 
ATOM   1998 C CG  . ASN A 1 275 ? -66.682 40.638 -123.955 1.00 14.13 ? 270  ASN A CG  1 
ATOM   1999 O OD1 . ASN A 1 275 ? -66.269 39.850 -123.097 1.00 15.66 ? 270  ASN A OD1 1 
ATOM   2000 N ND2 . ASN A 1 275 ? -66.595 41.857 -123.821 1.00 16.14 ? 270  ASN A ND2 1 
ATOM   2001 N N   . ARG A 1 276 ? -69.564 38.976 -127.195 1.00 17.30 ? 271  ARG A N   1 
ATOM   2002 C CA  . ARG A 1 276 ? -70.118 38.909 -128.554 1.00 17.59 ? 271  ARG A CA  1 
ATOM   2003 C C   . ARG A 1 276 ? -71.610 39.282 -128.541 1.00 17.81 ? 271  ARG A C   1 
ATOM   2004 O O   . ARG A 1 276 ? -72.084 39.981 -129.426 1.00 17.35 ? 271  ARG A O   1 
ATOM   2005 C CB  . ARG A 1 276 ? -69.944 37.500 -129.148 1.00 15.55 ? 271  ARG A CB  1 
ATOM   2006 C CG  . ARG A 1 276 ? -70.269 37.400 -130.635 1.00 14.69 ? 271  ARG A CG  1 
ATOM   2007 C CD  . ARG A 1 276 ? -71.053 36.137 -130.950 1.00 16.01 ? 271  ARG A CD  1 
ATOM   2008 N NE  . ARG A 1 276 ? -72.351 36.117 -130.264 1.00 18.12 ? 271  ARG A NE  1 
ATOM   2009 C CZ  . ARG A 1 276 ? -73.452 36.735 -130.696 1.00 17.94 ? 271  ARG A CZ  1 
ATOM   2010 N NH1 . ARG A 1 276 ? -73.438 37.426 -131.831 1.00 18.19 ? 271  ARG A NH1 1 
ATOM   2011 N NH2 . ARG A 1 276 ? -74.567 36.683 -129.981 1.00 15.28 ? 271  ARG A NH2 1 
ATOM   2012 N N   . LYS A 1 277 ? -72.340 38.819 -127.534 1.00 17.72 ? 272  LYS A N   1 
ATOM   2013 C CA  . LYS A 1 277 ? -73.755 39.120 -127.448 1.00 19.47 ? 272  LYS A CA  1 
ATOM   2014 C C   . LYS A 1 277 ? -74.015 40.628 -127.363 1.00 19.85 ? 272  LYS A C   1 
ATOM   2015 O O   . LYS A 1 277 ? -74.739 41.201 -128.192 1.00 19.42 ? 272  LYS A O   1 
ATOM   2016 C CB  . LYS A 1 277 ? -74.372 38.432 -126.231 1.00 20.40 ? 272  LYS A CB  1 
ATOM   2017 C CG  . LYS A 1 277 ? -75.882 38.547 -126.215 1.00 23.06 ? 272  LYS A CG  1 
ATOM   2018 C CD  . LYS A 1 277 ? -76.483 38.335 -124.836 1.00 26.27 ? 272  LYS A CD  1 
ATOM   2019 C CE  . LYS A 1 277 ? -76.141 36.991 -124.237 1.00 28.73 ? 272  LYS A CE  1 
ATOM   2020 N NZ  . LYS A 1 277 ? -76.785 36.837 -122.893 1.00 30.60 ? 272  LYS A NZ  1 
ATOM   2021 N N   . VAL A 1 278 ? -73.428 41.266 -126.351 1.00 19.79 ? 273  VAL A N   1 
ATOM   2022 C CA  . VAL A 1 278 ? -73.581 42.706 -126.144 1.00 18.52 ? 273  VAL A CA  1 
ATOM   2023 C C   . VAL A 1 278 ? -73.028 43.495 -127.331 1.00 18.10 ? 273  VAL A C   1 
ATOM   2024 O O   . VAL A 1 278 ? -73.600 44.513 -127.711 1.00 18.86 ? 273  VAL A O   1 
ATOM   2025 C CB  . VAL A 1 278 ? -72.865 43.177 -124.834 1.00 18.09 ? 273  VAL A CB  1 
ATOM   2026 C CG1 . VAL A 1 278 ? -72.978 44.685 -124.669 1.00 16.69 ? 273  VAL A CG1 1 
ATOM   2027 C CG2 . VAL A 1 278 ? -73.481 42.499 -123.635 1.00 16.63 ? 273  VAL A CG2 1 
ATOM   2028 N N   . ALA A 1 279 ? -71.923 43.033 -127.915 1.00 17.90 ? 274  ALA A N   1 
ATOM   2029 C CA  . ALA A 1 279 ? -71.326 43.721 -129.071 1.00 18.42 ? 274  ALA A CA  1 
ATOM   2030 C C   . ALA A 1 279 ? -72.304 43.789 -130.251 1.00 18.33 ? 274  ALA A C   1 
ATOM   2031 O O   . ALA A 1 279 ? -72.463 44.827 -130.884 1.00 17.48 ? 274  ALA A O   1 
ATOM   2032 C CB  . ALA A 1 279 ? -70.020 43.027 -129.503 1.00 17.97 ? 274  ALA A CB  1 
ATOM   2033 N N   . GLU A 1 280 ? -72.959 42.673 -130.539 1.00 18.77 ? 275  GLU A N   1 
ATOM   2034 C CA  . GLU A 1 280 ? -73.925 42.622 -131.619 1.00 19.94 ? 275  GLU A CA  1 
ATOM   2035 C C   . GLU A 1 280 ? -75.090 43.587 -131.383 1.00 19.52 ? 275  GLU A C   1 
ATOM   2036 O O   . GLU A 1 280 ? -75.524 44.302 -132.283 1.00 19.21 ? 275  GLU A O   1 
ATOM   2037 C CB  . GLU A 1 280 ? -74.483 41.224 -131.745 1.00 22.38 ? 275  GLU A CB  1 
ATOM   2038 C CG  . GLU A 1 280 ? -75.277 41.073 -132.994 1.00 29.03 ? 275  GLU A CG  1 
ATOM   2039 C CD  . GLU A 1 280 ? -76.371 40.084 -132.840 1.00 32.83 ? 275  GLU A CD  1 
ATOM   2040 O OE1 . GLU A 1 280 ? -76.068 38.928 -132.466 1.00 34.35 ? 275  GLU A OE1 1 
ATOM   2041 O OE2 . GLU A 1 280 ? -77.533 40.476 -133.090 1.00 37.23 ? 275  GLU A OE2 1 
ATOM   2042 N N   . ALA A 1 281 ? -75.618 43.584 -130.170 1.00 19.03 ? 276  ALA A N   1 
ATOM   2043 C CA  . ALA A 1 281 ? -76.721 44.471 -129.852 1.00 18.47 ? 276  ALA A CA  1 
ATOM   2044 C C   . ALA A 1 281 ? -76.255 45.924 -129.984 1.00 18.71 ? 276  ALA A C   1 
ATOM   2045 O O   . ALA A 1 281 ? -77.044 46.813 -130.313 1.00 18.83 ? 276  ALA A O   1 
ATOM   2046 C CB  . ALA A 1 281 ? -77.214 44.198 -128.442 1.00 18.09 ? 276  ALA A CB  1 
ATOM   2047 N N   . PHE A 1 282 ? -74.978 46.172 -129.722 1.00 16.73 ? 277  PHE A N   1 
ATOM   2048 C CA  . PHE A 1 282 ? -74.487 47.530 -129.834 1.00 18.01 ? 277  PHE A CA  1 
ATOM   2049 C C   . PHE A 1 282 ? -74.581 47.929 -131.287 1.00 20.05 ? 277  PHE A C   1 
ATOM   2050 O O   . PHE A 1 282 ? -74.941 49.054 -131.620 1.00 21.89 ? 277  PHE A O   1 
ATOM   2051 C CB  . PHE A 1 282 ? -73.038 47.625 -129.384 1.00 15.65 ? 277  PHE A CB  1 
ATOM   2052 C CG  . PHE A 1 282 ? -72.448 48.982 -129.546 1.00 14.24 ? 277  PHE A CG  1 
ATOM   2053 C CD1 . PHE A 1 282 ? -72.509 49.910 -128.512 1.00 14.93 ? 277  PHE A CD1 1 
ATOM   2054 C CD2 . PHE A 1 282 ? -71.843 49.355 -130.746 1.00 15.87 ? 277  PHE A CD2 1 
ATOM   2055 C CE1 . PHE A 1 282 ? -71.970 51.216 -128.667 1.00 15.23 ? 277  PHE A CE1 1 
ATOM   2056 C CE2 . PHE A 1 282 ? -71.299 50.659 -130.919 1.00 16.99 ? 277  PHE A CE2 1 
ATOM   2057 C CZ  . PHE A 1 282 ? -71.366 51.587 -129.874 1.00 16.21 ? 277  PHE A CZ  1 
ATOM   2058 N N   . ALA A 1 283 ? -74.254 46.982 -132.153 1.00 21.56 ? 278  ALA A N   1 
ATOM   2059 C CA  . ALA A 1 283 ? -74.263 47.210 -133.582 1.00 22.36 ? 278  ALA A CA  1 
ATOM   2060 C C   . ALA A 1 283 ? -75.679 47.439 -134.095 1.00 23.49 ? 278  ALA A C   1 
ATOM   2061 O O   . ALA A 1 283 ? -75.893 48.223 -135.017 1.00 23.17 ? 278  ALA A O   1 
ATOM   2062 C CB  . ALA A 1 283 ? -73.619 46.014 -134.292 1.00 20.61 ? 278  ALA A CB  1 
ATOM   2063 N N   . ARG A 1 284 ? -76.645 46.756 -133.489 1.00 24.64 ? 279  ARG A N   1 
ATOM   2064 C CA  . ARG A 1 284 ? -78.027 46.874 -133.920 1.00 26.53 ? 279  ARG A CA  1 
ATOM   2065 C C   . ARG A 1 284 ? -78.823 48.054 -133.352 1.00 27.54 ? 279  ARG A C   1 
ATOM   2066 O O   . ARG A 1 284 ? -79.513 48.745 -134.102 1.00 29.35 ? 279  ARG A O   1 
ATOM   2067 C CB  . ARG A 1 284 ? -78.787 45.577 -133.620 1.00 25.56 ? 279  ARG A CB  1 
ATOM   2068 C CG  . ARG A 1 284 ? -78.269 44.327 -134.327 1.00 28.09 ? 279  ARG A CG  1 
ATOM   2069 C CD  . ARG A 1 284 ? -79.159 43.089 -134.041 1.00 29.48 ? 279  ARG A CD  1 
ATOM   2070 N NE  . ARG A 1 284 ? -80.170 43.369 -133.013 1.00 33.32 ? 279  ARG A NE  1 
ATOM   2071 C CZ  . ARG A 1 284 ? -80.097 43.008 -131.724 1.00 34.56 ? 279  ARG A CZ  1 
ATOM   2072 N NH1 . ARG A 1 284 ? -79.050 42.317 -131.252 1.00 34.66 ? 279  ARG A NH1 1 
ATOM   2073 N NH2 . ARG A 1 284 ? -81.072 43.367 -130.885 1.00 33.84 ? 279  ARG A NH2 1 
ATOM   2074 N N   . THR A 1 285 ? -78.704 48.300 -132.047 1.00 27.65 ? 280  THR A N   1 
ATOM   2075 C CA  . THR A 1 285 ? -79.481 49.339 -131.360 1.00 27.03 ? 280  THR A CA  1 
ATOM   2076 C C   . THR A 1 285 ? -78.885 50.713 -131.154 1.00 27.54 ? 280  THR A C   1 
ATOM   2077 O O   . THR A 1 285 ? -79.607 51.670 -130.866 1.00 28.12 ? 280  THR A O   1 
ATOM   2078 C CB  . THR A 1 285 ? -79.880 48.877 -129.973 1.00 26.44 ? 280  THR A CB  1 
ATOM   2079 O OG1 . THR A 1 285 ? -78.697 48.720 -129.181 1.00 25.08 ? 280  THR A OG1 1 
ATOM   2080 C CG2 . THR A 1 285 ? -80.613 47.565 -130.045 1.00 26.88 ? 280  THR A CG2 1 
ATOM   2081 N N   . GLY A 1 286 ? -77.576 50.822 -131.259 1.00 27.69 ? 281  GLY A N   1 
ATOM   2082 C CA  . GLY A 1 286 ? -76.977 52.115 -131.039 1.00 29.08 ? 281  GLY A CA  1 
ATOM   2083 C C   . GLY A 1 286 ? -76.928 52.471 -129.558 1.00 30.33 ? 281  GLY A C   1 
ATOM   2084 O O   . GLY A 1 286 ? -76.420 53.541 -129.207 1.00 31.88 ? 281  GLY A O   1 
ATOM   2085 N N   . LYS A 1 287 ? -77.432 51.604 -128.677 1.00 29.63 ? 282  LYS A N   1 
ATOM   2086 C CA  . LYS A 1 287 ? -77.395 51.929 -127.250 1.00 29.45 ? 282  LYS A CA  1 
ATOM   2087 C C   . LYS A 1 287 ? -75.983 51.885 -126.714 1.00 29.90 ? 282  LYS A C   1 
ATOM   2088 O O   . LYS A 1 287 ? -75.072 51.359 -127.358 1.00 30.69 ? 282  LYS A O   1 
ATOM   2089 C CB  . LYS A 1 287 ? -78.236 50.972 -126.427 1.00 28.85 ? 282  LYS A CB  1 
ATOM   2090 C CG  . LYS A 1 287 ? -79.721 51.186 -126.506 1.00 29.77 ? 282  LYS A CG  1 
ATOM   2091 C CD  . LYS A 1 287 ? -80.420 50.075 -125.731 1.00 30.71 ? 282  LYS A CD  1 
ATOM   2092 C CE  . LYS A 1 287 ? -81.922 50.070 -125.940 1.00 32.21 ? 282  LYS A CE  1 
ATOM   2093 N NZ  . LYS A 1 287 ? -82.582 48.947 -125.215 1.00 31.65 ? 282  LYS A NZ  1 
ATOM   2094 N N   . SER A 1 288 ? -75.806 52.425 -125.515 1.00 29.57 ? 283  SER A N   1 
ATOM   2095 C CA  . SER A 1 288 ? -74.493 52.445 -124.891 1.00 28.42 ? 283  SER A CA  1 
ATOM   2096 C C   . SER A 1 288 ? -74.117 51.052 -124.415 1.00 28.14 ? 283  SER A C   1 
ATOM   2097 O O   . SER A 1 288 ? -74.973 50.234 -124.072 1.00 28.50 ? 283  SER A O   1 
ATOM   2098 C CB  . SER A 1 288 ? -74.471 53.405 -123.696 1.00 27.36 ? 283  SER A CB  1 
ATOM   2099 O OG  . SER A 1 288 ? -75.152 52.879 -122.565 1.00 25.34 ? 283  SER A OG  1 
ATOM   2100 N N   . ILE A 1 289 ? -72.825 50.782 -124.394 1.00 27.23 ? 284  ILE A N   1 
ATOM   2101 C CA  . ILE A 1 289 ? -72.374 49.500 -123.922 1.00 27.18 ? 284  ILE A CA  1 
ATOM   2102 C C   . ILE A 1 289 ? -72.791 49.324 -122.469 1.00 27.94 ? 284  ILE A C   1 
ATOM   2103 O O   . ILE A 1 289 ? -73.271 48.266 -122.082 1.00 27.78 ? 284  ILE A O   1 
ATOM   2104 C CB  . ILE A 1 289 ? -70.852 49.379 -124.085 1.00 26.68 ? 284  ILE A CB  1 
ATOM   2105 C CG1 . ILE A 1 289 ? -70.558 48.874 -125.497 1.00 26.07 ? 284  ILE A CG1 1 
ATOM   2106 C CG2 . ILE A 1 289 ? -70.255 48.481 -123.005 1.00 25.57 ? 284  ILE A CG2 1 
ATOM   2107 C CD1 . ILE A 1 289 ? -69.116 48.700 -125.808 1.00 28.84 ? 284  ILE A CD1 1 
ATOM   2108 N N   . GLU A 1 290 ? -72.630 50.367 -121.662 1.00 29.78 ? 285  GLU A N   1 
ATOM   2109 C CA  . GLU A 1 290 ? -73.020 50.265 -120.258 1.00 31.41 ? 285  GLU A CA  1 
ATOM   2110 C C   . GLU A 1 290 ? -74.466 49.839 -120.133 1.00 29.99 ? 285  GLU A C   1 
ATOM   2111 O O   . GLU A 1 290 ? -74.774 48.929 -119.368 1.00 29.61 ? 285  GLU A O   1 
ATOM   2112 C CB  . GLU A 1 290 ? -72.821 51.585 -119.511 1.00 34.29 ? 285  GLU A CB  1 
ATOM   2113 C CG  . GLU A 1 290 ? -73.488 51.587 -118.136 1.00 40.64 ? 285  GLU A CG  1 
ATOM   2114 C CD  . GLU A 1 290 ? -72.838 52.545 -117.121 1.00 44.69 ? 285  GLU A CD  1 
ATOM   2115 O OE1 . GLU A 1 290 ? -73.018 53.788 -117.225 1.00 48.00 ? 285  GLU A OE1 1 
ATOM   2116 O OE2 . GLU A 1 290 ? -72.141 52.038 -116.209 1.00 44.97 ? 285  GLU A OE2 1 
ATOM   2117 N N   . GLN A 1 291 ? -75.348 50.485 -120.893 1.00 29.14 ? 286  GLN A N   1 
ATOM   2118 C CA  . GLN A 1 291 ? -76.766 50.159 -120.840 1.00 27.94 ? 286  GLN A CA  1 
ATOM   2119 C C   . GLN A 1 291 ? -77.041 48.735 -121.284 1.00 26.51 ? 286  GLN A C   1 
ATOM   2120 O O   . GLN A 1 291 ? -77.863 48.035 -120.689 1.00 24.94 ? 286  GLN A O   1 
ATOM   2121 C CB  . GLN A 1 291 ? -77.575 51.104 -121.710 1.00 29.82 ? 286  GLN A CB  1 
ATOM   2122 C CG  . GLN A 1 291 ? -79.074 50.921 -121.513 1.00 34.84 ? 286  GLN A CG  1 
ATOM   2123 C CD  . GLN A 1 291 ? -79.896 51.800 -122.437 1.00 38.09 ? 286  GLN A CD  1 
ATOM   2124 O OE1 . GLN A 1 291 ? -79.520 52.945 -122.714 1.00 40.81 ? 286  GLN A OE1 1 
ATOM   2125 N NE2 . GLN A 1 291 ? -81.031 51.281 -122.907 1.00 37.71 ? 286  GLN A NE2 1 
ATOM   2126 N N   . LEU A 1 292 ? -76.355 48.305 -122.338 1.00 24.87 ? 287  LEU A N   1 
ATOM   2127 C CA  . LEU A 1 292 ? -76.546 46.955 -122.830 1.00 24.07 ? 287  LEU A CA  1 
ATOM   2128 C C   . LEU A 1 292 ? -76.067 45.923 -121.805 1.00 24.42 ? 287  LEU A C   1 
ATOM   2129 O O   . LEU A 1 292 ? -76.669 44.859 -121.646 1.00 24.60 ? 287  LEU A O   1 
ATOM   2130 C CB  . LEU A 1 292 ? -75.837 46.789 -124.165 1.00 21.25 ? 287  LEU A CB  1 
ATOM   2131 C CG  . LEU A 1 292 ? -76.450 47.626 -125.286 1.00 19.69 ? 287  LEU A CG  1 
ATOM   2132 C CD1 . LEU A 1 292 ? -75.587 47.451 -126.516 1.00 20.23 ? 287  LEU A CD1 1 
ATOM   2133 C CD2 . LEU A 1 292 ? -77.879 47.216 -125.560 1.00 15.72 ? 287  LEU A CD2 1 
ATOM   2134 N N   . GLU A 1 293 ? -74.997 46.240 -121.092 1.00 24.61 ? 288  GLU A N   1 
ATOM   2135 C CA  . GLU A 1 293 ? -74.516 45.327 -120.072 1.00 25.56 ? 288  GLU A CA  1 
ATOM   2136 C C   . GLU A 1 293 ? -75.589 45.129 -118.997 1.00 26.57 ? 288  GLU A C   1 
ATOM   2137 O O   . GLU A 1 293 ? -75.855 44.011 -118.555 1.00 25.98 ? 288  GLU A O   1 
ATOM   2138 C CB  . GLU A 1 293 ? -73.261 45.873 -119.420 1.00 24.26 ? 288  GLU A CB  1 
ATOM   2139 C CG  . GLU A 1 293 ? -72.700 44.932 -118.412 1.00 25.09 ? 288  GLU A CG  1 
ATOM   2140 C CD  . GLU A 1 293 ? -71.549 45.524 -117.688 1.00 27.33 ? 288  GLU A CD  1 
ATOM   2141 O OE1 . GLU A 1 293 ? -71.770 46.487 -116.929 1.00 28.65 ? 288  GLU A OE1 1 
ATOM   2142 O OE2 . GLU A 1 293 ? -70.414 45.037 -117.888 1.00 30.32 ? 288  GLU A OE2 1 
ATOM   2143 N N   . LYS A 1 294 ? -76.204 46.224 -118.572 1.00 28.19 ? 289  LYS A N   1 
ATOM   2144 C CA  . LYS A 1 294 ? -77.239 46.144 -117.552 1.00 30.44 ? 289  LYS A CA  1 
ATOM   2145 C C   . LYS A 1 294 ? -78.499 45.446 -118.077 1.00 29.61 ? 289  LYS A C   1 
ATOM   2146 O O   . LYS A 1 294 ? -79.048 44.556 -117.423 1.00 30.07 ? 289  LYS A O   1 
ATOM   2147 C CB  . LYS A 1 294 ? -77.580 47.547 -117.035 1.00 31.79 ? 289  LYS A CB  1 
ATOM   2148 C CG  . LYS A 1 294 ? -78.489 47.561 -115.827 1.00 35.76 ? 289  LYS A CG  1 
ATOM   2149 C CD  . LYS A 1 294 ? -78.670 48.978 -115.259 1.00 40.65 ? 289  LYS A CD  1 
ATOM   2150 C CE  . LYS A 1 294 ? -79.745 48.991 -114.141 1.00 43.08 ? 289  LYS A CE  1 
ATOM   2151 N NZ  . LYS A 1 294 ? -80.048 50.351 -113.559 1.00 43.99 ? 289  LYS A NZ  1 
ATOM   2152 N N   . GLU A 1 295 ? -78.951 45.824 -119.261 1.00 28.36 ? 290  GLU A N   1 
ATOM   2153 C CA  . GLU A 1 295 ? -80.150 45.216 -119.802 1.00 27.98 ? 290  GLU A CA  1 
ATOM   2154 C C   . GLU A 1 295 ? -80.016 43.777 -120.246 1.00 26.39 ? 290  GLU A C   1 
ATOM   2155 O O   . GLU A 1 295 ? -80.990 43.036 -120.205 1.00 27.00 ? 290  GLU A O   1 
ATOM   2156 C CB  . GLU A 1 295 ? -80.664 46.010 -120.990 1.00 31.25 ? 290  GLU A CB  1 
ATOM   2157 C CG  . GLU A 1 295 ? -81.178 47.387 -120.669 1.00 34.76 ? 290  GLU A CG  1 
ATOM   2158 C CD  . GLU A 1 295 ? -81.574 48.124 -121.936 1.00 37.71 ? 290  GLU A CD  1 
ATOM   2159 O OE1 . GLU A 1 295 ? -81.602 47.459 -123.020 1.00 36.48 ? 290  GLU A OE1 1 
ATOM   2160 O OE2 . GLU A 1 295 ? -81.851 49.350 -121.834 1.00 38.45 ? 290  GLU A OE2 1 
ATOM   2161 N N   . LEU A 1 296 ? -78.824 43.365 -120.658 1.00 23.85 ? 291  LEU A N   1 
ATOM   2162 C CA  . LEU A 1 296 ? -78.670 42.010 -121.168 1.00 20.91 ? 291  LEU A CA  1 
ATOM   2163 C C   . LEU A 1 296 ? -78.002 40.948 -120.318 1.00 21.03 ? 291  LEU A C   1 
ATOM   2164 O O   . LEU A 1 296 ? -78.323 39.778 -120.446 1.00 21.93 ? 291  LEU A O   1 
ATOM   2165 C CB  . LEU A 1 296 ? -77.942 42.061 -122.512 1.00 18.27 ? 291  LEU A CB  1 
ATOM   2166 C CG  . LEU A 1 296 ? -78.591 42.798 -123.684 1.00 15.80 ? 291  LEU A CG  1 
ATOM   2167 C CD1 . LEU A 1 296 ? -77.664 42.806 -124.907 1.00 13.71 ? 291  LEU A CD1 1 
ATOM   2168 C CD2 . LEU A 1 296 ? -79.895 42.102 -124.009 1.00 13.77 ? 291  LEU A CD2 1 
ATOM   2169 N N   . LEU A 1 297 ? -77.077 41.336 -119.452 1.00 21.62 ? 292  LEU A N   1 
ATOM   2170 C CA  . LEU A 1 297 ? -76.343 40.349 -118.673 1.00 21.25 ? 292  LEU A CA  1 
ATOM   2171 C C   . LEU A 1 297 ? -76.763 40.080 -117.232 1.00 21.80 ? 292  LEU A C   1 
ATOM   2172 O O   . LEU A 1 297 ? -75.992 39.529 -116.452 1.00 22.05 ? 292  LEU A O   1 
ATOM   2173 C CB  . LEU A 1 297 ? -74.854 40.700 -118.724 1.00 20.50 ? 292  LEU A CB  1 
ATOM   2174 C CG  . LEU A 1 297 ? -74.356 40.940 -120.146 1.00 19.39 ? 292  LEU A CG  1 
ATOM   2175 C CD1 . LEU A 1 297 ? -72.855 41.123 -120.162 1.00 19.23 ? 292  LEU A CD1 1 
ATOM   2176 C CD2 . LEU A 1 297 ? -74.779 39.757 -121.020 1.00 19.13 ? 292  LEU A CD2 1 
ATOM   2177 N N   . ASN A 1 298 ? -77.978 40.458 -116.875 1.00 22.49 ? 293  ASN A N   1 
ATOM   2178 C CA  . ASN A 1 298 ? -78.462 40.221 -115.532 1.00 24.41 ? 293  ASN A CA  1 
ATOM   2179 C C   . ASN A 1 298 ? -77.378 40.292 -114.439 1.00 24.34 ? 293  ASN A C   1 
ATOM   2180 O O   . ASN A 1 298 ? -77.271 39.406 -113.585 1.00 24.68 ? 293  ASN A O   1 
ATOM   2181 C CB  . ASN A 1 298 ? -79.137 38.859 -115.485 1.00 27.72 ? 293  ASN A CB  1 
ATOM   2182 C CG  . ASN A 1 298 ? -79.708 38.551 -114.125 1.00 31.99 ? 293  ASN A CG  1 
ATOM   2183 O OD1 . ASN A 1 298 ? -79.770 37.384 -113.716 1.00 35.11 ? 293  ASN A OD1 1 
ATOM   2184 N ND2 . ASN A 1 298 ? -80.135 39.600 -113.405 1.00 32.90 ? 293  ASN A ND2 1 
ATOM   2185 N N   . GLY A 1 299 ? -76.553 41.329 -114.472 1.00 23.85 ? 294  GLY A N   1 
ATOM   2186 C CA  . GLY A 1 299 ? -75.539 41.461 -113.445 1.00 22.42 ? 294  GLY A CA  1 
ATOM   2187 C C   . GLY A 1 299 ? -74.149 40.990 -113.777 1.00 21.88 ? 294  GLY A C   1 
ATOM   2188 O O   . GLY A 1 299 ? -73.202 41.355 -113.089 1.00 23.00 ? 294  GLY A O   1 
ATOM   2189 N N   . GLN A 1 300 ? -73.998 40.165 -114.802 1.00 20.37 ? 295  GLN A N   1 
ATOM   2190 C CA  . GLN A 1 300 ? -72.660 39.713 -115.145 1.00 19.71 ? 295  GLN A CA  1 
ATOM   2191 C C   . GLN A 1 300 ? -71.900 40.878 -115.787 1.00 19.46 ? 295  GLN A C   1 
ATOM   2192 O O   . GLN A 1 300 ? -72.507 41.862 -116.200 1.00 19.97 ? 295  GLN A O   1 
ATOM   2193 C CB  . GLN A 1 300 ? -72.744 38.482 -116.045 1.00 18.71 ? 295  GLN A CB  1 
ATOM   2194 C CG  . GLN A 1 300 ? -73.439 37.335 -115.332 1.00 18.32 ? 295  GLN A CG  1 
ATOM   2195 C CD  . GLN A 1 300 ? -73.481 36.066 -116.157 1.00 20.20 ? 295  GLN A CD  1 
ATOM   2196 O OE1 . GLN A 1 300 ? -74.269 35.157 -115.885 1.00 18.92 ? 295  GLN A OE1 1 
ATOM   2197 N NE2 . GLN A 1 300 ? -72.628 35.995 -117.173 1.00 20.90 ? 295  GLN A NE2 1 
ATOM   2198 N N   . LYS A 1 301 ? -70.580 40.783 -115.860 1.00 18.77 ? 296  LYS A N   1 
ATOM   2199 C CA  . LYS A 1 301 ? -69.784 41.879 -116.402 1.00 18.00 ? 296  LYS A CA  1 
ATOM   2200 C C   . LYS A 1 301 ? -69.078 41.632 -117.724 1.00 17.40 ? 296  LYS A C   1 
ATOM   2201 O O   . LYS A 1 301 ? -68.693 40.522 -118.037 1.00 17.65 ? 296  LYS A O   1 
ATOM   2202 C CB  . LYS A 1 301 ? -68.718 42.297 -115.379 1.00 18.02 ? 296  LYS A CB  1 
ATOM   2203 C CG  . LYS A 1 301 ? -69.243 42.588 -113.986 1.00 18.76 ? 296  LYS A CG  1 
ATOM   2204 C CD  . LYS A 1 301 ? -70.243 43.722 -114.029 1.00 20.60 ? 296  LYS A CD  1 
ATOM   2205 C CE  . LYS A 1 301 ? -70.648 44.152 -112.649 1.00 19.91 ? 296  LYS A CE  1 
ATOM   2206 N NZ  . LYS A 1 301 ? -71.390 45.427 -112.752 1.00 22.07 ? 296  LYS A NZ  1 
ATOM   2207 N N   . LEU A 1 302 ? -68.896 42.708 -118.477 1.00 18.48 ? 297  LEU A N   1 
ATOM   2208 C CA  . LEU A 1 302 ? -68.182 42.686 -119.747 1.00 20.24 ? 297  LEU A CA  1 
ATOM   2209 C C   . LEU A 1 302 ? -66.743 43.074 -119.453 1.00 20.55 ? 297  LEU A C   1 
ATOM   2210 O O   . LEU A 1 302 ? -66.484 43.854 -118.535 1.00 19.97 ? 297  LEU A O   1 
ATOM   2211 C CB  . LEU A 1 302 ? -68.752 43.730 -120.689 1.00 22.21 ? 297  LEU A CB  1 
ATOM   2212 C CG  . LEU A 1 302 ? -70.011 43.366 -121.439 1.00 23.65 ? 297  LEU A CG  1 
ATOM   2213 C CD1 . LEU A 1 302 ? -70.553 44.629 -122.074 1.00 23.66 ? 297  LEU A CD1 1 
ATOM   2214 C CD2 . LEU A 1 302 ? -69.689 42.293 -122.495 1.00 23.86 ? 297  LEU A CD2 1 
ATOM   2215 N N   . GLN A 1 303 ? -65.811 42.564 -120.248 1.00 21.70 ? 298  GLN A N   1 
ATOM   2216 C CA  . GLN A 1 303 ? -64.399 42.878 -120.053 1.00 22.37 ? 298  GLN A CA  1 
ATOM   2217 C C   . GLN A 1 303 ? -63.770 43.409 -121.339 1.00 22.50 ? 298  GLN A C   1 
ATOM   2218 O O   . GLN A 1 303 ? -62.834 44.205 -121.304 1.00 22.41 ? 298  GLN A O   1 
ATOM   2219 C CB  . GLN A 1 303 ? -63.653 41.627 -119.606 1.00 25.59 ? 298  GLN A CB  1 
ATOM   2220 C CG  . GLN A 1 303 ? -64.230 40.931 -118.376 1.00 32.66 ? 298  GLN A CG  1 
ATOM   2221 C CD  . GLN A 1 303 ? -64.463 41.875 -117.184 1.00 37.59 ? 298  GLN A CD  1 
ATOM   2222 O OE1 . GLN A 1 303 ? -63.665 42.781 -116.902 1.00 39.62 ? 298  GLN A OE1 1 
ATOM   2223 N NE2 . GLN A 1 303 ? -65.557 41.644 -116.465 1.00 41.69 ? 298  GLN A NE2 1 
ATOM   2224 N N   . GLY A 1 304 ? -64.311 42.954 -122.471 1.00 22.44 ? 299  GLY A N   1 
ATOM   2225 C CA  . GLY A 1 304 ? -63.828 43.325 -123.789 1.00 21.04 ? 299  GLY A CA  1 
ATOM   2226 C C   . GLY A 1 304 ? -63.628 44.797 -124.043 1.00 21.99 ? 299  GLY A C   1 
ATOM   2227 O O   . GLY A 1 304 ? -62.514 45.209 -124.387 1.00 23.58 ? 299  GLY A O   1 
ATOM   2228 N N   . PRO A 1 305 ? -64.674 45.628 -123.906 1.00 21.58 ? 300  PRO A N   1 
ATOM   2229 C CA  . PRO A 1 305 ? -64.479 47.067 -124.155 1.00 21.74 ? 300  PRO A CA  1 
ATOM   2230 C C   . PRO A 1 305 ? -63.500 47.752 -123.170 1.00 22.53 ? 300  PRO A C   1 
ATOM   2231 O O   . PRO A 1 305 ? -62.598 48.494 -123.581 1.00 21.92 ? 300  PRO A O   1 
ATOM   2232 C CB  . PRO A 1 305 ? -65.905 47.628 -124.063 1.00 19.01 ? 300  PRO A CB  1 
ATOM   2233 C CG  . PRO A 1 305 ? -66.744 46.502 -124.484 1.00 17.77 ? 300  PRO A CG  1 
ATOM   2234 C CD  . PRO A 1 305 ? -66.107 45.316 -123.776 1.00 19.51 ? 300  PRO A CD  1 
ATOM   2235 N N   . GLU A 1 306 ? -63.685 47.504 -121.876 1.00 23.30 ? 301  GLU A N   1 
ATOM   2236 C CA  . GLU A 1 306 ? -62.818 48.083 -120.868 1.00 25.20 ? 301  GLU A CA  1 
ATOM   2237 C C   . GLU A 1 306 ? -61.364 47.685 -121.181 1.00 23.96 ? 301  GLU A C   1 
ATOM   2238 O O   . GLU A 1 306 ? -60.447 48.498 -121.026 1.00 24.01 ? 301  GLU A O   1 
ATOM   2239 C CB  . GLU A 1 306 ? -63.270 47.604 -119.487 1.00 29.28 ? 301  GLU A CB  1 
ATOM   2240 C CG  . GLU A 1 306 ? -62.168 47.099 -118.574 1.00 39.05 ? 301  GLU A CG  1 
ATOM   2241 C CD  . GLU A 1 306 ? -62.683 46.095 -117.523 1.00 44.92 ? 301  GLU A CD  1 
ATOM   2242 O OE1 . GLU A 1 306 ? -61.841 45.507 -116.790 1.00 46.74 ? 301  GLU A OE1 1 
ATOM   2243 O OE2 . GLU A 1 306 ? -63.926 45.896 -117.431 1.00 48.60 ? 301  GLU A OE2 1 
ATOM   2244 N N   . THR A 1 307 ? -61.156 46.447 -121.639 1.00 21.90 ? 302  THR A N   1 
ATOM   2245 C CA  . THR A 1 307 ? -59.810 45.974 -121.997 1.00 19.61 ? 302  THR A CA  1 
ATOM   2246 C C   . THR A 1 307 ? -59.266 46.763 -123.202 1.00 19.86 ? 302  THR A C   1 
ATOM   2247 O O   . THR A 1 307 ? -58.090 47.137 -123.233 1.00 18.94 ? 302  THR A O   1 
ATOM   2248 C CB  . THR A 1 307 ? -59.804 44.474 -122.383 1.00 18.05 ? 302  THR A CB  1 
ATOM   2249 O OG1 . THR A 1 307 ? -60.301 43.687 -121.300 1.00 15.70 ? 302  THR A OG1 1 
ATOM   2250 C CG2 . THR A 1 307 ? -58.393 44.022 -122.717 1.00 15.02 ? 302  THR A CG2 1 
ATOM   2251 N N   . ALA A 1 308 ? -60.120 46.991 -124.199 1.00 18.62 ? 303  ALA A N   1 
ATOM   2252 C CA  . ALA A 1 308 ? -59.703 47.737 -125.370 1.00 19.25 ? 303  ALA A CA  1 
ATOM   2253 C C   . ALA A 1 308 ? -59.243 49.132 -124.929 1.00 20.67 ? 303  ALA A C   1 
ATOM   2254 O O   . ALA A 1 308 ? -58.236 49.644 -125.443 1.00 21.01 ? 303  ALA A O   1 
ATOM   2255 C CB  . ALA A 1 308 ? -60.848 47.832 -126.376 1.00 17.92 ? 303  ALA A CB  1 
ATOM   2256 N N   . ARG A 1 309 ? -59.981 49.741 -123.991 1.00 21.92 ? 304  ARG A N   1 
ATOM   2257 C CA  . ARG A 1 309 ? -59.650 51.070 -123.441 1.00 22.88 ? 304  ARG A CA  1 
ATOM   2258 C C   . ARG A 1 309 ? -58.226 51.014 -122.816 1.00 22.17 ? 304  ARG A C   1 
ATOM   2259 O O   . ARG A 1 309 ? -57.414 51.928 -122.972 1.00 21.30 ? 304  ARG A O   1 
ATOM   2260 C CB  . ARG A 1 309 ? -60.683 51.454 -122.379 1.00 25.63 ? 304  ARG A CB  1 
ATOM   2261 C CG  . ARG A 1 309 ? -61.040 52.939 -122.302 1.00 31.33 ? 304  ARG A CG  1 
ATOM   2262 C CD  . ARG A 1 309 ? -61.652 53.303 -120.936 1.00 36.94 ? 304  ARG A CD  1 
ATOM   2263 N NE  . ARG A 1 309 ? -62.809 52.470 -120.582 1.00 43.99 ? 304  ARG A NE  1 
ATOM   2264 C CZ  . ARG A 1 309 ? -63.081 52.024 -119.347 1.00 46.77 ? 304  ARG A CZ  1 
ATOM   2265 N NH1 . ARG A 1 309 ? -62.266 52.335 -118.344 1.00 47.87 ? 304  ARG A NH1 1 
ATOM   2266 N NH2 . ARG A 1 309 ? -64.169 51.269 -119.109 1.00 46.56 ? 304  ARG A NH2 1 
ATOM   2267 N N   . GLU A 1 310 ? -57.934 49.923 -122.118 1.00 21.82 ? 305  GLU A N   1 
ATOM   2268 C CA  . GLU A 1 310 ? -56.630 49.698 -121.517 1.00 20.67 ? 305  GLU A CA  1 
ATOM   2269 C C   . GLU A 1 310 ? -55.567 49.596 -122.590 1.00 20.26 ? 305  GLU A C   1 
ATOM   2270 O O   . GLU A 1 310 ? -54.485 50.179 -122.468 1.00 19.20 ? 305  GLU A O   1 
ATOM   2271 C CB  . GLU A 1 310 ? -56.664 48.418 -120.714 1.00 21.17 ? 305  GLU A CB  1 
ATOM   2272 C CG  . GLU A 1 310 ? -57.229 48.657 -119.363 1.00 27.50 ? 305  GLU A CG  1 
ATOM   2273 C CD  . GLU A 1 310 ? -56.170 49.111 -118.365 1.00 31.47 ? 305  GLU A CD  1 
ATOM   2274 O OE1 . GLU A 1 310 ? -55.235 49.861 -118.759 1.00 32.09 ? 305  GLU A OE1 1 
ATOM   2275 O OE2 . GLU A 1 310 ? -56.280 48.713 -117.174 1.00 35.16 ? 305  GLU A OE2 1 
ATOM   2276 N N   . LEU A 1 311 ? -55.873 48.847 -123.646 1.00 20.05 ? 306  LEU A N   1 
ATOM   2277 C CA  . LEU A 1 311 ? -54.935 48.697 -124.742 1.00 19.70 ? 306  LEU A CA  1 
ATOM   2278 C C   . LEU A 1 311 ? -54.658 50.070 -125.333 1.00 21.12 ? 306  LEU A C   1 
ATOM   2279 O O   . LEU A 1 311 ? -53.499 50.427 -125.562 1.00 22.63 ? 306  LEU A O   1 
ATOM   2280 C CB  . LEU A 1 311 ? -55.492 47.769 -125.816 1.00 17.30 ? 306  LEU A CB  1 
ATOM   2281 C CG  . LEU A 1 311 ? -55.782 46.321 -125.411 1.00 16.37 ? 306  LEU A CG  1 
ATOM   2282 C CD1 . LEU A 1 311 ? -56.164 45.545 -126.669 1.00 14.94 ? 306  LEU A CD1 1 
ATOM   2283 C CD2 . LEU A 1 311 ? -54.579 45.685 -124.740 1.00 13.85 ? 306  LEU A CD2 1 
ATOM   2284 N N   . TYR A 1 312 ? -55.714 50.842 -125.573 1.00 20.96 ? 307  TYR A N   1 
ATOM   2285 C CA  . TYR A 1 312 ? -55.557 52.186 -126.125 1.00 21.28 ? 307  TYR A CA  1 
ATOM   2286 C C   . TYR A 1 312 ? -54.550 52.974 -125.279 1.00 21.39 ? 307  TYR A C   1 
ATOM   2287 O O   . TYR A 1 312 ? -53.621 53.604 -125.802 1.00 20.86 ? 307  TYR A O   1 
ATOM   2288 C CB  . TYR A 1 312 ? -56.902 52.937 -126.135 1.00 21.78 ? 307  TYR A CB  1 
ATOM   2289 C CG  . TYR A 1 312 ? -56.788 54.378 -126.603 1.00 22.01 ? 307  TYR A CG  1 
ATOM   2290 C CD1 . TYR A 1 312 ? -56.531 54.676 -127.944 1.00 22.76 ? 307  TYR A CD1 1 
ATOM   2291 C CD2 . TYR A 1 312 ? -56.893 55.444 -125.702 1.00 20.29 ? 307  TYR A CD2 1 
ATOM   2292 C CE1 . TYR A 1 312 ? -56.382 56.005 -128.374 1.00 22.64 ? 307  TYR A CE1 1 
ATOM   2293 C CE2 . TYR A 1 312 ? -56.747 56.767 -126.118 1.00 20.26 ? 307  TYR A CE2 1 
ATOM   2294 C CZ  . TYR A 1 312 ? -56.496 57.044 -127.456 1.00 22.34 ? 307  TYR A CZ  1 
ATOM   2295 O OH  . TYR A 1 312 ? -56.400 58.348 -127.905 1.00 20.77 ? 307  TYR A OH  1 
ATOM   2296 N N   . SER A 1 313 ? -54.740 52.938 -123.968 1.00 21.10 ? 308  SER A N   1 
ATOM   2297 C CA  . SER A 1 313 ? -53.847 53.654 -123.082 1.00 21.79 ? 308  SER A CA  1 
ATOM   2298 C C   . SER A 1 313 ? -52.411 53.162 -123.169 1.00 22.09 ? 308  SER A C   1 
ATOM   2299 O O   . SER A 1 313 ? -51.485 53.974 -123.257 1.00 21.86 ? 308  SER A O   1 
ATOM   2300 C CB  . SER A 1 313 ? -54.317 53.553 -121.641 1.00 23.18 ? 308  SER A CB  1 
ATOM   2301 O OG  . SER A 1 313 ? -53.361 54.181 -120.813 1.00 24.36 ? 308  SER A OG  1 
ATOM   2302 N N   . ILE A 1 314 ? -52.221 51.841 -123.130 1.00 21.29 ? 309  ILE A N   1 
ATOM   2303 C CA  . ILE A 1 314 ? -50.880 51.270 -123.239 1.00 20.86 ? 309  ILE A CA  1 
ATOM   2304 C C   . ILE A 1 314 ? -50.230 51.679 -124.584 1.00 22.51 ? 309  ILE A C   1 
ATOM   2305 O O   . ILE A 1 314 ? -49.086 52.159 -124.616 1.00 22.24 ? 309  ILE A O   1 
ATOM   2306 C CB  . ILE A 1 314 ? -50.934 49.728 -123.140 1.00 20.17 ? 309  ILE A CB  1 
ATOM   2307 C CG1 . ILE A 1 314 ? -51.251 49.313 -121.711 1.00 19.24 ? 309  ILE A CG1 1 
ATOM   2308 C CG2 . ILE A 1 314 ? -49.613 49.106 -123.607 1.00 18.41 ? 309  ILE A CG2 1 
ATOM   2309 C CD1 . ILE A 1 314 ? -51.744 47.903 -121.616 1.00 19.92 ? 309  ILE A CD1 1 
ATOM   2310 N N   . LEU A 1 315 ? -50.969 51.506 -125.682 1.00 22.84 ? 310  LEU A N   1 
ATOM   2311 C CA  . LEU A 1 315 ? -50.461 51.836 -127.008 1.00 24.40 ? 310  LEU A CA  1 
ATOM   2312 C C   . LEU A 1 315 ? -50.176 53.312 -127.215 1.00 26.71 ? 310  LEU A C   1 
ATOM   2313 O O   . LEU A 1 315 ? -49.203 53.687 -127.877 1.00 26.33 ? 310  LEU A O   1 
ATOM   2314 C CB  . LEU A 1 315 ? -51.430 51.365 -128.086 1.00 22.36 ? 310  LEU A CB  1 
ATOM   2315 C CG  . LEU A 1 315 ? -51.508 49.859 -128.267 1.00 21.34 ? 310  LEU A CG  1 
ATOM   2316 C CD1 . LEU A 1 315 ? -52.566 49.513 -129.297 1.00 20.53 ? 310  LEU A CD1 1 
ATOM   2317 C CD2 . LEU A 1 315 ? -50.168 49.358 -128.706 1.00 20.04 ? 310  LEU A CD2 1 
ATOM   2318 N N   . GLN A 1 316 ? -51.012 54.169 -126.656 1.00 28.58 ? 311  GLN A N   1 
ATOM   2319 C CA  . GLN A 1 316 ? -50.762 55.575 -126.870 1.00 31.90 ? 311  GLN A CA  1 
ATOM   2320 C C   . GLN A 1 316 ? -49.558 56.081 -126.090 1.00 32.25 ? 311  GLN A C   1 
ATOM   2321 O O   . GLN A 1 316 ? -48.858 56.977 -126.554 1.00 33.78 ? 311  GLN A O   1 
ATOM   2322 C CB  . GLN A 1 316 ? -51.985 56.387 -126.526 1.00 32.79 ? 311  GLN A CB  1 
ATOM   2323 C CG  . GLN A 1 316 ? -52.263 56.412 -125.090 1.00 36.77 ? 311  GLN A CG  1 
ATOM   2324 C CD  . GLN A 1 316 ? -52.489 57.804 -124.633 1.00 39.22 ? 311  GLN A CD  1 
ATOM   2325 O OE1 . GLN A 1 316 ? -51.536 58.546 -124.321 1.00 39.55 ? 311  GLN A OE1 1 
ATOM   2326 N NE2 . GLN A 1 316 ? -53.759 58.202 -124.615 1.00 40.71 ? 311  GLN A NE2 1 
ATOM   2327 N N   . HIS A 1 317 ? -49.307 55.515 -124.915 1.00 32.46 ? 312  HIS A N   1 
ATOM   2328 C CA  . HIS A 1 317 ? -48.159 55.948 -124.131 1.00 31.68 ? 312  HIS A CA  1 
ATOM   2329 C C   . HIS A 1 317 ? -46.886 55.554 -124.839 1.00 31.00 ? 312  HIS A C   1 
ATOM   2330 O O   . HIS A 1 317 ? -45.798 55.762 -124.321 1.00 31.39 ? 312  HIS A O   1 
ATOM   2331 C CB  . HIS A 1 317 ? -48.170 55.335 -122.733 1.00 32.53 ? 312  HIS A CB  1 
ATOM   2332 C CG  . HIS A 1 317 ? -49.181 55.949 -121.822 1.00 34.39 ? 312  HIS A CG  1 
ATOM   2333 N ND1 . HIS A 1 317 ? -49.314 57.312 -121.677 1.00 35.47 ? 312  HIS A ND1 1 
ATOM   2334 C CD2 . HIS A 1 317 ? -50.112 55.393 -121.011 1.00 35.86 ? 312  HIS A CD2 1 
ATOM   2335 C CE1 . HIS A 1 317 ? -50.286 57.571 -120.819 1.00 35.92 ? 312  HIS A CE1 1 
ATOM   2336 N NE2 . HIS A 1 317 ? -50.786 56.423 -120.400 1.00 36.19 ? 312  HIS A NE2 1 
ATOM   2337 N N   . LYS A 1 318 ? -47.020 54.980 -126.025 1.00 30.26 ? 313  LYS A N   1 
ATOM   2338 C CA  . LYS A 1 318 ? -45.848 54.586 -126.781 1.00 30.92 ? 313  LYS A CA  1 
ATOM   2339 C C   . LYS A 1 318 ? -46.069 54.934 -128.229 1.00 31.05 ? 313  LYS A C   1 
ATOM   2340 O O   . LYS A 1 318 ? -45.382 54.436 -129.120 1.00 31.84 ? 313  LYS A O   1 
ATOM   2341 C CB  . LYS A 1 318 ? -45.587 53.097 -126.602 1.00 31.35 ? 313  LYS A CB  1 
ATOM   2342 C CG  . LYS A 1 318 ? -45.345 52.773 -125.147 1.00 35.87 ? 313  LYS A CG  1 
ATOM   2343 C CD  . LYS A 1 318 ? -44.644 51.461 -124.927 1.00 39.75 ? 313  LYS A CD  1 
ATOM   2344 C CE  . LYS A 1 318 ? -43.785 51.528 -123.658 1.00 42.81 ? 313  LYS A CE  1 
ATOM   2345 N NZ  . LYS A 1 318 ? -42.669 52.532 -123.803 1.00 44.00 ? 313  LYS A NZ  1 
ATOM   2346 N N   . GLY A 1 319 ? -47.045 55.809 -128.447 1.00 30.93 ? 314  GLY A N   1 
ATOM   2347 C CA  . GLY A 1 319 ? -47.386 56.247 -129.785 1.00 30.48 ? 314  GLY A CA  1 
ATOM   2348 C C   . GLY A 1 319 ? -47.463 55.130 -130.803 1.00 30.14 ? 314  GLY A C   1 
ATOM   2349 O O   . GLY A 1 319 ? -47.024 55.285 -131.940 1.00 31.14 ? 314  GLY A O   1 
ATOM   2350 N N   . LEU A 1 320 ? -48.030 54.005 -130.400 1.00 29.91 ? 315  LEU A N   1 
ATOM   2351 C CA  . LEU A 1 320 ? -48.152 52.875 -131.292 1.00 30.92 ? 315  LEU A CA  1 
ATOM   2352 C C   . LEU A 1 320 ? -49.601 52.524 -131.611 1.00 31.40 ? 315  LEU A C   1 
ATOM   2353 O O   . LEU A 1 320 ? -49.878 51.407 -132.054 1.00 32.41 ? 315  LEU A O   1 
ATOM   2354 C CB  . LEU A 1 320 ? -47.466 51.665 -130.675 1.00 31.55 ? 315  LEU A CB  1 
ATOM   2355 C CG  . LEU A 1 320 ? -45.944 51.717 -130.628 1.00 32.52 ? 315  LEU A CG  1 
ATOM   2356 C CD1 . LEU A 1 320 ? -45.415 50.514 -129.858 1.00 31.49 ? 315  LEU A CD1 1 
ATOM   2357 C CD2 . LEU A 1 320 ? -45.406 51.720 -132.056 1.00 33.13 ? 315  LEU A CD2 1 
ATOM   2358 N N   . VAL A 1 321 ? -50.513 53.475 -131.407 1.00 30.54 ? 316  VAL A N   1 
ATOM   2359 C CA  . VAL A 1 321 ? -51.932 53.241 -131.646 1.00 29.25 ? 316  VAL A CA  1 
ATOM   2360 C C   . VAL A 1 321 ? -52.208 52.833 -133.072 1.00 29.44 ? 316  VAL A C   1 
ATOM   2361 O O   . VAL A 1 321 ? -53.029 51.960 -133.329 1.00 30.04 ? 316  VAL A O   1 
ATOM   2362 C CB  . VAL A 1 321 ? -52.776 54.489 -131.344 1.00 29.16 ? 316  VAL A CB  1 
ATOM   2363 C CG1 . VAL A 1 321 ? -54.268 54.139 -131.420 1.00 28.18 ? 316  VAL A CG1 1 
ATOM   2364 C CG2 . VAL A 1 321 ? -52.410 55.046 -129.980 1.00 28.79 ? 316  VAL A CG2 1 
ATOM   2365 N N   . ASP A 1 322 ? -51.521 53.472 -134.003 1.00 30.53 ? 317  ASP A N   1 
ATOM   2366 C CA  . ASP A 1 322 ? -51.713 53.178 -135.411 1.00 32.83 ? 317  ASP A CA  1 
ATOM   2367 C C   . ASP A 1 322 ? -51.297 51.753 -135.805 1.00 32.07 ? 317  ASP A C   1 
ATOM   2368 O O   . ASP A 1 322 ? -51.612 51.300 -136.909 1.00 31.98 ? 317  ASP A O   1 
ATOM   2369 C CB  . ASP A 1 322 ? -50.958 54.213 -136.265 1.00 36.68 ? 317  ASP A CB  1 
ATOM   2370 C CG  . ASP A 1 322 ? -49.420 54.208 -136.022 1.00 41.19 ? 317  ASP A CG  1 
ATOM   2371 O OD1 . ASP A 1 322 ? -48.719 54.888 -136.812 1.00 43.64 ? 317  ASP A OD1 1 
ATOM   2372 O OD2 . ASP A 1 322 ? -48.909 53.555 -135.067 1.00 41.09 ? 317  ASP A OD2 1 
ATOM   2373 N N   . LYS A 1 323 ? -50.616 51.057 -134.892 1.00 30.57 ? 318  LYS A N   1 
ATOM   2374 C CA  . LYS A 1 323 ? -50.126 49.698 -135.116 1.00 29.25 ? 318  LYS A CA  1 
ATOM   2375 C C   . LYS A 1 323 ? -51.082 48.513 -134.868 1.00 27.23 ? 318  LYS A C   1 
ATOM   2376 O O   . LYS A 1 323 ? -50.820 47.400 -135.305 1.00 26.52 ? 318  LYS A O   1 
ATOM   2377 C CB  . LYS A 1 323 ? -48.862 49.504 -134.289 1.00 31.60 ? 318  LYS A CB  1 
ATOM   2378 C CG  . LYS A 1 323 ? -47.719 50.349 -134.774 1.00 36.34 ? 318  LYS A CG  1 
ATOM   2379 C CD  . LYS A 1 323 ? -47.430 50.005 -136.214 1.00 40.35 ? 318  LYS A CD  1 
ATOM   2380 C CE  . LYS A 1 323 ? -46.547 51.033 -136.876 1.00 44.16 ? 318  LYS A CE  1 
ATOM   2381 N NZ  . LYS A 1 323 ? -46.391 50.737 -138.338 1.00 46.95 ? 318  LYS A NZ  1 
ATOM   2382 N N   . PHE A 1 324 ? -52.177 48.742 -134.160 1.00 24.73 ? 319  PHE A N   1 
ATOM   2383 C CA  . PHE A 1 324 ? -53.134 47.681 -133.884 1.00 22.22 ? 319  PHE A CA  1 
ATOM   2384 C C   . PHE A 1 324 ? -54.554 48.078 -134.269 1.00 20.50 ? 319  PHE A C   1 
ATOM   2385 O O   . PHE A 1 324 ? -55.423 48.284 -133.414 1.00 20.39 ? 319  PHE A O   1 
ATOM   2386 C CB  . PHE A 1 324 ? -53.054 47.281 -132.416 1.00 21.63 ? 319  PHE A CB  1 
ATOM   2387 C CG  . PHE A 1 324 ? -51.729 46.687 -132.044 1.00 21.81 ? 319  PHE A CG  1 
ATOM   2388 C CD1 . PHE A 1 324 ? -50.656 47.504 -131.701 1.00 21.14 ? 319  PHE A CD1 1 
ATOM   2389 C CD2 . PHE A 1 324 ? -51.541 45.309 -132.080 1.00 21.08 ? 319  PHE A CD2 1 
ATOM   2390 C CE1 . PHE A 1 324 ? -49.423 46.957 -131.398 1.00 20.84 ? 319  PHE A CE1 1 
ATOM   2391 C CE2 . PHE A 1 324 ? -50.311 44.745 -131.778 1.00 20.75 ? 319  PHE A CE2 1 
ATOM   2392 C CZ  . PHE A 1 324 ? -49.244 45.568 -131.436 1.00 21.47 ? 319  PHE A CZ  1 
ATOM   2393 N N   . PRO A 1 325 ? -54.793 48.172 -135.586 1.00 19.03 ? 320  PRO A N   1 
ATOM   2394 C CA  . PRO A 1 325 ? -56.010 48.524 -136.332 1.00 17.63 ? 320  PRO A CA  1 
ATOM   2395 C C   . PRO A 1 325 ? -57.284 47.883 -135.786 1.00 17.49 ? 320  PRO A C   1 
ATOM   2396 O O   . PRO A 1 325 ? -58.236 48.575 -135.443 1.00 16.64 ? 320  PRO A O   1 
ATOM   2397 C CB  . PRO A 1 325 ? -55.720 48.014 -137.739 1.00 17.53 ? 320  PRO A CB  1 
ATOM   2398 C CG  . PRO A 1 325 ? -54.243 48.035 -137.826 1.00 18.96 ? 320  PRO A CG  1 
ATOM   2399 C CD  . PRO A 1 325 ? -53.767 47.609 -136.486 1.00 17.59 ? 320  PRO A CD  1 
ATOM   2400 N N   . LEU A 1 326 ? -57.293 46.553 -135.730 1.00 16.75 ? 321  LEU A N   1 
ATOM   2401 C CA  . LEU A 1 326 ? -58.447 45.801 -135.262 1.00 15.98 ? 321  LEU A CA  1 
ATOM   2402 C C   . LEU A 1 326 ? -58.734 46.139 -133.798 1.00 16.17 ? 321  LEU A C   1 
ATOM   2403 O O   . LEU A 1 326 ? -59.881 46.430 -133.450 1.00 15.93 ? 321  LEU A O   1 
ATOM   2404 C CB  . LEU A 1 326 ? -58.183 44.301 -135.461 1.00 16.54 ? 321  LEU A CB  1 
ATOM   2405 C CG  . LEU A 1 326 ? -59.122 43.115 -135.142 1.00 16.24 ? 321  LEU A CG  1 
ATOM   2406 C CD1 . LEU A 1 326 ? -60.143 43.433 -134.053 1.00 13.59 ? 321  LEU A CD1 1 
ATOM   2407 C CD2 . LEU A 1 326 ? -59.793 42.695 -136.400 1.00 16.24 ? 321  LEU A CD2 1 
ATOM   2408 N N   . PHE A 1 327 ? -57.707 46.099 -132.943 1.00 16.13 ? 322  PHE A N   1 
ATOM   2409 C CA  . PHE A 1 327 ? -57.892 46.434 -131.519 1.00 16.75 ? 322  PHE A CA  1 
ATOM   2410 C C   . PHE A 1 327 ? -58.442 47.854 -131.413 1.00 15.87 ? 322  PHE A C   1 
ATOM   2411 O O   . PHE A 1 327 ? -59.472 48.111 -130.788 1.00 15.12 ? 322  PHE A O   1 
ATOM   2412 C CB  . PHE A 1 327 ? -56.565 46.398 -130.726 1.00 16.91 ? 322  PHE A CB  1 
ATOM   2413 C CG  . PHE A 1 327 ? -56.057 45.030 -130.408 1.00 16.29 ? 322  PHE A CG  1 
ATOM   2414 C CD1 . PHE A 1 327 ? -54.722 44.848 -130.066 1.00 16.63 ? 322  PHE A CD1 1 
ATOM   2415 C CD2 . PHE A 1 327 ? -56.874 43.914 -130.508 1.00 17.96 ? 322  PHE A CD2 1 
ATOM   2416 C CE1 . PHE A 1 327 ? -54.199 43.562 -129.842 1.00 16.93 ? 322  PHE A CE1 1 
ATOM   2417 C CE2 . PHE A 1 327 ? -56.360 42.615 -130.283 1.00 18.51 ? 322  PHE A CE2 1 
ATOM   2418 C CZ  . PHE A 1 327 ? -55.022 42.444 -129.955 1.00 17.91 ? 322  PHE A CZ  1 
ATOM   2419 N N   . MET A 1 328 ? -57.734 48.780 -132.036 1.00 15.50 ? 323  MET A N   1 
ATOM   2420 C CA  . MET A 1 328 ? -58.151 50.156 -131.983 1.00 16.87 ? 323  MET A CA  1 
ATOM   2421 C C   . MET A 1 328 ? -59.530 50.416 -132.609 1.00 17.47 ? 323  MET A C   1 
ATOM   2422 O O   . MET A 1 328 ? -60.261 51.304 -132.169 1.00 19.10 ? 323  MET A O   1 
ATOM   2423 C CB  . MET A 1 328 ? -57.049 51.012 -132.586 1.00 16.80 ? 323  MET A CB  1 
ATOM   2424 C CG  . MET A 1 328 ? -55.784 50.994 -131.699 1.00 17.48 ? 323  MET A CG  1 
ATOM   2425 S SD  . MET A 1 328 ? -56.150 51.458 -129.950 1.00 19.59 ? 323  MET A SD  1 
ATOM   2426 C CE  . MET A 1 328 ? -56.652 49.902 -129.236 1.00 17.02 ? 323  MET A CE  1 
ATOM   2427 N N   . ALA A 1 329 ? -59.905 49.620 -133.603 1.00 16.91 ? 324  ALA A N   1 
ATOM   2428 C CA  . ALA A 1 329 ? -61.203 49.772 -134.252 1.00 15.84 ? 324  ALA A CA  1 
ATOM   2429 C C   . ALA A 1 329 ? -62.303 49.398 -133.251 1.00 15.24 ? 324  ALA A C   1 
ATOM   2430 O O   . ALA A 1 329 ? -63.411 49.961 -133.263 1.00 13.28 ? 324  ALA A O   1 
ATOM   2431 C CB  . ALA A 1 329 ? -61.280 48.869 -135.492 1.00 16.24 ? 324  ALA A CB  1 
ATOM   2432 N N   . VAL A 1 330 ? -61.998 48.438 -132.387 1.00 13.98 ? 325  VAL A N   1 
ATOM   2433 C CA  . VAL A 1 330 ? -62.966 48.030 -131.389 1.00 13.64 ? 325  VAL A CA  1 
ATOM   2434 C C   . VAL A 1 330 ? -63.102 49.180 -130.387 1.00 15.12 ? 325  VAL A C   1 
ATOM   2435 O O   . VAL A 1 330 ? -64.214 49.576 -130.001 1.00 14.36 ? 325  VAL A O   1 
ATOM   2436 C CB  . VAL A 1 330 ? -62.503 46.746 -130.673 1.00 12.52 ? 325  VAL A CB  1 
ATOM   2437 C CG1 . VAL A 1 330 ? -63.426 46.426 -129.532 1.00 9.76  ? 325  VAL A CG1 1 
ATOM   2438 C CG2 . VAL A 1 330 ? -62.480 45.582 -131.672 1.00 12.80 ? 325  VAL A CG2 1 
ATOM   2439 N N   . TYR A 1 331 ? -61.957 49.737 -129.996 1.00 15.33 ? 326  TYR A N   1 
ATOM   2440 C CA  . TYR A 1 331 ? -61.947 50.824 -129.042 1.00 14.58 ? 326  TYR A CA  1 
ATOM   2441 C C   . TYR A 1 331 ? -62.693 52.034 -129.563 1.00 15.33 ? 326  TYR A C   1 
ATOM   2442 O O   . TYR A 1 331 ? -63.491 52.628 -128.833 1.00 14.67 ? 326  TYR A O   1 
ATOM   2443 C CB  . TYR A 1 331 ? -60.515 51.222 -128.690 1.00 16.08 ? 326  TYR A CB  1 
ATOM   2444 C CG  . TYR A 1 331 ? -60.455 52.529 -127.955 1.00 17.28 ? 326  TYR A CG  1 
ATOM   2445 C CD1 . TYR A 1 331 ? -60.920 52.626 -126.648 1.00 20.13 ? 326  TYR A CD1 1 
ATOM   2446 C CD2 . TYR A 1 331 ? -60.029 53.698 -128.594 1.00 16.31 ? 326  TYR A CD2 1 
ATOM   2447 C CE1 . TYR A 1 331 ? -60.973 53.866 -125.979 1.00 19.24 ? 326  TYR A CE1 1 
ATOM   2448 C CE2 . TYR A 1 331 ? -60.082 54.923 -127.949 1.00 17.93 ? 326  TYR A CE2 1 
ATOM   2449 C CZ  . TYR A 1 331 ? -60.559 55.001 -126.634 1.00 18.97 ? 326  TYR A CZ  1 
ATOM   2450 O OH  . TYR A 1 331 ? -60.633 56.209 -125.985 1.00 18.34 ? 326  TYR A OH  1 
ATOM   2451 N N   . LYS A 1 332 ? -62.447 52.410 -130.817 1.00 14.97 ? 327  LYS A N   1 
ATOM   2452 C CA  . LYS A 1 332 ? -63.115 53.591 -131.352 1.00 16.76 ? 327  LYS A CA  1 
ATOM   2453 C C   . LYS A 1 332 ? -64.628 53.412 -131.516 1.00 17.11 ? 327  LYS A C   1 
ATOM   2454 O O   . LYS A 1 332 ? -65.407 54.348 -131.276 1.00 16.74 ? 327  LYS A O   1 
ATOM   2455 C CB  . LYS A 1 332 ? -62.471 54.032 -132.661 1.00 17.35 ? 327  LYS A CB  1 
ATOM   2456 C CG  . LYS A 1 332 ? -60.993 54.268 -132.540 1.00 20.54 ? 327  LYS A CG  1 
ATOM   2457 C CD  . LYS A 1 332 ? -60.570 55.376 -133.476 1.00 26.88 ? 327  LYS A CD  1 
ATOM   2458 C CE  . LYS A 1 332 ? -59.074 55.381 -133.755 1.00 28.87 ? 327  LYS A CE  1 
ATOM   2459 N NZ  . LYS A 1 332 ? -58.690 54.278 -134.704 1.00 32.93 ? 327  LYS A NZ  1 
ATOM   2460 N N   . VAL A 1 333 ? -65.065 52.218 -131.896 1.00 16.32 ? 328  VAL A N   1 
ATOM   2461 C CA  . VAL A 1 333 ? -66.494 52.021 -132.024 1.00 16.18 ? 328  VAL A CA  1 
ATOM   2462 C C   . VAL A 1 333 ? -67.185 52.048 -130.655 1.00 16.82 ? 328  VAL A C   1 
ATOM   2463 O O   . VAL A 1 333 ? -68.274 52.592 -130.510 1.00 18.32 ? 328  VAL A O   1 
ATOM   2464 C CB  . VAL A 1 333 ? -66.804 50.720 -132.742 1.00 14.68 ? 328  VAL A CB  1 
ATOM   2465 C CG1 . VAL A 1 333 ? -68.281 50.408 -132.617 1.00 13.60 ? 328  VAL A CG1 1 
ATOM   2466 C CG2 . VAL A 1 333 ? -66.415 50.864 -134.216 1.00 12.92 ? 328  VAL A CG2 1 
ATOM   2467 N N   . CYS A 1 334 ? -66.539 51.488 -129.645 1.00 16.62 ? 329  CYS A N   1 
ATOM   2468 C CA  . CYS A 1 334 ? -67.114 51.463 -128.307 1.00 16.98 ? 329  CYS A CA  1 
ATOM   2469 C C   . CYS A 1 334 ? -67.078 52.796 -127.586 1.00 17.65 ? 329  CYS A C   1 
ATOM   2470 O O   . CYS A 1 334 ? -68.010 53.155 -126.867 1.00 16.05 ? 329  CYS A O   1 
ATOM   2471 C CB  . CYS A 1 334 ? -66.366 50.476 -127.426 1.00 15.96 ? 329  CYS A CB  1 
ATOM   2472 S SG  . CYS A 1 334 ? -66.576 48.785 -127.833 1.00 20.29 ? 329  CYS A SG  1 
ATOM   2473 N N   . TYR A 1 335 ? -65.989 53.531 -127.767 1.00 19.24 ? 330  TYR A N   1 
ATOM   2474 C CA  . TYR A 1 335 ? -65.841 54.774 -127.046 1.00 19.91 ? 330  TYR A CA  1 
ATOM   2475 C C   . TYR A 1 335 ? -65.781 56.082 -127.787 1.00 20.26 ? 330  TYR A C   1 
ATOM   2476 O O   . TYR A 1 335 ? -66.165 57.105 -127.234 1.00 22.42 ? 330  TYR A O   1 
ATOM   2477 C CB  . TYR A 1 335 ? -64.631 54.660 -126.140 1.00 20.68 ? 330  TYR A CB  1 
ATOM   2478 C CG  . TYR A 1 335 ? -64.764 53.537 -125.146 1.00 20.82 ? 330  TYR A CG  1 
ATOM   2479 C CD1 . TYR A 1 335 ? -64.222 52.276 -125.383 1.00 20.98 ? 330  TYR A CD1 1 
ATOM   2480 C CD2 . TYR A 1 335 ? -65.409 53.750 -123.952 1.00 23.19 ? 330  TYR A CD2 1 
ATOM   2481 C CE1 . TYR A 1 335 ? -64.323 51.258 -124.426 1.00 22.76 ? 330  TYR A CE1 1 
ATOM   2482 C CE2 . TYR A 1 335 ? -65.513 52.756 -122.997 1.00 24.57 ? 330  TYR A CE2 1 
ATOM   2483 C CZ  . TYR A 1 335 ? -64.975 51.519 -123.225 1.00 24.12 ? 330  TYR A CZ  1 
ATOM   2484 O OH  . TYR A 1 335 ? -65.107 50.588 -122.219 1.00 24.28 ? 330  TYR A OH  1 
ATOM   2485 N N   . GLU A 1 336 ? -65.319 56.081 -129.025 1.00 20.27 ? 331  GLU A N   1 
ATOM   2486 C CA  . GLU A 1 336 ? -65.226 57.344 -129.734 1.00 20.40 ? 331  GLU A CA  1 
ATOM   2487 C C   . GLU A 1 336 ? -66.445 57.716 -130.551 1.00 20.83 ? 331  GLU A C   1 
ATOM   2488 O O   . GLU A 1 336 ? -66.595 58.869 -130.928 1.00 21.30 ? 331  GLU A O   1 
ATOM   2489 C CB  . GLU A 1 336 ? -63.993 57.356 -130.630 1.00 20.07 ? 331  GLU A CB  1 
ATOM   2490 C CG  . GLU A 1 336 ? -62.681 57.409 -129.878 1.00 19.91 ? 331  GLU A CG  1 
ATOM   2491 C CD  . GLU A 1 336 ? -61.526 57.675 -130.814 1.00 22.44 ? 331  GLU A CD  1 
ATOM   2492 O OE1 . GLU A 1 336 ? -61.815 57.880 -132.016 1.00 22.28 ? 331  GLU A OE1 1 
ATOM   2493 O OE2 . GLU A 1 336 ? -60.346 57.684 -130.361 1.00 22.12 ? 331  GLU A OE2 1 
ATOM   2494 N N   . GLY A 1 337 ? -67.316 56.747 -130.822 1.00 21.26 ? 332  GLY A N   1 
ATOM   2495 C CA  . GLY A 1 337 ? -68.497 57.022 -131.619 1.00 19.54 ? 332  GLY A CA  1 
ATOM   2496 C C   . GLY A 1 337 ? -68.308 56.788 -133.109 1.00 19.35 ? 332  GLY A C   1 
ATOM   2497 O O   . GLY A 1 337 ? -69.054 57.306 -133.935 1.00 19.86 ? 332  GLY A O   1 
ATOM   2498 N N   . GLN A 1 338 ? -67.287 56.025 -133.466 1.00 18.72 ? 333  GLN A N   1 
ATOM   2499 C CA  . GLN A 1 338 ? -67.054 55.691 -134.862 1.00 18.23 ? 333  GLN A CA  1 
ATOM   2500 C C   . GLN A 1 338 ? -68.179 54.739 -135.294 1.00 17.67 ? 333  GLN A C   1 
ATOM   2501 O O   . GLN A 1 338 ? -68.454 53.762 -134.607 1.00 17.78 ? 333  GLN A O   1 
ATOM   2502 C CB  . GLN A 1 338 ? -65.703 54.982 -135.012 1.00 18.36 ? 333  GLN A CB  1 
ATOM   2503 C CG  . GLN A 1 338 ? -65.640 54.147 -136.251 1.00 21.40 ? 333  GLN A CG  1 
ATOM   2504 C CD  . GLN A 1 338 ? -64.254 53.691 -136.631 1.00 22.46 ? 333  GLN A CD  1 
ATOM   2505 O OE1 . GLN A 1 338 ? -63.490 53.214 -135.805 1.00 23.74 ? 333  GLN A OE1 1 
ATOM   2506 N NE2 . GLN A 1 338 ? -63.937 53.808 -137.910 1.00 23.13 ? 333  GLN A NE2 1 
ATOM   2507 N N   . PRO A 1 339 ? -68.853 55.018 -136.418 1.00 17.57 ? 334  PRO A N   1 
ATOM   2508 C CA  . PRO A 1 339 ? -69.940 54.133 -136.878 1.00 17.47 ? 334  PRO A CA  1 
ATOM   2509 C C   . PRO A 1 339 ? -69.457 52.682 -137.001 1.00 17.13 ? 334  PRO A C   1 
ATOM   2510 O O   . PRO A 1 339 ? -68.405 52.404 -137.596 1.00 15.69 ? 334  PRO A O   1 
ATOM   2511 C CB  . PRO A 1 339 ? -70.331 54.724 -138.233 1.00 17.88 ? 334  PRO A CB  1 
ATOM   2512 C CG  . PRO A 1 339 ? -70.005 56.188 -138.070 1.00 18.02 ? 334  PRO A CG  1 
ATOM   2513 C CD  . PRO A 1 339 ? -68.677 56.159 -137.332 1.00 17.97 ? 334  PRO A CD  1 
ATOM   2514 N N   . VAL A 1 340 ? -70.235 51.765 -136.440 1.00 16.26 ? 335  VAL A N   1 
ATOM   2515 C CA  . VAL A 1 340 ? -69.880 50.366 -136.451 1.00 16.50 ? 335  VAL A CA  1 
ATOM   2516 C C   . VAL A 1 340 ? -69.693 49.843 -137.871 1.00 17.16 ? 335  VAL A C   1 
ATOM   2517 O O   . VAL A 1 340 ? -68.819 49.022 -138.138 1.00 16.65 ? 335  VAL A O   1 
ATOM   2518 C CB  . VAL A 1 340 ? -70.952 49.562 -135.701 1.00 17.36 ? 335  VAL A CB  1 
ATOM   2519 C CG1 . VAL A 1 340 ? -72.281 49.690 -136.411 1.00 17.89 ? 335  VAL A CG1 1 
ATOM   2520 C CG2 . VAL A 1 340 ? -70.534 48.109 -135.573 1.00 18.05 ? 335  VAL A CG2 1 
ATOM   2521 N N   . GLY A 1 341 ? -70.514 50.338 -138.788 1.00 17.94 ? 336  GLY A N   1 
ATOM   2522 C CA  . GLY A 1 341 ? -70.426 49.912 -140.172 1.00 18.62 ? 336  GLY A CA  1 
ATOM   2523 C C   . GLY A 1 341 ? -69.059 50.126 -140.781 1.00 19.32 ? 336  GLY A C   1 
ATOM   2524 O O   . GLY A 1 341 ? -68.766 49.620 -141.858 1.00 19.86 ? 336  GLY A O   1 
ATOM   2525 N N   . GLU A 1 342 ? -68.218 50.883 -140.093 1.00 21.20 ? 337  GLU A N   1 
ATOM   2526 C CA  . GLU A 1 342 ? -66.862 51.154 -140.569 1.00 22.38 ? 337  GLU A CA  1 
ATOM   2527 C C   . GLU A 1 342 ? -65.902 50.083 -140.094 1.00 21.27 ? 337  GLU A C   1 
ATOM   2528 O O   . GLU A 1 342 ? -64.726 50.107 -140.441 1.00 19.94 ? 337  GLU A O   1 
ATOM   2529 C CB  . GLU A 1 342 ? -66.365 52.510 -140.070 1.00 24.73 ? 337  GLU A CB  1 
ATOM   2530 C CG  . GLU A 1 342 ? -66.588 53.634 -141.037 1.00 29.98 ? 337  GLU A CG  1 
ATOM   2531 C CD  . GLU A 1 342 ? -66.382 54.990 -140.398 1.00 33.75 ? 337  GLU A CD  1 
ATOM   2532 O OE1 . GLU A 1 342 ? -65.277 55.253 -139.872 1.00 34.22 ? 337  GLU A OE1 1 
ATOM   2533 O OE2 . GLU A 1 342 ? -67.340 55.797 -140.423 1.00 37.83 ? 337  GLU A OE2 1 
ATOM   2534 N N   . PHE A 1 343 ? -66.396 49.143 -139.292 1.00 20.31 ? 338  PHE A N   1 
ATOM   2535 C CA  . PHE A 1 343 ? -65.523 48.093 -138.804 1.00 19.89 ? 338  PHE A CA  1 
ATOM   2536 C C   . PHE A 1 343 ? -64.911 47.289 -139.949 1.00 19.60 ? 338  PHE A C   1 
ATOM   2537 O O   . PHE A 1 343 ? -63.706 47.025 -139.957 1.00 20.73 ? 338  PHE A O   1 
ATOM   2538 C CB  . PHE A 1 343 ? -66.261 47.148 -137.869 1.00 19.30 ? 338  PHE A CB  1 
ATOM   2539 C CG  . PHE A 1 343 ? -65.347 46.257 -137.095 1.00 18.52 ? 338  PHE A CG  1 
ATOM   2540 C CD1 . PHE A 1 343 ? -64.633 46.754 -136.005 1.00 17.76 ? 338  PHE A CD1 1 
ATOM   2541 C CD2 . PHE A 1 343 ? -65.157 44.935 -137.478 1.00 18.35 ? 338  PHE A CD2 1 
ATOM   2542 C CE1 . PHE A 1 343 ? -63.737 45.947 -135.304 1.00 16.95 ? 338  PHE A CE1 1 
ATOM   2543 C CE2 . PHE A 1 343 ? -64.255 44.115 -136.776 1.00 19.51 ? 338  PHE A CE2 1 
ATOM   2544 C CZ  . PHE A 1 343 ? -63.545 44.627 -135.687 1.00 17.13 ? 338  PHE A CZ  1 
ATOM   2545 N N   . ILE A 1 344 ? -65.722 46.914 -140.925 1.00 18.04 ? 339  ILE A N   1 
ATOM   2546 C CA  . ILE A 1 344 ? -65.192 46.144 -142.025 1.00 19.61 ? 339  ILE A CA  1 
ATOM   2547 C C   . ILE A 1 344 ? -63.967 46.777 -142.684 1.00 21.62 ? 339  ILE A C   1 
ATOM   2548 O O   . ILE A 1 344 ? -63.061 46.075 -143.138 1.00 21.82 ? 339  ILE A O   1 
ATOM   2549 C CB  . ILE A 1 344 ? -66.256 45.895 -143.084 1.00 17.94 ? 339  ILE A CB  1 
ATOM   2550 C CG1 . ILE A 1 344 ? -67.438 45.151 -142.454 1.00 17.00 ? 339  ILE A CG1 1 
ATOM   2551 C CG2 . ILE A 1 344 ? -65.659 45.111 -144.243 1.00 16.67 ? 339  ILE A CG2 1 
ATOM   2552 C CD1 . ILE A 1 344 ? -67.051 43.922 -141.666 1.00 15.18 ? 339  ILE A CD1 1 
ATOM   2553 N N   . HIS A 1 345 ? -63.921 48.100 -142.734 1.00 23.45 ? 340  HIS A N   1 
ATOM   2554 C CA  . HIS A 1 345 ? -62.781 48.751 -143.350 1.00 26.03 ? 340  HIS A CA  1 
ATOM   2555 C C   . HIS A 1 345 ? -61.457 48.377 -142.659 1.00 26.09 ? 340  HIS A C   1 
ATOM   2556 O O   . HIS A 1 345 ? -60.433 48.222 -143.334 1.00 26.31 ? 340  HIS A O   1 
ATOM   2557 C CB  . HIS A 1 345 ? -62.991 50.270 -143.376 1.00 29.60 ? 340  HIS A CB  1 
ATOM   2558 C CG  . HIS A 1 345 ? -61.875 51.039 -144.026 1.00 35.34 ? 340  HIS A CG  1 
ATOM   2559 N ND1 . HIS A 1 345 ? -60.682 51.319 -143.383 1.00 38.14 ? 340  HIS A ND1 1 
ATOM   2560 C CD2 . HIS A 1 345 ? -61.777 51.603 -145.255 1.00 36.07 ? 340  HIS A CD2 1 
ATOM   2561 C CE1 . HIS A 1 345 ? -59.901 52.022 -144.187 1.00 36.46 ? 340  HIS A CE1 1 
ATOM   2562 N NE2 . HIS A 1 345 ? -60.541 52.207 -145.328 1.00 37.59 ? 340  HIS A NE2 1 
ATOM   2563 N N   . CYS A 1 346 ? -61.450 48.190 -141.340 1.00 24.86 ? 341  CYS A N   1 
ATOM   2564 C CA  . CYS A 1 346 ? -60.177 47.844 -140.720 1.00 25.21 ? 341  CYS A CA  1 
ATOM   2565 C C   . CYS A 1 346 ? -59.761 46.409 -141.005 1.00 24.75 ? 341  CYS A C   1 
ATOM   2566 O O   . CYS A 1 346 ? -58.633 46.022 -140.725 1.00 25.34 ? 341  CYS A O   1 
ATOM   2567 C CB  . CYS A 1 346 ? -60.184 48.100 -139.215 1.00 25.69 ? 341  CYS A CB  1 
ATOM   2568 S SG  . CYS A 1 346 ? -60.524 46.687 -138.189 1.00 28.62 ? 341  CYS A SG  1 
ATOM   2569 N N   . LEU A 1 347 ? -60.661 45.611 -141.568 1.00 24.13 ? 342  LEU A N   1 
ATOM   2570 C CA  . LEU A 1 347 ? -60.313 44.235 -141.896 1.00 22.99 ? 342  LEU A CA  1 
ATOM   2571 C C   . LEU A 1 347 ? -59.769 44.220 -143.311 1.00 23.50 ? 342  LEU A C   1 
ATOM   2572 O O   . LEU A 1 347 ? -58.785 43.541 -143.618 1.00 23.23 ? 342  LEU A O   1 
ATOM   2573 C CB  . LEU A 1 347 ? -61.532 43.336 -141.849 1.00 19.89 ? 342  LEU A CB  1 
ATOM   2574 C CG  . LEU A 1 347 ? -62.247 43.167 -140.534 1.00 19.64 ? 342  LEU A CG  1 
ATOM   2575 C CD1 . LEU A 1 347 ? -63.328 42.135 -140.731 1.00 19.63 ? 342  LEU A CD1 1 
ATOM   2576 C CD2 . LEU A 1 347 ? -61.285 42.748 -139.462 1.00 17.72 ? 342  LEU A CD2 1 
ATOM   2577 N N   . GLN A 1 348 ? -60.434 44.985 -144.164 1.00 24.01 ? 343  GLN A N   1 
ATOM   2578 C CA  . GLN A 1 348 ? -60.080 45.079 -145.565 1.00 26.00 ? 343  GLN A CA  1 
ATOM   2579 C C   . GLN A 1 348 ? -58.697 45.665 -145.777 1.00 26.66 ? 343  GLN A C   1 
ATOM   2580 O O   . GLN A 1 348 ? -58.053 45.396 -146.783 1.00 27.67 ? 343  GLN A O   1 
ATOM   2581 C CB  . GLN A 1 348 ? -61.111 45.936 -146.307 1.00 26.42 ? 343  GLN A CB  1 
ATOM   2582 C CG  . GLN A 1 348 ? -62.533 45.423 -146.211 1.00 26.20 ? 343  GLN A CG  1 
ATOM   2583 C CD  . GLN A 1 348 ? -63.515 46.279 -146.982 1.00 26.32 ? 343  GLN A CD  1 
ATOM   2584 O OE1 . GLN A 1 348 ? -63.722 47.445 -146.661 1.00 26.07 ? 343  GLN A OE1 1 
ATOM   2585 N NE2 . GLN A 1 348 ? -64.128 45.698 -148.008 1.00 26.45 ? 343  GLN A NE2 1 
ATOM   2586 N N   . ASN A 1 349 ? -58.243 46.461 -144.820 1.00 27.48 ? 344  ASN A N   1 
ATOM   2587 C CA  . ASN A 1 349 ? -56.942 47.108 -144.921 1.00 28.27 ? 344  ASN A CA  1 
ATOM   2588 C C   . ASN A 1 349 ? -55.899 46.506 -144.026 1.00 27.29 ? 344  ASN A C   1 
ATOM   2589 O O   . ASN A 1 349 ? -54.728 46.834 -144.120 1.00 28.46 ? 344  ASN A O   1 
ATOM   2590 C CB  . ASN A 1 349 ? -57.086 48.577 -144.577 1.00 30.38 ? 344  ASN A CB  1 
ATOM   2591 C CG  . ASN A 1 349 ? -57.900 49.305 -145.599 1.00 35.36 ? 344  ASN A CG  1 
ATOM   2592 O OD1 . ASN A 1 349 ? -57.367 49.761 -146.610 1.00 39.70 ? 344  ASN A OD1 1 
ATOM   2593 N ND2 . ASN A 1 349 ? -59.211 49.385 -145.376 1.00 37.14 ? 344  ASN A ND2 1 
ATOM   2594 N N   . HIS A 1 350 ? -56.318 45.610 -143.157 1.00 26.14 ? 345  HIS A N   1 
ATOM   2595 C CA  . HIS A 1 350 ? -55.385 45.029 -142.229 1.00 24.05 ? 345  HIS A CA  1 
ATOM   2596 C C   . HIS A 1 350 ? -54.084 44.503 -142.838 1.00 24.42 ? 345  HIS A C   1 
ATOM   2597 O O   . HIS A 1 350 ? -54.083 43.820 -143.877 1.00 25.27 ? 345  HIS A O   1 
ATOM   2598 C CB  . HIS A 1 350 ? -56.069 43.933 -141.445 1.00 20.81 ? 345  HIS A CB  1 
ATOM   2599 C CG  . HIS A 1 350 ? -55.402 43.647 -140.151 1.00 18.05 ? 345  HIS A CG  1 
ATOM   2600 N ND1 . HIS A 1 350 ? -54.156 43.064 -140.077 1.00 15.62 ? 345  HIS A ND1 1 
ATOM   2601 C CD2 . HIS A 1 350 ? -55.779 43.913 -138.878 1.00 16.78 ? 345  HIS A CD2 1 
ATOM   2602 C CE1 . HIS A 1 350 ? -53.794 42.979 -138.810 1.00 16.07 ? 345  HIS A CE1 1 
ATOM   2603 N NE2 . HIS A 1 350 ? -54.760 43.488 -138.062 1.00 16.83 ? 345  HIS A NE2 1 
ATOM   2604 N N   . PRO A 1 351 ? -52.946 44.858 -142.217 1.00 23.15 ? 346  PRO A N   1 
ATOM   2605 C CA  . PRO A 1 351 ? -51.675 44.375 -142.742 1.00 21.91 ? 346  PRO A CA  1 
ATOM   2606 C C   . PRO A 1 351 ? -51.739 42.861 -142.858 1.00 21.70 ? 346  PRO A C   1 
ATOM   2607 O O   . PRO A 1 351 ? -52.379 42.196 -142.043 1.00 20.59 ? 346  PRO A O   1 
ATOM   2608 C CB  . PRO A 1 351 ? -50.654 44.852 -141.694 1.00 22.02 ? 346  PRO A CB  1 
ATOM   2609 C CG  . PRO A 1 351 ? -51.494 45.341 -140.513 1.00 21.38 ? 346  PRO A CG  1 
ATOM   2610 C CD  . PRO A 1 351 ? -52.728 45.862 -141.162 1.00 20.91 ? 346  PRO A CD  1 
ATOM   2611 N N   . GLU A 1 352 ? -51.078 42.328 -143.882 1.00 22.61 ? 347  GLU A N   1 
ATOM   2612 C CA  . GLU A 1 352 ? -51.053 40.896 -144.120 1.00 22.43 ? 347  GLU A CA  1 
ATOM   2613 C C   . GLU A 1 352 ? -50.195 40.133 -143.127 1.00 22.61 ? 347  GLU A C   1 
ATOM   2614 O O   . GLU A 1 352 ? -50.421 38.953 -142.907 1.00 23.88 ? 347  GLU A O   1 
ATOM   2615 C CB  . GLU A 1 352 ? -50.635 40.614 -145.562 1.00 22.87 ? 347  GLU A CB  1 
ATOM   2616 C CG  . GLU A 1 352 ? -51.671 41.158 -146.567 1.00 27.07 ? 347  GLU A CG  1 
ATOM   2617 C CD  . GLU A 1 352 ? -51.381 40.805 -148.031 1.00 29.97 ? 347  GLU A CD  1 
ATOM   2618 O OE1 . GLU A 1 352 ? -50.198 40.537 -148.364 1.00 30.24 ? 347  GLU A OE1 1 
ATOM   2619 O OE2 . GLU A 1 352 ? -52.344 40.817 -148.849 1.00 31.39 ? 347  GLU A OE2 1 
ATOM   2620 N N   . HIS A 1 353 ? -49.230 40.796 -142.502 1.00 23.32 ? 348  HIS A N   1 
ATOM   2621 C CA  . HIS A 1 353 ? -48.387 40.145 -141.493 1.00 23.76 ? 348  HIS A CA  1 
ATOM   2622 C C   . HIS A 1 353 ? -47.987 41.180 -140.442 1.00 25.44 ? 348  HIS A C   1 
ATOM   2623 O O   . HIS A 1 353 ? -48.105 42.380 -140.684 1.00 26.57 ? 348  HIS A O   1 
ATOM   2624 C CB  . HIS A 1 353 ? -47.160 39.510 -142.156 1.00 21.89 ? 348  HIS A CB  1 
ATOM   2625 C CG  . HIS A 1 353 ? -47.511 38.488 -143.195 1.00 21.74 ? 348  HIS A CG  1 
ATOM   2626 N ND1 . HIS A 1 353 ? -47.943 37.217 -142.874 1.00 20.60 ? 348  HIS A ND1 1 
ATOM   2627 C CD2 . HIS A 1 353 ? -47.620 38.588 -144.541 1.00 20.92 ? 348  HIS A CD2 1 
ATOM   2628 C CE1 . HIS A 1 353 ? -48.310 36.583 -143.971 1.00 18.72 ? 348  HIS A CE1 1 
ATOM   2629 N NE2 . HIS A 1 353 ? -48.126 37.393 -144.997 1.00 20.79 ? 348  HIS A NE2 1 
ATOM   2630 N N   . MET A 1 354 ? -47.554 40.718 -139.269 1.00 27.11 ? 349  MET A N   1 
ATOM   2631 C CA  . MET A 1 354 ? -47.157 41.614 -138.179 1.00 28.66 ? 349  MET A CA  1 
ATOM   2632 C C   . MET A 1 354 ? -46.041 41.049 -137.302 1.00 30.77 ? 349  MET A C   1 
ATOM   2633 O O   . MET A 1 354 ? -45.457 41.845 -136.518 1.00 31.11 ? 349  MET A O   1 
ATOM   2634 C CB  . MET A 1 354 ? -48.352 41.933 -137.291 1.00 27.27 ? 349  MET A CB  1 
ATOM   2635 C CG  . MET A 1 354 ? -49.261 43.000 -137.819 1.00 26.13 ? 349  MET A CG  1 
ATOM   2636 S SD  . MET A 1 354 ? -50.711 43.131 -136.776 1.00 28.26 ? 349  MET A SD  1 
ATOM   2637 C CE  . MET A 1 354 ? -50.114 44.132 -135.427 1.00 25.65 ? 349  MET A CE  1 
ATOM   2638 O OXT . MET A 1 354 ? -45.785 39.820 -137.392 1.00 32.89 ? 349  MET A OXT 1 
HETATM 2639 S S   . SO4 B 2 .   ? -76.100 20.410 -111.428 1.00 41.07 ? 1001 SO4 A S   1 
HETATM 2640 O O1  . SO4 B 2 .   ? -75.689 19.220 -110.635 1.00 43.25 ? 1001 SO4 A O1  1 
HETATM 2641 O O2  . SO4 B 2 .   ? -77.100 20.055 -112.489 1.00 42.08 ? 1001 SO4 A O2  1 
HETATM 2642 O O3  . SO4 B 2 .   ? -76.682 21.387 -110.489 1.00 42.63 ? 1001 SO4 A O3  1 
HETATM 2643 O O4  . SO4 B 2 .   ? -74.897 21.012 -112.041 1.00 42.02 ? 1001 SO4 A O4  1 
HETATM 2644 S S   . SO4 C 2 .   ? -67.118 36.219 -122.318 1.00 17.69 ? 1002 SO4 A S   1 
HETATM 2645 O O1  . SO4 C 2 .   ? -66.664 37.059 -121.199 1.00 17.02 ? 1002 SO4 A O1  1 
HETATM 2646 O O2  . SO4 C 2 .   ? -68.429 35.571 -121.967 1.00 15.97 ? 1002 SO4 A O2  1 
HETATM 2647 O O3  . SO4 C 2 .   ? -67.252 37.083 -123.510 1.00 15.40 ? 1002 SO4 A O3  1 
HETATM 2648 O O4  . SO4 C 2 .   ? -66.093 35.193 -122.631 1.00 18.50 ? 1002 SO4 A O4  1 
HETATM 2649 S S   . SO4 D 2 .   ? -41.579 32.034 -132.033 1.00 71.56 ? 1003 SO4 A S   1 
HETATM 2650 O O1  . SO4 D 2 .   ? -42.122 33.100 -131.144 1.00 72.12 ? 1003 SO4 A O1  1 
HETATM 2651 O O2  . SO4 D 2 .   ? -40.957 30.929 -131.215 1.00 70.29 ? 1003 SO4 A O2  1 
HETATM 2652 O O3  . SO4 D 2 .   ? -42.717 31.523 -132.855 1.00 71.59 ? 1003 SO4 A O3  1 
HETATM 2653 O O4  . SO4 D 2 .   ? -40.573 32.618 -132.968 1.00 71.85 ? 1003 SO4 A O4  1 
HETATM 2654 S S   . SO4 E 2 .   ? -76.153 34.056 -126.953 1.00 90.43 ? 1004 SO4 A S   1 
HETATM 2655 O O1  . SO4 E 2 .   ? -75.561 35.410 -127.150 1.00 90.82 ? 1004 SO4 A O1  1 
HETATM 2656 O O2  . SO4 E 2 .   ? -76.318 33.745 -125.486 1.00 90.18 ? 1004 SO4 A O2  1 
HETATM 2657 O O3  . SO4 E 2 .   ? -77.467 34.056 -127.662 1.00 90.45 ? 1004 SO4 A O3  1 
HETATM 2658 O O4  . SO4 E 2 .   ? -75.279 33.019 -127.575 1.00 90.37 ? 1004 SO4 A O4  1 
HETATM 2659 S S   . SO4 F 2 .   ? -75.528 31.670 -117.929 1.00 95.82 ? 1005 SO4 A S   1 
HETATM 2660 O O1  . SO4 F 2 .   ? -74.755 30.922 -116.901 1.00 95.66 ? 1005 SO4 A O1  1 
HETATM 2661 O O2  . SO4 F 2 .   ? -76.152 32.901 -117.327 1.00 95.72 ? 1005 SO4 A O2  1 
HETATM 2662 O O3  . SO4 F 2 .   ? -74.588 32.030 -119.035 1.00 96.29 ? 1005 SO4 A O3  1 
HETATM 2663 O O4  . SO4 F 2 .   ? -76.579 30.790 -118.509 1.00 96.45 ? 1005 SO4 A O4  1 
HETATM 2664 P PA  . NAD G 3 .   ? -69.889 37.931 -113.643 1.00 22.82 ? 2001 NAD A PA  1 
HETATM 2665 O O1A . NAD G 3 .   ? -68.897 38.514 -114.536 1.00 19.28 ? 2001 NAD A O1A 1 
HETATM 2666 O O2A . NAD G 3 .   ? -70.516 36.638 -113.804 1.00 23.55 ? 2001 NAD A O2A 1 
HETATM 2667 O O5B . NAD G 3 .   ? -70.448 38.701 -112.341 1.00 23.03 ? 2001 NAD A O5B 1 
HETATM 2668 C C5B . NAD G 3 .   ? -70.225 39.927 -111.734 1.00 25.75 ? 2001 NAD A C5B 1 
HETATM 2669 C C4B . NAD G 3 .   ? -69.826 39.442 -110.388 1.00 28.81 ? 2001 NAD A C4B 1 
HETATM 2670 O O4B . NAD G 3 .   ? -69.076 40.478 -109.742 1.00 29.21 ? 2001 NAD A O4B 1 
HETATM 2671 C C3B . NAD G 3 .   ? -70.970 38.969 -109.397 1.00 29.91 ? 2001 NAD A C3B 1 
HETATM 2672 O O3B . NAD G 3 .   ? -70.813 37.593 -109.030 1.00 29.02 ? 2001 NAD A O3B 1 
HETATM 2673 C C2B . NAD G 3 .   ? -70.750 39.838 -108.138 1.00 31.22 ? 2001 NAD A C2B 1 
HETATM 2674 O O2B . NAD G 3 .   ? -70.440 39.169 -106.928 1.00 31.61 ? 2001 NAD A O2B 1 
HETATM 2675 C C1B . NAD G 3 .   ? -69.564 40.695 -108.494 1.00 29.98 ? 2001 NAD A C1B 1 
HETATM 2676 N N9A . NAD G 3 .   ? -69.807 42.106 -108.296 1.00 30.04 ? 2001 NAD A N9A 1 
HETATM 2677 C C8A . NAD G 3 .   ? -70.726 42.967 -108.878 1.00 27.81 ? 2001 NAD A C8A 1 
HETATM 2678 N N7A . NAD G 3 .   ? -70.579 44.159 -108.350 1.00 28.97 ? 2001 NAD A N7A 1 
HETATM 2679 C C5A . NAD G 3 .   ? -69.544 44.092 -107.404 1.00 30.09 ? 2001 NAD A C5A 1 
HETATM 2680 C C6A . NAD G 3 .   ? -68.890 45.014 -106.483 1.00 30.86 ? 2001 NAD A C6A 1 
HETATM 2681 N N6A . NAD G 3 .   ? -69.280 46.277 -106.420 1.00 31.24 ? 2001 NAD A N6A 1 
HETATM 2682 N N1A . NAD G 3 .   ? -67.828 44.554 -105.655 1.00 31.59 ? 2001 NAD A N1A 1 
HETATM 2683 C C2A . NAD G 3 .   ? -67.392 43.244 -105.688 1.00 30.31 ? 2001 NAD A C2A 1 
HETATM 2684 N N3A . NAD G 3 .   ? -68.022 42.392 -106.549 1.00 29.06 ? 2001 NAD A N3A 1 
HETATM 2685 C C4A . NAD G 3 .   ? -69.070 42.796 -107.391 1.00 29.68 ? 2001 NAD A C4A 1 
HETATM 2686 O O3  . NAD G 3 .   ? -68.742 37.143 -113.110 1.00 19.21 ? 2001 NAD A O3  1 
HETATM 2687 P PN  . NAD G 3 .   ? -67.467 35.938 -113.674 1.00 19.21 ? 2001 NAD A PN  1 
HETATM 2688 O O1N . NAD G 3 .   ? -67.929 35.461 -114.984 1.00 16.06 ? 2001 NAD A O1N 1 
HETATM 2689 O O2N . NAD G 3 .   ? -67.358 34.821 -112.614 1.00 17.94 ? 2001 NAD A O2N 1 
HETATM 2690 O O5D . NAD G 3 .   ? -66.046 36.635 -113.888 1.00 18.67 ? 2001 NAD A O5D 1 
HETATM 2691 C C5D . NAD G 3 .   ? -64.795 36.353 -113.240 1.00 18.88 ? 2001 NAD A C5D 1 
HETATM 2692 C C4D . NAD G 3 .   ? -63.691 36.447 -114.297 1.00 19.12 ? 2001 NAD A C4D 1 
HETATM 2693 O O4D . NAD G 3 .   ? -63.902 35.223 -115.047 1.00 20.07 ? 2001 NAD A O4D 1 
HETATM 2694 C C3D . NAD G 3 .   ? -63.833 37.544 -115.321 1.00 18.58 ? 2001 NAD A C3D 1 
HETATM 2695 O O3D . NAD G 3 .   ? -62.618 38.160 -115.498 1.00 16.75 ? 2001 NAD A O3D 1 
HETATM 2696 C C2D . NAD G 3 .   ? -64.231 36.874 -116.660 1.00 19.80 ? 2001 NAD A C2D 1 
HETATM 2697 O O2D . NAD G 3 .   ? -63.822 37.461 -117.839 1.00 21.28 ? 2001 NAD A O2D 1 
HETATM 2698 C C1D . NAD G 3 .   ? -63.696 35.455 -116.408 1.00 20.36 ? 2001 NAD A C1D 1 
HETATM 2699 N N1N . NAD G 3 .   ? -64.212 34.295 -117.135 1.00 21.06 ? 2001 NAD A N1N 1 
HETATM 2700 C C2N . NAD G 3 .   ? -65.694 34.101 -117.377 1.00 21.68 ? 2001 NAD A C2N 1 
HETATM 2701 C C3N . NAD G 3 .   ? -66.119 32.956 -118.068 1.00 22.66 ? 2001 NAD A C3N 1 
HETATM 2702 C C7N . NAD G 3 .   ? -67.636 33.127 -118.101 1.00 23.93 ? 2001 NAD A C7N 1 
HETATM 2703 O O7N . NAD G 3 .   ? -68.098 32.449 -119.033 1.00 26.29 ? 2001 NAD A O7N 1 
HETATM 2704 N N7N . NAD G 3 .   ? -68.514 33.840 -117.339 1.00 24.52 ? 2001 NAD A N7N 1 
HETATM 2705 C C4N . NAD G 3 .   ? -65.106 31.874 -118.584 1.00 22.41 ? 2001 NAD A C4N 1 
HETATM 2706 C C5N . NAD G 3 .   ? -63.614 32.108 -118.322 1.00 21.53 ? 2001 NAD A C5N 1 
HETATM 2707 C C6N . NAD G 3 .   ? -63.172 33.333 -117.589 1.00 21.68 ? 2001 NAD A C6N 1 
HETATM 2708 O O   . HOH H 4 .   ? -55.557 11.952 -102.801 1.00 10.18 ? 2002 HOH A O   1 
HETATM 2709 O O   . HOH H 4 .   ? -66.917 20.542 -118.066 1.00 11.64 ? 2003 HOH A O   1 
HETATM 2710 O O   . HOH H 4 .   ? -69.463 35.908 -143.612 1.00 22.43 ? 2004 HOH A O   1 
HETATM 2711 O O   . HOH H 4 .   ? -53.558 40.444 -116.823 1.00 11.50 ? 2005 HOH A O   1 
HETATM 2712 O O   . HOH H 4 .   ? -75.716 27.759 -109.161 1.00 21.69 ? 2006 HOH A O   1 
HETATM 2713 O O   . HOH H 4 .   ? -72.721 38.975 -105.545 1.00 18.92 ? 2007 HOH A O   1 
HETATM 2714 O O   . HOH H 4 .   ? -62.525 34.401 -144.684 1.00 14.03 ? 2008 HOH A O   1 
HETATM 2715 O O   . HOH H 4 .   ? -53.792 24.359 -123.697 1.00 15.28 ? 2009 HOH A O   1 
HETATM 2716 O O   . HOH H 4 .   ? -67.647 37.037 -126.351 1.00 30.42 ? 2010 HOH A O   1 
HETATM 2717 O O   . HOH H 4 .   ? -72.034 36.198 -106.807 1.00 14.48 ? 2011 HOH A O   1 
HETATM 2718 O O   . HOH H 4 .   ? -66.866 36.205 -110.219 1.00 22.47 ? 2012 HOH A O   1 
HETATM 2719 O O   . HOH H 4 .   ? -67.660 22.895 -121.307 1.00 27.64 ? 2013 HOH A O   1 
HETATM 2720 O O   . HOH H 4 .   ? -73.209 42.110 -110.550 1.00 24.60 ? 2014 HOH A O   1 
HETATM 2721 O O   . HOH H 4 .   ? -59.756 24.183 -125.724 1.00 16.45 ? 2015 HOH A O   1 
HETATM 2722 O O   . HOH H 4 .   ? -74.793 26.845 -122.678 1.00 17.69 ? 2016 HOH A O   1 
HETATM 2723 O O   . HOH H 4 .   ? -72.738 35.083 -127.768 1.00 26.18 ? 2017 HOH A O   1 
HETATM 2724 O O   . HOH H 4 .   ? -77.068 40.243 -129.366 1.00 19.06 ? 2018 HOH A O   1 
HETATM 2725 O O   . HOH H 4 .   ? -60.504 40.824 -121.243 1.00 12.42 ? 2019 HOH A O   1 
HETATM 2726 O O   . HOH H 4 .   ? -49.611 47.954 -102.131 1.00 18.47 ? 2020 HOH A O   1 
HETATM 2727 O O   . HOH H 4 .   ? -60.744 23.808 -99.061  1.00 29.46 ? 2021 HOH A O   1 
HETATM 2728 O O   . HOH H 4 .   ? -69.655 33.402 -121.208 1.00 19.88 ? 2022 HOH A O   1 
HETATM 2729 O O   . HOH H 4 .   ? -67.134 39.538 -106.710 1.00 12.71 ? 2023 HOH A O   1 
HETATM 2730 O O   . HOH H 4 .   ? -71.624 31.070 -119.110 1.00 18.21 ? 2024 HOH A O   1 
HETATM 2731 O O   . HOH H 4 .   ? -76.505 36.756 -114.188 1.00 18.67 ? 2025 HOH A O   1 
HETATM 2732 O O   . HOH H 4 .   ? -57.502 32.553 -122.827 1.00 32.21 ? 2026 HOH A O   1 
HETATM 2733 O O   . HOH H 4 .   ? -50.050 38.886 -150.387 1.00 24.33 ? 2027 HOH A O   1 
HETATM 2734 O O   . HOH H 4 .   ? -60.455 30.616 -118.911 1.00 10.62 ? 2028 HOH A O   1 
HETATM 2735 O O   . HOH H 4 .   ? -56.984 15.371 -112.566 1.00 26.86 ? 2029 HOH A O   1 
HETATM 2736 O O   . HOH H 4 .   ? -50.806 36.284 -141.806 1.00 17.68 ? 2030 HOH A O   1 
HETATM 2737 O O   . HOH H 4 .   ? -46.345 21.229 -113.398 1.00 15.10 ? 2031 HOH A O   1 
HETATM 2738 O O   . HOH H 4 .   ? -61.606 43.447 -118.446 1.00 29.20 ? 2032 HOH A O   1 
HETATM 2739 O O   . HOH H 4 .   ? -55.243 22.254 -122.387 1.00 21.16 ? 2033 HOH A O   1 
HETATM 2740 O O   . HOH H 4 .   ? -82.021 48.346 -134.063 1.00 59.82 ? 2034 HOH A O   1 
HETATM 2741 O O   . HOH H 4 .   ? -56.567 21.373 -93.558  1.00 19.53 ? 2035 HOH A O   1 
HETATM 2742 O O   . HOH H 4 .   ? -44.199 41.303 -133.659 1.00 20.25 ? 2036 HOH A O   1 
HETATM 2743 O O   . HOH H 4 .   ? -74.465 51.398 -129.975 1.00 53.09 ? 2037 HOH A O   1 
HETATM 2744 O O   . HOH H 4 .   ? -69.868 53.859 -132.133 1.00 27.89 ? 2038 HOH A O   1 
HETATM 2745 O O   . HOH H 4 .   ? -64.149 36.978 -120.415 1.00 19.19 ? 2039 HOH A O   1 
HETATM 2746 O O   . HOH H 4 .   ? -45.467 34.283 -109.116 1.00 30.13 ? 2040 HOH A O   1 
HETATM 2747 O O   . HOH H 4 .   ? -66.329 46.502 -120.246 1.00 24.92 ? 2041 HOH A O   1 
HETATM 2748 O O   . HOH H 4 .   ? -67.989 36.962 -92.981  1.00 28.74 ? 2042 HOH A O   1 
HETATM 2749 O O   . HOH H 4 .   ? -66.222 17.927 -109.881 1.00 27.02 ? 2043 HOH A O   1 
HETATM 2750 O O   . HOH H 4 .   ? -62.864 40.645 -115.587 1.00 41.01 ? 2044 HOH A O   1 
HETATM 2751 O O   . HOH H 4 .   ? -74.871 42.959 -116.108 1.00 23.72 ? 2045 HOH A O   1 
HETATM 2752 O O   . HOH H 4 .   ? -67.807 45.770 -116.924 1.00 27.59 ? 2046 HOH A O   1 
HETATM 2753 O O   . HOH H 4 .   ? -67.721 38.009 -136.484 1.00 32.26 ? 2047 HOH A O   1 
HETATM 2754 O O   . HOH H 4 .   ? -54.400 13.623 -119.507 1.00 52.59 ? 2048 HOH A O   1 
HETATM 2755 O O   . HOH H 4 .   ? -64.006 34.044 -120.935 1.00 37.33 ? 2049 HOH A O   1 
HETATM 2756 O O   . HOH H 4 .   ? -77.594 24.727 -119.566 1.00 34.21 ? 2050 HOH A O   1 
HETATM 2757 O O   . HOH H 4 .   ? -62.496 40.769 -91.301  1.00 28.86 ? 2051 HOH A O   1 
HETATM 2758 O O   . HOH H 4 .   ? -60.708 15.668 -98.657  1.00 25.69 ? 2052 HOH A O   1 
HETATM 2759 O O   . HOH H 4 .   ? -60.224 31.875 -116.224 1.00 21.14 ? 2053 HOH A O   1 
HETATM 2760 O O   . HOH H 4 .   ? -69.748 37.506 -138.494 1.00 21.32 ? 2054 HOH A O   1 
HETATM 2761 O O   . HOH H 4 .   ? -80.561 30.763 -105.558 1.00 37.67 ? 2055 HOH A O   1 
HETATM 2762 O O   . HOH H 4 .   ? -69.951 41.435 -99.230  1.00 20.95 ? 2056 HOH A O   1 
HETATM 2763 O O   . HOH H 4 .   ? -48.831 26.574 -97.891  1.00 49.62 ? 2057 HOH A O   1 
HETATM 2764 O O   . HOH H 4 .   ? -53.767 39.695 -144.320 1.00 46.22 ? 2058 HOH A O   1 
HETATM 2765 O O   . HOH H 4 .   ? -74.089 24.135 -121.922 1.00 17.15 ? 2059 HOH A O   1 
HETATM 2766 O O   . HOH H 4 .   ? -79.787 21.216 -111.136 1.00 30.65 ? 2060 HOH A O   1 
HETATM 2767 O O   . HOH H 4 .   ? -75.884 20.404 -103.814 1.00 22.53 ? 2061 HOH A O   1 
HETATM 2768 O O   . HOH H 4 .   ? -69.417 17.723 -102.437 1.00 29.49 ? 2062 HOH A O   1 
HETATM 2769 O O   . HOH H 4 .   ? -63.784 31.157 -121.927 1.00 11.06 ? 2063 HOH A O   1 
HETATM 2770 O O   . HOH H 4 .   ? -74.295 30.671 -121.857 1.00 20.13 ? 2064 HOH A O   1 
HETATM 2771 O O   . HOH H 4 .   ? -75.499 28.152 -116.139 1.00 33.57 ? 2065 HOH A O   1 
HETATM 2772 O O   . HOH H 4 .   ? -54.612 32.821 -96.818  1.00 32.06 ? 2066 HOH A O   1 
HETATM 2773 O O   . HOH H 4 .   ? -54.900 45.321 -95.419  1.00 31.47 ? 2067 HOH A O   1 
HETATM 2774 O O   . HOH H 4 .   ? -53.201 23.786 -131.592 1.00 27.12 ? 2068 HOH A O   1 
HETATM 2775 O O   . HOH H 4 .   ? -72.715 26.244 -97.954  1.00 31.45 ? 2069 HOH A O   1 
HETATM 2776 O O   . HOH H 4 .   ? -72.414 29.854 -142.764 1.00 24.08 ? 2070 HOH A O   1 
HETATM 2777 O O   . HOH H 4 .   ? -53.974 15.973 -117.912 1.00 46.89 ? 2071 HOH A O   1 
HETATM 2778 O O   . HOH H 4 .   ? -47.656 18.264 -106.504 1.00 30.40 ? 2072 HOH A O   1 
HETATM 2779 O O   . HOH H 4 .   ? -45.946 30.178 -111.268 1.00 25.69 ? 2073 HOH A O   1 
HETATM 2780 O O   . HOH H 4 .   ? -85.025 41.346 -105.866 1.00 30.91 ? 2074 HOH A O   1 
HETATM 2781 O O   . HOH H 4 .   ? -68.772 15.360 -122.017 1.00 31.62 ? 2075 HOH A O   1 
HETATM 2782 O O   . HOH H 4 .   ? -66.703 39.641 -120.309 1.00 33.09 ? 2076 HOH A O   1 
HETATM 2783 O O   . HOH H 4 .   ? -80.680 54.515 -130.750 1.00 40.50 ? 2077 HOH A O   1 
HETATM 2784 O O   . HOH H 4 .   ? -73.077 25.116 -101.331 1.00 26.34 ? 2078 HOH A O   1 
HETATM 2785 O O   . HOH H 4 .   ? -56.740 48.125 -141.351 1.00 27.88 ? 2079 HOH A O   1 
HETATM 2786 O O   . HOH H 4 .   ? -67.587 16.140 -115.587 1.00 22.91 ? 2080 HOH A O   1 
HETATM 2787 O O   . HOH H 4 .   ? -48.167 38.525 -135.162 1.00 28.42 ? 2081 HOH A O   1 
HETATM 2788 O O   . HOH H 4 .   ? -50.501 26.770 -100.594 1.00 31.93 ? 2082 HOH A O   1 
HETATM 2789 O O   . HOH H 4 .   ? -39.063 24.297 -114.618 1.00 28.31 ? 2083 HOH A O   1 
HETATM 2790 O O   . HOH H 4 .   ? -44.076 27.395 -121.641 1.00 28.92 ? 2084 HOH A O   1 
HETATM 2791 O O   . HOH H 4 .   ? -74.148 45.315 -114.084 1.00 35.56 ? 2085 HOH A O   1 
HETATM 2792 O O   . HOH H 4 .   ? -55.885 37.595 -118.332 1.00 24.85 ? 2086 HOH A O   1 
HETATM 2793 O O   . HOH H 4 .   ? -66.945 38.782 -116.429 1.00 39.92 ? 2087 HOH A O   1 
HETATM 2794 O O   . HOH H 4 .   ? -46.893 33.189 -99.729  1.00 27.27 ? 2088 HOH A O   1 
HETATM 2795 O O   . HOH H 4 .   ? -50.234 56.055 -133.108 1.00 31.03 ? 2089 HOH A O   1 
HETATM 2796 O O   . HOH H 4 .   ? -68.158 37.429 -104.739 1.00 20.73 ? 2090 HOH A O   1 
HETATM 2797 O O   . HOH H 4 .   ? -48.458 50.476 -139.870 1.00 46.15 ? 2091 HOH A O   1 
HETATM 2798 O O   . HOH H 4 .   ? -41.118 55.851 -113.936 1.00 45.19 ? 2092 HOH A O   1 
HETATM 2799 O O   . HOH H 4 .   ? -57.641 41.529 -145.467 1.00 43.52 ? 2093 HOH A O   1 
HETATM 2800 O O   . HOH H 4 .   ? -40.464 36.027 -133.446 1.00 42.66 ? 2094 HOH A O   1 
HETATM 2801 O O   . HOH H 4 .   ? -48.167 37.314 -112.489 1.00 41.69 ? 2095 HOH A O   1 
HETATM 2802 O O   . HOH H 4 .   ? -73.882 34.499 -119.279 1.00 30.02 ? 2096 HOH A O   1 
HETATM 2803 O O   . HOH H 4 .   ? -49.364 29.218 -107.775 1.00 31.16 ? 2097 HOH A O   1 
HETATM 2804 O O   . HOH H 4 .   ? -66.579 49.271 -143.370 1.00 36.54 ? 2098 HOH A O   1 
HETATM 2805 O O   . HOH H 4 .   ? -59.447 13.500 -115.081 1.00 38.62 ? 2099 HOH A O   1 
HETATM 2806 O O   . HOH H 4 .   ? -74.235 54.734 -131.070 1.00 24.87 ? 2100 HOH A O   1 
HETATM 2807 O O   . HOH H 4 .   ? -73.863 25.583 -125.500 1.00 28.42 ? 2101 HOH A O   1 
HETATM 2808 O O   . HOH H 4 .   ? -47.355 39.526 -147.897 1.00 39.03 ? 2102 HOH A O   1 
HETATM 2809 O O   . HOH H 4 .   ? -46.189 36.587 -147.532 1.00 42.39 ? 2103 HOH A O   1 
HETATM 2810 O O   . HOH H 4 .   ? -42.830 55.493 -122.394 1.00 36.41 ? 2104 HOH A O   1 
HETATM 2811 O O   . HOH H 4 .   ? -78.574 32.770 -106.817 1.00 56.86 ? 2105 HOH A O   1 
HETATM 2812 O O   . HOH H 4 .   ? -45.056 53.146 -138.363 1.00 37.56 ? 2106 HOH A O   1 
HETATM 2813 O O   . HOH H 4 .   ? -73.348 31.000 -125.062 1.00 39.39 ? 2107 HOH A O   1 
HETATM 2814 O O   . HOH H 4 .   ? -81.673 36.529 -95.871  1.00 53.59 ? 2108 HOH A O   1 
HETATM 2815 O O   . HOH H 4 .   ? -60.798 49.947 -118.524 1.00 46.25 ? 2109 HOH A O   1 
HETATM 2816 O O   . HOH H 4 .   ? -75.674 47.071 -137.836 1.00 25.96 ? 2110 HOH A O   1 
HETATM 2817 O O   . HOH H 4 .   ? -74.662 55.065 -127.248 1.00 33.98 ? 2111 HOH A O   1 
HETATM 2818 O O   . HOH H 4 .   ? -80.728 41.221 -108.066 1.00 37.51 ? 2112 HOH A O   1 
HETATM 2819 O O   . HOH H 4 .   ? -80.648 41.718 -117.129 1.00 33.35 ? 2113 HOH A O   1 
HETATM 2820 O O   . HOH H 4 .   ? -55.401 51.910 -135.357 1.00 34.27 ? 2114 HOH A O   1 
HETATM 2821 O O   . HOH H 4 .   ? -75.605 26.201 -118.074 1.00 30.44 ? 2115 HOH A O   1 
HETATM 2822 O O   . HOH H 4 .   ? -77.671 53.844 -124.380 1.00 34.43 ? 2116 HOH A O   1 
HETATM 2823 O O   . HOH H 4 .   ? -79.520 26.560 -116.990 1.00 37.15 ? 2117 HOH A O   1 
HETATM 2824 O O   . HOH H 4 .   ? -44.796 47.049 -121.123 1.00 40.87 ? 2118 HOH A O   1 
HETATM 2825 O O   . HOH H 4 .   ? -47.631 35.727 -93.990  1.00 37.51 ? 2119 HOH A O   1 
HETATM 2826 O O   . HOH H 4 .   ? -83.500 25.463 -104.125 1.00 53.28 ? 2120 HOH A O   1 
HETATM 2827 O O   . HOH H 4 .   ? -74.809 34.738 -94.627  1.00 22.46 ? 2121 HOH A O   1 
HETATM 2828 O O   . HOH H 4 .   ? -62.512 35.571 -88.079  1.00 46.03 ? 2122 HOH A O   1 
HETATM 2829 O O   . HOH H 4 .   ? -50.466 40.054 -97.908  1.00 34.88 ? 2123 HOH A O   1 
HETATM 2830 O O   . HOH H 4 .   ? -70.102 47.661 -114.810 1.00 38.06 ? 2124 HOH A O   1 
HETATM 2831 O O   . HOH H 4 .   ? -53.635 47.763 -97.698  1.00 27.75 ? 2125 HOH A O   1 
HETATM 2832 O O   . HOH H 4 .   ? -42.926 51.309 -137.074 1.00 52.56 ? 2126 HOH A O   1 
HETATM 2833 O O   . HOH H 4 .   ? -45.830 36.954 -107.153 1.00 46.40 ? 2127 HOH A O   1 
HETATM 2834 O O   . HOH H 4 .   ? -78.909 37.500 -132.826 1.00 49.14 ? 2128 HOH A O   1 
HETATM 2835 O O   . HOH H 4 .   ? -48.351 19.285 -113.893 1.00 20.72 ? 2129 HOH A O   1 
HETATM 2836 O O   . HOH H 4 .   ? -65.481 41.925 -97.648  1.00 38.43 ? 2130 HOH A O   1 
HETATM 2837 O O   . HOH H 4 .   ? -44.317 34.872 -121.460 1.00 51.97 ? 2131 HOH A O   1 
HETATM 2838 O O   . HOH H 4 .   ? -75.137 44.472 -103.070 1.00 28.66 ? 2132 HOH A O   1 
HETATM 2839 O O   . HOH H 4 .   ? -53.738 13.106 -116.673 1.00 2.78  ? 2133 HOH A O   1 
HETATM 2840 O O   . HOH H 4 .   ? -66.360 32.445 -121.382 1.00 19.33 ? 2134 HOH A O   1 
HETATM 2841 O O   . HOH H 4 .   ? -68.326 37.556 -108.201 1.00 23.26 ? 2135 HOH A O   1 
HETATM 2842 O O   . HOH H 4 .   ? -51.841 37.260 -144.473 1.00 47.65 ? 2136 HOH A O   1 
HETATM 2843 O O   . HOH H 4 .   ? -59.018 47.884 -117.308 1.00 30.57 ? 2137 HOH A O   1 
HETATM 2844 O O   . HOH H 4 .   ? -75.647 31.815 -94.485  1.00 17.34 ? 2138 HOH A O   1 
HETATM 2845 O O   . HOH H 4 .   ? -55.859 19.245 -122.224 1.00 21.61 ? 2139 HOH A O   1 
HETATM 2846 O O   . HOH H 4 .   ? -48.256 39.893 -152.193 1.00 35.13 ? 2140 HOH A O   1 
HETATM 2847 O O   . HOH H 4 .   ? -63.453 15.423 -98.179  1.00 20.29 ? 2141 HOH A O   1 
HETATM 2848 O O   . HOH H 4 .   ? -46.413 29.334 -108.161 1.00 31.81 ? 2142 HOH A O   1 
HETATM 2849 O O   . HOH H 4 .   ? -43.966 33.922 -118.593 1.00 18.48 ? 2143 HOH A O   1 
HETATM 2850 O O   . HOH H 4 .   ? -43.175 34.978 -107.903 1.00 39.47 ? 2144 HOH A O   1 
HETATM 2851 O O   . HOH H 4 .   ? -58.657 15.724 -110.026 1.00 26.48 ? 2145 HOH A O   1 
HETATM 2852 O O   . HOH H 4 .   ? -44.104 24.210 -120.866 1.00 27.94 ? 2146 HOH A O   1 
HETATM 2853 O O   . HOH H 4 .   ? -67.275 15.524 -108.338 1.00 17.05 ? 2147 HOH A O   1 
HETATM 2854 O O   . HOH H 4 .   ? -72.454 33.607 -122.333 1.00 28.59 ? 2148 HOH A O   1 
HETATM 2855 O O   . HOH H 4 .   ? -57.993 11.084 -102.215 1.00 42.34 ? 2149 HOH A O   1 
HETATM 2856 O O   . HOH H 4 .   ? -46.169 34.205 -135.673 1.00 40.87 ? 2150 HOH A O   1 
HETATM 2857 O O   . HOH H 4 .   ? -52.552 12.473 -102.806 1.00 57.46 ? 2151 HOH A O   1 
HETATM 2858 O O   . HOH H 4 .   ? -74.912 22.917 -126.754 1.00 30.93 ? 2152 HOH A O   1 
HETATM 2859 O O   . HOH H 4 .   ? -75.802 36.109 -120.536 1.00 32.88 ? 2153 HOH A O   1 
HETATM 2860 O O   . HOH H 4 .   ? -47.603 56.486 -134.780 1.00 30.81 ? 2154 HOH A O   1 
HETATM 2861 O O   . HOH H 4 .   ? -66.531 19.153 -115.537 1.00 40.42 ? 2155 HOH A O   1 
HETATM 2862 O O   . HOH H 4 .   ? -45.788 33.146 -112.125 1.00 45.61 ? 2156 HOH A O   1 
HETATM 2863 O O   . HOH H 4 .   ? -49.330 25.467 -102.763 1.00 37.32 ? 2157 HOH A O   1 
HETATM 2864 O O   . HOH H 4 .   ? -48.468 27.679 -93.445  1.00 37.44 ? 2158 HOH A O   1 
HETATM 2865 O O   . HOH H 4 .   ? -46.099 35.777 -111.407 1.00 55.50 ? 2159 HOH A O   1 
HETATM 2866 O O   . HOH H 4 .   ? -81.646 20.553 -113.363 1.00 41.52 ? 2160 HOH A O   1 
HETATM 2867 O O   . HOH H 4 .   ? -44.734 22.770 -115.414 1.00 26.84 ? 2161 HOH A O   1 
HETATM 2868 O O   . HOH H 4 .   ? -66.323 48.045 -116.719 1.00 47.46 ? 2162 HOH A O   1 
HETATM 2869 O O   . HOH H 4 .   ? -47.076 45.255 -138.955 1.00 28.48 ? 2163 HOH A O   1 
HETATM 2870 O O   . HOH H 4 .   ? -68.797 25.881 -92.854  1.00 26.51 ? 2164 HOH A O   1 
HETATM 2871 O O   . HOH H 4 .   ? -45.117 37.712 -134.510 1.00 49.51 ? 2165 HOH A O   1 
HETATM 2872 O O   . HOH H 4 .   ? -46.448 42.768 -116.828 1.00 33.93 ? 2166 HOH A O   1 
HETATM 2873 O O   . HOH H 4 .   ? -50.399 35.774 -138.850 1.00 35.01 ? 2167 HOH A O   1 
HETATM 2874 O O   . HOH H 4 .   ? -76.192 28.458 -124.352 1.00 54.13 ? 2168 HOH A O   1 
HETATM 2875 O O   . HOH H 4 .   ? -62.334 38.300 -89.659  1.00 39.71 ? 2169 HOH A O   1 
HETATM 2876 O O   . HOH H 4 .   ? -79.214 40.343 -127.439 1.00 28.84 ? 2170 HOH A O   1 
HETATM 2877 O O   . HOH H 4 .   ? -69.147 55.391 -128.662 1.00 33.95 ? 2171 HOH A O   1 
HETATM 2878 O O   . HOH H 4 .   ? -55.346 43.176 -146.944 1.00 44.87 ? 2172 HOH A O   1 
HETATM 2879 O O   . HOH H 4 .   ? -60.300 47.880 -100.116 1.00 45.20 ? 2173 HOH A O   1 
HETATM 2880 O O   . HOH H 4 .   ? -77.490 37.191 -129.500 1.00 57.33 ? 2174 HOH A O   1 
HETATM 2881 O O   . HOH H 4 .   ? -42.392 32.850 -135.459 1.00 47.12 ? 2175 HOH A O   1 
HETATM 2882 O O   . HOH H 4 .   ? -78.318 44.240 -103.025 1.00 31.17 ? 2176 HOH A O   1 
HETATM 2883 O O   . HOH H 4 .   ? -43.724 53.562 -135.340 1.00 49.68 ? 2177 HOH A O   1 
HETATM 2884 O O   . HOH H 4 .   ? -60.760 13.566 -112.554 1.00 30.35 ? 2178 HOH A O   1 
HETATM 2885 O O   . HOH H 4 .   ? -43.113 28.798 -130.943 1.00 46.45 ? 2179 HOH A O   1 
HETATM 2886 O O   . HOH H 4 .   ? -76.245 42.506 -144.416 1.00 38.94 ? 2180 HOH A O   1 
HETATM 2887 O O   . HOH H 4 .   ? -76.156 36.060 -132.685 1.00 41.72 ? 2181 HOH A O   1 
HETATM 2888 O O   . HOH H 4 .   ? -81.650 24.587 -117.703 1.00 35.37 ? 2182 HOH A O   1 
HETATM 2889 O O   . HOH H 4 .   ? -61.087 47.923 -107.037 1.00 34.80 ? 2183 HOH A O   1 
HETATM 2890 O O   . HOH H 4 .   ? -45.294 40.987 -119.109 1.00 30.07 ? 2184 HOH A O   1 
HETATM 2891 O O   . HOH H 4 .   ? -46.711 38.724 -109.349 1.00 50.61 ? 2185 HOH A O   1 
HETATM 2892 O O   . HOH H 4 .   ? -82.364 42.594 -105.863 1.00 60.52 ? 2186 HOH A O   1 
HETATM 2893 O O   . HOH H 4 .   ? -60.286 10.365 -114.717 1.00 34.72 ? 2187 HOH A O   1 
HETATM 2894 O O   . HOH H 4 .   ? -78.650 20.545 -102.553 1.00 46.08 ? 2188 HOH A O   1 
HETATM 2895 O O   . HOH H 4 .   ? -48.742 35.976 -136.382 1.00 33.55 ? 2189 HOH A O   1 
HETATM 2896 O O   . HOH H 4 .   ? -68.518 48.418 -119.260 1.00 36.44 ? 2190 HOH A O   1 
HETATM 2897 O O   . HOH H 4 .   ? -48.867 35.519 -96.961  1.00 31.29 ? 2191 HOH A O   1 
HETATM 2898 O O   . HOH H 4 .   ? -81.168 38.510 -118.061 1.00 42.25 ? 2192 HOH A O   1 
HETATM 2899 O O   . HOH H 4 .   ? -50.769 43.687 -149.565 1.00 35.68 ? 2193 HOH A O   1 
HETATM 2900 O O   . HOH H 4 .   ? -51.384 49.315 -100.439 1.00 49.31 ? 2194 HOH A O   1 
HETATM 2901 O O   . HOH H 4 .   ? -59.008 51.328 -136.659 1.00 30.43 ? 2195 HOH A O   1 
HETATM 2902 O O   . HOH H 4 .   ? -39.658 26.157 -109.126 1.00 28.31 ? 2196 HOH A O   1 
HETATM 2903 O O   . HOH H 4 .   ? -72.492 34.416 -137.902 1.00 42.25 ? 2197 HOH A O   1 
HETATM 2904 O O   . HOH H 4 .   ? -58.994 44.373 -94.391  1.00 33.25 ? 2198 HOH A O   1 
HETATM 2905 O O   . HOH H 4 .   ? -48.098 53.278 -138.722 1.00 50.42 ? 2199 HOH A O   1 
HETATM 2906 O O   . HOH H 4 .   ? -41.090 34.556 -120.754 1.00 42.99 ? 2200 HOH A O   1 
HETATM 2907 O O   . HOH H 4 .   ? -60.155 59.324 -134.192 1.00 44.77 ? 2201 HOH A O   1 
HETATM 2908 O O   . HOH H 4 .   ? -73.560 45.140 -110.485 1.00 46.03 ? 2202 HOH A O   1 
HETATM 2909 O O   . HOH H 4 .   ? -73.754 48.165 -116.501 1.00 33.87 ? 2203 HOH A O   1 
HETATM 2910 O O   . HOH H 4 .   ? -39.910 38.975 -133.019 1.00 37.91 ? 2204 HOH A O   1 
HETATM 2911 O O   . HOH H 4 .   ? -45.433 37.374 -114.340 1.00 27.24 ? 2205 HOH A O   1 
HETATM 2912 O O   . HOH H 4 .   ? -55.251 37.431 -114.273 1.00 45.34 ? 2206 HOH A O   1 
HETATM 2913 O O   . HOH H 4 .   ? -68.410 47.884 -112.088 1.00 42.89 ? 2207 HOH A O   1 
HETATM 2914 O O   . HOH H 4 .   ? -80.923 25.469 -109.717 1.00 33.80 ? 2208 HOH A O   1 
HETATM 2915 O O   . HOH H 4 .   ? -74.642 18.991 -115.165 1.00 30.54 ? 2209 HOH A O   1 
HETATM 2916 O O   . HOH H 4 .   ? -54.867 26.527 -93.009  1.00 43.42 ? 2210 HOH A O   1 
HETATM 2917 O O   . HOH H 4 .   ? -77.940 29.447 -116.400 1.00 28.18 ? 2211 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -4  ?   ?   ?   A . n 
A 1 2   PRO 2   -3  ?   ?   ?   A . n 
A 1 3   LEU 3   -2  ?   ?   ?   A . n 
A 1 4   GLY 4   -1  ?   ?   ?   A . n 
A 1 5   SER 5   0   0   SER SER A . n 
A 1 6   MET 6   1   1   MET MET A . n 
A 1 7   ALA 7   2   2   ALA ALA A . n 
A 1 8   SER 8   3   3   SER SER A . n 
A 1 9   LYS 9   4   4   LYS LYS A . n 
A 1 10  LYS 10  5   5   LYS LYS A . n 
A 1 11  VAL 11  6   6   VAL VAL A . n 
A 1 12  CYS 12  7   7   CYS CYS A . n 
A 1 13  ILE 13  8   8   ILE ILE A . n 
A 1 14  VAL 14  9   9   VAL VAL A . n 
A 1 15  GLY 15  10  10  GLY GLY A . n 
A 1 16  SER 16  11  11  SER SER A . n 
A 1 17  GLY 17  12  12  GLY GLY A . n 
A 1 18  ASN 18  13  13  ASN ASN A . n 
A 1 19  TRP 19  14  14  TRP TRP A . n 
A 1 20  GLY 20  15  15  GLY GLY A . n 
A 1 21  SER 21  16  16  SER SER A . n 
A 1 22  ALA 22  17  17  ALA ALA A . n 
A 1 23  ILE 23  18  18  ILE ILE A . n 
A 1 24  ALA 24  19  19  ALA ALA A . n 
A 1 25  LYS 25  20  20  LYS LYS A . n 
A 1 26  ILE 26  21  21  ILE ILE A . n 
A 1 27  VAL 27  22  22  VAL VAL A . n 
A 1 28  GLY 28  23  23  GLY GLY A . n 
A 1 29  GLY 29  24  24  GLY GLY A . n 
A 1 30  ASN 30  25  25  ASN ASN A . n 
A 1 31  ALA 31  26  26  ALA ALA A . n 
A 1 32  ALA 32  27  27  ALA ALA A . n 
A 1 33  GLN 33  28  28  GLN GLN A . n 
A 1 34  LEU 34  29  29  LEU LEU A . n 
A 1 35  ALA 35  30  30  ALA ALA A . n 
A 1 36  GLN 36  31  31  GLN GLN A . n 
A 1 37  PHE 37  32  32  PHE PHE A . n 
A 1 38  ASP 38  33  33  ASP ASP A . n 
A 1 39  PRO 39  34  34  PRO PRO A . n 
A 1 40  ARG 40  35  35  ARG ARG A . n 
A 1 41  VAL 41  36  36  VAL VAL A . n 
A 1 42  THR 42  37  37  THR THR A . n 
A 1 43  MET 43  38  38  MET MET A . n 
A 1 44  TRP 44  39  39  TRP TRP A . n 
A 1 45  VAL 45  40  40  VAL VAL A . n 
A 1 46  PHE 46  41  41  PHE PHE A . n 
A 1 47  GLU 47  42  42  GLU GLU A . n 
A 1 48  GLU 48  43  43  GLU GLU A . n 
A 1 49  ASP 49  44  44  ASP ASP A . n 
A 1 50  ILE 50  45  45  ILE ILE A . n 
A 1 51  GLY 51  46  46  GLY GLY A . n 
A 1 52  GLY 52  47  47  GLY GLY A . n 
A 1 53  LYS 53  48  48  LYS LYS A . n 
A 1 54  LYS 54  49  49  LYS LYS A . n 
A 1 55  LEU 55  50  50  LEU LEU A . n 
A 1 56  THR 56  51  51  THR THR A . n 
A 1 57  GLU 57  52  52  GLU GLU A . n 
A 1 58  ILE 58  53  53  ILE ILE A . n 
A 1 59  ILE 59  54  54  ILE ILE A . n 
A 1 60  ASN 60  55  55  ASN ASN A . n 
A 1 61  THR 61  56  56  THR THR A . n 
A 1 62  GLN 62  57  57  GLN GLN A . n 
A 1 63  HIS 63  58  58  HIS HIS A . n 
A 1 64  GLU 64  59  59  GLU GLU A . n 
A 1 65  ASN 65  60  60  ASN ASN A . n 
A 1 66  VAL 66  61  61  VAL VAL A . n 
A 1 67  LYS 67  62  62  LYS LYS A . n 
A 1 68  TYR 68  63  63  TYR TYR A . n 
A 1 69  LEU 69  64  64  LEU LEU A . n 
A 1 70  PRO 70  65  65  PRO PRO A . n 
A 1 71  GLY 71  66  66  GLY GLY A . n 
A 1 72  HIS 72  67  67  HIS HIS A . n 
A 1 73  LYS 73  68  68  LYS LYS A . n 
A 1 74  LEU 74  69  69  LEU LEU A . n 
A 1 75  PRO 75  70  70  PRO PRO A . n 
A 1 76  PRO 76  71  71  PRO PRO A . n 
A 1 77  ASN 77  72  72  ASN ASN A . n 
A 1 78  VAL 78  73  73  VAL VAL A . n 
A 1 79  VAL 79  74  74  VAL VAL A . n 
A 1 80  ALA 80  75  75  ALA ALA A . n 
A 1 81  VAL 81  76  76  VAL VAL A . n 
A 1 82  PRO 82  77  77  PRO PRO A . n 
A 1 83  ASP 83  78  78  ASP ASP A . n 
A 1 84  VAL 84  79  79  VAL VAL A . n 
A 1 85  VAL 85  80  80  VAL VAL A . n 
A 1 86  GLN 86  81  81  GLN GLN A . n 
A 1 87  ALA 87  82  82  ALA ALA A . n 
A 1 88  ALA 88  83  83  ALA ALA A . n 
A 1 89  GLU 89  84  84  GLU GLU A . n 
A 1 90  ASP 90  85  85  ASP ASP A . n 
A 1 91  ALA 91  86  86  ALA ALA A . n 
A 1 92  ASP 92  87  87  ASP ASP A . n 
A 1 93  ILE 93  88  88  ILE ILE A . n 
A 1 94  LEU 94  89  89  LEU LEU A . n 
A 1 95  ILE 95  90  90  ILE ILE A . n 
A 1 96  PHE 96  91  91  PHE PHE A . n 
A 1 97  VAL 97  92  92  VAL VAL A . n 
A 1 98  VAL 98  93  93  VAL VAL A . n 
A 1 99  PRO 99  94  94  PRO PRO A . n 
A 1 100 HIS 100 95  95  HIS HIS A . n 
A 1 101 GLN 101 96  96  GLN GLN A . n 
A 1 102 PHE 102 97  97  PHE PHE A . n 
A 1 103 ILE 103 98  98  ILE ILE A . n 
A 1 104 GLY 104 99  99  GLY GLY A . n 
A 1 105 LYS 105 100 100 LYS LYS A . n 
A 1 106 ILE 106 101 101 ILE ILE A . n 
A 1 107 CYS 107 102 102 CYS CYS A . n 
A 1 108 ASP 108 103 103 ASP ASP A . n 
A 1 109 GLN 109 104 104 GLN GLN A . n 
A 1 110 LEU 110 105 105 LEU LEU A . n 
A 1 111 LYS 111 106 106 LYS LYS A . n 
A 1 112 GLY 112 107 107 GLY GLY A . n 
A 1 113 HIS 113 108 108 HIS HIS A . n 
A 1 114 LEU 114 109 109 LEU LEU A . n 
A 1 115 LYS 115 110 110 LYS LYS A . n 
A 1 116 ALA 116 111 111 ALA ALA A . n 
A 1 117 ASN 117 112 112 ASN ASN A . n 
A 1 118 ALA 118 113 113 ALA ALA A . n 
A 1 119 THR 119 114 114 THR THR A . n 
A 1 120 GLY 120 115 115 GLY GLY A . n 
A 1 121 ILE 121 116 116 ILE ILE A . n 
A 1 122 SER 122 117 117 SER SER A . n 
A 1 123 LEU 123 118 118 LEU LEU A . n 
A 1 124 ILE 124 119 119 ILE ILE A . n 
A 1 125 LYS 125 120 120 LYS LYS A . n 
A 1 126 GLY 126 121 121 GLY GLY A . n 
A 1 127 VAL 127 122 122 VAL VAL A . n 
A 1 128 ASP 128 123 123 ASP ASP A . n 
A 1 129 GLU 129 124 124 GLU GLU A . n 
A 1 130 GLY 130 125 125 GLY GLY A . n 
A 1 131 PRO 131 126 126 PRO PRO A . n 
A 1 132 ASN 132 127 127 ASN ASN A . n 
A 1 133 GLY 133 128 128 GLY GLY A . n 
A 1 134 LEU 134 129 129 LEU LEU A . n 
A 1 135 LYS 135 130 130 LYS LYS A . n 
A 1 136 LEU 136 131 131 LEU LEU A . n 
A 1 137 ILE 137 132 132 ILE ILE A . n 
A 1 138 SER 138 133 133 SER SER A . n 
A 1 139 GLU 139 134 134 GLU GLU A . n 
A 1 140 VAL 140 135 135 VAL VAL A . n 
A 1 141 ILE 141 136 136 ILE ILE A . n 
A 1 142 GLY 142 137 137 GLY GLY A . n 
A 1 143 GLU 143 138 138 GLU GLU A . n 
A 1 144 ARG 144 139 139 ARG ARG A . n 
A 1 145 LEU 145 140 140 LEU LEU A . n 
A 1 146 GLY 146 141 141 GLY GLY A . n 
A 1 147 ILE 147 142 142 ILE ILE A . n 
A 1 148 PRO 148 143 143 PRO PRO A . n 
A 1 149 MET 149 144 144 MET MET A . n 
A 1 150 SER 150 145 145 SER SER A . n 
A 1 151 VAL 151 146 146 VAL VAL A . n 
A 1 152 LEU 152 147 147 LEU LEU A . n 
A 1 153 MET 153 148 148 MET MET A . n 
A 1 154 GLY 154 149 149 GLY GLY A . n 
A 1 155 ALA 155 150 150 ALA ALA A . n 
A 1 156 ASN 156 151 151 ASN ASN A . n 
A 1 157 ILE 157 152 152 ILE ILE A . n 
A 1 158 ALA 158 153 153 ALA ALA A . n 
A 1 159 SER 159 154 154 SER SER A . n 
A 1 160 GLU 160 155 155 GLU GLU A . n 
A 1 161 VAL 161 156 156 VAL VAL A . n 
A 1 162 ALA 162 157 157 ALA ALA A . n 
A 1 163 ASP 163 158 158 ASP ASP A . n 
A 1 164 GLU 164 159 159 GLU GLU A . n 
A 1 165 LYS 165 160 160 LYS LYS A . n 
A 1 166 PHE 166 161 161 PHE PHE A . n 
A 1 167 CYS 167 162 162 CYS CYS A . n 
A 1 168 GLU 168 163 163 GLU GLU A . n 
A 1 169 THR 169 164 164 THR THR A . n 
A 1 170 THR 170 165 165 THR THR A . n 
A 1 171 ILE 171 166 166 ILE ILE A . n 
A 1 172 GLY 172 167 167 GLY GLY A . n 
A 1 173 CYS 173 168 168 CYS CYS A . n 
A 1 174 LYS 174 169 169 LYS LYS A . n 
A 1 175 ASP 175 170 170 ASP ASP A . n 
A 1 176 PRO 176 171 171 PRO PRO A . n 
A 1 177 ALA 177 172 172 ALA ALA A . n 
A 1 178 GLN 178 173 173 GLN GLN A . n 
A 1 179 GLY 179 174 174 GLY GLY A . n 
A 1 180 GLN 180 175 175 GLN GLN A . n 
A 1 181 LEU 181 176 176 LEU LEU A . n 
A 1 182 LEU 182 177 177 LEU LEU A . n 
A 1 183 LYS 183 178 178 LYS LYS A . n 
A 1 184 GLU 184 179 179 GLU GLU A . n 
A 1 185 LEU 185 180 180 LEU LEU A . n 
A 1 186 MET 186 181 181 MET MET A . n 
A 1 187 GLN 187 182 182 GLN GLN A . n 
A 1 188 THR 188 183 183 THR THR A . n 
A 1 189 PRO 189 184 184 PRO PRO A . n 
A 1 190 ASN 190 185 185 ASN ASN A . n 
A 1 191 PHE 191 186 186 PHE PHE A . n 
A 1 192 ARG 192 187 187 ARG ARG A . n 
A 1 193 ILE 193 188 188 ILE ILE A . n 
A 1 194 THR 194 189 189 THR THR A . n 
A 1 195 VAL 195 190 190 VAL VAL A . n 
A 1 196 VAL 196 191 191 VAL VAL A . n 
A 1 197 GLN 197 192 192 GLN GLN A . n 
A 1 198 GLU 198 193 193 GLU GLU A . n 
A 1 199 VAL 199 194 194 VAL VAL A . n 
A 1 200 ASP 200 195 195 ASP ASP A . n 
A 1 201 THR 201 196 196 THR THR A . n 
A 1 202 VAL 202 197 197 VAL VAL A . n 
A 1 203 GLU 203 198 198 GLU GLU A . n 
A 1 204 ILE 204 199 199 ILE ILE A . n 
A 1 205 CYS 205 200 200 CYS CYS A . n 
A 1 206 GLY 206 201 201 GLY GLY A . n 
A 1 207 ALA 207 202 202 ALA ALA A . n 
A 1 208 LEU 208 203 203 LEU LEU A . n 
A 1 209 LYS 209 204 204 LYS LYS A . n 
A 1 210 ASN 210 205 205 ASN ASN A . n 
A 1 211 VAL 211 206 206 VAL VAL A . n 
A 1 212 VAL 212 207 207 VAL VAL A . n 
A 1 213 ALA 213 208 208 ALA ALA A . n 
A 1 214 VAL 214 209 209 VAL VAL A . n 
A 1 215 GLY 215 210 210 GLY GLY A . n 
A 1 216 ALA 216 211 211 ALA ALA A . n 
A 1 217 GLY 217 212 212 GLY GLY A . n 
A 1 218 PHE 218 213 213 PHE PHE A . n 
A 1 219 CYS 219 214 214 CYS CYS A . n 
A 1 220 ASP 220 215 215 ASP ASP A . n 
A 1 221 GLY 221 216 216 GLY GLY A . n 
A 1 222 LEU 222 217 217 LEU LEU A . n 
A 1 223 GLY 223 218 218 GLY GLY A . n 
A 1 224 PHE 224 219 219 PHE PHE A . n 
A 1 225 GLY 225 220 220 GLY GLY A . n 
A 1 226 ASP 226 221 221 ASP ASP A . n 
A 1 227 ASN 227 222 222 ASN ASN A . n 
A 1 228 THR 228 223 223 THR THR A . n 
A 1 229 LYS 229 224 224 LYS LYS A . n 
A 1 230 ALA 230 225 225 ALA ALA A . n 
A 1 231 ALA 231 226 226 ALA ALA A . n 
A 1 232 VAL 232 227 227 VAL VAL A . n 
A 1 233 ILE 233 228 228 ILE ILE A . n 
A 1 234 ARG 234 229 229 ARG ARG A . n 
A 1 235 LEU 235 230 230 LEU LEU A . n 
A 1 236 GLY 236 231 231 GLY GLY A . n 
A 1 237 LEU 237 232 232 LEU LEU A . n 
A 1 238 MET 238 233 233 MET MET A . n 
A 1 239 GLU 239 234 234 GLU GLU A . n 
A 1 240 MET 240 235 235 MET MET A . n 
A 1 241 ILE 241 236 236 ILE ILE A . n 
A 1 242 ALA 242 237 237 ALA ALA A . n 
A 1 243 PHE 243 238 238 PHE PHE A . n 
A 1 244 ALA 244 239 239 ALA ALA A . n 
A 1 245 LYS 245 240 240 LYS LYS A . n 
A 1 246 LEU 246 241 241 LEU LEU A . n 
A 1 247 PHE 247 242 242 PHE PHE A . n 
A 1 248 CYS 248 243 243 CYS CYS A . n 
A 1 249 SER 249 244 244 SER SER A . n 
A 1 250 GLY 250 245 245 GLY GLY A . n 
A 1 251 PRO 251 246 246 PRO PRO A . n 
A 1 252 VAL 252 247 247 VAL VAL A . n 
A 1 253 SER 253 248 248 SER SER A . n 
A 1 254 SER 254 249 249 SER SER A . n 
A 1 255 ALA 255 250 250 ALA ALA A . n 
A 1 256 THR 256 251 251 THR THR A . n 
A 1 257 PHE 257 252 252 PHE PHE A . n 
A 1 258 LEU 258 253 253 LEU LEU A . n 
A 1 259 GLU 259 254 254 GLU GLU A . n 
A 1 260 SER 260 255 255 SER SER A . n 
A 1 261 CYS 261 256 256 CYS CYS A . n 
A 1 262 GLY 262 257 257 GLY GLY A . n 
A 1 263 VAL 263 258 258 VAL VAL A . n 
A 1 264 ALA 264 259 259 ALA ALA A . n 
A 1 265 ASP 265 260 260 ASP ASP A . n 
A 1 266 LEU 266 261 261 LEU LEU A . n 
A 1 267 ILE 267 262 262 ILE ILE A . n 
A 1 268 THR 268 263 263 THR THR A . n 
A 1 269 THR 269 264 264 THR THR A . n 
A 1 270 CYS 270 265 265 CYS CYS A . n 
A 1 271 TYR 271 266 266 TYR TYR A . n 
A 1 272 GLY 272 267 267 GLY GLY A . n 
A 1 273 GLY 273 268 268 GLY GLY A . n 
A 1 274 ARG 274 269 269 ARG ARG A . n 
A 1 275 ASN 275 270 270 ASN ASN A . n 
A 1 276 ARG 276 271 271 ARG ARG A . n 
A 1 277 LYS 277 272 272 LYS LYS A . n 
A 1 278 VAL 278 273 273 VAL VAL A . n 
A 1 279 ALA 279 274 274 ALA ALA A . n 
A 1 280 GLU 280 275 275 GLU GLU A . n 
A 1 281 ALA 281 276 276 ALA ALA A . n 
A 1 282 PHE 282 277 277 PHE PHE A . n 
A 1 283 ALA 283 278 278 ALA ALA A . n 
A 1 284 ARG 284 279 279 ARG ARG A . n 
A 1 285 THR 285 280 280 THR THR A . n 
A 1 286 GLY 286 281 281 GLY GLY A . n 
A 1 287 LYS 287 282 282 LYS LYS A . n 
A 1 288 SER 288 283 283 SER SER A . n 
A 1 289 ILE 289 284 284 ILE ILE A . n 
A 1 290 GLU 290 285 285 GLU GLU A . n 
A 1 291 GLN 291 286 286 GLN GLN A . n 
A 1 292 LEU 292 287 287 LEU LEU A . n 
A 1 293 GLU 293 288 288 GLU GLU A . n 
A 1 294 LYS 294 289 289 LYS LYS A . n 
A 1 295 GLU 295 290 290 GLU GLU A . n 
A 1 296 LEU 296 291 291 LEU LEU A . n 
A 1 297 LEU 297 292 292 LEU LEU A . n 
A 1 298 ASN 298 293 293 ASN ASN A . n 
A 1 299 GLY 299 294 294 GLY GLY A . n 
A 1 300 GLN 300 295 295 GLN GLN A . n 
A 1 301 LYS 301 296 296 LYS LYS A . n 
A 1 302 LEU 302 297 297 LEU LEU A . n 
A 1 303 GLN 303 298 298 GLN GLN A . n 
A 1 304 GLY 304 299 299 GLY GLY A . n 
A 1 305 PRO 305 300 300 PRO PRO A . n 
A 1 306 GLU 306 301 301 GLU GLU A . n 
A 1 307 THR 307 302 302 THR THR A . n 
A 1 308 ALA 308 303 303 ALA ALA A . n 
A 1 309 ARG 309 304 304 ARG ARG A . n 
A 1 310 GLU 310 305 305 GLU GLU A . n 
A 1 311 LEU 311 306 306 LEU LEU A . n 
A 1 312 TYR 312 307 307 TYR TYR A . n 
A 1 313 SER 313 308 308 SER SER A . n 
A 1 314 ILE 314 309 309 ILE ILE A . n 
A 1 315 LEU 315 310 310 LEU LEU A . n 
A 1 316 GLN 316 311 311 GLN GLN A . n 
A 1 317 HIS 317 312 312 HIS HIS A . n 
A 1 318 LYS 318 313 313 LYS LYS A . n 
A 1 319 GLY 319 314 314 GLY GLY A . n 
A 1 320 LEU 320 315 315 LEU LEU A . n 
A 1 321 VAL 321 316 316 VAL VAL A . n 
A 1 322 ASP 322 317 317 ASP ASP A . n 
A 1 323 LYS 323 318 318 LYS LYS A . n 
A 1 324 PHE 324 319 319 PHE PHE A . n 
A 1 325 PRO 325 320 320 PRO PRO A . n 
A 1 326 LEU 326 321 321 LEU LEU A . n 
A 1 327 PHE 327 322 322 PHE PHE A . n 
A 1 328 MET 328 323 323 MET MET A . n 
A 1 329 ALA 329 324 324 ALA ALA A . n 
A 1 330 VAL 330 325 325 VAL VAL A . n 
A 1 331 TYR 331 326 326 TYR TYR A . n 
A 1 332 LYS 332 327 327 LYS LYS A . n 
A 1 333 VAL 333 328 328 VAL VAL A . n 
A 1 334 CYS 334 329 329 CYS CYS A . n 
A 1 335 TYR 335 330 330 TYR TYR A . n 
A 1 336 GLU 336 331 331 GLU GLU A . n 
A 1 337 GLY 337 332 332 GLY GLY A . n 
A 1 338 GLN 338 333 333 GLN GLN A . n 
A 1 339 PRO 339 334 334 PRO PRO A . n 
A 1 340 VAL 340 335 335 VAL VAL A . n 
A 1 341 GLY 341 336 336 GLY GLY A . n 
A 1 342 GLU 342 337 337 GLU GLU A . n 
A 1 343 PHE 343 338 338 PHE PHE A . n 
A 1 344 ILE 344 339 339 ILE ILE A . n 
A 1 345 HIS 345 340 340 HIS HIS A . n 
A 1 346 CYS 346 341 341 CYS CYS A . n 
A 1 347 LEU 347 342 342 LEU LEU A . n 
A 1 348 GLN 348 343 343 GLN GLN A . n 
A 1 349 ASN 349 344 344 ASN ASN A . n 
A 1 350 HIS 350 345 345 HIS HIS A . n 
A 1 351 PRO 351 346 346 PRO PRO A . n 
A 1 352 GLU 352 347 347 GLU GLU A . n 
A 1 353 HIS 353 348 348 HIS HIS A . n 
A 1 354 MET 354 349 349 MET MET A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1   1001 1001 SO4 SO4 A . 
C 2 SO4 1   1002 1002 SO4 SO4 A . 
D 2 SO4 1   1003 1003 SO4 SO4 A . 
E 2 SO4 1   1004 1004 SO4 SO4 A . 
F 2 SO4 1   1005 1005 SO4 SO4 A . 
G 3 NAD 1   2001 2001 NAD NAD A . 
H 4 HOH 1   2002 1    HOH HOH A . 
H 4 HOH 2   2003 2    HOH HOH A . 
H 4 HOH 3   2004 3    HOH HOH A . 
H 4 HOH 4   2005 4    HOH HOH A . 
H 4 HOH 5   2006 5    HOH HOH A . 
H 4 HOH 6   2007 6    HOH HOH A . 
H 4 HOH 7   2008 7    HOH HOH A . 
H 4 HOH 8   2009 8    HOH HOH A . 
H 4 HOH 9   2010 9    HOH HOH A . 
H 4 HOH 10  2011 10   HOH HOH A . 
H 4 HOH 11  2012 11   HOH HOH A . 
H 4 HOH 12  2013 12   HOH HOH A . 
H 4 HOH 13  2014 13   HOH HOH A . 
H 4 HOH 14  2015 14   HOH HOH A . 
H 4 HOH 15  2016 15   HOH HOH A . 
H 4 HOH 16  2017 16   HOH HOH A . 
H 4 HOH 17  2018 17   HOH HOH A . 
H 4 HOH 18  2019 18   HOH HOH A . 
H 4 HOH 19  2020 19   HOH HOH A . 
H 4 HOH 20  2021 20   HOH HOH A . 
H 4 HOH 21  2022 21   HOH HOH A . 
H 4 HOH 22  2023 22   HOH HOH A . 
H 4 HOH 23  2024 24   HOH HOH A . 
H 4 HOH 24  2025 25   HOH HOH A . 
H 4 HOH 25  2026 26   HOH HOH A . 
H 4 HOH 26  2027 27   HOH HOH A . 
H 4 HOH 27  2028 28   HOH HOH A . 
H 4 HOH 28  2029 29   HOH HOH A . 
H 4 HOH 29  2030 30   HOH HOH A . 
H 4 HOH 30  2031 31   HOH HOH A . 
H 4 HOH 31  2032 32   HOH HOH A . 
H 4 HOH 32  2033 33   HOH HOH A . 
H 4 HOH 33  2034 34   HOH HOH A . 
H 4 HOH 34  2035 35   HOH HOH A . 
H 4 HOH 35  2036 36   HOH HOH A . 
H 4 HOH 36  2037 37   HOH HOH A . 
H 4 HOH 37  2038 38   HOH HOH A . 
H 4 HOH 38  2039 39   HOH HOH A . 
H 4 HOH 39  2040 40   HOH HOH A . 
H 4 HOH 40  2041 41   HOH HOH A . 
H 4 HOH 41  2042 42   HOH HOH A . 
H 4 HOH 42  2043 43   HOH HOH A . 
H 4 HOH 43  2044 44   HOH HOH A . 
H 4 HOH 44  2045 45   HOH HOH A . 
H 4 HOH 45  2046 46   HOH HOH A . 
H 4 HOH 46  2047 47   HOH HOH A . 
H 4 HOH 47  2048 48   HOH HOH A . 
H 4 HOH 48  2049 49   HOH HOH A . 
H 4 HOH 49  2050 50   HOH HOH A . 
H 4 HOH 50  2051 51   HOH HOH A . 
H 4 HOH 51  2052 52   HOH HOH A . 
H 4 HOH 52  2053 53   HOH HOH A . 
H 4 HOH 53  2054 54   HOH HOH A . 
H 4 HOH 54  2055 55   HOH HOH A . 
H 4 HOH 55  2056 56   HOH HOH A . 
H 4 HOH 56  2057 57   HOH HOH A . 
H 4 HOH 57  2058 58   HOH HOH A . 
H 4 HOH 58  2059 59   HOH HOH A . 
H 4 HOH 59  2060 60   HOH HOH A . 
H 4 HOH 60  2061 61   HOH HOH A . 
H 4 HOH 61  2062 62   HOH HOH A . 
H 4 HOH 62  2063 63   HOH HOH A . 
H 4 HOH 63  2064 64   HOH HOH A . 
H 4 HOH 64  2065 65   HOH HOH A . 
H 4 HOH 65  2066 66   HOH HOH A . 
H 4 HOH 66  2067 67   HOH HOH A . 
H 4 HOH 67  2068 68   HOH HOH A . 
H 4 HOH 68  2069 69   HOH HOH A . 
H 4 HOH 69  2070 70   HOH HOH A . 
H 4 HOH 70  2071 71   HOH HOH A . 
H 4 HOH 71  2072 72   HOH HOH A . 
H 4 HOH 72  2073 73   HOH HOH A . 
H 4 HOH 73  2074 74   HOH HOH A . 
H 4 HOH 74  2075 75   HOH HOH A . 
H 4 HOH 75  2076 76   HOH HOH A . 
H 4 HOH 76  2077 77   HOH HOH A . 
H 4 HOH 77  2078 78   HOH HOH A . 
H 4 HOH 78  2079 79   HOH HOH A . 
H 4 HOH 79  2080 80   HOH HOH A . 
H 4 HOH 80  2081 81   HOH HOH A . 
H 4 HOH 81  2082 82   HOH HOH A . 
H 4 HOH 82  2083 83   HOH HOH A . 
H 4 HOH 83  2084 84   HOH HOH A . 
H 4 HOH 84  2085 85   HOH HOH A . 
H 4 HOH 85  2086 86   HOH HOH A . 
H 4 HOH 86  2087 87   HOH HOH A . 
H 4 HOH 87  2088 89   HOH HOH A . 
H 4 HOH 88  2089 91   HOH HOH A . 
H 4 HOH 89  2090 92   HOH HOH A . 
H 4 HOH 90  2091 93   HOH HOH A . 
H 4 HOH 91  2092 94   HOH HOH A . 
H 4 HOH 92  2093 95   HOH HOH A . 
H 4 HOH 93  2094 96   HOH HOH A . 
H 4 HOH 94  2095 97   HOH HOH A . 
H 4 HOH 95  2096 98   HOH HOH A . 
H 4 HOH 96  2097 99   HOH HOH A . 
H 4 HOH 97  2098 100  HOH HOH A . 
H 4 HOH 98  2099 101  HOH HOH A . 
H 4 HOH 99  2100 102  HOH HOH A . 
H 4 HOH 100 2101 104  HOH HOH A . 
H 4 HOH 101 2102 105  HOH HOH A . 
H 4 HOH 102 2103 106  HOH HOH A . 
H 4 HOH 103 2104 107  HOH HOH A . 
H 4 HOH 104 2105 108  HOH HOH A . 
H 4 HOH 105 2106 109  HOH HOH A . 
H 4 HOH 106 2107 110  HOH HOH A . 
H 4 HOH 107 2108 111  HOH HOH A . 
H 4 HOH 108 2109 112  HOH HOH A . 
H 4 HOH 109 2110 113  HOH HOH A . 
H 4 HOH 110 2111 114  HOH HOH A . 
H 4 HOH 111 2112 115  HOH HOH A . 
H 4 HOH 112 2113 116  HOH HOH A . 
H 4 HOH 113 2114 117  HOH HOH A . 
H 4 HOH 114 2115 118  HOH HOH A . 
H 4 HOH 115 2116 119  HOH HOH A . 
H 4 HOH 116 2117 120  HOH HOH A . 
H 4 HOH 117 2118 121  HOH HOH A . 
H 4 HOH 118 2119 122  HOH HOH A . 
H 4 HOH 119 2120 124  HOH HOH A . 
H 4 HOH 120 2121 125  HOH HOH A . 
H 4 HOH 121 2122 126  HOH HOH A . 
H 4 HOH 122 2123 127  HOH HOH A . 
H 4 HOH 123 2124 128  HOH HOH A . 
H 4 HOH 124 2125 129  HOH HOH A . 
H 4 HOH 125 2126 130  HOH HOH A . 
H 4 HOH 126 2127 131  HOH HOH A . 
H 4 HOH 127 2128 133  HOH HOH A . 
H 4 HOH 128 2129 134  HOH HOH A . 
H 4 HOH 129 2130 135  HOH HOH A . 
H 4 HOH 130 2131 136  HOH HOH A . 
H 4 HOH 131 2132 137  HOH HOH A . 
H 4 HOH 132 2133 138  HOH HOH A . 
H 4 HOH 133 2134 139  HOH HOH A . 
H 4 HOH 134 2135 140  HOH HOH A . 
H 4 HOH 135 2136 142  HOH HOH A . 
H 4 HOH 136 2137 143  HOH HOH A . 
H 4 HOH 137 2138 144  HOH HOH A . 
H 4 HOH 138 2139 145  HOH HOH A . 
H 4 HOH 139 2140 146  HOH HOH A . 
H 4 HOH 140 2141 147  HOH HOH A . 
H 4 HOH 141 2142 148  HOH HOH A . 
H 4 HOH 142 2143 149  HOH HOH A . 
H 4 HOH 143 2144 150  HOH HOH A . 
H 4 HOH 144 2145 151  HOH HOH A . 
H 4 HOH 145 2146 152  HOH HOH A . 
H 4 HOH 146 2147 153  HOH HOH A . 
H 4 HOH 147 2148 155  HOH HOH A . 
H 4 HOH 148 2149 156  HOH HOH A . 
H 4 HOH 149 2150 157  HOH HOH A . 
H 4 HOH 150 2151 158  HOH HOH A . 
H 4 HOH 151 2152 159  HOH HOH A . 
H 4 HOH 152 2153 160  HOH HOH A . 
H 4 HOH 153 2154 161  HOH HOH A . 
H 4 HOH 154 2155 162  HOH HOH A . 
H 4 HOH 155 2156 163  HOH HOH A . 
H 4 HOH 156 2157 164  HOH HOH A . 
H 4 HOH 157 2158 165  HOH HOH A . 
H 4 HOH 158 2159 166  HOH HOH A . 
H 4 HOH 159 2160 167  HOH HOH A . 
H 4 HOH 160 2161 169  HOH HOH A . 
H 4 HOH 161 2162 170  HOH HOH A . 
H 4 HOH 162 2163 171  HOH HOH A . 
H 4 HOH 163 2164 172  HOH HOH A . 
H 4 HOH 164 2165 173  HOH HOH A . 
H 4 HOH 165 2166 174  HOH HOH A . 
H 4 HOH 166 2167 177  HOH HOH A . 
H 4 HOH 167 2168 178  HOH HOH A . 
H 4 HOH 168 2169 179  HOH HOH A . 
H 4 HOH 169 2170 180  HOH HOH A . 
H 4 HOH 170 2171 181  HOH HOH A . 
H 4 HOH 171 2172 182  HOH HOH A . 
H 4 HOH 172 2173 183  HOH HOH A . 
H 4 HOH 173 2174 184  HOH HOH A . 
H 4 HOH 174 2175 186  HOH HOH A . 
H 4 HOH 175 2176 187  HOH HOH A . 
H 4 HOH 176 2177 190  HOH HOH A . 
H 4 HOH 177 2178 191  HOH HOH A . 
H 4 HOH 178 2179 193  HOH HOH A . 
H 4 HOH 179 2180 194  HOH HOH A . 
H 4 HOH 180 2181 195  HOH HOH A . 
H 4 HOH 181 2182 197  HOH HOH A . 
H 4 HOH 182 2183 198  HOH HOH A . 
H 4 HOH 183 2184 199  HOH HOH A . 
H 4 HOH 184 2185 201  HOH HOH A . 
H 4 HOH 185 2186 202  HOH HOH A . 
H 4 HOH 186 2187 203  HOH HOH A . 
H 4 HOH 187 2188 204  HOH HOH A . 
H 4 HOH 188 2189 207  HOH HOH A . 
H 4 HOH 189 2190 208  HOH HOH A . 
H 4 HOH 190 2191 209  HOH HOH A . 
H 4 HOH 191 2192 210  HOH HOH A . 
H 4 HOH 192 2193 211  HOH HOH A . 
H 4 HOH 193 2194 212  HOH HOH A . 
H 4 HOH 194 2195 213  HOH HOH A . 
H 4 HOH 195 2196 214  HOH HOH A . 
H 4 HOH 196 2197 217  HOH HOH A . 
H 4 HOH 197 2198 219  HOH HOH A . 
H 4 HOH 198 2199 220  HOH HOH A . 
H 4 HOH 199 2200 222  HOH HOH A . 
H 4 HOH 200 2201 224  HOH HOH A . 
H 4 HOH 201 2202 225  HOH HOH A . 
H 4 HOH 202 2203 226  HOH HOH A . 
H 4 HOH 203 2204 227  HOH HOH A . 
H 4 HOH 204 2205 228  HOH HOH A . 
H 4 HOH 205 2206 229  HOH HOH A . 
H 4 HOH 206 2207 230  HOH HOH A . 
H 4 HOH 207 2208 231  HOH HOH A . 
H 4 HOH 208 2209 233  HOH HOH A . 
H 4 HOH 209 2210 234  HOH HOH A . 
H 4 HOH 210 2211 236  HOH HOH A . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?        monomeric 1 
2 software_defined_assembly PISA,PQS dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D,E,F,G,H 
2 1,2 A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 7860  ? 
2 MORE         -161  ? 
2 'SSA (A^2)'  25320 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z           1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000    
2 'crystal symmetry operation' 6_553 x,-y+1/2,-z-7/4 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 
-1.0000000000 0.0000000000 58.2995000000 0.0000000000 0.0000000000 -1.0000000000 -269.0485000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-04-11 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MAR345    'data collection' . ? 1 
SCALEPACK 'data scaling'    . ? 2 
CNS       refinement        . ? 3 
CNS       phasing           . ? 4 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             PHE 
_pdbx_validate_rmsd_angle.auth_seq_id_1              319 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              320 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              320 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                131.47 
_pdbx_validate_rmsd_angle.angle_target_value         119.30 
_pdbx_validate_rmsd_angle.angle_deviation            12.17 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.50 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 MET A 1   ? ? 50.69   149.59 
2 1 SER A 11  ? ? -158.26 20.52  
3 1 ASN A 60  ? ? -107.09 67.06  
4 1 LYS A 106 ? ? -39.97  120.40 
5 1 PRO A 126 ? ? -45.90  -19.90 
6 1 ASN A 127 ? ? -150.72 78.10  
7 1 ASN A 293 ? ? 33.17   47.30  
8 1 HIS A 312 ? ? -67.59  3.52   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY -4 ? A GLY 1 
2 1 Y 1 A PRO -3 ? A PRO 2 
3 1 Y 1 A LEU -2 ? A LEU 3 
4 1 Y 1 A GLY -1 ? A GLY 4 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION'                     SO4 
3 NICOTINAMIDE-ADENINE-DINUCLEOTIDE NAD 
4 water                             HOH 
#