data_1X2W
# 
_entry.id   1X2W 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1X2W         
RCSB  RCSB024310   
WWPDB D_1000024310 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1X2T 
_pdbx_database_related.details        'Habu IX-bp at pH 6.5' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1X2W 
_pdbx_database_status.recvd_initial_deposition_date   2005-04-26 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Suzuki, N.'   1 
'Fujimoto, Z.' 2 
'Morita, T.'   3 
'Fukamizu, A.' 4 
'Mizuno, H.'   5 
# 
_citation.id                        primary 
_citation.title                     
'pH-Dependent Structural Changes at Ca(2+)-binding sites of Coagulation Factor IX-binding Protein' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            353 
_citation.page_first                80 
_citation.page_last                 87 
_citation.year                      2005 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16165155 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2005.08.018 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Suzuki, N.'   1 
primary 'Fujimoto, Z.' 2 
primary 'Morita, T.'   3 
primary 'Fukamizu, A.' 4 
primary 'Mizuno, H.'   5 
# 
_cell.entry_id           1X2W 
_cell.length_a           134.121 
_cell.length_b           37.831 
_cell.length_c           55.828 
_cell.angle_alpha        90.00 
_cell.angle_beta         110.46 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1X2W 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'Coagulation factor IX/X-binding protein A chain'        14655.184 1   ? ? ? ? 
2 polymer     nat 'Coagulation factor IX/factor X-binding protein B chain' 14455.071 1   ? ? ? ? 
3 non-polymer syn 'CHLORIDE ION'                                           35.453    1   ? ? ? ? 
4 non-polymer syn 'RUBIDIUM ION'                                           85.468    2   ? ? ? ? 
5 non-polymer syn 'SULFATE ION'                                            96.063    1   ? ? ? ? 
6 water       nat water                                                    18.015    323 ? ? ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        IX/X-BP 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;DCPSGWSSYEGHCYKPFKLYKTWDDAERFCTEQAKGGHLVSIESAGEADFVAQLVTENIQNTKSYVWIGLRVQGKEKQCS
SEWSDGSSVSYENWIEAESKTCLGLEKETGFRKWVNIYCGQQNPFVCEA
;
;DCPSGWSSYEGHCYKPFKLYKTWDDAERFCTEQAKGGHLVSIESAGEADFVAQLVTENIQNTKSYVWIGLRVQGKEKQCS
SEWSDGSSVSYENWIEAESKTCLGLEKETGFRKWVNIYCGQQNPFVCEA
;
A ? 
2 'polypeptide(L)' no no 
;DCPSDWSSYEGHCYKPFSEPKNWADAENFCTQQHAGGHLVSFQSSEEADFVVKLAFQTFGHSIFWMGLSNVWNQCNWQWS
NAAMLRYKAWAEESYCVYFKSTNNKWRSRACRMMAQFVCEFQA
;
;DCPSDWSSYEGHCYKPFSEPKNWADAENFCTQQHAGGHLVSFQSSEEADFVVKLAFQTFGHSIFWMGLSNVWNQCNWQWS
NAAMLRYKAWAEESYCVYFKSTNNKWRSRACRMMAQFVCEFQA
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   CYS n 
1 3   PRO n 
1 4   SER n 
1 5   GLY n 
1 6   TRP n 
1 7   SER n 
1 8   SER n 
1 9   TYR n 
1 10  GLU n 
1 11  GLY n 
1 12  HIS n 
1 13  CYS n 
1 14  TYR n 
1 15  LYS n 
1 16  PRO n 
1 17  PHE n 
1 18  LYS n 
1 19  LEU n 
1 20  TYR n 
1 21  LYS n 
1 22  THR n 
1 23  TRP n 
1 24  ASP n 
1 25  ASP n 
1 26  ALA n 
1 27  GLU n 
1 28  ARG n 
1 29  PHE n 
1 30  CYS n 
1 31  THR n 
1 32  GLU n 
1 33  GLN n 
1 34  ALA n 
1 35  LYS n 
1 36  GLY n 
1 37  GLY n 
1 38  HIS n 
1 39  LEU n 
1 40  VAL n 
1 41  SER n 
1 42  ILE n 
1 43  GLU n 
1 44  SER n 
1 45  ALA n 
1 46  GLY n 
1 47  GLU n 
1 48  ALA n 
1 49  ASP n 
1 50  PHE n 
1 51  VAL n 
1 52  ALA n 
1 53  GLN n 
1 54  LEU n 
1 55  VAL n 
1 56  THR n 
1 57  GLU n 
1 58  ASN n 
1 59  ILE n 
1 60  GLN n 
1 61  ASN n 
1 62  THR n 
1 63  LYS n 
1 64  SER n 
1 65  TYR n 
1 66  VAL n 
1 67  TRP n 
1 68  ILE n 
1 69  GLY n 
1 70  LEU n 
1 71  ARG n 
1 72  VAL n 
1 73  GLN n 
1 74  GLY n 
1 75  LYS n 
1 76  GLU n 
1 77  LYS n 
1 78  GLN n 
1 79  CYS n 
1 80  SER n 
1 81  SER n 
1 82  GLU n 
1 83  TRP n 
1 84  SER n 
1 85  ASP n 
1 86  GLY n 
1 87  SER n 
1 88  SER n 
1 89  VAL n 
1 90  SER n 
1 91  TYR n 
1 92  GLU n 
1 93  ASN n 
1 94  TRP n 
1 95  ILE n 
1 96  GLU n 
1 97  ALA n 
1 98  GLU n 
1 99  SER n 
1 100 LYS n 
1 101 THR n 
1 102 CYS n 
1 103 LEU n 
1 104 GLY n 
1 105 LEU n 
1 106 GLU n 
1 107 LYS n 
1 108 GLU n 
1 109 THR n 
1 110 GLY n 
1 111 PHE n 
1 112 ARG n 
1 113 LYS n 
1 114 TRP n 
1 115 VAL n 
1 116 ASN n 
1 117 ILE n 
1 118 TYR n 
1 119 CYS n 
1 120 GLY n 
1 121 GLN n 
1 122 GLN n 
1 123 ASN n 
1 124 PRO n 
1 125 PHE n 
1 126 VAL n 
1 127 CYS n 
1 128 GLU n 
1 129 ALA n 
2 1   ASP n 
2 2   CYS n 
2 3   PRO n 
2 4   SER n 
2 5   ASP n 
2 6   TRP n 
2 7   SER n 
2 8   SER n 
2 9   TYR n 
2 10  GLU n 
2 11  GLY n 
2 12  HIS n 
2 13  CYS n 
2 14  TYR n 
2 15  LYS n 
2 16  PRO n 
2 17  PHE n 
2 18  SER n 
2 19  GLU n 
2 20  PRO n 
2 21  LYS n 
2 22  ASN n 
2 23  TRP n 
2 24  ALA n 
2 25  ASP n 
2 26  ALA n 
2 27  GLU n 
2 28  ASN n 
2 29  PHE n 
2 30  CYS n 
2 31  THR n 
2 32  GLN n 
2 33  GLN n 
2 34  HIS n 
2 35  ALA n 
2 36  GLY n 
2 37  GLY n 
2 38  HIS n 
2 39  LEU n 
2 40  VAL n 
2 41  SER n 
2 42  PHE n 
2 43  GLN n 
2 44  SER n 
2 45  SER n 
2 46  GLU n 
2 47  GLU n 
2 48  ALA n 
2 49  ASP n 
2 50  PHE n 
2 51  VAL n 
2 52  VAL n 
2 53  LYS n 
2 54  LEU n 
2 55  ALA n 
2 56  PHE n 
2 57  GLN n 
2 58  THR n 
2 59  PHE n 
2 60  GLY n 
2 61  HIS n 
2 62  SER n 
2 63  ILE n 
2 64  PHE n 
2 65  TRP n 
2 66  MET n 
2 67  GLY n 
2 68  LEU n 
2 69  SER n 
2 70  ASN n 
2 71  VAL n 
2 72  TRP n 
2 73  ASN n 
2 74  GLN n 
2 75  CYS n 
2 76  ASN n 
2 77  TRP n 
2 78  GLN n 
2 79  TRP n 
2 80  SER n 
2 81  ASN n 
2 82  ALA n 
2 83  ALA n 
2 84  MET n 
2 85  LEU n 
2 86  ARG n 
2 87  TYR n 
2 88  LYS n 
2 89  ALA n 
2 90  TRP n 
2 91  ALA n 
2 92  GLU n 
2 93  GLU n 
2 94  SER n 
2 95  TYR n 
2 96  CYS n 
2 97  VAL n 
2 98  TYR n 
2 99  PHE n 
2 100 LYS n 
2 101 SER n 
2 102 THR n 
2 103 ASN n 
2 104 ASN n 
2 105 LYS n 
2 106 TRP n 
2 107 ARG n 
2 108 SER n 
2 109 ARG n 
2 110 ALA n 
2 111 CYS n 
2 112 ARG n 
2 113 MET n 
2 114 MET n 
2 115 ALA n 
2 116 GLN n 
2 117 PHE n 
2 118 VAL n 
2 119 CYS n 
2 120 GLU n 
2 121 PHE n 
2 122 GLN n 
2 123 ALA n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? ? 'Trimeresurus flavoviridis' 88087 Trimeresurus ? ? ? ? Venom ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 'Trimeresurus flavoviridis' 88087 Trimeresurus ? ? ? ? Venom ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q7LZ71_TRIFL Q7LZ71 1 
;DCPSGWSSYEGHCYKPFKLYKTWDDAERFCTEQAKGGHLVSIESAGEADFVAQLVTENIQNTKSYVWIGLRVQGKEKQCS
SEWSDGSSVSYENWIEAESKTCLGLEKETGFRKWVNIYCGQQNPFVCEA
;
1  ? 
2 UNP IXB_TRIFL    P23807 2 
;DCPSDWSSYEGHCYKPFSEPKNWADAENFCTQQHAGGHLVSFQSSEEADFVVKLAFQTFGHSIFWMGLSNVWNQCNWQWS
NAAMLRYKAWAEESYCVYFKSTNNKWRSRACRMMAQFVCEFQA
;
24 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1X2W A 1 ? 129 ? Q7LZ71 1  ? 129 ? 1 129 
2 2 1X2W B 1 ? 123 ? P23807 24 ? 146 ? 1 123 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
RB  non-polymer         . 'RUBIDIUM ION'  ? 'Rb 1'           85.468  
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1X2W 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.3 
_exptl_crystal.density_percent_sol   46.1 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pdbx_details    
'AMMONIUM SULPHATE, RUBIDIUM ACETATE, PEGMME 2000, pH 4.6, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS VII' 
_diffrn_detector.pdbx_collection_date   2003-09-11 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    COLLIMATION 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1X2W 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             36.2 
_reflns.d_resolution_high            2.29 
_reflns.number_obs                   11631 
_reflns.number_all                   12105 
_reflns.percent_possible_obs         95.7 
_reflns.pdbx_Rmerge_I_obs            0.086 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        7.3 
_reflns.B_iso_Wilson_estimate        39.9 
_reflns.pdbx_redundancy              3.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.29 
_reflns_shell.d_res_low              2.37 
_reflns_shell.percent_possible_all   89.8 
_reflns_shell.Rmerge_I_obs           0.272 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.3 
_reflns_shell.pdbx_redundancy        3.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1193 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1X2W 
_refine.ls_number_reflns_obs                     11542 
_refine.ls_number_reflns_all                     12064 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               984047.99 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             34.68 
_refine.ls_d_res_high                            2.29 
_refine.ls_percent_reflns_obs                    96.1 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.214 
_refine.ls_R_factor_R_free                       0.28 
_refine.ls_R_factor_R_free_error                 0.012 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  566 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               32.1 
_refine.aniso_B[1][1]                            5.77 
_refine.aniso_B[2][2]                            -1.12 
_refine.aniso_B[3][3]                            -4.66 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            4.99 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.35875 
_refine.solvent_model_param_bsol                 66.2253 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1BJ3' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1X2W 
_refine_analyze.Luzzati_coordinate_error_obs    0.28 
_refine_analyze.Luzzati_sigma_a_obs             0.31 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.33 
_refine_analyze.Luzzati_sigma_a_free            0.30 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2047 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         8 
_refine_hist.number_atoms_solvent             323 
_refine_hist.number_atoms_total               2378 
_refine_hist.d_res_high                       2.29 
_refine_hist.d_res_low                        34.68 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      22.7  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.73  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.36  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.17  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.00  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.89  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.29 
_refine_ls_shell.d_res_low                        2.43 
_refine_ls_shell.number_reflns_R_work             1801 
_refine_ls_shell.R_factor_R_work                  0.331 
_refine_ls_shell.percent_reflns_obs               94.6 
_refine_ls_shell.R_factor_R_free                  0.484 
_refine_ls_shell.R_factor_R_free_error            0.052 
_refine_ls_shell.percent_reflns_R_free            4.6 
_refine_ls_shell.number_reflns_R_free             87 
_refine_ls_shell.number_reflns_obs                1889 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 ion.param         ion.top     'X-RAY DIFFRACTION' 
3 water_rep.param   water.top   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1X2W 
_struct.title                     'Crystal Structure of Apo-Habu IX-bp at pH 4.6' 
_struct.pdbx_descriptor           
'Coagulation factor IX/X-binding protein A chain, Coagulation factor IX/factor X-binding protein B chain' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1X2W 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            'HETERODIMER, DOMAIN SWAPPING, C-TYPE LECTIN-LIKE PROTEIN, PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 6 ? 
H N N 6 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 22 ? ALA A 34 ? THR A 22 ALA A 34 1 ? 13 
HELX_P HELX_P2 2 SER A 44 ? ILE A 59 ? SER A 44 ILE A 59 1 ? 16 
HELX_P HELX_P3 3 ILE A 95 ? SER A 99 ? ILE A 95 SER A 99 5 ? 5  
HELX_P HELX_P4 4 ASN B 22 ? GLN B 32 ? ASN B 22 GLN B 32 1 ? 11 
HELX_P HELX_P5 5 SER B 44 ? GLY B 60 ? SER B 44 GLY B 60 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 2   SG ? ? ? 1_555 A CYS 13  SG ? ? A CYS 2   A CYS 13  1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf2  disulf ? ? A CYS 30  SG ? ? ? 1_555 A CYS 127 SG ? ? A CYS 30  A CYS 127 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf3  disulf ? ? A CYS 79  SG ? ? ? 1_555 B CYS 75  SG ? ? A CYS 79  B CYS 75  1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf4  disulf ? ? A CYS 102 SG ? ? ? 1_555 A CYS 119 SG ? ? A CYS 102 A CYS 119 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf5  disulf ? ? B CYS 2   SG ? ? ? 1_555 B CYS 13  SG ? ? B CYS 2   B CYS 13  1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf6  disulf ? ? B CYS 30  SG ? ? ? 1_555 B CYS 119 SG ? ? B CYS 30  B CYS 119 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf7  disulf ? ? B CYS 96  SG ? ? ? 1_555 B CYS 111 SG ? ? B CYS 96  B CYS 111 1_555 ? ? ? ? ? ? ? 2.047 ? 
metalc1  metalc ? ? D RB  .   RB ? ? ? 1_555 G HOH .   O  ? ? A RB  402 A HOH 455 1_555 ? ? ? ? ? ? ? 3.746 ? 
metalc2  metalc ? ? D RB  .   RB ? ? ? 1_555 A LYS 77  N  ? ? A RB  402 A LYS 77  1_555 ? ? ? ? ? ? ? 3.846 ? 
metalc3  metalc ? ? D RB  .   RB ? ? ? 1_555 G HOH .   O  ? ? A RB  402 A HOH 564 1_555 ? ? ? ? ? ? ? 3.077 ? 
metalc4  metalc ? ? E RB  .   RB ? ? ? 1_555 G HOH .   O  ? ? A RB  403 A HOH 428 1_555 ? ? ? ? ? ? ? 3.899 ? 
metalc5  metalc ? ? E RB  .   RB ? ? ? 1_555 A CYS 2   O  ? ? A RB  403 A CYS 2   1_555 ? ? ? ? ? ? ? 3.165 ? 
metalc6  metalc ? ? E RB  .   RB ? ? ? 1_555 G HOH .   O  ? ? A RB  403 A HOH 437 1_555 ? ? ? ? ? ? ? 3.065 ? 
metalc7  metalc ? ? E RB  .   RB ? ? ? 1_555 A TRP 6   O  ? ? A RB  403 A TRP 6   1_555 ? ? ? ? ? ? ? 2.978 ? 
metalc8  metalc ? ? E RB  .   RB ? ? ? 1_555 A ASP 1   O  ? ? A RB  403 A ASP 1   1_555 ? ? ? ? ? ? ? 3.775 ? 
metalc9  metalc ? ? E RB  .   RB ? ? ? 1_555 G HOH .   O  ? ? A RB  403 A HOH 540 1_555 ? ? ? ? ? ? ? 3.369 ? 
metalc10 metalc ? ? E RB  .   RB ? ? ? 1_555 A PRO 3   O  ? ? A RB  403 A PRO 3   1_555 ? ? ? ? ? ? ? 3.411 ? 
metalc11 metalc ? ? D RB  .   RB ? ? ? 1_555 A LYS 77  N  ? ? A RB  402 A LYS 77  2_555 ? ? ? ? ? ? ? 3.846 ? 
metalc12 metalc ? ? D RB  .   RB ? ? ? 1_555 G HOH .   O  ? ? A RB  402 A HOH 455 2_555 ? ? ? ? ? ? ? 3.746 ? 
metalc13 metalc ? ? D RB  .   RB ? ? ? 1_555 G HOH .   O  ? ? A RB  402 A HOH 564 2_555 ? ? ? ? ? ? ? 3.077 ? 
metalc14 metalc ? ? E RB  .   RB ? ? ? 1_555 H HOH .   O  ? ? A RB  403 B HOH 268 1_546 ? ? ? ? ? ? ? 3.190 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
D 4 5 ? anti-parallel 
D 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 7   ? TYR A 9   ? SER A 7   TYR A 9   
A 2 HIS A 12  ? LYS A 21  ? HIS A 12  LYS A 21  
A 3 ASN A 123 ? GLU A 128 ? ASN A 123 GLU A 128 
A 4 HIS A 38  ? LEU A 39  ? HIS A 38  LEU A 39  
B 1 VAL A 115 ? ILE A 117 ? VAL A 115 ILE A 117 
B 2 CYS A 102 ? LEU A 105 ? CYS A 102 LEU A 105 
B 3 VAL A 66  ? VAL A 72  ? VAL A 66  VAL A 72  
B 4 TRP B 77  ? TRP B 79  ? TRP B 77  TRP B 79  
C 1 SER B 7   ? SER B 8   ? SER B 7   SER B 8   
C 2 HIS B 12  ? LYS B 21  ? HIS B 12  LYS B 21  
C 3 ALA B 115 ? GLN B 122 ? ALA B 115 GLN B 122 
C 4 HIS B 38  ? LEU B 39  ? HIS B 38  LEU B 39  
D 1 SER B 7   ? SER B 8   ? SER B 7   SER B 8   
D 2 HIS B 12  ? LYS B 21  ? HIS B 12  LYS B 21  
D 3 ALA B 115 ? GLN B 122 ? ALA B 115 GLN B 122 
D 4 ILE B 63  ? TRP B 65  ? ILE B 63  TRP B 65  
D 5 TYR B 95  ? LYS B 100 ? TYR B 95  LYS B 100 
D 6 ARG B 107 ? ALA B 110 ? ARG B 107 ALA B 110 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 7   ? N SER A 7   O TYR A 14  ? O TYR A 14  
A 2 3 N PHE A 17  ? N PHE A 17  O PHE A 125 ? O PHE A 125 
A 3 4 O GLU A 128 ? O GLU A 128 N HIS A 38  ? N HIS A 38  
B 1 2 O ILE A 117 ? O ILE A 117 N CYS A 102 ? N CYS A 102 
B 2 3 O LEU A 105 ? O LEU A 105 N VAL A 66  ? N VAL A 66  
B 3 4 N ARG A 71  ? N ARG A 71  O GLN B 78  ? O GLN B 78  
C 1 2 N SER B 7   ? N SER B 7   O TYR B 14  ? O TYR B 14  
C 2 3 N LYS B 15  ? N LYS B 15  O CYS B 119 ? O CYS B 119 
C 3 4 O GLU B 120 ? O GLU B 120 N HIS B 38  ? N HIS B 38  
D 1 2 N SER B 7   ? N SER B 7   O TYR B 14  ? O TYR B 14  
D 2 3 N LYS B 15  ? N LYS B 15  O CYS B 119 ? O CYS B 119 
D 3 4 O GLN B 116 ? O GLN B 116 N TRP B 65  ? N TRP B 65  
D 4 5 N PHE B 64  ? N PHE B 64  O PHE B 99  ? O PHE B 99  
D 5 6 N CYS B 96  ? N CYS B 96  O ARG B 109 ? O ARG B 109 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL A 401'  
AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE RB A 402'  
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE RB A 403'  
AC4 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE SO4 A 404' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 GLN A 73  ? GLN A 73  . ? 1_555 ? 
2  AC1 5 GLY A 74  ? GLY A 74  . ? 1_555 ? 
3  AC1 5 GLU A 76  ? GLU A 76  . ? 1_555 ? 
4  AC1 5 TYR A 91  ? TYR A 91  . ? 2_555 ? 
5  AC1 5 ASN B 76  ? ASN B 76  . ? 1_555 ? 
6  AC2 2 HOH G .   ? HOH A 564 . ? 1_555 ? 
7  AC2 2 HOH G .   ? HOH A 564 . ? 2_555 ? 
8  AC3 4 CYS A 2   ? CYS A 2   . ? 1_555 ? 
9  AC3 4 PRO A 3   ? PRO A 3   . ? 1_555 ? 
10 AC3 4 TRP A 6   ? TRP A 6   . ? 1_555 ? 
11 AC3 4 HOH G .   ? HOH A 437 . ? 1_555 ? 
12 AC4 8 ASP A 24  ? ASP A 24  . ? 1_555 ? 
13 AC4 8 ARG A 71  ? ARG A 71  . ? 1_555 ? 
14 AC4 8 GLY A 74  ? GLY A 74  . ? 1_555 ? 
15 AC4 8 LYS A 75  ? LYS A 75  . ? 1_555 ? 
16 AC4 8 CYS A 119 ? CYS A 119 . ? 1_555 ? 
17 AC4 8 HOH G .   ? HOH A 456 . ? 1_555 ? 
18 AC4 8 HOH G .   ? HOH A 479 . ? 1_555 ? 
19 AC4 8 HOH G .   ? HOH A 489 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1X2W 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1X2W 
_atom_sites.fract_transf_matrix[1][1]   0.007456 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002782 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.026433 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019118 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
RB 
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASP A 1 1   ? 9.081   -11.598 41.318  1.00 50.41 ? 1   ASP A N   1 
ATOM   2    C  CA  . ASP A 1 1   ? 9.512   -13.027 41.351  1.00 48.97 ? 1   ASP A CA  1 
ATOM   3    C  C   . ASP A 1 1   ? 9.492   -13.686 39.970  1.00 45.62 ? 1   ASP A C   1 
ATOM   4    O  O   . ASP A 1 1   ? 10.508  -14.213 39.510  1.00 46.52 ? 1   ASP A O   1 
ATOM   5    C  CB  . ASP A 1 1   ? 8.617   -13.822 42.315  1.00 51.99 ? 1   ASP A CB  1 
ATOM   6    C  CG  . ASP A 1 1   ? 7.132   -13.742 41.953  1.00 54.86 ? 1   ASP A CG  1 
ATOM   7    O  OD1 . ASP A 1 1   ? 6.740   -14.218 40.863  1.00 54.40 ? 1   ASP A OD1 1 
ATOM   8    O  OD2 . ASP A 1 1   ? 6.351   -13.204 42.768  1.00 56.64 ? 1   ASP A OD2 1 
ATOM   9    N  N   . CYS A 1 2   ? 8.330   -13.645 39.322  1.00 40.44 ? 2   CYS A N   1 
ATOM   10   C  CA  . CYS A 1 2   ? 8.115   -14.236 38.004  1.00 35.15 ? 2   CYS A CA  1 
ATOM   11   C  C   . CYS A 1 2   ? 8.003   -15.758 38.059  1.00 33.77 ? 2   CYS A C   1 
ATOM   12   O  O   . CYS A 1 2   ? 8.724   -16.423 38.799  1.00 30.67 ? 2   CYS A O   1 
ATOM   13   C  CB  . CYS A 1 2   ? 9.228   -13.828 37.033  1.00 32.49 ? 2   CYS A CB  1 
ATOM   14   S  SG  . CYS A 1 2   ? 9.323   -12.030 36.727  1.00 31.55 ? 2   CYS A SG  1 
ATOM   15   N  N   . PRO A 1 3   ? 7.076   -16.325 37.273  1.00 33.51 ? 3   PRO A N   1 
ATOM   16   C  CA  . PRO A 1 3   ? 6.826   -17.768 37.192  1.00 33.99 ? 3   PRO A CA  1 
ATOM   17   C  C   . PRO A 1 3   ? 8.031   -18.556 36.693  1.00 33.67 ? 3   PRO A C   1 
ATOM   18   O  O   . PRO A 1 3   ? 8.852   -18.029 35.941  1.00 34.03 ? 3   PRO A O   1 
ATOM   19   C  CB  . PRO A 1 3   ? 5.655   -17.857 36.216  1.00 33.62 ? 3   PRO A CB  1 
ATOM   20   C  CG  . PRO A 1 3   ? 4.928   -16.567 36.439  1.00 33.44 ? 3   PRO A CG  1 
ATOM   21   C  CD  . PRO A 1 3   ? 6.063   -15.581 36.504  1.00 34.88 ? 3   PRO A CD  1 
ATOM   22   N  N   . SER A 1 4   ? 8.131   -19.816 37.113  1.00 32.63 ? 4   SER A N   1 
ATOM   23   C  CA  . SER A 1 4   ? 9.223   -20.684 36.678  1.00 32.35 ? 4   SER A CA  1 
ATOM   24   C  C   . SER A 1 4   ? 9.291   -20.589 35.163  1.00 30.29 ? 4   SER A C   1 
ATOM   25   O  O   . SER A 1 4   ? 8.274   -20.744 34.489  1.00 30.02 ? 4   SER A O   1 
ATOM   26   C  CB  . SER A 1 4   ? 8.952   -22.139 37.061  1.00 32.47 ? 4   SER A CB  1 
ATOM   27   O  OG  . SER A 1 4   ? 8.754   -22.272 38.452  1.00 37.61 ? 4   SER A OG  1 
ATOM   28   N  N   . GLY A 1 5   ? 10.483  -20.341 34.632  1.00 28.73 ? 5   GLY A N   1 
ATOM   29   C  CA  . GLY A 1 5   ? 10.627  -20.230 33.193  1.00 27.17 ? 5   GLY A CA  1 
ATOM   30   C  C   . GLY A 1 5   ? 10.821  -18.790 32.762  1.00 26.18 ? 5   GLY A C   1 
ATOM   31   O  O   . GLY A 1 5   ? 11.465  -18.518 31.751  1.00 27.01 ? 5   GLY A O   1 
ATOM   32   N  N   . TRP A 1 6   ? 10.260  -17.865 33.533  1.00 24.34 ? 6   TRP A N   1 
ATOM   33   C  CA  . TRP A 1 6   ? 10.392  -16.442 33.240  1.00 25.75 ? 6   TRP A CA  1 
ATOM   34   C  C   . TRP A 1 6   ? 11.501  -15.816 34.090  1.00 26.42 ? 6   TRP A C   1 
ATOM   35   O  O   . TRP A 1 6   ? 11.828  -16.312 35.172  1.00 27.67 ? 6   TRP A O   1 
ATOM   36   C  CB  . TRP A 1 6   ? 9.070   -15.721 33.512  1.00 25.70 ? 6   TRP A CB  1 
ATOM   37   C  CG  . TRP A 1 6   ? 7.919   -16.224 32.692  1.00 26.59 ? 6   TRP A CG  1 
ATOM   38   C  CD1 . TRP A 1 6   ? 7.281   -17.431 32.815  1.00 26.31 ? 6   TRP A CD1 1 
ATOM   39   C  CD2 . TRP A 1 6   ? 7.268   -15.533 31.620  1.00 26.68 ? 6   TRP A CD2 1 
ATOM   40   N  NE1 . TRP A 1 6   ? 6.272   -17.529 31.883  1.00 26.49 ? 6   TRP A NE1 1 
ATOM   41   C  CE2 . TRP A 1 6   ? 6.242   -16.379 31.138  1.00 24.94 ? 6   TRP A CE2 1 
ATOM   42   C  CE3 . TRP A 1 6   ? 7.451   -14.278 31.020  1.00 26.96 ? 6   TRP A CE3 1 
ATOM   43   C  CZ2 . TRP A 1 6   ? 5.404   -16.011 30.084  1.00 25.53 ? 6   TRP A CZ2 1 
ATOM   44   C  CZ3 . TRP A 1 6   ? 6.613   -13.911 29.969  1.00 27.06 ? 6   TRP A CZ3 1 
ATOM   45   C  CH2 . TRP A 1 6   ? 5.603   -14.776 29.514  1.00 27.35 ? 6   TRP A CH2 1 
ATOM   46   N  N   . SER A 1 7   ? 12.083  -14.727 33.601  1.00 25.56 ? 7   SER A N   1 
ATOM   47   C  CA  . SER A 1 7   ? 13.149  -14.053 34.330  1.00 25.72 ? 7   SER A CA  1 
ATOM   48   C  C   . SER A 1 7   ? 12.703  -12.644 34.656  1.00 26.22 ? 7   SER A C   1 
ATOM   49   O  O   . SER A 1 7   ? 11.999  -12.019 33.870  1.00 30.28 ? 7   SER A O   1 
ATOM   50   C  CB  . SER A 1 7   ? 14.420  -14.024 33.490  1.00 27.76 ? 7   SER A CB  1 
ATOM   51   O  OG  . SER A 1 7   ? 14.769  -15.336 33.086  1.00 29.02 ? 7   SER A OG  1 
ATOM   52   N  N   . SER A 1 8   ? 13.116  -12.141 35.813  1.00 26.33 ? 8   SER A N   1 
ATOM   53   C  CA  . SER A 1 8   ? 12.713  -10.808 36.239  1.00 27.55 ? 8   SER A CA  1 
ATOM   54   C  C   . SER A 1 8   ? 13.743  -9.708  36.027  1.00 27.39 ? 8   SER A C   1 
ATOM   55   O  O   . SER A 1 8   ? 14.955  -9.928  36.084  1.00 26.82 ? 8   SER A O   1 
ATOM   56   C  CB  . SER A 1 8   ? 12.324  -10.833 37.720  1.00 28.87 ? 8   SER A CB  1 
ATOM   57   O  OG  . SER A 1 8   ? 13.450  -11.128 38.525  1.00 30.54 ? 8   SER A OG  1 
ATOM   58   N  N   . TYR A 1 9   ? 13.232  -8.511  35.777  1.00 28.13 ? 9   TYR A N   1 
ATOM   59   C  CA  . TYR A 1 9   ? 14.061  -7.333  35.594  1.00 27.73 ? 9   TYR A CA  1 
ATOM   60   C  C   . TYR A 1 9   ? 13.177  -6.115  35.817  1.00 27.85 ? 9   TYR A C   1 
ATOM   61   O  O   . TYR A 1 9   ? 12.208  -5.892  35.090  1.00 25.79 ? 9   TYR A O   1 
ATOM   62   C  CB  . TYR A 1 9   ? 14.679  -7.284  34.193  1.00 27.01 ? 9   TYR A CB  1 
ATOM   63   C  CG  . TYR A 1 9   ? 15.581  -6.082  34.010  1.00 26.64 ? 9   TYR A CG  1 
ATOM   64   C  CD1 . TYR A 1 9   ? 16.820  -6.008  34.652  1.00 25.60 ? 9   TYR A CD1 1 
ATOM   65   C  CD2 . TYR A 1 9   ? 15.159  -4.982  33.264  1.00 25.03 ? 9   TYR A CD2 1 
ATOM   66   C  CE1 . TYR A 1 9   ? 17.611  -4.867  34.560  1.00 25.14 ? 9   TYR A CE1 1 
ATOM   67   C  CE2 . TYR A 1 9   ? 15.943  -3.833  33.164  1.00 25.23 ? 9   TYR A CE2 1 
ATOM   68   C  CZ  . TYR A 1 9   ? 17.163  -3.779  33.813  1.00 27.09 ? 9   TYR A CZ  1 
ATOM   69   O  OH  . TYR A 1 9   ? 17.920  -2.632  33.729  1.00 26.58 ? 9   TYR A OH  1 
ATOM   70   N  N   . GLU A 1 10  ? 13.515  -5.352  36.850  1.00 29.85 ? 10  GLU A N   1 
ATOM   71   C  CA  . GLU A 1 10  ? 12.790  -4.144  37.227  1.00 31.57 ? 10  GLU A CA  1 
ATOM   72   C  C   . GLU A 1 10  ? 11.286  -4.181  36.940  1.00 30.87 ? 10  GLU A C   1 
ATOM   73   O  O   . GLU A 1 10  ? 10.813  -3.533  36.005  1.00 32.70 ? 10  GLU A O   1 
ATOM   74   C  CB  . GLU A 1 10  ? 13.404  -2.921  36.532  1.00 31.64 ? 10  GLU A CB  1 
ATOM   75   C  CG  . GLU A 1 10  ? 14.913  -2.832  36.645  1.00 34.75 ? 10  GLU A CG  1 
ATOM   76   C  CD  . GLU A 1 10  ? 15.465  -1.519  36.121  1.00 36.13 ? 10  GLU A CD  1 
ATOM   77   O  OE1 . GLU A 1 10  ? 14.881  -0.967  35.167  1.00 39.30 ? 10  GLU A OE1 1 
ATOM   78   O  OE2 . GLU A 1 10  ? 16.492  -1.045  36.653  1.00 35.75 ? 10  GLU A OE2 1 
ATOM   79   N  N   . GLY A 1 11  ? 10.547  -4.947  37.740  1.00 28.82 ? 11  GLY A N   1 
ATOM   80   C  CA  . GLY A 1 11  ? 9.102   -5.023  37.591  1.00 24.69 ? 11  GLY A CA  1 
ATOM   81   C  C   . GLY A 1 11  ? 8.477   -5.858  36.485  1.00 24.52 ? 11  GLY A C   1 
ATOM   82   O  O   . GLY A 1 11  ? 7.248   -5.978  36.431  1.00 21.56 ? 11  GLY A O   1 
ATOM   83   N  N   . HIS A 1 12  ? 9.282   -6.438  35.602  1.00 23.70 ? 12  HIS A N   1 
ATOM   84   C  CA  . HIS A 1 12  ? 8.716   -7.243  34.524  1.00 24.11 ? 12  HIS A CA  1 
ATOM   85   C  C   . HIS A 1 12  ? 9.264   -8.661  34.454  1.00 23.56 ? 12  HIS A C   1 
ATOM   86   O  O   . HIS A 1 12  ? 10.311  -8.965  35.023  1.00 24.71 ? 12  HIS A O   1 
ATOM   87   C  CB  . HIS A 1 12  ? 8.924   -6.557  33.171  1.00 25.20 ? 12  HIS A CB  1 
ATOM   88   C  CG  . HIS A 1 12  ? 8.039   -5.370  32.951  1.00 27.68 ? 12  HIS A CG  1 
ATOM   89   N  ND1 . HIS A 1 12  ? 8.485   -4.072  33.080  1.00 28.42 ? 12  HIS A ND1 1 
ATOM   90   C  CD2 . HIS A 1 12  ? 6.728   -5.286  32.625  1.00 28.03 ? 12  HIS A CD2 1 
ATOM   91   C  CE1 . HIS A 1 12  ? 7.487   -3.241  32.841  1.00 29.22 ? 12  HIS A CE1 1 
ATOM   92   N  NE2 . HIS A 1 12  ? 6.409   -3.952  32.563  1.00 29.28 ? 12  HIS A NE2 1 
ATOM   93   N  N   . CYS A 1 13  ? 8.535   -9.517  33.745  1.00 23.04 ? 13  CYS A N   1 
ATOM   94   C  CA  . CYS A 1 13  ? 8.907   -10.911 33.562  1.00 23.23 ? 13  CYS A CA  1 
ATOM   95   C  C   . CYS A 1 13  ? 9.105   -11.189 32.077  1.00 22.84 ? 13  CYS A C   1 
ATOM   96   O  O   . CYS A 1 13  ? 8.284   -10.793 31.240  1.00 21.39 ? 13  CYS A O   1 
ATOM   97   C  CB  . CYS A 1 13  ? 7.814   -11.824 34.128  1.00 24.86 ? 13  CYS A CB  1 
ATOM   98   S  SG  . CYS A 1 13  ? 7.523   -11.584 35.914  1.00 29.29 ? 13  CYS A SG  1 
ATOM   99   N  N   . TYR A 1 14  ? 10.188  -11.881 31.750  1.00 21.26 ? 14  TYR A N   1 
ATOM   100  C  CA  . TYR A 1 14  ? 10.492  -12.176 30.356  1.00 24.19 ? 14  TYR A CA  1 
ATOM   101  C  C   . TYR A 1 14  ? 10.733  -13.650 30.094  1.00 24.98 ? 14  TYR A C   1 
ATOM   102  O  O   . TYR A 1 14  ? 11.159  -14.381 30.983  1.00 27.13 ? 14  TYR A O   1 
ATOM   103  C  CB  . TYR A 1 14  ? 11.738  -11.411 29.913  1.00 21.07 ? 14  TYR A CB  1 
ATOM   104  C  CG  . TYR A 1 14  ? 11.708  -9.940  30.211  1.00 20.59 ? 14  TYR A CG  1 
ATOM   105  C  CD1 . TYR A 1 14  ? 11.824  -9.471  31.522  1.00 21.65 ? 14  TYR A CD1 1 
ATOM   106  C  CD2 . TYR A 1 14  ? 11.611  -9.010  29.178  1.00 21.50 ? 14  TYR A CD2 1 
ATOM   107  C  CE1 . TYR A 1 14  ? 11.853  -8.107  31.798  1.00 24.69 ? 14  TYR A CE1 1 
ATOM   108  C  CE2 . TYR A 1 14  ? 11.644  -7.642  29.438  1.00 26.21 ? 14  TYR A CE2 1 
ATOM   109  C  CZ  . TYR A 1 14  ? 11.769  -7.195  30.747  1.00 24.89 ? 14  TYR A CZ  1 
ATOM   110  O  OH  . TYR A 1 14  ? 11.845  -5.844  30.993  1.00 26.80 ? 14  TYR A OH  1 
ATOM   111  N  N   . LYS A 1 15  ? 10.474  -14.071 28.860  1.00 25.16 ? 15  LYS A N   1 
ATOM   112  C  CA  . LYS A 1 15  ? 10.698  -15.454 28.457  1.00 25.26 ? 15  LYS A CA  1 
ATOM   113  C  C   . LYS A 1 15  ? 10.976  -15.540 26.958  1.00 25.83 ? 15  LYS A C   1 
ATOM   114  O  O   . LYS A 1 15  ? 10.154  -15.141 26.132  1.00 25.85 ? 15  LYS A O   1 
ATOM   115  C  CB  . LYS A 1 15  ? 9.490   -16.333 28.811  1.00 23.75 ? 15  LYS A CB  1 
ATOM   116  C  CG  . LYS A 1 15  ? 9.665   -17.807 28.454  1.00 20.41 ? 15  LYS A CG  1 
ATOM   117  C  CD  . LYS A 1 15  ? 8.483   -18.647 28.935  1.00 23.67 ? 15  LYS A CD  1 
ATOM   118  C  CE  . LYS A 1 15  ? 8.652   -20.127 28.570  1.00 21.93 ? 15  LYS A CE  1 
ATOM   119  N  NZ  . LYS A 1 15  ? 7.477   -20.950 28.976  1.00 23.83 ? 15  LYS A NZ  1 
ATOM   120  N  N   . PRO A 1 16  ? 12.155  -16.060 26.592  1.00 26.22 ? 16  PRO A N   1 
ATOM   121  C  CA  . PRO A 1 16  ? 12.554  -16.206 25.194  1.00 26.85 ? 16  PRO A CA  1 
ATOM   122  C  C   . PRO A 1 16  ? 11.979  -17.490 24.600  1.00 29.14 ? 16  PRO A C   1 
ATOM   123  O  O   . PRO A 1 16  ? 11.804  -18.495 25.299  1.00 29.60 ? 16  PRO A O   1 
ATOM   124  C  CB  . PRO A 1 16  ? 14.066  -16.251 25.286  1.00 27.30 ? 16  PRO A CB  1 
ATOM   125  C  CG  . PRO A 1 16  ? 14.264  -17.064 26.539  1.00 26.89 ? 16  PRO A CG  1 
ATOM   126  C  CD  . PRO A 1 16  ? 13.251  -16.460 27.494  1.00 25.69 ? 16  PRO A CD  1 
ATOM   127  N  N   . PHE A 1 17  ? 11.686  -17.452 23.308  1.00 29.46 ? 17  PHE A N   1 
ATOM   128  C  CA  . PHE A 1 17  ? 11.146  -18.610 22.617  1.00 29.78 ? 17  PHE A CA  1 
ATOM   129  C  C   . PHE A 1 17  ? 11.901  -18.838 21.330  1.00 31.52 ? 17  PHE A C   1 
ATOM   130  O  O   . PHE A 1 17  ? 11.953  -17.955 20.480  1.00 33.25 ? 17  PHE A O   1 
ATOM   131  C  CB  . PHE A 1 17  ? 9.665   -18.399 22.303  1.00 28.78 ? 17  PHE A CB  1 
ATOM   132  C  CG  . PHE A 1 17  ? 8.794   -18.428 23.510  1.00 28.41 ? 17  PHE A CG  1 
ATOM   133  C  CD1 . PHE A 1 17  ? 8.268   -19.633 23.971  1.00 27.61 ? 17  PHE A CD1 1 
ATOM   134  C  CD2 . PHE A 1 17  ? 8.555   -17.265 24.232  1.00 27.55 ? 17  PHE A CD2 1 
ATOM   135  C  CE1 . PHE A 1 17  ? 7.519   -19.678 25.141  1.00 28.19 ? 17  PHE A CE1 1 
ATOM   136  C  CE2 . PHE A 1 17  ? 7.808   -17.296 25.404  1.00 28.39 ? 17  PHE A CE2 1 
ATOM   137  C  CZ  . PHE A 1 17  ? 7.288   -18.505 25.861  1.00 28.01 ? 17  PHE A CZ  1 
ATOM   138  N  N   . LYS A 1 18  ? 12.504  -20.013 21.190  1.00 33.11 ? 18  LYS A N   1 
ATOM   139  C  CA  . LYS A 1 18  ? 13.212  -20.318 19.962  1.00 35.91 ? 18  LYS A CA  1 
ATOM   140  C  C   . LYS A 1 18  ? 12.164  -20.949 19.061  1.00 35.80 ? 18  LYS A C   1 
ATOM   141  O  O   . LYS A 1 18  ? 12.270  -22.109 18.672  1.00 36.95 ? 18  LYS A O   1 
ATOM   142  C  CB  . LYS A 1 18  ? 14.368  -21.300 20.194  1.00 38.45 ? 18  LYS A CB  1 
ATOM   143  C  CG  . LYS A 1 18  ? 15.401  -21.257 19.068  1.00 41.45 ? 18  LYS A CG  1 
ATOM   144  C  CD  . LYS A 1 18  ? 16.088  -22.597 18.811  1.00 45.05 ? 18  LYS A CD  1 
ATOM   145  C  CE  . LYS A 1 18  ? 16.991  -23.018 19.955  1.00 47.91 ? 18  LYS A CE  1 
ATOM   146  N  NZ  . LYS A 1 18  ? 17.828  -24.201 19.592  1.00 49.51 ? 18  LYS A NZ  1 
ATOM   147  N  N   . LEU A 1 19  ? 11.127  -20.171 18.773  1.00 36.58 ? 19  LEU A N   1 
ATOM   148  C  CA  . LEU A 1 19  ? 10.025  -20.595 17.915  1.00 37.36 ? 19  LEU A CA  1 
ATOM   149  C  C   . LEU A 1 19  ? 9.986   -19.646 16.730  1.00 36.06 ? 19  LEU A C   1 
ATOM   150  O  O   . LEU A 1 19  ? 10.136  -18.438 16.893  1.00 36.73 ? 19  LEU A O   1 
ATOM   151  C  CB  . LEU A 1 19  ? 8.692   -20.516 18.666  1.00 36.99 ? 19  LEU A CB  1 
ATOM   152  C  CG  . LEU A 1 19  ? 8.447   -21.525 19.788  1.00 36.63 ? 19  LEU A CG  1 
ATOM   153  C  CD1 . LEU A 1 19  ? 7.262   -21.082 20.628  1.00 36.17 ? 19  LEU A CD1 1 
ATOM   154  C  CD2 . LEU A 1 19  ? 8.204   -22.898 19.186  1.00 37.92 ? 19  LEU A CD2 1 
ATOM   155  N  N   . TYR A 1 20  ? 9.771   -20.192 15.542  1.00 35.88 ? 20  TYR A N   1 
ATOM   156  C  CA  . TYR A 1 20  ? 9.730   -19.380 14.330  1.00 33.78 ? 20  TYR A CA  1 
ATOM   157  C  C   . TYR A 1 20  ? 8.314   -18.984 13.946  1.00 32.21 ? 20  TYR A C   1 
ATOM   158  O  O   . TYR A 1 20  ? 7.508   -19.828 13.568  1.00 32.65 ? 20  TYR A O   1 
ATOM   159  C  CB  . TYR A 1 20  ? 10.396  -20.149 13.195  1.00 33.92 ? 20  TYR A CB  1 
ATOM   160  C  CG  . TYR A 1 20  ? 11.826  -20.517 13.520  1.00 34.90 ? 20  TYR A CG  1 
ATOM   161  C  CD1 . TYR A 1 20  ? 12.867  -19.604 13.321  1.00 34.84 ? 20  TYR A CD1 1 
ATOM   162  C  CD2 . TYR A 1 20  ? 12.137  -21.764 14.075  1.00 33.68 ? 20  TYR A CD2 1 
ATOM   163  C  CE1 . TYR A 1 20  ? 14.183  -19.922 13.666  1.00 36.33 ? 20  TYR A CE1 1 
ATOM   164  C  CE2 . TYR A 1 20  ? 13.443  -22.092 14.424  1.00 34.65 ? 20  TYR A CE2 1 
ATOM   165  C  CZ  . TYR A 1 20  ? 14.463  -21.167 14.219  1.00 36.05 ? 20  TYR A CZ  1 
ATOM   166  O  OH  . TYR A 1 20  ? 15.756  -21.486 14.570  1.00 36.38 ? 20  TYR A OH  1 
ATOM   167  N  N   . LYS A 1 21  ? 8.013   -17.694 14.066  1.00 31.02 ? 21  LYS A N   1 
ATOM   168  C  CA  . LYS A 1 21  ? 6.691   -17.183 13.720  1.00 30.54 ? 21  LYS A CA  1 
ATOM   169  C  C   . LYS A 1 21  ? 6.799   -15.795 13.102  1.00 30.52 ? 21  LYS A C   1 
ATOM   170  O  O   . LYS A 1 21  ? 7.817   -15.111 13.243  1.00 30.44 ? 21  LYS A O   1 
ATOM   171  C  CB  . LYS A 1 21  ? 5.788   -17.086 14.957  1.00 28.21 ? 21  LYS A CB  1 
ATOM   172  C  CG  . LYS A 1 21  ? 5.605   -18.370 15.752  1.00 28.47 ? 21  LYS A CG  1 
ATOM   173  C  CD  . LYS A 1 21  ? 4.619   -18.149 16.903  1.00 29.74 ? 21  LYS A CD  1 
ATOM   174  C  CE  . LYS A 1 21  ? 4.525   -19.357 17.830  1.00 28.72 ? 21  LYS A CE  1 
ATOM   175  N  NZ  . LYS A 1 21  ? 4.063   -20.583 17.136  1.00 30.57 ? 21  LYS A NZ  1 
ATOM   176  N  N   . THR A 1 22  ? 5.738   -15.391 12.412  1.00 29.32 ? 22  THR A N   1 
ATOM   177  C  CA  . THR A 1 22  ? 5.674   -14.071 11.806  1.00 27.95 ? 22  THR A CA  1 
ATOM   178  C  C   . THR A 1 22  ? 5.485   -13.108 12.980  1.00 27.47 ? 22  THR A C   1 
ATOM   179  O  O   . THR A 1 22  ? 5.192   -13.552 14.096  1.00 27.28 ? 22  THR A O   1 
ATOM   180  C  CB  . THR A 1 22  ? 4.471   -13.967 10.847  1.00 26.70 ? 22  THR A CB  1 
ATOM   181  O  OG1 . THR A 1 22  ? 3.264   -14.263 11.557  1.00 26.67 ? 22  THR A OG1 1 
ATOM   182  C  CG2 . THR A 1 22  ? 4.623   -14.953 9.686   1.00 25.48 ? 22  THR A CG2 1 
ATOM   183  N  N   . TRP A 1 23  ? 5.653   -11.806 12.752  1.00 25.51 ? 23  TRP A N   1 
ATOM   184  C  CA  . TRP A 1 23  ? 5.491   -10.846 13.845  1.00 23.52 ? 23  TRP A CA  1 
ATOM   185  C  C   . TRP A 1 23  ? 4.116   -10.963 14.483  1.00 25.71 ? 23  TRP A C   1 
ATOM   186  O  O   . TRP A 1 23  ? 3.978   -10.870 15.708  1.00 27.70 ? 23  TRP A O   1 
ATOM   187  C  CB  . TRP A 1 23  ? 5.666   -9.401  13.366  1.00 19.51 ? 23  TRP A CB  1 
ATOM   188  C  CG  . TRP A 1 23  ? 5.704   -8.424  14.517  1.00 18.69 ? 23  TRP A CG  1 
ATOM   189  C  CD1 . TRP A 1 23  ? 6.805   -8.028  15.214  1.00 18.05 ? 23  TRP A CD1 1 
ATOM   190  C  CD2 . TRP A 1 23  ? 4.582   -7.794  15.153  1.00 17.41 ? 23  TRP A CD2 1 
ATOM   191  N  NE1 . TRP A 1 23  ? 6.443   -7.196  16.243  1.00 16.39 ? 23  TRP A NE1 1 
ATOM   192  C  CE2 . TRP A 1 23  ? 5.086   -7.035  16.231  1.00 17.08 ? 23  TRP A CE2 1 
ATOM   193  C  CE3 . TRP A 1 23  ? 3.200   -7.800  14.918  1.00 16.88 ? 23  TRP A CE3 1 
ATOM   194  C  CZ2 . TRP A 1 23  ? 4.258   -6.287  17.079  1.00 18.19 ? 23  TRP A CZ2 1 
ATOM   195  C  CZ3 . TRP A 1 23  ? 2.372   -7.056  15.762  1.00 16.38 ? 23  TRP A CZ3 1 
ATOM   196  C  CH2 . TRP A 1 23  ? 2.907   -6.310  16.830  1.00 17.84 ? 23  TRP A CH2 1 
ATOM   197  N  N   . ASP A 1 24  ? 3.095   -11.154 13.651  1.00 26.05 ? 24  ASP A N   1 
ATOM   198  C  CA  . ASP A 1 24  ? 1.731   -11.259 14.154  1.00 27.26 ? 24  ASP A CA  1 
ATOM   199  C  C   . ASP A 1 24  ? 1.483   -12.532 14.963  1.00 25.73 ? 24  ASP A C   1 
ATOM   200  O  O   . ASP A 1 24  ? 0.846   -12.481 16.013  1.00 26.07 ? 24  ASP A O   1 
ATOM   201  C  CB  . ASP A 1 24  ? 0.703   -11.175 13.011  1.00 27.75 ? 24  ASP A CB  1 
ATOM   202  C  CG  . ASP A 1 24  ? 0.719   -9.829  12.289  1.00 29.43 ? 24  ASP A CG  1 
ATOM   203  O  OD1 . ASP A 1 24  ? 1.020   -8.795  12.916  1.00 31.04 ? 24  ASP A OD1 1 
ATOM   204  O  OD2 . ASP A 1 24  ? 0.406   -9.804  11.083  1.00 32.48 ? 24  ASP A OD2 1 
ATOM   205  N  N   . ASP A 1 25  ? 1.968   -13.675 14.490  1.00 25.62 ? 25  ASP A N   1 
ATOM   206  C  CA  . ASP A 1 25  ? 1.736   -14.897 15.247  1.00 24.96 ? 25  ASP A CA  1 
ATOM   207  C  C   . ASP A 1 25  ? 2.521   -14.864 16.554  1.00 24.24 ? 25  ASP A C   1 
ATOM   208  O  O   . ASP A 1 25  ? 2.098   -15.439 17.555  1.00 22.95 ? 25  ASP A O   1 
ATOM   209  C  CB  . ASP A 1 25  ? 2.117   -16.135 14.430  1.00 23.05 ? 25  ASP A CB  1 
ATOM   210  C  CG  . ASP A 1 25  ? 1.183   -16.368 13.262  1.00 25.82 ? 25  ASP A CG  1 
ATOM   211  O  OD1 . ASP A 1 25  ? 0.006   -15.961 13.349  1.00 24.59 ? 25  ASP A OD1 1 
ATOM   212  O  OD2 . ASP A 1 25  ? 1.621   -16.970 12.258  1.00 29.15 ? 25  ASP A OD2 1 
ATOM   213  N  N   . ALA A 1 26  ? 3.661   -14.177 16.530  1.00 25.30 ? 26  ALA A N   1 
ATOM   214  C  CA  . ALA A 1 26  ? 4.526   -14.049 17.698  1.00 25.27 ? 26  ALA A CA  1 
ATOM   215  C  C   . ALA A 1 26  ? 3.831   -13.211 18.764  1.00 26.57 ? 26  ALA A C   1 
ATOM   216  O  O   . ALA A 1 26  ? 3.669   -13.646 19.905  1.00 26.27 ? 26  ALA A O   1 
ATOM   217  C  CB  . ALA A 1 26  ? 5.847   -13.400 17.297  1.00 26.04 ? 26  ALA A CB  1 
ATOM   218  N  N   . GLU A 1 27  ? 3.422   -12.009 18.378  1.00 26.04 ? 27  GLU A N   1 
ATOM   219  C  CA  . GLU A 1 27  ? 2.738   -11.100 19.280  1.00 28.01 ? 27  GLU A CA  1 
ATOM   220  C  C   . GLU A 1 27  ? 1.486   -11.732 19.871  1.00 28.93 ? 27  GLU A C   1 
ATOM   221  O  O   . GLU A 1 27  ? 1.221   -11.591 21.065  1.00 28.51 ? 27  GLU A O   1 
ATOM   222  C  CB  . GLU A 1 27  ? 2.382   -9.815  18.537  1.00 27.70 ? 27  GLU A CB  1 
ATOM   223  C  CG  . GLU A 1 27  ? 1.387   -8.908  19.241  1.00 28.10 ? 27  GLU A CG  1 
ATOM   224  C  CD  . GLU A 1 27  ? 1.846   -8.414  20.600  1.00 27.50 ? 27  GLU A CD  1 
ATOM   225  O  OE1 . GLU A 1 27  ? 3.058   -8.186  20.793  1.00 25.55 ? 27  GLU A OE1 1 
ATOM   226  O  OE2 . GLU A 1 27  ? 0.974   -8.230  21.474  1.00 27.50 ? 27  GLU A OE2 1 
ATOM   227  N  N   . ARG A 1 28  ? 0.713   -12.424 19.039  1.00 29.73 ? 28  ARG A N   1 
ATOM   228  C  CA  . ARG A 1 28  ? -0.495  -13.074 19.520  1.00 31.14 ? 28  ARG A CA  1 
ATOM   229  C  C   . ARG A 1 28  ? -0.126  -14.206 20.458  1.00 30.71 ? 28  ARG A C   1 
ATOM   230  O  O   . ARG A 1 28  ? -0.774  -14.415 21.480  1.00 28.81 ? 28  ARG A O   1 
ATOM   231  C  CB  . ARG A 1 28  ? -1.319  -13.631 18.361  1.00 34.48 ? 28  ARG A CB  1 
ATOM   232  C  CG  . ARG A 1 28  ? -2.250  -14.774 18.787  1.00 39.20 ? 28  ARG A CG  1 
ATOM   233  C  CD  . ARG A 1 28  ? -3.446  -14.942 17.858  1.00 43.29 ? 28  ARG A CD  1 
ATOM   234  N  NE  . ARG A 1 28  ? -3.959  -16.307 17.902  1.00 46.96 ? 28  ARG A NE  1 
ATOM   235  C  CZ  . ARG A 1 28  ? -3.374  -17.339 17.301  1.00 49.67 ? 28  ARG A CZ  1 
ATOM   236  N  NH1 . ARG A 1 28  ? -2.258  -17.155 16.602  1.00 49.40 ? 28  ARG A NH1 1 
ATOM   237  N  NH2 . ARG A 1 28  ? -3.891  -18.558 17.412  1.00 50.41 ? 28  ARG A NH2 1 
ATOM   238  N  N   . PHE A 1 29  ? 0.913   -14.946 20.086  1.00 30.93 ? 29  PHE A N   1 
ATOM   239  C  CA  . PHE A 1 29  ? 1.385   -16.055 20.894  1.00 30.92 ? 29  PHE A CA  1 
ATOM   240  C  C   . PHE A 1 29  ? 1.802   -15.543 22.268  1.00 29.36 ? 29  PHE A C   1 
ATOM   241  O  O   . PHE A 1 29  ? 1.490   -16.155 23.284  1.00 30.27 ? 29  PHE A O   1 
ATOM   242  C  CB  . PHE A 1 29  ? 2.560   -16.752 20.201  1.00 28.90 ? 29  PHE A CB  1 
ATOM   243  C  CG  . PHE A 1 29  ? 3.214   -17.810 21.039  1.00 30.53 ? 29  PHE A CG  1 
ATOM   244  C  CD1 . PHE A 1 29  ? 4.228   -17.484 21.933  1.00 31.34 ? 29  PHE A CD1 1 
ATOM   245  C  CD2 . PHE A 1 29  ? 2.800   -19.135 20.955  1.00 31.96 ? 29  PHE A CD2 1 
ATOM   246  C  CE1 . PHE A 1 29  ? 4.819   -18.459 22.730  1.00 29.68 ? 29  PHE A CE1 1 
ATOM   247  C  CE2 . PHE A 1 29  ? 3.384   -20.113 21.749  1.00 31.14 ? 29  PHE A CE2 1 
ATOM   248  C  CZ  . PHE A 1 29  ? 4.397   -19.773 22.639  1.00 30.68 ? 29  PHE A CZ  1 
ATOM   249  N  N   . CYS A 1 30  ? 2.502   -14.415 22.295  1.00 28.93 ? 30  CYS A N   1 
ATOM   250  C  CA  . CYS A 1 30  ? 2.946   -13.831 23.557  1.00 28.35 ? 30  CYS A CA  1 
ATOM   251  C  C   . CYS A 1 30  ? 1.789   -13.421 24.462  1.00 26.67 ? 30  CYS A C   1 
ATOM   252  O  O   . CYS A 1 30  ? 1.893   -13.492 25.684  1.00 26.19 ? 30  CYS A O   1 
ATOM   253  C  CB  . CYS A 1 30  ? 3.827   -12.611 23.305  1.00 26.83 ? 30  CYS A CB  1 
ATOM   254  S  SG  . CYS A 1 30  ? 5.564   -12.957 22.904  1.00 29.02 ? 30  CYS A SG  1 
ATOM   255  N  N   . THR A 1 31  ? 0.693   -12.970 23.864  1.00 27.29 ? 31  THR A N   1 
ATOM   256  C  CA  . THR A 1 31  ? -0.464  -12.566 24.645  1.00 25.77 ? 31  THR A CA  1 
ATOM   257  C  C   . THR A 1 31  ? -1.094  -13.775 25.329  1.00 26.50 ? 31  THR A C   1 
ATOM   258  O  O   . THR A 1 31  ? -1.791  -13.630 26.332  1.00 26.98 ? 31  THR A O   1 
ATOM   259  C  CB  . THR A 1 31  ? -1.536  -11.884 23.762  1.00 26.61 ? 31  THR A CB  1 
ATOM   260  O  OG1 . THR A 1 31  ? -2.029  -12.811 22.790  1.00 26.44 ? 31  THR A OG1 1 
ATOM   261  C  CG2 . THR A 1 31  ? -0.949  -10.674 23.039  1.00 27.88 ? 31  THR A CG2 1 
ATOM   262  N  N   . GLU A 1 32  ? -0.842  -14.963 24.784  1.00 26.44 ? 32  GLU A N   1 
ATOM   263  C  CA  . GLU A 1 32  ? -1.398  -16.204 25.324  1.00 30.36 ? 32  GLU A CA  1 
ATOM   264  C  C   . GLU A 1 32  ? -0.509  -16.840 26.382  1.00 31.14 ? 32  GLU A C   1 
ATOM   265  O  O   . GLU A 1 32  ? -0.941  -17.757 27.086  1.00 32.95 ? 32  GLU A O   1 
ATOM   266  C  CB  . GLU A 1 32  ? -1.631  -17.228 24.197  1.00 30.63 ? 32  GLU A CB  1 
ATOM   267  C  CG  . GLU A 1 32  ? -2.752  -16.868 23.227  1.00 33.88 ? 32  GLU A CG  1 
ATOM   268  C  CD  . GLU A 1 32  ? -4.146  -17.091 23.814  1.00 35.19 ? 32  GLU A CD  1 
ATOM   269  O  OE1 . GLU A 1 32  ? -4.326  -16.905 25.039  1.00 36.31 ? 32  GLU A OE1 1 
ATOM   270  O  OE2 . GLU A 1 32  ? -5.069  -17.440 23.043  1.00 35.67 ? 32  GLU A OE2 1 
ATOM   271  N  N   . GLN A 1 33  ? 0.727   -16.357 26.489  1.00 30.41 ? 33  GLN A N   1 
ATOM   272  C  CA  . GLN A 1 33  ? 1.687   -16.900 27.445  1.00 31.49 ? 33  GLN A CA  1 
ATOM   273  C  C   . GLN A 1 33  ? 1.559   -16.332 28.848  1.00 31.88 ? 33  GLN A C   1 
ATOM   274  O  O   . GLN A 1 33  ? 2.018   -16.940 29.815  1.00 30.62 ? 33  GLN A O   1 
ATOM   275  C  CB  . GLN A 1 33  ? 3.116   -16.682 26.945  1.00 31.56 ? 33  GLN A CB  1 
ATOM   276  C  CG  . GLN A 1 33  ? 3.401   -17.378 25.636  1.00 33.51 ? 33  GLN A CG  1 
ATOM   277  C  CD  . GLN A 1 33  ? 2.903   -18.809 25.639  1.00 34.75 ? 33  GLN A CD  1 
ATOM   278  O  OE1 . GLN A 1 33  ? 3.434   -19.662 26.347  1.00 35.37 ? 33  GLN A OE1 1 
ATOM   279  N  NE2 . GLN A 1 33  ? 1.865   -19.074 24.855  1.00 33.96 ? 33  GLN A NE2 1 
ATOM   280  N  N   . ALA A 1 34  ? 0.950   -15.159 28.960  1.00 31.24 ? 34  ALA A N   1 
ATOM   281  C  CA  . ALA A 1 34  ? 0.778   -14.546 30.266  1.00 32.17 ? 34  ALA A CA  1 
ATOM   282  C  C   . ALA A 1 34  ? -0.282  -13.461 30.219  1.00 32.20 ? 34  ALA A C   1 
ATOM   283  O  O   . ALA A 1 34  ? -0.561  -12.892 29.166  1.00 31.70 ? 34  ALA A O   1 
ATOM   284  C  CB  . ALA A 1 34  ? 2.107   -13.961 30.755  1.00 30.82 ? 34  ALA A CB  1 
ATOM   285  N  N   . LYS A 1 35  ? -0.886  -13.188 31.366  1.00 32.93 ? 35  LYS A N   1 
ATOM   286  C  CA  . LYS A 1 35  ? -1.887  -12.145 31.435  1.00 33.84 ? 35  LYS A CA  1 
ATOM   287  C  C   . LYS A 1 35  ? -1.116  -10.861 31.119  1.00 32.43 ? 35  LYS A C   1 
ATOM   288  O  O   . LYS A 1 35  ? -0.101  -10.571 31.745  1.00 32.07 ? 35  LYS A O   1 
ATOM   289  C  CB  . LYS A 1 35  ? -2.496  -12.104 32.843  1.00 36.59 ? 35  LYS A CB  1 
ATOM   290  C  CG  . LYS A 1 35  ? -3.791  -11.302 32.963  1.00 41.86 ? 35  LYS A CG  1 
ATOM   291  C  CD  . LYS A 1 35  ? -4.477  -11.550 34.313  1.00 44.20 ? 35  LYS A CD  1 
ATOM   292  C  CE  . LYS A 1 35  ? -5.760  -10.740 34.459  1.00 44.84 ? 35  LYS A CE  1 
ATOM   293  N  NZ  . LYS A 1 35  ? -6.761  -11.045 33.394  1.00 47.19 ? 35  LYS A NZ  1 
ATOM   294  N  N   . GLY A 1 36  ? -1.582  -10.115 30.124  1.00 33.21 ? 36  GLY A N   1 
ATOM   295  C  CA  . GLY A 1 36  ? -0.914  -8.884  29.739  1.00 30.77 ? 36  GLY A CA  1 
ATOM   296  C  C   . GLY A 1 36  ? 0.378   -9.120  28.973  1.00 30.10 ? 36  GLY A C   1 
ATOM   297  O  O   . GLY A 1 36  ? 1.241   -8.248  28.938  1.00 29.63 ? 36  GLY A O   1 
ATOM   298  N  N   . GLY A 1 37  ? 0.509   -10.295 28.359  1.00 26.55 ? 37  GLY A N   1 
ATOM   299  C  CA  . GLY A 1 37  ? 1.714   -10.614 27.615  1.00 26.48 ? 37  GLY A CA  1 
ATOM   300  C  C   . GLY A 1 37  ? 1.804   -9.982  26.236  1.00 26.61 ? 37  GLY A C   1 
ATOM   301  O  O   . GLY A 1 37  ? 0.799   -9.822  25.550  1.00 27.03 ? 37  GLY A O   1 
ATOM   302  N  N   . HIS A 1 38  ? 3.019   -9.628  25.831  1.00 25.04 ? 38  HIS A N   1 
ATOM   303  C  CA  . HIS A 1 38  ? 3.273   -9.011  24.532  1.00 25.88 ? 38  HIS A CA  1 
ATOM   304  C  C   . HIS A 1 38  ? 4.707   -9.304  24.140  1.00 26.81 ? 38  HIS A C   1 
ATOM   305  O  O   . HIS A 1 38  ? 5.482   -9.837  24.938  1.00 27.98 ? 38  HIS A O   1 
ATOM   306  C  CB  . HIS A 1 38  ? 3.138   -7.489  24.612  1.00 24.90 ? 38  HIS A CB  1 
ATOM   307  C  CG  . HIS A 1 38  ? 1.750   -7.009  24.875  1.00 25.22 ? 38  HIS A CG  1 
ATOM   308  N  ND1 . HIS A 1 38  ? 0.745   -7.086  23.936  1.00 25.23 ? 38  HIS A ND1 1 
ATOM   309  C  CD2 . HIS A 1 38  ? 1.199   -6.437  25.972  1.00 26.36 ? 38  HIS A CD2 1 
ATOM   310  C  CE1 . HIS A 1 38  ? -0.366  -6.583  24.441  1.00 25.39 ? 38  HIS A CE1 1 
ATOM   311  N  NE2 . HIS A 1 38  ? -0.118  -6.181  25.675  1.00 28.72 ? 38  HIS A NE2 1 
ATOM   312  N  N   . LEU A 1 39  ? 5.060   -8.943  22.911  1.00 27.65 ? 39  LEU A N   1 
ATOM   313  C  CA  . LEU A 1 39  ? 6.428   -9.104  22.448  1.00 27.63 ? 39  LEU A CA  1 
ATOM   314  C  C   . LEU A 1 39  ? 7.215   -8.074  23.260  1.00 28.49 ? 39  LEU A C   1 
ATOM   315  O  O   . LEU A 1 39  ? 6.712   -6.990  23.551  1.00 28.84 ? 39  LEU A O   1 
ATOM   316  C  CB  . LEU A 1 39  ? 6.533   -8.814  20.948  1.00 26.35 ? 39  LEU A CB  1 
ATOM   317  C  CG  . LEU A 1 39  ? 6.241   -10.015 20.039  1.00 26.48 ? 39  LEU A CG  1 
ATOM   318  C  CD1 . LEU A 1 39  ? 6.206   -9.588  18.577  1.00 26.22 ? 39  LEU A CD1 1 
ATOM   319  C  CD2 . LEU A 1 39  ? 7.313   -11.073 20.252  1.00 24.66 ? 39  LEU A CD2 1 
ATOM   320  N  N   . VAL A 1 40  ? 8.440   -8.423  23.633  1.00 29.51 ? 40  VAL A N   1 
ATOM   321  C  CA  . VAL A 1 40  ? 9.281   -7.560  24.449  1.00 29.21 ? 40  VAL A CA  1 
ATOM   322  C  C   . VAL A 1 40  ? 9.439   -6.107  23.985  1.00 30.88 ? 40  VAL A C   1 
ATOM   323  O  O   . VAL A 1 40  ? 9.678   -5.833  22.807  1.00 29.91 ? 40  VAL A O   1 
ATOM   324  C  CB  . VAL A 1 40  ? 10.692  -8.187  24.610  1.00 28.67 ? 40  VAL A CB  1 
ATOM   325  C  CG1 . VAL A 1 40  ? 11.406  -8.249  23.252  1.00 26.24 ? 40  VAL A CG1 1 
ATOM   326  C  CG2 . VAL A 1 40  ? 11.499  -7.396  25.626  1.00 25.04 ? 40  VAL A CG2 1 
ATOM   327  N  N   . SER A 1 41  ? 9.291   -5.178  24.925  1.00 31.60 ? 41  SER A N   1 
ATOM   328  C  CA  . SER A 1 41  ? 9.475   -3.765  24.631  1.00 31.99 ? 41  SER A CA  1 
ATOM   329  C  C   . SER A 1 41  ? 10.750  -3.340  25.363  1.00 33.92 ? 41  SER A C   1 
ATOM   330  O  O   . SER A 1 41  ? 10.958  -3.695  26.529  1.00 34.00 ? 41  SER A O   1 
ATOM   331  C  CB  . SER A 1 41  ? 8.286   -2.940  25.118  1.00 33.18 ? 41  SER A CB  1 
ATOM   332  O  OG  . SER A 1 41  ? 8.232   -2.897  26.530  1.00 37.40 ? 41  SER A OG  1 
ATOM   333  N  N   . ILE A 1 42  ? 11.597  -2.582  24.672  1.00 33.24 ? 42  ILE A N   1 
ATOM   334  C  CA  . ILE A 1 42  ? 12.866  -2.112  25.219  1.00 32.54 ? 42  ILE A CA  1 
ATOM   335  C  C   . ILE A 1 42  ? 12.814  -0.597  25.456  1.00 33.99 ? 42  ILE A C   1 
ATOM   336  O  O   . ILE A 1 42  ? 12.932  0.198   24.514  1.00 34.70 ? 42  ILE A O   1 
ATOM   337  C  CB  . ILE A 1 42  ? 13.990  -2.452  24.237  1.00 31.88 ? 42  ILE A CB  1 
ATOM   338  C  CG1 . ILE A 1 42  ? 13.880  -3.927  23.844  1.00 30.24 ? 42  ILE A CG1 1 
ATOM   339  C  CG2 . ILE A 1 42  ? 15.336  -2.163  24.863  1.00 32.41 ? 42  ILE A CG2 1 
ATOM   340  C  CD1 . ILE A 1 42  ? 14.810  -4.343  22.741  1.00 29.76 ? 42  ILE A CD1 1 
ATOM   341  N  N   . GLU A 1 43  ? 12.662  -0.204  26.718  1.00 31.69 ? 43  GLU A N   1 
ATOM   342  C  CA  . GLU A 1 43  ? 12.537  1.204   27.078  1.00 31.65 ? 43  GLU A CA  1 
ATOM   343  C  C   . GLU A 1 43  ? 13.718  1.854   27.801  1.00 30.09 ? 43  GLU A C   1 
ATOM   344  O  O   . GLU A 1 43  ? 13.586  2.949   28.328  1.00 29.05 ? 43  GLU A O   1 
ATOM   345  C  CB  . GLU A 1 43  ? 11.277  1.388   27.921  1.00 33.22 ? 43  GLU A CB  1 
ATOM   346  C  CG  . GLU A 1 43  ? 10.034  0.736   27.324  1.00 39.75 ? 43  GLU A CG  1 
ATOM   347  C  CD  . GLU A 1 43  ? 8.821   0.833   28.237  1.00 42.42 ? 43  GLU A CD  1 
ATOM   348  O  OE1 . GLU A 1 43  ? 8.405   1.966   28.561  1.00 45.65 ? 43  GLU A OE1 1 
ATOM   349  O  OE2 . GLU A 1 43  ? 8.280   -0.223  28.633  1.00 45.66 ? 43  GLU A OE2 1 
ATOM   350  N  N   . SER A 1 44  ? 14.865  1.187   27.834  1.00 30.28 ? 44  SER A N   1 
ATOM   351  C  CA  . SER A 1 44  ? 16.048  1.735   28.499  1.00 28.51 ? 44  SER A CA  1 
ATOM   352  C  C   . SER A 1 44  ? 17.258  0.894   28.143  1.00 28.54 ? 44  SER A C   1 
ATOM   353  O  O   . SER A 1 44  ? 17.123  -0.267  27.757  1.00 30.73 ? 44  SER A O   1 
ATOM   354  C  CB  . SER A 1 44  ? 15.882  1.720   30.020  1.00 27.87 ? 44  SER A CB  1 
ATOM   355  O  OG  . SER A 1 44  ? 16.049  0.406   30.534  1.00 26.67 ? 44  SER A OG  1 
ATOM   356  N  N   . ALA A 1 45  ? 18.443  1.478   28.274  1.00 27.88 ? 45  ALA A N   1 
ATOM   357  C  CA  . ALA A 1 45  ? 19.673  0.752   27.980  1.00 27.16 ? 45  ALA A CA  1 
ATOM   358  C  C   . ALA A 1 45  ? 19.807  -0.440  28.934  1.00 25.82 ? 45  ALA A C   1 
ATOM   359  O  O   . ALA A 1 45  ? 20.201  -1.530  28.527  1.00 25.78 ? 45  ALA A O   1 
ATOM   360  C  CB  . ALA A 1 45  ? 20.880  1.683   28.119  1.00 26.42 ? 45  ALA A CB  1 
ATOM   361  N  N   . GLY A 1 46  ? 19.476  -0.227  30.203  1.00 27.18 ? 46  GLY A N   1 
ATOM   362  C  CA  . GLY A 1 46  ? 19.566  -1.304  31.174  1.00 26.79 ? 46  GLY A CA  1 
ATOM   363  C  C   . GLY A 1 46  ? 18.686  -2.464  30.754  1.00 28.24 ? 46  GLY A C   1 
ATOM   364  O  O   . GLY A 1 46  ? 19.089  -3.622  30.822  1.00 29.10 ? 46  GLY A O   1 
ATOM   365  N  N   . GLU A 1 47  ? 17.473  -2.149  30.315  1.00 29.13 ? 47  GLU A N   1 
ATOM   366  C  CA  . GLU A 1 47  ? 16.548  -3.173  29.867  1.00 29.60 ? 47  GLU A CA  1 
ATOM   367  C  C   . GLU A 1 47  ? 17.063  -3.822  28.589  1.00 28.69 ? 47  GLU A C   1 
ATOM   368  O  O   . GLU A 1 47  ? 16.920  -5.032  28.405  1.00 28.31 ? 47  GLU A O   1 
ATOM   369  C  CB  . GLU A 1 47  ? 15.161  -2.573  29.627  1.00 33.22 ? 47  GLU A CB  1 
ATOM   370  C  CG  . GLU A 1 47  ? 14.136  -3.586  29.137  1.00 38.53 ? 47  GLU A CG  1 
ATOM   371  C  CD  . GLU A 1 47  ? 12.749  -2.996  29.016  1.00 41.62 ? 47  GLU A CD  1 
ATOM   372  O  OE1 . GLU A 1 47  ? 12.623  -1.898  28.439  1.00 43.72 ? 47  GLU A OE1 1 
ATOM   373  O  OE2 . GLU A 1 47  ? 11.782  -3.632  29.489  1.00 45.02 ? 47  GLU A OE2 1 
ATOM   374  N  N   . ALA A 1 48  ? 17.664  -3.021  27.710  1.00 28.06 ? 48  ALA A N   1 
ATOM   375  C  CA  . ALA A 1 48  ? 18.205  -3.540  26.458  1.00 27.19 ? 48  ALA A CA  1 
ATOM   376  C  C   . ALA A 1 48  ? 19.356  -4.500  26.766  1.00 27.14 ? 48  ALA A C   1 
ATOM   377  O  O   . ALA A 1 48  ? 19.541  -5.511  26.086  1.00 25.54 ? 48  ALA A O   1 
ATOM   378  C  CB  . ALA A 1 48  ? 18.683  -2.397  25.573  1.00 26.68 ? 48  ALA A CB  1 
ATOM   379  N  N   . ASP A 1 49  ? 20.132  -4.182  27.794  1.00 27.39 ? 49  ASP A N   1 
ATOM   380  C  CA  . ASP A 1 49  ? 21.233  -5.055  28.185  1.00 28.43 ? 49  ASP A CA  1 
ATOM   381  C  C   . ASP A 1 49  ? 20.620  -6.383  28.638  1.00 28.28 ? 49  ASP A C   1 
ATOM   382  O  O   . ASP A 1 49  ? 20.971  -7.457  28.135  1.00 26.54 ? 49  ASP A O   1 
ATOM   383  C  CB  . ASP A 1 49  ? 22.029  -4.432  29.341  1.00 30.02 ? 49  ASP A CB  1 
ATOM   384  C  CG  . ASP A 1 49  ? 23.087  -5.377  29.900  1.00 30.48 ? 49  ASP A CG  1 
ATOM   385  O  OD1 . ASP A 1 49  ? 23.981  -5.797  29.134  1.00 35.67 ? 49  ASP A OD1 1 
ATOM   386  O  OD2 . ASP A 1 49  ? 23.026  -5.706  31.104  1.00 30.43 ? 49  ASP A OD2 1 
ATOM   387  N  N   . PHE A 1 50  ? 19.693  -6.289  29.586  1.00 26.14 ? 50  PHE A N   1 
ATOM   388  C  CA  . PHE A 1 50  ? 19.025  -7.459  30.121  1.00 27.56 ? 50  PHE A CA  1 
ATOM   389  C  C   . PHE A 1 50  ? 18.412  -8.352  29.053  1.00 28.94 ? 50  PHE A C   1 
ATOM   390  O  O   . PHE A 1 50  ? 18.395  -9.571  29.205  1.00 31.63 ? 50  PHE A O   1 
ATOM   391  C  CB  . PHE A 1 50  ? 17.924  -7.060  31.095  1.00 25.43 ? 50  PHE A CB  1 
ATOM   392  C  CG  . PHE A 1 50  ? 17.244  -8.232  31.721  1.00 26.72 ? 50  PHE A CG  1 
ATOM   393  C  CD1 . PHE A 1 50  ? 17.906  -9.005  32.673  1.00 24.56 ? 50  PHE A CD1 1 
ATOM   394  C  CD2 . PHE A 1 50  ? 15.963  -8.608  31.320  1.00 27.24 ? 50  PHE A CD2 1 
ATOM   395  C  CE1 . PHE A 1 50  ? 17.307  -10.140 33.218  1.00 25.72 ? 50  PHE A CE1 1 
ATOM   396  C  CE2 . PHE A 1 50  ? 15.352  -9.742  31.858  1.00 27.77 ? 50  PHE A CE2 1 
ATOM   397  C  CZ  . PHE A 1 50  ? 16.028  -10.511 32.812  1.00 26.29 ? 50  PHE A CZ  1 
ATOM   398  N  N   . VAL A 1 51  ? 17.893  -7.751  27.984  1.00 29.24 ? 51  VAL A N   1 
ATOM   399  C  CA  . VAL A 1 51  ? 17.281  -8.527  26.905  1.00 27.28 ? 51  VAL A CA  1 
ATOM   400  C  C   . VAL A 1 51  ? 18.341  -9.205  26.054  1.00 27.74 ? 51  VAL A C   1 
ATOM   401  O  O   . VAL A 1 51  ? 18.206  -10.378 25.703  1.00 26.43 ? 51  VAL A O   1 
ATOM   402  C  CB  . VAL A 1 51  ? 16.412  -7.646  25.975  1.00 27.40 ? 51  VAL A CB  1 
ATOM   403  C  CG1 . VAL A 1 51  ? 15.937  -8.470  24.773  1.00 22.26 ? 51  VAL A CG1 1 
ATOM   404  C  CG2 . VAL A 1 51  ? 15.215  -7.089  26.748  1.00 25.46 ? 51  VAL A CG2 1 
ATOM   405  N  N   . ALA A 1 52  ? 19.385  -8.453  25.716  1.00 27.54 ? 52  ALA A N   1 
ATOM   406  C  CA  . ALA A 1 52  ? 20.477  -8.971  24.906  1.00 28.49 ? 52  ALA A CA  1 
ATOM   407  C  C   . ALA A 1 52  ? 21.106  -10.174 25.605  1.00 29.85 ? 52  ALA A C   1 
ATOM   408  O  O   . ALA A 1 52  ? 21.422  -11.180 24.975  1.00 31.26 ? 52  ALA A O   1 
ATOM   409  C  CB  . ALA A 1 52  ? 21.509  -7.892  24.689  1.00 26.19 ? 52  ALA A CB  1 
ATOM   410  N  N   . GLN A 1 53  ? 21.286  -10.055 26.913  1.00 32.76 ? 53  GLN A N   1 
ATOM   411  C  CA  . GLN A 1 53  ? 21.852  -11.122 27.723  1.00 33.62 ? 53  GLN A CA  1 
ATOM   412  C  C   . GLN A 1 53  ? 20.956  -12.366 27.648  1.00 34.04 ? 53  GLN A C   1 
ATOM   413  O  O   . GLN A 1 53  ? 21.439  -13.478 27.414  1.00 36.08 ? 53  GLN A O   1 
ATOM   414  C  CB  . GLN A 1 53  ? 21.986  -10.631 29.168  1.00 35.79 ? 53  GLN A CB  1 
ATOM   415  C  CG  . GLN A 1 53  ? 21.809  -11.693 30.238  1.00 40.96 ? 53  GLN A CG  1 
ATOM   416  C  CD  . GLN A 1 53  ? 20.969  -11.193 31.410  1.00 43.02 ? 53  GLN A CD  1 
ATOM   417  O  OE1 . GLN A 1 53  ? 21.485  -10.575 32.351  1.00 44.09 ? 53  GLN A OE1 1 
ATOM   418  N  NE2 . GLN A 1 53  ? 19.660  -11.443 31.345  1.00 39.85 ? 53  GLN A NE2 1 
ATOM   419  N  N   . LEU A 1 54  ? 19.651  -12.173 27.834  1.00 31.91 ? 54  LEU A N   1 
ATOM   420  C  CA  . LEU A 1 54  ? 18.694  -13.276 27.787  1.00 30.42 ? 54  LEU A CA  1 
ATOM   421  C  C   . LEU A 1 54  ? 18.703  -13.986 26.429  1.00 30.81 ? 54  LEU A C   1 
ATOM   422  O  O   . LEU A 1 54  ? 18.647  -15.214 26.355  1.00 30.19 ? 54  LEU A O   1 
ATOM   423  C  CB  . LEU A 1 54  ? 17.284  -12.759 28.085  1.00 26.91 ? 54  LEU A CB  1 
ATOM   424  C  CG  . LEU A 1 54  ? 16.189  -13.829 28.116  1.00 28.83 ? 54  LEU A CG  1 
ATOM   425  C  CD1 . LEU A 1 54  ? 16.363  -14.737 29.341  1.00 28.20 ? 54  LEU A CD1 1 
ATOM   426  C  CD2 . LEU A 1 54  ? 14.831  -13.152 28.151  1.00 26.85 ? 54  LEU A CD2 1 
ATOM   427  N  N   . VAL A 1 55  ? 18.763  -13.202 25.358  1.00 30.80 ? 55  VAL A N   1 
ATOM   428  C  CA  . VAL A 1 55  ? 18.779  -13.739 24.005  1.00 28.56 ? 55  VAL A CA  1 
ATOM   429  C  C   . VAL A 1 55  ? 20.076  -14.500 23.764  1.00 30.40 ? 55  VAL A C   1 
ATOM   430  O  O   . VAL A 1 55  ? 20.068  -15.634 23.286  1.00 30.50 ? 55  VAL A O   1 
ATOM   431  C  CB  . VAL A 1 55  ? 18.655  -12.597 22.963  1.00 28.58 ? 55  VAL A CB  1 
ATOM   432  C  CG1 . VAL A 1 55  ? 18.784  -13.147 21.553  1.00 28.68 ? 55  VAL A CG1 1 
ATOM   433  C  CG2 . VAL A 1 55  ? 17.315  -11.890 23.127  1.00 26.96 ? 55  VAL A CG2 1 
ATOM   434  N  N   . THR A 1 56  ? 21.194  -13.869 24.106  1.00 32.26 ? 56  THR A N   1 
ATOM   435  C  CA  . THR A 1 56  ? 22.511  -14.469 23.926  1.00 32.35 ? 56  THR A CA  1 
ATOM   436  C  C   . THR A 1 56  ? 22.610  -15.879 24.516  1.00 32.64 ? 56  THR A C   1 
ATOM   437  O  O   . THR A 1 56  ? 23.103  -16.803 23.865  1.00 31.21 ? 56  THR A O   1 
ATOM   438  C  CB  . THR A 1 56  ? 23.597  -13.573 24.562  1.00 33.89 ? 56  THR A CB  1 
ATOM   439  O  OG1 . THR A 1 56  ? 23.583  -12.288 23.929  1.00 36.41 ? 56  THR A OG1 1 
ATOM   440  C  CG2 . THR A 1 56  ? 24.975  -14.180 24.386  1.00 34.25 ? 56  THR A CG2 1 
ATOM   441  N  N   . GLU A 1 57  ? 22.122  -16.043 25.742  1.00 34.30 ? 57  GLU A N   1 
ATOM   442  C  CA  . GLU A 1 57  ? 22.177  -17.328 26.435  1.00 34.88 ? 57  GLU A CA  1 
ATOM   443  C  C   . GLU A 1 57  ? 21.033  -18.308 26.143  1.00 35.23 ? 57  GLU A C   1 
ATOM   444  O  O   . GLU A 1 57  ? 21.177  -19.506 26.392  1.00 35.62 ? 57  GLU A O   1 
ATOM   445  C  CB  . GLU A 1 57  ? 22.250  -17.096 27.955  1.00 34.10 ? 57  GLU A CB  1 
ATOM   446  C  CG  . GLU A 1 57  ? 23.422  -16.233 28.423  1.00 36.77 ? 57  GLU A CG  1 
ATOM   447  C  CD  . GLU A 1 57  ? 24.785  -16.902 28.227  1.00 37.69 ? 57  GLU A CD  1 
ATOM   448  O  OE1 . GLU A 1 57  ? 24.976  -18.033 28.722  1.00 38.63 ? 57  GLU A OE1 1 
ATOM   449  O  OE2 . GLU A 1 57  ? 25.668  -16.295 27.585  1.00 35.76 ? 57  GLU A OE2 1 
ATOM   450  N  N   . ASN A 1 58  ? 19.912  -17.825 25.610  1.00 35.46 ? 58  ASN A N   1 
ATOM   451  C  CA  . ASN A 1 58  ? 18.771  -18.711 25.362  1.00 36.67 ? 58  ASN A CA  1 
ATOM   452  C  C   . ASN A 1 58  ? 18.272  -18.920 23.936  1.00 38.39 ? 58  ASN A C   1 
ATOM   453  O  O   . ASN A 1 58  ? 17.531  -19.870 23.678  1.00 37.24 ? 58  ASN A O   1 
ATOM   454  C  CB  . ASN A 1 58  ? 17.594  -18.271 26.232  1.00 36.34 ? 58  ASN A CB  1 
ATOM   455  C  CG  . ASN A 1 58  ? 17.885  -18.420 27.703  1.00 34.03 ? 58  ASN A CG  1 
ATOM   456  O  OD1 . ASN A 1 58  ? 17.979  -19.533 28.212  1.00 32.51 ? 58  ASN A OD1 1 
ATOM   457  N  ND2 . ASN A 1 58  ? 18.052  -17.298 28.392  1.00 33.50 ? 58  ASN A ND2 1 
ATOM   458  N  N   . ILE A 1 59  ? 18.650  -18.041 23.015  1.00 39.91 ? 59  ILE A N   1 
ATOM   459  C  CA  . ILE A 1 59  ? 18.211  -18.187 21.629  1.00 42.02 ? 59  ILE A CA  1 
ATOM   460  C  C   . ILE A 1 59  ? 19.456  -18.277 20.759  1.00 43.51 ? 59  ILE A C   1 
ATOM   461  O  O   . ILE A 1 59  ? 20.017  -17.259 20.342  1.00 44.02 ? 59  ILE A O   1 
ATOM   462  C  CB  . ILE A 1 59  ? 17.351  -16.985 21.176  1.00 41.35 ? 59  ILE A CB  1 
ATOM   463  C  CG1 . ILE A 1 59  ? 16.259  -16.703 22.210  1.00 40.00 ? 59  ILE A CG1 1 
ATOM   464  C  CG2 . ILE A 1 59  ? 16.707  -17.287 19.834  1.00 39.83 ? 59  ILE A CG2 1 
ATOM   465  C  CD1 . ILE A 1 59  ? 15.440  -15.465 21.911  1.00 38.82 ? 59  ILE A CD1 1 
ATOM   466  N  N   . GLN A 1 60  ? 19.887  -19.503 20.491  1.00 44.06 ? 60  GLN A N   1 
ATOM   467  C  CA  . GLN A 1 60  ? 21.088  -19.729 19.703  1.00 45.79 ? 60  GLN A CA  1 
ATOM   468  C  C   . GLN A 1 60  ? 20.875  -20.750 18.590  1.00 46.20 ? 60  GLN A C   1 
ATOM   469  O  O   . GLN A 1 60  ? 19.908  -21.509 18.610  1.00 45.56 ? 60  GLN A O   1 
ATOM   470  C  CB  . GLN A 1 60  ? 22.210  -20.180 20.642  1.00 46.97 ? 60  GLN A CB  1 
ATOM   471  C  CG  . GLN A 1 60  ? 22.439  -19.211 21.803  1.00 47.33 ? 60  GLN A CG  1 
ATOM   472  C  CD  . GLN A 1 60  ? 23.422  -19.725 22.835  1.00 47.95 ? 60  GLN A CD  1 
ATOM   473  O  OE1 . GLN A 1 60  ? 23.155  -20.697 23.546  1.00 46.47 ? 60  GLN A OE1 1 
ATOM   474  N  NE2 . GLN A 1 60  ? 24.571  -19.070 22.924  1.00 49.39 ? 60  GLN A NE2 1 
ATOM   475  N  N   . ASN A 1 61  ? 21.783  -20.755 17.616  1.00 48.25 ? 61  ASN A N   1 
ATOM   476  C  CA  . ASN A 1 61  ? 21.706  -21.682 16.485  1.00 49.34 ? 61  ASN A CA  1 
ATOM   477  C  C   . ASN A 1 61  ? 20.417  -21.528 15.672  1.00 49.86 ? 61  ASN A C   1 
ATOM   478  O  O   . ASN A 1 61  ? 19.820  -22.526 15.265  1.00 50.38 ? 61  ASN A O   1 
ATOM   479  C  CB  . ASN A 1 61  ? 21.800  -23.135 16.969  1.00 49.25 ? 61  ASN A CB  1 
ATOM   480  C  CG  . ASN A 1 61  ? 23.074  -23.420 17.737  1.00 48.63 ? 61  ASN A CG  1 
ATOM   481  O  OD1 . ASN A 1 61  ? 24.174  -23.120 17.273  1.00 47.35 ? 61  ASN A OD1 1 
ATOM   482  N  ND2 . ASN A 1 61  ? 22.931  -24.015 18.918  1.00 47.14 ? 61  ASN A ND2 1 
ATOM   483  N  N   . THR A 1 62  ? 19.983  -20.293 15.437  1.00 50.01 ? 62  THR A N   1 
ATOM   484  C  CA  . THR A 1 62  ? 18.759  -20.069 14.672  1.00 49.45 ? 62  THR A CA  1 
ATOM   485  C  C   . THR A 1 62  ? 19.030  -19.252 13.421  1.00 48.93 ? 62  THR A C   1 
ATOM   486  O  O   . THR A 1 62  ? 18.234  -19.264 12.482  1.00 48.55 ? 62  THR A O   1 
ATOM   487  C  CB  . THR A 1 62  ? 17.704  -19.323 15.499  1.00 50.14 ? 62  THR A CB  1 
ATOM   488  O  OG1 . THR A 1 62  ? 18.140  -17.980 15.731  1.00 51.30 ? 62  THR A OG1 1 
ATOM   489  C  CG2 . THR A 1 62  ? 17.486  -20.020 16.831  1.00 51.04 ? 62  THR A CG2 1 
ATOM   490  N  N   . LYS A 1 63  ? 20.160  -18.549 13.417  1.00 48.58 ? 63  LYS A N   1 
ATOM   491  C  CA  . LYS A 1 63  ? 20.547  -17.707 12.289  1.00 47.94 ? 63  LYS A CA  1 
ATOM   492  C  C   . LYS A 1 63  ? 19.336  -16.918 11.817  1.00 46.28 ? 63  LYS A C   1 
ATOM   493  O  O   . LYS A 1 63  ? 18.865  -17.097 10.695  1.00 46.71 ? 63  LYS A O   1 
ATOM   494  C  CB  . LYS A 1 63  ? 21.094  -18.563 11.144  1.00 49.75 ? 63  LYS A CB  1 
ATOM   495  C  CG  . LYS A 1 63  ? 22.357  -19.340 11.497  1.00 53.34 ? 63  LYS A CG  1 
ATOM   496  C  CD  . LYS A 1 63  ? 22.902  -20.098 10.292  1.00 55.26 ? 63  LYS A CD  1 
ATOM   497  C  CE  . LYS A 1 63  ? 24.148  -20.902 10.648  1.00 56.07 ? 63  LYS A CE  1 
ATOM   498  N  NZ  . LYS A 1 63  ? 25.216  -20.050 11.242  1.00 56.21 ? 63  LYS A NZ  1 
ATOM   499  N  N   . SER A 1 64  ? 18.835  -16.047 12.686  1.00 42.92 ? 64  SER A N   1 
ATOM   500  C  CA  . SER A 1 64  ? 17.669  -15.243 12.372  1.00 40.94 ? 64  SER A CA  1 
ATOM   501  C  C   . SER A 1 64  ? 17.661  -13.958 13.188  1.00 40.46 ? 64  SER A C   1 
ATOM   502  O  O   . SER A 1 64  ? 18.623  -13.631 13.875  1.00 43.33 ? 64  SER A O   1 
ATOM   503  C  CB  . SER A 1 64  ? 16.399  -16.030 12.686  1.00 41.30 ? 64  SER A CB  1 
ATOM   504  O  OG  . SER A 1 64  ? 16.427  -17.315 12.099  1.00 42.93 ? 64  SER A OG  1 
ATOM   505  N  N   . TYR A 1 65  ? 16.561  -13.226 13.101  1.00 37.51 ? 65  TYR A N   1 
ATOM   506  C  CA  . TYR A 1 65  ? 16.401  -11.995 13.853  1.00 34.28 ? 65  TYR A CA  1 
ATOM   507  C  C   . TYR A 1 65  ? 15.547  -12.354 15.068  1.00 32.06 ? 65  TYR A C   1 
ATOM   508  O  O   . TYR A 1 65  ? 14.982  -13.441 15.128  1.00 30.67 ? 65  TYR A O   1 
ATOM   509  C  CB  . TYR A 1 65  ? 15.686  -10.951 12.990  1.00 34.02 ? 65  TYR A CB  1 
ATOM   510  C  CG  . TYR A 1 65  ? 16.514  -10.438 11.834  1.00 33.56 ? 65  TYR A CG  1 
ATOM   511  C  CD1 . TYR A 1 65  ? 17.590  -9.579  12.053  1.00 32.54 ? 65  TYR A CD1 1 
ATOM   512  C  CD2 . TYR A 1 65  ? 16.220  -10.805 10.523  1.00 33.83 ? 65  TYR A CD2 1 
ATOM   513  C  CE1 . TYR A 1 65  ? 18.348  -9.096  11.001  1.00 33.33 ? 65  TYR A CE1 1 
ATOM   514  C  CE2 . TYR A 1 65  ? 16.975  -10.327 9.459   1.00 35.26 ? 65  TYR A CE2 1 
ATOM   515  C  CZ  . TYR A 1 65  ? 18.037  -9.471  9.706   1.00 35.39 ? 65  TYR A CZ  1 
ATOM   516  O  OH  . TYR A 1 65  ? 18.784  -8.982  8.661   1.00 35.76 ? 65  TYR A OH  1 
ATOM   517  N  N   . VAL A 1 66  ? 15.466  -11.457 16.039  1.00 30.06 ? 66  VAL A N   1 
ATOM   518  C  CA  . VAL A 1 66  ? 14.654  -11.713 17.220  1.00 27.95 ? 66  VAL A CA  1 
ATOM   519  C  C   . VAL A 1 66  ? 13.635  -10.578 17.351  1.00 26.12 ? 66  VAL A C   1 
ATOM   520  O  O   . VAL A 1 66  ? 13.999  -9.412  17.485  1.00 26.90 ? 66  VAL A O   1 
ATOM   521  C  CB  . VAL A 1 66  ? 15.533  -11.814 18.494  1.00 28.87 ? 66  VAL A CB  1 
ATOM   522  C  CG1 . VAL A 1 66  ? 14.663  -12.107 19.727  1.00 24.82 ? 66  VAL A CG1 1 
ATOM   523  C  CG2 . VAL A 1 66  ? 16.564  -12.913 18.312  1.00 25.21 ? 66  VAL A CG2 1 
ATOM   524  N  N   . TRP A 1 67  ? 12.358  -10.939 17.288  1.00 23.29 ? 67  TRP A N   1 
ATOM   525  C  CA  . TRP A 1 67  ? 11.252  -9.993  17.369  1.00 23.83 ? 67  TRP A CA  1 
ATOM   526  C  C   . TRP A 1 67  ? 11.163  -9.144  18.645  1.00 23.91 ? 67  TRP A C   1 
ATOM   527  O  O   . TRP A 1 67  ? 11.310  -9.660  19.758  1.00 22.58 ? 67  TRP A O   1 
ATOM   528  C  CB  . TRP A 1 67  ? 9.919   -10.741 17.253  1.00 22.91 ? 67  TRP A CB  1 
ATOM   529  C  CG  . TRP A 1 67  ? 9.586   -11.357 15.937  1.00 26.14 ? 67  TRP A CG  1 
ATOM   530  C  CD1 . TRP A 1 67  ? 9.033   -12.590 15.739  1.00 26.37 ? 67  TRP A CD1 1 
ATOM   531  C  CD2 . TRP A 1 67  ? 9.656   -10.738 14.645  1.00 24.55 ? 67  TRP A CD2 1 
ATOM   532  N  NE1 . TRP A 1 67  ? 8.746   -12.775 14.409  1.00 27.41 ? 67  TRP A NE1 1 
ATOM   533  C  CE2 . TRP A 1 67  ? 9.117   -11.655 13.715  1.00 25.72 ? 67  TRP A CE2 1 
ATOM   534  C  CE3 . TRP A 1 67  ? 10.116  -9.499  14.185  1.00 25.04 ? 67  TRP A CE3 1 
ATOM   535  C  CZ2 . TRP A 1 67  ? 9.024   -11.371 12.349  1.00 25.94 ? 67  TRP A CZ2 1 
ATOM   536  C  CZ3 . TRP A 1 67  ? 10.022  -9.214  12.830  1.00 26.49 ? 67  TRP A CZ3 1 
ATOM   537  C  CH2 . TRP A 1 67  ? 9.479   -10.148 11.926  1.00 27.15 ? 67  TRP A CH2 1 
ATOM   538  N  N   . ILE A 1 68  ? 10.918  -7.846  18.474  1.00 23.45 ? 68  ILE A N   1 
ATOM   539  C  CA  . ILE A 1 68  ? 10.690  -6.953  19.613  1.00 22.83 ? 68  ILE A CA  1 
ATOM   540  C  C   . ILE A 1 68  ? 9.313   -6.373  19.288  1.00 23.24 ? 68  ILE A C   1 
ATOM   541  O  O   . ILE A 1 68  ? 8.846   -6.487  18.150  1.00 23.44 ? 68  ILE A O   1 
ATOM   542  C  CB  . ILE A 1 68  ? 11.735  -5.808  19.749  1.00 20.46 ? 68  ILE A CB  1 
ATOM   543  C  CG1 . ILE A 1 68  ? 11.739  -4.926  18.499  1.00 21.49 ? 68  ILE A CG1 1 
ATOM   544  C  CG2 . ILE A 1 68  ? 13.103  -6.383  20.028  1.00 19.26 ? 68  ILE A CG2 1 
ATOM   545  C  CD1 . ILE A 1 68  ? 12.604  -3.689  18.652  1.00 16.04 ? 68  ILE A CD1 1 
ATOM   546  N  N   . GLY A 1 69  ? 8.658   -5.764  20.265  1.00 21.84 ? 69  GLY A N   1 
ATOM   547  C  CA  . GLY A 1 69  ? 7.328   -5.234  20.021  1.00 22.47 ? 69  GLY A CA  1 
ATOM   548  C  C   . GLY A 1 69  ? 7.154   -3.970  19.193  1.00 20.81 ? 69  GLY A C   1 
ATOM   549  O  O   . GLY A 1 69  ? 6.024   -3.552  18.961  1.00 19.75 ? 69  GLY A O   1 
ATOM   550  N  N   . LEU A 1 70  ? 8.244   -3.362  18.741  1.00 22.09 ? 70  LEU A N   1 
ATOM   551  C  CA  . LEU A 1 70  ? 8.144   -2.127  17.959  1.00 23.48 ? 70  LEU A CA  1 
ATOM   552  C  C   . LEU A 1 70  ? 7.939   -2.340  16.456  1.00 23.16 ? 70  LEU A C   1 
ATOM   553  O  O   . LEU A 1 70  ? 8.755   -2.966  15.801  1.00 22.17 ? 70  LEU A O   1 
ATOM   554  C  CB  . LEU A 1 70  ? 9.396   -1.271  18.184  1.00 23.18 ? 70  LEU A CB  1 
ATOM   555  C  CG  . LEU A 1 70  ? 9.398   0.151   17.609  1.00 24.13 ? 70  LEU A CG  1 
ATOM   556  C  CD1 . LEU A 1 70  ? 8.299   0.979   18.257  1.00 20.22 ? 70  LEU A CD1 1 
ATOM   557  C  CD2 . LEU A 1 70  ? 10.755  0.797   17.851  1.00 22.98 ? 70  LEU A CD2 1 
ATOM   558  N  N   . ARG A 1 71  ? 6.851   -1.798  15.917  1.00 25.31 ? 71  ARG A N   1 
ATOM   559  C  CA  . ARG A 1 71  ? 6.552   -1.923  14.487  1.00 27.63 ? 71  ARG A CA  1 
ATOM   560  C  C   . ARG A 1 71  ? 5.566   -0.849  14.031  1.00 27.95 ? 71  ARG A C   1 
ATOM   561  O  O   . ARG A 1 71  ? 4.966   -0.166  14.862  1.00 28.56 ? 71  ARG A O   1 
ATOM   562  C  CB  . ARG A 1 71  ? 5.931   -3.283  14.192  1.00 26.68 ? 71  ARG A CB  1 
ATOM   563  C  CG  . ARG A 1 71  ? 4.637   -3.505  14.952  1.00 29.74 ? 71  ARG A CG  1 
ATOM   564  C  CD  . ARG A 1 71  ? 3.782   -4.532  14.255  1.00 31.70 ? 71  ARG A CD  1 
ATOM   565  N  NE  . ARG A 1 71  ? 3.353   -4.051  12.949  1.00 30.74 ? 71  ARG A NE  1 
ATOM   566  C  CZ  . ARG A 1 71  ? 3.016   -4.843  11.937  1.00 29.87 ? 71  ARG A CZ  1 
ATOM   567  N  NH1 . ARG A 1 71  ? 3.056   -6.162  12.080  1.00 26.28 ? 71  ARG A NH1 1 
ATOM   568  N  NH2 . ARG A 1 71  ? 2.652   -4.310  10.778  1.00 30.06 ? 71  ARG A NH2 1 
ATOM   569  N  N   . VAL A 1 72  ? 5.407   -0.695  12.717  1.00 26.58 ? 72  VAL A N   1 
ATOM   570  C  CA  . VAL A 1 72  ? 4.445   0.267   12.191  1.00 28.02 ? 72  VAL A CA  1 
ATOM   571  C  C   . VAL A 1 72  ? 3.116   -0.479  12.321  1.00 29.40 ? 72  VAL A C   1 
ATOM   572  O  O   . VAL A 1 72  ? 3.018   -1.654  11.961  1.00 29.49 ? 72  VAL A O   1 
ATOM   573  C  CB  . VAL A 1 72  ? 4.724   0.635   10.694  1.00 28.63 ? 72  VAL A CB  1 
ATOM   574  C  CG1 . VAL A 1 72  ? 6.165   1.054   10.517  1.00 24.28 ? 72  VAL A CG1 1 
ATOM   575  C  CG2 . VAL A 1 72  ? 4.405   -0.526  9.787   1.00 30.57 ? 72  VAL A CG2 1 
ATOM   576  N  N   . GLN A 1 73  ? 2.092   0.189   12.835  1.00 31.29 ? 73  GLN A N   1 
ATOM   577  C  CA  . GLN A 1 73  ? 0.815   -0.477  13.054  1.00 34.04 ? 73  GLN A CA  1 
ATOM   578  C  C   . GLN A 1 73  ? 0.038   -0.990  11.854  1.00 33.39 ? 73  GLN A C   1 
ATOM   579  O  O   . GLN A 1 73  ? -0.478  -2.107  11.889  1.00 35.14 ? 73  GLN A O   1 
ATOM   580  C  CB  . GLN A 1 73  ? -0.089  0.411   13.900  1.00 36.12 ? 73  GLN A CB  1 
ATOM   581  C  CG  . GLN A 1 73  ? 0.495   0.683   15.257  1.00 39.13 ? 73  GLN A CG  1 
ATOM   582  C  CD  . GLN A 1 73  ? -0.487  1.341   16.176  1.00 41.74 ? 73  GLN A CD  1 
ATOM   583  O  OE1 . GLN A 1 73  ? -1.066  2.373   15.844  1.00 42.50 ? 73  GLN A OE1 1 
ATOM   584  N  NE2 . GLN A 1 73  ? -0.685  0.750   17.350  1.00 42.38 ? 73  GLN A NE2 1 
ATOM   585  N  N   . GLY A 1 74  ? -0.049  -0.190  10.799  1.00 31.24 ? 74  GLY A N   1 
ATOM   586  C  CA  . GLY A 1 74  ? -0.798  -0.612  9.629   1.00 28.95 ? 74  GLY A CA  1 
ATOM   587  C  C   . GLY A 1 74  ? -0.128  -1.611  8.698   1.00 27.77 ? 74  GLY A C   1 
ATOM   588  O  O   . GLY A 1 74  ? 0.936   -2.163  8.995   1.00 26.37 ? 74  GLY A O   1 
ATOM   589  N  N   . LYS A 1 75  ? -0.762  -1.832  7.549   1.00 27.29 ? 75  LYS A N   1 
ATOM   590  C  CA  . LYS A 1 75  ? -0.259  -2.778  6.553   1.00 26.89 ? 75  LYS A CA  1 
ATOM   591  C  C   . LYS A 1 75  ? 0.280   -2.104  5.289   1.00 26.38 ? 75  LYS A C   1 
ATOM   592  O  O   . LYS A 1 75  ? 0.504   -2.770  4.273   1.00 23.90 ? 75  LYS A O   1 
ATOM   593  C  CB  . LYS A 1 75  ? -1.366  -3.772  6.183   1.00 27.36 ? 75  LYS A CB  1 
ATOM   594  C  CG  . LYS A 1 75  ? -1.768  -4.715  7.325   1.00 28.27 ? 75  LYS A CG  1 
ATOM   595  C  CD  . LYS A 1 75  ? -3.121  -5.360  7.062   1.00 32.14 ? 75  LYS A CD  1 
ATOM   596  C  CE  . LYS A 1 75  ? -3.339  -6.574  7.943   1.00 32.85 ? 75  LYS A CE  1 
ATOM   597  N  NZ  . LYS A 1 75  ? -2.325  -7.621  7.639   1.00 34.77 ? 75  LYS A NZ  1 
ATOM   598  N  N   . GLU A 1 76  ? 0.489   -0.788  5.359   1.00 26.28 ? 76  GLU A N   1 
ATOM   599  C  CA  . GLU A 1 76  ? 1.019   -0.025  4.226   1.00 27.09 ? 76  GLU A CA  1 
ATOM   600  C  C   . GLU A 1 76  ? 2.419   -0.494  3.876   1.00 27.20 ? 76  GLU A C   1 
ATOM   601  O  O   . GLU A 1 76  ? 3.143   -1.000  4.734   1.00 27.64 ? 76  GLU A O   1 
ATOM   602  C  CB  . GLU A 1 76  ? 1.136   1.468   4.548   1.00 27.70 ? 76  GLU A CB  1 
ATOM   603  C  CG  . GLU A 1 76  ? 0.110   2.007   5.507   1.00 29.91 ? 76  GLU A CG  1 
ATOM   604  C  CD  . GLU A 1 76  ? 0.446   1.709   6.957   1.00 27.95 ? 76  GLU A CD  1 
ATOM   605  O  OE1 . GLU A 1 76  ? 1.410   2.298   7.494   1.00 29.58 ? 76  GLU A OE1 1 
ATOM   606  O  OE2 . GLU A 1 76  ? -0.262  0.884   7.556   1.00 25.40 ? 76  GLU A OE2 1 
ATOM   607  N  N   . LYS A 1 77  ? 2.801   -0.307  2.617   1.00 26.53 ? 77  LYS A N   1 
ATOM   608  C  CA  . LYS A 1 77  ? 4.140   -0.661  2.178   1.00 25.83 ? 77  LYS A CA  1 
ATOM   609  C  C   . LYS A 1 77  ? 5.036   0.520   2.545   1.00 24.77 ? 77  LYS A C   1 
ATOM   610  O  O   . LYS A 1 77  ? 6.249   0.386   2.624   1.00 26.27 ? 77  LYS A O   1 
ATOM   611  C  CB  . LYS A 1 77  ? 4.171   -0.911  0.660   1.00 24.08 ? 77  LYS A CB  1 
ATOM   612  C  CG  . LYS A 1 77  ? 3.405   -2.147  0.229   1.00 22.56 ? 77  LYS A CG  1 
ATOM   613  C  CD  . LYS A 1 77  ? 3.971   -3.395  0.892   1.00 23.19 ? 77  LYS A CD  1 
ATOM   614  C  CE  . LYS A 1 77  ? 3.192   -4.642  0.507   1.00 23.33 ? 77  LYS A CE  1 
ATOM   615  N  NZ  . LYS A 1 77  ? 1.823   -4.634  1.062   1.00 25.07 ? 77  LYS A NZ  1 
ATOM   616  N  N   . GLN A 1 78  ? 4.423   1.677   2.780   1.00 26.07 ? 78  GLN A N   1 
ATOM   617  C  CA  . GLN A 1 78  ? 5.173   2.874   3.151   1.00 28.35 ? 78  GLN A CA  1 
ATOM   618  C  C   . GLN A 1 78  ? 4.250   4.025   3.550   1.00 28.63 ? 78  GLN A C   1 
ATOM   619  O  O   . GLN A 1 78  ? 3.024   3.921   3.431   1.00 28.61 ? 78  GLN A O   1 
ATOM   620  C  CB  . GLN A 1 78  ? 6.065   3.319   1.991   1.00 29.71 ? 78  GLN A CB  1 
ATOM   621  C  CG  . GLN A 1 78  ? 5.327   3.952   0.826   1.00 33.31 ? 78  GLN A CG  1 
ATOM   622  C  CD  . GLN A 1 78  ? 6.248   4.231   -0.348  1.00 38.19 ? 78  GLN A CD  1 
ATOM   623  O  OE1 . GLN A 1 78  ? 7.300   4.847   -0.185  1.00 42.94 ? 78  GLN A OE1 1 
ATOM   624  N  NE2 . GLN A 1 78  ? 5.859   3.778   -1.537  1.00 39.55 ? 78  GLN A NE2 1 
ATOM   625  N  N   . CYS A 1 79  ? 4.846   5.112   4.037   1.00 27.58 ? 79  CYS A N   1 
ATOM   626  C  CA  . CYS A 1 79  ? 4.092   6.298   4.434   1.00 30.37 ? 79  CYS A CA  1 
ATOM   627  C  C   . CYS A 1 79  ? 4.774   7.514   3.822   1.00 32.36 ? 79  CYS A C   1 
ATOM   628  O  O   . CYS A 1 79  ? 5.364   8.334   4.519   1.00 32.44 ? 79  CYS A O   1 
ATOM   629  C  CB  . CYS A 1 79  ? 4.029   6.419   5.965   1.00 29.00 ? 79  CYS A CB  1 
ATOM   630  S  SG  . CYS A 1 79  ? 3.437   4.878   6.716   1.00 28.09 ? 79  CYS A SG  1 
ATOM   631  N  N   . SER A 1 80  ? 4.699   7.601   2.500   1.00 35.44 ? 80  SER A N   1 
ATOM   632  C  CA  . SER A 1 80  ? 5.298   8.696   1.753   1.00 38.44 ? 80  SER A CA  1 
ATOM   633  C  C   . SER A 1 80  ? 4.265   9.170   0.736   1.00 38.72 ? 80  SER A C   1 
ATOM   634  O  O   . SER A 1 80  ? 3.786   8.391   -0.083  1.00 40.63 ? 80  SER A O   1 
ATOM   635  C  CB  . SER A 1 80  ? 6.560   8.208   1.044   1.00 39.33 ? 80  SER A CB  1 
ATOM   636  O  OG  . SER A 1 80  ? 7.326   9.296   0.567   1.00 42.56 ? 80  SER A OG  1 
ATOM   637  N  N   . SER A 1 81  ? 3.923   10.449  0.792   1.00 39.81 ? 81  SER A N   1 
ATOM   638  C  CA  . SER A 1 81  ? 2.920   11.008  -0.103  1.00 39.64 ? 81  SER A CA  1 
ATOM   639  C  C   . SER A 1 81  ? 3.404   11.429  -1.488  1.00 38.52 ? 81  SER A C   1 
ATOM   640  O  O   . SER A 1 81  ? 2.655   11.330  -2.461  1.00 38.25 ? 81  SER A O   1 
ATOM   641  C  CB  . SER A 1 81  ? 2.243   12.204  0.569   1.00 40.34 ? 81  SER A CB  1 
ATOM   642  O  OG  . SER A 1 81  ? 1.198   12.716  -0.240  1.00 41.59 ? 81  SER A OG  1 
ATOM   643  N  N   . GLU A 1 82  ? 4.643   11.898  -1.587  1.00 37.83 ? 82  GLU A N   1 
ATOM   644  C  CA  . GLU A 1 82  ? 5.154   12.349  -2.875  1.00 36.87 ? 82  GLU A CA  1 
ATOM   645  C  C   . GLU A 1 82  ? 6.630   12.072  -3.117  1.00 35.02 ? 82  GLU A C   1 
ATOM   646  O  O   . GLU A 1 82  ? 7.409   11.893  -2.183  1.00 34.30 ? 82  GLU A O   1 
ATOM   647  C  CB  . GLU A 1 82  ? 4.903   13.853  -3.031  1.00 39.81 ? 82  GLU A CB  1 
ATOM   648  C  CG  . GLU A 1 82  ? 5.472   14.686  -1.895  1.00 42.87 ? 82  GLU A CG  1 
ATOM   649  C  CD  . GLU A 1 82  ? 5.381   16.181  -2.150  1.00 46.68 ? 82  GLU A CD  1 
ATOM   650  O  OE1 . GLU A 1 82  ? 4.262   16.695  -2.366  1.00 46.77 ? 82  GLU A OE1 1 
ATOM   651  O  OE2 . GLU A 1 82  ? 6.439   16.845  -2.131  1.00 50.51 ? 82  GLU A OE2 1 
ATOM   652  N  N   . TRP A 1 83  ? 7.003   12.046  -4.393  1.00 32.41 ? 83  TRP A N   1 
ATOM   653  C  CA  . TRP A 1 83  ? 8.388   11.824  -4.778  1.00 29.94 ? 83  TRP A CA  1 
ATOM   654  C  C   . TRP A 1 83  ? 9.133   13.132  -4.576  1.00 29.60 ? 83  TRP A C   1 
ATOM   655  O  O   . TRP A 1 83  ? 8.521   14.163  -4.280  1.00 26.73 ? 83  TRP A O   1 
ATOM   656  C  CB  . TRP A 1 83  ? 8.487   11.428  -6.245  1.00 26.57 ? 83  TRP A CB  1 
ATOM   657  C  CG  . TRP A 1 83  ? 7.703   10.223  -6.589  1.00 24.55 ? 83  TRP A CG  1 
ATOM   658  C  CD1 . TRP A 1 83  ? 6.348   10.129  -6.715  1.00 23.06 ? 83  TRP A CD1 1 
ATOM   659  C  CD2 . TRP A 1 83  ? 8.225   8.928   -6.872  1.00 22.91 ? 83  TRP A CD2 1 
ATOM   660  N  NE1 . TRP A 1 83  ? 5.992   8.850   -7.065  1.00 22.96 ? 83  TRP A NE1 1 
ATOM   661  C  CE2 . TRP A 1 83  ? 7.126   8.091   -7.169  1.00 22.71 ? 83  TRP A CE2 1 
ATOM   662  C  CE3 . TRP A 1 83  ? 9.517   8.392   -6.907  1.00 22.48 ? 83  TRP A CE3 1 
ATOM   663  C  CZ2 . TRP A 1 83  ? 7.278   6.743   -7.500  1.00 24.94 ? 83  TRP A CZ2 1 
ATOM   664  C  CZ3 . TRP A 1 83  ? 9.673   7.050   -7.236  1.00 24.59 ? 83  TRP A CZ3 1 
ATOM   665  C  CH2 . TRP A 1 83  ? 8.555   6.240   -7.529  1.00 26.24 ? 83  TRP A CH2 1 
ATOM   666  N  N   . SER A 1 84  ? 10.448  13.091  -4.759  1.00 28.63 ? 84  SER A N   1 
ATOM   667  C  CA  . SER A 1 84  ? 11.273  14.275  -4.583  1.00 27.98 ? 84  SER A CA  1 
ATOM   668  C  C   . SER A 1 84  ? 10.970  15.382  -5.597  1.00 27.27 ? 84  SER A C   1 
ATOM   669  O  O   . SER A 1 84  ? 11.340  16.534  -5.384  1.00 26.90 ? 84  SER A O   1 
ATOM   670  C  CB  . SER A 1 84  ? 12.756  13.894  -4.643  1.00 27.51 ? 84  SER A CB  1 
ATOM   671  O  OG  . SER A 1 84  ? 13.075  13.244  -5.862  1.00 30.29 ? 84  SER A OG  1 
ATOM   672  N  N   . ASP A 1 85  ? 10.294  15.042  -6.690  1.00 28.14 ? 85  ASP A N   1 
ATOM   673  C  CA  . ASP A 1 85  ? 9.971   16.049  -7.692  1.00 28.70 ? 85  ASP A CA  1 
ATOM   674  C  C   . ASP A 1 85  ? 8.632   16.710  -7.428  1.00 29.09 ? 85  ASP A C   1 
ATOM   675  O  O   . ASP A 1 85  ? 8.136   17.461  -8.263  1.00 30.66 ? 85  ASP A O   1 
ATOM   676  C  CB  . ASP A 1 85  ? 9.983   15.458  -9.112  1.00 30.04 ? 85  ASP A CB  1 
ATOM   677  C  CG  . ASP A 1 85  ? 9.008   14.305  -9.291  1.00 31.11 ? 85  ASP A CG  1 
ATOM   678  O  OD1 . ASP A 1 85  ? 8.058   14.171  -8.490  1.00 31.69 ? 85  ASP A OD1 1 
ATOM   679  O  OD2 . ASP A 1 85  ? 9.190   13.533  -10.259 1.00 31.18 ? 85  ASP A OD2 1 
ATOM   680  N  N   . GLY A 1 86  ? 8.043   16.425  -6.271  1.00 27.62 ? 86  GLY A N   1 
ATOM   681  C  CA  . GLY A 1 86  ? 6.769   17.029  -5.932  1.00 27.96 ? 86  GLY A CA  1 
ATOM   682  C  C   . GLY A 1 86  ? 5.533   16.334  -6.475  1.00 28.76 ? 86  GLY A C   1 
ATOM   683  O  O   . GLY A 1 86  ? 4.431   16.606  -6.015  1.00 30.62 ? 86  GLY A O   1 
ATOM   684  N  N   . SER A 1 87  ? 5.693   15.444  -7.450  1.00 30.31 ? 87  SER A N   1 
ATOM   685  C  CA  . SER A 1 87  ? 4.537   14.744  -7.999  1.00 31.77 ? 87  SER A CA  1 
ATOM   686  C  C   . SER A 1 87  ? 3.983   13.787  -6.952  1.00 33.25 ? 87  SER A C   1 
ATOM   687  O  O   . SER A 1 87  ? 4.706   13.318  -6.070  1.00 33.31 ? 87  SER A O   1 
ATOM   688  C  CB  . SER A 1 87  ? 4.905   13.980  -9.276  1.00 30.26 ? 87  SER A CB  1 
ATOM   689  O  OG  . SER A 1 87  ? 5.802   12.917  -9.020  1.00 31.50 ? 87  SER A OG  1 
ATOM   690  N  N   . SER A 1 88  ? 2.691   13.508  -7.054  1.00 35.23 ? 88  SER A N   1 
ATOM   691  C  CA  . SER A 1 88  ? 2.013   12.635  -6.114  1.00 36.03 ? 88  SER A CA  1 
ATOM   692  C  C   . SER A 1 88  ? 2.354   11.163  -6.341  1.00 36.56 ? 88  SER A C   1 
ATOM   693  O  O   . SER A 1 88  ? 2.673   10.754  -7.459  1.00 36.71 ? 88  SER A O   1 
ATOM   694  C  CB  . SER A 1 88  ? 0.503   12.853  -6.220  1.00 35.90 ? 88  SER A CB  1 
ATOM   695  O  OG  . SER A 1 88  ? -0.171  12.235  -5.140  1.00 40.05 ? 88  SER A OG  1 
ATOM   696  N  N   . VAL A 1 89  ? 2.284   10.378  -5.267  1.00 36.10 ? 89  VAL A N   1 
ATOM   697  C  CA  . VAL A 1 89  ? 2.586   8.956   -5.317  1.00 34.23 ? 89  VAL A CA  1 
ATOM   698  C  C   . VAL A 1 89  ? 1.340   8.097   -5.502  1.00 34.88 ? 89  VAL A C   1 
ATOM   699  O  O   . VAL A 1 89  ? 0.487   8.001   -4.618  1.00 35.76 ? 89  VAL A O   1 
ATOM   700  C  CB  . VAL A 1 89  ? 3.318   8.497   -4.044  1.00 34.25 ? 89  VAL A CB  1 
ATOM   701  C  CG1 . VAL A 1 89  ? 3.482   6.984   -4.047  1.00 35.29 ? 89  VAL A CG1 1 
ATOM   702  C  CG2 . VAL A 1 89  ? 4.679   9.153   -3.974  1.00 35.52 ? 89  VAL A CG2 1 
ATOM   703  N  N   . SER A 1 90  ? 1.246   7.479   -6.671  1.00 33.73 ? 90  SER A N   1 
ATOM   704  C  CA  . SER A 1 90  ? 0.135   6.610   -7.001  1.00 34.10 ? 90  SER A CA  1 
ATOM   705  C  C   . SER A 1 90  ? 0.727   5.241   -7.290  1.00 32.60 ? 90  SER A C   1 
ATOM   706  O  O   . SER A 1 90  ? 0.690   4.349   -6.448  1.00 32.98 ? 90  SER A O   1 
ATOM   707  C  CB  . SER A 1 90  ? -0.607  7.140   -8.230  1.00 35.31 ? 90  SER A CB  1 
ATOM   708  O  OG  . SER A 1 90  ? -1.256  8.362   -7.929  1.00 40.13 ? 90  SER A OG  1 
ATOM   709  N  N   . TYR A 1 91  ? 1.286   5.090   -8.482  1.00 28.71 ? 91  TYR A N   1 
ATOM   710  C  CA  . TYR A 1 91  ? 1.908   3.841   -8.873  1.00 26.57 ? 91  TYR A CA  1 
ATOM   711  C  C   . TYR A 1 91  ? 2.952   3.426   -7.836  1.00 25.80 ? 91  TYR A C   1 
ATOM   712  O  O   . TYR A 1 91  ? 3.737   4.248   -7.377  1.00 25.86 ? 91  TYR A O   1 
ATOM   713  C  CB  . TYR A 1 91  ? 2.574   4.016   -10.234 1.00 24.13 ? 91  TYR A CB  1 
ATOM   714  C  CG  . TYR A 1 91  ? 3.448   2.864   -10.658 1.00 23.17 ? 91  TYR A CG  1 
ATOM   715  C  CD1 . TYR A 1 91  ? 2.904   1.707   -11.220 1.00 22.83 ? 91  TYR A CD1 1 
ATOM   716  C  CD2 . TYR A 1 91  ? 4.829   2.938   -10.513 1.00 22.94 ? 91  TYR A CD2 1 
ATOM   717  C  CE1 . TYR A 1 91  ? 3.728   0.650   -11.632 1.00 22.81 ? 91  TYR A CE1 1 
ATOM   718  C  CE2 . TYR A 1 91  ? 5.651   1.899   -10.914 1.00 23.64 ? 91  TYR A CE2 1 
ATOM   719  C  CZ  . TYR A 1 91  ? 5.100   0.761   -11.469 1.00 22.11 ? 91  TYR A CZ  1 
ATOM   720  O  OH  . TYR A 1 91  ? 5.938   -0.259  -11.831 1.00 23.97 ? 91  TYR A OH  1 
ATOM   721  N  N   . GLU A 1 92  ? 2.939   2.147   -7.470  1.00 25.70 ? 92  GLU A N   1 
ATOM   722  C  CA  . GLU A 1 92  ? 3.892   1.575   -6.513  1.00 25.00 ? 92  GLU A CA  1 
ATOM   723  C  C   . GLU A 1 92  ? 4.130   0.120   -6.927  1.00 24.52 ? 92  GLU A C   1 
ATOM   724  O  O   . GLU A 1 92  ? 3.218   -0.535  -7.435  1.00 24.92 ? 92  GLU A O   1 
ATOM   725  C  CB  . GLU A 1 92  ? 3.340   1.633   -5.085  1.00 23.17 ? 92  GLU A CB  1 
ATOM   726  C  CG  . GLU A 1 92  ? 3.238   3.047   -4.515  1.00 24.79 ? 92  GLU A CG  1 
ATOM   727  C  CD  . GLU A 1 92  ? 2.875   3.060   -3.037  1.00 23.27 ? 92  GLU A CD  1 
ATOM   728  O  OE1 . GLU A 1 92  ? 3.533   2.344   -2.264  1.00 24.81 ? 92  GLU A OE1 1 
ATOM   729  O  OE2 . GLU A 1 92  ? 1.939   3.786   -2.649  1.00 27.38 ? 92  GLU A OE2 1 
ATOM   730  N  N   . ASN A 1 93  ? 5.341   -0.389  -6.713  1.00 22.98 ? 93  ASN A N   1 
ATOM   731  C  CA  . ASN A 1 93  ? 5.647   -1.759  -7.116  1.00 24.19 ? 93  ASN A CA  1 
ATOM   732  C  C   . ASN A 1 93  ? 6.622   -2.453  -6.155  1.00 24.96 ? 93  ASN A C   1 
ATOM   733  O  O   . ASN A 1 93  ? 7.690   -2.924  -6.558  1.00 26.34 ? 93  ASN A O   1 
ATOM   734  C  CB  . ASN A 1 93  ? 6.208   -1.742  -8.547  1.00 22.39 ? 93  ASN A CB  1 
ATOM   735  C  CG  . ASN A 1 93  ? 6.206   -3.111  -9.203  1.00 21.57 ? 93  ASN A CG  1 
ATOM   736  O  OD1 . ASN A 1 93  ? 5.185   -3.804  -9.236  1.00 23.42 ? 93  ASN A OD1 1 
ATOM   737  N  ND2 . ASN A 1 93  ? 7.348   -3.500  -9.746  1.00 19.72 ? 93  ASN A ND2 1 
ATOM   738  N  N   . TRP A 1 94  ? 6.236   -2.524  -4.884  1.00 24.66 ? 94  TRP A N   1 
ATOM   739  C  CA  . TRP A 1 94  ? 7.064   -3.155  -3.854  1.00 25.86 ? 94  TRP A CA  1 
ATOM   740  C  C   . TRP A 1 94  ? 7.118   -4.676  -3.891  1.00 26.68 ? 94  TRP A C   1 
ATOM   741  O  O   . TRP A 1 94  ? 6.122   -5.351  -4.191  1.00 25.76 ? 94  TRP A O   1 
ATOM   742  C  CB  . TRP A 1 94  ? 6.580   -2.789  -2.445  1.00 24.50 ? 94  TRP A CB  1 
ATOM   743  C  CG  . TRP A 1 94  ? 6.873   -1.392  -1.995  1.00 27.58 ? 94  TRP A CG  1 
ATOM   744  C  CD1 . TRP A 1 94  ? 6.086   -0.287  -2.169  1.00 25.90 ? 94  TRP A CD1 1 
ATOM   745  C  CD2 . TRP A 1 94  ? 8.033   -0.952  -1.283  1.00 27.49 ? 94  TRP A CD2 1 
ATOM   746  N  NE1 . TRP A 1 94  ? 6.685   0.812   -1.604  1.00 27.89 ? 94  TRP A NE1 1 
ATOM   747  C  CE2 . TRP A 1 94  ? 7.882   0.433   -1.054  1.00 28.20 ? 94  TRP A CE2 1 
ATOM   748  C  CE3 . TRP A 1 94  ? 9.188   -1.593  -0.815  1.00 29.51 ? 94  TRP A CE3 1 
ATOM   749  C  CZ2 . TRP A 1 94  ? 8.847   1.191   -0.375  1.00 28.49 ? 94  TRP A CZ2 1 
ATOM   750  C  CZ3 . TRP A 1 94  ? 10.149  -0.838  -0.138  1.00 30.17 ? 94  TRP A CZ3 1 
ATOM   751  C  CH2 . TRP A 1 94  ? 9.968   0.539   0.073   1.00 28.03 ? 94  TRP A CH2 1 
ATOM   752  N  N   . ILE A 1 95  ? 8.298   -5.205  -3.586  1.00 26.58 ? 95  ILE A N   1 
ATOM   753  C  CA  . ILE A 1 95  ? 8.478   -6.637  -3.457  1.00 26.05 ? 95  ILE A CA  1 
ATOM   754  C  C   . ILE A 1 95  ? 8.001   -6.741  -2.011  1.00 28.38 ? 95  ILE A C   1 
ATOM   755  O  O   . ILE A 1 95  ? 8.464   -5.991  -1.152  1.00 27.41 ? 95  ILE A O   1 
ATOM   756  C  CB  . ILE A 1 95  ? 9.968   -7.047  -3.545  1.00 27.19 ? 95  ILE A CB  1 
ATOM   757  C  CG1 . ILE A 1 95  ? 10.418  -7.036  -5.012  1.00 25.90 ? 95  ILE A CG1 1 
ATOM   758  C  CG2 . ILE A 1 95  ? 10.181  -8.423  -2.890  1.00 21.41 ? 95  ILE A CG2 1 
ATOM   759  C  CD1 . ILE A 1 95  ? 11.871  -7.410  -5.220  1.00 27.90 ? 95  ILE A CD1 1 
ATOM   760  N  N   . GLU A 1 96  ? 7.056   -7.635  -1.753  1.00 30.91 ? 96  GLU A N   1 
ATOM   761  C  CA  . GLU A 1 96  ? 6.490   -7.784  -0.416  1.00 33.01 ? 96  GLU A CA  1 
ATOM   762  C  C   . GLU A 1 96  ? 7.527   -7.707  0.701   1.00 31.23 ? 96  GLU A C   1 
ATOM   763  O  O   . GLU A 1 96  ? 7.387   -6.912  1.636   1.00 30.62 ? 96  GLU A O   1 
ATOM   764  C  CB  . GLU A 1 96  ? 5.711   -9.102  -0.324  1.00 35.55 ? 96  GLU A CB  1 
ATOM   765  C  CG  . GLU A 1 96  ? 4.729   -9.185  0.832   1.00 44.04 ? 96  GLU A CG  1 
ATOM   766  C  CD  . GLU A 1 96  ? 3.647   -8.109  0.770   1.00 49.98 ? 96  GLU A CD  1 
ATOM   767  O  OE1 . GLU A 1 96  ? 3.008   -7.969  -0.299  1.00 52.49 ? 96  GLU A OE1 1 
ATOM   768  O  OE2 . GLU A 1 96  ? 3.428   -7.409  1.791   1.00 51.59 ? 96  GLU A OE2 1 
ATOM   769  N  N   . ALA A 1 97  ? 8.577   -8.515  0.589   1.00 31.75 ? 97  ALA A N   1 
ATOM   770  C  CA  . ALA A 1 97  ? 9.624   -8.564  1.607   1.00 31.87 ? 97  ALA A CA  1 
ATOM   771  C  C   . ALA A 1 97  ? 10.594  -7.383  1.640   1.00 31.61 ? 97  ALA A C   1 
ATOM   772  O  O   . ALA A 1 97  ? 11.449  -7.318  2.523   1.00 33.39 ? 97  ALA A O   1 
ATOM   773  C  CB  . ALA A 1 97  ? 10.400  -9.866  1.477   1.00 31.14 ? 97  ALA A CB  1 
ATOM   774  N  N   . GLU A 1 98  ? 10.476  -6.453  0.694   1.00 30.60 ? 98  GLU A N   1 
ATOM   775  C  CA  . GLU A 1 98  ? 11.367  -5.289  0.675   1.00 28.89 ? 98  GLU A CA  1 
ATOM   776  C  C   . GLU A 1 98  ? 10.815  -4.179  1.559   1.00 26.93 ? 98  GLU A C   1 
ATOM   777  O  O   . GLU A 1 98  ? 11.507  -3.210  1.854   1.00 25.81 ? 98  GLU A O   1 
ATOM   778  C  CB  . GLU A 1 98  ? 11.567  -4.760  -0.749  1.00 29.26 ? 98  GLU A CB  1 
ATOM   779  C  CG  . GLU A 1 98  ? 12.515  -5.588  -1.619  1.00 32.01 ? 98  GLU A CG  1 
ATOM   780  C  CD  . GLU A 1 98  ? 13.946  -5.638  -1.091  1.00 35.80 ? 98  GLU A CD  1 
ATOM   781  O  OE1 . GLU A 1 98  ? 14.445  -4.605  -0.595  1.00 35.23 ? 98  GLU A OE1 1 
ATOM   782  O  OE2 . GLU A 1 98  ? 14.582  -6.714  -1.192  1.00 37.29 ? 98  GLU A OE2 1 
ATOM   783  N  N   . SER A 1 99  ? 9.556   -4.317  1.959   1.00 26.02 ? 99  SER A N   1 
ATOM   784  C  CA  . SER A 1 99  ? 8.938   -3.347  2.844   1.00 26.74 ? 99  SER A CA  1 
ATOM   785  C  C   . SER A 1 99  ? 9.194   -3.919  4.227   1.00 28.01 ? 99  SER A C   1 
ATOM   786  O  O   . SER A 1 99  ? 8.535   -4.875  4.644   1.00 27.28 ? 99  SER A O   1 
ATOM   787  C  CB  . SER A 1 99  ? 7.436   -3.250  2.589   1.00 27.79 ? 99  SER A CB  1 
ATOM   788  O  OG  . SER A 1 99  ? 6.839   -2.327  3.486   1.00 26.06 ? 99  SER A OG  1 
ATOM   789  N  N   . LYS A 1 100 ? 10.177  -3.345  4.915   1.00 29.05 ? 100 LYS A N   1 
ATOM   790  C  CA  . LYS A 1 100 ? 10.580  -3.786  6.245   1.00 29.56 ? 100 LYS A CA  1 
ATOM   791  C  C   . LYS A 1 100 ? 10.032  -2.824  7.291   1.00 29.50 ? 100 LYS A C   1 
ATOM   792  O  O   . LYS A 1 100 ? 10.635  -1.787  7.573   1.00 30.63 ? 100 LYS A O   1 
ATOM   793  C  CB  . LYS A 1 100 ? 12.107  -3.832  6.316   1.00 30.91 ? 100 LYS A CB  1 
ATOM   794  C  CG  . LYS A 1 100 ? 12.755  -4.748  5.275   1.00 30.82 ? 100 LYS A CG  1 
ATOM   795  C  CD  . LYS A 1 100 ? 14.158  -4.273  4.933   1.00 32.82 ? 100 LYS A CD  1 
ATOM   796  C  CE  . LYS A 1 100 ? 15.001  -5.346  4.246   1.00 35.24 ? 100 LYS A CE  1 
ATOM   797  N  NZ  . LYS A 1 100 ? 14.428  -5.810  2.961   1.00 35.74 ? 100 LYS A NZ  1 
ATOM   798  N  N   . THR A 1 101 ? 8.890   -3.179  7.870   1.00 27.72 ? 101 THR A N   1 
ATOM   799  C  CA  . THR A 1 101 ? 8.245   -2.334  8.857   1.00 26.75 ? 101 THR A CA  1 
ATOM   800  C  C   . THR A 1 101 ? 8.147   -2.940  10.260  1.00 28.32 ? 101 THR A C   1 
ATOM   801  O  O   . THR A 1 101 ? 7.357   -2.485  11.090  1.00 27.36 ? 101 THR A O   1 
ATOM   802  C  CB  . THR A 1 101 ? 6.850   -1.928  8.361   1.00 27.82 ? 101 THR A CB  1 
ATOM   803  O  OG1 . THR A 1 101 ? 6.096   -3.102  8.022   1.00 30.19 ? 101 THR A OG1 1 
ATOM   804  C  CG2 . THR A 1 101 ? 6.973   -1.053  7.126   1.00 24.56 ? 101 THR A CG2 1 
ATOM   805  N  N   . CYS A 1 102 ? 8.948   -3.972  10.513  1.00 28.44 ? 102 CYS A N   1 
ATOM   806  C  CA  . CYS A 1 102 ? 9.008   -4.615  11.825  1.00 30.12 ? 102 CYS A CA  1 
ATOM   807  C  C   . CYS A 1 102 ? 10.470  -4.612  12.274  1.00 30.74 ? 102 CYS A C   1 
ATOM   808  O  O   . CYS A 1 102 ? 11.383  -4.558  11.447  1.00 31.12 ? 102 CYS A O   1 
ATOM   809  C  CB  . CYS A 1 102 ? 8.464   -6.056  11.772  1.00 29.29 ? 102 CYS A CB  1 
ATOM   810  S  SG  . CYS A 1 102 ? 6.643   -6.147  11.861  1.00 28.50 ? 102 CYS A SG  1 
ATOM   811  N  N   . LEU A 1 103 ? 10.695  -4.653  13.581  1.00 31.24 ? 103 LEU A N   1 
ATOM   812  C  CA  . LEU A 1 103 ? 12.052  -4.647  14.106  1.00 31.00 ? 103 LEU A CA  1 
ATOM   813  C  C   . LEU A 1 103 ? 12.440  -5.932  14.830  1.00 32.26 ? 103 LEU A C   1 
ATOM   814  O  O   . LEU A 1 103 ? 11.625  -6.559  15.514  1.00 33.02 ? 103 LEU A O   1 
ATOM   815  C  CB  . LEU A 1 103 ? 12.241  -3.456  15.045  1.00 29.09 ? 103 LEU A CB  1 
ATOM   816  C  CG  . LEU A 1 103 ? 12.179  -2.090  14.362  1.00 27.96 ? 103 LEU A CG  1 
ATOM   817  C  CD1 . LEU A 1 103 ? 12.225  -0.978  15.402  1.00 25.88 ? 103 LEU A CD1 1 
ATOM   818  C  CD2 . LEU A 1 103 ? 13.333  -1.975  13.386  1.00 26.82 ? 103 LEU A CD2 1 
ATOM   819  N  N   . GLY A 1 104 ? 13.703  -6.310  14.670  1.00 32.37 ? 104 GLY A N   1 
ATOM   820  C  CA  . GLY A 1 104 ? 14.216  -7.501  15.314  1.00 31.72 ? 104 GLY A CA  1 
ATOM   821  C  C   . GLY A 1 104 ? 15.680  -7.311  15.654  1.00 31.71 ? 104 GLY A C   1 
ATOM   822  O  O   . GLY A 1 104 ? 16.379  -6.548  14.984  1.00 31.85 ? 104 GLY A O   1 
ATOM   823  N  N   . LEU A 1 105 ? 16.145  -7.992  16.696  1.00 29.04 ? 105 LEU A N   1 
ATOM   824  C  CA  . LEU A 1 105 ? 17.539  -7.891  17.105  1.00 27.81 ? 105 LEU A CA  1 
ATOM   825  C  C   . LEU A 1 105 ? 18.330  -8.935  16.331  1.00 29.85 ? 105 LEU A C   1 
ATOM   826  O  O   . LEU A 1 105 ? 17.748  -9.875  15.786  1.00 29.85 ? 105 LEU A O   1 
ATOM   827  C  CB  . LEU A 1 105 ? 17.670  -8.142  18.613  1.00 23.51 ? 105 LEU A CB  1 
ATOM   828  C  CG  . LEU A 1 105 ? 16.730  -7.362  19.540  1.00 19.81 ? 105 LEU A CG  1 
ATOM   829  C  CD1 . LEU A 1 105 ? 17.027  -7.747  20.985  1.00 21.85 ? 105 LEU A CD1 1 
ATOM   830  C  CD2 . LEU A 1 105 ? 16.897  -5.863  19.343  1.00 18.23 ? 105 LEU A CD2 1 
ATOM   831  N  N   . GLU A 1 106 ? 19.651  -8.767  16.273  1.00 32.85 ? 106 GLU A N   1 
ATOM   832  C  CA  . GLU A 1 106 ? 20.508  -9.711  15.558  1.00 34.46 ? 106 GLU A CA  1 
ATOM   833  C  C   . GLU A 1 106 ? 21.815  -9.950  16.310  1.00 35.41 ? 106 GLU A C   1 
ATOM   834  O  O   . GLU A 1 106 ? 22.298  -9.078  17.033  1.00 35.58 ? 106 GLU A O   1 
ATOM   835  C  CB  . GLU A 1 106 ? 20.810  -9.196  14.146  1.00 34.80 ? 106 GLU A CB  1 
ATOM   836  C  CG  . GLU A 1 106 ? 22.027  -8.300  14.039  1.00 34.55 ? 106 GLU A CG  1 
ATOM   837  C  CD  . GLU A 1 106 ? 22.053  -7.491  12.751  1.00 35.68 ? 106 GLU A CD  1 
ATOM   838  O  OE1 . GLU A 1 106 ? 21.738  -8.051  11.679  1.00 34.08 ? 106 GLU A OE1 1 
ATOM   839  O  OE2 . GLU A 1 106 ? 22.396  -6.292  12.811  1.00 35.28 ? 106 GLU A OE2 1 
ATOM   840  N  N   . LYS A 1 107 ? 22.372  -11.143 16.134  1.00 34.83 ? 107 LYS A N   1 
ATOM   841  C  CA  . LYS A 1 107 ? 23.620  -11.539 16.776  1.00 35.04 ? 107 LYS A CA  1 
ATOM   842  C  C   . LYS A 1 107 ? 24.765  -10.625 16.352  1.00 34.26 ? 107 LYS A C   1 
ATOM   843  O  O   . LYS A 1 107 ? 25.561  -10.180 17.179  1.00 34.86 ? 107 LYS A O   1 
ATOM   844  C  CB  . LYS A 1 107 ? 23.936  -12.990 16.402  1.00 37.01 ? 107 LYS A CB  1 
ATOM   845  C  CG  . LYS A 1 107 ? 25.191  -13.566 17.017  1.00 38.88 ? 107 LYS A CG  1 
ATOM   846  C  CD  . LYS A 1 107 ? 25.411  -14.997 16.523  1.00 42.08 ? 107 LYS A CD  1 
ATOM   847  C  CE  . LYS A 1 107 ? 26.766  -15.540 16.963  1.00 43.05 ? 107 LYS A CE  1 
ATOM   848  N  NZ  . LYS A 1 107 ? 27.041  -16.888 16.393  1.00 44.59 ? 107 LYS A NZ  1 
ATOM   849  N  N   . GLU A 1 108 ? 24.832  -10.343 15.057  1.00 33.43 ? 108 GLU A N   1 
ATOM   850  C  CA  . GLU A 1 108 ? 25.869  -9.484  14.489  1.00 33.60 ? 108 GLU A CA  1 
ATOM   851  C  C   . GLU A 1 108 ? 26.128  -8.205  15.291  1.00 30.14 ? 108 GLU A C   1 
ATOM   852  O  O   . GLU A 1 108 ? 27.278  -7.849  15.549  1.00 29.41 ? 108 GLU A O   1 
ATOM   853  C  CB  . GLU A 1 108 ? 25.488  -9.130  13.053  1.00 38.85 ? 108 GLU A CB  1 
ATOM   854  C  CG  . GLU A 1 108 ? 26.343  -8.071  12.404  1.00 45.77 ? 108 GLU A CG  1 
ATOM   855  C  CD  . GLU A 1 108 ? 25.752  -7.614  11.082  1.00 51.11 ? 108 GLU A CD  1 
ATOM   856  O  OE1 . GLU A 1 108 ? 25.696  -8.433  10.136  1.00 51.49 ? 108 GLU A OE1 1 
ATOM   857  O  OE2 . GLU A 1 108 ? 25.332  -6.438  10.994  1.00 53.67 ? 108 GLU A OE2 1 
ATOM   858  N  N   . THR A 1 109 ? 25.061  -7.511  15.671  1.00 26.42 ? 109 THR A N   1 
ATOM   859  C  CA  . THR A 1 109 ? 25.196  -6.287  16.446  1.00 25.14 ? 109 THR A CA  1 
ATOM   860  C  C   . THR A 1 109 ? 24.911  -6.537  17.928  1.00 26.54 ? 109 THR A C   1 
ATOM   861  O  O   . THR A 1 109 ? 24.424  -5.657  18.640  1.00 26.98 ? 109 THR A O   1 
ATOM   862  C  CB  . THR A 1 109 ? 24.258  -5.190  15.913  1.00 25.23 ? 109 THR A CB  1 
ATOM   863  O  OG1 . THR A 1 109 ? 22.973  -5.757  15.638  1.00 25.02 ? 109 THR A OG1 1 
ATOM   864  C  CG2 . THR A 1 109 ? 24.828  -4.570  14.629  1.00 22.67 ? 109 THR A CG2 1 
ATOM   865  N  N   . GLY A 1 110 ? 25.214  -7.753  18.375  1.00 25.43 ? 110 GLY A N   1 
ATOM   866  C  CA  . GLY A 1 110 ? 25.025  -8.128  19.767  1.00 26.40 ? 110 GLY A CA  1 
ATOM   867  C  C   . GLY A 1 110 ? 23.622  -8.011  20.324  1.00 26.92 ? 110 GLY A C   1 
ATOM   868  O  O   . GLY A 1 110 ? 23.463  -7.768  21.516  1.00 28.92 ? 110 GLY A O   1 
ATOM   869  N  N   . PHE A 1 111 ? 22.616  -8.182  19.469  1.00 27.22 ? 111 PHE A N   1 
ATOM   870  C  CA  . PHE A 1 111 ? 21.215  -8.101  19.870  1.00 27.92 ? 111 PHE A CA  1 
ATOM   871  C  C   . PHE A 1 111 ? 20.928  -6.790  20.613  1.00 28.45 ? 111 PHE A C   1 
ATOM   872  O  O   . PHE A 1 111 ? 20.061  -6.740  21.482  1.00 27.66 ? 111 PHE A O   1 
ATOM   873  C  CB  . PHE A 1 111 ? 20.846  -9.307  20.758  1.00 28.91 ? 111 PHE A CB  1 
ATOM   874  C  CG  . PHE A 1 111 ? 21.128  -10.659 20.119  1.00 30.04 ? 111 PHE A CG  1 
ATOM   875  C  CD1 . PHE A 1 111 ? 20.382  -11.106 19.031  1.00 30.54 ? 111 PHE A CD1 1 
ATOM   876  C  CD2 . PHE A 1 111 ? 22.141  -11.478 20.611  1.00 29.41 ? 111 PHE A CD2 1 
ATOM   877  C  CE1 . PHE A 1 111 ? 20.643  -12.349 18.445  1.00 31.58 ? 111 PHE A CE1 1 
ATOM   878  C  CE2 . PHE A 1 111 ? 22.411  -12.724 20.033  1.00 29.34 ? 111 PHE A CE2 1 
ATOM   879  C  CZ  . PHE A 1 111 ? 21.661  -13.161 18.949  1.00 29.90 ? 111 PHE A CZ  1 
ATOM   880  N  N   . ARG A 1 112 ? 21.665  -5.738  20.266  1.00 29.91 ? 112 ARG A N   1 
ATOM   881  C  CA  . ARG A 1 112 ? 21.504  -4.423  20.885  1.00 30.30 ? 112 ARG A CA  1 
ATOM   882  C  C   . ARG A 1 112 ? 21.148  -3.365  19.841  1.00 30.62 ? 112 ARG A C   1 
ATOM   883  O  O   . ARG A 1 112 ? 21.204  -2.166  20.116  1.00 31.73 ? 112 ARG A O   1 
ATOM   884  C  CB  . ARG A 1 112 ? 22.796  -3.996  21.609  1.00 30.76 ? 112 ARG A CB  1 
ATOM   885  C  CG  . ARG A 1 112 ? 23.048  -4.641  22.977  1.00 32.02 ? 112 ARG A CG  1 
ATOM   886  C  CD  . ARG A 1 112 ? 22.008  -4.228  24.022  1.00 33.15 ? 112 ARG A CD  1 
ATOM   887  N  NE  . ARG A 1 112 ? 22.081  -2.813  24.398  1.00 34.94 ? 112 ARG A NE  1 
ATOM   888  C  CZ  . ARG A 1 112 ? 22.804  -2.328  25.407  1.00 34.26 ? 112 ARG A CZ  1 
ATOM   889  N  NH1 . ARG A 1 112 ? 23.532  -3.137  26.165  1.00 34.98 ? 112 ARG A NH1 1 
ATOM   890  N  NH2 . ARG A 1 112 ? 22.795  -1.028  25.665  1.00 32.83 ? 112 ARG A NH2 1 
ATOM   891  N  N   . LYS A 1 113 ? 20.780  -3.803  18.643  1.00 29.77 ? 113 LYS A N   1 
ATOM   892  C  CA  . LYS A 1 113 ? 20.422  -2.867  17.585  1.00 29.52 ? 113 LYS A CA  1 
ATOM   893  C  C   . LYS A 1 113 ? 19.143  -3.305  16.873  1.00 29.06 ? 113 LYS A C   1 
ATOM   894  O  O   . LYS A 1 113 ? 18.997  -4.467  16.482  1.00 29.88 ? 113 LYS A O   1 
ATOM   895  C  CB  . LYS A 1 113 ? 21.567  -2.754  16.578  1.00 30.67 ? 113 LYS A CB  1 
ATOM   896  C  CG  . LYS A 1 113 ? 21.956  -1.330  16.227  1.00 31.38 ? 113 LYS A CG  1 
ATOM   897  C  CD  . LYS A 1 113 ? 22.681  -0.634  17.367  1.00 28.62 ? 113 LYS A CD  1 
ATOM   898  C  CE  . LYS A 1 113 ? 23.065  0.786   16.963  1.00 30.61 ? 113 LYS A CE  1 
ATOM   899  N  NZ  . LYS A 1 113 ? 24.042  1.415   17.897  1.00 30.84 ? 113 LYS A NZ  1 
ATOM   900  N  N   . TRP A 1 114 ? 18.226  -2.360  16.704  1.00 28.15 ? 114 TRP A N   1 
ATOM   901  C  CA  . TRP A 1 114 ? 16.938  -2.620  16.066  1.00 26.77 ? 114 TRP A CA  1 
ATOM   902  C  C   . TRP A 1 114 ? 17.025  -2.550  14.538  1.00 26.40 ? 114 TRP A C   1 
ATOM   903  O  O   . TRP A 1 114 ? 17.266  -1.484  13.967  1.00 25.81 ? 114 TRP A O   1 
ATOM   904  C  CB  . TRP A 1 114 ? 15.901  -1.616  16.585  1.00 25.04 ? 114 TRP A CB  1 
ATOM   905  C  CG  . TRP A 1 114 ? 15.822  -1.537  18.099  1.00 27.69 ? 114 TRP A CG  1 
ATOM   906  C  CD1 . TRP A 1 114 ? 16.291  -2.459  18.999  1.00 27.96 ? 114 TRP A CD1 1 
ATOM   907  C  CD2 . TRP A 1 114 ? 15.196  -0.503  18.879  1.00 27.18 ? 114 TRP A CD2 1 
ATOM   908  N  NE1 . TRP A 1 114 ? 15.994  -2.064  20.284  1.00 29.80 ? 114 TRP A NE1 1 
ATOM   909  C  CE2 . TRP A 1 114 ? 15.322  -0.870  20.241  1.00 28.78 ? 114 TRP A CE2 1 
ATOM   910  C  CE3 . TRP A 1 114 ? 14.540  0.692   18.561  1.00 26.15 ? 114 TRP A CE3 1 
ATOM   911  C  CZ2 . TRP A 1 114 ? 14.816  -0.079  21.285  1.00 28.21 ? 114 TRP A CZ2 1 
ATOM   912  C  CZ3 . TRP A 1 114 ? 14.033  1.482   19.606  1.00 28.78 ? 114 TRP A CZ3 1 
ATOM   913  C  CH2 . TRP A 1 114 ? 14.176  1.088   20.949  1.00 26.14 ? 114 TRP A CH2 1 
ATOM   914  N  N   . VAL A 1 115 ? 16.802  -3.692  13.890  1.00 25.19 ? 115 VAL A N   1 
ATOM   915  C  CA  . VAL A 1 115 ? 16.878  -3.804  12.434  1.00 23.63 ? 115 VAL A CA  1 
ATOM   916  C  C   . VAL A 1 115 ? 15.521  -3.885  11.736  1.00 24.52 ? 115 VAL A C   1 
ATOM   917  O  O   . VAL A 1 115 ? 14.654  -4.689  12.112  1.00 26.03 ? 115 VAL A O   1 
ATOM   918  C  CB  . VAL A 1 115 ? 17.678  -5.057  12.028  1.00 23.12 ? 115 VAL A CB  1 
ATOM   919  C  CG1 . VAL A 1 115 ? 18.039  -4.990  10.554  1.00 22.99 ? 115 VAL A CG1 1 
ATOM   920  C  CG2 . VAL A 1 115 ? 18.926  -5.181  12.888  1.00 22.42 ? 115 VAL A CG2 1 
ATOM   921  N  N   . ASN A 1 116 ? 15.347  -3.057  10.709  1.00 23.10 ? 116 ASN A N   1 
ATOM   922  C  CA  . ASN A 1 116 ? 14.111  -3.041  9.935   1.00 21.69 ? 116 ASN A CA  1 
ATOM   923  C  C   . ASN A 1 116 ? 14.018  -4.344  9.159   1.00 22.91 ? 116 ASN A C   1 
ATOM   924  O  O   . ASN A 1 116 ? 14.904  -4.664  8.373   1.00 22.55 ? 116 ASN A O   1 
ATOM   925  C  CB  . ASN A 1 116 ? 14.103  -1.876  8.942   1.00 20.57 ? 116 ASN A CB  1 
ATOM   926  C  CG  . ASN A 1 116 ? 13.782  -0.543  9.599   1.00 20.77 ? 116 ASN A CG  1 
ATOM   927  O  OD1 . ASN A 1 116 ? 14.569  -0.025  10.401  1.00 20.83 ? 116 ASN A OD1 1 
ATOM   928  N  ND2 . ASN A 1 116 ? 12.619  0.022   9.260   1.00 15.27 ? 116 ASN A ND2 1 
ATOM   929  N  N   . ILE A 1 117 ? 12.947  -5.098  9.381   1.00 24.54 ? 117 ILE A N   1 
ATOM   930  C  CA  . ILE A 1 117 ? 12.772  -6.361  8.683   1.00 25.38 ? 117 ILE A CA  1 
ATOM   931  C  C   . ILE A 1 117 ? 11.316  -6.628  8.319   1.00 25.59 ? 117 ILE A C   1 
ATOM   932  O  O   . ILE A 1 117 ? 10.393  -6.077  8.920   1.00 23.96 ? 117 ILE A O   1 
ATOM   933  C  CB  . ILE A 1 117 ? 13.314  -7.565  9.520   1.00 25.59 ? 117 ILE A CB  1 
ATOM   934  C  CG1 . ILE A 1 117 ? 12.568  -7.657  10.857  1.00 26.34 ? 117 ILE A CG1 1 
ATOM   935  C  CG2 . ILE A 1 117 ? 14.817  -7.418  9.739   1.00 23.55 ? 117 ILE A CG2 1 
ATOM   936  C  CD1 . ILE A 1 117 ? 13.043  -8.785  11.757  1.00 24.39 ? 117 ILE A CD1 1 
ATOM   937  N  N   . TYR A 1 118 ? 11.139  -7.475  7.312   1.00 25.69 ? 118 TYR A N   1 
ATOM   938  C  CA  . TYR A 1 118 ? 9.827   -7.874  6.822   1.00 27.45 ? 118 TYR A CA  1 
ATOM   939  C  C   . TYR A 1 118 ? 9.075   -8.639  7.914   1.00 28.36 ? 118 TYR A C   1 
ATOM   940  O  O   . TYR A 1 118 ? 9.571   -9.640  8.436   1.00 26.30 ? 118 TYR A O   1 
ATOM   941  C  CB  . TYR A 1 118 ? 10.016  -8.748  5.581   1.00 26.88 ? 118 TYR A CB  1 
ATOM   942  C  CG  . TYR A 1 118 ? 8.776   -9.443  5.076   1.00 28.17 ? 118 TYR A CG  1 
ATOM   943  C  CD1 . TYR A 1 118 ? 7.605   -8.733  4.809   1.00 29.41 ? 118 TYR A CD1 1 
ATOM   944  C  CD2 . TYR A 1 118 ? 8.794   -10.809 4.803   1.00 27.35 ? 118 TYR A CD2 1 
ATOM   945  C  CE1 . TYR A 1 118 ? 6.482   -9.368  4.278   1.00 30.06 ? 118 TYR A CE1 1 
ATOM   946  C  CE2 . TYR A 1 118 ? 7.682   -11.449 4.271   1.00 28.09 ? 118 TYR A CE2 1 
ATOM   947  C  CZ  . TYR A 1 118 ? 6.532   -10.728 4.010   1.00 28.97 ? 118 TYR A CZ  1 
ATOM   948  O  OH  . TYR A 1 118 ? 5.441   -11.371 3.478   1.00 27.31 ? 118 TYR A OH  1 
ATOM   949  N  N   . CYS A 1 119 ? 7.878   -8.156  8.245   1.00 28.57 ? 119 CYS A N   1 
ATOM   950  C  CA  . CYS A 1 119 ? 7.039   -8.755  9.280   1.00 30.22 ? 119 CYS A CA  1 
ATOM   951  C  C   . CYS A 1 119 ? 6.595   -10.184 8.974   1.00 31.13 ? 119 CYS A C   1 
ATOM   952  O  O   . CYS A 1 119 ? 6.165   -10.907 9.876   1.00 31.82 ? 119 CYS A O   1 
ATOM   953  C  CB  . CYS A 1 119 ? 5.791   -7.906  9.506   1.00 28.53 ? 119 CYS A CB  1 
ATOM   954  S  SG  . CYS A 1 119 ? 6.055   -6.149  9.916   1.00 29.12 ? 119 CYS A SG  1 
ATOM   955  N  N   . GLY A 1 120 ? 6.682   -10.570 7.703   1.00 31.88 ? 120 GLY A N   1 
ATOM   956  C  CA  . GLY A 1 120 ? 6.293   -11.904 7.281   1.00 30.11 ? 120 GLY A CA  1 
ATOM   957  C  C   . GLY A 1 120 ? 7.350   -12.950 7.587   1.00 32.40 ? 120 GLY A C   1 
ATOM   958  O  O   . GLY A 1 120 ? 7.096   -14.148 7.467   1.00 34.73 ? 120 GLY A O   1 
ATOM   959  N  N   . GLN A 1 121 ? 8.545   -12.503 7.967   1.00 31.04 ? 121 GLN A N   1 
ATOM   960  C  CA  . GLN A 1 121 ? 9.630   -13.414 8.327   1.00 29.23 ? 121 GLN A CA  1 
ATOM   961  C  C   . GLN A 1 121 ? 9.161   -14.291 9.495   1.00 27.85 ? 121 GLN A C   1 
ATOM   962  O  O   . GLN A 1 121 ? 8.245   -13.917 10.232  1.00 25.93 ? 121 GLN A O   1 
ATOM   963  C  CB  . GLN A 1 121 ? 10.857  -12.615 8.770   1.00 29.41 ? 121 GLN A CB  1 
ATOM   964  C  CG  . GLN A 1 121 ? 11.977  -12.503 7.750   1.00 33.03 ? 121 GLN A CG  1 
ATOM   965  C  CD  . GLN A 1 121 ? 13.133  -11.653 8.265   1.00 35.31 ? 121 GLN A CD  1 
ATOM   966  O  OE1 . GLN A 1 121 ? 13.503  -11.740 9.435   1.00 34.06 ? 121 GLN A OE1 1 
ATOM   967  N  NE2 . GLN A 1 121 ? 13.711  -10.833 7.389   1.00 35.27 ? 121 GLN A NE2 1 
ATOM   968  N  N   . GLN A 1 122 ? 9.778   -15.453 9.662   1.00 26.98 ? 122 GLN A N   1 
ATOM   969  C  CA  . GLN A 1 122 ? 9.416   -16.339 10.767  1.00 30.51 ? 122 GLN A CA  1 
ATOM   970  C  C   . GLN A 1 122 ? 10.620  -16.478 11.683  1.00 29.93 ? 122 GLN A C   1 
ATOM   971  O  O   . GLN A 1 122 ? 11.486  -17.324 11.470  1.00 30.24 ? 122 GLN A O   1 
ATOM   972  C  CB  . GLN A 1 122 ? 8.969   -17.709 10.246  1.00 34.29 ? 122 GLN A CB  1 
ATOM   973  C  CG  . GLN A 1 122 ? 7.590   -17.687 9.591   1.00 38.18 ? 122 GLN A CG  1 
ATOM   974  C  CD  . GLN A 1 122 ? 7.159   -19.048 9.079   1.00 39.93 ? 122 GLN A CD  1 
ATOM   975  O  OE1 . GLN A 1 122 ? 7.784   -19.607 8.183   1.00 42.34 ? 122 GLN A OE1 1 
ATOM   976  N  NE2 . GLN A 1 122 ? 6.085   -19.588 9.650   1.00 41.98 ? 122 GLN A NE2 1 
ATOM   977  N  N   . ASN A 1 123 ? 10.660  -15.634 12.708  1.00 29.17 ? 123 ASN A N   1 
ATOM   978  C  CA  . ASN A 1 123 ? 11.775  -15.608 13.638  1.00 29.05 ? 123 ASN A CA  1 
ATOM   979  C  C   . ASN A 1 123 ? 11.419  -15.932 15.076  1.00 28.46 ? 123 ASN A C   1 
ATOM   980  O  O   . ASN A 1 123 ? 10.248  -15.980 15.445  1.00 30.39 ? 123 ASN A O   1 
ATOM   981  C  CB  . ASN A 1 123 ? 12.414  -14.217 13.628  1.00 27.22 ? 123 ASN A CB  1 
ATOM   982  C  CG  . ASN A 1 123 ? 12.734  -13.737 12.239  1.00 27.02 ? 123 ASN A CG  1 
ATOM   983  O  OD1 . ASN A 1 123 ? 13.352  -14.454 11.450  1.00 30.16 ? 123 ASN A OD1 1 
ATOM   984  N  ND2 . ASN A 1 123 ? 12.324  -12.512 11.929  1.00 24.24 ? 123 ASN A ND2 1 
ATOM   985  N  N   . PRO A 1 124 ? 12.443  -16.184 15.904  1.00 28.56 ? 124 PRO A N   1 
ATOM   986  C  CA  . PRO A 1 124 ? 12.207  -16.482 17.315  1.00 29.12 ? 124 PRO A CA  1 
ATOM   987  C  C   . PRO A 1 124 ? 11.882  -15.128 17.957  1.00 30.39 ? 124 PRO A C   1 
ATOM   988  O  O   . PRO A 1 124 ? 11.899  -14.097 17.272  1.00 29.10 ? 124 PRO A O   1 
ATOM   989  C  CB  . PRO A 1 124 ? 13.544  -17.068 17.777  1.00 28.61 ? 124 PRO A CB  1 
ATOM   990  C  CG  . PRO A 1 124 ? 14.542  -16.391 16.883  1.00 28.23 ? 124 PRO A CG  1 
ATOM   991  C  CD  . PRO A 1 124 ? 13.846  -16.464 15.539  1.00 27.98 ? 124 PRO A CD  1 
ATOM   992  N  N   . PHE A 1 125 ? 11.601  -15.120 19.255  1.00 28.62 ? 125 PHE A N   1 
ATOM   993  C  CA  . PHE A 1 125 ? 11.231  -13.883 19.930  1.00 27.79 ? 125 PHE A CA  1 
ATOM   994  C  C   . PHE A 1 125 ? 11.330  -13.992 21.451  1.00 26.40 ? 125 PHE A C   1 
ATOM   995  O  O   . PHE A 1 125 ? 11.762  -15.001 21.995  1.00 25.05 ? 125 PHE A O   1 
ATOM   996  C  CB  . PHE A 1 125 ? 9.792   -13.529 19.553  1.00 27.88 ? 125 PHE A CB  1 
ATOM   997  C  CG  . PHE A 1 125 ? 8.840   -14.693 19.678  1.00 29.30 ? 125 PHE A CG  1 
ATOM   998  C  CD1 . PHE A 1 125 ? 8.804   -15.688 18.704  1.00 30.23 ? 125 PHE A CD1 1 
ATOM   999  C  CD2 . PHE A 1 125 ? 8.031   -14.832 20.802  1.00 30.43 ? 125 PHE A CD2 1 
ATOM   1000 C  CE1 . PHE A 1 125 ? 7.979   -16.807 18.849  1.00 29.84 ? 125 PHE A CE1 1 
ATOM   1001 C  CE2 . PHE A 1 125 ? 7.201   -15.947 20.959  1.00 29.34 ? 125 PHE A CE2 1 
ATOM   1002 C  CZ  . PHE A 1 125 ? 7.178   -16.936 19.980  1.00 30.45 ? 125 PHE A CZ  1 
ATOM   1003 N  N   . VAL A 1 126 ? 10.909  -12.934 22.127  1.00 26.22 ? 126 VAL A N   1 
ATOM   1004 C  CA  . VAL A 1 126 ? 10.916  -12.889 23.580  1.00 27.25 ? 126 VAL A CA  1 
ATOM   1005 C  C   . VAL A 1 126 ? 9.632   -12.199 23.994  1.00 27.16 ? 126 VAL A C   1 
ATOM   1006 O  O   . VAL A 1 126 ? 9.279   -11.161 23.433  1.00 26.42 ? 126 VAL A O   1 
ATOM   1007 C  CB  . VAL A 1 126 ? 12.118  -12.073 24.128  1.00 27.41 ? 126 VAL A CB  1 
ATOM   1008 C  CG1 . VAL A 1 126 ? 11.885  -11.721 25.592  1.00 29.71 ? 126 VAL A CG1 1 
ATOM   1009 C  CG2 . VAL A 1 126 ? 13.407  -12.870 23.984  1.00 27.42 ? 126 VAL A CG2 1 
ATOM   1010 N  N   . CYS A 1 127 ? 8.933   -12.787 24.962  1.00 28.34 ? 127 CYS A N   1 
ATOM   1011 C  CA  . CYS A 1 127 ? 7.686   -12.227 25.475  1.00 26.07 ? 127 CYS A CA  1 
ATOM   1012 C  C   . CYS A 1 127 ? 7.957   -11.511 26.799  1.00 26.56 ? 127 CYS A C   1 
ATOM   1013 O  O   . CYS A 1 127 ? 8.926   -11.823 27.500  1.00 24.81 ? 127 CYS A O   1 
ATOM   1014 C  CB  . CYS A 1 127 ? 6.650   -13.331 25.713  1.00 27.16 ? 127 CYS A CB  1 
ATOM   1015 S  SG  . CYS A 1 127 ? 6.161   -14.333 24.273  1.00 29.93 ? 127 CYS A SG  1 
ATOM   1016 N  N   . GLU A 1 128 ? 7.085   -10.569 27.144  1.00 24.62 ? 128 GLU A N   1 
ATOM   1017 C  CA  . GLU A 1 128 ? 7.231   -9.806  28.370  1.00 23.22 ? 128 GLU A CA  1 
ATOM   1018 C  C   . GLU A 1 128 ? 5.885   -9.521  29.009  1.00 24.08 ? 128 GLU A C   1 
ATOM   1019 O  O   . GLU A 1 128 ? 4.957   -9.064  28.350  1.00 23.02 ? 128 GLU A O   1 
ATOM   1020 C  CB  . GLU A 1 128 ? 7.921   -8.476  28.091  1.00 23.45 ? 128 GLU A CB  1 
ATOM   1021 C  CG  . GLU A 1 128 ? 8.128   -7.646  29.328  1.00 22.68 ? 128 GLU A CG  1 
ATOM   1022 C  CD  . GLU A 1 128 ? 8.477   -6.208  29.024  1.00 24.14 ? 128 GLU A CD  1 
ATOM   1023 O  OE1 . GLU A 1 128 ? 8.843   -5.909  27.862  1.00 23.55 ? 128 GLU A OE1 1 
ATOM   1024 O  OE2 . GLU A 1 128 ? 8.392   -5.381  29.960  1.00 21.41 ? 128 GLU A OE2 1 
ATOM   1025 N  N   . ALA A 1 129 ? 5.787   -9.800  30.300  1.00 25.10 ? 129 ALA A N   1 
ATOM   1026 C  CA  . ALA A 1 129 ? 4.567   -9.559  31.045  1.00 26.28 ? 129 ALA A CA  1 
ATOM   1027 C  C   . ALA A 1 129 ? 4.996   -8.886  32.339  1.00 25.96 ? 129 ALA A C   1 
ATOM   1028 O  O   . ALA A 1 129 ? 4.820   -9.487  33.426  1.00 26.50 ? 129 ALA A O   1 
ATOM   1029 C  CB  . ALA A 1 129 ? 3.846   -10.875 31.333  1.00 25.21 ? 129 ALA A CB  1 
ATOM   1030 O  OXT . ALA A 1 129 ? 5.507   -7.754  32.254  1.00 26.50 ? 129 ALA A OXT 1 
ATOM   1031 N  N   . ASP B 2 1   ? 12.263  17.473  -26.974 1.00 50.44 ? 1   ASP B N   1 
ATOM   1032 C  CA  . ASP B 2 1   ? 13.558  16.791  -27.258 1.00 49.04 ? 1   ASP B CA  1 
ATOM   1033 C  C   . ASP B 2 1   ? 14.550  16.984  -26.107 1.00 47.80 ? 1   ASP B C   1 
ATOM   1034 O  O   . ASP B 2 1   ? 14.527  18.010  -25.423 1.00 49.99 ? 1   ASP B O   1 
ATOM   1035 C  CB  . ASP B 2 1   ? 14.149  17.332  -28.555 1.00 50.85 ? 1   ASP B CB  1 
ATOM   1036 C  CG  . ASP B 2 1   ? 15.437  16.651  -28.926 1.00 51.51 ? 1   ASP B CG  1 
ATOM   1037 O  OD1 . ASP B 2 1   ? 15.421  15.416  -29.112 1.00 53.58 ? 1   ASP B OD1 1 
ATOM   1038 O  OD2 . ASP B 2 1   ? 16.465  17.351  -29.028 1.00 54.10 ? 1   ASP B OD2 1 
ATOM   1039 N  N   . CYS B 2 2   ? 15.428  16.004  -25.907 1.00 43.76 ? 2   CYS B N   1 
ATOM   1040 C  CA  . CYS B 2 2   ? 16.393  16.051  -24.813 1.00 39.93 ? 2   CYS B CA  1 
ATOM   1041 C  C   . CYS B 2 2   ? 17.842  16.291  -25.216 1.00 38.71 ? 2   CYS B C   1 
ATOM   1042 O  O   . CYS B 2 2   ? 18.199  16.192  -26.385 1.00 40.13 ? 2   CYS B O   1 
ATOM   1043 C  CB  . CYS B 2 2   ? 16.329  14.746  -24.019 1.00 37.70 ? 2   CYS B CB  1 
ATOM   1044 S  SG  . CYS B 2 2   ? 14.706  14.385  -23.284 1.00 33.17 ? 2   CYS B SG  1 
ATOM   1045 N  N   . PRO B 2 3   ? 18.697  16.626  -24.233 1.00 37.21 ? 3   PRO B N   1 
ATOM   1046 C  CA  . PRO B 2 3   ? 20.129  16.876  -24.460 1.00 35.06 ? 3   PRO B CA  1 
ATOM   1047 C  C   . PRO B 2 3   ? 20.755  15.562  -24.934 1.00 33.63 ? 3   PRO B C   1 
ATOM   1048 O  O   . PRO B 2 3   ? 20.288  14.490  -24.553 1.00 34.49 ? 3   PRO B O   1 
ATOM   1049 C  CB  . PRO B 2 3   ? 20.624  17.290  -23.077 1.00 34.45 ? 3   PRO B CB  1 
ATOM   1050 C  CG  . PRO B 2 3   ? 19.417  17.974  -22.480 1.00 35.58 ? 3   PRO B CG  1 
ATOM   1051 C  CD  . PRO B 2 3   ? 18.295  17.048  -22.876 1.00 34.41 ? 3   PRO B CD  1 
ATOM   1052 N  N   . SER B 2 4   ? 21.809  15.627  -25.739 1.00 32.46 ? 4   SER B N   1 
ATOM   1053 C  CA  . SER B 2 4   ? 22.418  14.402  -26.266 1.00 32.86 ? 4   SER B CA  1 
ATOM   1054 C  C   . SER B 2 4   ? 22.873  13.377  -25.223 1.00 32.23 ? 4   SER B C   1 
ATOM   1055 O  O   . SER B 2 4   ? 22.936  12.179  -25.516 1.00 31.13 ? 4   SER B O   1 
ATOM   1056 C  CB  . SER B 2 4   ? 23.587  14.742  -27.200 1.00 31.59 ? 4   SER B CB  1 
ATOM   1057 O  OG  . SER B 2 4   ? 24.633  15.396  -26.507 1.00 35.06 ? 4   SER B OG  1 
ATOM   1058 N  N   . ASP B 2 5   ? 23.186  13.835  -24.013 1.00 31.14 ? 5   ASP B N   1 
ATOM   1059 C  CA  . ASP B 2 5   ? 23.623  12.923  -22.957 1.00 28.78 ? 5   ASP B CA  1 
ATOM   1060 C  C   . ASP B 2 5   ? 22.448  12.331  -22.168 1.00 28.30 ? 5   ASP B C   1 
ATOM   1061 O  O   . ASP B 2 5   ? 22.636  11.460  -21.319 1.00 27.06 ? 5   ASP B O   1 
ATOM   1062 C  CB  . ASP B 2 5   ? 24.622  13.624  -22.014 1.00 27.97 ? 5   ASP B CB  1 
ATOM   1063 C  CG  . ASP B 2 5   ? 24.133  14.979  -21.530 1.00 29.73 ? 5   ASP B CG  1 
ATOM   1064 O  OD1 . ASP B 2 5   ? 23.774  15.816  -22.377 1.00 29.89 ? 5   ASP B OD1 1 
ATOM   1065 O  OD2 . ASP B 2 5   ? 24.115  15.215  -20.302 1.00 32.97 ? 5   ASP B OD2 1 
ATOM   1066 N  N   . TRP B 2 6   ? 21.238  12.799  -22.455 1.00 26.70 ? 6   TRP B N   1 
ATOM   1067 C  CA  . TRP B 2 6   ? 20.045  12.285  -21.783 1.00 29.94 ? 6   TRP B CA  1 
ATOM   1068 C  C   . TRP B 2 6   ? 19.216  11.462  -22.767 1.00 29.51 ? 6   TRP B C   1 
ATOM   1069 O  O   . TRP B 2 6   ? 19.447  11.507  -23.973 1.00 28.25 ? 6   TRP B O   1 
ATOM   1070 C  CB  . TRP B 2 6   ? 19.184  13.429  -21.218 1.00 30.71 ? 6   TRP B CB  1 
ATOM   1071 C  CG  . TRP B 2 6   ? 19.845  14.213  -20.107 1.00 32.40 ? 6   TRP B CG  1 
ATOM   1072 C  CD1 . TRP B 2 6   ? 20.986  14.968  -20.196 1.00 34.43 ? 6   TRP B CD1 1 
ATOM   1073 C  CD2 . TRP B 2 6   ? 19.391  14.335  -18.752 1.00 30.52 ? 6   TRP B CD2 1 
ATOM   1074 N  NE1 . TRP B 2 6   ? 21.266  15.552  -18.982 1.00 33.36 ? 6   TRP B NE1 1 
ATOM   1075 C  CE2 . TRP B 2 6   ? 20.304  15.181  -18.079 1.00 31.75 ? 6   TRP B CE2 1 
ATOM   1076 C  CE3 . TRP B 2 6   ? 18.303  13.814  -18.041 1.00 31.07 ? 6   TRP B CE3 1 
ATOM   1077 C  CZ2 . TRP B 2 6   ? 20.158  15.518  -16.729 1.00 31.91 ? 6   TRP B CZ2 1 
ATOM   1078 C  CZ3 . TRP B 2 6   ? 18.156  14.149  -16.695 1.00 32.05 ? 6   TRP B CZ3 1 
ATOM   1079 C  CH2 . TRP B 2 6   ? 19.080  14.994  -16.055 1.00 33.62 ? 6   TRP B CH2 1 
ATOM   1080 N  N   . SER B 2 7   ? 18.260  10.704  -22.243 1.00 31.67 ? 7   SER B N   1 
ATOM   1081 C  CA  . SER B 2 7   ? 17.398  9.868   -23.069 1.00 32.23 ? 7   SER B CA  1 
ATOM   1082 C  C   . SER B 2 7   ? 15.939  10.232  -22.825 1.00 33.32 ? 7   SER B C   1 
ATOM   1083 O  O   . SER B 2 7   ? 15.487  10.287  -21.680 1.00 32.23 ? 7   SER B O   1 
ATOM   1084 C  CB  . SER B 2 7   ? 17.645  8.395   -22.752 1.00 31.38 ? 7   SER B CB  1 
ATOM   1085 O  OG  . SER B 2 7   ? 19.009  8.068   -22.969 1.00 31.86 ? 7   SER B OG  1 
ATOM   1086 N  N   . SER B 2 8   ? 15.210  10.485  -23.911 1.00 35.10 ? 8   SER B N   1 
ATOM   1087 C  CA  . SER B 2 8   ? 13.808  10.884  -23.832 1.00 36.17 ? 8   SER B CA  1 
ATOM   1088 C  C   . SER B 2 8   ? 12.793  9.753   -23.786 1.00 36.49 ? 8   SER B C   1 
ATOM   1089 O  O   . SER B 2 8   ? 13.008  8.672   -24.334 1.00 36.65 ? 8   SER B O   1 
ATOM   1090 C  CB  . SER B 2 8   ? 13.458  11.795  -25.011 1.00 37.54 ? 8   SER B CB  1 
ATOM   1091 O  OG  . SER B 2 8   ? 13.475  11.079  -26.233 1.00 38.82 ? 8   SER B OG  1 
ATOM   1092 N  N   . TYR B 2 9   ? 11.674  10.030  -23.127 1.00 37.33 ? 9   TYR B N   1 
ATOM   1093 C  CA  . TYR B 2 9   ? 10.579  9.082   -23.012 1.00 38.42 ? 9   TYR B CA  1 
ATOM   1094 C  C   . TYR B 2 9   ? 9.328   9.791   -22.511 1.00 39.51 ? 9   TYR B C   1 
ATOM   1095 O  O   . TYR B 2 9   ? 9.195   10.076  -21.324 1.00 40.94 ? 9   TYR B O   1 
ATOM   1096 C  CB  . TYR B 2 9   ? 10.941  7.925   -22.072 1.00 38.04 ? 9   TYR B CB  1 
ATOM   1097 C  CG  . TYR B 2 9   ? 9.829   6.902   -21.933 1.00 37.23 ? 9   TYR B CG  1 
ATOM   1098 C  CD1 . TYR B 2 9   ? 8.831   7.052   -20.969 1.00 38.24 ? 9   TYR B CD1 1 
ATOM   1099 C  CD2 . TYR B 2 9   ? 9.745   5.814   -22.803 1.00 37.49 ? 9   TYR B CD2 1 
ATOM   1100 C  CE1 . TYR B 2 9   ? 7.776   6.144   -20.877 1.00 38.65 ? 9   TYR B CE1 1 
ATOM   1101 C  CE2 . TYR B 2 9   ? 8.696   4.903   -22.724 1.00 35.90 ? 9   TYR B CE2 1 
ATOM   1102 C  CZ  . TYR B 2 9   ? 7.716   5.074   -21.761 1.00 39.41 ? 9   TYR B CZ  1 
ATOM   1103 O  OH  . TYR B 2 9   ? 6.667   4.186   -21.686 1.00 40.91 ? 9   TYR B OH  1 
ATOM   1104 N  N   . GLU B 2 10  ? 8.424   10.085  -23.436 1.00 40.44 ? 10  GLU B N   1 
ATOM   1105 C  CA  . GLU B 2 10  ? 7.166   10.750  -23.127 1.00 41.35 ? 10  GLU B CA  1 
ATOM   1106 C  C   . GLU B 2 10  ? 7.305   12.094  -22.413 1.00 42.32 ? 10  GLU B C   1 
ATOM   1107 O  O   . GLU B 2 10  ? 6.887   12.249  -21.262 1.00 40.87 ? 10  GLU B O   1 
ATOM   1108 C  CB  . GLU B 2 10  ? 6.276   9.814   -22.310 1.00 42.34 ? 10  GLU B CB  1 
ATOM   1109 C  CG  . GLU B 2 10  ? 6.216   8.403   -22.877 1.00 45.03 ? 10  GLU B CG  1 
ATOM   1110 C  CD  . GLU B 2 10  ? 5.070   7.583   -22.316 1.00 47.83 ? 10  GLU B CD  1 
ATOM   1111 O  OE1 . GLU B 2 10  ? 4.794   7.696   -21.102 1.00 46.45 ? 10  GLU B OE1 1 
ATOM   1112 O  OE2 . GLU B 2 10  ? 4.451   6.815   -23.089 1.00 49.91 ? 10  GLU B OE2 1 
ATOM   1113 N  N   . GLY B 2 11  ? 7.897   13.061  -23.109 1.00 41.79 ? 11  GLY B N   1 
ATOM   1114 C  CA  . GLY B 2 11  ? 8.055   14.396  -22.556 1.00 41.13 ? 11  GLY B CA  1 
ATOM   1115 C  C   . GLY B 2 11  ? 8.945   14.554  -21.341 1.00 40.03 ? 11  GLY B C   1 
ATOM   1116 O  O   . GLY B 2 11  ? 8.883   15.579  -20.661 1.00 42.39 ? 11  GLY B O   1 
ATOM   1117 N  N   . HIS B 2 12  ? 9.768   13.551  -21.060 1.00 37.78 ? 12  HIS B N   1 
ATOM   1118 C  CA  . HIS B 2 12  ? 10.684  13.599  -19.925 1.00 35.27 ? 12  HIS B CA  1 
ATOM   1119 C  C   . HIS B 2 12  ? 12.079  13.156  -20.368 1.00 34.20 ? 12  HIS B C   1 
ATOM   1120 O  O   . HIS B 2 12  ? 12.221  12.369  -21.306 1.00 33.43 ? 12  HIS B O   1 
ATOM   1121 C  CB  . HIS B 2 12  ? 10.182  12.688  -18.798 1.00 35.93 ? 12  HIS B CB  1 
ATOM   1122 C  CG  . HIS B 2 12  ? 9.027   13.251  -18.028 1.00 34.07 ? 12  HIS B CG  1 
ATOM   1123 N  ND1 . HIS B 2 12  ? 9.177   14.239  -17.079 1.00 33.53 ? 12  HIS B ND1 1 
ATOM   1124 C  CD2 . HIS B 2 12  ? 7.701   12.980  -18.080 1.00 34.40 ? 12  HIS B CD2 1 
ATOM   1125 C  CE1 . HIS B 2 12  ? 7.995   14.552  -16.579 1.00 31.43 ? 12  HIS B CE1 1 
ATOM   1126 N  NE2 . HIS B 2 12  ? 7.082   13.802  -17.169 1.00 33.70 ? 12  HIS B NE2 1 
ATOM   1127 N  N   . CYS B 2 13  ? 13.106  13.673  -19.702 1.00 31.75 ? 13  CYS B N   1 
ATOM   1128 C  CA  . CYS B 2 13  ? 14.481  13.317  -20.026 1.00 31.51 ? 13  CYS B CA  1 
ATOM   1129 C  C   . CYS B 2 13  ? 15.087  12.572  -18.849 1.00 31.21 ? 13  CYS B C   1 
ATOM   1130 O  O   . CYS B 2 13  ? 14.944  12.996  -17.698 1.00 30.75 ? 13  CYS B O   1 
ATOM   1131 C  CB  . CYS B 2 13  ? 15.308  14.570  -20.323 1.00 32.08 ? 13  CYS B CB  1 
ATOM   1132 S  SG  . CYS B 2 13  ? 14.632  15.597  -21.660 1.00 31.73 ? 13  CYS B SG  1 
ATOM   1133 N  N   . TYR B 2 14  ? 15.760  11.462  -19.136 1.00 29.09 ? 14  TYR B N   1 
ATOM   1134 C  CA  . TYR B 2 14  ? 16.365  10.659  -18.081 1.00 27.54 ? 14  TYR B CA  1 
ATOM   1135 C  C   . TYR B 2 14  ? 17.840  10.398  -18.320 1.00 27.08 ? 14  TYR B C   1 
ATOM   1136 O  O   . TYR B 2 14  ? 18.289  10.248  -19.466 1.00 27.82 ? 14  TYR B O   1 
ATOM   1137 C  CB  . TYR B 2 14  ? 15.644  9.312   -17.942 1.00 27.01 ? 14  TYR B CB  1 
ATOM   1138 C  CG  . TYR B 2 14  ? 14.132  9.399   -17.835 1.00 25.83 ? 14  TYR B CG  1 
ATOM   1139 C  CD1 . TYR B 2 14  ? 13.348  9.602   -18.965 1.00 25.23 ? 14  TYR B CD1 1 
ATOM   1140 C  CD2 . TYR B 2 14  ? 13.485  9.241   -16.606 1.00 28.22 ? 14  TYR B CD2 1 
ATOM   1141 C  CE1 . TYR B 2 14  ? 11.958  9.640   -18.886 1.00 27.35 ? 14  TYR B CE1 1 
ATOM   1142 C  CE2 . TYR B 2 14  ? 12.090  9.280   -16.512 1.00 27.14 ? 14  TYR B CE2 1 
ATOM   1143 C  CZ  . TYR B 2 14  ? 11.333  9.476   -17.659 1.00 27.91 ? 14  TYR B CZ  1 
ATOM   1144 O  OH  . TYR B 2 14  ? 9.955   9.486   -17.594 1.00 26.79 ? 14  TYR B OH  1 
ATOM   1145 N  N   . LYS B 2 15  ? 18.595  10.340  -17.231 1.00 24.77 ? 15  LYS B N   1 
ATOM   1146 C  CA  . LYS B 2 15  ? 20.017  10.077  -17.327 1.00 25.78 ? 15  LYS B CA  1 
ATOM   1147 C  C   . LYS B 2 15  ? 20.582  9.400   -16.082 1.00 27.62 ? 15  LYS B C   1 
ATOM   1148 O  O   . LYS B 2 15  ? 20.443  9.907   -14.961 1.00 27.04 ? 15  LYS B O   1 
ATOM   1149 C  CB  . LYS B 2 15  ? 20.789  11.372  -17.587 1.00 24.69 ? 15  LYS B CB  1 
ATOM   1150 C  CG  . LYS B 2 15  ? 22.279  11.147  -17.783 1.00 22.79 ? 15  LYS B CG  1 
ATOM   1151 C  CD  . LYS B 2 15  ? 23.034  12.460  -17.910 1.00 26.38 ? 15  LYS B CD  1 
ATOM   1152 C  CE  . LYS B 2 15  ? 24.543  12.236  -17.914 1.00 23.88 ? 15  LYS B CE  1 
ATOM   1153 N  NZ  . LYS B 2 15  ? 25.287  13.527  -17.993 1.00 27.62 ? 15  LYS B NZ  1 
ATOM   1154 N  N   . PRO B 2 16  ? 21.213  8.227   -16.263 1.00 28.85 ? 16  PRO B N   1 
ATOM   1155 C  CA  . PRO B 2 16  ? 21.801  7.500   -15.136 1.00 29.73 ? 16  PRO B CA  1 
ATOM   1156 C  C   . PRO B 2 16  ? 23.215  8.007   -14.873 1.00 29.95 ? 16  PRO B C   1 
ATOM   1157 O  O   . PRO B 2 16  ? 23.864  8.532   -15.776 1.00 30.46 ? 16  PRO B O   1 
ATOM   1158 C  CB  . PRO B 2 16  ? 21.778  6.050   -15.615 1.00 30.70 ? 16  PRO B CB  1 
ATOM   1159 C  CG  . PRO B 2 16  ? 22.006  6.191   -17.087 1.00 30.71 ? 16  PRO B CG  1 
ATOM   1160 C  CD  . PRO B 2 16  ? 21.125  7.363   -17.458 1.00 28.92 ? 16  PRO B CD  1 
ATOM   1161 N  N   . PHE B 2 17  ? 23.678  7.870   -13.635 1.00 31.32 ? 17  PHE B N   1 
ATOM   1162 C  CA  . PHE B 2 17  ? 25.026  8.294   -13.264 1.00 32.88 ? 17  PHE B CA  1 
ATOM   1163 C  C   . PHE B 2 17  ? 25.748  7.162   -12.542 1.00 34.09 ? 17  PHE B C   1 
ATOM   1164 O  O   . PHE B 2 17  ? 25.116  6.347   -11.872 1.00 33.11 ? 17  PHE B O   1 
ATOM   1165 C  CB  . PHE B 2 17  ? 24.972  9.545   -12.382 1.00 31.64 ? 17  PHE B CB  1 
ATOM   1166 C  CG  . PHE B 2 17  ? 24.564  10.782  -13.125 1.00 31.29 ? 17  PHE B CG  1 
ATOM   1167 C  CD1 . PHE B 2 17  ? 23.247  10.962  -13.537 1.00 30.56 ? 17  PHE B CD1 1 
ATOM   1168 C  CD2 . PHE B 2 17  ? 25.514  11.743  -13.470 1.00 31.32 ? 17  PHE B CD2 1 
ATOM   1169 C  CE1 . PHE B 2 17  ? 22.879  12.081  -14.288 1.00 29.77 ? 17  PHE B CE1 1 
ATOM   1170 C  CE2 . PHE B 2 17  ? 25.158  12.866  -14.222 1.00 30.94 ? 17  PHE B CE2 1 
ATOM   1171 C  CZ  . PHE B 2 17  ? 23.834  13.033  -14.632 1.00 30.01 ? 17  PHE B CZ  1 
ATOM   1172 N  N   . SER B 2 18  ? 27.070  7.111   -12.674 1.00 36.29 ? 18  SER B N   1 
ATOM   1173 C  CA  . SER B 2 18  ? 27.845  6.045   -12.047 1.00 39.61 ? 18  SER B CA  1 
ATOM   1174 C  C   . SER B 2 18  ? 28.378  6.357   -10.649 1.00 40.06 ? 18  SER B C   1 
ATOM   1175 O  O   . SER B 2 18  ? 28.433  5.476   -9.792  1.00 39.32 ? 18  SER B O   1 
ATOM   1176 C  CB  . SER B 2 18  ? 29.010  5.649   -12.956 1.00 39.97 ? 18  SER B CB  1 
ATOM   1177 O  OG  . SER B 2 18  ? 29.909  6.731   -13.125 1.00 45.56 ? 18  SER B OG  1 
ATOM   1178 N  N   . GLU B 2 19  ? 28.774  7.604   -10.421 1.00 41.63 ? 19  GLU B N   1 
ATOM   1179 C  CA  . GLU B 2 19  ? 29.309  8.000   -9.124  1.00 43.42 ? 19  GLU B CA  1 
ATOM   1180 C  C   . GLU B 2 19  ? 28.344  7.761   -7.966  1.00 41.74 ? 19  GLU B C   1 
ATOM   1181 O  O   . GLU B 2 19  ? 27.334  8.452   -7.833  1.00 40.54 ? 19  GLU B O   1 
ATOM   1182 C  CB  . GLU B 2 19  ? 29.716  9.473   -9.150  1.00 47.82 ? 19  GLU B CB  1 
ATOM   1183 C  CG  . GLU B 2 19  ? 31.217  9.691   -9.195  1.00 53.54 ? 19  GLU B CG  1 
ATOM   1184 C  CD  . GLU B 2 19  ? 31.919  9.205   -7.934  1.00 57.55 ? 19  GLU B CD  1 
ATOM   1185 O  OE1 . GLU B 2 19  ? 31.782  8.007   -7.594  1.00 60.93 ? 19  GLU B OE1 1 
ATOM   1186 O  OE2 . GLU B 2 19  ? 32.611  10.020  -7.284  1.00 58.30 ? 19  GLU B OE2 1 
ATOM   1187 N  N   . PRO B 2 20  ? 28.654  6.775   -7.106  1.00 40.57 ? 20  PRO B N   1 
ATOM   1188 C  CA  . PRO B 2 20  ? 27.832  6.423   -5.944  1.00 37.59 ? 20  PRO B CA  1 
ATOM   1189 C  C   . PRO B 2 20  ? 27.671  7.562   -4.946  1.00 35.21 ? 20  PRO B C   1 
ATOM   1190 O  O   . PRO B 2 20  ? 28.640  8.222   -4.570  1.00 33.58 ? 20  PRO B O   1 
ATOM   1191 C  CB  . PRO B 2 20  ? 28.578  5.234   -5.344  1.00 37.59 ? 20  PRO B CB  1 
ATOM   1192 C  CG  . PRO B 2 20  ? 29.180  4.590   -6.550  1.00 40.45 ? 20  PRO B CG  1 
ATOM   1193 C  CD  . PRO B 2 20  ? 29.729  5.785   -7.291  1.00 40.71 ? 20  PRO B CD  1 
ATOM   1194 N  N   . LYS B 2 21  ? 26.434  7.784   -4.522  1.00 33.52 ? 21  LYS B N   1 
ATOM   1195 C  CA  . LYS B 2 21  ? 26.127  8.832   -3.560  1.00 32.68 ? 21  LYS B CA  1 
ATOM   1196 C  C   . LYS B 2 21  ? 25.011  8.354   -2.644  1.00 32.19 ? 21  LYS B C   1 
ATOM   1197 O  O   . LYS B 2 21  ? 24.228  7.477   -3.018  1.00 34.41 ? 21  LYS B O   1 
ATOM   1198 C  CB  . LYS B 2 21  ? 25.680  10.107  -4.285  1.00 30.10 ? 21  LYS B CB  1 
ATOM   1199 C  CG  . LYS B 2 21  ? 26.719  10.706  -5.219  1.00 27.95 ? 21  LYS B CG  1 
ATOM   1200 C  CD  . LYS B 2 21  ? 26.146  11.886  -5.994  1.00 27.13 ? 21  LYS B CD  1 
ATOM   1201 C  CE  . LYS B 2 21  ? 27.143  12.403  -7.022  1.00 27.75 ? 21  LYS B CE  1 
ATOM   1202 N  NZ  . LYS B 2 21  ? 28.403  12.865  -6.387  1.00 23.63 ? 21  LYS B NZ  1 
ATOM   1203 N  N   . ASN B 2 22  ? 24.950  8.902   -1.436  1.00 31.26 ? 22  ASN B N   1 
ATOM   1204 C  CA  . ASN B 2 22  ? 23.876  8.528   -0.534  1.00 31.00 ? 22  ASN B CA  1 
ATOM   1205 C  C   . ASN B 2 22  ? 22.648  9.182   -1.167  1.00 30.22 ? 22  ASN B C   1 
ATOM   1206 O  O   . ASN B 2 22  ? 22.794  9.994   -2.088  1.00 30.48 ? 22  ASN B O   1 
ATOM   1207 C  CB  . ASN B 2 22  ? 24.145  9.035   0.897   1.00 32.14 ? 22  ASN B CB  1 
ATOM   1208 C  CG  . ASN B 2 22  ? 24.213  10.547  0.999   1.00 32.75 ? 22  ASN B CG  1 
ATOM   1209 O  OD1 . ASN B 2 22  ? 24.605  11.087  2.036   1.00 34.09 ? 22  ASN B OD1 1 
ATOM   1210 N  ND2 . ASN B 2 22  ? 23.821  11.237  -0.061  1.00 32.36 ? 22  ASN B ND2 1 
ATOM   1211 N  N   . TRP B 2 23  ? 21.451  8.835   -0.705  1.00 28.65 ? 23  TRP B N   1 
ATOM   1212 C  CA  . TRP B 2 23  ? 20.233  9.386   -1.298  1.00 26.98 ? 23  TRP B CA  1 
ATOM   1213 C  C   . TRP B 2 23  ? 20.196  10.908  -1.404  1.00 27.12 ? 23  TRP B C   1 
ATOM   1214 O  O   . TRP B 2 23  ? 19.908  11.448  -2.473  1.00 26.37 ? 23  TRP B O   1 
ATOM   1215 C  CB  . TRP B 2 23  ? 18.995  8.916   -0.533  1.00 25.58 ? 23  TRP B CB  1 
ATOM   1216 C  CG  . TRP B 2 23  ? 17.715  9.241   -1.245  1.00 24.07 ? 23  TRP B CG  1 
ATOM   1217 C  CD1 . TRP B 2 23  ? 17.043  8.445   -2.121  1.00 24.21 ? 23  TRP B CD1 1 
ATOM   1218 C  CD2 . TRP B 2 23  ? 16.998  10.483  -1.200  1.00 23.31 ? 23  TRP B CD2 1 
ATOM   1219 N  NE1 . TRP B 2 23  ? 15.955  9.111   -2.630  1.00 23.88 ? 23  TRP B NE1 1 
ATOM   1220 C  CE2 . TRP B 2 23  ? 15.905  10.366  -2.083  1.00 22.64 ? 23  TRP B CE2 1 
ATOM   1221 C  CE3 . TRP B 2 23  ? 17.176  11.688  -0.501  1.00 23.09 ? 23  TRP B CE3 1 
ATOM   1222 C  CZ2 . TRP B 2 23  ? 14.989  11.409  -2.291  1.00 23.37 ? 23  TRP B CZ2 1 
ATOM   1223 C  CZ3 . TRP B 2 23  ? 16.265  12.728  -0.709  1.00 20.51 ? 23  TRP B CZ3 1 
ATOM   1224 C  CH2 . TRP B 2 23  ? 15.188  12.579  -1.597  1.00 21.58 ? 23  TRP B CH2 1 
ATOM   1225 N  N   . ALA B 2 24  ? 20.481  11.595  -0.300  1.00 25.68 ? 24  ALA B N   1 
ATOM   1226 C  CA  . ALA B 2 24  ? 20.453  13.055  -0.274  1.00 26.81 ? 24  ALA B CA  1 
ATOM   1227 C  C   . ALA B 2 24  ? 21.364  13.708  -1.310  1.00 28.07 ? 24  ALA B C   1 
ATOM   1228 O  O   . ALA B 2 24  ? 20.945  14.610  -2.029  1.00 26.10 ? 24  ALA B O   1 
ATOM   1229 C  CB  . ALA B 2 24  ? 20.810  13.563  1.120   1.00 24.45 ? 24  ALA B CB  1 
ATOM   1230 N  N   . ASP B 2 25  ? 22.611  13.254  -1.379  1.00 31.05 ? 25  ASP B N   1 
ATOM   1231 C  CA  . ASP B 2 25  ? 23.570  13.820  -2.316  1.00 32.07 ? 25  ASP B CA  1 
ATOM   1232 C  C   . ASP B 2 25  ? 23.192  13.545  -3.762  1.00 33.71 ? 25  ASP B C   1 
ATOM   1233 O  O   . ASP B 2 25  ? 23.438  14.378  -4.635  1.00 34.37 ? 25  ASP B O   1 
ATOM   1234 C  CB  . ASP B 2 25  ? 24.979  13.288  -2.030  1.00 33.22 ? 25  ASP B CB  1 
ATOM   1235 C  CG  . ASP B 2 25  ? 25.474  13.664  -0.640  1.00 32.08 ? 25  ASP B CG  1 
ATOM   1236 O  OD1 . ASP B 2 25  ? 24.902  14.601  -0.038  1.00 31.16 ? 25  ASP B OD1 1 
ATOM   1237 O  OD2 . ASP B 2 25  ? 26.439  13.031  -0.161  1.00 29.93 ? 25  ASP B OD2 1 
ATOM   1238 N  N   . ALA B 2 26  ? 22.587  12.385  -4.013  1.00 33.25 ? 26  ALA B N   1 
ATOM   1239 C  CA  . ALA B 2 26  ? 22.160  12.021  -5.363  1.00 32.85 ? 26  ALA B CA  1 
ATOM   1240 C  C   . ALA B 2 26  ? 21.046  12.960  -5.837  1.00 32.36 ? 26  ALA B C   1 
ATOM   1241 O  O   . ALA B 2 26  ? 21.115  13.529  -6.926  1.00 32.24 ? 26  ALA B O   1 
ATOM   1242 C  CB  . ALA B 2 26  ? 21.674  10.573  -5.385  1.00 32.61 ? 26  ALA B CB  1 
ATOM   1243 N  N   . GLU B 2 27  ? 20.020  13.113  -5.009  1.00 31.88 ? 27  GLU B N   1 
ATOM   1244 C  CA  . GLU B 2 27  ? 18.898  13.990  -5.322  1.00 32.75 ? 27  GLU B CA  1 
ATOM   1245 C  C   . GLU B 2 27  ? 19.423  15.393  -5.617  1.00 34.79 ? 27  GLU B C   1 
ATOM   1246 O  O   . GLU B 2 27  ? 19.197  15.935  -6.704  1.00 35.12 ? 27  GLU B O   1 
ATOM   1247 C  CB  . GLU B 2 27  ? 17.923  14.023  -4.143  1.00 28.16 ? 27  GLU B CB  1 
ATOM   1248 C  CG  . GLU B 2 27  ? 16.851  15.096  -4.188  1.00 28.96 ? 27  GLU B CG  1 
ATOM   1249 C  CD  . GLU B 2 27  ? 15.959  15.025  -5.414  1.00 30.37 ? 27  GLU B CD  1 
ATOM   1250 O  OE1 . GLU B 2 27  ? 15.739  13.912  -5.948  1.00 30.50 ? 27  GLU B OE1 1 
ATOM   1251 O  OE2 . GLU B 2 27  ? 15.459  16.092  -5.832  1.00 27.70 ? 27  GLU B OE2 1 
ATOM   1252 N  N   . ASN B 2 28  ? 20.149  15.965  -4.661  1.00 33.74 ? 28  ASN B N   1 
ATOM   1253 C  CA  . ASN B 2 28  ? 20.701  17.306  -4.830  1.00 33.98 ? 28  ASN B CA  1 
ATOM   1254 C  C   . ASN B 2 28  ? 21.541  17.423  -6.094  1.00 32.61 ? 28  ASN B C   1 
ATOM   1255 O  O   . ASN B 2 28  ? 21.469  18.420  -6.816  1.00 31.63 ? 28  ASN B O   1 
ATOM   1256 C  CB  . ASN B 2 28  ? 21.566  17.696  -3.633  1.00 34.76 ? 28  ASN B CB  1 
ATOM   1257 C  CG  . ASN B 2 28  ? 22.196  19.060  -3.808  1.00 36.62 ? 28  ASN B CG  1 
ATOM   1258 O  OD1 . ASN B 2 28  ? 23.417  19.211  -3.746  1.00 37.34 ? 28  ASN B OD1 1 
ATOM   1259 N  ND2 . ASN B 2 28  ? 21.361  20.067  -4.042  1.00 37.79 ? 28  ASN B ND2 1 
ATOM   1260 N  N   . PHE B 2 29  ? 22.356  16.408  -6.343  1.00 31.60 ? 29  PHE B N   1 
ATOM   1261 C  CA  . PHE B 2 29  ? 23.205  16.397  -7.519  1.00 29.71 ? 29  PHE B CA  1 
ATOM   1262 C  C   . PHE B 2 29  ? 22.325  16.523  -8.752  1.00 28.89 ? 29  PHE B C   1 
ATOM   1263 O  O   . PHE B 2 29  ? 22.604  17.315  -9.651  1.00 28.96 ? 29  PHE B O   1 
ATOM   1264 C  CB  . PHE B 2 29  ? 24.019  15.100  -7.559  1.00 28.54 ? 29  PHE B CB  1 
ATOM   1265 C  CG  . PHE B 2 29  ? 24.868  14.949  -8.789  1.00 29.53 ? 29  PHE B CG  1 
ATOM   1266 C  CD1 . PHE B 2 29  ? 24.376  14.299  -9.913  1.00 26.85 ? 29  PHE B CD1 1 
ATOM   1267 C  CD2 . PHE B 2 29  ? 26.162  15.465  -8.825  1.00 31.04 ? 29  PHE B CD2 1 
ATOM   1268 C  CE1 . PHE B 2 29  ? 25.160  14.161  -11.059 1.00 28.01 ? 29  PHE B CE1 1 
ATOM   1269 C  CE2 . PHE B 2 29  ? 26.953  15.331  -9.970  1.00 31.41 ? 29  PHE B CE2 1 
ATOM   1270 C  CZ  . PHE B 2 29  ? 26.448  14.675  -11.088 1.00 29.11 ? 29  PHE B CZ  1 
ATOM   1271 N  N   . CYS B 2 30  ? 21.246  15.751  -8.778  1.00 29.56 ? 30  CYS B N   1 
ATOM   1272 C  CA  . CYS B 2 30  ? 20.327  15.784  -9.904  1.00 29.45 ? 30  CYS B CA  1 
ATOM   1273 C  C   . CYS B 2 30  ? 19.806  17.188  -10.186 1.00 29.23 ? 30  CYS B C   1 
ATOM   1274 O  O   . CYS B 2 30  ? 19.738  17.615  -11.345 1.00 29.92 ? 30  CYS B O   1 
ATOM   1275 C  CB  . CYS B 2 30  ? 19.145  14.838  -9.665  1.00 28.08 ? 30  CYS B CB  1 
ATOM   1276 S  SG  . CYS B 2 30  ? 19.499  13.057  -9.882  1.00 27.08 ? 30  CYS B SG  1 
ATOM   1277 N  N   . THR B 2 31  ? 19.445  17.914  -9.133  1.00 28.54 ? 31  THR B N   1 
ATOM   1278 C  CA  . THR B 2 31  ? 18.918  19.260  -9.310  1.00 29.03 ? 31  THR B CA  1 
ATOM   1279 C  C   . THR B 2 31  ? 19.929  20.172  -9.999  1.00 30.11 ? 31  THR B C   1 
ATOM   1280 O  O   . THR B 2 31  ? 19.556  21.188  -10.575 1.00 29.60 ? 31  THR B O   1 
ATOM   1281 C  CB  . THR B 2 31  ? 18.518  19.904  -7.959  1.00 27.64 ? 31  THR B CB  1 
ATOM   1282 O  OG1 . THR B 2 31  ? 19.695  20.221  -7.212  1.00 25.53 ? 31  THR B OG1 1 
ATOM   1283 C  CG2 . THR B 2 31  ? 17.642  18.955  -7.144  1.00 25.72 ? 31  THR B CG2 1 
ATOM   1284 N  N   . GLN B 2 32  ? 21.205  19.796  -9.948  1.00 32.67 ? 32  GLN B N   1 
ATOM   1285 C  CA  . GLN B 2 32  ? 22.267  20.600  -10.548 1.00 34.32 ? 32  GLN B CA  1 
ATOM   1286 C  C   . GLN B 2 32  ? 22.665  20.183  -11.961 1.00 35.01 ? 32  GLN B C   1 
ATOM   1287 O  O   . GLN B 2 32  ? 23.580  20.769  -12.535 1.00 36.16 ? 32  GLN B O   1 
ATOM   1288 C  CB  . GLN B 2 32  ? 23.518  20.557  -9.667  1.00 34.67 ? 32  GLN B CB  1 
ATOM   1289 C  CG  . GLN B 2 32  ? 23.280  20.871  -8.198  1.00 39.62 ? 32  GLN B CG  1 
ATOM   1290 C  CD  . GLN B 2 32  ? 24.528  20.652  -7.342  1.00 42.07 ? 32  GLN B CD  1 
ATOM   1291 O  OE1 . GLN B 2 32  ? 25.224  19.636  -7.476  1.00 42.57 ? 32  GLN B OE1 1 
ATOM   1292 N  NE2 . GLN B 2 32  ? 24.805  21.596  -6.450  1.00 43.01 ? 32  GLN B NE2 1 
ATOM   1293 N  N   . GLN B 2 33  ? 21.994  19.183  -12.528 1.00 35.35 ? 33  GLN B N   1 
ATOM   1294 C  CA  . GLN B 2 33  ? 22.349  18.715  -13.871 1.00 35.84 ? 33  GLN B CA  1 
ATOM   1295 C  C   . GLN B 2 33  ? 21.508  19.333  -14.994 1.00 36.05 ? 33  GLN B C   1 
ATOM   1296 O  O   . GLN B 2 33  ? 21.867  19.242  -16.171 1.00 35.00 ? 33  GLN B O   1 
ATOM   1297 C  CB  . GLN B 2 33  ? 22.266  17.184  -13.930 1.00 34.64 ? 33  GLN B CB  1 
ATOM   1298 C  CG  . GLN B 2 33  ? 23.115  16.481  -12.872 1.00 34.95 ? 33  GLN B CG  1 
ATOM   1299 C  CD  . GLN B 2 33  ? 24.586  16.878  -12.929 1.00 34.69 ? 33  GLN B CD  1 
ATOM   1300 O  OE1 . GLN B 2 33  ? 25.266  16.652  -13.929 1.00 32.96 ? 33  GLN B OE1 1 
ATOM   1301 N  NE2 . GLN B 2 33  ? 25.080  17.474  -11.850 1.00 33.25 ? 33  GLN B NE2 1 
ATOM   1302 N  N   . HIS B 2 34  ? 20.390  19.948  -14.616 1.00 37.13 ? 34  HIS B N   1 
ATOM   1303 C  CA  . HIS B 2 34  ? 19.479  20.616  -15.545 1.00 37.04 ? 34  HIS B CA  1 
ATOM   1304 C  C   . HIS B 2 34  ? 18.332  21.213  -14.741 1.00 37.85 ? 34  HIS B C   1 
ATOM   1305 O  O   . HIS B 2 34  ? 17.958  20.680  -13.695 1.00 38.11 ? 34  HIS B O   1 
ATOM   1306 C  CB  . HIS B 2 34  ? 18.921  19.638  -16.581 1.00 39.05 ? 34  HIS B CB  1 
ATOM   1307 C  CG  . HIS B 2 34  ? 18.108  20.298  -17.655 1.00 41.82 ? 34  HIS B CG  1 
ATOM   1308 N  ND1 . HIS B 2 34  ? 16.957  21.009  -17.388 1.00 41.12 ? 34  HIS B ND1 1 
ATOM   1309 C  CD2 . HIS B 2 34  ? 18.290  20.368  -18.996 1.00 41.46 ? 34  HIS B CD2 1 
ATOM   1310 C  CE1 . HIS B 2 34  ? 16.466  21.489  -18.518 1.00 42.12 ? 34  HIS B CE1 1 
ATOM   1311 N  NE2 . HIS B 2 34  ? 17.256  21.114  -19.508 1.00 40.06 ? 34  HIS B NE2 1 
ATOM   1312 N  N   . ALA B 2 35  ? 17.779  22.324  -15.221 1.00 37.52 ? 35  ALA B N   1 
ATOM   1313 C  CA  . ALA B 2 35  ? 16.676  22.985  -14.529 1.00 35.19 ? 35  ALA B CA  1 
ATOM   1314 C  C   . ALA B 2 35  ? 15.576  21.984  -14.210 1.00 33.20 ? 35  ALA B C   1 
ATOM   1315 O  O   . ALA B 2 35  ? 15.220  21.174  -15.057 1.00 34.63 ? 35  ALA B O   1 
ATOM   1316 C  CB  . ALA B 2 35  ? 16.116  24.111  -15.393 1.00 36.67 ? 35  ALA B CB  1 
ATOM   1317 N  N   . GLY B 2 36  ? 15.045  22.039  -12.990 1.00 32.69 ? 36  GLY B N   1 
ATOM   1318 C  CA  . GLY B 2 36  ? 13.979  21.131  -12.601 1.00 28.02 ? 36  GLY B CA  1 
ATOM   1319 C  C   . GLY B 2 36  ? 14.376  19.665  -12.501 1.00 28.91 ? 36  GLY B C   1 
ATOM   1320 O  O   . GLY B 2 36  ? 13.523  18.780  -12.616 1.00 27.41 ? 36  GLY B O   1 
ATOM   1321 N  N   . GLY B 2 37  ? 15.666  19.407  -12.287 1.00 27.28 ? 37  GLY B N   1 
ATOM   1322 C  CA  . GLY B 2 37  ? 16.149  18.042  -12.160 1.00 27.78 ? 37  GLY B CA  1 
ATOM   1323 C  C   . GLY B 2 37  ? 15.940  17.437  -10.775 1.00 28.67 ? 37  GLY B C   1 
ATOM   1324 O  O   . GLY B 2 37  ? 16.042  18.125  -9.758  1.00 27.00 ? 37  GLY B O   1 
ATOM   1325 N  N   . HIS B 2 38  ? 15.650  16.138  -10.745 1.00 28.97 ? 38  HIS B N   1 
ATOM   1326 C  CA  . HIS B 2 38  ? 15.405  15.397  -9.507  1.00 28.42 ? 38  HIS B CA  1 
ATOM   1327 C  C   . HIS B 2 38  ? 15.649  13.923  -9.795  1.00 28.53 ? 38  HIS B C   1 
ATOM   1328 O  O   . HIS B 2 38  ? 15.828  13.536  -10.951 1.00 29.15 ? 38  HIS B O   1 
ATOM   1329 C  CB  . HIS B 2 38  ? 13.944  15.531  -9.072  1.00 27.88 ? 38  HIS B CB  1 
ATOM   1330 C  CG  . HIS B 2 38  ? 13.536  16.917  -8.687  1.00 29.47 ? 38  HIS B CG  1 
ATOM   1331 N  ND1 . HIS B 2 38  ? 13.838  17.469  -7.460  1.00 27.60 ? 38  HIS B ND1 1 
ATOM   1332 C  CD2 . HIS B 2 38  ? 12.819  17.851  -9.356  1.00 28.09 ? 38  HIS B CD2 1 
ATOM   1333 C  CE1 . HIS B 2 38  ? 13.322  18.683  -7.389  1.00 27.39 ? 38  HIS B CE1 1 
ATOM   1334 N  NE2 . HIS B 2 38  ? 12.699  18.939  -8.525  1.00 27.90 ? 38  HIS B NE2 1 
ATOM   1335 N  N   . LEU B 2 39  ? 15.648  13.101  -8.746  1.00 26.75 ? 39  LEU B N   1 
ATOM   1336 C  CA  . LEU B 2 39  ? 15.812  11.666  -8.931  1.00 24.90 ? 39  LEU B CA  1 
ATOM   1337 C  C   . LEU B 2 39  ? 14.562  11.215  -9.677  1.00 24.46 ? 39  LEU B C   1 
ATOM   1338 O  O   . LEU B 2 39  ? 13.486  11.787  -9.489  1.00 25.26 ? 39  LEU B O   1 
ATOM   1339 C  CB  . LEU B 2 39  ? 15.905  10.936  -7.584  1.00 23.26 ? 39  LEU B CB  1 
ATOM   1340 C  CG  . LEU B 2 39  ? 17.282  10.873  -6.920  1.00 22.23 ? 39  LEU B CG  1 
ATOM   1341 C  CD1 . LEU B 2 39  ? 17.179  10.143  -5.592  1.00 22.62 ? 39  LEU B CD1 1 
ATOM   1342 C  CD2 . LEU B 2 39  ? 18.265  10.168  -7.834  1.00 22.32 ? 39  LEU B CD2 1 
ATOM   1343 N  N   . VAL B 2 40  ? 14.704  10.200  -10.524 1.00 23.71 ? 40  VAL B N   1 
ATOM   1344 C  CA  . VAL B 2 40  ? 13.585  9.693   -11.302 1.00 23.67 ? 40  VAL B CA  1 
ATOM   1345 C  C   . VAL B 2 40  ? 12.432  9.233   -10.414 1.00 25.25 ? 40  VAL B C   1 
ATOM   1346 O  O   . VAL B 2 40  ? 12.636  8.802   -9.284  1.00 25.78 ? 40  VAL B O   1 
ATOM   1347 C  CB  . VAL B 2 40  ? 14.029  8.504   -12.224 1.00 22.45 ? 40  VAL B CB  1 
ATOM   1348 C  CG1 . VAL B 2 40  ? 14.564  7.345   -11.389 1.00 22.28 ? 40  VAL B CG1 1 
ATOM   1349 C  CG2 . VAL B 2 40  ? 12.863  8.037   -13.068 1.00 20.53 ? 40  VAL B CG2 1 
ATOM   1350 N  N   . SER B 2 41  ? 11.220  9.346   -10.945 1.00 26.59 ? 41  SER B N   1 
ATOM   1351 C  CA  . SER B 2 41  ? 10.005  8.929   -10.260 1.00 28.47 ? 41  SER B CA  1 
ATOM   1352 C  C   . SER B 2 41  ? 9.225   8.068   -11.268 1.00 29.04 ? 41  SER B C   1 
ATOM   1353 O  O   . SER B 2 41  ? 9.323   8.291   -12.469 1.00 25.99 ? 41  SER B O   1 
ATOM   1354 C  CB  . SER B 2 41  ? 9.187   10.158  -9.855  1.00 27.85 ? 41  SER B CB  1 
ATOM   1355 O  OG  . SER B 2 41  ? 8.925   10.973  -10.982 1.00 25.34 ? 41  SER B OG  1 
ATOM   1356 N  N   . PHE B 2 42  ? 8.473   7.077   -10.789 1.00 31.27 ? 42  PHE B N   1 
ATOM   1357 C  CA  . PHE B 2 42  ? 7.709   6.215   -11.692 1.00 31.53 ? 42  PHE B CA  1 
ATOM   1358 C  C   . PHE B 2 42  ? 6.209   6.391   -11.534 1.00 32.85 ? 42  PHE B C   1 
ATOM   1359 O  O   . PHE B 2 42  ? 5.650   6.144   -10.462 1.00 32.91 ? 42  PHE B O   1 
ATOM   1360 C  CB  . PHE B 2 42  ? 8.058   4.735   -11.482 1.00 29.61 ? 42  PHE B CB  1 
ATOM   1361 C  CG  . PHE B 2 42  ? 9.516   4.414   -11.661 1.00 29.12 ? 42  PHE B CG  1 
ATOM   1362 C  CD1 . PHE B 2 42  ? 10.262  5.022   -12.662 1.00 25.43 ? 42  PHE B CD1 1 
ATOM   1363 C  CD2 . PHE B 2 42  ? 10.139  3.478   -10.836 1.00 30.38 ? 42  PHE B CD2 1 
ATOM   1364 C  CE1 . PHE B 2 42  ? 11.604  4.707   -12.843 1.00 24.60 ? 42  PHE B CE1 1 
ATOM   1365 C  CE2 . PHE B 2 42  ? 11.485  3.154   -11.012 1.00 28.34 ? 42  PHE B CE2 1 
ATOM   1366 C  CZ  . PHE B 2 42  ? 12.219  3.773   -12.020 1.00 26.65 ? 42  PHE B CZ  1 
ATOM   1367 N  N   . GLN B 2 43  ? 5.559   6.814   -12.614 1.00 34.54 ? 43  GLN B N   1 
ATOM   1368 C  CA  . GLN B 2 43  ? 4.118   7.024   -12.606 1.00 37.88 ? 43  GLN B CA  1 
ATOM   1369 C  C   . GLN B 2 43  ? 3.408   5.898   -13.346 1.00 37.91 ? 43  GLN B C   1 
ATOM   1370 O  O   . GLN B 2 43  ? 2.188   5.781   -13.287 1.00 39.56 ? 43  GLN B O   1 
ATOM   1371 C  CB  . GLN B 2 43  ? 3.779   8.358   -13.268 1.00 40.81 ? 43  GLN B CB  1 
ATOM   1372 C  CG  . GLN B 2 43  ? 3.049   9.337   -12.368 1.00 44.56 ? 43  GLN B CG  1 
ATOM   1373 C  CD  . GLN B 2 43  ? 3.858   9.722   -11.149 1.00 48.37 ? 43  GLN B CD  1 
ATOM   1374 O  OE1 . GLN B 2 43  ? 4.980   10.227  -11.262 1.00 51.01 ? 43  GLN B OE1 1 
ATOM   1375 N  NE2 . GLN B 2 43  ? 3.292   9.491   -9.971  1.00 49.25 ? 43  GLN B NE2 1 
ATOM   1376 N  N   . SER B 2 44  ? 4.178   5.063   -14.036 1.00 37.56 ? 44  SER B N   1 
ATOM   1377 C  CA  . SER B 2 44  ? 3.603   3.959   -14.793 1.00 36.76 ? 44  SER B CA  1 
ATOM   1378 C  C   . SER B 2 44  ? 4.564   2.788   -14.914 1.00 35.75 ? 44  SER B C   1 
ATOM   1379 O  O   . SER B 2 44  ? 5.744   2.908   -14.618 1.00 37.11 ? 44  SER B O   1 
ATOM   1380 C  CB  . SER B 2 44  ? 3.218   4.432   -16.195 1.00 36.55 ? 44  SER B CB  1 
ATOM   1381 O  OG  . SER B 2 44  ? 4.369   4.733   -16.952 1.00 33.03 ? 44  SER B OG  1 
ATOM   1382 N  N   . SER B 2 45  ? 4.042   1.657   -15.365 1.00 35.96 ? 45  SER B N   1 
ATOM   1383 C  CA  . SER B 2 45  ? 4.836   0.448   -15.541 1.00 35.68 ? 45  SER B CA  1 
ATOM   1384 C  C   . SER B 2 45  ? 5.803   0.585   -16.716 1.00 34.72 ? 45  SER B C   1 
ATOM   1385 O  O   . SER B 2 45  ? 6.962   0.170   -16.634 1.00 34.84 ? 45  SER B O   1 
ATOM   1386 C  CB  . SER B 2 45  ? 3.907   -0.741  -15.780 1.00 35.90 ? 45  SER B CB  1 
ATOM   1387 O  OG  . SER B 2 45  ? 2.883   -0.782  -14.802 1.00 35.19 ? 45  SER B OG  1 
ATOM   1388 N  N   . GLU B 2 46  ? 5.321   1.174   -17.807 1.00 34.83 ? 46  GLU B N   1 
ATOM   1389 C  CA  . GLU B 2 46  ? 6.132   1.361   -19.009 1.00 33.80 ? 46  GLU B CA  1 
ATOM   1390 C  C   . GLU B 2 46  ? 7.290   2.318   -18.761 1.00 32.50 ? 46  GLU B C   1 
ATOM   1391 O  O   . GLU B 2 46  ? 8.410   2.089   -19.223 1.00 30.34 ? 46  GLU B O   1 
ATOM   1392 C  CB  . GLU B 2 46  ? 5.269   1.887   -20.152 1.00 35.40 ? 46  GLU B CB  1 
ATOM   1393 C  CG  . GLU B 2 46  ? 4.100   0.985   -20.492 1.00 42.66 ? 46  GLU B CG  1 
ATOM   1394 C  CD  . GLU B 2 46  ? 3.067   0.932   -19.381 1.00 44.67 ? 46  GLU B CD  1 
ATOM   1395 O  OE1 . GLU B 2 46  ? 2.445   1.982   -19.102 1.00 45.37 ? 46  GLU B OE1 1 
ATOM   1396 O  OE2 . GLU B 2 46  ? 2.885   -0.155  -18.787 1.00 47.23 ? 46  GLU B OE2 1 
ATOM   1397 N  N   . GLU B 2 47  ? 7.018   3.395   -18.035 1.00 30.99 ? 47  GLU B N   1 
ATOM   1398 C  CA  . GLU B 2 47  ? 8.057   4.363   -17.716 1.00 29.78 ? 47  GLU B CA  1 
ATOM   1399 C  C   . GLU B 2 47  ? 9.176   3.687   -16.933 1.00 29.37 ? 47  GLU B C   1 
ATOM   1400 O  O   . GLU B 2 47  ? 10.346  3.841   -17.267 1.00 31.56 ? 47  GLU B O   1 
ATOM   1401 C  CB  . GLU B 2 47  ? 7.470   5.524   -16.908 1.00 27.65 ? 47  GLU B CB  1 
ATOM   1402 C  CG  . GLU B 2 47  ? 8.493   6.283   -16.100 1.00 29.79 ? 47  GLU B CG  1 
ATOM   1403 C  CD  . GLU B 2 47  ? 7.920   7.516   -15.434 1.00 28.80 ? 47  GLU B CD  1 
ATOM   1404 O  OE1 . GLU B 2 47  ? 6.757   7.466   -14.978 1.00 29.58 ? 47  GLU B OE1 1 
ATOM   1405 O  OE2 . GLU B 2 47  ? 8.642   8.531   -15.358 1.00 26.28 ? 47  GLU B OE2 1 
ATOM   1406 N  N   . ALA B 2 48  ? 8.816   2.937   -15.892 1.00 30.14 ? 48  ALA B N   1 
ATOM   1407 C  CA  . ALA B 2 48  ? 9.808   2.236   -15.081 1.00 29.62 ? 48  ALA B CA  1 
ATOM   1408 C  C   . ALA B 2 48  ? 10.587  1.244   -15.952 1.00 29.70 ? 48  ALA B C   1 
ATOM   1409 O  O   . ALA B 2 48  ? 11.808  1.111   -15.816 1.00 29.43 ? 48  ALA B O   1 
ATOM   1410 C  CB  . ALA B 2 48  ? 9.126   1.506   -13.924 1.00 26.75 ? 48  ALA B CB  1 
ATOM   1411 N  N   . ASP B 2 49  ? 9.883   0.543   -16.841 1.00 30.82 ? 49  ASP B N   1 
ATOM   1412 C  CA  . ASP B 2 49  ? 10.547  -0.414  -17.732 1.00 31.36 ? 49  ASP B CA  1 
ATOM   1413 C  C   . ASP B 2 49  ? 11.611  0.296   -18.555 1.00 31.10 ? 49  ASP B C   1 
ATOM   1414 O  O   . ASP B 2 49  ? 12.738  -0.183  -18.678 1.00 31.95 ? 49  ASP B O   1 
ATOM   1415 C  CB  . ASP B 2 49  ? 9.549   -1.084  -18.685 1.00 30.97 ? 49  ASP B CB  1 
ATOM   1416 C  CG  . ASP B 2 49  ? 8.659   -2.101  -17.991 1.00 33.29 ? 49  ASP B CG  1 
ATOM   1417 O  OD1 . ASP B 2 49  ? 9.099   -2.706  -16.989 1.00 32.71 ? 49  ASP B OD1 1 
ATOM   1418 O  OD2 . ASP B 2 49  ? 7.521   -2.307  -18.463 1.00 35.82 ? 49  ASP B OD2 1 
ATOM   1419 N  N   . PHE B 2 50  ? 11.246  1.442   -19.121 1.00 31.33 ? 50  PHE B N   1 
ATOM   1420 C  CA  . PHE B 2 50  ? 12.182  2.210   -19.924 1.00 31.42 ? 50  PHE B CA  1 
ATOM   1421 C  C   . PHE B 2 50  ? 13.413  2.613   -19.124 1.00 31.05 ? 50  PHE B C   1 
ATOM   1422 O  O   . PHE B 2 50  ? 14.531  2.554   -19.627 1.00 31.21 ? 50  PHE B O   1 
ATOM   1423 C  CB  . PHE B 2 50  ? 11.527  3.476   -20.464 1.00 33.20 ? 50  PHE B CB  1 
ATOM   1424 C  CG  . PHE B 2 50  ? 12.508  4.431   -21.089 1.00 35.61 ? 50  PHE B CG  1 
ATOM   1425 C  CD1 . PHE B 2 50  ? 13.060  4.164   -22.337 1.00 36.13 ? 50  PHE B CD1 1 
ATOM   1426 C  CD2 . PHE B 2 50  ? 12.909  5.579   -20.410 1.00 35.62 ? 50  PHE B CD2 1 
ATOM   1427 C  CE1 . PHE B 2 50  ? 14.000  5.029   -22.905 1.00 36.49 ? 50  PHE B CE1 1 
ATOM   1428 C  CE2 . PHE B 2 50  ? 13.846  6.450   -20.966 1.00 36.69 ? 50  PHE B CE2 1 
ATOM   1429 C  CZ  . PHE B 2 50  ? 14.393  6.173   -22.218 1.00 36.41 ? 50  PHE B CZ  1 
ATOM   1430 N  N   . VAL B 2 51  ? 13.198  3.036   -17.882 1.00 30.11 ? 51  VAL B N   1 
ATOM   1431 C  CA  . VAL B 2 51  ? 14.295  3.462   -17.031 1.00 29.34 ? 51  VAL B CA  1 
ATOM   1432 C  C   . VAL B 2 51  ? 15.209  2.299   -16.675 1.00 29.91 ? 51  VAL B C   1 
ATOM   1433 O  O   . VAL B 2 51  ? 16.427  2.442   -16.687 1.00 30.62 ? 51  VAL B O   1 
ATOM   1434 C  CB  . VAL B 2 51  ? 13.764  4.132   -15.745 1.00 29.80 ? 51  VAL B CB  1 
ATOM   1435 C  CG1 . VAL B 2 51  ? 14.918  4.482   -14.809 1.00 27.72 ? 51  VAL B CG1 1 
ATOM   1436 C  CG2 . VAL B 2 51  ? 13.000  5.387   -16.110 1.00 29.21 ? 51  VAL B CG2 1 
ATOM   1437 N  N   . VAL B 2 52  ? 14.627  1.147   -16.364 1.00 30.45 ? 52  VAL B N   1 
ATOM   1438 C  CA  . VAL B 2 52  ? 15.424  -0.029  -16.025 1.00 30.63 ? 52  VAL B CA  1 
ATOM   1439 C  C   . VAL B 2 52  ? 16.307  -0.404  -17.207 1.00 30.64 ? 52  VAL B C   1 
ATOM   1440 O  O   . VAL B 2 52  ? 17.517  -0.581  -17.068 1.00 31.07 ? 52  VAL B O   1 
ATOM   1441 C  CB  . VAL B 2 52  ? 14.530  -1.245  -15.675 1.00 30.56 ? 52  VAL B CB  1 
ATOM   1442 C  CG1 . VAL B 2 52  ? 15.384  -2.489  -15.507 1.00 29.83 ? 52  VAL B CG1 1 
ATOM   1443 C  CG2 . VAL B 2 52  ? 13.758  -0.973  -14.396 1.00 33.77 ? 52  VAL B CG2 1 
ATOM   1444 N  N   . LYS B 2 53  ? 15.685  -0.532  -18.373 1.00 32.29 ? 53  LYS B N   1 
ATOM   1445 C  CA  . LYS B 2 53  ? 16.392  -0.881  -19.600 1.00 31.73 ? 53  LYS B CA  1 
ATOM   1446 C  C   . LYS B 2 53  ? 17.579  0.063   -19.806 1.00 30.70 ? 53  LYS B C   1 
ATOM   1447 O  O   . LYS B 2 53  ? 18.696  -0.374  -20.079 1.00 29.69 ? 53  LYS B O   1 
ATOM   1448 C  CB  . LYS B 2 53  ? 15.436  -0.767  -20.786 1.00 34.28 ? 53  LYS B CB  1 
ATOM   1449 C  CG  . LYS B 2 53  ? 15.832  -1.567  -22.010 1.00 38.76 ? 53  LYS B CG  1 
ATOM   1450 C  CD  . LYS B 2 53  ? 14.888  -2.743  -22.203 1.00 44.11 ? 53  LYS B CD  1 
ATOM   1451 C  CE  . LYS B 2 53  ? 13.442  -2.268  -22.357 1.00 46.99 ? 53  LYS B CE  1 
ATOM   1452 N  NZ  . LYS B 2 53  ? 12.466  -3.399  -22.414 1.00 49.70 ? 53  LYS B NZ  1 
ATOM   1453 N  N   . LEU B 2 54  ? 17.328  1.361   -19.661 1.00 31.01 ? 54  LEU B N   1 
ATOM   1454 C  CA  . LEU B 2 54  ? 18.367  2.370   -19.842 1.00 30.72 ? 54  LEU B CA  1 
ATOM   1455 C  C   . LEU B 2 54  ? 19.515  2.154   -18.871 1.00 31.18 ? 54  LEU B C   1 
ATOM   1456 O  O   . LEU B 2 54  ? 20.673  2.060   -19.280 1.00 32.06 ? 54  LEU B O   1 
ATOM   1457 C  CB  . LEU B 2 54  ? 17.784  3.776   -19.658 1.00 31.28 ? 54  LEU B CB  1 
ATOM   1458 C  CG  . LEU B 2 54  ? 18.736  4.969   -19.822 1.00 31.37 ? 54  LEU B CG  1 
ATOM   1459 C  CD1 . LEU B 2 54  ? 19.339  4.982   -21.218 1.00 27.18 ? 54  LEU B CD1 1 
ATOM   1460 C  CD2 . LEU B 2 54  ? 17.974  6.259   -19.565 1.00 32.36 ? 54  LEU B CD2 1 
ATOM   1461 N  N   . ALA B 2 55  ? 19.188  2.060   -17.585 1.00 31.21 ? 55  ALA B N   1 
ATOM   1462 C  CA  . ALA B 2 55  ? 20.203  1.855   -16.563 1.00 29.86 ? 55  ALA B CA  1 
ATOM   1463 C  C   . ALA B 2 55  ? 21.067  0.659   -16.924 1.00 29.73 ? 55  ALA B C   1 
ATOM   1464 O  O   . ALA B 2 55  ? 22.293  0.734   -16.866 1.00 26.91 ? 55  ALA B O   1 
ATOM   1465 C  CB  . ALA B 2 55  ? 19.550  1.644   -15.198 1.00 28.90 ? 55  ALA B CB  1 
ATOM   1466 N  N   . PHE B 2 56  ? 20.432  -0.441  -17.312 1.00 31.25 ? 56  PHE B N   1 
ATOM   1467 C  CA  . PHE B 2 56  ? 21.190  -1.632  -17.670 1.00 34.75 ? 56  PHE B CA  1 
ATOM   1468 C  C   . PHE B 2 56  ? 22.060  -1.410  -18.901 1.00 35.44 ? 56  PHE B C   1 
ATOM   1469 O  O   . PHE B 2 56  ? 23.240  -1.739  -18.889 1.00 37.85 ? 56  PHE B O   1 
ATOM   1470 C  CB  . PHE B 2 56  ? 20.274  -2.829  -17.920 1.00 35.45 ? 56  PHE B CB  1 
ATOM   1471 C  CG  . PHE B 2 56  ? 21.014  -4.133  -18.001 1.00 37.58 ? 56  PHE B CG  1 
ATOM   1472 C  CD1 . PHE B 2 56  ? 21.513  -4.733  -16.849 1.00 39.01 ? 56  PHE B CD1 1 
ATOM   1473 C  CD2 . PHE B 2 56  ? 21.259  -4.739  -19.229 1.00 38.91 ? 56  PHE B CD2 1 
ATOM   1474 C  CE1 . PHE B 2 56  ? 22.246  -5.915  -16.913 1.00 40.44 ? 56  PHE B CE1 1 
ATOM   1475 C  CE2 . PHE B 2 56  ? 21.994  -5.923  -19.306 1.00 41.30 ? 56  PHE B CE2 1 
ATOM   1476 C  CZ  . PHE B 2 56  ? 22.488  -6.512  -18.144 1.00 41.01 ? 56  PHE B CZ  1 
ATOM   1477 N  N   . GLN B 2 57  ? 21.482  -0.856  -19.960 1.00 37.27 ? 57  GLN B N   1 
ATOM   1478 C  CA  . GLN B 2 57  ? 22.238  -0.601  -21.184 1.00 37.83 ? 57  GLN B CA  1 
ATOM   1479 C  C   . GLN B 2 57  ? 23.439  0.275   -20.867 1.00 36.61 ? 57  GLN B C   1 
ATOM   1480 O  O   . GLN B 2 57  ? 24.507  0.131   -21.460 1.00 37.04 ? 57  GLN B O   1 
ATOM   1481 C  CB  . GLN B 2 57  ? 21.368  0.122   -22.215 1.00 41.02 ? 57  GLN B CB  1 
ATOM   1482 C  CG  . GLN B 2 57  ? 20.072  -0.591  -22.567 1.00 44.90 ? 57  GLN B CG  1 
ATOM   1483 C  CD  . GLN B 2 57  ? 19.234  0.188   -23.568 1.00 47.15 ? 57  GLN B CD  1 
ATOM   1484 O  OE1 . GLN B 2 57  ? 19.067  1.403   -23.440 1.00 47.23 ? 57  GLN B OE1 1 
ATOM   1485 N  NE2 . GLN B 2 57  ? 18.694  -0.512  -24.565 1.00 46.05 ? 57  GLN B NE2 1 
ATOM   1486 N  N   . THR B 2 58  ? 23.246  1.175   -19.911 1.00 35.58 ? 58  THR B N   1 
ATOM   1487 C  CA  . THR B 2 58  ? 24.273  2.116   -19.501 1.00 33.61 ? 58  THR B CA  1 
ATOM   1488 C  C   . THR B 2 58  ? 25.372  1.527   -18.613 1.00 34.80 ? 58  THR B C   1 
ATOM   1489 O  O   . THR B 2 58  ? 26.551  1.606   -18.958 1.00 36.48 ? 58  THR B O   1 
ATOM   1490 C  CB  . THR B 2 58  ? 23.634  3.324   -18.764 1.00 35.16 ? 58  THR B CB  1 
ATOM   1491 O  OG1 . THR B 2 58  ? 22.581  3.882   -19.566 1.00 32.13 ? 58  THR B OG1 1 
ATOM   1492 C  CG2 . THR B 2 58  ? 24.681  4.404   -18.493 1.00 35.69 ? 58  THR B CG2 1 
ATOM   1493 N  N   . PHE B 2 59  ? 24.991  0.925   -17.484 1.00 34.66 ? 59  PHE B N   1 
ATOM   1494 C  CA  . PHE B 2 59  ? 25.963  0.377   -16.537 1.00 32.59 ? 59  PHE B CA  1 
ATOM   1495 C  C   . PHE B 2 59  ? 25.891  -1.120  -16.214 1.00 33.73 ? 59  PHE B C   1 
ATOM   1496 O  O   . PHE B 2 59  ? 26.689  -1.618  -15.419 1.00 33.82 ? 59  PHE B O   1 
ATOM   1497 C  CB  . PHE B 2 59  ? 25.888  1.175   -15.227 1.00 31.68 ? 59  PHE B CB  1 
ATOM   1498 C  CG  . PHE B 2 59  ? 26.168  2.645   -15.394 1.00 28.74 ? 59  PHE B CG  1 
ATOM   1499 C  CD1 . PHE B 2 59  ? 27.409  3.083   -15.842 1.00 30.17 ? 59  PHE B CD1 1 
ATOM   1500 C  CD2 . PHE B 2 59  ? 25.186  3.591   -15.119 1.00 29.25 ? 59  PHE B CD2 1 
ATOM   1501 C  CE1 . PHE B 2 59  ? 27.671  4.448   -16.018 1.00 30.22 ? 59  PHE B CE1 1 
ATOM   1502 C  CE2 . PHE B 2 59  ? 25.437  4.962   -15.291 1.00 27.67 ? 59  PHE B CE2 1 
ATOM   1503 C  CZ  . PHE B 2 59  ? 26.682  5.386   -15.742 1.00 28.66 ? 59  PHE B CZ  1 
ATOM   1504 N  N   . GLY B 2 60  ? 24.955  -1.841  -16.823 1.00 35.48 ? 60  GLY B N   1 
ATOM   1505 C  CA  . GLY B 2 60  ? 24.837  -3.265  -16.551 1.00 36.02 ? 60  GLY B CA  1 
ATOM   1506 C  C   . GLY B 2 60  ? 24.253  -3.550  -15.175 1.00 36.93 ? 60  GLY B C   1 
ATOM   1507 O  O   . GLY B 2 60  ? 23.421  -2.788  -14.691 1.00 37.40 ? 60  GLY B O   1 
ATOM   1508 N  N   . HIS B 2 61  ? 24.687  -4.640  -14.543 1.00 36.70 ? 61  HIS B N   1 
ATOM   1509 C  CA  . HIS B 2 61  ? 24.198  -5.020  -13.214 1.00 36.20 ? 61  HIS B CA  1 
ATOM   1510 C  C   . HIS B 2 61  ? 24.607  -3.998  -12.161 1.00 35.32 ? 61  HIS B C   1 
ATOM   1511 O  O   . HIS B 2 61  ? 25.798  -3.774  -11.921 1.00 35.66 ? 61  HIS B O   1 
ATOM   1512 C  CB  . HIS B 2 61  ? 24.730  -6.403  -12.828 1.00 36.13 ? 61  HIS B CB  1 
ATOM   1513 C  CG  . HIS B 2 61  ? 24.303  -7.490  -13.762 1.00 39.39 ? 61  HIS B CG  1 
ATOM   1514 N  ND1 . HIS B 2 61  ? 23.006  -7.956  -13.818 1.00 40.05 ? 61  HIS B ND1 1 
ATOM   1515 C  CD2 . HIS B 2 61  ? 24.985  -8.159  -14.723 1.00 39.60 ? 61  HIS B CD2 1 
ATOM   1516 C  CE1 . HIS B 2 61  ? 22.908  -8.862  -14.775 1.00 40.93 ? 61  HIS B CE1 1 
ATOM   1517 N  NE2 . HIS B 2 61  ? 24.094  -9.002  -15.340 1.00 40.03 ? 61  HIS B NE2 1 
ATOM   1518 N  N   . SER B 2 62  ? 23.612  -3.384  -11.531 1.00 33.09 ? 62  SER B N   1 
ATOM   1519 C  CA  . SER B 2 62  ? 23.874  -2.372  -10.522 1.00 31.96 ? 62  SER B CA  1 
ATOM   1520 C  C   . SER B 2 62  ? 22.560  -1.904  -9.897  1.00 30.35 ? 62  SER B C   1 
ATOM   1521 O  O   . SER B 2 62  ? 21.487  -2.361  -10.287 1.00 30.39 ? 62  SER B O   1 
ATOM   1522 C  CB  . SER B 2 62  ? 24.606  -1.194  -11.170 1.00 31.23 ? 62  SER B CB  1 
ATOM   1523 O  OG  . SER B 2 62  ? 25.234  -0.389  -10.195 1.00 35.80 ? 62  SER B OG  1 
ATOM   1524 N  N   . ILE B 2 63  ? 22.646  -1.000  -8.926  1.00 28.86 ? 63  ILE B N   1 
ATOM   1525 C  CA  . ILE B 2 63  ? 21.456  -0.487  -8.258  1.00 29.51 ? 63  ILE B CA  1 
ATOM   1526 C  C   . ILE B 2 63  ? 21.400  1.035   -8.336  1.00 28.51 ? 63  ILE B C   1 
ATOM   1527 O  O   . ILE B 2 63  ? 22.424  1.709   -8.215  1.00 28.22 ? 63  ILE B O   1 
ATOM   1528 C  CB  . ILE B 2 63  ? 21.409  -0.930  -6.774  1.00 30.66 ? 63  ILE B CB  1 
ATOM   1529 C  CG1 . ILE B 2 63  ? 22.620  -0.375  -6.018  1.00 32.53 ? 63  ILE B CG1 1 
ATOM   1530 C  CG2 . ILE B 2 63  ? 21.388  -2.447  -6.694  1.00 28.07 ? 63  ILE B CG2 1 
ATOM   1531 C  CD1 . ILE B 2 63  ? 22.608  -0.680  -4.518  1.00 34.09 ? 63  ILE B CD1 1 
ATOM   1532 N  N   . PHE B 2 64  ? 20.198  1.571   -8.532  1.00 27.32 ? 64  PHE B N   1 
ATOM   1533 C  CA  . PHE B 2 64  ? 20.028  3.013   -8.658  1.00 26.35 ? 64  PHE B CA  1 
ATOM   1534 C  C   . PHE B 2 64  ? 18.937  3.608   -7.763  1.00 26.11 ? 64  PHE B C   1 
ATOM   1535 O  O   . PHE B 2 64  ? 17.850  3.039   -7.617  1.00 24.07 ? 64  PHE B O   1 
ATOM   1536 C  CB  . PHE B 2 64  ? 19.722  3.371   -10.118 1.00 25.02 ? 64  PHE B CB  1 
ATOM   1537 C  CG  . PHE B 2 64  ? 20.648  2.728   -11.112 1.00 24.76 ? 64  PHE B CG  1 
ATOM   1538 C  CD1 . PHE B 2 64  ? 20.601  1.353   -11.343 1.00 21.86 ? 64  PHE B CD1 1 
ATOM   1539 C  CD2 . PHE B 2 64  ? 21.578  3.497   -11.815 1.00 24.93 ? 64  PHE B CD2 1 
ATOM   1540 C  CE1 . PHE B 2 64  ? 21.466  0.752   -12.258 1.00 24.80 ? 64  PHE B CE1 1 
ATOM   1541 C  CE2 . PHE B 2 64  ? 22.452  2.904   -12.739 1.00 23.23 ? 64  PHE B CE2 1 
ATOM   1542 C  CZ  . PHE B 2 64  ? 22.396  1.531   -12.960 1.00 22.04 ? 64  PHE B CZ  1 
ATOM   1543 N  N   . TRP B 2 65  ? 19.245  4.767   -7.185  1.00 25.89 ? 65  TRP B N   1 
ATOM   1544 C  CA  . TRP B 2 65  ? 18.327  5.503   -6.319  1.00 25.18 ? 65  TRP B CA  1 
ATOM   1545 C  C   . TRP B 2 65  ? 17.102  5.974   -7.103  1.00 26.24 ? 65  TRP B C   1 
ATOM   1546 O  O   . TRP B 2 65  ? 17.192  6.337   -8.280  1.00 24.11 ? 65  TRP B O   1 
ATOM   1547 C  CB  . TRP B 2 65  ? 19.021  6.738   -5.721  1.00 24.15 ? 65  TRP B CB  1 
ATOM   1548 C  CG  . TRP B 2 65  ? 19.952  6.489   -4.548  1.00 24.57 ? 65  TRP B CG  1 
ATOM   1549 C  CD1 . TRP B 2 65  ? 21.196  7.028   -4.366  1.00 23.39 ? 65  TRP B CD1 1 
ATOM   1550 C  CD2 . TRP B 2 65  ? 19.663  5.743   -3.351  1.00 23.50 ? 65  TRP B CD2 1 
ATOM   1551 N  NE1 . TRP B 2 65  ? 21.692  6.674   -3.133  1.00 23.57 ? 65  TRP B NE1 1 
ATOM   1552 C  CE2 . TRP B 2 65  ? 20.772  5.887   -2.489  1.00 23.11 ? 65  TRP B CE2 1 
ATOM   1553 C  CE3 . TRP B 2 65  ? 18.571  4.973   -2.923  1.00 23.07 ? 65  TRP B CE3 1 
ATOM   1554 C  CZ2 . TRP B 2 65  ? 20.822  5.288   -1.221  1.00 23.64 ? 65  TRP B CZ2 1 
ATOM   1555 C  CZ3 . TRP B 2 65  ? 18.623  4.376   -1.660  1.00 23.28 ? 65  TRP B CZ3 1 
ATOM   1556 C  CH2 . TRP B 2 65  ? 19.743  4.540   -0.827  1.00 23.56 ? 65  TRP B CH2 1 
ATOM   1557 N  N   . MET B 2 66  ? 15.966  5.982   -6.414  1.00 27.73 ? 66  MET B N   1 
ATOM   1558 C  CA  . MET B 2 66  ? 14.674  6.401   -6.951  1.00 27.04 ? 66  MET B CA  1 
ATOM   1559 C  C   . MET B 2 66  ? 14.309  7.623   -6.099  1.00 26.56 ? 66  MET B C   1 
ATOM   1560 O  O   . MET B 2 66  ? 14.876  7.803   -5.025  1.00 27.90 ? 66  MET B O   1 
ATOM   1561 C  CB  . MET B 2 66  ? 13.687  5.267   -6.719  1.00 29.15 ? 66  MET B CB  1 
ATOM   1562 C  CG  . MET B 2 66  ? 12.455  5.254   -7.559  1.00 29.00 ? 66  MET B CG  1 
ATOM   1563 S  SD  . MET B 2 66  ? 11.531  3.737   -7.151  1.00 32.83 ? 66  MET B SD  1 
ATOM   1564 C  CE  . MET B 2 66  ? 12.610  2.517   -7.864  1.00 24.85 ? 66  MET B CE  1 
ATOM   1565 N  N   . GLY B 2 67  ? 13.367  8.446   -6.552  1.00 26.07 ? 67  GLY B N   1 
ATOM   1566 C  CA  . GLY B 2 67  ? 12.998  9.643   -5.800  1.00 24.94 ? 67  GLY B CA  1 
ATOM   1567 C  C   . GLY B 2 67  ? 12.183  9.534   -4.513  1.00 25.41 ? 67  GLY B C   1 
ATOM   1568 O  O   . GLY B 2 67  ? 11.473  10.475  -4.150  1.00 24.00 ? 67  GLY B O   1 
ATOM   1569 N  N   . LEU B 2 68  ? 12.279  8.407   -3.815  1.00 25.95 ? 68  LEU B N   1 
ATOM   1570 C  CA  . LEU B 2 68  ? 11.539  8.208   -2.564  1.00 26.63 ? 68  LEU B CA  1 
ATOM   1571 C  C   . LEU B 2 68  ? 12.484  8.052   -1.370  1.00 26.85 ? 68  LEU B C   1 
ATOM   1572 O  O   . LEU B 2 68  ? 13.326  7.147   -1.349  1.00 26.25 ? 68  LEU B O   1 
ATOM   1573 C  CB  . LEU B 2 68  ? 10.647  6.966   -2.657  1.00 25.33 ? 68  LEU B CB  1 
ATOM   1574 C  CG  . LEU B 2 68  ? 9.417   7.003   -3.566  1.00 26.04 ? 68  LEU B CG  1 
ATOM   1575 C  CD1 . LEU B 2 68  ? 8.761   5.630   -3.563  1.00 24.58 ? 68  LEU B CD1 1 
ATOM   1576 C  CD2 . LEU B 2 68  ? 8.436   8.069   -3.093  1.00 19.63 ? 68  LEU B CD2 1 
ATOM   1577 N  N   . SER B 2 69  ? 12.326  8.924   -0.376  1.00 25.77 ? 69  SER B N   1 
ATOM   1578 C  CA  . SER B 2 69  ? 13.171  8.898   0.817   1.00 27.17 ? 69  SER B CA  1 
ATOM   1579 C  C   . SER B 2 69  ? 12.374  8.777   2.120   1.00 25.59 ? 69  SER B C   1 
ATOM   1580 O  O   . SER B 2 69  ? 11.154  8.938   2.126   1.00 24.55 ? 69  SER B O   1 
ATOM   1581 C  CB  . SER B 2 69  ? 14.018  10.171  0.866   1.00 27.37 ? 69  SER B CB  1 
ATOM   1582 O  OG  . SER B 2 69  ? 13.185  11.318  0.866   1.00 28.75 ? 69  SER B OG  1 
ATOM   1583 N  N   . ASN B 2 70  ? 13.077  8.499   3.220   1.00 25.20 ? 70  ASN B N   1 
ATOM   1584 C  CA  . ASN B 2 70  ? 12.445  8.374   4.535   1.00 24.72 ? 70  ASN B CA  1 
ATOM   1585 C  C   . ASN B 2 70  ? 11.047  7.788   4.376   1.00 23.76 ? 70  ASN B C   1 
ATOM   1586 O  O   . ASN B 2 70  ? 10.057  8.392   4.792   1.00 24.99 ? 70  ASN B O   1 
ATOM   1587 C  CB  . ASN B 2 70  ? 12.342  9.757   5.182   1.00 23.25 ? 70  ASN B CB  1 
ATOM   1588 C  CG  . ASN B 2 70  ? 13.664  10.483  5.210   1.00 23.68 ? 70  ASN B CG  1 
ATOM   1589 O  OD1 . ASN B 2 70  ? 13.712  11.694  5.416   1.00 25.89 ? 70  ASN B OD1 1 
ATOM   1590 N  ND2 . ASN B 2 70  ? 14.751  9.746   5.000   1.00 23.38 ? 70  ASN B ND2 1 
ATOM   1591 N  N   . VAL B 2 71  ? 10.972  6.608   3.781   1.00 23.30 ? 71  VAL B N   1 
ATOM   1592 C  CA  . VAL B 2 71  ? 9.692   5.976   3.505   1.00 24.58 ? 71  VAL B CA  1 
ATOM   1593 C  C   . VAL B 2 71  ? 8.858   5.457   4.679   1.00 24.70 ? 71  VAL B C   1 
ATOM   1594 O  O   . VAL B 2 71  ? 7.640   5.360   4.567   1.00 23.82 ? 71  VAL B O   1 
ATOM   1595 C  CB  . VAL B 2 71  ? 9.885   4.851   2.468   1.00 25.79 ? 71  VAL B CB  1 
ATOM   1596 C  CG1 . VAL B 2 71  ? 10.418  5.452   1.169   1.00 24.78 ? 71  VAL B CG1 1 
ATOM   1597 C  CG2 . VAL B 2 71  ? 10.861  3.808   2.992   1.00 25.29 ? 71  VAL B CG2 1 
ATOM   1598 N  N   . TRP B 2 72  ? 9.486   5.140   5.805   1.00 26.54 ? 72  TRP B N   1 
ATOM   1599 C  CA  . TRP B 2 72  ? 8.728   4.637   6.949   1.00 27.73 ? 72  TRP B CA  1 
ATOM   1600 C  C   . TRP B 2 72  ? 8.839   5.528   8.173   1.00 27.87 ? 72  TRP B C   1 
ATOM   1601 O  O   . TRP B 2 72  ? 8.257   5.226   9.216   1.00 28.71 ? 72  TRP B O   1 
ATOM   1602 C  CB  . TRP B 2 72  ? 9.193   3.230   7.326   1.00 25.98 ? 72  TRP B CB  1 
ATOM   1603 C  CG  . TRP B 2 72  ? 9.201   2.294   6.172   1.00 26.66 ? 72  TRP B CG  1 
ATOM   1604 C  CD1 . TRP B 2 72  ? 8.177   2.058   5.298   1.00 26.94 ? 72  TRP B CD1 1 
ATOM   1605 C  CD2 . TRP B 2 72  ? 10.296  1.487   5.735   1.00 27.44 ? 72  TRP B CD2 1 
ATOM   1606 N  NE1 . TRP B 2 72  ? 8.570   1.157   4.336   1.00 25.61 ? 72  TRP B NE1 1 
ATOM   1607 C  CE2 . TRP B 2 72  ? 9.868   0.790   4.580   1.00 27.27 ? 72  TRP B CE2 1 
ATOM   1608 C  CE3 . TRP B 2 72  ? 11.601  1.284   6.203   1.00 27.30 ? 72  TRP B CE3 1 
ATOM   1609 C  CZ2 . TRP B 2 72  ? 10.702  -0.093  3.884   1.00 25.57 ? 72  TRP B CZ2 1 
ATOM   1610 C  CZ3 . TRP B 2 72  ? 12.429  0.401   5.509   1.00 27.75 ? 72  TRP B CZ3 1 
ATOM   1611 C  CH2 . TRP B 2 72  ? 11.975  -0.273  4.363   1.00 26.28 ? 72  TRP B CH2 1 
ATOM   1612 N  N   . ASN B 2 73  ? 9.581   6.622   8.049   1.00 28.52 ? 73  ASN B N   1 
ATOM   1613 C  CA  . ASN B 2 73  ? 9.766   7.533   9.171   1.00 29.71 ? 73  ASN B CA  1 
ATOM   1614 C  C   . ASN B 2 73  ? 8.478   8.219   9.603   1.00 30.35 ? 73  ASN B C   1 
ATOM   1615 O  O   . ASN B 2 73  ? 8.319   8.549   10.776  1.00 30.95 ? 73  ASN B O   1 
ATOM   1616 C  CB  . ASN B 2 73  ? 10.825  8.586   8.834   1.00 30.45 ? 73  ASN B CB  1 
ATOM   1617 C  CG  . ASN B 2 73  ? 12.180  7.971   8.534   1.00 30.15 ? 73  ASN B CG  1 
ATOM   1618 O  OD1 . ASN B 2 73  ? 12.424  7.474   7.431   1.00 27.88 ? 73  ASN B OD1 1 
ATOM   1619 N  ND2 . ASN B 2 73  ? 13.066  7.988   9.524   1.00 28.15 ? 73  ASN B ND2 1 
ATOM   1620 N  N   . GLN B 2 74  ? 7.560   8.422   8.658   1.00 31.42 ? 74  GLN B N   1 
ATOM   1621 C  CA  . GLN B 2 74  ? 6.280   9.071   8.941   1.00 30.61 ? 74  GLN B CA  1 
ATOM   1622 C  C   . GLN B 2 74  ? 5.189   8.073   9.289   1.00 29.01 ? 74  GLN B C   1 
ATOM   1623 O  O   . GLN B 2 74  ? 4.033   8.446   9.468   1.00 29.74 ? 74  GLN B O   1 
ATOM   1624 C  CB  . GLN B 2 74  ? 5.822   9.915   7.745   1.00 33.08 ? 74  GLN B CB  1 
ATOM   1625 C  CG  . GLN B 2 74  ? 6.685   11.134  7.483   1.00 38.02 ? 74  GLN B CG  1 
ATOM   1626 C  CD  . GLN B 2 74  ? 6.850   12.000  8.719   1.00 42.72 ? 74  GLN B CD  1 
ATOM   1627 O  OE1 . GLN B 2 74  ? 5.878   12.557  9.241   1.00 46.11 ? 74  GLN B OE1 1 
ATOM   1628 N  NE2 . GLN B 2 74  ? 8.086   12.113  9.201   1.00 44.48 ? 74  GLN B NE2 1 
ATOM   1629 N  N   . CYS B 2 75  ? 5.550   6.799   9.365   1.00 28.09 ? 75  CYS B N   1 
ATOM   1630 C  CA  . CYS B 2 75  ? 4.583   5.772   9.715   1.00 26.65 ? 75  CYS B CA  1 
ATOM   1631 C  C   . CYS B 2 75  ? 4.424   5.816   11.229  1.00 26.30 ? 75  CYS B C   1 
ATOM   1632 O  O   . CYS B 2 75  ? 5.216   6.456   11.911  1.00 27.53 ? 75  CYS B O   1 
ATOM   1633 C  CB  . CYS B 2 75  ? 5.078   4.396   9.281   1.00 26.36 ? 75  CYS B CB  1 
ATOM   1634 S  SG  . CYS B 2 75  ? 5.122   4.046   7.482   1.00 30.04 ? 75  CYS B SG  1 
ATOM   1635 N  N   . ASN B 2 76  ? 3.410   5.144   11.760  1.00 26.88 ? 76  ASN B N   1 
ATOM   1636 C  CA  . ASN B 2 76  ? 3.201   5.162   13.201  1.00 27.99 ? 76  ASN B CA  1 
ATOM   1637 C  C   . ASN B 2 76  ? 3.834   3.970   13.912  1.00 27.17 ? 76  ASN B C   1 
ATOM   1638 O  O   . ASN B 2 76  ? 3.217   2.915   14.057  1.00 26.87 ? 76  ASN B O   1 
ATOM   1639 C  CB  . ASN B 2 76  ? 1.711   5.203   13.535  1.00 28.09 ? 76  ASN B CB  1 
ATOM   1640 C  CG  . ASN B 2 76  ? 1.460   5.435   15.010  1.00 29.18 ? 76  ASN B CG  1 
ATOM   1641 O  OD1 . ASN B 2 76  ? 0.448   5.002   15.556  1.00 29.19 ? 76  ASN B OD1 1 
ATOM   1642 N  ND2 . ASN B 2 76  ? 2.382   6.133   15.663  1.00 31.15 ? 76  ASN B ND2 1 
ATOM   1643 N  N   . TRP B 2 77  ? 5.071   4.154   14.355  1.00 27.17 ? 77  TRP B N   1 
ATOM   1644 C  CA  . TRP B 2 77  ? 5.799   3.120   15.065  1.00 27.57 ? 77  TRP B CA  1 
ATOM   1645 C  C   . TRP B 2 77  ? 5.389   3.128   16.528  1.00 28.77 ? 77  TRP B C   1 
ATOM   1646 O  O   . TRP B 2 77  ? 5.377   4.187   17.157  1.00 29.07 ? 77  TRP B O   1 
ATOM   1647 C  CB  . TRP B 2 77  ? 7.300   3.375   14.996  1.00 25.63 ? 77  TRP B CB  1 
ATOM   1648 C  CG  . TRP B 2 77  ? 7.886   3.220   13.654  1.00 27.04 ? 77  TRP B CG  1 
ATOM   1649 C  CD1 . TRP B 2 77  ? 8.040   4.187   12.710  1.00 26.01 ? 77  TRP B CD1 1 
ATOM   1650 C  CD2 . TRP B 2 77  ? 8.420   2.015   13.094  1.00 26.43 ? 77  TRP B CD2 1 
ATOM   1651 N  NE1 . TRP B 2 77  ? 8.644   3.661   11.591  1.00 28.26 ? 77  TRP B NE1 1 
ATOM   1652 C  CE2 . TRP B 2 77  ? 8.887   2.329   11.799  1.00 27.48 ? 77  TRP B CE2 1 
ATOM   1653 C  CE3 . TRP B 2 77  ? 8.548   0.700   13.561  1.00 24.65 ? 77  TRP B CE3 1 
ATOM   1654 C  CZ2 . TRP B 2 77  ? 9.478   1.374   10.960  1.00 27.08 ? 77  TRP B CZ2 1 
ATOM   1655 C  CZ3 . TRP B 2 77  ? 9.132   -0.251  12.729  1.00 25.53 ? 77  TRP B CZ3 1 
ATOM   1656 C  CH2 . TRP B 2 77  ? 9.592   0.094   11.441  1.00 27.17 ? 77  TRP B CH2 1 
ATOM   1657 N  N   . GLN B 2 78  ? 5.065   1.957   17.069  1.00 27.43 ? 78  GLN B N   1 
ATOM   1658 C  CA  . GLN B 2 78  ? 4.683   1.858   18.469  1.00 29.41 ? 78  GLN B CA  1 
ATOM   1659 C  C   . GLN B 2 78  ? 4.804   0.453   19.030  1.00 28.54 ? 78  GLN B C   1 
ATOM   1660 O  O   . GLN B 2 78  ? 4.700   -0.532  18.300  1.00 27.24 ? 78  GLN B O   1 
ATOM   1661 C  CB  . GLN B 2 78  ? 3.267   2.398   18.674  1.00 31.84 ? 78  GLN B CB  1 
ATOM   1662 C  CG  . GLN B 2 78  ? 3.240   3.915   18.782  1.00 37.01 ? 78  GLN B CG  1 
ATOM   1663 C  CD  . GLN B 2 78  ? 1.851   4.501   18.735  1.00 41.12 ? 78  GLN B CD  1 
ATOM   1664 O  OE1 . GLN B 2 78  ? 1.690   5.720   18.657  1.00 43.42 ? 78  GLN B OE1 1 
ATOM   1665 N  NE2 . GLN B 2 78  ? 0.836   3.643   18.783  1.00 42.82 ? 78  GLN B NE2 1 
ATOM   1666 N  N   . TRP B 2 79  ? 5.049   0.381   20.336  1.00 28.90 ? 79  TRP B N   1 
ATOM   1667 C  CA  . TRP B 2 79  ? 5.189   -0.886  21.043  1.00 28.90 ? 79  TRP B CA  1 
ATOM   1668 C  C   . TRP B 2 79  ? 3.830   -1.537  21.199  1.00 27.75 ? 79  TRP B C   1 
ATOM   1669 O  O   . TRP B 2 79  ? 2.870   -0.877  21.581  1.00 28.05 ? 79  TRP B O   1 
ATOM   1670 C  CB  . TRP B 2 79  ? 5.779   -0.661  22.438  1.00 30.86 ? 79  TRP B CB  1 
ATOM   1671 C  CG  . TRP B 2 79  ? 7.155   -0.083  22.439  1.00 31.43 ? 79  TRP B CG  1 
ATOM   1672 C  CD1 . TRP B 2 79  ? 7.510   1.200   22.751  1.00 30.15 ? 79  TRP B CD1 1 
ATOM   1673 C  CD2 . TRP B 2 79  ? 8.366   -0.769  22.111  1.00 31.71 ? 79  TRP B CD2 1 
ATOM   1674 N  NE1 . TRP B 2 79  ? 8.870   1.353   22.640  1.00 30.18 ? 79  TRP B NE1 1 
ATOM   1675 C  CE2 . TRP B 2 79  ? 9.421   0.159   22.247  1.00 31.73 ? 79  TRP B CE2 1 
ATOM   1676 C  CE3 . TRP B 2 79  ? 8.663   -2.082  21.713  1.00 31.54 ? 79  TRP B CE3 1 
ATOM   1677 C  CZ2 . TRP B 2 79  ? 10.756  -0.183  21.999  1.00 30.30 ? 79  TRP B CZ2 1 
ATOM   1678 C  CZ3 . TRP B 2 79  ? 9.991   -2.421  21.467  1.00 31.71 ? 79  TRP B CZ3 1 
ATOM   1679 C  CH2 . TRP B 2 79  ? 11.020  -1.472  21.611  1.00 30.41 ? 79  TRP B CH2 1 
ATOM   1680 N  N   . SER B 2 80  ? 3.750   -2.831  20.912  1.00 28.09 ? 80  SER B N   1 
ATOM   1681 C  CA  . SER B 2 80  ? 2.494   -3.552  21.051  1.00 28.26 ? 80  SER B CA  1 
ATOM   1682 C  C   . SER B 2 80  ? 1.974   -3.521  22.491  1.00 29.80 ? 80  SER B C   1 
ATOM   1683 O  O   . SER B 2 80  ? 0.793   -3.767  22.720  1.00 31.85 ? 80  SER B O   1 
ATOM   1684 C  CB  . SER B 2 80  ? 2.657   -5.005  20.592  1.00 29.16 ? 80  SER B CB  1 
ATOM   1685 O  OG  . SER B 2 80  ? 3.663   -5.677  21.330  1.00 28.00 ? 80  SER B OG  1 
ATOM   1686 N  N   . ASN B 2 81  ? 2.842   -3.231  23.460  1.00 28.60 ? 81  ASN B N   1 
ATOM   1687 C  CA  . ASN B 2 81  ? 2.402   -3.164  24.859  1.00 31.18 ? 81  ASN B CA  1 
ATOM   1688 C  C   . ASN B 2 81  ? 1.983   -1.730  25.180  1.00 31.33 ? 81  ASN B C   1 
ATOM   1689 O  O   . ASN B 2 81  ? 1.753   -1.379  26.334  1.00 30.53 ? 81  ASN B O   1 
ATOM   1690 C  CB  . ASN B 2 81  ? 3.510   -3.636  25.825  1.00 29.99 ? 81  ASN B CB  1 
ATOM   1691 C  CG  . ASN B 2 81  ? 4.641   -2.626  25.972  1.00 33.22 ? 81  ASN B CG  1 
ATOM   1692 O  OD1 . ASN B 2 81  ? 5.001   -1.931  25.022  1.00 34.08 ? 81  ASN B OD1 1 
ATOM   1693 N  ND2 . ASN B 2 81  ? 5.219   -2.557  27.163  1.00 35.65 ? 81  ASN B ND2 1 
ATOM   1694 N  N   . ALA B 2 82  ? 1.905   -0.909  24.133  1.00 32.15 ? 82  ALA B N   1 
ATOM   1695 C  CA  . ALA B 2 82  ? 1.485   0.488   24.232  1.00 32.00 ? 82  ALA B CA  1 
ATOM   1696 C  C   . ALA B 2 82  ? 2.357   1.413   25.079  1.00 32.67 ? 82  ALA B C   1 
ATOM   1697 O  O   . ALA B 2 82  ? 1.885   2.444   25.563  1.00 31.59 ? 82  ALA B O   1 
ATOM   1698 C  CB  . ALA B 2 82  ? 0.046   0.552   24.720  1.00 31.57 ? 82  ALA B CB  1 
ATOM   1699 N  N   . ALA B 2 83  ? 3.624   1.054   25.255  1.00 33.45 ? 83  ALA B N   1 
ATOM   1700 C  CA  . ALA B 2 83  ? 4.538   1.887   26.026  1.00 33.69 ? 83  ALA B CA  1 
ATOM   1701 C  C   . ALA B 2 83  ? 5.026   3.044   25.159  1.00 34.51 ? 83  ALA B C   1 
ATOM   1702 O  O   . ALA B 2 83  ? 5.186   2.901   23.948  1.00 34.44 ? 83  ALA B O   1 
ATOM   1703 C  CB  . ALA B 2 83  ? 5.721   1.061   26.504  1.00 33.50 ? 83  ALA B CB  1 
ATOM   1704 N  N   . MET B 2 84  ? 5.260   4.192   25.784  1.00 35.52 ? 84  MET B N   1 
ATOM   1705 C  CA  . MET B 2 84  ? 5.743   5.361   25.065  1.00 36.99 ? 84  MET B CA  1 
ATOM   1706 C  C   . MET B 2 84  ? 7.102   5.112   24.423  1.00 37.78 ? 84  MET B C   1 
ATOM   1707 O  O   . MET B 2 84  ? 8.039   4.671   25.084  1.00 36.09 ? 84  MET B O   1 
ATOM   1708 C  CB  . MET B 2 84  ? 5.854   6.557   26.009  1.00 38.41 ? 84  MET B CB  1 
ATOM   1709 C  CG  . MET B 2 84  ? 4.572   7.345   26.169  1.00 42.31 ? 84  MET B CG  1 
ATOM   1710 S  SD  . MET B 2 84  ? 4.757   8.713   27.330  1.00 48.61 ? 84  MET B SD  1 
ATOM   1711 C  CE  . MET B 2 84  ? 3.058   8.853   27.959  1.00 43.10 ? 84  MET B CE  1 
ATOM   1712 N  N   . LEU B 2 85  ? 7.199   5.399   23.130  1.00 39.35 ? 85  LEU B N   1 
ATOM   1713 C  CA  . LEU B 2 85  ? 8.450   5.236   22.405  1.00 40.44 ? 85  LEU B CA  1 
ATOM   1714 C  C   . LEU B 2 85  ? 9.364   6.386   22.821  1.00 40.89 ? 85  LEU B C   1 
ATOM   1715 O  O   . LEU B 2 85  ? 9.133   7.536   22.443  1.00 40.19 ? 85  LEU B O   1 
ATOM   1716 C  CB  . LEU B 2 85  ? 8.208   5.302   20.893  1.00 40.98 ? 85  LEU B CB  1 
ATOM   1717 C  CG  . LEU B 2 85  ? 9.350   4.878   19.961  1.00 41.95 ? 85  LEU B CG  1 
ATOM   1718 C  CD1 . LEU B 2 85  ? 8.964   5.213   18.534  1.00 42.46 ? 85  LEU B CD1 1 
ATOM   1719 C  CD2 . LEU B 2 85  ? 10.650  5.580   20.325  1.00 43.28 ? 85  LEU B CD2 1 
ATOM   1720 N  N   . ARG B 2 86  ? 10.397  6.074   23.599  1.00 41.95 ? 86  ARG B N   1 
ATOM   1721 C  CA  . ARG B 2 86  ? 11.339  7.089   24.056  1.00 41.25 ? 86  ARG B CA  1 
ATOM   1722 C  C   . ARG B 2 86  ? 12.778  6.644   23.831  1.00 39.66 ? 86  ARG B C   1 
ATOM   1723 O  O   . ARG B 2 86  ? 13.529  7.307   23.117  1.00 39.80 ? 86  ARG B O   1 
ATOM   1724 C  CB  . ARG B 2 86  ? 11.087  7.414   25.533  1.00 44.33 ? 86  ARG B CB  1 
ATOM   1725 C  CG  . ARG B 2 86  ? 9.748   8.127   25.772  1.00 49.60 ? 86  ARG B CG  1 
ATOM   1726 C  CD  . ARG B 2 86  ? 9.694   9.471   25.036  1.00 52.57 ? 86  ARG B CD  1 
ATOM   1727 N  NE  . ARG B 2 86  ? 8.369   10.093  25.049  1.00 55.86 ? 86  ARG B NE  1 
ATOM   1728 C  CZ  . ARG B 2 86  ? 7.704   10.439  26.150  1.00 58.64 ? 86  ARG B CZ  1 
ATOM   1729 N  NH1 . ARG B 2 86  ? 8.234   10.225  27.348  1.00 59.28 ? 86  ARG B NH1 1 
ATOM   1730 N  NH2 . ARG B 2 86  ? 6.509   11.011  26.052  1.00 57.95 ? 86  ARG B NH2 1 
ATOM   1731 N  N   . TYR B 2 87  ? 13.164  5.528   24.438  1.00 37.24 ? 87  TYR B N   1 
ATOM   1732 C  CA  . TYR B 2 87  ? 14.509  4.999   24.258  1.00 34.43 ? 87  TYR B CA  1 
ATOM   1733 C  C   . TYR B 2 87  ? 14.580  4.453   22.833  1.00 33.33 ? 87  TYR B C   1 
ATOM   1734 O  O   . TYR B 2 87  ? 13.749  3.641   22.447  1.00 32.09 ? 87  TYR B O   1 
ATOM   1735 C  CB  . TYR B 2 87  ? 14.780  3.862   25.258  1.00 32.65 ? 87  TYR B CB  1 
ATOM   1736 C  CG  . TYR B 2 87  ? 16.071  3.101   25.001  1.00 28.86 ? 87  TYR B CG  1 
ATOM   1737 C  CD1 . TYR B 2 87  ? 17.314  3.670   25.290  1.00 27.68 ? 87  TYR B CD1 1 
ATOM   1738 C  CD2 . TYR B 2 87  ? 16.051  1.825   24.445  1.00 26.60 ? 87  TYR B CD2 1 
ATOM   1739 C  CE1 . TYR B 2 87  ? 18.499  2.988   25.030  1.00 25.01 ? 87  TYR B CE1 1 
ATOM   1740 C  CE2 . TYR B 2 87  ? 17.240  1.128   24.183  1.00 24.98 ? 87  TYR B CE2 1 
ATOM   1741 C  CZ  . TYR B 2 87  ? 18.459  1.716   24.477  1.00 25.44 ? 87  TYR B CZ  1 
ATOM   1742 O  OH  . TYR B 2 87  ? 19.636  1.037   24.224  1.00 23.67 ? 87  TYR B OH  1 
ATOM   1743 N  N   . LYS B 2 88  ? 15.561  4.907   22.057  1.00 33.83 ? 88  LYS B N   1 
ATOM   1744 C  CA  . LYS B 2 88  ? 15.730  4.447   20.680  1.00 33.87 ? 88  LYS B CA  1 
ATOM   1745 C  C   . LYS B 2 88  ? 17.073  3.747   20.492  1.00 32.36 ? 88  LYS B C   1 
ATOM   1746 O  O   . LYS B 2 88  ? 18.060  4.122   21.114  1.00 32.15 ? 88  LYS B O   1 
ATOM   1747 C  CB  . LYS B 2 88  ? 15.640  5.623   19.701  1.00 36.38 ? 88  LYS B CB  1 
ATOM   1748 C  CG  . LYS B 2 88  ? 14.238  6.185   19.478  1.00 39.76 ? 88  LYS B CG  1 
ATOM   1749 C  CD  . LYS B 2 88  ? 14.012  7.465   20.268  1.00 43.98 ? 88  LYS B CD  1 
ATOM   1750 C  CE  . LYS B 2 88  ? 12.716  8.158   19.867  1.00 43.95 ? 88  LYS B CE  1 
ATOM   1751 N  NZ  . LYS B 2 88  ? 12.740  8.588   18.440  1.00 46.37 ? 88  LYS B NZ  1 
ATOM   1752 N  N   . ALA B 2 89  ? 17.106  2.740   19.621  1.00 31.87 ? 89  ALA B N   1 
ATOM   1753 C  CA  . ALA B 2 89  ? 18.335  1.991   19.351  1.00 30.12 ? 89  ALA B CA  1 
ATOM   1754 C  C   . ALA B 2 89  ? 18.336  1.479   17.912  1.00 29.47 ? 89  ALA B C   1 
ATOM   1755 O  O   . ALA B 2 89  ? 18.698  0.331   17.639  1.00 25.86 ? 89  ALA B O   1 
ATOM   1756 C  CB  . ALA B 2 89  ? 18.459  0.818   20.329  1.00 28.99 ? 89  ALA B CB  1 
ATOM   1757 N  N   . TRP B 2 90  ? 17.935  2.349   16.992  1.00 31.12 ? 90  TRP B N   1 
ATOM   1758 C  CA  . TRP B 2 90  ? 17.856  2.009   15.570  1.00 30.78 ? 90  TRP B CA  1 
ATOM   1759 C  C   . TRP B 2 90  ? 19.194  1.715   14.908  1.00 30.48 ? 90  TRP B C   1 
ATOM   1760 O  O   . TRP B 2 90  ? 20.151  2.466   15.079  1.00 32.89 ? 90  TRP B O   1 
ATOM   1761 C  CB  . TRP B 2 90  ? 17.192  3.146   14.795  1.00 30.35 ? 90  TRP B CB  1 
ATOM   1762 C  CG  . TRP B 2 90  ? 15.810  3.472   15.249  1.00 30.72 ? 90  TRP B CG  1 
ATOM   1763 C  CD1 . TRP B 2 90  ? 15.451  4.238   16.322  1.00 29.44 ? 90  TRP B CD1 1 
ATOM   1764 C  CD2 . TRP B 2 90  ? 14.594  3.027   14.646  1.00 29.26 ? 90  TRP B CD2 1 
ATOM   1765 N  NE1 . TRP B 2 90  ? 14.083  4.299   16.421  1.00 29.37 ? 90  TRP B NE1 1 
ATOM   1766 C  CE2 . TRP B 2 90  ? 13.532  3.565   15.405  1.00 29.52 ? 90  TRP B CE2 1 
ATOM   1767 C  CE3 . TRP B 2 90  ? 14.298  2.225   13.534  1.00 30.40 ? 90  TRP B CE3 1 
ATOM   1768 C  CZ2 . TRP B 2 90  ? 12.191  3.329   15.089  1.00 29.43 ? 90  TRP B CZ2 1 
ATOM   1769 C  CZ3 . TRP B 2 90  ? 12.965  1.989   13.218  1.00 31.88 ? 90  TRP B CZ3 1 
ATOM   1770 C  CH2 . TRP B 2 90  ? 11.926  2.542   13.996  1.00 30.68 ? 90  TRP B CH2 1 
ATOM   1771 N  N   . ALA B 2 91  ? 19.262  0.625   14.147  1.00 29.93 ? 91  ALA B N   1 
ATOM   1772 C  CA  . ALA B 2 91  ? 20.493  0.297   13.429  1.00 29.25 ? 91  ALA B CA  1 
ATOM   1773 C  C   . ALA B 2 91  ? 20.640  1.359   12.338  1.00 27.93 ? 91  ALA B C   1 
ATOM   1774 O  O   . ALA B 2 91  ? 21.736  1.827   12.048  1.00 28.43 ? 91  ALA B O   1 
ATOM   1775 C  CB  . ALA B 2 91  ? 20.399  -1.099  12.799  1.00 28.53 ? 91  ALA B CB  1 
ATOM   1776 N  N   . GLU B 2 92  ? 19.510  1.743   11.757  1.00 28.37 ? 92  GLU B N   1 
ATOM   1777 C  CA  . GLU B 2 92  ? 19.476  2.741   10.698  1.00 29.83 ? 92  GLU B CA  1 
ATOM   1778 C  C   . GLU B 2 92  ? 18.357  3.737   10.993  1.00 30.72 ? 92  GLU B C   1 
ATOM   1779 O  O   . GLU B 2 92  ? 17.305  3.368   11.519  1.00 31.10 ? 92  GLU B O   1 
ATOM   1780 C  CB  . GLU B 2 92  ? 19.244  2.061   9.339   1.00 29.62 ? 92  GLU B CB  1 
ATOM   1781 C  CG  . GLU B 2 92  ? 20.345  1.082   8.932   1.00 29.87 ? 92  GLU B CG  1 
ATOM   1782 C  CD  . GLU B 2 92  ? 21.670  1.769   8.616   1.00 32.51 ? 92  GLU B CD  1 
ATOM   1783 O  OE1 . GLU B 2 92  ? 21.842  2.959   8.964   1.00 32.55 ? 92  GLU B OE1 1 
ATOM   1784 O  OE2 . GLU B 2 92  ? 22.549  1.110   8.021   1.00 35.37 ? 92  GLU B OE2 1 
ATOM   1785 N  N   . GLU B 2 93  ? 18.586  4.999   10.656  1.00 32.13 ? 93  GLU B N   1 
ATOM   1786 C  CA  . GLU B 2 93  ? 17.599  6.038   10.912  1.00 35.06 ? 93  GLU B CA  1 
ATOM   1787 C  C   . GLU B 2 93  ? 16.537  6.197   9.822   1.00 33.55 ? 93  GLU B C   1 
ATOM   1788 O  O   . GLU B 2 93  ? 15.385  6.527   10.118  1.00 31.77 ? 93  GLU B O   1 
ATOM   1789 C  CB  . GLU B 2 93  ? 18.309  7.373   11.173  1.00 39.64 ? 93  GLU B CB  1 
ATOM   1790 C  CG  . GLU B 2 93  ? 19.294  7.809   10.094  1.00 47.73 ? 93  GLU B CG  1 
ATOM   1791 C  CD  . GLU B 2 93  ? 20.123  9.016   10.522  1.00 52.74 ? 93  GLU B CD  1 
ATOM   1792 O  OE1 . GLU B 2 93  ? 19.530  9.983   11.051  1.00 54.73 ? 93  GLU B OE1 1 
ATOM   1793 O  OE2 . GLU B 2 93  ? 21.362  9.002   10.329  1.00 53.80 ? 93  GLU B OE2 1 
ATOM   1794 N  N   . SER B 2 94  ? 16.908  5.948   8.568   1.00 31.12 ? 94  SER B N   1 
ATOM   1795 C  CA  . SER B 2 94  ? 15.946  6.084   7.481   1.00 30.29 ? 94  SER B CA  1 
ATOM   1796 C  C   . SER B 2 94  ? 16.270  5.244   6.257   1.00 29.77 ? 94  SER B C   1 
ATOM   1797 O  O   . SER B 2 94  ? 17.434  4.990   5.943   1.00 29.68 ? 94  SER B O   1 
ATOM   1798 C  CB  . SER B 2 94  ? 15.819  7.549   7.062   1.00 27.93 ? 94  SER B CB  1 
ATOM   1799 O  OG  . SER B 2 94  ? 17.003  7.999   6.438   1.00 30.41 ? 94  SER B OG  1 
ATOM   1800 N  N   . TYR B 2 95  ? 15.216  4.817   5.569   1.00 30.14 ? 95  TYR B N   1 
ATOM   1801 C  CA  . TYR B 2 95  ? 15.355  4.013   4.363   1.00 29.42 ? 95  TYR B CA  1 
ATOM   1802 C  C   . TYR B 2 95  ? 14.884  4.750   3.116   1.00 27.87 ? 95  TYR B C   1 
ATOM   1803 O  O   . TYR B 2 95  ? 14.009  5.612   3.172   1.00 28.51 ? 95  TYR B O   1 
ATOM   1804 C  CB  . TYR B 2 95  ? 14.598  2.689   4.506   1.00 25.89 ? 95  TYR B CB  1 
ATOM   1805 C  CG  . TYR B 2 95  ? 15.373  1.644   5.275   1.00 26.72 ? 95  TYR B CG  1 
ATOM   1806 C  CD1 . TYR B 2 95  ? 15.495  1.707   6.669   1.00 26.62 ? 95  TYR B CD1 1 
ATOM   1807 C  CD2 . TYR B 2 95  ? 16.014  0.602   4.606   1.00 26.97 ? 95  TYR B CD2 1 
ATOM   1808 C  CE1 . TYR B 2 95  ? 16.242  0.755   7.372   1.00 24.52 ? 95  TYR B CE1 1 
ATOM   1809 C  CE2 . TYR B 2 95  ? 16.761  -0.350  5.299   1.00 27.67 ? 95  TYR B CE2 1 
ATOM   1810 C  CZ  . TYR B 2 95  ? 16.873  -0.267  6.676   1.00 25.51 ? 95  TYR B CZ  1 
ATOM   1811 O  OH  . TYR B 2 95  ? 17.635  -1.196  7.339   1.00 27.11 ? 95  TYR B OH  1 
ATOM   1812 N  N   . CYS B 2 96  ? 15.482  4.395   1.989   1.00 27.70 ? 96  CYS B N   1 
ATOM   1813 C  CA  . CYS B 2 96  ? 15.161  5.011   0.713   1.00 26.60 ? 96  CYS B CA  1 
ATOM   1814 C  C   . CYS B 2 96  ? 14.912  3.927   -0.343  1.00 26.81 ? 96  CYS B C   1 
ATOM   1815 O  O   . CYS B 2 96  ? 15.402  2.804   -0.229  1.00 24.64 ? 96  CYS B O   1 
ATOM   1816 C  CB  . CYS B 2 96  ? 16.309  5.958   0.312   1.00 26.96 ? 96  CYS B CB  1 
ATOM   1817 S  SG  . CYS B 2 96  ? 16.276  7.566   1.196   1.00 27.18 ? 96  CYS B SG  1 
ATOM   1818 N  N   . VAL B 2 97  ? 14.143  4.266   -1.371  1.00 26.86 ? 97  VAL B N   1 
ATOM   1819 C  CA  . VAL B 2 97  ? 13.809  3.304   -2.410  1.00 23.99 ? 97  VAL B CA  1 
ATOM   1820 C  C   . VAL B 2 97  ? 14.719  3.316   -3.623  1.00 25.14 ? 97  VAL B C   1 
ATOM   1821 O  O   . VAL B 2 97  ? 15.093  4.373   -4.134  1.00 24.11 ? 97  VAL B O   1 
ATOM   1822 C  CB  . VAL B 2 97  ? 12.366  3.506   -2.894  1.00 22.31 ? 97  VAL B CB  1 
ATOM   1823 C  CG1 . VAL B 2 97  ? 11.967  2.380   -3.831  1.00 21.88 ? 97  VAL B CG1 1 
ATOM   1824 C  CG2 . VAL B 2 97  ? 11.428  3.582   -1.693  1.00 21.04 ? 97  VAL B CG2 1 
ATOM   1825 N  N   . TYR B 2 98  ? 15.080  2.122   -4.074  1.00 25.19 ? 98  TYR B N   1 
ATOM   1826 C  CA  . TYR B 2 98  ? 15.919  1.978   -5.251  1.00 27.05 ? 98  TYR B CA  1 
ATOM   1827 C  C   . TYR B 2 98  ? 15.409  0.796   -6.055  1.00 28.15 ? 98  TYR B C   1 
ATOM   1828 O  O   . TYR B 2 98  ? 14.521  0.056   -5.612  1.00 27.63 ? 98  TYR B O   1 
ATOM   1829 C  CB  . TYR B 2 98  ? 17.389  1.736   -4.870  1.00 29.64 ? 98  TYR B CB  1 
ATOM   1830 C  CG  . TYR B 2 98  ? 17.703  0.333   -4.380  1.00 30.11 ? 98  TYR B CG  1 
ATOM   1831 C  CD1 . TYR B 2 98  ? 17.440  -0.050  -3.061  1.00 30.40 ? 98  TYR B CD1 1 
ATOM   1832 C  CD2 . TYR B 2 98  ? 18.246  -0.618  -5.245  1.00 31.15 ? 98  TYR B CD2 1 
ATOM   1833 C  CE1 . TYR B 2 98  ? 17.712  -1.348  -2.618  1.00 30.49 ? 98  TYR B CE1 1 
ATOM   1834 C  CE2 . TYR B 2 98  ? 18.518  -1.917  -4.816  1.00 30.09 ? 98  TYR B CE2 1 
ATOM   1835 C  CZ  . TYR B 2 98  ? 18.252  -2.275  -3.504  1.00 31.79 ? 98  TYR B CZ  1 
ATOM   1836 O  OH  . TYR B 2 98  ? 18.533  -3.557  -3.082  1.00 33.10 ? 98  TYR B OH  1 
ATOM   1837 N  N   . PHE B 2 99  ? 15.972  0.630   -7.243  1.00 28.46 ? 99  PHE B N   1 
ATOM   1838 C  CA  . PHE B 2 99  ? 15.616  -0.475  -8.115  1.00 29.60 ? 99  PHE B CA  1 
ATOM   1839 C  C   . PHE B 2 99  ? 16.920  -0.986  -8.701  1.00 31.55 ? 99  PHE B C   1 
ATOM   1840 O  O   . PHE B 2 99  ? 17.910  -0.249  -8.762  1.00 32.11 ? 99  PHE B O   1 
ATOM   1841 C  CB  . PHE B 2 99  ? 14.686  0.001   -9.238  1.00 29.72 ? 99  PHE B CB  1 
ATOM   1842 C  CG  . PHE B 2 99  ? 15.363  0.867   -10.272 1.00 28.68 ? 99  PHE B CG  1 
ATOM   1843 C  CD1 . PHE B 2 99  ? 16.160  0.299   -11.263 1.00 27.13 ? 99  PHE B CD1 1 
ATOM   1844 C  CD2 . PHE B 2 99  ? 15.209  2.249   -10.249 1.00 27.56 ? 99  PHE B CD2 1 
ATOM   1845 C  CE1 . PHE B 2 99  ? 16.790  1.088   -12.208 1.00 26.04 ? 99  PHE B CE1 1 
ATOM   1846 C  CE2 . PHE B 2 99  ? 15.838  3.048   -11.193 1.00 28.17 ? 99  PHE B CE2 1 
ATOM   1847 C  CZ  . PHE B 2 99  ? 16.630  2.466   -12.174 1.00 28.01 ? 99  PHE B CZ  1 
ATOM   1848 N  N   . LYS B 2 100 ? 16.933  -2.246  -9.112  1.00 33.25 ? 100 LYS B N   1 
ATOM   1849 C  CA  . LYS B 2 100 ? 18.126  -2.811  -9.721  1.00 34.94 ? 100 LYS B CA  1 
ATOM   1850 C  C   . LYS B 2 100 ? 17.888  -2.897  -11.225 1.00 35.59 ? 100 LYS B C   1 
ATOM   1851 O  O   . LYS B 2 100 ? 16.783  -3.188  -11.674 1.00 37.10 ? 100 LYS B O   1 
ATOM   1852 C  CB  . LYS B 2 100 ? 18.439  -4.187  -9.128  1.00 36.79 ? 100 LYS B CB  1 
ATOM   1853 C  CG  . LYS B 2 100 ? 17.361  -5.227  -9.301  1.00 40.91 ? 100 LYS B CG  1 
ATOM   1854 C  CD  . LYS B 2 100 ? 17.635  -6.447  -8.426  1.00 42.79 ? 100 LYS B CD  1 
ATOM   1855 C  CE  . LYS B 2 100 ? 18.928  -7.155  -8.796  1.00 44.99 ? 100 LYS B CE  1 
ATOM   1856 N  NZ  . LYS B 2 100 ? 19.168  -8.331  -7.912  1.00 49.34 ? 100 LYS B NZ  1 
ATOM   1857 N  N   . SER B 2 101 ? 18.933  -2.628  -11.995 1.00 36.11 ? 101 SER B N   1 
ATOM   1858 C  CA  . SER B 2 101 ? 18.864  -2.633  -13.452 1.00 34.57 ? 101 SER B CA  1 
ATOM   1859 C  C   . SER B 2 101 ? 18.277  -3.872  -14.132 1.00 34.80 ? 101 SER B C   1 
ATOM   1860 O  O   . SER B 2 101 ? 18.060  -3.857  -15.347 1.00 35.09 ? 101 SER B O   1 
ATOM   1861 C  CB  . SER B 2 101 ? 20.258  -2.358  -14.018 1.00 33.38 ? 101 SER B CB  1 
ATOM   1862 O  OG  . SER B 2 101 ? 21.230  -3.116  -13.324 1.00 29.73 ? 101 SER B OG  1 
ATOM   1863 N  N   . THR B 2 102 ? 18.013  -4.934  -13.374 1.00 32.93 ? 102 THR B N   1 
ATOM   1864 C  CA  . THR B 2 102 ? 17.462  -6.150  -13.973 1.00 33.34 ? 102 THR B CA  1 
ATOM   1865 C  C   . THR B 2 102 ? 15.935  -6.247  -14.009 1.00 32.92 ? 102 THR B C   1 
ATOM   1866 O  O   . THR B 2 102 ? 15.387  -6.968  -14.848 1.00 32.12 ? 102 THR B O   1 
ATOM   1867 C  CB  . THR B 2 102 ? 18.025  -7.409  -13.297 1.00 33.50 ? 102 THR B CB  1 
ATOM   1868 O  OG1 . THR B 2 102 ? 18.043  -7.226  -11.877 1.00 35.17 ? 102 THR B OG1 1 
ATOM   1869 C  CG2 . THR B 2 102 ? 19.438  -7.688  -13.796 1.00 34.81 ? 102 THR B CG2 1 
ATOM   1870 N  N   . ASN B 2 103 ? 15.252  -5.527  -13.115 1.00 30.97 ? 103 ASN B N   1 
ATOM   1871 C  CA  . ASN B 2 103 ? 13.787  -5.536  -13.083 1.00 30.05 ? 103 ASN B CA  1 
ATOM   1872 C  C   . ASN B 2 103 ? 13.224  -4.257  -12.444 1.00 27.82 ? 103 ASN B C   1 
ATOM   1873 O  O   . ASN B 2 103 ? 13.964  -3.500  -11.816 1.00 24.88 ? 103 ASN B O   1 
ATOM   1874 C  CB  . ASN B 2 103 ? 13.271  -6.806  -12.368 1.00 30.17 ? 103 ASN B CB  1 
ATOM   1875 C  CG  . ASN B 2 103 ? 13.509  -6.797  -10.860 1.00 31.52 ? 103 ASN B CG  1 
ATOM   1876 O  OD1 . ASN B 2 103 ? 13.544  -7.850  -10.229 1.00 35.35 ? 103 ASN B OD1 1 
ATOM   1877 N  ND2 . ASN B 2 103 ? 13.650  -5.619  -10.280 1.00 33.35 ? 103 ASN B ND2 1 
ATOM   1878 N  N   . ASN B 2 104 ? 11.922  -4.018  -12.604 1.00 26.02 ? 104 ASN B N   1 
ATOM   1879 C  CA  . ASN B 2 104 ? 11.302  -2.808  -12.064 1.00 26.72 ? 104 ASN B CA  1 
ATOM   1880 C  C   . ASN B 2 104 ? 10.708  -2.928  -10.655 1.00 26.37 ? 104 ASN B C   1 
ATOM   1881 O  O   . ASN B 2 104 ? 9.838   -2.150  -10.276 1.00 25.61 ? 104 ASN B O   1 
ATOM   1882 C  CB  . ASN B 2 104 ? 10.218  -2.302  -13.025 1.00 27.41 ? 104 ASN B CB  1 
ATOM   1883 C  CG  . ASN B 2 104 ? 9.090   -3.303  -13.212 1.00 28.91 ? 104 ASN B CG  1 
ATOM   1884 O  OD1 . ASN B 2 104 ? 8.989   -4.287  -12.478 1.00 32.80 ? 104 ASN B OD1 1 
ATOM   1885 N  ND2 . ASN B 2 104 ? 8.230   -3.051  -14.191 1.00 27.49 ? 104 ASN B ND2 1 
ATOM   1886 N  N   . LYS B 2 105 ? 11.182  -3.889  -9.875  1.00 26.31 ? 105 LYS B N   1 
ATOM   1887 C  CA  . LYS B 2 105 ? 10.670  -4.074  -8.525  1.00 26.16 ? 105 LYS B CA  1 
ATOM   1888 C  C   . LYS B 2 105 ? 11.295  -3.104  -7.517  1.00 25.29 ? 105 LYS B C   1 
ATOM   1889 O  O   . LYS B 2 105 ? 12.499  -2.851  -7.545  1.00 27.68 ? 105 LYS B O   1 
ATOM   1890 C  CB  . LYS B 2 105 ? 10.895  -5.521  -8.105  1.00 25.97 ? 105 LYS B CB  1 
ATOM   1891 C  CG  . LYS B 2 105 ? 10.173  -6.501  -9.027  1.00 28.96 ? 105 LYS B CG  1 
ATOM   1892 C  CD  . LYS B 2 105 ? 10.403  -7.947  -8.618  1.00 32.62 ? 105 LYS B CD  1 
ATOM   1893 C  CE  . LYS B 2 105 ? 9.616   -8.894  -9.501  1.00 33.44 ? 105 LYS B CE  1 
ATOM   1894 N  NZ  . LYS B 2 105 ? 8.175   -8.511  -9.554  1.00 35.84 ? 105 LYS B NZ  1 
ATOM   1895 N  N   . TRP B 2 106 ? 10.474  -2.548  -6.631  1.00 23.23 ? 106 TRP B N   1 
ATOM   1896 C  CA  . TRP B 2 106 ? 10.972  -1.597  -5.641  1.00 21.62 ? 106 TRP B CA  1 
ATOM   1897 C  C   . TRP B 2 106 ? 11.615  -2.322  -4.457  1.00 24.12 ? 106 TRP B C   1 
ATOM   1898 O  O   . TRP B 2 106 ? 11.040  -3.263  -3.890  1.00 23.21 ? 106 TRP B O   1 
ATOM   1899 C  CB  . TRP B 2 106 ? 9.834   -0.689  -5.156  1.00 21.16 ? 106 TRP B CB  1 
ATOM   1900 C  CG  . TRP B 2 106 ? 9.265   0.242   -6.209  1.00 18.65 ? 106 TRP B CG  1 
ATOM   1901 C  CD1 . TRP B 2 106 ? 9.373   0.118   -7.569  1.00 20.84 ? 106 TRP B CD1 1 
ATOM   1902 C  CD2 . TRP B 2 106 ? 8.423   1.382   -5.980  1.00 20.10 ? 106 TRP B CD2 1 
ATOM   1903 N  NE1 . TRP B 2 106 ? 8.646   1.103   -8.197  1.00 22.02 ? 106 TRP B NE1 1 
ATOM   1904 C  CE2 . TRP B 2 106 ? 8.053   1.892   -7.246  1.00 19.05 ? 106 TRP B CE2 1 
ATOM   1905 C  CE3 . TRP B 2 106 ? 7.941   2.021   -4.826  1.00 20.02 ? 106 TRP B CE3 1 
ATOM   1906 C  CZ2 . TRP B 2 106 ? 7.224   3.009   -7.392  1.00 20.06 ? 106 TRP B CZ2 1 
ATOM   1907 C  CZ3 . TRP B 2 106 ? 7.112   3.137   -4.974  1.00 21.40 ? 106 TRP B CZ3 1 
ATOM   1908 C  CH2 . TRP B 2 106 ? 6.764   3.617   -6.250  1.00 20.62 ? 106 TRP B CH2 1 
ATOM   1909 N  N   . ARG B 2 107 ? 12.820  -1.885  -4.103  1.00 24.45 ? 107 ARG B N   1 
ATOM   1910 C  CA  . ARG B 2 107 ? 13.579  -2.475  -3.003  1.00 23.48 ? 107 ARG B CA  1 
ATOM   1911 C  C   . ARG B 2 107 ? 13.976  -1.358  -2.040  1.00 24.08 ? 107 ARG B C   1 
ATOM   1912 O  O   . ARG B 2 107 ? 13.932  -0.175  -2.402  1.00 21.98 ? 107 ARG B O   1 
ATOM   1913 C  CB  . ARG B 2 107 ? 14.824  -3.168  -3.561  1.00 22.61 ? 107 ARG B CB  1 
ATOM   1914 C  CG  . ARG B 2 107 ? 14.500  -4.206  -4.614  1.00 22.92 ? 107 ARG B CG  1 
ATOM   1915 C  CD  . ARG B 2 107 ? 15.617  -4.375  -5.631  1.00 24.52 ? 107 ARG B CD  1 
ATOM   1916 N  NE  . ARG B 2 107 ? 15.199  -5.251  -6.721  1.00 25.10 ? 107 ARG B NE  1 
ATOM   1917 C  CZ  . ARG B 2 107 ? 15.182  -6.579  -6.655  1.00 28.03 ? 107 ARG B CZ  1 
ATOM   1918 N  NH1 . ARG B 2 107 ? 15.576  -7.202  -5.551  1.00 26.90 ? 107 ARG B NH1 1 
ATOM   1919 N  NH2 . ARG B 2 107 ? 14.748  -7.285  -7.690  1.00 28.45 ? 107 ARG B NH2 1 
ATOM   1920 N  N   . SER B 2 108 ? 14.362  -1.725  -0.819  1.00 22.48 ? 108 SER B N   1 
ATOM   1921 C  CA  . SER B 2 108 ? 14.743  -0.731  0.180   1.00 22.53 ? 108 SER B CA  1 
ATOM   1922 C  C   . SER B 2 108 ? 16.211  -0.790  0.602   1.00 23.11 ? 108 SER B C   1 
ATOM   1923 O  O   . SER B 2 108 ? 16.827  -1.855  0.603   1.00 22.67 ? 108 SER B O   1 
ATOM   1924 C  CB  . SER B 2 108 ? 13.843  -0.860  1.416   1.00 23.50 ? 108 SER B CB  1 
ATOM   1925 O  OG  . SER B 2 108 ? 13.857  -2.182  1.924   1.00 24.40 ? 108 SER B OG  1 
ATOM   1926 N  N   . ARG B 2 109 ? 16.760  0.377   0.938   1.00 24.36 ? 109 ARG B N   1 
ATOM   1927 C  CA  . ARG B 2 109 ? 18.144  0.516   1.389   1.00 24.99 ? 109 ARG B CA  1 
ATOM   1928 C  C   . ARG B 2 109 ? 18.304  1.764   2.258   1.00 25.87 ? 109 ARG B C   1 
ATOM   1929 O  O   . ARG B 2 109 ? 17.684  2.796   1.991   1.00 25.51 ? 109 ARG B O   1 
ATOM   1930 C  CB  . ARG B 2 109 ? 19.102  0.605   0.193   1.00 24.19 ? 109 ARG B CB  1 
ATOM   1931 C  CG  . ARG B 2 109 ? 20.466  1.195   0.550   1.00 26.13 ? 109 ARG B CG  1 
ATOM   1932 C  CD  . ARG B 2 109 ? 21.444  1.179   -0.615  1.00 27.87 ? 109 ARG B CD  1 
ATOM   1933 N  NE  . ARG B 2 109 ? 21.951  -0.162  -0.858  1.00 31.25 ? 109 ARG B NE  1 
ATOM   1934 C  CZ  . ARG B 2 109 ? 23.240  -0.483  -0.879  1.00 29.54 ? 109 ARG B CZ  1 
ATOM   1935 N  NH1 . ARG B 2 109 ? 24.164  0.441   -0.675  1.00 29.67 ? 109 ARG B NH1 1 
ATOM   1936 N  NH2 . ARG B 2 109 ? 23.603  -1.737  -1.092  1.00 31.75 ? 109 ARG B NH2 1 
ATOM   1937 N  N   . ALA B 2 110 ? 19.134  1.663   3.295   1.00 26.67 ? 110 ALA B N   1 
ATOM   1938 C  CA  . ALA B 2 110 ? 19.386  2.789   4.192   1.00 27.84 ? 110 ALA B CA  1 
ATOM   1939 C  C   . ALA B 2 110 ? 19.827  3.991   3.365   1.00 28.92 ? 110 ALA B C   1 
ATOM   1940 O  O   . ALA B 2 110 ? 20.724  3.876   2.528   1.00 29.81 ? 110 ALA B O   1 
ATOM   1941 C  CB  . ALA B 2 110 ? 20.464  2.423   5.201   1.00 27.60 ? 110 ALA B CB  1 
ATOM   1942 N  N   . CYS B 2 111 ? 19.202  5.141   3.607   1.00 29.25 ? 111 CYS B N   1 
ATOM   1943 C  CA  . CYS B 2 111 ? 19.499  6.361   2.861   1.00 29.23 ? 111 CYS B CA  1 
ATOM   1944 C  C   . CYS B 2 111 ? 20.939  6.859   2.971   1.00 29.86 ? 111 CYS B C   1 
ATOM   1945 O  O   . CYS B 2 111 ? 21.425  7.546   2.073   1.00 30.19 ? 111 CYS B O   1 
ATOM   1946 C  CB  . CYS B 2 111 ? 18.553  7.487   3.288   1.00 26.61 ? 111 CYS B CB  1 
ATOM   1947 S  SG  . CYS B 2 111 ? 16.764  7.161   3.142   1.00 26.48 ? 111 CYS B SG  1 
ATOM   1948 N  N   . ARG B 2 112 ? 21.615  6.525   4.067   1.00 32.23 ? 112 ARG B N   1 
ATOM   1949 C  CA  . ARG B 2 112 ? 22.997  6.961   4.279   1.00 34.05 ? 112 ARG B CA  1 
ATOM   1950 C  C   . ARG B 2 112 ? 23.969  6.148   3.433   1.00 34.67 ? 112 ARG B C   1 
ATOM   1951 O  O   . ARG B 2 112 ? 25.093  6.576   3.186   1.00 36.55 ? 112 ARG B O   1 
ATOM   1952 C  CB  . ARG B 2 112 ? 23.388  6.826   5.751   1.00 35.70 ? 112 ARG B CB  1 
ATOM   1953 C  CG  . ARG B 2 112 ? 23.623  5.391   6.183   1.00 37.93 ? 112 ARG B CG  1 
ATOM   1954 C  CD  . ARG B 2 112 ? 24.170  5.307   7.598   1.00 39.66 ? 112 ARG B CD  1 
ATOM   1955 N  NE  . ARG B 2 112 ? 24.397  3.921   7.994   1.00 42.66 ? 112 ARG B NE  1 
ATOM   1956 C  CZ  . ARG B 2 112 ? 25.249  3.098   7.390   1.00 45.11 ? 112 ARG B CZ  1 
ATOM   1957 N  NH1 . ARG B 2 112 ? 25.965  3.520   6.356   1.00 47.40 ? 112 ARG B NH1 1 
ATOM   1958 N  NH2 . ARG B 2 112 ? 25.383  1.847   7.813   1.00 45.77 ? 112 ARG B NH2 1 
ATOM   1959 N  N   . MET B 2 113 ? 23.539  4.968   3.001   1.00 35.17 ? 113 MET B N   1 
ATOM   1960 C  CA  . MET B 2 113 ? 24.383  4.120   2.171   1.00 35.42 ? 113 MET B CA  1 
ATOM   1961 C  C   . MET B 2 113 ? 24.463  4.683   0.750   1.00 35.85 ? 113 MET B C   1 
ATOM   1962 O  O   . MET B 2 113 ? 23.725  5.606   0.400   1.00 35.23 ? 113 MET B O   1 
ATOM   1963 C  CB  . MET B 2 113 ? 23.837  2.696   2.151   1.00 35.19 ? 113 MET B CB  1 
ATOM   1964 C  CG  . MET B 2 113 ? 23.986  1.974   3.476   1.00 33.80 ? 113 MET B CG  1 
ATOM   1965 S  SD  . MET B 2 113 ? 23.362  0.300   3.384   1.00 33.84 ? 113 MET B SD  1 
ATOM   1966 C  CE  . MET B 2 113 ? 24.743  -0.559  2.729   1.00 31.32 ? 113 MET B CE  1 
ATOM   1967 N  N   . MET B 2 114 ? 25.350  4.127   -0.069  1.00 35.40 ? 114 MET B N   1 
ATOM   1968 C  CA  . MET B 2 114 ? 25.519  4.634   -1.423  1.00 36.18 ? 114 MET B CA  1 
ATOM   1969 C  C   . MET B 2 114 ? 24.961  3.768   -2.534  1.00 34.76 ? 114 MET B C   1 
ATOM   1970 O  O   . MET B 2 114 ? 24.753  2.568   -2.364  1.00 33.74 ? 114 MET B O   1 
ATOM   1971 C  CB  . MET B 2 114 ? 27.000  4.907   -1.690  1.00 38.76 ? 114 MET B CB  1 
ATOM   1972 C  CG  . MET B 2 114 ? 27.649  5.772   -0.634  1.00 41.64 ? 114 MET B CG  1 
ATOM   1973 S  SD  . MET B 2 114 ? 29.073  6.624   -1.273  1.00 48.62 ? 114 MET B SD  1 
ATOM   1974 C  CE  . MET B 2 114 ? 30.304  5.293   -1.282  1.00 46.94 ? 114 MET B CE  1 
ATOM   1975 N  N   . ALA B 2 115 ? 24.729  4.401   -3.681  1.00 34.05 ? 115 ALA B N   1 
ATOM   1976 C  CA  . ALA B 2 115 ? 24.199  3.720   -4.856  1.00 31.86 ? 115 ALA B CA  1 
ATOM   1977 C  C   . ALA B 2 115 ? 24.301  4.610   -6.092  1.00 32.59 ? 115 ALA B C   1 
ATOM   1978 O  O   . ALA B 2 115 ? 24.516  5.820   -5.985  1.00 31.71 ? 115 ALA B O   1 
ATOM   1979 C  CB  . ALA B 2 115 ? 22.744  3.338   -4.624  1.00 28.86 ? 115 ALA B CB  1 
ATOM   1980 N  N   . GLN B 2 116 ? 24.170  4.001   -7.267  1.00 32.20 ? 116 GLN B N   1 
ATOM   1981 C  CA  . GLN B 2 116 ? 24.194  4.763   -8.502  1.00 32.29 ? 116 GLN B CA  1 
ATOM   1982 C  C   . GLN B 2 116 ? 22.789  5.356   -8.563  1.00 31.14 ? 116 GLN B C   1 
ATOM   1983 O  O   . GLN B 2 116 ? 21.989  5.133   -7.659  1.00 29.19 ? 116 GLN B O   1 
ATOM   1984 C  CB  . GLN B 2 116 ? 24.443  3.850   -9.702  1.00 31.95 ? 116 GLN B CB  1 
ATOM   1985 C  CG  . GLN B 2 116 ? 25.757  3.072   -9.629  1.00 37.69 ? 116 GLN B CG  1 
ATOM   1986 C  CD  . GLN B 2 116 ? 26.182  2.487   -10.976 1.00 39.17 ? 116 GLN B CD  1 
ATOM   1987 O  OE1 . GLN B 2 116 ? 27.123  1.699   -11.058 1.00 38.14 ? 116 GLN B OE1 1 
ATOM   1988 N  NE2 . GLN B 2 116 ? 25.493  2.888   -12.039 1.00 42.69 ? 116 GLN B NE2 1 
ATOM   1989 N  N   . PHE B 2 117 ? 22.471  6.100   -9.609  1.00 29.88 ? 117 PHE B N   1 
ATOM   1990 C  CA  . PHE B 2 117 ? 21.146  6.692   -9.675  1.00 30.92 ? 117 PHE B CA  1 
ATOM   1991 C  C   . PHE B 2 117 ? 20.793  7.247   -11.048 1.00 31.51 ? 117 PHE B C   1 
ATOM   1992 O  O   . PHE B 2 117 ? 21.658  7.404   -11.914 1.00 32.66 ? 117 PHE B O   1 
ATOM   1993 C  CB  . PHE B 2 117 ? 21.022  7.812   -8.629  1.00 29.09 ? 117 PHE B CB  1 
ATOM   1994 C  CG  . PHE B 2 117 ? 22.055  8.891   -8.779  1.00 30.81 ? 117 PHE B CG  1 
ATOM   1995 C  CD1 . PHE B 2 117 ? 23.357  8.695   -8.330  1.00 30.57 ? 117 PHE B CD1 1 
ATOM   1996 C  CD2 . PHE B 2 117 ? 21.742  10.088  -9.418  1.00 31.70 ? 117 PHE B CD2 1 
ATOM   1997 C  CE1 . PHE B 2 117 ? 24.333  9.673   -8.519  1.00 31.51 ? 117 PHE B CE1 1 
ATOM   1998 C  CE2 . PHE B 2 117 ? 22.711  11.074  -9.613  1.00 29.22 ? 117 PHE B CE2 1 
ATOM   1999 C  CZ  . PHE B 2 117 ? 24.006  10.866  -9.165  1.00 31.30 ? 117 PHE B CZ  1 
ATOM   2000 N  N   . VAL B 2 118 ? 19.506  7.543   -11.228 1.00 30.55 ? 118 VAL B N   1 
ATOM   2001 C  CA  . VAL B 2 118 ? 18.991  8.103   -12.472 1.00 29.86 ? 118 VAL B CA  1 
ATOM   2002 C  C   . VAL B 2 118 ? 18.350  9.460   -12.171 1.00 28.45 ? 118 VAL B C   1 
ATOM   2003 O  O   . VAL B 2 118 ? 17.613  9.595   -11.196 1.00 29.77 ? 118 VAL B O   1 
ATOM   2004 C  CB  . VAL B 2 118 ? 17.927  7.163   -13.109 1.00 28.97 ? 118 VAL B CB  1 
ATOM   2005 C  CG1 . VAL B 2 118 ? 17.361  7.792   -14.372 1.00 27.19 ? 118 VAL B CG1 1 
ATOM   2006 C  CG2 . VAL B 2 118 ? 18.552  5.803   -13.426 1.00 26.67 ? 118 VAL B CG2 1 
ATOM   2007 N  N   . CYS B 2 119 ? 18.653  10.467  -12.986 1.00 28.11 ? 119 CYS B N   1 
ATOM   2008 C  CA  . CYS B 2 119 ? 18.077  11.795  -12.794 1.00 27.09 ? 119 CYS B CA  1 
ATOM   2009 C  C   . CYS B 2 119 ? 17.007  12.010  -13.858 1.00 27.71 ? 119 CYS B C   1 
ATOM   2010 O  O   . CYS B 2 119 ? 16.994  11.317  -14.880 1.00 24.53 ? 119 CYS B O   1 
ATOM   2011 C  CB  . CYS B 2 119 ? 19.133  12.890  -12.918 1.00 28.87 ? 119 CYS B CB  1 
ATOM   2012 S  SG  . CYS B 2 119 ? 20.460  12.933  -11.671 1.00 27.53 ? 119 CYS B SG  1 
ATOM   2013 N  N   . GLU B 2 120 ? 16.127  12.983  -13.628 1.00 27.13 ? 120 GLU B N   1 
ATOM   2014 C  CA  . GLU B 2 120 ? 15.029  13.243  -14.550 1.00 28.42 ? 120 GLU B CA  1 
ATOM   2015 C  C   . GLU B 2 120 ? 14.507  14.674  -14.548 1.00 29.93 ? 120 GLU B C   1 
ATOM   2016 O  O   . GLU B 2 120 ? 14.529  15.349  -13.519 1.00 30.80 ? 120 GLU B O   1 
ATOM   2017 C  CB  . GLU B 2 120 ? 13.868  12.303  -14.205 1.00 27.03 ? 120 GLU B CB  1 
ATOM   2018 C  CG  . GLU B 2 120 ? 12.563  12.584  -14.940 1.00 28.16 ? 120 GLU B CG  1 
ATOM   2019 C  CD  . GLU B 2 120 ? 11.377  11.819  -14.354 1.00 29.58 ? 120 GLU B CD  1 
ATOM   2020 O  OE1 . GLU B 2 120 ? 10.251  11.952  -14.888 1.00 28.89 ? 120 GLU B OE1 1 
ATOM   2021 O  OE2 . GLU B 2 120 ? 11.570  11.084  -13.361 1.00 26.75 ? 120 GLU B OE2 1 
ATOM   2022 N  N   . PHE B 2 121 ? 14.044  15.134  -15.708 1.00 31.80 ? 121 PHE B N   1 
ATOM   2023 C  CA  . PHE B 2 121 ? 13.441  16.460  -15.810 1.00 36.28 ? 121 PHE B CA  1 
ATOM   2024 C  C   . PHE B 2 121 ? 12.361  16.457  -16.893 1.00 38.63 ? 121 PHE B C   1 
ATOM   2025 O  O   . PHE B 2 121 ? 12.412  15.665  -17.838 1.00 38.24 ? 121 PHE B O   1 
ATOM   2026 C  CB  . PHE B 2 121 ? 14.497  17.562  -16.039 1.00 34.31 ? 121 PHE B CB  1 
ATOM   2027 C  CG  . PHE B 2 121 ? 15.125  17.566  -17.403 1.00 34.72 ? 121 PHE B CG  1 
ATOM   2028 C  CD1 . PHE B 2 121 ? 14.475  18.154  -18.485 1.00 33.82 ? 121 PHE B CD1 1 
ATOM   2029 C  CD2 . PHE B 2 121 ? 16.404  17.045  -17.592 1.00 33.33 ? 121 PHE B CD2 1 
ATOM   2030 C  CE1 . PHE B 2 121 ? 15.091  18.230  -19.736 1.00 33.63 ? 121 PHE B CE1 1 
ATOM   2031 C  CE2 . PHE B 2 121 ? 17.026  17.116  -18.836 1.00 34.49 ? 121 PHE B CE2 1 
ATOM   2032 C  CZ  . PHE B 2 121 ? 16.367  17.714  -19.912 1.00 33.70 ? 121 PHE B CZ  1 
ATOM   2033 N  N   . GLN B 2 122 ? 11.372  17.332  -16.724 1.00 42.06 ? 122 GLN B N   1 
ATOM   2034 C  CA  . GLN B 2 122 ? 10.227  17.435  -17.631 1.00 45.86 ? 122 GLN B CA  1 
ATOM   2035 C  C   . GLN B 2 122 ? 10.421  18.238  -18.917 1.00 47.72 ? 122 GLN B C   1 
ATOM   2036 O  O   . GLN B 2 122 ? 11.340  19.048  -19.032 1.00 47.05 ? 122 GLN B O   1 
ATOM   2037 C  CB  . GLN B 2 122 ? 9.036   18.015  -16.861 1.00 46.58 ? 122 GLN B CB  1 
ATOM   2038 C  CG  . GLN B 2 122 ? 7.807   18.298  -17.705 1.00 51.22 ? 122 GLN B CG  1 
ATOM   2039 C  CD  . GLN B 2 122 ? 6.744   19.059  -16.939 1.00 52.34 ? 122 GLN B CD  1 
ATOM   2040 O  OE1 . GLN B 2 122 ? 6.127   18.528  -16.015 1.00 54.86 ? 122 GLN B OE1 1 
ATOM   2041 N  NE2 . GLN B 2 122 ? 6.528   20.315  -17.318 1.00 53.76 ? 122 GLN B NE2 1 
ATOM   2042 N  N   . ALA B 2 123 ? 9.518   18.001  -19.869 1.00 51.05 ? 123 ALA B N   1 
ATOM   2043 C  CA  . ALA B 2 123 ? 9.500   18.675  -21.169 1.00 52.74 ? 123 ALA B CA  1 
ATOM   2044 C  C   . ALA B 2 123 ? 10.889  18.963  -21.712 1.00 53.61 ? 123 ALA B C   1 
ATOM   2045 O  O   . ALA B 2 123 ? 11.221  20.152  -21.926 1.00 53.98 ? 123 ALA B O   1 
ATOM   2046 C  CB  . ALA B 2 123 ? 8.691   19.976  -21.074 1.00 52.53 ? 123 ALA B CB  1 
ATOM   2047 O  OXT . ALA B 2 123 ? 11.647  17.988  -21.916 1.00 53.98 ? 123 ALA B OXT 1 
HETATM 2048 CL CL  . CL  C 3 .   ? 1.145   2.794   10.655  1.00 40.25 ? 401 CL  A CL  1 
HETATM 2049 RB RB  . RB  D 4 .   ? 0.000   0.000   0.000   0.50 53.49 ? 402 RB  A RB  1 
HETATM 2050 RB RB  . RB  E 4 .   ? 11.579  -17.460 37.909  0.70 48.30 ? 403 RB  A RB  1 
HETATM 2051 S  S   . SO4 F 5 .   ? 1.184   -7.101  8.769   1.00 52.13 ? 404 SO4 A S   1 
HETATM 2052 O  O1  . SO4 F 5 .   ? 2.238   -7.797  9.538   1.00 49.72 ? 404 SO4 A O1  1 
HETATM 2053 O  O2  . SO4 F 5 .   ? 1.413   -5.640  8.800   1.00 51.81 ? 404 SO4 A O2  1 
HETATM 2054 O  O3  . SO4 F 5 .   ? 1.201   -7.563  7.364   1.00 51.54 ? 404 SO4 A O3  1 
HETATM 2055 O  O4  . SO4 F 5 .   ? -0.128  -7.397  9.376   1.00 52.08 ? 404 SO4 A O4  1 
HETATM 2056 O  O   . HOH G 6 .   ? 9.333   -3.226  28.858  1.00 23.70 ? 405 HOH A O   1 
HETATM 2057 O  O   . HOH G 6 .   ? 3.938   -8.871  6.367   1.00 40.95 ? 406 HOH A O   1 
HETATM 2058 O  O   . HOH G 6 .   ? 13.770  -16.525 10.090  1.00 16.76 ? 407 HOH A O   1 
HETATM 2059 O  O   . HOH G 6 .   ? 16.750  0.014   11.749  1.00 11.05 ? 408 HOH A O   1 
HETATM 2060 O  O   . HOH G 6 .   ? 16.549  -7.867  6.198   1.00 32.94 ? 409 HOH A O   1 
HETATM 2061 O  O   . HOH G 6 .   ? 3.218   -2.356  7.551   1.00 21.54 ? 410 HOH A O   1 
HETATM 2062 O  O   . HOH G 6 .   ? 3.975   7.052   -7.990  1.00 20.19 ? 411 HOH A O   1 
HETATM 2063 O  O   . HOH G 6 .   ? 20.854  -6.251  17.238  1.00 27.01 ? 412 HOH A O   1 
HETATM 2064 O  O   . HOH G 6 .   ? -1.783  -8.042  20.463  1.00 31.19 ? 413 HOH A O   1 
HETATM 2065 O  O   . HOH G 6 .   ? 0.923   -14.371 10.606  1.00 30.80 ? 414 HOH A O   1 
HETATM 2066 O  O   . HOH G 6 .   ? 18.516  4.034   29.102  1.00 32.74 ? 415 HOH A O   1 
HETATM 2067 O  O   . HOH G 6 .   ? 7.060   -5.796  6.901   1.00 25.50 ? 416 HOH A O   1 
HETATM 2068 O  O   . HOH G 6 .   ? 18.358  -5.247  23.331  1.00 22.89 ? 417 HOH A O   1 
HETATM 2069 O  O   . HOH G 6 .   ? 20.219  -1.402  22.729  1.00 21.98 ? 418 HOH A O   1 
HETATM 2070 O  O   . HOH G 6 .   ? 11.745  13.407  -11.548 1.00 14.22 ? 419 HOH A O   1 
HETATM 2071 O  O   . HOH G 6 .   ? 2.520   -17.724 32.399  1.00 33.85 ? 420 HOH A O   1 
HETATM 2072 O  O   . HOH G 6 .   ? 3.180   -10.706 4.309   1.00 31.66 ? 421 HOH A O   1 
HETATM 2073 O  O   . HOH G 6 .   ? 12.014  -20.372 30.282  1.00 26.14 ? 422 HOH A O   1 
HETATM 2074 O  O   . HOH G 6 .   ? 4.894   -19.664 28.355  1.00 25.65 ? 423 HOH A O   1 
HETATM 2075 O  O   . HOH G 6 .   ? 0.666   -21.175 24.032  1.00 24.64 ? 424 HOH A O   1 
HETATM 2076 O  O   . HOH G 6 .   ? 17.264  -5.683  6.940   1.00 27.05 ? 425 HOH A O   1 
HETATM 2077 O  O   . HOH G 6 .   ? 17.128  -9.142  37.012  1.00 43.49 ? 426 HOH A O   1 
HETATM 2078 O  O   . HOH G 6 .   ? 3.417   -4.410  -3.181  1.00 31.70 ? 427 HOH A O   1 
HETATM 2079 O  O   . HOH G 6 .   ? 14.308  -17.929 35.164  1.00 25.52 ? 428 HOH A O   1 
HETATM 2080 O  O   . HOH G 6 .   ? 8.494   -10.945 -0.756  1.00 25.75 ? 429 HOH A O   1 
HETATM 2081 O  O   . HOH G 6 .   ? 4.558   -14.931 6.059   1.00 32.99 ? 430 HOH A O   1 
HETATM 2082 O  O   . HOH G 6 .   ? 8.020   -23.748 27.174  1.00 33.12 ? 431 HOH A O   1 
HETATM 2083 O  O   . HOH G 6 .   ? 13.412  -16.916 31.064  1.00 28.18 ? 432 HOH A O   1 
HETATM 2084 O  O   . HOH G 6 .   ? -0.470  5.096   -3.739  1.00 19.81 ? 433 HOH A O   1 
HETATM 2085 O  O   . HOH G 6 .   ? 18.587  -22.447 26.466  1.00 45.73 ? 434 HOH A O   1 
HETATM 2086 O  O   . HOH G 6 .   ? 5.618   -22.269 8.456   1.00 49.52 ? 435 HOH A O   1 
HETATM 2087 O  O   . HOH G 6 .   ? 15.708  -5.754  38.253  1.00 38.40 ? 436 HOH A O   1 
HETATM 2088 O  O   . HOH G 6 .   ? 12.979  -20.018 36.965  1.00 20.29 ? 437 HOH A O   1 
HETATM 2089 O  O   . HOH G 6 .   ? 16.412  -7.149  1.091   1.00 31.73 ? 438 HOH A O   1 
HETATM 2090 O  O   . HOH G 6 .   ? 12.442  3.629   9.233   1.00 20.81 ? 439 HOH A O   1 
HETATM 2091 O  O   . HOH G 6 .   ? 1.212   15.167  -8.600  1.00 23.63 ? 440 HOH A O   1 
HETATM 2092 O  O   . HOH G 6 .   ? 24.653  -5.701  26.060  1.00 29.45 ? 441 HOH A O   1 
HETATM 2093 O  O   . HOH G 6 .   ? 24.537  -9.715  25.754  1.00 34.59 ? 442 HOH A O   1 
HETATM 2094 O  O   . HOH G 6 .   ? 4.565   -2.417  -12.406 1.00 21.08 ? 443 HOH A O   1 
HETATM 2095 O  O   . HOH G 6 .   ? 25.430  -3.244  19.017  1.00 26.74 ? 444 HOH A O   1 
HETATM 2096 O  O   . HOH G 6 .   ? 1.660   -6.391  -2.665  1.00 35.95 ? 445 HOH A O   1 
HETATM 2097 O  O   . HOH G 6 .   ? 5.432   -6.237  3.305   1.00 31.00 ? 446 HOH A O   1 
HETATM 2098 O  O   . HOH G 6 .   ? 17.029  -10.200 6.514   1.00 33.79 ? 447 HOH A O   1 
HETATM 2099 O  O   . HOH G 6 .   ? 9.291   4.069   27.360  1.00 37.97 ? 448 HOH A O   1 
HETATM 2100 O  O   . HOH G 6 .   ? 18.050  -2.821  22.297  1.00 25.97 ? 449 HOH A O   1 
HETATM 2101 O  O   . HOH G 6 .   ? 4.599   -3.732  4.864   1.00 21.88 ? 450 HOH A O   1 
HETATM 2102 O  O   . HOH G 6 .   ? -1.927  -8.871  26.093  1.00 32.70 ? 451 HOH A O   1 
HETATM 2103 O  O   . HOH G 6 .   ? 0.246   -17.564 17.260  1.00 25.80 ? 452 HOH A O   1 
HETATM 2104 O  O   . HOH G 6 .   ? 0.460   -4.446  13.982  1.00 36.27 ? 453 HOH A O   1 
HETATM 2105 O  O   . HOH G 6 .   ? -0.987  -10.244 16.579  1.00 35.16 ? 454 HOH A O   1 
HETATM 2106 O  O   . HOH G 6 .   ? -0.255  -3.263  1.822   1.00 27.77 ? 455 HOH A O   1 
HETATM 2107 O  O   . HOH G 6 .   ? -0.700  -4.636  10.550  1.00 37.10 ? 456 HOH A O   1 
HETATM 2108 O  O   . HOH G 6 .   ? -0.023  -14.264 33.730  1.00 30.96 ? 457 HOH A O   1 
HETATM 2109 O  O   . HOH G 6 .   ? 18.818  -24.518 17.164  1.00 49.88 ? 458 HOH A O   1 
HETATM 2110 O  O   . HOH G 6 .   ? -1.928  -13.982 14.655  1.00 27.90 ? 459 HOH A O   1 
HETATM 2111 O  O   . HOH G 6 .   ? -3.452  -7.337  27.401  1.00 28.14 ? 460 HOH A O   1 
HETATM 2112 O  O   . HOH G 6 .   ? 12.090  -6.809  39.917  1.00 30.68 ? 461 HOH A O   1 
HETATM 2113 O  O   . HOH G 6 .   ? 3.412   -1.818  -3.862  1.00 29.79 ? 462 HOH A O   1 
HETATM 2114 O  O   . HOH G 6 .   ? 13.463  -9.440  3.416   1.00 24.36 ? 463 HOH A O   1 
HETATM 2115 O  O   . HOH G 6 .   ? 7.717   -21.147 31.562  1.00 21.47 ? 464 HOH A O   1 
HETATM 2116 O  O   . HOH G 6 .   ? 7.624   12.084  0.906   1.00 28.17 ? 465 HOH A O   1 
HETATM 2117 O  O   . HOH G 6 .   ? 9.579   -0.898  35.285  1.00 36.61 ? 466 HOH A O   1 
HETATM 2118 O  O   . HOH G 6 .   ? 11.561  -20.899 26.196  1.00 36.07 ? 467 HOH A O   1 
HETATM 2119 O  O   . HOH G 6 .   ? 23.971  -8.715  31.464  1.00 39.06 ? 468 HOH A O   1 
HETATM 2120 O  O   . HOH G 6 .   ? 14.188  -9.365  -1.974  1.00 38.76 ? 469 HOH A O   1 
HETATM 2121 O  O   . HOH G 6 .   ? 16.539  -6.552  -3.059  1.00 45.21 ? 470 HOH A O   1 
HETATM 2122 O  O   . HOH G 6 .   ? 21.260  -7.586  9.109   1.00 38.06 ? 471 HOH A O   1 
HETATM 2123 O  O   . HOH G 6 .   ? 23.755  -18.349 17.248  1.00 46.56 ? 472 HOH A O   1 
HETATM 2124 O  O   . HOH G 6 .   ? 1.944   17.690  -8.996  1.00 39.60 ? 473 HOH A O   1 
HETATM 2125 O  O   . HOH G 6 .   ? 18.937  -1.444  36.177  1.00 37.86 ? 474 HOH A O   1 
HETATM 2126 O  O   . HOH G 6 .   ? -2.993  -11.379 28.047  1.00 36.73 ? 475 HOH A O   1 
HETATM 2127 O  O   . HOH G 6 .   ? 19.678  6.036   26.362  1.00 49.10 ? 476 HOH A O   1 
HETATM 2128 O  O   . HOH G 6 .   ? 9.776   10.593  -0.931  1.00 24.45 ? 477 HOH A O   1 
HETATM 2129 O  O   . HOH G 6 .   ? 1.650   16.406  -6.191  1.00 31.52 ? 478 HOH A O   1 
HETATM 2130 O  O   . HOH G 6 .   ? 3.104   -5.266  6.696   1.00 32.73 ? 479 HOH A O   1 
HETATM 2131 O  O   . HOH G 6 .   ? 14.687  -14.289 37.553  1.00 34.95 ? 480 HOH A O   1 
HETATM 2132 O  O   . HOH G 6 .   ? -1.086  -18.140 20.180  1.00 36.41 ? 481 HOH A O   1 
HETATM 2133 O  O   . HOH G 6 .   ? 22.588  -3.454  11.781  1.00 21.76 ? 482 HOH A O   1 
HETATM 2134 O  O   . HOH G 6 .   ? 21.432  -12.834 14.242  1.00 36.37 ? 483 HOH A O   1 
HETATM 2135 O  O   . HOH G 6 .   ? 12.542  -11.566 4.403   1.00 30.71 ? 484 HOH A O   1 
HETATM 2136 O  O   . HOH G 6 .   ? -3.342  -14.555 28.458  1.00 26.91 ? 485 HOH A O   1 
HETATM 2137 O  O   . HOH G 6 .   ? 9.984   19.324  -5.793  1.00 34.80 ? 486 HOH A O   1 
HETATM 2138 O  O   . HOH G 6 .   ? -2.335  -10.252 18.937  1.00 37.02 ? 487 HOH A O   1 
HETATM 2139 O  O   . HOH G 6 .   ? 21.520  3.249   18.335  1.00 37.27 ? 488 HOH A O   1 
HETATM 2140 O  O   . HOH G 6 .   ? 3.238   -10.374 10.694  1.00 25.56 ? 489 HOH A O   1 
HETATM 2141 O  O   . HOH G 6 .   ? 6.445   -7.840  -6.397  1.00 47.73 ? 490 HOH A O   1 
HETATM 2142 O  O   . HOH G 6 .   ? 11.382  -4.003  33.144  1.00 30.34 ? 491 HOH A O   1 
HETATM 2143 O  O   . HOH G 6 .   ? 14.898  2.925   9.418   1.00 33.93 ? 492 HOH A O   1 
HETATM 2144 O  O   . HOH G 6 .   ? -4.506  -15.440 13.508  1.00 39.90 ? 493 HOH A O   1 
HETATM 2145 O  O   . HOH G 6 .   ? -5.035  -10.163 29.222  1.00 45.89 ? 494 HOH A O   1 
HETATM 2146 O  O   . HOH G 6 .   ? 6.797   -10.271 -3.517  1.00 47.70 ? 495 HOH A O   1 
HETATM 2147 O  O   . HOH G 6 .   ? 9.053   18.883  -2.896  1.00 39.00 ? 496 HOH A O   1 
HETATM 2148 O  O   . HOH G 6 .   ? -0.935  -6.353  12.751  1.00 43.84 ? 497 HOH A O   1 
HETATM 2149 O  O   . HOH G 6 .   ? 8.600   -23.436 15.452  1.00 29.31 ? 498 HOH A O   1 
HETATM 2150 O  O   . HOH G 6 .   ? 18.772  -21.863 21.861  1.00 28.05 ? 499 HOH A O   1 
HETATM 2151 O  O   . HOH G 6 .   ? 3.897   -12.171 35.002  1.00 28.25 ? 500 HOH A O   1 
HETATM 2152 O  O   . HOH G 6 .   ? 6.837   -6.165  -10.748 1.00 32.64 ? 501 HOH A O   1 
HETATM 2153 O  O   . HOH G 6 .   ? 1.310   -5.678  4.786   1.00 48.03 ? 502 HOH A O   1 
HETATM 2154 O  O   . HOH G 6 .   ? 4.697   -14.410 33.625  1.00 32.66 ? 503 HOH A O   1 
HETATM 2155 O  O   . HOH G 6 .   ? 22.307  -10.125 10.334  1.00 26.95 ? 504 HOH A O   1 
HETATM 2156 O  O   . HOH G 6 .   ? 20.346  -21.761 24.184  1.00 28.72 ? 505 HOH A O   1 
HETATM 2157 O  O   . HOH G 6 .   ? 11.681  -16.443 7.851   1.00 38.07 ? 506 HOH A O   1 
HETATM 2158 O  O   . HOH G 6 .   ? 20.178  -5.118  8.073   1.00 27.35 ? 507 HOH A O   1 
HETATM 2159 O  O   . HOH G 6 .   ? 19.399  -7.310  37.252  1.00 38.32 ? 508 HOH A O   1 
HETATM 2160 O  O   . HOH G 6 .   ? 26.014  -11.227 22.339  1.00 33.87 ? 509 HOH A O   1 
HETATM 2161 O  O   . HOH G 6 .   ? 6.153   -22.036 15.420  1.00 34.24 ? 510 HOH A O   1 
HETATM 2162 O  O   . HOH G 6 .   ? -5.028  -18.915 20.288  1.00 30.32 ? 511 HOH A O   1 
HETATM 2163 O  O   . HOH G 6 .   ? 21.345  -7.297  33.353  1.00 43.99 ? 512 HOH A O   1 
HETATM 2164 O  O   . HOH G 6 .   ? 6.210   -12.646 1.370   1.00 46.45 ? 513 HOH A O   1 
HETATM 2165 O  O   . HOH G 6 .   ? 28.821  -5.356  13.519  1.00 39.16 ? 514 HOH A O   1 
HETATM 2166 O  O   . HOH G 6 .   ? 19.993  -12.927 11.165  1.00 41.16 ? 515 HOH A O   1 
HETATM 2167 O  O   . HOH G 6 .   ? 11.874  -21.897 23.601  1.00 35.62 ? 516 HOH A O   1 
HETATM 2168 O  O   . HOH G 6 .   ? 16.167  -23.025 23.479  1.00 39.65 ? 517 HOH A O   1 
HETATM 2169 O  O   . HOH G 6 .   ? 19.944  -7.225  40.500  1.00 38.70 ? 518 HOH A O   1 
HETATM 2170 O  O   . HOH G 6 .   ? 19.961  -10.978 7.946   1.00 47.38 ? 519 HOH A O   1 
HETATM 2171 O  O   . HOH G 6 .   ? 12.309  -0.546  30.699  1.00 34.13 ? 520 HOH A O   1 
HETATM 2172 O  O   . HOH G 6 .   ? 23.065  -18.161 14.652  1.00 40.63 ? 521 HOH A O   1 
HETATM 2173 O  O   . HOH G 6 .   ? 28.497  -11.360 13.192  1.00 41.40 ? 522 HOH A O   1 
HETATM 2174 O  O   . HOH G 6 .   ? -0.493  20.946  -4.438  1.00 42.76 ? 523 HOH A O   1 
HETATM 2175 O  O   . HOH G 6 .   ? 4.702   -6.561  27.611  1.00 26.25 ? 524 HOH A O   1 
HETATM 2176 O  O   . HOH G 6 .   ? 19.012  -6.826  0.712   1.00 41.71 ? 525 HOH A O   1 
HETATM 2177 O  O   . HOH G 6 .   ? 21.885  -26.572 18.722  1.00 30.97 ? 526 HOH A O   1 
HETATM 2178 O  O   . HOH G 6 .   ? 22.410  -16.374 19.851  1.00 34.25 ? 527 HOH A O   1 
HETATM 2179 O  O   . HOH G 6 .   ? 29.354  -17.768 18.528  1.00 47.29 ? 528 HOH A O   1 
HETATM 2180 O  O   . HOH G 6 .   ? 24.498  -15.920 21.490  1.00 28.44 ? 529 HOH A O   1 
HETATM 2181 O  O   . HOH G 6 .   ? 9.244   -23.366 31.000  1.00 38.87 ? 530 HOH A O   1 
HETATM 2182 O  O   . HOH G 6 .   ? 3.058   -3.865  -10.575 1.00 21.41 ? 531 HOH A O   1 
HETATM 2183 O  O   . HOH G 6 .   ? 6.980   -16.382 6.326   1.00 31.88 ? 532 HOH A O   1 
HETATM 2184 O  O   . HOH G 6 .   ? 15.984  -24.059 15.417  1.00 47.59 ? 533 HOH A O   1 
HETATM 2185 O  O   . HOH G 6 .   ? 12.540  21.135  -5.300  1.00 45.11 ? 534 HOH A O   1 
HETATM 2186 O  O   . HOH G 6 .   ? 1.737   -19.837 15.717  1.00 42.01 ? 535 HOH A O   1 
HETATM 2187 O  O   . HOH G 6 .   ? -6.760  -14.261 27.856  1.00 46.75 ? 536 HOH A O   1 
HETATM 2188 O  O   . HOH G 6 .   ? 18.579  -13.882 32.654  1.00 34.15 ? 537 HOH A O   1 
HETATM 2189 O  O   . HOH G 6 .   ? -2.165  11.113  -9.230  1.00 39.74 ? 538 HOH A O   1 
HETATM 2190 O  O   . HOH G 6 .   ? 19.855  -10.947 39.619  1.00 45.54 ? 539 HOH A O   1 
HETATM 2191 O  O   . HOH G 6 .   ? 13.062  -14.763 39.280  1.00 34.97 ? 540 HOH A O   1 
HETATM 2192 O  O   . HOH G 6 .   ? 13.462  -8.061  5.858   1.00 18.12 ? 541 HOH A O   1 
HETATM 2193 O  O   . HOH G 6 .   ? 2.842   -12.242 1.016   1.00 46.22 ? 542 HOH A O   1 
HETATM 2194 O  O   . HOH G 6 .   ? -0.775  7.306   -1.668  1.00 39.98 ? 543 HOH A O   1 
HETATM 2195 O  O   . HOH G 6 .   ? 17.023  -11.131 39.384  1.00 40.30 ? 544 HOH A O   1 
HETATM 2196 O  O   . HOH G 6 .   ? 20.701  -4.769  32.591  1.00 35.86 ? 545 HOH A O   1 
HETATM 2197 O  O   . HOH G 6 .   ? 24.475  -10.432 5.152   1.00 41.36 ? 546 HOH A O   1 
HETATM 2198 O  O   . HOH G 6 .   ? 25.987  5.219   15.183  1.00 50.72 ? 547 HOH A O   1 
HETATM 2199 O  O   . HOH G 6 .   ? -5.502  -12.310 26.722  1.00 50.85 ? 548 HOH A O   1 
HETATM 2200 O  O   . HOH G 6 .   ? 7.130   -8.556  42.287  1.00 49.55 ? 549 HOH A O   1 
HETATM 2201 O  O   . HOH G 6 .   ? -4.870  -13.711 30.509  1.00 48.86 ? 550 HOH A O   1 
HETATM 2202 O  O   . HOH G 6 .   ? 14.587  -20.753 27.956  1.00 43.58 ? 551 HOH A O   1 
HETATM 2203 O  O   . HOH G 6 .   ? 24.246  -23.769 13.646  1.00 35.96 ? 552 HOH A O   1 
HETATM 2204 O  O   . HOH G 6 .   ? 6.054   19.875  -2.733  1.00 39.99 ? 553 HOH A O   1 
HETATM 2205 O  O   . HOH G 6 .   ? 23.806  -11.667 12.297  1.00 44.14 ? 554 HOH A O   1 
HETATM 2206 O  O   . HOH G 6 .   ? 25.321  -7.675  23.795  1.00 32.10 ? 555 HOH A O   1 
HETATM 2207 O  O   . HOH G 6 .   ? 7.544   -5.902  -7.645  1.00 43.49 ? 556 HOH A O   1 
HETATM 2208 O  O   . HOH G 6 .   ? 15.195  -18.499 29.700  1.00 45.65 ? 557 HOH A O   1 
HETATM 2209 O  O   . HOH G 6 .   ? 9.024   -24.206 33.432  1.00 35.79 ? 558 HOH A O   1 
HETATM 2210 O  O   . HOH G 6 .   ? 8.981   -5.475  15.496  1.00 34.08 ? 559 HOH A O   1 
HETATM 2211 O  O   . HOH G 6 .   ? 17.918  -2.286  38.985  1.00 47.83 ? 560 HOH A O   1 
HETATM 2212 O  O   . HOH G 6 .   ? -4.213  -6.612  30.154  1.00 50.03 ? 561 HOH A O   1 
HETATM 2213 O  O   . HOH G 6 .   ? 0.007   18.849  0.000   0.50 35.19 ? 562 HOH A O   1 
HETATM 2214 O  O   . HOH G 6 .   ? 19.456  -7.494  4.283   1.00 53.18 ? 563 HOH A O   1 
HETATM 2215 O  O   . HOH G 6 .   ? 2.008   0.366   -2.303  1.00 50.39 ? 564 HOH A O   1 
HETATM 2216 O  O   . HOH G 6 .   ? 28.346  -5.980  19.620  1.00 48.16 ? 565 HOH A O   1 
HETATM 2217 O  O   . HOH G 6 .   ? -11.027 -10.996 31.780  1.00 46.83 ? 566 HOH A O   1 
HETATM 2218 O  O   . HOH G 6 .   ? 20.372  -17.584 16.952  1.00 53.11 ? 567 HOH A O   1 
HETATM 2219 O  O   . HOH G 6 .   ? 26.371  2.629   17.064  1.00 51.68 ? 568 HOH A O   1 
HETATM 2220 O  O   . HOH G 6 .   ? 25.511  2.724   13.691  1.00 51.60 ? 569 HOH A O   1 
HETATM 2221 O  O   . HOH H 6 .   ? 8.503   10.506  -13.706 1.00 15.38 ? 124 HOH B O   1 
HETATM 2222 O  O   . HOH H 6 .   ? 11.345  -3.289  -15.816 1.00 30.21 ? 125 HOH B O   1 
HETATM 2223 O  O   . HOH H 6 .   ? 21.309  8.980   -20.824 1.00 21.09 ? 126 HOH B O   1 
HETATM 2224 O  O   . HOH H 6 .   ? 21.192  3.558   21.501  1.00 29.57 ? 127 HOH B O   1 
HETATM 2225 O  O   . HOH H 6 .   ? 29.108  10.357  -11.981 1.00 21.08 ? 128 HOH B O   1 
HETATM 2226 O  O   . HOH H 6 .   ? 18.238  5.430   17.826  1.00 26.93 ? 129 HOH B O   1 
HETATM 2227 O  O   . HOH H 6 .   ? 11.549  4.238   26.240  1.00 19.66 ? 130 HOH B O   1 
HETATM 2228 O  O   . HOH H 6 .   ? 12.365  5.052   6.850   1.00 24.45 ? 131 HOH B O   1 
HETATM 2229 O  O   . HOH H 6 .   ? 21.399  -8.521  -11.291 1.00 41.36 ? 132 HOH B O   1 
HETATM 2230 O  O   . HOH H 6 .   ? 18.113  -1.510  10.172  1.00 20.41 ? 133 HOH B O   1 
HETATM 2231 O  O   . HOH H 6 .   ? 12.186  16.118  -12.440 1.00 21.01 ? 134 HOH B O   1 
HETATM 2232 O  O   . HOH H 6 .   ? 14.481  -3.523  -8.883  1.00 28.91 ? 135 HOH B O   1 
HETATM 2233 O  O   . HOH H 6 .   ? 15.415  -10.511 -7.775  1.00 26.98 ? 136 HOH B O   1 
HETATM 2234 O  O   . HOH H 6 .   ? 11.507  12.398  -7.856  1.00 20.52 ? 137 HOH B O   1 
HETATM 2235 O  O   . HOH H 6 .   ? 19.337  12.484  -26.660 1.00 27.18 ? 138 HOH B O   1 
HETATM 2236 O  O   . HOH H 6 .   ? 15.541  20.785  -9.317  1.00 29.08 ? 139 HOH B O   1 
HETATM 2237 O  O   . HOH H 6 .   ? 24.655  13.612  2.849   1.00 30.11 ? 140 HOH B O   1 
HETATM 2238 O  O   . HOH H 6 .   ? 11.491  5.105   11.214  1.00 29.03 ? 141 HOH B O   1 
HETATM 2239 O  O   . HOH H 6 .   ? 20.964  5.358   8.918   1.00 22.48 ? 142 HOH B O   1 
HETATM 2240 O  O   . HOH H 6 .   ? 7.806   8.418   5.985   1.00 34.08 ? 143 HOH B O   1 
HETATM 2241 O  O   . HOH H 6 .   ? 11.256  3.146   23.513  1.00 30.55 ? 144 HOH B O   1 
HETATM 2242 O  O   . HOH H 6 .   ? 6.124   11.395  -15.411 1.00 38.80 ? 145 HOH B O   1 
HETATM 2243 O  O   . HOH H 6 .   ? 22.344  11.766  4.071   1.00 39.79 ? 146 HOH B O   1 
HETATM 2244 O  O   . HOH H 6 .   ? 25.906  -3.427  -0.749  1.00 28.80 ? 147 HOH B O   1 
HETATM 2245 O  O   . HOH H 6 .   ? 16.657  10.399  -26.565 1.00 29.72 ? 148 HOH B O   1 
HETATM 2246 O  O   . HOH H 6 .   ? 11.027  19.063  -13.847 1.00 30.96 ? 149 HOH B O   1 
HETATM 2247 O  O   . HOH H 6 .   ? 23.569  3.711   11.081  1.00 29.25 ? 150 HOH B O   1 
HETATM 2248 O  O   . HOH H 6 .   ? 10.813  -5.455  -14.371 1.00 29.60 ? 151 HOH B O   1 
HETATM 2249 O  O   . HOH H 6 .   ? 17.408  21.214  -22.426 1.00 32.48 ? 152 HOH B O   1 
HETATM 2250 O  O   . HOH H 6 .   ? 5.876   -4.101  22.724  1.00 40.60 ? 153 HOH B O   1 
HETATM 2251 O  O   . HOH H 6 .   ? 26.142  8.844   3.762   1.00 41.97 ? 154 HOH B O   1 
HETATM 2252 O  O   . HOH H 6 .   ? -0.062  9.643   -14.209 1.00 32.00 ? 155 HOH B O   1 
HETATM 2253 O  O   . HOH H 6 .   ? 28.336  0.336   -12.773 1.00 46.36 ? 156 HOH B O   1 
HETATM 2254 O  O   . HOH H 6 .   ? 7.674   -5.031  -16.783 1.00 33.79 ? 157 HOH B O   1 
HETATM 2255 O  O   . HOH H 6 .   ? 16.641  -3.410  2.768   1.00 31.91 ? 158 HOH B O   1 
HETATM 2256 O  O   . HOH H 6 .   ? 8.449   -0.137  -11.161 1.00 18.06 ? 159 HOH B O   1 
HETATM 2257 O  O   . HOH H 6 .   ? 12.967  -6.250  -16.749 1.00 38.00 ? 160 HOH B O   1 
HETATM 2258 O  O   . HOH H 6 .   ? 16.061  19.584  -23.959 1.00 47.29 ? 161 HOH B O   1 
HETATM 2259 O  O   . HOH H 6 .   ? 20.471  10.262  2.272   1.00 25.53 ? 162 HOH B O   1 
HETATM 2260 O  O   . HOH H 6 .   ? 9.936   11.934  1.909   1.00 23.08 ? 163 HOH B O   1 
HETATM 2261 O  O   . HOH H 6 .   ? 17.304  22.835  -10.202 1.00 31.12 ? 164 HOH B O   1 
HETATM 2262 O  O   . HOH H 6 .   ? 27.166  10.798  -0.971  1.00 29.21 ? 165 HOH B O   1 
HETATM 2263 O  O   . HOH H 6 .   ? -0.702  -3.754  20.140  1.00 39.43 ? 166 HOH B O   1 
HETATM 2264 O  O   . HOH H 6 .   ? 17.921  -4.639  -0.611  1.00 23.71 ? 167 HOH B O   1 
HETATM 2265 O  O   . HOH H 6 .   ? 7.866   10.428  -18.982 1.00 27.66 ? 168 HOH B O   1 
HETATM 2266 O  O   . HOH H 6 .   ? 4.939   15.782  -15.751 1.00 48.12 ? 169 HOH B O   1 
HETATM 2267 O  O   . HOH H 6 .   ? 4.440   2.982   21.354  1.00 37.90 ? 170 HOH B O   1 
HETATM 2268 O  O   . HOH H 6 .   ? 21.408  3.238   -23.638 1.00 34.57 ? 171 HOH B O   1 
HETATM 2269 O  O   . HOH H 6 .   ? 23.516  7.113   -20.828 1.00 27.79 ? 172 HOH B O   1 
HETATM 2270 O  O   . HOH H 6 .   ? 20.359  4.766   13.655  1.00 23.00 ? 173 HOH B O   1 
HETATM 2271 O  O   . HOH H 6 .   ? 15.314  12.598  -28.046 1.00 29.45 ? 174 HOH B O   1 
HETATM 2272 O  O   . HOH H 6 .   ? 27.640  18.752  -11.885 1.00 31.98 ? 175 HOH B O   1 
HETATM 2273 O  O   . HOH H 6 .   ? 20.248  -1.337  3.406   1.00 34.61 ? 176 HOH B O   1 
HETATM 2274 O  O   . HOH H 6 .   ? 24.696  15.612  -16.662 1.00 34.94 ? 177 HOH B O   1 
HETATM 2275 O  O   . HOH H 6 .   ? 13.960  5.707   12.645  1.00 38.50 ? 178 HOH B O   1 
HETATM 2276 O  O   . HOH H 6 .   ? 17.721  -3.824  4.990   1.00 29.26 ? 179 HOH B O   1 
HETATM 2277 O  O   . HOH H 6 .   ? 19.222  -3.202  1.857   1.00 39.67 ? 180 HOH B O   1 
HETATM 2278 O  O   . HOH H 6 .   ? 0.562   10.752  -9.678  1.00 24.21 ? 181 HOH B O   1 
HETATM 2279 O  O   . HOH H 6 .   ? 20.231  10.123  -26.745 1.00 37.12 ? 182 HOH B O   1 
HETATM 2280 O  O   . HOH H 6 .   ? 8.170   10.642  3.856   1.00 31.07 ? 183 HOH B O   1 
HETATM 2281 O  O   . HOH H 6 .   ? 20.078  -2.283  5.693   1.00 36.76 ? 184 HOH B O   1 
HETATM 2282 O  O   . HOH H 6 .   ? 29.235  11.987  -14.181 1.00 27.09 ? 185 HOH B O   1 
HETATM 2283 O  O   . HOH H 6 .   ? 15.249  22.180  -6.892  1.00 40.94 ? 186 HOH B O   1 
HETATM 2284 O  O   . HOH H 6 .   ? 14.653  7.526   -25.740 1.00 45.69 ? 187 HOH B O   1 
HETATM 2285 O  O   . HOH H 6 .   ? 5.315   3.975   28.516  1.00 31.57 ? 188 HOH B O   1 
HETATM 2286 O  O   . HOH H 6 .   ? 18.109  18.250  -2.744  1.00 38.97 ? 189 HOH B O   1 
HETATM 2287 O  O   . HOH H 6 .   ? 4.599   -6.050  -12.720 1.00 39.68 ? 190 HOH B O   1 
HETATM 2288 O  O   . HOH H 6 .   ? 13.819  24.241  -6.934  1.00 44.32 ? 191 HOH B O   1 
HETATM 2289 O  O   . HOH H 6 .   ? 6.057   6.694   15.077  1.00 45.21 ? 192 HOH B O   1 
HETATM 2290 O  O   . HOH H 6 .   ? 0.628   -3.113  16.341  1.00 38.14 ? 193 HOH B O   1 
HETATM 2291 O  O   . HOH H 6 .   ? 23.797  17.773  -18.210 1.00 39.08 ? 194 HOH B O   1 
HETATM 2292 O  O   . HOH H 6 .   ? 29.570  10.197  -1.982  1.00 37.62 ? 195 HOH B O   1 
HETATM 2293 O  O   . HOH H 6 .   ? 2.592   -2.065  17.511  1.00 31.47 ? 196 HOH B O   1 
HETATM 2294 O  O   . HOH H 6 .   ? -0.182  -5.564  18.545  1.00 32.41 ? 197 HOH B O   1 
HETATM 2295 O  O   . HOH H 6 .   ? 2.830   12.813  7.551   1.00 27.81 ? 198 HOH B O   1 
HETATM 2296 O  O   . HOH H 6 .   ? 2.526   6.046   23.396  1.00 43.99 ? 199 HOH B O   1 
HETATM 2297 O  O   . HOH H 6 .   ? 12.618  -2.903  -18.869 1.00 37.02 ? 200 HOH B O   1 
HETATM 2298 O  O   . HOH H 6 .   ? 19.420  14.178  5.116   1.00 24.87 ? 201 HOH B O   1 
HETATM 2299 O  O   . HOH H 6 .   ? 28.395  0.256   6.072   1.00 28.29 ? 202 HOH B O   1 
HETATM 2300 O  O   . HOH H 6 .   ? 5.504   -4.178  -14.252 1.00 43.83 ? 203 HOH B O   1 
HETATM 2301 O  O   . HOH H 6 .   ? 17.132  6.854   23.012  1.00 24.47 ? 204 HOH B O   1 
HETATM 2302 O  O   . HOH H 6 .   ? 28.391  8.892   -14.114 1.00 40.04 ? 205 HOH B O   1 
HETATM 2303 O  O   . HOH H 6 .   ? 24.712  21.919  -2.270  1.00 46.24 ? 206 HOH B O   1 
HETATM 2304 O  O   . HOH H 6 .   ? 8.044   8.428   19.535  1.00 32.66 ? 207 HOH B O   1 
HETATM 2305 O  O   . HOH H 6 .   ? 19.005  -7.099  -17.613 1.00 31.94 ? 208 HOH B O   1 
HETATM 2306 O  O   . HOH H 6 .   ? 27.588  13.530  4.925   1.00 43.82 ? 209 HOH B O   1 
HETATM 2307 O  O   . HOH H 6 .   ? 11.472  14.679  -25.861 1.00 44.39 ? 210 HOH B O   1 
HETATM 2308 O  O   . HOH H 6 .   ? 20.221  9.067   6.443   1.00 33.88 ? 211 HOH B O   1 
HETATM 2309 O  O   . HOH H 6 .   ? 18.985  21.531  -4.350  1.00 33.55 ? 212 HOH B O   1 
HETATM 2310 O  O   . HOH H 6 .   ? 8.525   14.200  12.200  1.00 47.21 ? 213 HOH B O   1 
HETATM 2311 O  O   . HOH H 6 .   ? 19.540  7.185   -26.047 1.00 34.03 ? 214 HOH B O   1 
HETATM 2312 O  O   . HOH H 6 .   ? 35.573  5.731   -0.419  1.00 35.97 ? 215 HOH B O   1 
HETATM 2313 O  O   . HOH H 6 .   ? 26.685  1.563   -6.042  1.00 33.32 ? 216 HOH B O   1 
HETATM 2314 O  O   . HOH H 6 .   ? 14.642  11.387  17.792  1.00 41.53 ? 217 HOH B O   1 
HETATM 2315 O  O   . HOH H 6 .   ? 1.351   8.924   17.949  1.00 36.45 ? 218 HOH B O   1 
HETATM 2316 O  O   . HOH H 6 .   ? 4.874   13.620  13.010  1.00 34.22 ? 219 HOH B O   1 
HETATM 2317 O  O   . HOH H 6 .   ? 25.506  -3.221  1.743   1.00 39.23 ? 220 HOH B O   1 
HETATM 2318 O  O   . HOH H 6 .   ? 26.824  7.163   7.299   1.00 33.41 ? 221 HOH B O   1 
HETATM 2319 O  O   . HOH H 6 .   ? 34.184  1.505   -1.874  1.00 37.44 ? 222 HOH B O   1 
HETATM 2320 O  O   . HOH H 6 .   ? 25.109  16.111  -4.100  1.00 50.53 ? 223 HOH B O   1 
HETATM 2321 O  O   . HOH H 6 .   ? 11.138  8.134   -26.473 1.00 22.72 ? 224 HOH B O   1 
HETATM 2322 O  O   . HOH H 6 .   ? 20.717  17.890  0.321   1.00 47.19 ? 225 HOH B O   1 
HETATM 2323 O  O   . HOH H 6 .   ? 13.913  15.159  7.693   1.00 42.62 ? 226 HOH B O   1 
HETATM 2324 O  O   . HOH H 6 .   ? 17.264  9.235   17.914  1.00 47.56 ? 227 HOH B O   1 
HETATM 2325 O  O   . HOH H 6 .   ? 11.592  0.210   -23.201 1.00 48.12 ? 228 HOH B O   1 
HETATM 2326 O  O   . HOH H 6 .   ? 7.291   -0.852  -21.530 1.00 47.07 ? 229 HOH B O   1 
HETATM 2327 O  O   . HOH H 6 .   ? 9.083   0.697   -21.275 1.00 27.61 ? 230 HOH B O   1 
HETATM 2328 O  O   . HOH H 6 .   ? 27.167  2.138   0.748   1.00 26.83 ? 231 HOH B O   1 
HETATM 2329 O  O   . HOH H 6 .   ? 21.882  -5.582  -1.581  1.00 35.46 ? 232 HOH B O   1 
HETATM 2330 O  O   . HOH H 6 .   ? 19.828  -5.707  -4.402  1.00 51.36 ? 233 HOH B O   1 
HETATM 2331 O  O   . HOH H 6 .   ? 4.471   5.516   -19.547 1.00 42.02 ? 234 HOH B O   1 
HETATM 2332 O  O   . HOH H 6 .   ? 11.485  12.109  -1.902  1.00 38.01 ? 235 HOH B O   1 
HETATM 2333 O  O   . HOH H 6 .   ? 19.914  6.169   6.268   1.00 38.50 ? 236 HOH B O   1 
HETATM 2334 O  O   . HOH H 6 .   ? 17.958  6.800   14.859  1.00 52.53 ? 237 HOH B O   1 
HETATM 2335 O  O   . HOH H 6 .   ? 14.436  8.243   30.818  1.00 48.92 ? 238 HOH B O   1 
HETATM 2336 O  O   . HOH H 6 .   ? 23.934  -11.971 -14.343 1.00 45.26 ? 239 HOH B O   1 
HETATM 2337 O  O   . HOH H 6 .   ? 10.805  6.938   12.919  1.00 41.10 ? 240 HOH B O   1 
HETATM 2338 O  O   . HOH H 6 .   ? 28.080  13.353  2.433   1.00 43.92 ? 241 HOH B O   1 
HETATM 2339 O  O   . HOH H 6 .   ? 7.689   -10.763 -14.242 1.00 40.14 ? 242 HOH B O   1 
HETATM 2340 O  O   . HOH H 6 .   ? 15.248  18.615  -4.377  1.00 36.51 ? 243 HOH B O   1 
HETATM 2341 O  O   . HOH H 6 .   ? 15.140  -10.127 -15.002 1.00 38.51 ? 244 HOH B O   1 
HETATM 2342 O  O   . HOH H 6 .   ? 10.695  14.033  -0.379  1.00 37.77 ? 245 HOH B O   1 
HETATM 2343 O  O   . HOH H 6 .   ? 24.746  -7.345  -2.185  1.00 41.93 ? 246 HOH B O   1 
HETATM 2344 O  O   . HOH H 6 .   ? 20.982  -10.841 -12.265 1.00 41.89 ? 247 HOH B O   1 
HETATM 2345 O  O   . HOH H 6 .   ? 22.493  11.470  -30.800 1.00 41.06 ? 248 HOH B O   1 
HETATM 2346 O  O   . HOH H 6 .   ? 0.497   0.211   -21.201 1.00 48.24 ? 249 HOH B O   1 
HETATM 2347 O  O   . HOH H 6 .   ? 13.873  -1.727  -25.418 1.00 43.50 ? 250 HOH B O   1 
HETATM 2348 O  O   . HOH H 6 .   ? 28.309  -3.692  -10.610 1.00 38.04 ? 251 HOH B O   1 
HETATM 2349 O  O   . HOH H 6 .   ? 21.961  -9.214  -3.950  1.00 51.28 ? 252 HOH B O   1 
HETATM 2350 O  O   . HOH H 6 .   ? 20.921  10.820  14.651  1.00 46.34 ? 253 HOH B O   1 
HETATM 2351 O  O   . HOH H 6 .   ? 14.624  14.183  1.935   1.00 31.86 ? 254 HOH B O   1 
HETATM 2352 O  O   . HOH H 6 .   ? 5.277   -4.104  -17.005 1.00 39.68 ? 255 HOH B O   1 
HETATM 2353 O  O   . HOH H 6 .   ? 21.172  16.003  3.454   1.00 35.13 ? 256 HOH B O   1 
HETATM 2354 O  O   . HOH H 6 .   ? 14.621  9.904   26.418  1.00 46.75 ? 257 HOH B O   1 
HETATM 2355 O  O   . HOH H 6 .   ? 12.105  9.525   12.425  1.00 47.67 ? 258 HOH B O   1 
HETATM 2356 O  O   . HOH H 6 .   ? 16.326  -11.196 -11.409 1.00 40.54 ? 259 HOH B O   1 
HETATM 2357 O  O   . HOH H 6 .   ? 26.803  16.992  4.481   1.00 46.19 ? 260 HOH B O   1 
HETATM 2358 O  O   . HOH H 6 .   ? 27.180  5.832   9.928   1.00 47.51 ? 261 HOH B O   1 
HETATM 2359 O  O   . HOH H 6 .   ? 9.834   -8.831  -13.145 1.00 45.02 ? 262 HOH B O   1 
HETATM 2360 O  O   . HOH H 6 .   ? 17.199  25.142  -7.398  1.00 46.51 ? 263 HOH B O   1 
HETATM 2361 O  O   . HOH H 6 .   ? 21.558  23.392  -14.853 1.00 39.65 ? 264 HOH B O   1 
HETATM 2362 O  O   . HOH H 6 .   ? 30.489  12.631  -4.009  1.00 46.26 ? 265 HOH B O   1 
HETATM 2363 O  O   . HOH H 6 .   ? 33.086  15.883  -5.731  1.00 37.26 ? 266 HOH B O   1 
HETATM 2364 O  O   . HOH H 6 .   ? 5.549   9.383   23.176  1.00 36.46 ? 267 HOH B O   1 
HETATM 2365 O  O   . HOH H 6 .   ? 30.462  18.039  -12.315 1.00 28.26 ? 268 HOH B O   1 
HETATM 2366 O  O   . HOH H 6 .   ? 4.666   6.258   21.921  1.00 36.62 ? 269 HOH B O   1 
HETATM 2367 O  O   . HOH H 6 .   ? 9.759   20.429  -26.153 0.50 51.80 ? 270 HOH B O   1 
HETATM 2368 O  O   . HOH H 6 .   ? 9.759   10.593  -26.153 0.50 51.80 ? 271 HOH B O   1 
HETATM 2369 O  O   . HOH H 6 .   ? 0.714   3.212   21.594  1.00 47.97 ? 272 HOH B O   1 
HETATM 2370 O  O   . HOH H 6 .   ? 18.348  15.652  -0.066  1.00 46.65 ? 273 HOH B O   1 
HETATM 2371 O  O   . HOH H 6 .   ? -0.852  6.135   18.363  1.00 48.70 ? 274 HOH B O   1 
HETATM 2372 O  O   . HOH H 6 .   ? 14.346  7.595   15.140  1.00 48.92 ? 275 HOH B O   1 
HETATM 2373 O  O   . HOH H 6 .   ? 23.146  7.891   8.699   1.00 48.88 ? 276 HOH B O   1 
HETATM 2374 O  O   . HOH H 6 .   ? 19.610  -8.661  -3.015  1.00 49.73 ? 277 HOH B O   1 
HETATM 2375 O  O   . HOH H 6 .   ? -3.456  0.543   23.737  1.00 47.15 ? 278 HOH B O   1 
HETATM 2376 O  O   . HOH H 6 .   ? 17.086  10.566  4.752   1.00 51.56 ? 279 HOH B O   1 
HETATM 2377 O  O   . HOH H 6 .   ? 9.759   -0.757  -26.153 0.50 21.15 ? 280 HOH B O   1 
HETATM 2378 O  O   . HOH H 6 .   ? 31.176  7.733   -4.122  1.00 51.42 ? 281 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   1   ASP ASP A . n 
A 1 2   CYS 2   2   2   CYS CYS A . n 
A 1 3   PRO 3   3   3   PRO PRO A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLY 5   5   5   GLY GLY A . n 
A 1 6   TRP 6   6   6   TRP TRP A . n 
A 1 7   SER 7   7   7   SER SER A . n 
A 1 8   SER 8   8   8   SER SER A . n 
A 1 9   TYR 9   9   9   TYR TYR A . n 
A 1 10  GLU 10  10  10  GLU GLU A . n 
A 1 11  GLY 11  11  11  GLY GLY A . n 
A 1 12  HIS 12  12  12  HIS HIS A . n 
A 1 13  CYS 13  13  13  CYS CYS A . n 
A 1 14  TYR 14  14  14  TYR TYR A . n 
A 1 15  LYS 15  15  15  LYS LYS A . n 
A 1 16  PRO 16  16  16  PRO PRO A . n 
A 1 17  PHE 17  17  17  PHE PHE A . n 
A 1 18  LYS 18  18  18  LYS LYS A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  TYR 20  20  20  TYR TYR A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  THR 22  22  22  THR THR A . n 
A 1 23  TRP 23  23  23  TRP TRP A . n 
A 1 24  ASP 24  24  24  ASP ASP A . n 
A 1 25  ASP 25  25  25  ASP ASP A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  GLU 27  27  27  GLU GLU A . n 
A 1 28  ARG 28  28  28  ARG ARG A . n 
A 1 29  PHE 29  29  29  PHE PHE A . n 
A 1 30  CYS 30  30  30  CYS CYS A . n 
A 1 31  THR 31  31  31  THR THR A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  GLN 33  33  33  GLN GLN A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  LYS 35  35  35  LYS LYS A . n 
A 1 36  GLY 36  36  36  GLY GLY A . n 
A 1 37  GLY 37  37  37  GLY GLY A . n 
A 1 38  HIS 38  38  38  HIS HIS A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  SER 41  41  41  SER SER A . n 
A 1 42  ILE 42  42  42  ILE ILE A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  ALA 45  45  45  ALA ALA A . n 
A 1 46  GLY 46  46  46  GLY GLY A . n 
A 1 47  GLU 47  47  47  GLU GLU A . n 
A 1 48  ALA 48  48  48  ALA ALA A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  PHE 50  50  50  PHE PHE A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  ALA 52  52  52  ALA ALA A . n 
A 1 53  GLN 53  53  53  GLN GLN A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  THR 56  56  56  THR THR A . n 
A 1 57  GLU 57  57  57  GLU GLU A . n 
A 1 58  ASN 58  58  58  ASN ASN A . n 
A 1 59  ILE 59  59  59  ILE ILE A . n 
A 1 60  GLN 60  60  60  GLN GLN A . n 
A 1 61  ASN 61  61  61  ASN ASN A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  TYR 65  65  65  TYR TYR A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  TRP 67  67  67  TRP TRP A . n 
A 1 68  ILE 68  68  68  ILE ILE A . n 
A 1 69  GLY 69  69  69  GLY GLY A . n 
A 1 70  LEU 70  70  70  LEU LEU A . n 
A 1 71  ARG 71  71  71  ARG ARG A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  GLN 73  73  73  GLN GLN A . n 
A 1 74  GLY 74  74  74  GLY GLY A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  GLU 76  76  76  GLU GLU A . n 
A 1 77  LYS 77  77  77  LYS LYS A . n 
A 1 78  GLN 78  78  78  GLN GLN A . n 
A 1 79  CYS 79  79  79  CYS CYS A . n 
A 1 80  SER 80  80  80  SER SER A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  TRP 83  83  83  TRP TRP A . n 
A 1 84  SER 84  84  84  SER SER A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  SER 87  87  87  SER SER A . n 
A 1 88  SER 88  88  88  SER SER A . n 
A 1 89  VAL 89  89  89  VAL VAL A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  TYR 91  91  91  TYR TYR A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASN 93  93  93  ASN ASN A . n 
A 1 94  TRP 94  94  94  TRP TRP A . n 
A 1 95  ILE 95  95  95  ILE ILE A . n 
A 1 96  GLU 96  96  96  GLU GLU A . n 
A 1 97  ALA 97  97  97  ALA ALA A . n 
A 1 98  GLU 98  98  98  GLU GLU A . n 
A 1 99  SER 99  99  99  SER SER A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 THR 101 101 101 THR THR A . n 
A 1 102 CYS 102 102 102 CYS CYS A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 GLU 106 106 106 GLU GLU A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 GLU 108 108 108 GLU GLU A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 GLY 110 110 110 GLY GLY A . n 
A 1 111 PHE 111 111 111 PHE PHE A . n 
A 1 112 ARG 112 112 112 ARG ARG A . n 
A 1 113 LYS 113 113 113 LYS LYS A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 ASN 116 116 116 ASN ASN A . n 
A 1 117 ILE 117 117 117 ILE ILE A . n 
A 1 118 TYR 118 118 118 TYR TYR A . n 
A 1 119 CYS 119 119 119 CYS CYS A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 GLN 121 121 121 GLN GLN A . n 
A 1 122 GLN 122 122 122 GLN GLN A . n 
A 1 123 ASN 123 123 123 ASN ASN A . n 
A 1 124 PRO 124 124 124 PRO PRO A . n 
A 1 125 PHE 125 125 125 PHE PHE A . n 
A 1 126 VAL 126 126 126 VAL VAL A . n 
A 1 127 CYS 127 127 127 CYS CYS A . n 
A 1 128 GLU 128 128 128 GLU GLU A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
B 2 1   ASP 1   1   1   ASP ASP B . n 
B 2 2   CYS 2   2   2   CYS CYS B . n 
B 2 3   PRO 3   3   3   PRO PRO B . n 
B 2 4   SER 4   4   4   SER SER B . n 
B 2 5   ASP 5   5   5   ASP ASP B . n 
B 2 6   TRP 6   6   6   TRP TRP B . n 
B 2 7   SER 7   7   7   SER SER B . n 
B 2 8   SER 8   8   8   SER SER B . n 
B 2 9   TYR 9   9   9   TYR TYR B . n 
B 2 10  GLU 10  10  10  GLU GLU B . n 
B 2 11  GLY 11  11  11  GLY GLY B . n 
B 2 12  HIS 12  12  12  HIS HIS B . n 
B 2 13  CYS 13  13  13  CYS CYS B . n 
B 2 14  TYR 14  14  14  TYR TYR B . n 
B 2 15  LYS 15  15  15  LYS LYS B . n 
B 2 16  PRO 16  16  16  PRO PRO B . n 
B 2 17  PHE 17  17  17  PHE PHE B . n 
B 2 18  SER 18  18  18  SER SER B . n 
B 2 19  GLU 19  19  19  GLU GLU B . n 
B 2 20  PRO 20  20  20  PRO PRO B . n 
B 2 21  LYS 21  21  21  LYS LYS B . n 
B 2 22  ASN 22  22  22  ASN ASN B . n 
B 2 23  TRP 23  23  23  TRP TRP B . n 
B 2 24  ALA 24  24  24  ALA ALA B . n 
B 2 25  ASP 25  25  25  ASP ASP B . n 
B 2 26  ALA 26  26  26  ALA ALA B . n 
B 2 27  GLU 27  27  27  GLU GLU B . n 
B 2 28  ASN 28  28  28  ASN ASN B . n 
B 2 29  PHE 29  29  29  PHE PHE B . n 
B 2 30  CYS 30  30  30  CYS CYS B . n 
B 2 31  THR 31  31  31  THR THR B . n 
B 2 32  GLN 32  32  32  GLN GLN B . n 
B 2 33  GLN 33  33  33  GLN GLN B . n 
B 2 34  HIS 34  34  34  HIS HIS B . n 
B 2 35  ALA 35  35  35  ALA ALA B . n 
B 2 36  GLY 36  36  36  GLY GLY B . n 
B 2 37  GLY 37  37  37  GLY GLY B . n 
B 2 38  HIS 38  38  38  HIS HIS B . n 
B 2 39  LEU 39  39  39  LEU LEU B . n 
B 2 40  VAL 40  40  40  VAL VAL B . n 
B 2 41  SER 41  41  41  SER SER B . n 
B 2 42  PHE 42  42  42  PHE PHE B . n 
B 2 43  GLN 43  43  43  GLN GLN B . n 
B 2 44  SER 44  44  44  SER SER B . n 
B 2 45  SER 45  45  45  SER SER B . n 
B 2 46  GLU 46  46  46  GLU GLU B . n 
B 2 47  GLU 47  47  47  GLU GLU B . n 
B 2 48  ALA 48  48  48  ALA ALA B . n 
B 2 49  ASP 49  49  49  ASP ASP B . n 
B 2 50  PHE 50  50  50  PHE PHE B . n 
B 2 51  VAL 51  51  51  VAL VAL B . n 
B 2 52  VAL 52  52  52  VAL VAL B . n 
B 2 53  LYS 53  53  53  LYS LYS B . n 
B 2 54  LEU 54  54  54  LEU LEU B . n 
B 2 55  ALA 55  55  55  ALA ALA B . n 
B 2 56  PHE 56  56  56  PHE PHE B . n 
B 2 57  GLN 57  57  57  GLN GLN B . n 
B 2 58  THR 58  58  58  THR THR B . n 
B 2 59  PHE 59  59  59  PHE PHE B . n 
B 2 60  GLY 60  60  60  GLY GLY B . n 
B 2 61  HIS 61  61  61  HIS HIS B . n 
B 2 62  SER 62  62  62  SER SER B . n 
B 2 63  ILE 63  63  63  ILE ILE B . n 
B 2 64  PHE 64  64  64  PHE PHE B . n 
B 2 65  TRP 65  65  65  TRP TRP B . n 
B 2 66  MET 66  66  66  MET MET B . n 
B 2 67  GLY 67  67  67  GLY GLY B . n 
B 2 68  LEU 68  68  68  LEU LEU B . n 
B 2 69  SER 69  69  69  SER SER B . n 
B 2 70  ASN 70  70  70  ASN ASN B . n 
B 2 71  VAL 71  71  71  VAL VAL B . n 
B 2 72  TRP 72  72  72  TRP TRP B . n 
B 2 73  ASN 73  73  73  ASN ASN B . n 
B 2 74  GLN 74  74  74  GLN GLN B . n 
B 2 75  CYS 75  75  75  CYS CYS B . n 
B 2 76  ASN 76  76  76  ASN ASN B . n 
B 2 77  TRP 77  77  77  TRP TRP B . n 
B 2 78  GLN 78  78  78  GLN GLN B . n 
B 2 79  TRP 79  79  79  TRP TRP B . n 
B 2 80  SER 80  80  80  SER SER B . n 
B 2 81  ASN 81  81  81  ASN ASN B . n 
B 2 82  ALA 82  82  82  ALA ALA B . n 
B 2 83  ALA 83  83  83  ALA ALA B . n 
B 2 84  MET 84  84  84  MET MET B . n 
B 2 85  LEU 85  85  85  LEU LEU B . n 
B 2 86  ARG 86  86  86  ARG ARG B . n 
B 2 87  TYR 87  87  87  TYR TYR B . n 
B 2 88  LYS 88  88  88  LYS LYS B . n 
B 2 89  ALA 89  89  89  ALA ALA B . n 
B 2 90  TRP 90  90  90  TRP TRP B . n 
B 2 91  ALA 91  91  91  ALA ALA B . n 
B 2 92  GLU 92  92  92  GLU GLU B . n 
B 2 93  GLU 93  93  93  GLU GLU B . n 
B 2 94  SER 94  94  94  SER SER B . n 
B 2 95  TYR 95  95  95  TYR TYR B . n 
B 2 96  CYS 96  96  96  CYS CYS B . n 
B 2 97  VAL 97  97  97  VAL VAL B . n 
B 2 98  TYR 98  98  98  TYR TYR B . n 
B 2 99  PHE 99  99  99  PHE PHE B . n 
B 2 100 LYS 100 100 100 LYS LYS B . n 
B 2 101 SER 101 101 101 SER SER B . n 
B 2 102 THR 102 102 102 THR THR B . n 
B 2 103 ASN 103 103 103 ASN ASN B . n 
B 2 104 ASN 104 104 104 ASN ASN B . n 
B 2 105 LYS 105 105 105 LYS LYS B . n 
B 2 106 TRP 106 106 106 TRP TRP B . n 
B 2 107 ARG 107 107 107 ARG ARG B . n 
B 2 108 SER 108 108 108 SER SER B . n 
B 2 109 ARG 109 109 109 ARG ARG B . n 
B 2 110 ALA 110 110 110 ALA ALA B . n 
B 2 111 CYS 111 111 111 CYS CYS B . n 
B 2 112 ARG 112 112 112 ARG ARG B . n 
B 2 113 MET 113 113 113 MET MET B . n 
B 2 114 MET 114 114 114 MET MET B . n 
B 2 115 ALA 115 115 115 ALA ALA B . n 
B 2 116 GLN 116 116 116 GLN GLN B . n 
B 2 117 PHE 117 117 117 PHE PHE B . n 
B 2 118 VAL 118 118 118 VAL VAL B . n 
B 2 119 CYS 119 119 119 CYS CYS B . n 
B 2 120 GLU 120 120 120 GLU GLU B . n 
B 2 121 PHE 121 121 121 PHE PHE B . n 
B 2 122 GLN 122 122 122 GLN GLN B . n 
B 2 123 ALA 123 123 123 ALA ALA B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 CL  1   401 401 CL  CL  A . 
D 4 RB  1   402 402 RB  RB  A . 
E 4 RB  1   403 403 RB  RB  A . 
F 5 SO4 1   404 404 SO4 SO4 A . 
G 6 HOH 1   405 1   HOH HOH A . 
G 6 HOH 2   406 3   HOH HOH A . 
G 6 HOH 3   407 4   HOH HOH A . 
G 6 HOH 4   408 5   HOH HOH A . 
G 6 HOH 5   409 7   HOH HOH A . 
G 6 HOH 6   410 8   HOH HOH A . 
G 6 HOH 7   411 13  HOH HOH A . 
G 6 HOH 8   412 14  HOH HOH A . 
G 6 HOH 9   413 15  HOH HOH A . 
G 6 HOH 10  414 17  HOH HOH A . 
G 6 HOH 11  415 19  HOH HOH A . 
G 6 HOH 12  416 22  HOH HOH A . 
G 6 HOH 13  417 23  HOH HOH A . 
G 6 HOH 14  418 24  HOH HOH A . 
G 6 HOH 15  419 25  HOH HOH A . 
G 6 HOH 16  420 26  HOH HOH A . 
G 6 HOH 17  421 32  HOH HOH A . 
G 6 HOH 18  422 33  HOH HOH A . 
G 6 HOH 19  423 34  HOH HOH A . 
G 6 HOH 20  424 38  HOH HOH A . 
G 6 HOH 21  425 41  HOH HOH A . 
G 6 HOH 22  426 42  HOH HOH A . 
G 6 HOH 23  427 43  HOH HOH A . 
G 6 HOH 24  428 45  HOH HOH A . 
G 6 HOH 25  429 46  HOH HOH A . 
G 6 HOH 26  430 47  HOH HOH A . 
G 6 HOH 27  431 48  HOH HOH A . 
G 6 HOH 28  432 50  HOH HOH A . 
G 6 HOH 29  433 54  HOH HOH A . 
G 6 HOH 30  434 56  HOH HOH A . 
G 6 HOH 31  435 57  HOH HOH A . 
G 6 HOH 32  436 58  HOH HOH A . 
G 6 HOH 33  437 59  HOH HOH A . 
G 6 HOH 34  438 60  HOH HOH A . 
G 6 HOH 35  439 61  HOH HOH A . 
G 6 HOH 36  440 67  HOH HOH A . 
G 6 HOH 37  441 69  HOH HOH A . 
G 6 HOH 38  442 70  HOH HOH A . 
G 6 HOH 39  443 72  HOH HOH A . 
G 6 HOH 40  444 73  HOH HOH A . 
G 6 HOH 41  445 74  HOH HOH A . 
G 6 HOH 42  446 77  HOH HOH A . 
G 6 HOH 43  447 83  HOH HOH A . 
G 6 HOH 44  448 84  HOH HOH A . 
G 6 HOH 45  449 91  HOH HOH A . 
G 6 HOH 46  450 95  HOH HOH A . 
G 6 HOH 47  451 96  HOH HOH A . 
G 6 HOH 48  452 97  HOH HOH A . 
G 6 HOH 49  453 98  HOH HOH A . 
G 6 HOH 50  454 99  HOH HOH A . 
G 6 HOH 51  455 100 HOH HOH A . 
G 6 HOH 52  456 101 HOH HOH A . 
G 6 HOH 53  457 102 HOH HOH A . 
G 6 HOH 54  458 103 HOH HOH A . 
G 6 HOH 55  459 107 HOH HOH A . 
G 6 HOH 56  460 110 HOH HOH A . 
G 6 HOH 57  461 112 HOH HOH A . 
G 6 HOH 58  462 114 HOH HOH A . 
G 6 HOH 59  463 117 HOH HOH A . 
G 6 HOH 60  464 118 HOH HOH A . 
G 6 HOH 61  465 119 HOH HOH A . 
G 6 HOH 62  466 124 HOH HOH A . 
G 6 HOH 63  467 125 HOH HOH A . 
G 6 HOH 64  468 127 HOH HOH A . 
G 6 HOH 65  469 128 HOH HOH A . 
G 6 HOH 66  470 129 HOH HOH A . 
G 6 HOH 67  471 130 HOH HOH A . 
G 6 HOH 68  472 132 HOH HOH A . 
G 6 HOH 69  473 133 HOH HOH A . 
G 6 HOH 70  474 134 HOH HOH A . 
G 6 HOH 71  475 135 HOH HOH A . 
G 6 HOH 72  476 136 HOH HOH A . 
G 6 HOH 73  477 138 HOH HOH A . 
G 6 HOH 74  478 140 HOH HOH A . 
G 6 HOH 75  479 141 HOH HOH A . 
G 6 HOH 76  480 142 HOH HOH A . 
G 6 HOH 77  481 143 HOH HOH A . 
G 6 HOH 78  482 144 HOH HOH A . 
G 6 HOH 79  483 145 HOH HOH A . 
G 6 HOH 80  484 146 HOH HOH A . 
G 6 HOH 81  485 147 HOH HOH A . 
G 6 HOH 82  486 148 HOH HOH A . 
G 6 HOH 83  487 151 HOH HOH A . 
G 6 HOH 84  488 153 HOH HOH A . 
G 6 HOH 85  489 156 HOH HOH A . 
G 6 HOH 86  490 157 HOH HOH A . 
G 6 HOH 87  491 158 HOH HOH A . 
G 6 HOH 88  492 161 HOH HOH A . 
G 6 HOH 89  493 163 HOH HOH A . 
G 6 HOH 90  494 164 HOH HOH A . 
G 6 HOH 91  495 167 HOH HOH A . 
G 6 HOH 92  496 169 HOH HOH A . 
G 6 HOH 93  497 170 HOH HOH A . 
G 6 HOH 94  498 172 HOH HOH A . 
G 6 HOH 95  499 173 HOH HOH A . 
G 6 HOH 96  500 174 HOH HOH A . 
G 6 HOH 97  501 178 HOH HOH A . 
G 6 HOH 98  502 179 HOH HOH A . 
G 6 HOH 99  503 181 HOH HOH A . 
G 6 HOH 100 504 182 HOH HOH A . 
G 6 HOH 101 505 184 HOH HOH A . 
G 6 HOH 102 506 186 HOH HOH A . 
G 6 HOH 103 507 187 HOH HOH A . 
G 6 HOH 104 508 190 HOH HOH A . 
G 6 HOH 105 509 193 HOH HOH A . 
G 6 HOH 106 510 195 HOH HOH A . 
G 6 HOH 107 511 196 HOH HOH A . 
G 6 HOH 108 512 197 HOH HOH A . 
G 6 HOH 109 513 200 HOH HOH A . 
G 6 HOH 110 514 201 HOH HOH A . 
G 6 HOH 111 515 203 HOH HOH A . 
G 6 HOH 112 516 204 HOH HOH A . 
G 6 HOH 113 517 205 HOH HOH A . 
G 6 HOH 114 518 207 HOH HOH A . 
G 6 HOH 115 519 214 HOH HOH A . 
G 6 HOH 116 520 218 HOH HOH A . 
G 6 HOH 117 521 219 HOH HOH A . 
G 6 HOH 118 522 220 HOH HOH A . 
G 6 HOH 119 523 223 HOH HOH A . 
G 6 HOH 120 524 224 HOH HOH A . 
G 6 HOH 121 525 230 HOH HOH A . 
G 6 HOH 122 526 232 HOH HOH A . 
G 6 HOH 123 527 233 HOH HOH A . 
G 6 HOH 124 528 234 HOH HOH A . 
G 6 HOH 125 529 235 HOH HOH A . 
G 6 HOH 126 530 238 HOH HOH A . 
G 6 HOH 127 531 239 HOH HOH A . 
G 6 HOH 128 532 242 HOH HOH A . 
G 6 HOH 129 533 243 HOH HOH A . 
G 6 HOH 130 534 246 HOH HOH A . 
G 6 HOH 131 535 250 HOH HOH A . 
G 6 HOH 132 536 251 HOH HOH A . 
G 6 HOH 133 537 255 HOH HOH A . 
G 6 HOH 134 538 257 HOH HOH A . 
G 6 HOH 135 539 261 HOH HOH A . 
G 6 HOH 136 540 266 HOH HOH A . 
G 6 HOH 137 541 267 HOH HOH A . 
G 6 HOH 138 542 268 HOH HOH A . 
G 6 HOH 139 543 269 HOH HOH A . 
G 6 HOH 140 544 270 HOH HOH A . 
G 6 HOH 141 545 271 HOH HOH A . 
G 6 HOH 142 546 272 HOH HOH A . 
G 6 HOH 143 547 274 HOH HOH A . 
G 6 HOH 144 548 275 HOH HOH A . 
G 6 HOH 145 549 279 HOH HOH A . 
G 6 HOH 146 550 280 HOH HOH A . 
G 6 HOH 147 551 281 HOH HOH A . 
G 6 HOH 148 552 284 HOH HOH A . 
G 6 HOH 149 553 290 HOH HOH A . 
G 6 HOH 150 554 292 HOH HOH A . 
G 6 HOH 151 555 293 HOH HOH A . 
G 6 HOH 152 556 296 HOH HOH A . 
G 6 HOH 153 557 297 HOH HOH A . 
G 6 HOH 154 558 298 HOH HOH A . 
G 6 HOH 155 559 299 HOH HOH A . 
G 6 HOH 156 560 304 HOH HOH A . 
G 6 HOH 157 561 308 HOH HOH A . 
G 6 HOH 158 562 309 HOH HOH A . 
G 6 HOH 159 563 312 HOH HOH A . 
G 6 HOH 160 564 315 HOH HOH A . 
G 6 HOH 161 565 316 HOH HOH A . 
G 6 HOH 162 566 317 HOH HOH A . 
G 6 HOH 163 567 320 HOH HOH A . 
G 6 HOH 164 568 321 HOH HOH A . 
G 6 HOH 165 569 323 HOH HOH A . 
H 6 HOH 1   124 2   HOH HOH B . 
H 6 HOH 2   125 6   HOH HOH B . 
H 6 HOH 3   126 9   HOH HOH B . 
H 6 HOH 4   127 10  HOH HOH B . 
H 6 HOH 5   128 11  HOH HOH B . 
H 6 HOH 6   129 12  HOH HOH B . 
H 6 HOH 7   130 16  HOH HOH B . 
H 6 HOH 8   131 18  HOH HOH B . 
H 6 HOH 9   132 20  HOH HOH B . 
H 6 HOH 10  133 21  HOH HOH B . 
H 6 HOH 11  134 27  HOH HOH B . 
H 6 HOH 12  135 28  HOH HOH B . 
H 6 HOH 13  136 29  HOH HOH B . 
H 6 HOH 14  137 30  HOH HOH B . 
H 6 HOH 15  138 31  HOH HOH B . 
H 6 HOH 16  139 35  HOH HOH B . 
H 6 HOH 17  140 36  HOH HOH B . 
H 6 HOH 18  141 37  HOH HOH B . 
H 6 HOH 19  142 39  HOH HOH B . 
H 6 HOH 20  143 40  HOH HOH B . 
H 6 HOH 21  144 44  HOH HOH B . 
H 6 HOH 22  145 49  HOH HOH B . 
H 6 HOH 23  146 51  HOH HOH B . 
H 6 HOH 24  147 52  HOH HOH B . 
H 6 HOH 25  148 53  HOH HOH B . 
H 6 HOH 26  149 55  HOH HOH B . 
H 6 HOH 27  150 62  HOH HOH B . 
H 6 HOH 28  151 63  HOH HOH B . 
H 6 HOH 29  152 64  HOH HOH B . 
H 6 HOH 30  153 65  HOH HOH B . 
H 6 HOH 31  154 66  HOH HOH B . 
H 6 HOH 32  155 68  HOH HOH B . 
H 6 HOH 33  156 71  HOH HOH B . 
H 6 HOH 34  157 75  HOH HOH B . 
H 6 HOH 35  158 76  HOH HOH B . 
H 6 HOH 36  159 78  HOH HOH B . 
H 6 HOH 37  160 79  HOH HOH B . 
H 6 HOH 38  161 80  HOH HOH B . 
H 6 HOH 39  162 81  HOH HOH B . 
H 6 HOH 40  163 82  HOH HOH B . 
H 6 HOH 41  164 85  HOH HOH B . 
H 6 HOH 42  165 86  HOH HOH B . 
H 6 HOH 43  166 87  HOH HOH B . 
H 6 HOH 44  167 88  HOH HOH B . 
H 6 HOH 45  168 89  HOH HOH B . 
H 6 HOH 46  169 90  HOH HOH B . 
H 6 HOH 47  170 92  HOH HOH B . 
H 6 HOH 48  171 93  HOH HOH B . 
H 6 HOH 49  172 94  HOH HOH B . 
H 6 HOH 50  173 104 HOH HOH B . 
H 6 HOH 51  174 105 HOH HOH B . 
H 6 HOH 52  175 106 HOH HOH B . 
H 6 HOH 53  176 108 HOH HOH B . 
H 6 HOH 54  177 109 HOH HOH B . 
H 6 HOH 55  178 111 HOH HOH B . 
H 6 HOH 56  179 113 HOH HOH B . 
H 6 HOH 57  180 115 HOH HOH B . 
H 6 HOH 58  181 116 HOH HOH B . 
H 6 HOH 59  182 120 HOH HOH B . 
H 6 HOH 60  183 121 HOH HOH B . 
H 6 HOH 61  184 122 HOH HOH B . 
H 6 HOH 62  185 123 HOH HOH B . 
H 6 HOH 63  186 126 HOH HOH B . 
H 6 HOH 64  187 131 HOH HOH B . 
H 6 HOH 65  188 137 HOH HOH B . 
H 6 HOH 66  189 139 HOH HOH B . 
H 6 HOH 67  190 149 HOH HOH B . 
H 6 HOH 68  191 150 HOH HOH B . 
H 6 HOH 69  192 152 HOH HOH B . 
H 6 HOH 70  193 154 HOH HOH B . 
H 6 HOH 71  194 155 HOH HOH B . 
H 6 HOH 72  195 159 HOH HOH B . 
H 6 HOH 73  196 160 HOH HOH B . 
H 6 HOH 74  197 162 HOH HOH B . 
H 6 HOH 75  198 165 HOH HOH B . 
H 6 HOH 76  199 166 HOH HOH B . 
H 6 HOH 77  200 168 HOH HOH B . 
H 6 HOH 78  201 171 HOH HOH B . 
H 6 HOH 79  202 175 HOH HOH B . 
H 6 HOH 80  203 176 HOH HOH B . 
H 6 HOH 81  204 177 HOH HOH B . 
H 6 HOH 82  205 180 HOH HOH B . 
H 6 HOH 83  206 183 HOH HOH B . 
H 6 HOH 84  207 185 HOH HOH B . 
H 6 HOH 85  208 188 HOH HOH B . 
H 6 HOH 86  209 189 HOH HOH B . 
H 6 HOH 87  210 191 HOH HOH B . 
H 6 HOH 88  211 192 HOH HOH B . 
H 6 HOH 89  212 194 HOH HOH B . 
H 6 HOH 90  213 198 HOH HOH B . 
H 6 HOH 91  214 199 HOH HOH B . 
H 6 HOH 92  215 202 HOH HOH B . 
H 6 HOH 93  216 206 HOH HOH B . 
H 6 HOH 94  217 208 HOH HOH B . 
H 6 HOH 95  218 209 HOH HOH B . 
H 6 HOH 96  219 210 HOH HOH B . 
H 6 HOH 97  220 211 HOH HOH B . 
H 6 HOH 98  221 212 HOH HOH B . 
H 6 HOH 99  222 213 HOH HOH B . 
H 6 HOH 100 223 215 HOH HOH B . 
H 6 HOH 101 224 216 HOH HOH B . 
H 6 HOH 102 225 217 HOH HOH B . 
H 6 HOH 103 226 221 HOH HOH B . 
H 6 HOH 104 227 222 HOH HOH B . 
H 6 HOH 105 228 225 HOH HOH B . 
H 6 HOH 106 229 226 HOH HOH B . 
H 6 HOH 107 230 227 HOH HOH B . 
H 6 HOH 108 231 228 HOH HOH B . 
H 6 HOH 109 232 229 HOH HOH B . 
H 6 HOH 110 233 231 HOH HOH B . 
H 6 HOH 111 234 236 HOH HOH B . 
H 6 HOH 112 235 237 HOH HOH B . 
H 6 HOH 113 236 240 HOH HOH B . 
H 6 HOH 114 237 241 HOH HOH B . 
H 6 HOH 115 238 244 HOH HOH B . 
H 6 HOH 116 239 245 HOH HOH B . 
H 6 HOH 117 240 247 HOH HOH B . 
H 6 HOH 118 241 248 HOH HOH B . 
H 6 HOH 119 242 249 HOH HOH B . 
H 6 HOH 120 243 252 HOH HOH B . 
H 6 HOH 121 244 253 HOH HOH B . 
H 6 HOH 122 245 254 HOH HOH B . 
H 6 HOH 123 246 256 HOH HOH B . 
H 6 HOH 124 247 258 HOH HOH B . 
H 6 HOH 125 248 259 HOH HOH B . 
H 6 HOH 126 249 260 HOH HOH B . 
H 6 HOH 127 250 262 HOH HOH B . 
H 6 HOH 128 251 263 HOH HOH B . 
H 6 HOH 129 252 264 HOH HOH B . 
H 6 HOH 130 253 265 HOH HOH B . 
H 6 HOH 131 254 273 HOH HOH B . 
H 6 HOH 132 255 276 HOH HOH B . 
H 6 HOH 133 256 277 HOH HOH B . 
H 6 HOH 134 257 278 HOH HOH B . 
H 6 HOH 135 258 282 HOH HOH B . 
H 6 HOH 136 259 283 HOH HOH B . 
H 6 HOH 137 260 285 HOH HOH B . 
H 6 HOH 138 261 286 HOH HOH B . 
H 6 HOH 139 262 287 HOH HOH B . 
H 6 HOH 140 263 288 HOH HOH B . 
H 6 HOH 141 264 289 HOH HOH B . 
H 6 HOH 142 265 291 HOH HOH B . 
H 6 HOH 143 266 294 HOH HOH B . 
H 6 HOH 144 267 295 HOH HOH B . 
H 6 HOH 145 268 300 HOH HOH B . 
H 6 HOH 146 269 301 HOH HOH B . 
H 6 HOH 147 270 302 HOH HOH B . 
H 6 HOH 148 271 303 HOH HOH B . 
H 6 HOH 149 272 305 HOH HOH B . 
H 6 HOH 150 273 306 HOH HOH B . 
H 6 HOH 151 274 307 HOH HOH B . 
H 6 HOH 152 275 310 HOH HOH B . 
H 6 HOH 153 276 311 HOH HOH B . 
H 6 HOH 154 277 313 HOH HOH B . 
H 6 HOH 155 278 314 HOH HOH B . 
H 6 HOH 156 279 318 HOH HOH B . 
H 6 HOH 157 280 319 HOH HOH B . 
H 6 HOH 158 281 322 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric    2 
2 software_defined_assembly            PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D,E,F,G,H 
2 1,2 A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4170  ? 
1 MORE         -55   ? 
1 'SSA (A^2)'  12180 ? 
2 'ABSA (A^2)' 10490 ? 
2 MORE         -131  ? 
2 'SSA (A^2)'  22440 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 2_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A RB  402 ? D RB  . 
2 1 A HOH 562 ? G HOH . 
3 1 B HOH 270 ? H HOH . 
4 1 B HOH 271 ? H HOH . 
5 1 B HOH 280 ? H HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O ? G HOH .  ? A HOH 455 ? 1_555 RB ? D RB . ? A RB 402 ? 1_555 N ? A LYS 77 ? A LYS 77  ? 1_555 69.5  ? 
2  O ? G HOH .  ? A HOH 455 ? 1_555 RB ? D RB . ? A RB 402 ? 1_555 O ? G HOH .  ? A HOH 564 ? 1_555 120.8 ? 
3  N ? A LYS 77 ? A LYS 77  ? 1_555 RB ? D RB . ? A RB 402 ? 1_555 O ? G HOH .  ? A HOH 564 ? 1_555 92.5  ? 
4  O ? G HOH .  ? A HOH 455 ? 1_555 RB ? D RB . ? A RB 402 ? 1_555 N ? A LYS 77 ? A LYS 77  ? 2_555 102.2 ? 
5  N ? A LYS 77 ? A LYS 77  ? 1_555 RB ? D RB . ? A RB 402 ? 1_555 N ? A LYS 77 ? A LYS 77  ? 2_555 170.8 ? 
6  O ? G HOH .  ? A HOH 564 ? 1_555 RB ? D RB . ? A RB 402 ? 1_555 N ? A LYS 77 ? A LYS 77  ? 2_555 88.6  ? 
7  O ? G HOH .  ? A HOH 455 ? 1_555 RB ? D RB . ? A RB 402 ? 1_555 O ? G HOH .  ? A HOH 455 ? 2_555 58.8  ? 
8  N ? A LYS 77 ? A LYS 77  ? 1_555 RB ? D RB . ? A RB 402 ? 1_555 O ? G HOH .  ? A HOH 455 ? 2_555 102.2 ? 
9  O ? G HOH .  ? A HOH 564 ? 1_555 RB ? D RB . ? A RB 402 ? 1_555 O ? G HOH .  ? A HOH 455 ? 2_555 72.3  ? 
10 N ? A LYS 77 ? A LYS 77  ? 2_555 RB ? D RB . ? A RB 402 ? 1_555 O ? G HOH .  ? A HOH 455 ? 2_555 69.5  ? 
11 O ? G HOH .  ? A HOH 455 ? 1_555 RB ? D RB . ? A RB 402 ? 1_555 O ? G HOH .  ? A HOH 564 ? 2_555 72.3  ? 
12 N ? A LYS 77 ? A LYS 77  ? 1_555 RB ? D RB . ? A RB 402 ? 1_555 O ? G HOH .  ? A HOH 564 ? 2_555 88.6  ? 
13 O ? G HOH .  ? A HOH 564 ? 1_555 RB ? D RB . ? A RB 402 ? 1_555 O ? G HOH .  ? A HOH 564 ? 2_555 166.3 ? 
14 N ? A LYS 77 ? A LYS 77  ? 2_555 RB ? D RB . ? A RB 402 ? 1_555 O ? G HOH .  ? A HOH 564 ? 2_555 92.5  ? 
15 O ? G HOH .  ? A HOH 455 ? 2_555 RB ? D RB . ? A RB 402 ? 1_555 O ? G HOH .  ? A HOH 564 ? 2_555 120.8 ? 
16 O ? G HOH .  ? A HOH 428 ? 1_555 RB ? E RB . ? A RB 403 ? 1_555 O ? A CYS 2  ? A CYS 2   ? 1_555 150.3 ? 
17 O ? G HOH .  ? A HOH 428 ? 1_555 RB ? E RB . ? A RB 403 ? 1_555 O ? G HOH .  ? A HOH 437 ? 1_555 50.4  ? 
18 O ? A CYS 2  ? A CYS 2   ? 1_555 RB ? E RB . ? A RB 403 ? 1_555 O ? G HOH .  ? A HOH 437 ? 1_555 140.5 ? 
19 O ? G HOH .  ? A HOH 428 ? 1_555 RB ? E RB . ? A RB 403 ? 1_555 O ? A TRP 6  ? A TRP 6   ? 1_555 48.8  ? 
20 O ? A CYS 2  ? A CYS 2   ? 1_555 RB ? E RB . ? A RB 403 ? 1_555 O ? A TRP 6  ? A TRP 6   ? 1_555 102.0 ? 
21 O ? G HOH .  ? A HOH 437 ? 1_555 RB ? E RB . ? A RB 403 ? 1_555 O ? A TRP 6  ? A TRP 6   ? 1_555 90.0  ? 
22 O ? G HOH .  ? A HOH 428 ? 1_555 RB ? E RB . ? A RB 403 ? 1_555 O ? A ASP 1  ? A ASP 1   ? 1_555 126.9 ? 
23 O ? A CYS 2  ? A CYS 2   ? 1_555 RB ? E RB . ? A RB 403 ? 1_555 O ? A ASP 1  ? A ASP 1   ? 1_555 48.9  ? 
24 O ? G HOH .  ? A HOH 437 ? 1_555 RB ? E RB . ? A RB 403 ? 1_555 O ? A ASP 1  ? A ASP 1   ? 1_555 167.9 ? 
25 O ? A TRP 6  ? A TRP 6   ? 1_555 RB ? E RB . ? A RB 403 ? 1_555 O ? A ASP 1  ? A ASP 1   ? 1_555 94.7  ? 
26 O ? G HOH .  ? A HOH 428 ? 1_555 RB ? E RB . ? A RB 403 ? 1_555 O ? G HOH .  ? A HOH 540 ? 1_555 94.3  ? 
27 O ? A CYS 2  ? A CYS 2   ? 1_555 RB ? E RB . ? A RB 403 ? 1_555 O ? G HOH .  ? A HOH 540 ? 1_555 91.2  ? 
28 O ? G HOH .  ? A HOH 437 ? 1_555 RB ? E RB . ? A RB 403 ? 1_555 O ? G HOH .  ? A HOH 540 ? 1_555 126.3 ? 
29 O ? A TRP 6  ? A TRP 6   ? 1_555 RB ? E RB . ? A RB 403 ? 1_555 O ? G HOH .  ? A HOH 540 ? 1_555 91.6  ? 
30 O ? A ASP 1  ? A ASP 1   ? 1_555 RB ? E RB . ? A RB 403 ? 1_555 O ? G HOH .  ? A HOH 540 ? 1_555 42.6  ? 
31 O ? G HOH .  ? A HOH 428 ? 1_555 RB ? E RB . ? A RB 403 ? 1_555 O ? A PRO 3  ? A PRO 3   ? 1_555 97.7  ? 
32 O ? A CYS 2  ? A CYS 2   ? 1_555 RB ? E RB . ? A RB 403 ? 1_555 O ? A PRO 3  ? A PRO 3   ? 1_555 59.7  ? 
33 O ? G HOH .  ? A HOH 437 ? 1_555 RB ? E RB . ? A RB 403 ? 1_555 O ? A PRO 3  ? A PRO 3   ? 1_555 92.8  ? 
34 O ? A TRP 6  ? A TRP 6   ? 1_555 RB ? E RB . ? A RB 403 ? 1_555 O ? A PRO 3  ? A PRO 3   ? 1_555 66.5  ? 
35 O ? A ASP 1  ? A ASP 1   ? 1_555 RB ? E RB . ? A RB 403 ? 1_555 O ? A PRO 3  ? A PRO 3   ? 1_555 99.3  ? 
36 O ? G HOH .  ? A HOH 540 ? 1_555 RB ? E RB . ? A RB 403 ? 1_555 O ? A PRO 3  ? A PRO 3   ? 1_555 136.1 ? 
37 O ? G HOH .  ? A HOH 428 ? 1_555 RB ? E RB . ? A RB 403 ? 1_555 O ? H HOH .  ? B HOH 268 ? 1_546 120.7 ? 
38 O ? A CYS 2  ? A CYS 2   ? 1_555 RB ? E RB . ? A RB 403 ? 1_555 O ? H HOH .  ? B HOH 268 ? 1_546 83.0  ? 
39 O ? G HOH .  ? A HOH 437 ? 1_555 RB ? E RB . ? A RB 403 ? 1_555 O ? H HOH .  ? B HOH 268 ? 1_546 71.4  ? 
40 O ? A TRP 6  ? A TRP 6   ? 1_555 RB ? E RB . ? A RB 403 ? 1_555 O ? H HOH .  ? B HOH 268 ? 1_546 153.9 ? 
41 O ? A ASP 1  ? A ASP 1   ? 1_555 RB ? E RB . ? A RB 403 ? 1_555 O ? H HOH .  ? B HOH 268 ? 1_546 107.2 ? 
42 O ? G HOH .  ? A HOH 540 ? 1_555 RB ? E RB . ? A RB 403 ? 1_555 O ? H HOH .  ? B HOH 268 ? 1_546 114.0 ? 
43 O ? A PRO 3  ? A PRO 3   ? 1_555 RB ? E RB . ? A RB 403 ? 1_555 O ? H HOH .  ? B HOH 268 ? 1_546 95.5  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-10-04 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS   refinement 1.1 ? 1 
AMoRE phasing    .   ? 2 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 CYS A 2   ? ? 75.21   139.75 
2  1 TYR A 9   ? ? -160.46 116.55 
3  1 GLU A 10  ? ? 32.29   73.36  
4  1 SER A 90  ? ? -120.23 -78.27 
5  1 ASN A 93  ? ? -145.60 57.75  
6  1 TYR B 9   ? ? -166.12 101.29 
7  1 GLU B 19  ? ? -58.27  109.50 
8  1 HIS B 34  ? ? -179.25 149.20 
9  1 ASN B 70  ? ? 33.40   57.75  
10 1 ARG B 86  ? ? -131.54 -59.88 
11 1 ALA B 89  ? ? -149.57 43.82  
12 1 SER B 101 ? ? -51.75  -7.92  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'CHLORIDE ION' CL  
4 'RUBIDIUM ION' RB  
5 'SULFATE ION'  SO4 
6 water          HOH 
#