data_1X5G
# 
_entry.id   1X5G 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1X5G         
RCSB  RCSB024402   
WWPDB D_1000024402 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hso002001179.2 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1X5G 
_pdbx_database_status.recvd_initial_deposition_date   2005-05-15 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tochio, N.'                                             1 
'Koshiba, S.'                                            2 
'Inoue, M.'                                              3 
'Kigawa, T.'                                             4 
'Yokoyama, S.'                                           5 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 
# 
_citation.id                        primary 
_citation.title                     'The solution structure of the second fibronectin type III domain of human Neogenin' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tochio, N.'   1 
primary 'Koshiba, S.'  2 
primary 'Inoue, M.'    3 
primary 'Kigawa, T.'   4 
primary 'Yokoyama, S.' 5 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           Neogenin 
_entity.formula_weight             12415.506 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'fn3 domain' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGRVETQPEVQLPGPAPNLRAYAASPTSITVTWETPVSGNGEIQNYKLYYMEKGTDKEQDVDVSSHSYTINGLKK
YTEYSFRVVAYNKHGPGVSTPDVAVRTLSDSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGRVETQPEVQLPGPAPNLRAYAASPTSITVTWETPVSGNGEIQNYKLYYMEKGTDKEQDVDVSSHSYTINGLKK
YTEYSFRVVAYNKHGPGVSTPDVAVRTLSDSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hso002001179.2 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   ARG n 
1 9   VAL n 
1 10  GLU n 
1 11  THR n 
1 12  GLN n 
1 13  PRO n 
1 14  GLU n 
1 15  VAL n 
1 16  GLN n 
1 17  LEU n 
1 18  PRO n 
1 19  GLY n 
1 20  PRO n 
1 21  ALA n 
1 22  PRO n 
1 23  ASN n 
1 24  LEU n 
1 25  ARG n 
1 26  ALA n 
1 27  TYR n 
1 28  ALA n 
1 29  ALA n 
1 30  SER n 
1 31  PRO n 
1 32  THR n 
1 33  SER n 
1 34  ILE n 
1 35  THR n 
1 36  VAL n 
1 37  THR n 
1 38  TRP n 
1 39  GLU n 
1 40  THR n 
1 41  PRO n 
1 42  VAL n 
1 43  SER n 
1 44  GLY n 
1 45  ASN n 
1 46  GLY n 
1 47  GLU n 
1 48  ILE n 
1 49  GLN n 
1 50  ASN n 
1 51  TYR n 
1 52  LYS n 
1 53  LEU n 
1 54  TYR n 
1 55  TYR n 
1 56  MET n 
1 57  GLU n 
1 58  LYS n 
1 59  GLY n 
1 60  THR n 
1 61  ASP n 
1 62  LYS n 
1 63  GLU n 
1 64  GLN n 
1 65  ASP n 
1 66  VAL n 
1 67  ASP n 
1 68  VAL n 
1 69  SER n 
1 70  SER n 
1 71  HIS n 
1 72  SER n 
1 73  TYR n 
1 74  THR n 
1 75  ILE n 
1 76  ASN n 
1 77  GLY n 
1 78  LEU n 
1 79  LYS n 
1 80  LYS n 
1 81  TYR n 
1 82  THR n 
1 83  GLU n 
1 84  TYR n 
1 85  SER n 
1 86  PHE n 
1 87  ARG n 
1 88  VAL n 
1 89  VAL n 
1 90  ALA n 
1 91  TYR n 
1 92  ASN n 
1 93  LYS n 
1 94  HIS n 
1 95  GLY n 
1 96  PRO n 
1 97  GLY n 
1 98  VAL n 
1 99  SER n 
1 100 THR n 
1 101 PRO n 
1 102 ASP n 
1 103 VAL n 
1 104 ALA n 
1 105 VAL n 
1 106 ARG n 
1 107 THR n 
1 108 LEU n 
1 109 SER n 
1 110 ASP n 
1 111 SER n 
1 112 GLY n 
1 113 PRO n 
1 114 SER n 
1 115 SER n 
1 116 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 NEO1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P041213-03 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NEO1_HUMAN 
_struct_ref.pdbx_db_accession          Q92859 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RVETQPEVQLPGPAPNLRAYAASPTSITVTWETPVSGNGEIQNYKLYYMEKGTDKEQDVDVSSHSYTINGLKKYTEYSFR
VVAYNKHGPGVSTPDVAVRTLSD
;
_struct_ref.pdbx_align_begin           529 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1X5G 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 110 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q92859 
_struct_ref_seq.db_align_beg                  529 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  631 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       110 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1X5G GLY A 1   ? UNP Q92859 ? ? 'CLONING ARTIFACT' 1   1  
1 1X5G SER A 2   ? UNP Q92859 ? ? 'CLONING ARTIFACT' 2   2  
1 1X5G SER A 3   ? UNP Q92859 ? ? 'CLONING ARTIFACT' 3   3  
1 1X5G GLY A 4   ? UNP Q92859 ? ? 'CLONING ARTIFACT' 4   4  
1 1X5G SER A 5   ? UNP Q92859 ? ? 'CLONING ARTIFACT' 5   5  
1 1X5G SER A 6   ? UNP Q92859 ? ? 'CLONING ARTIFACT' 6   6  
1 1X5G GLY A 7   ? UNP Q92859 ? ? 'CLONING ARTIFACT' 7   7  
1 1X5G SER A 111 ? UNP Q92859 ? ? 'CLONING ARTIFACT' 111 8  
1 1X5G GLY A 112 ? UNP Q92859 ? ? 'CLONING ARTIFACT' 112 9  
1 1X5G PRO A 113 ? UNP Q92859 ? ? 'CLONING ARTIFACT' 113 10 
1 1X5G SER A 114 ? UNP Q92859 ? ? 'CLONING ARTIFACT' 114 11 
1 1X5G SER A 115 ? UNP Q92859 ? ? 'CLONING ARTIFACT' 115 12 
1 1X5G GLY A 116 ? UNP Q92859 ? ? 'CLONING ARTIFACT' 116 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '1.9mM FN3 domain U-15N,13C; 20mM d-Tris HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    900 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           1X5G 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1X5G 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function,structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1X5G 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XWINNMR 3.5      Bruker          1 
processing           NMRPipe 20031121 'Delaglio, F.'  2 
'data analysis'      NMRView 5.0.4    'Johnson, B.A.' 3 
'data analysis'      KUJIRA  0.9295   'Kobayashi, N.' 4 
'structure solution' CYANA   2.0.17   'Guntert, P.'   5 
refinement           CYANA   2.0.17   'Guntert, P.'   6 
# 
_exptl.entry_id          1X5G 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1X5G 
_struct.title                     'The solution structure of the second fibronectin type III domain of human Neogenin' 
_struct.pdbx_descriptor           Neogenin 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1X5G 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            
;RGM binding, fibronectin type III domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL ADHESION
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 25  ? SER A 30  ? ARG A 25  SER A 30  
A 2 SER A 33  ? THR A 37  ? SER A 33  THR A 37  
A 3 SER A 72  ? ILE A 75  ? SER A 72  ILE A 75  
B 1 VAL A 66  ? VAL A 68  ? VAL A 66  VAL A 68  
B 2 ASN A 50  ? GLU A 57  ? ASN A 50  GLU A 57  
B 3 GLU A 83  ? TYR A 91  ? GLU A 83  TYR A 91  
B 4 VAL A 105 ? ARG A 106 ? VAL A 105 ARG A 106 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 25 ? N ARG A 25 O THR A 37  ? O THR A 37  
A 2 3 N ILE A 34 ? N ILE A 34 O ILE A 75  ? O ILE A 75  
B 1 2 O VAL A 68 ? O VAL A 68 N TYR A 51  ? N TYR A 51  
B 2 3 N MET A 56 ? N MET A 56 O SER A 85  ? O SER A 85  
B 3 4 N TYR A 84 ? N TYR A 84 O VAL A 105 ? O VAL A 105 
# 
_database_PDB_matrix.entry_id          1X5G 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1X5G 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? 5.410   -2.636  13.385  1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? 6.152   -2.635  12.137  1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? 7.341   -3.574  12.169  1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? 8.470   -3.149  12.414  1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? 5.891   -2.636  14.239  1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? 5.491   -2.934  11.338  1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? 6.505   -1.632  11.943  1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? 7.088   -4.855  11.922  1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? 8.146   -5.859  11.930  1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? 8.651   -6.125  10.515  1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? 8.069   -6.919  9.775   1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? 7.641   -7.159  12.557  1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? 7.538   -7.040  13.965  1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? 6.167   -5.133  11.734  1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? 8.962   -5.476  12.524  1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? 6.667   -7.395  12.155  1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? 8.329   -7.959  12.324  1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? 8.376   -7.277  14.369  1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? 9.739   -5.456  10.145  1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? 10.321  -5.617  8.818   1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? 11.411  -6.685  8.829   1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? 12.128  -6.846  9.816   1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? 10.898  -4.288  8.327   1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? 11.227  -4.354  6.950   1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? 10.158  -4.838  10.780  1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? 9.535   -5.929  8.147   1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? 10.169  -3.506  8.473   1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? 11.792  -4.057  8.888   1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? 10.424  -4.304  6.426   1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? 11.530  -7.412  7.722   1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? 12.535  -8.455  7.625   1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? 12.328  -9.347  6.417   1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? 13.288  -9.730  5.748   1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? 10.931  -7.238  6.966   1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? 13.510  -7.996  7.557   1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? 12.494  -9.062  8.517   1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? 11.072  -9.681  6.137   1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? 10.743  -10.538 5.005   1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? 11.683  -10.275 3.832   1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? 11.618  -9.224  3.194   1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? 9.293   -10.312 4.571   1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? 8.796   -11.428 3.852   1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? 10.350  -9.344  6.708   1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? 10.859  -11.564 5.321   1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? 8.678   -10.160 5.445   1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? 9.242   -9.438  3.938   1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? 8.866   -11.258 2.910   1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? 12.557  -11.237 3.555   1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? 13.514  -11.109 2.463   1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? 13.327  -12.228 1.443   1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? 12.536  -13.147 1.650   1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? 14.945  -11.131 3.004   1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? 15.366  -12.456 3.280   1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? 12.560  -12.051 4.101   1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? 13.337  -10.161 1.976   1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? 15.611  -10.700 2.273   1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? 14.990  -10.554 3.917   1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? 16.293  -12.453 3.527   1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? 14.063  -12.143 0.338   1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? 13.965  -13.153 -0.698  1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? 15.289  -13.841 -0.966  1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? 16.338  -13.198 -0.980  1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? 14.678  -11.387 0.227   1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? 13.240  -13.895 -0.396  1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? 13.625  -12.685 -1.611  1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . ARG A 1 8   ? 15.241  -15.153 -1.176  1.00 0.00 ? 8   ARG A N    1  
ATOM 67    C CA   . ARG A 1 8   ? 16.446  -15.928 -1.441  1.00 0.00 ? 8   ARG A CA   1  
ATOM 68    C C    . ARG A 1 8   ? 16.748  -15.971 -2.936  1.00 0.00 ? 8   ARG A C    1  
ATOM 69    O O    . ARG A 1 8   ? 16.515  -16.982 -3.598  1.00 0.00 ? 8   ARG A O    1  
ATOM 70    C CB   . ARG A 1 8   ? 16.292  -17.351 -0.900  1.00 0.00 ? 8   ARG A CB   1  
ATOM 71    C CG   . ARG A 1 8   ? 17.600  -18.123 -0.835  1.00 0.00 ? 8   ARG A CG   1  
ATOM 72    C CD   . ARG A 1 8   ? 17.371  -19.619 -0.984  1.00 0.00 ? 8   ARG A CD   1  
ATOM 73    N NE   . ARG A 1 8   ? 18.457  -20.400 -0.398  1.00 0.00 ? 8   ARG A NE   1  
ATOM 74    C CZ   . ARG A 1 8   ? 18.684  -20.478 0.909   1.00 0.00 ? 8   ARG A CZ   1  
ATOM 75    N NH1  . ARG A 1 8   ? 17.904  -19.827 1.761   1.00 0.00 ? 8   ARG A NH1  1  
ATOM 76    N NH2  . ARG A 1 8   ? 19.693  -21.209 1.366   1.00 0.00 ? 8   ARG A NH2  1  
ATOM 77    H H    . ARG A 1 8   ? 14.374  -15.610 -1.152  1.00 0.00 ? 8   ARG A H    1  
ATOM 78    H HA   . ARG A 1 8   ? 17.269  -15.447 -0.933  1.00 0.00 ? 8   ARG A HA   1  
ATOM 79    H HB2  . ARG A 1 8   ? 15.879  -17.302 0.097   1.00 0.00 ? 8   ARG A HB2  1  
ATOM 80    H HB3  . ARG A 1 8   ? 15.610  -17.893 -1.537  1.00 0.00 ? 8   ARG A HB3  1  
ATOM 81    H HG2  . ARG A 1 8   ? 18.245  -17.788 -1.634  1.00 0.00 ? 8   ARG A HG2  1  
ATOM 82    H HG3  . ARG A 1 8   ? 18.072  -17.933 0.117   1.00 0.00 ? 8   ARG A HG3  1  
ATOM 83    H HD2  . ARG A 1 8   ? 16.447  -19.880 -0.490  1.00 0.00 ? 8   ARG A HD2  1  
ATOM 84    H HD3  . ARG A 1 8   ? 17.296  -19.855 -2.035  1.00 0.00 ? 8   ARG A HD3  1  
ATOM 85    H HE   . ARG A 1 8   ? 19.046  -20.889 -1.009  1.00 0.00 ? 8   ARG A HE   1  
ATOM 86    H HH11 . ARG A 1 8   ? 17.143  -19.276 1.419   1.00 0.00 ? 8   ARG A HH11 1  
ATOM 87    H HH12 . ARG A 1 8   ? 18.076  -19.889 2.744   1.00 0.00 ? 8   ARG A HH12 1  
ATOM 88    H HH21 . ARG A 1 8   ? 20.283  -21.702 0.727   1.00 0.00 ? 8   ARG A HH21 1  
ATOM 89    H HH22 . ARG A 1 8   ? 19.863  -21.267 2.349   1.00 0.00 ? 8   ARG A HH22 1  
ATOM 90    N N    . VAL A 1 9   ? 17.267  -14.866 -3.461  1.00 0.00 ? 9   VAL A N    1  
ATOM 91    C CA   . VAL A 1 9   ? 17.601  -14.777 -4.878  1.00 0.00 ? 9   VAL A CA   1  
ATOM 92    C C    . VAL A 1 9   ? 19.024  -14.265 -5.076  1.00 0.00 ? 9   VAL A C    1  
ATOM 93    O O    . VAL A 1 9   ? 19.359  -13.158 -4.656  1.00 0.00 ? 9   VAL A O    1  
ATOM 94    C CB   . VAL A 1 9   ? 16.625  -13.850 -5.627  1.00 0.00 ? 9   VAL A CB   1  
ATOM 95    C CG1  . VAL A 1 9   ? 15.227  -14.449 -5.644  1.00 0.00 ? 9   VAL A CG1  1  
ATOM 96    C CG2  . VAL A 1 9   ? 16.614  -12.466 -4.997  1.00 0.00 ? 9   VAL A CG2  1  
ATOM 97    H H    . VAL A 1 9   ? 17.430  -14.092 -2.882  1.00 0.00 ? 9   VAL A H    1  
ATOM 98    H HA   . VAL A 1 9   ? 17.522  -15.767 -5.302  1.00 0.00 ? 9   VAL A HA   1  
ATOM 99    H HB   . VAL A 1 9   ? 16.964  -13.755 -6.649  1.00 0.00 ? 9   VAL A HB   1  
ATOM 100   H HG11 . VAL A 1 9   ? 15.016  -14.844 -6.627  1.00 0.00 ? 9   VAL A HG11 1  
ATOM 101   H HG12 . VAL A 1 9   ? 15.166  -15.243 -4.914  1.00 0.00 ? 9   VAL A HG12 1  
ATOM 102   H HG13 . VAL A 1 9   ? 14.505  -13.682 -5.403  1.00 0.00 ? 9   VAL A HG13 1  
ATOM 103   H HG21 . VAL A 1 9   ? 16.831  -12.550 -3.942  1.00 0.00 ? 9   VAL A HG21 1  
ATOM 104   H HG22 . VAL A 1 9   ? 17.364  -11.849 -5.470  1.00 0.00 ? 9   VAL A HG22 1  
ATOM 105   H HG23 . VAL A 1 9   ? 15.642  -12.017 -5.131  1.00 0.00 ? 9   VAL A HG23 1  
ATOM 106   N N    . GLU A 1 10  ? 19.855  -15.079 -5.718  1.00 0.00 ? 10  GLU A N    1  
ATOM 107   C CA   . GLU A 1 10  ? 21.242  -14.709 -5.972  1.00 0.00 ? 10  GLU A CA   1  
ATOM 108   C C    . GLU A 1 10  ? 21.357  -13.858 -7.233  1.00 0.00 ? 10  GLU A C    1  
ATOM 109   O O    . GLU A 1 10  ? 22.307  -13.993 -8.004  1.00 0.00 ? 10  GLU A O    1  
ATOM 110   C CB   . GLU A 1 10  ? 22.112  -15.960 -6.107  1.00 0.00 ? 10  GLU A CB   1  
ATOM 111   C CG   . GLU A 1 10  ? 23.603  -15.674 -6.060  1.00 0.00 ? 10  GLU A CG   1  
ATOM 112   C CD   . GLU A 1 10  ? 24.425  -16.740 -6.759  1.00 0.00 ? 10  GLU A CD   1  
ATOM 113   O OE1  . GLU A 1 10  ? 24.807  -17.725 -6.093  1.00 0.00 ? 10  GLU A OE1  1  
ATOM 114   O OE2  . GLU A 1 10  ? 24.686  -16.588 -7.971  1.00 0.00 ? 10  GLU A OE2  1  
ATOM 115   H H    . GLU A 1 10  ? 19.528  -15.950 -6.029  1.00 0.00 ? 10  GLU A H    1  
ATOM 116   H HA   . GLU A 1 10  ? 21.590  -14.130 -5.129  1.00 0.00 ? 10  GLU A HA   1  
ATOM 117   H HB2  . GLU A 1 10  ? 21.870  -16.641 -5.304  1.00 0.00 ? 10  GLU A HB2  1  
ATOM 118   H HB3  . GLU A 1 10  ? 21.888  -16.438 -7.050  1.00 0.00 ? 10  GLU A HB3  1  
ATOM 119   H HG2  . GLU A 1 10  ? 23.790  -14.725 -6.539  1.00 0.00 ? 10  GLU A HG2  1  
ATOM 120   H HG3  . GLU A 1 10  ? 23.914  -15.621 -5.027  1.00 0.00 ? 10  GLU A HG3  1  
ATOM 121   N N    . THR A 1 11  ? 20.379  -12.980 -7.438  1.00 0.00 ? 11  THR A N    1  
ATOM 122   C CA   . THR A 1 11  ? 20.368  -12.108 -8.606  1.00 0.00 ? 11  THR A CA   1  
ATOM 123   C C    . THR A 1 11  ? 19.800  -10.736 -8.262  1.00 0.00 ? 11  THR A C    1  
ATOM 124   O O    . THR A 1 11  ? 19.414  -10.482 -7.121  1.00 0.00 ? 11  THR A O    1  
ATOM 125   C CB   . THR A 1 11  ? 19.544  -12.719 -9.755  1.00 0.00 ? 11  THR A CB   1  
ATOM 126   O OG1  . THR A 1 11  ? 18.172  -12.842 -9.363  1.00 0.00 ? 11  THR A OG1  1  
ATOM 127   C CG2  . THR A 1 11  ? 20.090  -14.084 -10.146 1.00 0.00 ? 11  THR A CG2  1  
ATOM 128   H H    . THR A 1 11  ? 19.649  -12.919 -6.788  1.00 0.00 ? 11  THR A H    1  
ATOM 129   H HA   . THR A 1 11  ? 21.387  -11.990 -8.945  1.00 0.00 ? 11  THR A HA   1  
ATOM 130   H HB   . THR A 1 11  ? 19.608  -12.063 -10.612 1.00 0.00 ? 11  THR A HB   1  
ATOM 131   H HG1  . THR A 1 11  ? 18.006  -12.284 -8.600  1.00 0.00 ? 11  THR A HG1  1  
ATOM 132   H HG21 . THR A 1 11  ? 19.336  -14.629 -10.695 1.00 0.00 ? 11  THR A HG21 1  
ATOM 133   H HG22 . THR A 1 11  ? 20.355  -14.634 -9.256  1.00 0.00 ? 11  THR A HG22 1  
ATOM 134   H HG23 . THR A 1 11  ? 20.965  -13.957 -10.766 1.00 0.00 ? 11  THR A HG23 1  
ATOM 135   N N    . GLN A 1 12  ? 19.750  -9.855  -9.256  1.00 0.00 ? 12  GLN A N    1  
ATOM 136   C CA   . GLN A 1 12  ? 19.228  -8.508  -9.057  1.00 0.00 ? 12  GLN A CA   1  
ATOM 137   C C    . GLN A 1 12  ? 18.291  -8.113  -10.194 1.00 0.00 ? 12  GLN A C    1  
ATOM 138   O O    . GLN A 1 12  ? 18.492  -8.481  -11.352 1.00 0.00 ? 12  GLN A O    1  
ATOM 139   C CB   . GLN A 1 12  ? 20.377  -7.503  -8.955  1.00 0.00 ? 12  GLN A CB   1  
ATOM 140   C CG   . GLN A 1 12  ? 21.400  -7.855  -7.887  1.00 0.00 ? 12  GLN A CG   1  
ATOM 141   C CD   . GLN A 1 12  ? 22.790  -7.350  -8.222  1.00 0.00 ? 12  GLN A CD   1  
ATOM 142   O OE1  . GLN A 1 12  ? 23.014  -6.145  -8.339  1.00 0.00 ? 12  GLN A OE1  1  
ATOM 143   N NE2  . GLN A 1 12  ? 23.733  -8.272  -8.377  1.00 0.00 ? 12  GLN A NE2  1  
ATOM 144   H H    . GLN A 1 12  ? 20.072  -10.116 -10.143 1.00 0.00 ? 12  GLN A H    1  
ATOM 145   H HA   . GLN A 1 12  ? 18.673  -8.501  -8.131  1.00 0.00 ? 12  GLN A HA   1  
ATOM 146   H HB2  . GLN A 1 12  ? 20.884  -7.456  -9.907  1.00 0.00 ? 12  GLN A HB2  1  
ATOM 147   H HB3  . GLN A 1 12  ? 19.969  -6.530  -8.725  1.00 0.00 ? 12  GLN A HB3  1  
ATOM 148   H HG2  . GLN A 1 12  ? 21.090  -7.414  -6.951  1.00 0.00 ? 12  GLN A HG2  1  
ATOM 149   H HG3  . GLN A 1 12  ? 21.438  -8.929  -7.783  1.00 0.00 ? 12  GLN A HG3  1  
ATOM 150   H HE21 . GLN A 1 12  ? 23.481  -9.214  -8.270  1.00 0.00 ? 12  GLN A HE21 1  
ATOM 151   H HE22 . GLN A 1 12  ? 24.640  -7.975  -8.595  1.00 0.00 ? 12  GLN A HE22 1  
ATOM 152   N N    . PRO A 1 13  ? 17.243  -7.348  -9.858  1.00 0.00 ? 13  PRO A N    1  
ATOM 153   C CA   . PRO A 1 13  ? 16.254  -6.887  -10.837 1.00 0.00 ? 13  PRO A CA   1  
ATOM 154   C C    . PRO A 1 13  ? 16.828  -5.850  -11.797 1.00 0.00 ? 13  PRO A C    1  
ATOM 155   O O    . PRO A 1 13  ? 18.044  -5.698  -11.905 1.00 0.00 ? 13  PRO A O    1  
ATOM 156   C CB   . PRO A 1 13  ? 15.159  -6.262  -9.969  1.00 0.00 ? 13  PRO A CB   1  
ATOM 157   C CG   . PRO A 1 13  ? 15.855  -5.856  -8.716  1.00 0.00 ? 13  PRO A CG   1  
ATOM 158   C CD   . PRO A 1 13  ? 16.942  -6.872  -8.497  1.00 0.00 ? 13  PRO A CD   1  
ATOM 159   H HA   . PRO A 1 13  ? 15.841  -7.710  -11.402 1.00 0.00 ? 13  PRO A HA   1  
ATOM 160   H HB2  . PRO A 1 13  ? 14.733  -5.410  -10.479 1.00 0.00 ? 13  PRO A HB2  1  
ATOM 161   H HB3  . PRO A 1 13  ? 14.389  -6.993  -9.773  1.00 0.00 ? 13  PRO A HB3  1  
ATOM 162   H HG2  . PRO A 1 13  ? 16.281  -4.871  -8.835  1.00 0.00 ? 13  PRO A HG2  1  
ATOM 163   H HG3  . PRO A 1 13  ? 15.160  -5.868  -7.890  1.00 0.00 ? 13  PRO A HG3  1  
ATOM 164   H HD2  . PRO A 1 13  ? 17.808  -6.408  -8.050  1.00 0.00 ? 13  PRO A HD2  1  
ATOM 165   H HD3  . PRO A 1 13  ? 16.582  -7.681  -7.878  1.00 0.00 ? 13  PRO A HD3  1  
ATOM 166   N N    . GLU A 1 14  ? 15.945  -5.140  -12.492 1.00 0.00 ? 14  GLU A N    1  
ATOM 167   C CA   . GLU A 1 14  ? 16.366  -4.119  -13.444 1.00 0.00 ? 14  GLU A CA   1  
ATOM 168   C C    . GLU A 1 14  ? 17.335  -3.136  -12.793 1.00 0.00 ? 14  GLU A C    1  
ATOM 169   O O    . GLU A 1 14  ? 17.711  -3.294  -11.632 1.00 0.00 ? 14  GLU A O    1  
ATOM 170   C CB   . GLU A 1 14  ? 15.150  -3.367  -13.990 1.00 0.00 ? 14  GLU A CB   1  
ATOM 171   C CG   . GLU A 1 14  ? 14.562  -3.990  -15.244 1.00 0.00 ? 14  GLU A CG   1  
ATOM 172   C CD   . GLU A 1 14  ? 13.102  -3.632  -15.444 1.00 0.00 ? 14  GLU A CD   1  
ATOM 173   O OE1  . GLU A 1 14  ? 12.257  -4.132  -14.673 1.00 0.00 ? 14  GLU A OE1  1  
ATOM 174   O OE2  . GLU A 1 14  ? 12.805  -2.850  -16.372 1.00 0.00 ? 14  GLU A OE2  1  
ATOM 175   H H    . GLU A 1 14  ? 14.988  -5.308  -12.363 1.00 0.00 ? 14  GLU A H    1  
ATOM 176   H HA   . GLU A 1 14  ? 16.868  -4.613  -14.261 1.00 0.00 ? 14  GLU A HA   1  
ATOM 177   H HB2  . GLU A 1 14  ? 14.383  -3.345  -13.229 1.00 0.00 ? 14  GLU A HB2  1  
ATOM 178   H HB3  . GLU A 1 14  ? 15.443  -2.353  -14.220 1.00 0.00 ? 14  GLU A HB3  1  
ATOM 179   H HG2  . GLU A 1 14  ? 15.122  -3.643  -16.100 1.00 0.00 ? 14  GLU A HG2  1  
ATOM 180   H HG3  . GLU A 1 14  ? 14.647  -5.064  -15.171 1.00 0.00 ? 14  GLU A HG3  1  
ATOM 181   N N    . VAL A 1 15  ? 17.737  -2.121  -13.551 1.00 0.00 ? 15  VAL A N    1  
ATOM 182   C CA   . VAL A 1 15  ? 18.663  -1.112  -13.050 1.00 0.00 ? 15  VAL A CA   1  
ATOM 183   C C    . VAL A 1 15  ? 18.031  0.275   -13.076 1.00 0.00 ? 15  VAL A C    1  
ATOM 184   O O    . VAL A 1 15  ? 18.590  1.232   -12.543 1.00 0.00 ? 15  VAL A O    1  
ATOM 185   C CB   . VAL A 1 15  ? 19.965  -1.086  -13.873 1.00 0.00 ? 15  VAL A CB   1  
ATOM 186   C CG1  . VAL A 1 15  ? 20.966  -0.121  -13.258 1.00 0.00 ? 15  VAL A CG1  1  
ATOM 187   C CG2  . VAL A 1 15  ? 20.555  -2.484  -13.979 1.00 0.00 ? 15  VAL A CG2  1  
ATOM 188   H H    . VAL A 1 15  ? 17.403  -2.049  -14.470 1.00 0.00 ? 15  VAL A H    1  
ATOM 189   H HA   . VAL A 1 15  ? 18.912  -1.365  -12.030 1.00 0.00 ? 15  VAL A HA   1  
ATOM 190   H HB   . VAL A 1 15  ? 19.730  -0.741  -14.869 1.00 0.00 ? 15  VAL A HB   1  
ATOM 191   H HG11 . VAL A 1 15  ? 20.605  0.891   -13.368 1.00 0.00 ? 15  VAL A HG11 1  
ATOM 192   H HG12 . VAL A 1 15  ? 21.088  -0.348  -12.209 1.00 0.00 ? 15  VAL A HG12 1  
ATOM 193   H HG13 . VAL A 1 15  ? 21.917  -0.220  -13.761 1.00 0.00 ? 15  VAL A HG13 1  
ATOM 194   H HG21 . VAL A 1 15  ? 19.806  -3.163  -14.358 1.00 0.00 ? 15  VAL A HG21 1  
ATOM 195   H HG22 . VAL A 1 15  ? 21.400  -2.469  -14.653 1.00 0.00 ? 15  VAL A HG22 1  
ATOM 196   H HG23 . VAL A 1 15  ? 20.880  -2.813  -13.003 1.00 0.00 ? 15  VAL A HG23 1  
ATOM 197   N N    . GLN A 1 16  ? 16.861  0.374   -13.700 1.00 0.00 ? 16  GLN A N    1  
ATOM 198   C CA   . GLN A 1 16  ? 16.153  1.645   -13.796 1.00 0.00 ? 16  GLN A CA   1  
ATOM 199   C C    . GLN A 1 16  ? 14.707  1.498   -13.334 1.00 0.00 ? 16  GLN A C    1  
ATOM 200   O O    . GLN A 1 16  ? 13.785  1.452   -14.149 1.00 0.00 ? 16  GLN A O    1  
ATOM 201   C CB   . GLN A 1 16  ? 16.191  2.168   -15.233 1.00 0.00 ? 16  GLN A CB   1  
ATOM 202   C CG   . GLN A 1 16  ? 17.568  2.638   -15.673 1.00 0.00 ? 16  GLN A CG   1  
ATOM 203   C CD   . GLN A 1 16  ? 17.519  3.506   -16.915 1.00 0.00 ? 16  GLN A CD   1  
ATOM 204   O OE1  . GLN A 1 16  ? 17.708  4.720   -16.845 1.00 0.00 ? 16  GLN A OE1  1  
ATOM 205   N NE2  . GLN A 1 16  ? 17.264  2.886   -18.061 1.00 0.00 ? 16  GLN A NE2  1  
ATOM 206   H H    . GLN A 1 16  ? 16.466  -0.425  -14.105 1.00 0.00 ? 16  GLN A H    1  
ATOM 207   H HA   . GLN A 1 16  ? 16.653  2.353   -13.152 1.00 0.00 ? 16  GLN A HA   1  
ATOM 208   H HB2  . GLN A 1 16  ? 15.873  1.379   -15.898 1.00 0.00 ? 16  GLN A HB2  1  
ATOM 209   H HB3  . GLN A 1 16  ? 15.506  2.999   -15.319 1.00 0.00 ? 16  GLN A HB3  1  
ATOM 210   H HG2  . GLN A 1 16  ? 18.013  3.209   -14.871 1.00 0.00 ? 16  GLN A HG2  1  
ATOM 211   H HG3  . GLN A 1 16  ? 18.180  1.772   -15.880 1.00 0.00 ? 16  GLN A HG3  1  
ATOM 212   H HE21 . GLN A 1 16  ? 17.122  1.916   -18.040 1.00 0.00 ? 16  GLN A HE21 1  
ATOM 213   H HE22 . GLN A 1 16  ? 17.226  3.422   -18.879 1.00 0.00 ? 16  GLN A HE22 1  
ATOM 214   N N    . LEU A 1 17  ? 14.515  1.425   -12.021 1.00 0.00 ? 17  LEU A N    1  
ATOM 215   C CA   . LEU A 1 17  ? 13.180  1.283   -11.450 1.00 0.00 ? 17  LEU A CA   1  
ATOM 216   C C    . LEU A 1 17  ? 12.873  2.430   -10.492 1.00 0.00 ? 17  LEU A C    1  
ATOM 217   O O    . LEU A 1 17  ? 13.769  3.107   -9.988  1.00 0.00 ? 17  LEU A O    1  
ATOM 218   C CB   . LEU A 1 17  ? 13.057  -0.055  -10.718 1.00 0.00 ? 17  LEU A CB   1  
ATOM 219   C CG   . LEU A 1 17  ? 12.554  -1.233  -11.553 1.00 0.00 ? 17  LEU A CG   1  
ATOM 220   C CD1  . LEU A 1 17  ? 12.984  -1.081  -13.004 1.00 0.00 ? 17  LEU A CD1  1  
ATOM 221   C CD2  . LEU A 1 17  ? 13.062  -2.548  -10.980 1.00 0.00 ? 17  LEU A CD2  1  
ATOM 222   H H    . LEU A 1 17  ? 15.288  1.467   -11.421 1.00 0.00 ? 17  LEU A H    1  
ATOM 223   H HA   . LEU A 1 17  ? 12.468  1.307   -12.261 1.00 0.00 ? 17  LEU A HA   1  
ATOM 224   H HB2  . LEU A 1 17  ? 14.032  -0.313  -10.335 1.00 0.00 ? 17  LEU A HB2  1  
ATOM 225   H HB3  . LEU A 1 17  ? 12.373  0.083   -9.892  1.00 0.00 ? 17  LEU A HB3  1  
ATOM 226   H HG   . LEU A 1 17  ? 11.474  -1.251  -11.526 1.00 0.00 ? 17  LEU A HG   1  
ATOM 227   H HD11 . LEU A 1 17  ? 12.893  -2.031  -13.508 1.00 0.00 ? 17  LEU A HD11 1  
ATOM 228   H HD12 . LEU A 1 17  ? 14.011  -0.749  -13.042 1.00 0.00 ? 17  LEU A HD12 1  
ATOM 229   H HD13 . LEU A 1 17  ? 12.353  -0.352  -13.491 1.00 0.00 ? 17  LEU A HD13 1  
ATOM 230   H HD21 . LEU A 1 17  ? 12.430  -3.355  -11.317 1.00 0.00 ? 17  LEU A HD21 1  
ATOM 231   H HD22 . LEU A 1 17  ? 13.042  -2.502  -9.900  1.00 0.00 ? 17  LEU A HD22 1  
ATOM 232   H HD23 . LEU A 1 17  ? 14.075  -2.719  -11.314 1.00 0.00 ? 17  LEU A HD23 1  
ATOM 233   N N    . PRO A 1 18  ? 11.576  2.653   -10.232 1.00 0.00 ? 18  PRO A N    1  
ATOM 234   C CA   . PRO A 1 18  ? 11.120  3.715   -9.331  1.00 0.00 ? 18  PRO A CA   1  
ATOM 235   C C    . PRO A 1 18  ? 11.464  3.426   -7.874  1.00 0.00 ? 18  PRO A C    1  
ATOM 236   O O    . PRO A 1 18  ? 11.744  2.286   -7.506  1.00 0.00 ? 18  PRO A O    1  
ATOM 237   C CB   . PRO A 1 18  ? 9.603   3.724   -9.531  1.00 0.00 ? 18  PRO A CB   1  
ATOM 238   C CG   . PRO A 1 18  ? 9.273   2.345   -9.989  1.00 0.00 ? 18  PRO A CG   1  
ATOM 239   C CD   . PRO A 1 18  ? 10.454  1.884   -10.798 1.00 0.00 ? 18  PRO A CD   1  
ATOM 240   H HA   . PRO A 1 18  ? 11.528  4.675   -9.612  1.00 0.00 ? 18  PRO A HA   1  
ATOM 241   H HB2  . PRO A 1 18  ? 9.115   3.958   -8.596  1.00 0.00 ? 18  PRO A HB2  1  
ATOM 242   H HB3  . PRO A 1 18  ? 9.338   4.460   -10.275 1.00 0.00 ? 18  PRO A HB3  1  
ATOM 243   H HG2  . PRO A 1 18  ? 9.127   1.700   -9.137  1.00 0.00 ? 18  PRO A HG2  1  
ATOM 244   H HG3  . PRO A 1 18  ? 8.385   2.365   -10.603 1.00 0.00 ? 18  PRO A HG3  1  
ATOM 245   H HD2  . PRO A 1 18  ? 10.609  0.823   -10.668 1.00 0.00 ? 18  PRO A HD2  1  
ATOM 246   H HD3  . PRO A 1 18  ? 10.313  2.121   -11.842 1.00 0.00 ? 18  PRO A HD3  1  
ATOM 247   N N    . GLY A 1 19  ? 11.439  4.467   -7.047  1.00 0.00 ? 19  GLY A N    1  
ATOM 248   C CA   . GLY A 1 19  ? 11.749  4.303   -5.639  1.00 0.00 ? 19  GLY A CA   1  
ATOM 249   C C    . GLY A 1 19  ? 10.506  4.255   -4.773  1.00 0.00 ? 19  GLY A C    1  
ATOM 250   O O    . GLY A 1 19  ? 9.382   4.407   -5.253  1.00 0.00 ? 19  GLY A O    1  
ATOM 251   H H    . GLY A 1 19  ? 11.208  5.354   -7.396  1.00 0.00 ? 19  GLY A H    1  
ATOM 252   H HA2  . GLY A 1 19  ? 12.303  3.386   -5.508  1.00 0.00 ? 19  GLY A HA2  1  
ATOM 253   H HA3  . GLY A 1 19  ? 12.364  5.132   -5.319  1.00 0.00 ? 19  GLY A HA3  1  
ATOM 254   N N    . PRO A 1 20  ? 10.700  4.036   -3.464  1.00 0.00 ? 20  PRO A N    1  
ATOM 255   C CA   . PRO A 1 20  ? 9.596   3.961   -2.502  1.00 0.00 ? 20  PRO A CA   1  
ATOM 256   C C    . PRO A 1 20  ? 8.930   5.314   -2.277  1.00 0.00 ? 20  PRO A C    1  
ATOM 257   O O    . PRO A 1 20  ? 9.604   6.315   -2.036  1.00 0.00 ? 20  PRO A O    1  
ATOM 258   C CB   . PRO A 1 20  ? 10.277  3.480   -1.218  1.00 0.00 ? 20  PRO A CB   1  
ATOM 259   C CG   . PRO A 1 20  ? 11.694  3.917   -1.354  1.00 0.00 ? 20  PRO A CG   1  
ATOM 260   C CD   . PRO A 1 20  ? 12.011  3.845   -2.822  1.00 0.00 ? 20  PRO A CD   1  
ATOM 261   H HA   . PRO A 1 20  ? 8.851   3.241   -2.808  1.00 0.00 ? 20  PRO A HA   1  
ATOM 262   H HB2  . PRO A 1 20  ? 9.801   3.938   -0.362  1.00 0.00 ? 20  PRO A HB2  1  
ATOM 263   H HB3  . PRO A 1 20  ? 10.201  2.405   -1.147  1.00 0.00 ? 20  PRO A HB3  1  
ATOM 264   H HG2  . PRO A 1 20  ? 11.802  4.930   -0.997  1.00 0.00 ? 20  PRO A HG2  1  
ATOM 265   H HG3  . PRO A 1 20  ? 12.339  3.252   -0.799  1.00 0.00 ? 20  PRO A HG3  1  
ATOM 266   H HD2  . PRO A 1 20  ? 12.695  4.633   -3.100  1.00 0.00 ? 20  PRO A HD2  1  
ATOM 267   H HD3  . PRO A 1 20  ? 12.425  2.879   -3.072  1.00 0.00 ? 20  PRO A HD3  1  
ATOM 268   N N    . ALA A 1 21  ? 7.604   5.336   -2.357  1.00 0.00 ? 21  ALA A N    1  
ATOM 269   C CA   . ALA A 1 21  ? 6.847   6.567   -2.159  1.00 0.00 ? 21  ALA A CA   1  
ATOM 270   C C    . ALA A 1 21  ? 6.932   7.037   -0.711  1.00 0.00 ? 21  ALA A C    1  
ATOM 271   O O    . ALA A 1 21  ? 6.425   6.391   0.207   1.00 0.00 ? 21  ALA A O    1  
ATOM 272   C CB   . ALA A 1 21  ? 5.395   6.364   -2.566  1.00 0.00 ? 21  ALA A CB   1  
ATOM 273   H H    . ALA A 1 21  ? 7.123   4.506   -2.551  1.00 0.00 ? 21  ALA A H    1  
ATOM 274   H HA   . ALA A 1 21  ? 7.273   7.326   -2.799  1.00 0.00 ? 21  ALA A HA   1  
ATOM 275   H HB1  . ALA A 1 21  ? 5.038   5.427   -2.167  1.00 0.00 ? 21  ALA A HB1  1  
ATOM 276   H HB2  . ALA A 1 21  ? 4.797   7.174   -2.177  1.00 0.00 ? 21  ALA A HB2  1  
ATOM 277   H HB3  . ALA A 1 21  ? 5.323   6.348   -3.643  1.00 0.00 ? 21  ALA A HB3  1  
ATOM 278   N N    . PRO A 1 22  ? 7.588   8.187   -0.498  1.00 0.00 ? 22  PRO A N    1  
ATOM 279   C CA   . PRO A 1 22  ? 7.754   8.769   0.837   1.00 0.00 ? 22  PRO A CA   1  
ATOM 280   C C    . PRO A 1 22  ? 6.442   9.298   1.406   1.00 0.00 ? 22  PRO A C    1  
ATOM 281   O O    . PRO A 1 22  ? 5.389   9.170   0.784   1.00 0.00 ? 22  PRO A O    1  
ATOM 282   C CB   . PRO A 1 22  ? 8.738   9.918   0.603   1.00 0.00 ? 22  PRO A CB   1  
ATOM 283   C CG   . PRO A 1 22  ? 8.556   10.287  -0.829  1.00 0.00 ? 22  PRO A CG   1  
ATOM 284   C CD   . PRO A 1 22  ? 8.217   9.009   -1.546  1.00 0.00 ? 22  PRO A CD   1  
ATOM 285   H HA   . PRO A 1 22  ? 8.185   8.059   1.528   1.00 0.00 ? 22  PRO A HA   1  
ATOM 286   H HB2  . PRO A 1 22  ? 8.494   10.743  1.258   1.00 0.00 ? 22  PRO A HB2  1  
ATOM 287   H HB3  . PRO A 1 22  ? 9.744   9.581   0.799   1.00 0.00 ? 22  PRO A HB3  1  
ATOM 288   H HG2  . PRO A 1 22  ? 7.748   10.997  -0.926  1.00 0.00 ? 22  PRO A HG2  1  
ATOM 289   H HG3  . PRO A 1 22  ? 9.472   10.704  -1.219  1.00 0.00 ? 22  PRO A HG3  1  
ATOM 290   H HD2  . PRO A 1 22  ? 7.525   9.201   -2.353  1.00 0.00 ? 22  PRO A HD2  1  
ATOM 291   H HD3  . PRO A 1 22  ? 9.113   8.537   -1.919  1.00 0.00 ? 22  PRO A HD3  1  
ATOM 292   N N    . ASN A 1 23  ? 6.515   9.892   2.593   1.00 0.00 ? 23  ASN A N    1  
ATOM 293   C CA   . ASN A 1 23  ? 5.332   10.440  3.246   1.00 0.00 ? 23  ASN A CA   1  
ATOM 294   C C    . ASN A 1 23  ? 4.147   9.488   3.116   1.00 0.00 ? 23  ASN A C    1  
ATOM 295   O O    . ASN A 1 23  ? 3.060   9.885   2.696   1.00 0.00 ? 23  ASN A O    1  
ATOM 296   C CB   . ASN A 1 23  ? 4.975   11.801  2.643   1.00 0.00 ? 23  ASN A CB   1  
ATOM 297   C CG   . ASN A 1 23  ? 6.136   12.776  2.689   1.00 0.00 ? 23  ASN A CG   1  
ATOM 298   O OD1  . ASN A 1 23  ? 6.565   13.295  1.659   1.00 0.00 ? 23  ASN A OD1  1  
ATOM 299   N ND2  . ASN A 1 23  ? 6.650   13.028  3.887   1.00 0.00 ? 23  ASN A ND2  1  
ATOM 300   H H    . ASN A 1 23  ? 7.384   9.964   3.040   1.00 0.00 ? 23  ASN A H    1  
ATOM 301   H HA   . ASN A 1 23  ? 5.561   10.570  4.293   1.00 0.00 ? 23  ASN A HA   1  
ATOM 302   H HB2  . ASN A 1 23  ? 4.684   11.665  1.612   1.00 0.00 ? 23  ASN A HB2  1  
ATOM 303   H HB3  . ASN A 1 23  ? 4.149   12.226  3.193   1.00 0.00 ? 23  ASN A HB3  1  
ATOM 304   H HD21 . ASN A 1 23  ? 6.257   12.578  4.664   1.00 0.00 ? 23  ASN A HD21 1  
ATOM 305   H HD22 . ASN A 1 23  ? 7.400   13.655  3.945   1.00 0.00 ? 23  ASN A HD22 1  
ATOM 306   N N    . LEU A 1 24  ? 4.366   8.229   3.479   1.00 0.00 ? 24  LEU A N    1  
ATOM 307   C CA   . LEU A 1 24  ? 3.316   7.218   3.404   1.00 0.00 ? 24  LEU A CA   1  
ATOM 308   C C    . LEU A 1 24  ? 2.523   7.159   4.706   1.00 0.00 ? 24  LEU A C    1  
ATOM 309   O O    . LEU A 1 24  ? 2.982   6.595   5.699   1.00 0.00 ? 24  LEU A O    1  
ATOM 310   C CB   . LEU A 1 24  ? 3.923   5.847   3.100   1.00 0.00 ? 24  LEU A CB   1  
ATOM 311   C CG   . LEU A 1 24  ? 2.945   4.671   3.075   1.00 0.00 ? 24  LEU A CG   1  
ATOM 312   C CD1  . LEU A 1 24  ? 2.019   4.773   1.872   1.00 0.00 ? 24  LEU A CD1  1  
ATOM 313   C CD2  . LEU A 1 24  ? 3.700   3.350   3.059   1.00 0.00 ? 24  LEU A CD2  1  
ATOM 314   H H    . LEU A 1 24  ? 5.253   7.971   3.806   1.00 0.00 ? 24  LEU A H    1  
ATOM 315   H HA   . LEU A 1 24  ? 2.648   7.493   2.602   1.00 0.00 ? 24  LEU A HA   1  
ATOM 316   H HB2  . LEU A 1 24  ? 4.398   5.902   2.133   1.00 0.00 ? 24  LEU A HB2  1  
ATOM 317   H HB3  . LEU A 1 24  ? 4.669   5.641   3.855   1.00 0.00 ? 24  LEU A HB3  1  
ATOM 318   H HG   . LEU A 1 24  ? 2.335   4.699   3.968   1.00 0.00 ? 24  LEU A HG   1  
ATOM 319   H HD11 . LEU A 1 24  ? 1.117   5.294   2.155   1.00 0.00 ? 24  LEU A HD11 1  
ATOM 320   H HD12 . LEU A 1 24  ? 1.769   3.781   1.526   1.00 0.00 ? 24  LEU A HD12 1  
ATOM 321   H HD13 . LEU A 1 24  ? 2.516   5.315   1.081   1.00 0.00 ? 24  LEU A HD13 1  
ATOM 322   H HD21 . LEU A 1 24  ? 4.613   3.465   2.495   1.00 0.00 ? 24  LEU A HD21 1  
ATOM 323   H HD22 . LEU A 1 24  ? 3.085   2.590   2.598   1.00 0.00 ? 24  LEU A HD22 1  
ATOM 324   H HD23 . LEU A 1 24  ? 3.936   3.058   4.072   1.00 0.00 ? 24  LEU A HD23 1  
ATOM 325   N N    . ARG A 1 25  ? 1.329   7.742   4.692   1.00 0.00 ? 25  ARG A N    1  
ATOM 326   C CA   . ARG A 1 25  ? 0.471   7.755   5.871   1.00 0.00 ? 25  ARG A CA   1  
ATOM 327   C C    . ARG A 1 25  ? -0.819  6.982   5.612   1.00 0.00 ? 25  ARG A C    1  
ATOM 328   O O    . ARG A 1 25  ? -1.234  6.813   4.466   1.00 0.00 ? 25  ARG A O    1  
ATOM 329   C CB   . ARG A 1 25  ? 0.144   9.194   6.274   1.00 0.00 ? 25  ARG A CB   1  
ATOM 330   C CG   . ARG A 1 25  ? 1.296   10.163  6.061   1.00 0.00 ? 25  ARG A CG   1  
ATOM 331   C CD   . ARG A 1 25  ? 2.268   10.139  7.230   1.00 0.00 ? 25  ARG A CD   1  
ATOM 332   N NE   . ARG A 1 25  ? 1.850   11.032  8.307   1.00 0.00 ? 25  ARG A NE   1  
ATOM 333   C CZ   . ARG A 1 25  ? 1.867   12.357  8.212   1.00 0.00 ? 25  ARG A CZ   1  
ATOM 334   N NH1  . ARG A 1 25  ? 2.279   12.939  7.095   1.00 0.00 ? 25  ARG A NH1  1  
ATOM 335   N NH2  . ARG A 1 25  ? 1.471   13.102  9.237   1.00 0.00 ? 25  ARG A NH2  1  
ATOM 336   H H    . ARG A 1 25  ? 1.018   8.175   3.870   1.00 0.00 ? 25  ARG A H    1  
ATOM 337   H HA   . ARG A 1 25  ? 1.008   7.277   6.677   1.00 0.00 ? 25  ARG A HA   1  
ATOM 338   H HB2  . ARG A 1 25  ? -0.698  9.537   5.691   1.00 0.00 ? 25  ARG A HB2  1  
ATOM 339   H HB3  . ARG A 1 25  ? -0.122  9.210   7.320   1.00 0.00 ? 25  ARG A HB3  1  
ATOM 340   H HG2  . ARG A 1 25  ? 1.825   9.886   5.161   1.00 0.00 ? 25  ARG A HG2  1  
ATOM 341   H HG3  . ARG A 1 25  ? 0.898   11.161  5.954   1.00 0.00 ? 25  ARG A HG3  1  
ATOM 342   H HD2  . ARG A 1 25  ? 2.325   9.131   7.613   1.00 0.00 ? 25  ARG A HD2  1  
ATOM 343   H HD3  . ARG A 1 25  ? 3.241   10.446  6.877   1.00 0.00 ? 25  ARG A HD3  1  
ATOM 344   H HE   . ARG A 1 25  ? 1.541   10.622  9.142   1.00 0.00 ? 25  ARG A HE   1  
ATOM 345   H HH11 . ARG A 1 25  ? 2.577   12.381  6.321   1.00 0.00 ? 25  ARG A HH11 1  
ATOM 346   H HH12 . ARG A 1 25  ? 2.289   13.937  7.026   1.00 0.00 ? 25  ARG A HH12 1  
ATOM 347   H HH21 . ARG A 1 25  ? 1.159   12.666  10.081  1.00 0.00 ? 25  ARG A HH21 1  
ATOM 348   H HH22 . ARG A 1 25  ? 1.484   14.098  9.164   1.00 0.00 ? 25  ARG A HH22 1  
ATOM 349   N N    . ALA A 1 26  ? -1.448  6.515   6.686   1.00 0.00 ? 26  ALA A N    1  
ATOM 350   C CA   . ALA A 1 26  ? -2.691  5.761   6.576   1.00 0.00 ? 26  ALA A CA   1  
ATOM 351   C C    . ALA A 1 26  ? -3.547  5.929   7.827   1.00 0.00 ? 26  ALA A C    1  
ATOM 352   O O    . ALA A 1 26  ? -3.079  5.711   8.945   1.00 0.00 ? 26  ALA A O    1  
ATOM 353   C CB   . ALA A 1 26  ? -2.395  4.289   6.329   1.00 0.00 ? 26  ALA A CB   1  
ATOM 354   H H    . ALA A 1 26  ? -1.067  6.682   7.573   1.00 0.00 ? 26  ALA A H    1  
ATOM 355   H HA   . ALA A 1 26  ? -3.237  6.141   5.725   1.00 0.00 ? 26  ALA A HA   1  
ATOM 356   H HB1  . ALA A 1 26  ? -2.229  4.129   5.274   1.00 0.00 ? 26  ALA A HB1  1  
ATOM 357   H HB2  . ALA A 1 26  ? -1.513  4.002   6.881   1.00 0.00 ? 26  ALA A HB2  1  
ATOM 358   H HB3  . ALA A 1 26  ? -3.235  3.695   6.656   1.00 0.00 ? 26  ALA A HB3  1  
ATOM 359   N N    . TYR A 1 27  ? -4.801  6.318   7.631   1.00 0.00 ? 27  TYR A N    1  
ATOM 360   C CA   . TYR A 1 27  ? -5.722  6.518   8.744   1.00 0.00 ? 27  TYR A CA   1  
ATOM 361   C C    . TYR A 1 27  ? -7.125  6.040   8.384   1.00 0.00 ? 27  TYR A C    1  
ATOM 362   O O    . TYR A 1 27  ? -7.588  6.231   7.260   1.00 0.00 ? 27  TYR A O    1  
ATOM 363   C CB   . TYR A 1 27  ? -5.761  7.994   9.142   1.00 0.00 ? 27  TYR A CB   1  
ATOM 364   C CG   . TYR A 1 27  ? -6.038  8.927   7.985   1.00 0.00 ? 27  TYR A CG   1  
ATOM 365   C CD1  . TYR A 1 27  ? -5.015  9.345   7.143   1.00 0.00 ? 27  TYR A CD1  1  
ATOM 366   C CD2  . TYR A 1 27  ? -7.325  9.388   7.732   1.00 0.00 ? 27  TYR A CD2  1  
ATOM 367   C CE1  . TYR A 1 27  ? -5.264  10.197  6.085   1.00 0.00 ? 27  TYR A CE1  1  
ATOM 368   C CE2  . TYR A 1 27  ? -7.583  10.239  6.675   1.00 0.00 ? 27  TYR A CE2  1  
ATOM 369   C CZ   . TYR A 1 27  ? -6.550  10.641  5.854   1.00 0.00 ? 27  TYR A CZ   1  
ATOM 370   O OH   . TYR A 1 27  ? -6.802  11.489  4.800   1.00 0.00 ? 27  TYR A OH   1  
ATOM 371   H H    . TYR A 1 27  ? -5.116  6.477   6.717   1.00 0.00 ? 27  TYR A H    1  
ATOM 372   H HA   . TYR A 1 27  ? -5.360  5.939   9.582   1.00 0.00 ? 27  TYR A HA   1  
ATOM 373   H HB2  . TYR A 1 27  ? -6.536  8.141   9.879   1.00 0.00 ? 27  TYR A HB2  1  
ATOM 374   H HB3  . TYR A 1 27  ? -4.808  8.270   9.570   1.00 0.00 ? 27  TYR A HB3  1  
ATOM 375   H HD1  . TYR A 1 27  ? -4.010  8.995   7.326   1.00 0.00 ? 27  TYR A HD1  1  
ATOM 376   H HD2  . TYR A 1 27  ? -8.132  9.071   8.376   1.00 0.00 ? 27  TYR A HD2  1  
ATOM 377   H HE1  . TYR A 1 27  ? -4.455  10.512  5.442   1.00 0.00 ? 27  TYR A HE1  1  
ATOM 378   H HE2  . TYR A 1 27  ? -8.589  10.587  6.494   1.00 0.00 ? 27  TYR A HE2  1  
ATOM 379   H HH   . TYR A 1 27  ? -6.152  12.195  4.795   1.00 0.00 ? 27  TYR A HH   1  
ATOM 380   N N    . ALA A 1 28  ? -7.796  5.417   9.347   1.00 0.00 ? 28  ALA A N    1  
ATOM 381   C CA   . ALA A 1 28  ? -9.147  4.913   9.133   1.00 0.00 ? 28  ALA A CA   1  
ATOM 382   C C    . ALA A 1 28  ? -10.170 6.043   9.191   1.00 0.00 ? 28  ALA A C    1  
ATOM 383   O O    . ALA A 1 28  ? -10.548 6.496   10.271  1.00 0.00 ? 28  ALA A O    1  
ATOM 384   C CB   . ALA A 1 28  ? -9.481  3.843   10.163  1.00 0.00 ? 28  ALA A CB   1  
ATOM 385   H H    . ALA A 1 28  ? -7.373  5.295   10.222  1.00 0.00 ? 28  ALA A H    1  
ATOM 386   H HA   . ALA A 1 28  ? -9.183  4.458   8.153   1.00 0.00 ? 28  ALA A HA   1  
ATOM 387   H HB1  . ALA A 1 28  ? -10.069 4.280   10.957  1.00 0.00 ? 28  ALA A HB1  1  
ATOM 388   H HB2  . ALA A 1 28  ? -10.043 3.052   9.690   1.00 0.00 ? 28  ALA A HB2  1  
ATOM 389   H HB3  . ALA A 1 28  ? -8.566  3.441   10.572  1.00 0.00 ? 28  ALA A HB3  1  
ATOM 390   N N    . ALA A 1 29  ? -10.614 6.493   8.022   1.00 0.00 ? 29  ALA A N    1  
ATOM 391   C CA   . ALA A 1 29  ? -11.594 7.569   7.940   1.00 0.00 ? 29  ALA A CA   1  
ATOM 392   C C    . ALA A 1 29  ? -12.967 7.097   8.406   1.00 0.00 ? 29  ALA A C    1  
ATOM 393   O O    . ALA A 1 29  ? -13.817 7.904   8.782   1.00 0.00 ? 29  ALA A O    1  
ATOM 394   C CB   . ALA A 1 29  ? -11.672 8.105   6.518   1.00 0.00 ? 29  ALA A CB   1  
ATOM 395   H H    . ALA A 1 29  ? -10.275 6.091   7.195   1.00 0.00 ? 29  ALA A H    1  
ATOM 396   H HA   . ALA A 1 29  ? -11.263 8.371   8.584   1.00 0.00 ? 29  ALA A HA   1  
ATOM 397   H HB1  . ALA A 1 29  ? -10.682 8.120   6.086   1.00 0.00 ? 29  ALA A HB1  1  
ATOM 398   H HB2  . ALA A 1 29  ? -12.313 7.468   5.928   1.00 0.00 ? 29  ALA A HB2  1  
ATOM 399   H HB3  . ALA A 1 29  ? -12.074 9.107   6.533   1.00 0.00 ? 29  ALA A HB3  1  
ATOM 400   N N    . SER A 1 30  ? -13.178 5.785   8.377   1.00 0.00 ? 30  SER A N    1  
ATOM 401   C CA   . SER A 1 30  ? -14.451 5.206   8.791   1.00 0.00 ? 30  SER A CA   1  
ATOM 402   C C    . SER A 1 30  ? -14.275 3.748   9.206   1.00 0.00 ? 30  SER A C    1  
ATOM 403   O O    . SER A 1 30  ? -13.294 3.091   8.858   1.00 0.00 ? 30  SER A O    1  
ATOM 404   C CB   . SER A 1 30  ? -15.475 5.307   7.659   1.00 0.00 ? 30  SER A CB   1  
ATOM 405   O OG   . SER A 1 30  ? -16.189 6.529   7.724   1.00 0.00 ? 30  SER A OG   1  
ATOM 406   H H    . SER A 1 30  ? -12.462 5.193   8.066   1.00 0.00 ? 30  SER A H    1  
ATOM 407   H HA   . SER A 1 30  ? -14.810 5.769   9.640   1.00 0.00 ? 30  SER A HA   1  
ATOM 408   H HB2  . SER A 1 30  ? -14.964 5.252   6.710   1.00 0.00 ? 30  SER A HB2  1  
ATOM 409   H HB3  . SER A 1 30  ? -16.176 4.488   7.738   1.00 0.00 ? 30  SER A HB3  1  
ATOM 410   H HG   . SER A 1 30  ? -17.034 6.383   8.156   1.00 0.00 ? 30  SER A HG   1  
ATOM 411   N N    . PRO A 1 31  ? -15.250 3.229   9.967   1.00 0.00 ? 31  PRO A N    1  
ATOM 412   C CA   . PRO A 1 31  ? -15.227 1.843   10.445  1.00 0.00 ? 31  PRO A CA   1  
ATOM 413   C C    . PRO A 1 31  ? -15.437 0.838   9.319   1.00 0.00 ? 31  PRO A C    1  
ATOM 414   O O    . PRO A 1 31  ? -15.376 -0.374  9.534   1.00 0.00 ? 31  PRO A O    1  
ATOM 415   C CB   . PRO A 1 31  ? -16.394 1.790   11.434  1.00 0.00 ? 31  PRO A CB   1  
ATOM 416   C CG   . PRO A 1 31  ? -17.321 2.867   10.985  1.00 0.00 ? 31  PRO A CG   1  
ATOM 417   C CD   . PRO A 1 31  ? -16.449 3.954   10.419  1.00 0.00 ? 31  PRO A CD   1  
ATOM 418   H HA   . PRO A 1 31  ? -14.305 1.617   10.961  1.00 0.00 ? 31  PRO A HA   1  
ATOM 419   H HB2  . PRO A 1 31  ? -16.865 0.818   11.388  1.00 0.00 ? 31  PRO A HB2  1  
ATOM 420   H HB3  . PRO A 1 31  ? -16.032 1.974   12.435  1.00 0.00 ? 31  PRO A HB3  1  
ATOM 421   H HG2  . PRO A 1 31  ? -17.985 2.486   10.225  1.00 0.00 ? 31  PRO A HG2  1  
ATOM 422   H HG3  . PRO A 1 31  ? -17.885 3.240   11.827  1.00 0.00 ? 31  PRO A HG3  1  
ATOM 423   H HD2  . PRO A 1 31  ? -16.941 4.440   9.590   1.00 0.00 ? 31  PRO A HD2  1  
ATOM 424   H HD3  . PRO A 1 31  ? -16.198 4.673   11.185  1.00 0.00 ? 31  PRO A HD3  1  
ATOM 425   N N    . THR A 1 32  ? -15.684 1.346   8.116   1.00 0.00 ? 32  THR A N    1  
ATOM 426   C CA   . THR A 1 32  ? -15.904 0.493   6.955   1.00 0.00 ? 32  THR A CA   1  
ATOM 427   C C    . THR A 1 32  ? -15.050 0.940   5.774   1.00 0.00 ? 32  THR A C    1  
ATOM 428   O O    . THR A 1 32  ? -15.118 0.358   4.691   1.00 0.00 ? 32  THR A O    1  
ATOM 429   C CB   . THR A 1 32  ? -17.385 0.491   6.532   1.00 0.00 ? 32  THR A CB   1  
ATOM 430   O OG1  . THR A 1 32  ? -17.784 1.808   6.137   1.00 0.00 ? 32  THR A OG1  1  
ATOM 431   C CG2  . THR A 1 32  ? -18.272 0.006   7.668   1.00 0.00 ? 32  THR A CG2  1  
ATOM 432   H H    . THR A 1 32  ? -15.720 2.320   8.008   1.00 0.00 ? 32  THR A H    1  
ATOM 433   H HA   . THR A 1 32  ? -15.627 -0.516  7.226   1.00 0.00 ? 32  THR A HA   1  
ATOM 434   H HB   . THR A 1 32  ? -17.503 -0.179  5.692   1.00 0.00 ? 32  THR A HB   1  
ATOM 435   H HG1  . THR A 1 32  ? -17.971 2.334   6.919   1.00 0.00 ? 32  THR A HG1  1  
ATOM 436   H HG21 . THR A 1 32  ? -17.683 -0.092  8.568   1.00 0.00 ? 32  THR A HG21 1  
ATOM 437   H HG22 . THR A 1 32  ? -18.696 -0.953  7.410   1.00 0.00 ? 32  THR A HG22 1  
ATOM 438   H HG23 . THR A 1 32  ? -19.066 0.718   7.834   1.00 0.00 ? 32  THR A HG23 1  
ATOM 439   N N    . SER A 1 33  ? -14.246 1.976   5.990   1.00 0.00 ? 33  SER A N    1  
ATOM 440   C CA   . SER A 1 33  ? -13.380 2.503   4.941   1.00 0.00 ? 33  SER A CA   1  
ATOM 441   C C    . SER A 1 33  ? -12.030 2.925   5.513   1.00 0.00 ? 33  SER A C    1  
ATOM 442   O O    . SER A 1 33  ? -11.853 2.993   6.730   1.00 0.00 ? 33  SER A O    1  
ATOM 443   C CB   . SER A 1 33  ? -14.048 3.692   4.249   1.00 0.00 ? 33  SER A CB   1  
ATOM 444   O OG   . SER A 1 33  ? -13.650 3.782   2.892   1.00 0.00 ? 33  SER A OG   1  
ATOM 445   H H    . SER A 1 33  ? -14.237 2.397   6.875   1.00 0.00 ? 33  SER A H    1  
ATOM 446   H HA   . SER A 1 33  ? -13.222 1.718   4.217   1.00 0.00 ? 33  SER A HA   1  
ATOM 447   H HB2  . SER A 1 33  ? -15.120 3.573   4.290   1.00 0.00 ? 33  SER A HB2  1  
ATOM 448   H HB3  . SER A 1 33  ? -13.768 4.604   4.756   1.00 0.00 ? 33  SER A HB3  1  
ATOM 449   H HG   . SER A 1 33  ? -12.929 3.170   2.729   1.00 0.00 ? 33  SER A HG   1  
ATOM 450   N N    . ILE A 1 34  ? -11.082 3.208   4.626   1.00 0.00 ? 34  ILE A N    1  
ATOM 451   C CA   . ILE A 1 34  ? -9.748  3.625   5.041   1.00 0.00 ? 34  ILE A CA   1  
ATOM 452   C C    . ILE A 1 34  ? -9.114  4.549   4.007   1.00 0.00 ? 34  ILE A C    1  
ATOM 453   O O    . ILE A 1 34  ? -9.159  4.279   2.806   1.00 0.00 ? 34  ILE A O    1  
ATOM 454   C CB   . ILE A 1 34  ? -8.824  2.413   5.266   1.00 0.00 ? 34  ILE A CB   1  
ATOM 455   C CG1  . ILE A 1 34  ? -9.298  1.600   6.473   1.00 0.00 ? 34  ILE A CG1  1  
ATOM 456   C CG2  . ILE A 1 34  ? -7.387  2.872   5.460   1.00 0.00 ? 34  ILE A CG2  1  
ATOM 457   C CD1  . ILE A 1 34  ? -8.578  0.279   6.631   1.00 0.00 ? 34  ILE A CD1  1  
ATOM 458   H H    . ILE A 1 34  ? -11.284 3.136   3.670   1.00 0.00 ? 34  ILE A H    1  
ATOM 459   H HA   . ILE A 1 34  ? -9.842  4.159   5.976   1.00 0.00 ? 34  ILE A HA   1  
ATOM 460   H HB   . ILE A 1 34  ? -8.862  1.792   4.385   1.00 0.00 ? 34  ILE A HB   1  
ATOM 461   H HG12 . ILE A 1 34  ? -9.137  2.175   7.371   1.00 0.00 ? 34  ILE A HG12 1  
ATOM 462   H HG13 . ILE A 1 34  ? -10.353 1.393   6.366   1.00 0.00 ? 34  ILE A HG13 1  
ATOM 463   H HG21 . ILE A 1 34  ? -6.792  2.561   4.614   1.00 0.00 ? 34  ILE A HG21 1  
ATOM 464   H HG22 . ILE A 1 34  ? -7.361  3.949   5.541   1.00 0.00 ? 34  ILE A HG22 1  
ATOM 465   H HG23 . ILE A 1 34  ? -6.987  2.433   6.362   1.00 0.00 ? 34  ILE A HG23 1  
ATOM 466   H HD11 . ILE A 1 34  ? -7.537  0.402   6.368   1.00 0.00 ? 34  ILE A HD11 1  
ATOM 467   H HD12 . ILE A 1 34  ? -8.654  -0.053  7.655   1.00 0.00 ? 34  ILE A HD12 1  
ATOM 468   H HD13 . ILE A 1 34  ? -9.028  -0.456  5.980   1.00 0.00 ? 34  ILE A HD13 1  
ATOM 469   N N    . THR A 1 35  ? -8.521  5.640   4.481   1.00 0.00 ? 35  THR A N    1  
ATOM 470   C CA   . THR A 1 35  ? -7.877  6.604   3.598   1.00 0.00 ? 35  THR A CA   1  
ATOM 471   C C    . THR A 1 35  ? -6.359  6.482   3.665   1.00 0.00 ? 35  THR A C    1  
ATOM 472   O O    . THR A 1 35  ? -5.775  6.459   4.748   1.00 0.00 ? 35  THR A O    1  
ATOM 473   C CB   . THR A 1 35  ? -8.280  8.048   3.953   1.00 0.00 ? 35  THR A CB   1  
ATOM 474   O OG1  . THR A 1 35  ? -9.673  8.247   3.687   1.00 0.00 ? 35  THR A OG1  1  
ATOM 475   C CG2  . THR A 1 35  ? -7.459  9.050   3.156   1.00 0.00 ? 35  THR A CG2  1  
ATOM 476   H H    . THR A 1 35  ? -8.519  5.800   5.448   1.00 0.00 ? 35  THR A H    1  
ATOM 477   H HA   . THR A 1 35  ? -8.201  6.400   2.588   1.00 0.00 ? 35  THR A HA   1  
ATOM 478   H HB   . THR A 1 35  ? -8.096  8.209   5.005   1.00 0.00 ? 35  THR A HB   1  
ATOM 479   H HG1  . THR A 1 35  ? -9.955  7.646   2.992   1.00 0.00 ? 35  THR A HG1  1  
ATOM 480   H HG21 . THR A 1 35  ? -8.069  9.910   2.921   1.00 0.00 ? 35  THR A HG21 1  
ATOM 481   H HG22 . THR A 1 35  ? -7.117  8.590   2.241   1.00 0.00 ? 35  THR A HG22 1  
ATOM 482   H HG23 . THR A 1 35  ? -6.607  9.363   3.742   1.00 0.00 ? 35  THR A HG23 1  
ATOM 483   N N    . VAL A 1 36  ? -5.724  6.404   2.499   1.00 0.00 ? 36  VAL A N    1  
ATOM 484   C CA   . VAL A 1 36  ? -4.273  6.286   2.426   1.00 0.00 ? 36  VAL A CA   1  
ATOM 485   C C    . VAL A 1 36  ? -3.672  7.407   1.585   1.00 0.00 ? 36  VAL A C    1  
ATOM 486   O O    . VAL A 1 36  ? -4.087  7.637   0.449   1.00 0.00 ? 36  VAL A O    1  
ATOM 487   C CB   . VAL A 1 36  ? -3.850  4.930   1.830   1.00 0.00 ? 36  VAL A CB   1  
ATOM 488   C CG1  . VAL A 1 36  ? -2.356  4.707   2.017   1.00 0.00 ? 36  VAL A CG1  1  
ATOM 489   C CG2  . VAL A 1 36  ? -4.648  3.799   2.461   1.00 0.00 ? 36  VAL A CG2  1  
ATOM 490   H H    . VAL A 1 36  ? -6.244  6.428   1.669   1.00 0.00 ? 36  VAL A H    1  
ATOM 491   H HA   . VAL A 1 36  ? -3.881  6.353   3.430   1.00 0.00 ? 36  VAL A HA   1  
ATOM 492   H HB   . VAL A 1 36  ? -4.060  4.943   0.771   1.00 0.00 ? 36  VAL A HB   1  
ATOM 493   H HG11 . VAL A 1 36  ? -2.151  4.495   3.056   1.00 0.00 ? 36  VAL A HG11 1  
ATOM 494   H HG12 . VAL A 1 36  ? -2.037  3.874   1.407   1.00 0.00 ? 36  VAL A HG12 1  
ATOM 495   H HG13 . VAL A 1 36  ? -1.821  5.597   1.720   1.00 0.00 ? 36  VAL A HG13 1  
ATOM 496   H HG21 . VAL A 1 36  ? -5.168  3.252   1.689   1.00 0.00 ? 36  VAL A HG21 1  
ATOM 497   H HG22 . VAL A 1 36  ? -3.978  3.133   2.985   1.00 0.00 ? 36  VAL A HG22 1  
ATOM 498   H HG23 . VAL A 1 36  ? -5.364  4.209   3.158   1.00 0.00 ? 36  VAL A HG23 1  
ATOM 499   N N    . THR A 1 37  ? -2.691  8.103   2.151   1.00 0.00 ? 37  THR A N    1  
ATOM 500   C CA   . THR A 1 37  ? -2.033  9.201   1.455   1.00 0.00 ? 37  THR A CA   1  
ATOM 501   C C    . THR A 1 37  ? -0.528  8.972   1.365   1.00 0.00 ? 37  THR A C    1  
ATOM 502   O O    . THR A 1 37  ? 0.120   8.651   2.361   1.00 0.00 ? 37  THR A O    1  
ATOM 503   C CB   . THR A 1 37  ? -2.295  10.548  2.155   1.00 0.00 ? 37  THR A CB   1  
ATOM 504   O OG1  . THR A 1 37  ? -1.660  10.565  3.438   1.00 0.00 ? 37  THR A OG1  1  
ATOM 505   C CG2  . THR A 1 37  ? -3.788  10.791  2.318   1.00 0.00 ? 37  THR A CG2  1  
ATOM 506   H H    . THR A 1 37  ? -2.405  7.872   3.059   1.00 0.00 ? 37  THR A H    1  
ATOM 507   H HA   . THR A 1 37  ? -2.439  9.254   0.455   1.00 0.00 ? 37  THR A HA   1  
ATOM 508   H HB   . THR A 1 37  ? -1.880  11.339  1.546   1.00 0.00 ? 37  THR A HB   1  
ATOM 509   H HG1  . THR A 1 37  ? -0.744  10.291  3.346   1.00 0.00 ? 37  THR A HG1  1  
ATOM 510   H HG21 . THR A 1 37  ? -4.005  11.832  2.130   1.00 0.00 ? 37  THR A HG21 1  
ATOM 511   H HG22 . THR A 1 37  ? -4.086  10.536  3.324   1.00 0.00 ? 37  THR A HG22 1  
ATOM 512   H HG23 . THR A 1 37  ? -4.331  10.178  1.615   1.00 0.00 ? 37  THR A HG23 1  
ATOM 513   N N    . TRP A 1 38  ? 0.021   9.140   0.168   1.00 0.00 ? 38  TRP A N    1  
ATOM 514   C CA   . TRP A 1 38  ? 1.450   8.952   -0.051  1.00 0.00 ? 38  TRP A CA   1  
ATOM 515   C C    . TRP A 1 38  ? 2.006   10.029  -0.976  1.00 0.00 ? 38  TRP A C    1  
ATOM 516   O O    . TRP A 1 38  ? 1.250   10.765  -1.610  1.00 0.00 ? 38  TRP A O    1  
ATOM 517   C CB   . TRP A 1 38  ? 1.719   7.567   -0.641  1.00 0.00 ? 38  TRP A CB   1  
ATOM 518   C CG   . TRP A 1 38  ? 1.064   7.351   -1.971  1.00 0.00 ? 38  TRP A CG   1  
ATOM 519   C CD1  . TRP A 1 38  ? 1.564   7.689   -3.196  1.00 0.00 ? 38  TRP A CD1  1  
ATOM 520   C CD2  . TRP A 1 38  ? -0.214  6.750   -2.210  1.00 0.00 ? 38  TRP A CD2  1  
ATOM 521   N NE1  . TRP A 1 38  ? 0.675   7.334   -4.182  1.00 0.00 ? 38  TRP A NE1  1  
ATOM 522   C CE2  . TRP A 1 38  ? -0.424  6.755   -3.602  1.00 0.00 ? 38  TRP A CE2  1  
ATOM 523   C CE3  . TRP A 1 38  ? -1.200  6.206   -1.382  1.00 0.00 ? 38  TRP A CE3  1  
ATOM 524   C CZ2  . TRP A 1 38  ? -1.579  6.239   -4.183  1.00 0.00 ? 38  TRP A CZ2  1  
ATOM 525   C CZ3  . TRP A 1 38  ? -2.346  5.694   -1.960  1.00 0.00 ? 38  TRP A CZ3  1  
ATOM 526   C CH2  . TRP A 1 38  ? -2.528  5.713   -3.349  1.00 0.00 ? 38  TRP A CH2  1  
ATOM 527   H H    . TRP A 1 38  ? -0.549  9.397   -0.588  1.00 0.00 ? 38  TRP A H    1  
ATOM 528   H HA   . TRP A 1 38  ? 1.944   9.028   0.907   1.00 0.00 ? 38  TRP A HA   1  
ATOM 529   H HB2  . TRP A 1 38  ? 2.783   7.437   -0.769  1.00 0.00 ? 38  TRP A HB2  1  
ATOM 530   H HB3  . TRP A 1 38  ? 1.348   6.816   0.041   1.00 0.00 ? 38  TRP A HB3  1  
ATOM 531   H HD1  . TRP A 1 38  ? 2.519   8.166   -3.352  1.00 0.00 ? 38  TRP A HD1  1  
ATOM 532   H HE1  . TRP A 1 38  ? 0.807   7.471   -5.143  1.00 0.00 ? 38  TRP A HE1  1  
ATOM 533   H HE3  . TRP A 1 38  ? -1.078  6.182   -0.309  1.00 0.00 ? 38  TRP A HE3  1  
ATOM 534   H HZ2  . TRP A 1 38  ? -1.734  6.246   -5.252  1.00 0.00 ? 38  TRP A HZ2  1  
ATOM 535   H HZ3  . TRP A 1 38  ? -3.120  5.270   -1.336  1.00 0.00 ? 38  TRP A HZ3  1  
ATOM 536   H HH2  . TRP A 1 38  ? -3.439  5.302   -3.757  1.00 0.00 ? 38  TRP A HH2  1  
ATOM 537   N N    . GLU A 1 39  ? 3.330   10.115  -1.050  1.00 0.00 ? 39  GLU A N    1  
ATOM 538   C CA   . GLU A 1 39  ? 3.985   11.104  -1.899  1.00 0.00 ? 39  GLU A CA   1  
ATOM 539   C C    . GLU A 1 39  ? 4.816   10.424  -2.984  1.00 0.00 ? 39  GLU A C    1  
ATOM 540   O O    . GLU A 1 39  ? 5.093   9.226   -2.912  1.00 0.00 ? 39  GLU A O    1  
ATOM 541   C CB   . GLU A 1 39  ? 4.877   12.020  -1.058  1.00 0.00 ? 39  GLU A CB   1  
ATOM 542   C CG   . GLU A 1 39  ? 4.112   13.115  -0.333  1.00 0.00 ? 39  GLU A CG   1  
ATOM 543   C CD   . GLU A 1 39  ? 3.905   14.348  -1.190  1.00 0.00 ? 39  GLU A CD   1  
ATOM 544   O OE1  . GLU A 1 39  ? 3.919   14.215  -2.432  1.00 0.00 ? 39  GLU A OE1  1  
ATOM 545   O OE2  . GLU A 1 39  ? 3.729   15.445  -0.620  1.00 0.00 ? 39  GLU A OE2  1  
ATOM 546   H H    . GLU A 1 39  ? 3.880   9.500   -0.521  1.00 0.00 ? 39  GLU A H    1  
ATOM 547   H HA   . GLU A 1 39  ? 3.217   11.698  -2.369  1.00 0.00 ? 39  GLU A HA   1  
ATOM 548   H HB2  . GLU A 1 39  ? 5.394   11.422  -0.322  1.00 0.00 ? 39  GLU A HB2  1  
ATOM 549   H HB3  . GLU A 1 39  ? 5.604   12.487  -1.705  1.00 0.00 ? 39  GLU A HB3  1  
ATOM 550   H HG2  . GLU A 1 39  ? 3.145   12.730  -0.044  1.00 0.00 ? 39  GLU A HG2  1  
ATOM 551   H HG3  . GLU A 1 39  ? 4.664   13.397  0.551   1.00 0.00 ? 39  GLU A HG3  1  
ATOM 552   N N    . THR A 1 40  ? 5.210   11.198  -3.990  1.00 0.00 ? 40  THR A N    1  
ATOM 553   C CA   . THR A 1 40  ? 6.007   10.672  -5.091  1.00 0.00 ? 40  THR A CA   1  
ATOM 554   C C    . THR A 1 40  ? 7.493   10.690  -4.752  1.00 0.00 ? 40  THR A C    1  
ATOM 555   O O    . THR A 1 40  ? 8.010   11.642  -4.167  1.00 0.00 ? 40  THR A O    1  
ATOM 556   C CB   . THR A 1 40  ? 5.778   11.477  -6.385  1.00 0.00 ? 40  THR A CB   1  
ATOM 557   O OG1  . THR A 1 40  ? 4.408   11.374  -6.789  1.00 0.00 ? 40  THR A OG1  1  
ATOM 558   C CG2  . THR A 1 40  ? 6.681   10.975  -7.502  1.00 0.00 ? 40  THR A CG2  1  
ATOM 559   H H    . THR A 1 40  ? 4.958   12.145  -3.991  1.00 0.00 ? 40  THR A H    1  
ATOM 560   H HA   . THR A 1 40  ? 5.700   9.652   -5.268  1.00 0.00 ? 40  THR A HA   1  
ATOM 561   H HB   . THR A 1 40  ? 6.012   12.514  -6.192  1.00 0.00 ? 40  THR A HB   1  
ATOM 562   H HG1  . THR A 1 40  ? 4.359   11.348  -7.748  1.00 0.00 ? 40  THR A HG1  1  
ATOM 563   H HG21 . THR A 1 40  ? 6.231   10.111  -7.967  1.00 0.00 ? 40  THR A HG21 1  
ATOM 564   H HG22 . THR A 1 40  ? 7.643   10.705  -7.092  1.00 0.00 ? 40  THR A HG22 1  
ATOM 565   H HG23 . THR A 1 40  ? 6.809   11.754  -8.238  1.00 0.00 ? 40  THR A HG23 1  
ATOM 566   N N    . PRO A 1 41  ? 8.199   9.613   -5.127  1.00 0.00 ? 41  PRO A N    1  
ATOM 567   C CA   . PRO A 1 41  ? 9.637   9.482   -4.874  1.00 0.00 ? 41  PRO A CA   1  
ATOM 568   C C    . PRO A 1 41  ? 10.465  10.442  -5.722  1.00 0.00 ? 41  PRO A C    1  
ATOM 569   O O    . PRO A 1 41  ? 10.265  10.548  -6.932  1.00 0.00 ? 41  PRO A O    1  
ATOM 570   C CB   . PRO A 1 41  ? 9.935   8.032   -5.263  1.00 0.00 ? 41  PRO A CB   1  
ATOM 571   C CG   . PRO A 1 41  ? 8.875   7.678   -6.248  1.00 0.00 ? 41  PRO A CG   1  
ATOM 572   C CD   . PRO A 1 41  ? 7.649   8.441   -5.828  1.00 0.00 ? 41  PRO A CD   1  
ATOM 573   H HA   . PRO A 1 41  ? 9.872   9.631   -3.830  1.00 0.00 ? 41  PRO A HA   1  
ATOM 574   H HB2  . PRO A 1 41  ? 10.921  7.969   -5.703  1.00 0.00 ? 41  PRO A HB2  1  
ATOM 575   H HB3  . PRO A 1 41  ? 9.885   7.402   -4.387  1.00 0.00 ? 41  PRO A HB3  1  
ATOM 576   H HG2  . PRO A 1 41  ? 9.181   7.976   -7.240  1.00 0.00 ? 41  PRO A HG2  1  
ATOM 577   H HG3  . PRO A 1 41  ? 8.684   6.616   -6.217  1.00 0.00 ? 41  PRO A HG3  1  
ATOM 578   H HD2  . PRO A 1 41  ? 7.077   8.742   -6.693  1.00 0.00 ? 41  PRO A HD2  1  
ATOM 579   H HD3  . PRO A 1 41  ? 7.043   7.844   -5.163  1.00 0.00 ? 41  PRO A HD3  1  
ATOM 580   N N    . VAL A 1 42  ? 11.397  11.138  -5.079  1.00 0.00 ? 42  VAL A N    1  
ATOM 581   C CA   . VAL A 1 42  ? 12.257  12.088  -5.774  1.00 0.00 ? 42  VAL A CA   1  
ATOM 582   C C    . VAL A 1 42  ? 13.156  11.381  -6.782  1.00 0.00 ? 42  VAL A C    1  
ATOM 583   O O    . VAL A 1 42  ? 13.686  12.004  -7.702  1.00 0.00 ? 42  VAL A O    1  
ATOM 584   C CB   . VAL A 1 42  ? 13.135  12.879  -4.786  1.00 0.00 ? 42  VAL A CB   1  
ATOM 585   C CG1  . VAL A 1 42  ? 12.269  13.665  -3.813  1.00 0.00 ? 42  VAL A CG1  1  
ATOM 586   C CG2  . VAL A 1 42  ? 14.073  11.941  -4.040  1.00 0.00 ? 42  VAL A CG2  1  
ATOM 587   H H    . VAL A 1 42  ? 11.509  11.010  -4.114  1.00 0.00 ? 42  VAL A H    1  
ATOM 588   H HA   . VAL A 1 42  ? 11.624  12.789  -6.300  1.00 0.00 ? 42  VAL A HA   1  
ATOM 589   H HB   . VAL A 1 42  ? 13.734  13.580  -5.348  1.00 0.00 ? 42  VAL A HB   1  
ATOM 590   H HG11 . VAL A 1 42  ? 11.617  14.325  -4.366  1.00 0.00 ? 42  VAL A HG11 1  
ATOM 591   H HG12 . VAL A 1 42  ? 11.677  12.981  -3.224  1.00 0.00 ? 42  VAL A HG12 1  
ATOM 592   H HG13 . VAL A 1 42  ? 12.902  14.249  -3.160  1.00 0.00 ? 42  VAL A HG13 1  
ATOM 593   H HG21 . VAL A 1 42  ? 14.317  11.100  -4.671  1.00 0.00 ? 42  VAL A HG21 1  
ATOM 594   H HG22 . VAL A 1 42  ? 14.978  12.470  -3.778  1.00 0.00 ? 42  VAL A HG22 1  
ATOM 595   H HG23 . VAL A 1 42  ? 13.590  11.589  -3.141  1.00 0.00 ? 42  VAL A HG23 1  
ATOM 596   N N    . SER A 1 43  ? 13.323  10.074  -6.602  1.00 0.00 ? 43  SER A N    1  
ATOM 597   C CA   . SER A 1 43  ? 14.161  9.281   -7.494  1.00 0.00 ? 43  SER A CA   1  
ATOM 598   C C    . SER A 1 43  ? 13.307  8.418   -8.417  1.00 0.00 ? 43  SER A C    1  
ATOM 599   O O    . SER A 1 43  ? 12.352  7.778   -7.979  1.00 0.00 ? 43  SER A O    1  
ATOM 600   C CB   . SER A 1 43  ? 15.110  8.396   -6.683  1.00 0.00 ? 43  SER A CB   1  
ATOM 601   O OG   . SER A 1 43  ? 16.276  8.085   -7.426  1.00 0.00 ? 43  SER A OG   1  
ATOM 602   H H    . SER A 1 43  ? 12.874  9.634   -5.850  1.00 0.00 ? 43  SER A H    1  
ATOM 603   H HA   . SER A 1 43  ? 14.744  9.963   -8.095  1.00 0.00 ? 43  SER A HA   1  
ATOM 604   H HB2  . SER A 1 43  ? 15.400  8.914   -5.782  1.00 0.00 ? 43  SER A HB2  1  
ATOM 605   H HB3  . SER A 1 43  ? 14.607  7.476   -6.424  1.00 0.00 ? 43  SER A HB3  1  
ATOM 606   H HG   . SER A 1 43  ? 16.982  8.689   -7.182  1.00 0.00 ? 43  SER A HG   1  
ATOM 607   N N    . GLY A 1 44  ? 13.658  8.407   -9.700  1.00 0.00 ? 44  GLY A N    1  
ATOM 608   C CA   . GLY A 1 44  ? 12.914  7.620   -10.666 1.00 0.00 ? 44  GLY A CA   1  
ATOM 609   C C    . GLY A 1 44  ? 13.140  8.085   -12.090 1.00 0.00 ? 44  GLY A C    1  
ATOM 610   O O    . GLY A 1 44  ? 13.533  9.228   -12.322 1.00 0.00 ? 44  GLY A O    1  
ATOM 611   H H    . GLY A 1 44  ? 14.429  8.937   -9.992  1.00 0.00 ? 44  GLY A H    1  
ATOM 612   H HA2  . GLY A 1 44  ? 13.218  6.587   -10.583 1.00 0.00 ? 44  GLY A HA2  1  
ATOM 613   H HA3  . GLY A 1 44  ? 11.861  7.693   -10.438 1.00 0.00 ? 44  GLY A HA3  1  
ATOM 614   N N    . ASN A 1 45  ? 12.893  7.197   -13.048 1.00 0.00 ? 45  ASN A N    1  
ATOM 615   C CA   . ASN A 1 45  ? 13.075  7.523   -14.458 1.00 0.00 ? 45  ASN A CA   1  
ATOM 616   C C    . ASN A 1 45  ? 11.768  8.013   -15.075 1.00 0.00 ? 45  ASN A C    1  
ATOM 617   O O    . ASN A 1 45  ? 10.748  7.329   -15.017 1.00 0.00 ? 45  ASN A O    1  
ATOM 618   C CB   . ASN A 1 45  ? 13.588  6.302   -15.223 1.00 0.00 ? 45  ASN A CB   1  
ATOM 619   C CG   . ASN A 1 45  ? 13.599  6.522   -16.723 1.00 0.00 ? 45  ASN A CG   1  
ATOM 620   O OD1  . ASN A 1 45  ? 12.639  6.187   -17.418 1.00 0.00 ? 45  ASN A OD1  1  
ATOM 621   N ND2  . ASN A 1 45  ? 14.688  7.089   -17.230 1.00 0.00 ? 45  ASN A ND2  1  
ATOM 622   H H    . ASN A 1 45  ? 12.582  6.302   -12.801 1.00 0.00 ? 45  ASN A H    1  
ATOM 623   H HA   . ASN A 1 45  ? 13.809  8.313   -14.524 1.00 0.00 ? 45  ASN A HA   1  
ATOM 624   H HB2  . ASN A 1 45  ? 14.596  6.082   -14.904 1.00 0.00 ? 45  ASN A HB2  1  
ATOM 625   H HB3  . ASN A 1 45  ? 12.954  5.456   -15.006 1.00 0.00 ? 45  ASN A HB3  1  
ATOM 626   H HD21 . ASN A 1 45  ? 15.413  7.330   -16.616 1.00 0.00 ? 45  ASN A HD21 1  
ATOM 627   H HD22 . ASN A 1 45  ? 14.721  7.244   -18.197 1.00 0.00 ? 45  ASN A HD22 1  
ATOM 628   N N    . GLY A 1 46  ? 11.809  9.202   -15.668 1.00 0.00 ? 46  GLY A N    1  
ATOM 629   C CA   . GLY A 1 46  ? 10.623  9.763   -16.289 1.00 0.00 ? 46  GLY A CA   1  
ATOM 630   C C    . GLY A 1 46  ? 9.514   10.022  -15.289 1.00 0.00 ? 46  GLY A C    1  
ATOM 631   O O    . GLY A 1 46  ? 9.719   10.709  -14.289 1.00 0.00 ? 46  GLY A O    1  
ATOM 632   H H    . GLY A 1 46  ? 12.652  9.703   -15.684 1.00 0.00 ? 46  GLY A H    1  
ATOM 633   H HA2  . GLY A 1 46  ? 10.887  10.694  -16.768 1.00 0.00 ? 46  GLY A HA2  1  
ATOM 634   H HA3  . GLY A 1 46  ? 10.263  9.073   -17.038 1.00 0.00 ? 46  GLY A HA3  1  
ATOM 635   N N    . GLU A 1 47  ? 8.334   9.473   -15.561 1.00 0.00 ? 47  GLU A N    1  
ATOM 636   C CA   . GLU A 1 47  ? 7.187   9.652   -14.678 1.00 0.00 ? 47  GLU A CA   1  
ATOM 637   C C    . GLU A 1 47  ? 6.479   8.323   -14.431 1.00 0.00 ? 47  GLU A C    1  
ATOM 638   O O    . GLU A 1 47  ? 6.521   7.420   -15.267 1.00 0.00 ? 47  GLU A O    1  
ATOM 639   C CB   . GLU A 1 47  ? 6.206   10.662  -15.277 1.00 0.00 ? 47  GLU A CB   1  
ATOM 640   C CG   . GLU A 1 47  ? 5.995   10.492  -16.773 1.00 0.00 ? 47  GLU A CG   1  
ATOM 641   C CD   . GLU A 1 47  ? 4.869   11.357  -17.305 1.00 0.00 ? 47  GLU A CD   1  
ATOM 642   O OE1  . GLU A 1 47  ? 5.129   12.531  -17.640 1.00 0.00 ? 47  GLU A OE1  1  
ATOM 643   O OE2  . GLU A 1 47  ? 3.727   10.858  -17.386 1.00 0.00 ? 47  GLU A OE2  1  
ATOM 644   H H    . GLU A 1 47  ? 8.232   8.936   -16.374 1.00 0.00 ? 47  GLU A H    1  
ATOM 645   H HA   . GLU A 1 47  ? 7.551   10.033  -13.736 1.00 0.00 ? 47  GLU A HA   1  
ATOM 646   H HB2  . GLU A 1 47  ? 5.251   10.554  -14.785 1.00 0.00 ? 47  GLU A HB2  1  
ATOM 647   H HB3  . GLU A 1 47  ? 6.582   11.659  -15.099 1.00 0.00 ? 47  GLU A HB3  1  
ATOM 648   H HG2  . GLU A 1 47  ? 6.907   10.760  -17.285 1.00 0.00 ? 47  GLU A HG2  1  
ATOM 649   H HG3  . GLU A 1 47  ? 5.762   9.457   -16.975 1.00 0.00 ? 47  GLU A HG3  1  
ATOM 650   N N    . ILE A 1 48  ? 5.828   8.212   -13.278 1.00 0.00 ? 48  ILE A N    1  
ATOM 651   C CA   . ILE A 1 48  ? 5.110   6.995   -12.920 1.00 0.00 ? 48  ILE A CA   1  
ATOM 652   C C    . ILE A 1 48  ? 3.780   6.904   -13.661 1.00 0.00 ? 48  ILE A C    1  
ATOM 653   O O    . ILE A 1 48  ? 2.914   7.763   -13.507 1.00 0.00 ? 48  ILE A O    1  
ATOM 654   C CB   . ILE A 1 48  ? 4.847   6.921   -11.405 1.00 0.00 ? 48  ILE A CB   1  
ATOM 655   C CG1  . ILE A 1 48  ? 6.135   7.198   -10.627 1.00 0.00 ? 48  ILE A CG1  1  
ATOM 656   C CG2  . ILE A 1 48  ? 4.279   5.559   -11.032 1.00 0.00 ? 48  ILE A CG2  1  
ATOM 657   C CD1  . ILE A 1 48  ? 7.190   6.129   -10.805 1.00 0.00 ? 48  ILE A CD1  1  
ATOM 658   H H    . ILE A 1 48  ? 5.831   8.966   -12.653 1.00 0.00 ? 48  ILE A H    1  
ATOM 659   H HA   . ILE A 1 48  ? 5.725   6.151   -13.201 1.00 0.00 ? 48  ILE A HA   1  
ATOM 660   H HB   . ILE A 1 48  ? 4.114   7.671   -11.152 1.00 0.00 ? 48  ILE A HB   1  
ATOM 661   H HG12 . ILE A 1 48  ? 6.554   8.135   -10.959 1.00 0.00 ? 48  ILE A HG12 1  
ATOM 662   H HG13 . ILE A 1 48  ? 5.903   7.265   -9.574  1.00 0.00 ? 48  ILE A HG13 1  
ATOM 663   H HG21 . ILE A 1 48  ? 3.202   5.617   -10.993 1.00 0.00 ? 48  ILE A HG21 1  
ATOM 664   H HG22 . ILE A 1 48  ? 4.573   4.832   -11.773 1.00 0.00 ? 48  ILE A HG22 1  
ATOM 665   H HG23 . ILE A 1 48  ? 4.659   5.263   -10.066 1.00 0.00 ? 48  ILE A HG23 1  
ATOM 666   H HD11 . ILE A 1 48  ? 6.822   5.191   -10.417 1.00 0.00 ? 48  ILE A HD11 1  
ATOM 667   H HD12 . ILE A 1 48  ? 7.420   6.020   -11.854 1.00 0.00 ? 48  ILE A HD12 1  
ATOM 668   H HD13 . ILE A 1 48  ? 8.084   6.413   -10.268 1.00 0.00 ? 48  ILE A HD13 1  
ATOM 669   N N    . GLN A 1 49  ? 3.627   5.855   -14.464 1.00 0.00 ? 49  GLN A N    1  
ATOM 670   C CA   . GLN A 1 49  ? 2.402   5.651   -15.227 1.00 0.00 ? 49  GLN A CA   1  
ATOM 671   C C    . GLN A 1 49  ? 1.183   5.651   -14.311 1.00 0.00 ? 49  GLN A C    1  
ATOM 672   O O    . GLN A 1 49  ? 0.265   6.452   -14.482 1.00 0.00 ? 49  GLN A O    1  
ATOM 673   C CB   . GLN A 1 49  ? 2.472   4.335   -16.003 1.00 0.00 ? 49  GLN A CB   1  
ATOM 674   C CG   . GLN A 1 49  ? 3.732   4.188   -16.840 1.00 0.00 ? 49  GLN A CG   1  
ATOM 675   C CD   . GLN A 1 49  ? 3.948   5.359   -17.779 1.00 0.00 ? 49  GLN A CD   1  
ATOM 676   O OE1  . GLN A 1 49  ? 2.993   5.945   -18.289 1.00 0.00 ? 49  GLN A OE1  1  
ATOM 677   N NE2  . GLN A 1 49  ? 5.209   5.707   -18.011 1.00 0.00 ? 49  GLN A NE2  1  
ATOM 678   H H    . GLN A 1 49  ? 4.354   5.204   -14.544 1.00 0.00 ? 49  GLN A H    1  
ATOM 679   H HA   . GLN A 1 49  ? 2.309   6.467   -15.929 1.00 0.00 ? 49  GLN A HA   1  
ATOM 680   H HB2  . GLN A 1 49  ? 2.435   3.515   -15.301 1.00 0.00 ? 49  GLN A HB2  1  
ATOM 681   H HB3  . GLN A 1 49  ? 1.619   4.273   -16.662 1.00 0.00 ? 49  GLN A HB3  1  
ATOM 682   H HG2  . GLN A 1 49  ? 4.583   4.116   -16.178 1.00 0.00 ? 49  GLN A HG2  1  
ATOM 683   H HG3  . GLN A 1 49  ? 3.656   3.285   -17.426 1.00 0.00 ? 49  GLN A HG3  1  
ATOM 684   H HE21 . GLN A 1 49  ? 5.919   5.194   -17.570 1.00 0.00 ? 49  GLN A HE21 1  
ATOM 685   H HE22 . GLN A 1 49  ? 5.377   6.459   -18.614 1.00 0.00 ? 49  GLN A HE22 1  
ATOM 686   N N    . ASN A 1 50  ? 1.181   4.746   -13.337 1.00 0.00 ? 50  ASN A N    1  
ATOM 687   C CA   . ASN A 1 50  ? 0.074   4.641   -12.394 1.00 0.00 ? 50  ASN A CA   1  
ATOM 688   C C    . ASN A 1 50  ? 0.560   4.136   -11.039 1.00 0.00 ? 50  ASN A C    1  
ATOM 689   O O    . ASN A 1 50  ? 1.544   3.401   -10.955 1.00 0.00 ? 50  ASN A O    1  
ATOM 690   C CB   . ASN A 1 50  ? -1.005  3.705   -12.943 1.00 0.00 ? 50  ASN A CB   1  
ATOM 691   C CG   . ASN A 1 50  ? -2.035  4.438   -13.781 1.00 0.00 ? 50  ASN A CG   1  
ATOM 692   O OD1  . ASN A 1 50  ? -1.704  5.043   -14.801 1.00 0.00 ? 50  ASN A OD1  1  
ATOM 693   N ND2  . ASN A 1 50  ? -3.290  4.387   -13.353 1.00 0.00 ? 50  ASN A ND2  1  
ATOM 694   H H    . ASN A 1 50  ? 1.942   4.135   -13.251 1.00 0.00 ? 50  ASN A H    1  
ATOM 695   H HA   . ASN A 1 50  ? -0.348  5.627   -12.267 1.00 0.00 ? 50  ASN A HA   1  
ATOM 696   H HB2  . ASN A 1 50  ? -0.538  2.951   -13.560 1.00 0.00 ? 50  ASN A HB2  1  
ATOM 697   H HB3  . ASN A 1 50  ? -1.512  3.227   -12.119 1.00 0.00 ? 50  ASN A HB3  1  
ATOM 698   H HD21 . ASN A 1 50  ? -3.480  3.886   -12.532 1.00 0.00 ? 50  ASN A HD21 1  
ATOM 699   H HD22 . ASN A 1 50  ? -3.977  4.852   -13.876 1.00 0.00 ? 50  ASN A HD22 1  
ATOM 700   N N    . TYR A 1 51  ? -0.137  4.534   -9.980  1.00 0.00 ? 51  TYR A N    1  
ATOM 701   C CA   . TYR A 1 51  ? 0.224   4.123   -8.629  1.00 0.00 ? 51  TYR A CA   1  
ATOM 702   C C    . TYR A 1 51  ? -0.603  2.920   -8.186  1.00 0.00 ? 51  TYR A C    1  
ATOM 703   O O    . TYR A 1 51  ? -1.833  2.972   -8.160  1.00 0.00 ? 51  TYR A O    1  
ATOM 704   C CB   . TYR A 1 51  ? 0.024   5.282   -7.650  1.00 0.00 ? 51  TYR A CB   1  
ATOM 705   C CG   . TYR A 1 51  ? 1.160   6.279   -7.653  1.00 0.00 ? 51  TYR A CG   1  
ATOM 706   C CD1  . TYR A 1 51  ? 2.442   5.903   -7.269  1.00 0.00 ? 51  TYR A CD1  1  
ATOM 707   C CD2  . TYR A 1 51  ? 0.952   7.598   -8.038  1.00 0.00 ? 51  TYR A CD2  1  
ATOM 708   C CE1  . TYR A 1 51  ? 3.483   6.811   -7.270  1.00 0.00 ? 51  TYR A CE1  1  
ATOM 709   C CE2  . TYR A 1 51  ? 1.988   8.512   -8.043  1.00 0.00 ? 51  TYR A CE2  1  
ATOM 710   C CZ   . TYR A 1 51  ? 3.251   8.114   -7.657  1.00 0.00 ? 51  TYR A CZ   1  
ATOM 711   O OH   . TYR A 1 51  ? 4.285   9.022   -7.659  1.00 0.00 ? 51  TYR A OH   1  
ATOM 712   H H    . TYR A 1 51  ? -0.912  5.120   -10.111 1.00 0.00 ? 51  TYR A H    1  
ATOM 713   H HA   . TYR A 1 51  ? 1.268   3.845   -8.634  1.00 0.00 ? 51  TYR A HA   1  
ATOM 714   H HB2  . TYR A 1 51  ? -0.881  5.810   -7.909  1.00 0.00 ? 51  TYR A HB2  1  
ATOM 715   H HB3  . TYR A 1 51  ? -0.069  4.887   -6.649  1.00 0.00 ? 51  TYR A HB3  1  
ATOM 716   H HD1  . TYR A 1 51  ? 2.620   4.881   -6.966  1.00 0.00 ? 51  TYR A HD1  1  
ATOM 717   H HD2  . TYR A 1 51  ? -0.039  7.906   -8.339  1.00 0.00 ? 51  TYR A HD2  1  
ATOM 718   H HE1  . TYR A 1 51  ? 4.472   6.500   -6.968  1.00 0.00 ? 51  TYR A HE1  1  
ATOM 719   H HE2  . TYR A 1 51  ? 1.806   9.533   -8.346  1.00 0.00 ? 51  TYR A HE2  1  
ATOM 720   H HH   . TYR A 1 51  ? 4.459   9.307   -8.560  1.00 0.00 ? 51  TYR A HH   1  
ATOM 721   N N    . LYS A 1 52  ? 0.081   1.836   -7.837  1.00 0.00 ? 52  LYS A N    1  
ATOM 722   C CA   . LYS A 1 52  ? -0.587  0.619   -7.393  1.00 0.00 ? 52  LYS A CA   1  
ATOM 723   C C    . LYS A 1 52  ? -0.733  0.601   -5.875  1.00 0.00 ? 52  LYS A C    1  
ATOM 724   O O    . LYS A 1 52  ? 0.259   0.571   -5.146  1.00 0.00 ? 52  LYS A O    1  
ATOM 725   C CB   . LYS A 1 52  ? 0.193   -0.614  -7.855  1.00 0.00 ? 52  LYS A CB   1  
ATOM 726   C CG   . LYS A 1 52  ? -0.636  -1.887  -7.873  1.00 0.00 ? 52  LYS A CG   1  
ATOM 727   C CD   . LYS A 1 52  ? -1.553  -1.938  -9.084  1.00 0.00 ? 52  LYS A CD   1  
ATOM 728   C CE   . LYS A 1 52  ? -0.874  -2.605  -10.270 1.00 0.00 ? 52  LYS A CE   1  
ATOM 729   N NZ   . LYS A 1 52  ? -1.779  -2.694  -11.449 1.00 0.00 ? 52  LYS A NZ   1  
ATOM 730   H H    . LYS A 1 52  ? 1.060   1.855   -7.879  1.00 0.00 ? 52  LYS A H    1  
ATOM 731   H HA   . LYS A 1 52  ? -1.571  0.599   -7.837  1.00 0.00 ? 52  LYS A HA   1  
ATOM 732   H HB2  . LYS A 1 52  ? 0.564   -0.437  -8.854  1.00 0.00 ? 52  LYS A HB2  1  
ATOM 733   H HB3  . LYS A 1 52  ? 1.031   -0.765  -7.190  1.00 0.00 ? 52  LYS A HB3  1  
ATOM 734   H HG2  . LYS A 1 52  ? 0.028   -2.738  -7.903  1.00 0.00 ? 52  LYS A HG2  1  
ATOM 735   H HG3  . LYS A 1 52  ? -1.237  -1.927  -6.976  1.00 0.00 ? 52  LYS A HG3  1  
ATOM 736   H HD2  . LYS A 1 52  ? -2.440  -2.498  -8.829  1.00 0.00 ? 52  LYS A HD2  1  
ATOM 737   H HD3  . LYS A 1 52  ? -1.829  -0.929  -9.359  1.00 0.00 ? 52  LYS A HD3  1  
ATOM 738   H HE2  . LYS A 1 52  ? -0.001  -2.031  -10.539 1.00 0.00 ? 52  LYS A HE2  1  
ATOM 739   H HE3  . LYS A 1 52  ? -0.574  -3.602  -9.982  1.00 0.00 ? 52  LYS A HE3  1  
ATOM 740   H HZ1  . LYS A 1 52  ? -2.649  -2.152  -11.273 1.00 0.00 ? 52  LYS A HZ1  1  
ATOM 741   H HZ2  . LYS A 1 52  ? -2.033  -3.685  -11.632 1.00 0.00 ? 52  LYS A HZ2  1  
ATOM 742   H HZ3  . LYS A 1 52  ? -1.307  -2.307  -12.292 1.00 0.00 ? 52  LYS A HZ3  1  
ATOM 743   N N    . LEU A 1 53  ? -1.975  0.618   -5.404  1.00 0.00 ? 53  LEU A N    1  
ATOM 744   C CA   . LEU A 1 53  ? -2.251  0.603   -3.971  1.00 0.00 ? 53  LEU A CA   1  
ATOM 745   C C    . LEU A 1 53  ? -2.786  -0.757  -3.535  1.00 0.00 ? 53  LEU A C    1  
ATOM 746   O O    . LEU A 1 53  ? -3.921  -1.118  -3.847  1.00 0.00 ? 53  LEU A O    1  
ATOM 747   C CB   . LEU A 1 53  ? -3.256  1.698   -3.614  1.00 0.00 ? 53  LEU A CB   1  
ATOM 748   C CG   . LEU A 1 53  ? -3.873  1.613   -2.217  1.00 0.00 ? 53  LEU A CG   1  
ATOM 749   C CD1  . LEU A 1 53  ? -2.816  1.853   -1.151  1.00 0.00 ? 53  LEU A CD1  1  
ATOM 750   C CD2  . LEU A 1 53  ? -5.012  2.612   -2.075  1.00 0.00 ? 53  LEU A CD2  1  
ATOM 751   H H    . LEU A 1 53  ? -2.725  0.642   -6.033  1.00 0.00 ? 53  LEU A H    1  
ATOM 752   H HA   . LEU A 1 53  ? -1.323  0.794   -3.453  1.00 0.00 ? 53  LEU A HA   1  
ATOM 753   H HB2  . LEU A 1 53  ? -2.752  2.649   -3.695  1.00 0.00 ? 53  LEU A HB2  1  
ATOM 754   H HB3  . LEU A 1 53  ? -4.060  1.657   -4.335  1.00 0.00 ? 53  LEU A HB3  1  
ATOM 755   H HG   . LEU A 1 53  ? -4.277  0.621   -2.069  1.00 0.00 ? 53  LEU A HG   1  
ATOM 756   H HD11 . LEU A 1 53  ? -3.040  1.256   -0.280  1.00 0.00 ? 53  LEU A HD11 1  
ATOM 757   H HD12 . LEU A 1 53  ? -2.810  2.898   -0.878  1.00 0.00 ? 53  LEU A HD12 1  
ATOM 758   H HD13 . LEU A 1 53  ? -1.846  1.578   -1.538  1.00 0.00 ? 53  LEU A HD13 1  
ATOM 759   H HD21 . LEU A 1 53  ? -4.839  3.451   -2.734  1.00 0.00 ? 53  LEU A HD21 1  
ATOM 760   H HD22 . LEU A 1 53  ? -5.061  2.961   -1.054  1.00 0.00 ? 53  LEU A HD22 1  
ATOM 761   H HD23 . LEU A 1 53  ? -5.945  2.135   -2.338  1.00 0.00 ? 53  LEU A HD23 1  
ATOM 762   N N    . TYR A 1 54  ? -1.963  -1.506  -2.810  1.00 0.00 ? 54  TYR A N    1  
ATOM 763   C CA   . TYR A 1 54  ? -2.353  -2.826  -2.330  1.00 0.00 ? 54  TYR A CA   1  
ATOM 764   C C    . TYR A 1 54  ? -3.102  -2.725  -1.004  1.00 0.00 ? 54  TYR A C    1  
ATOM 765   O O    . TYR A 1 54  ? -2.928  -1.766  -0.252  1.00 0.00 ? 54  TYR A O    1  
ATOM 766   C CB   . TYR A 1 54  ? -1.121  -3.717  -2.166  1.00 0.00 ? 54  TYR A CB   1  
ATOM 767   C CG   . TYR A 1 54  ? -0.430  -4.042  -3.471  1.00 0.00 ? 54  TYR A CG   1  
ATOM 768   C CD1  . TYR A 1 54  ? 0.015   -3.031  -4.314  1.00 0.00 ? 54  TYR A CD1  1  
ATOM 769   C CD2  . TYR A 1 54  ? -0.222  -5.359  -3.861  1.00 0.00 ? 54  TYR A CD2  1  
ATOM 770   C CE1  . TYR A 1 54  ? 0.646   -3.323  -5.507  1.00 0.00 ? 54  TYR A CE1  1  
ATOM 771   C CE2  . TYR A 1 54  ? 0.409   -5.660  -5.052  1.00 0.00 ? 54  TYR A CE2  1  
ATOM 772   C CZ   . TYR A 1 54  ? 0.841   -4.639  -5.872  1.00 0.00 ? 54  TYR A CZ   1  
ATOM 773   O OH   . TYR A 1 54  ? 1.471   -4.934  -7.060  1.00 0.00 ? 54  TYR A OH   1  
ATOM 774   H H    . TYR A 1 54  ? -1.071  -1.164  -2.593  1.00 0.00 ? 54  TYR A H    1  
ATOM 775   H HA   . TYR A 1 54  ? -3.008  -3.267  -3.067  1.00 0.00 ? 54  TYR A HA   1  
ATOM 776   H HB2  . TYR A 1 54  ? -0.407  -3.219  -1.528  1.00 0.00 ? 54  TYR A HB2  1  
ATOM 777   H HB3  . TYR A 1 54  ? -1.418  -4.649  -1.707  1.00 0.00 ? 54  TYR A HB3  1  
ATOM 778   H HD1  . TYR A 1 54  ? -0.138  -2.001  -4.025  1.00 0.00 ? 54  TYR A HD1  1  
ATOM 779   H HD2  . TYR A 1 54  ? -0.562  -6.157  -3.216  1.00 0.00 ? 54  TYR A HD2  1  
ATOM 780   H HE1  . TYR A 1 54  ? 0.985   -2.523  -6.149  1.00 0.00 ? 54  TYR A HE1  1  
ATOM 781   H HE2  . TYR A 1 54  ? 0.562   -6.690  -5.338  1.00 0.00 ? 54  TYR A HE2  1  
ATOM 782   H HH   . TYR A 1 54  ? 1.379   -4.192  -7.663  1.00 0.00 ? 54  TYR A HH   1  
ATOM 783   N N    . TYR A 1 55  ? -3.934  -3.721  -0.724  1.00 0.00 ? 55  TYR A N    1  
ATOM 784   C CA   . TYR A 1 55  ? -4.711  -3.745  0.509   1.00 0.00 ? 55  TYR A CA   1  
ATOM 785   C C    . TYR A 1 55  ? -5.176  -5.162  0.833   1.00 0.00 ? 55  TYR A C    1  
ATOM 786   O O    . TYR A 1 55  ? -5.687  -5.872  -0.033  1.00 0.00 ? 55  TYR A O    1  
ATOM 787   C CB   . TYR A 1 55  ? -5.919  -2.813  0.394   1.00 0.00 ? 55  TYR A CB   1  
ATOM 788   C CG   . TYR A 1 55  ? -6.995  -3.329  -0.534  1.00 0.00 ? 55  TYR A CG   1  
ATOM 789   C CD1  . TYR A 1 55  ? -6.781  -3.401  -1.905  1.00 0.00 ? 55  TYR A CD1  1  
ATOM 790   C CD2  . TYR A 1 55  ? -8.226  -3.743  -0.041  1.00 0.00 ? 55  TYR A CD2  1  
ATOM 791   C CE1  . TYR A 1 55  ? -7.762  -3.871  -2.757  1.00 0.00 ? 55  TYR A CE1  1  
ATOM 792   C CE2  . TYR A 1 55  ? -9.212  -4.216  -0.885  1.00 0.00 ? 55  TYR A CE2  1  
ATOM 793   C CZ   . TYR A 1 55  ? -8.975  -4.277  -2.243  1.00 0.00 ? 55  TYR A CZ   1  
ATOM 794   O OH   . TYR A 1 55  ? -9.955  -4.746  -3.087  1.00 0.00 ? 55  TYR A OH   1  
ATOM 795   H H    . TYR A 1 55  ? -4.030  -4.458  -1.363  1.00 0.00 ? 55  TYR A H    1  
ATOM 796   H HA   . TYR A 1 55  ? -4.074  -3.396  1.309   1.00 0.00 ? 55  TYR A HA   1  
ATOM 797   H HB2  . TYR A 1 55  ? -6.358  -2.683  1.371   1.00 0.00 ? 55  TYR A HB2  1  
ATOM 798   H HB3  . TYR A 1 55  ? -5.590  -1.854  0.021   1.00 0.00 ? 55  TYR A HB3  1  
ATOM 799   H HD1  . TYR A 1 55  ? -5.829  -3.082  -2.306  1.00 0.00 ? 55  TYR A HD1  1  
ATOM 800   H HD2  . TYR A 1 55  ? -8.408  -3.693  1.023   1.00 0.00 ? 55  TYR A HD2  1  
ATOM 801   H HE1  . TYR A 1 55  ? -7.577  -3.920  -3.821  1.00 0.00 ? 55  TYR A HE1  1  
ATOM 802   H HE2  . TYR A 1 55  ? -10.162 -4.533  -0.482  1.00 0.00 ? 55  TYR A HE2  1  
ATOM 803   H HH   . TYR A 1 55  ? -10.317 -4.015  -3.593  1.00 0.00 ? 55  TYR A HH   1  
ATOM 804   N N    . MET A 1 56  ? -4.996  -5.565  2.086   1.00 0.00 ? 56  MET A N    1  
ATOM 805   C CA   . MET A 1 56  ? -5.399  -6.895  2.526   1.00 0.00 ? 56  MET A CA   1  
ATOM 806   C C    . MET A 1 56  ? -5.650  -6.918  4.031   1.00 0.00 ? 56  MET A C    1  
ATOM 807   O O    . MET A 1 56  ? -5.200  -6.032  4.757   1.00 0.00 ? 56  MET A O    1  
ATOM 808   C CB   . MET A 1 56  ? -4.326  -7.923  2.161   1.00 0.00 ? 56  MET A CB   1  
ATOM 809   C CG   . MET A 1 56  ? -3.297  -8.142  3.257   1.00 0.00 ? 56  MET A CG   1  
ATOM 810   S SD   . MET A 1 56  ? -1.677  -8.597  2.608   1.00 0.00 ? 56  MET A SD   1  
ATOM 811   C CE   . MET A 1 56  ? -1.104  -9.716  3.884   1.00 0.00 ? 56  MET A CE   1  
ATOM 812   H H    . MET A 1 56  ? -4.584  -4.953  2.732   1.00 0.00 ? 56  MET A H    1  
ATOM 813   H HA   . MET A 1 56  ? -6.316  -7.149  2.016   1.00 0.00 ? 56  MET A HA   1  
ATOM 814   H HB2  . MET A 1 56  ? -4.806  -8.868  1.953   1.00 0.00 ? 56  MET A HB2  1  
ATOM 815   H HB3  . MET A 1 56  ? -3.810  -7.587  1.274   1.00 0.00 ? 56  MET A HB3  1  
ATOM 816   H HG2  . MET A 1 56  ? -3.196  -7.230  3.827   1.00 0.00 ? 56  MET A HG2  1  
ATOM 817   H HG3  . MET A 1 56  ? -3.645  -8.932  3.906   1.00 0.00 ? 56  MET A HG3  1  
ATOM 818   H HE1  . MET A 1 56  ? -0.138  -9.391  4.241   1.00 0.00 ? 56  MET A HE1  1  
ATOM 819   H HE2  . MET A 1 56  ? -1.808  -9.720  4.702   1.00 0.00 ? 56  MET A HE2  1  
ATOM 820   H HE3  . MET A 1 56  ? -1.019  -10.713 3.476   1.00 0.00 ? 56  MET A HE3  1  
ATOM 821   N N    . GLU A 1 57  ? -6.372  -7.935  4.491   1.00 0.00 ? 57  GLU A N    1  
ATOM 822   C CA   . GLU A 1 57  ? -6.683  -8.071  5.909   1.00 0.00 ? 57  GLU A CA   1  
ATOM 823   C C    . GLU A 1 57  ? -5.621  -8.903  6.622   1.00 0.00 ? 57  GLU A C    1  
ATOM 824   O O    . GLU A 1 57  ? -5.211  -9.957  6.135   1.00 0.00 ? 57  GLU A O    1  
ATOM 825   C CB   . GLU A 1 57  ? -8.059  -8.714  6.093   1.00 0.00 ? 57  GLU A CB   1  
ATOM 826   C CG   . GLU A 1 57  ? -8.652  -8.498  7.474   1.00 0.00 ? 57  GLU A CG   1  
ATOM 827   C CD   . GLU A 1 57  ? -9.662  -9.565  7.849   1.00 0.00 ? 57  GLU A CD   1  
ATOM 828   O OE1  . GLU A 1 57  ? -9.549  -10.697 7.335   1.00 0.00 ? 57  GLU A OE1  1  
ATOM 829   O OE2  . GLU A 1 57  ? -10.567 -9.267  8.658   1.00 0.00 ? 57  GLU A OE2  1  
ATOM 830   H H    . GLU A 1 57  ? -6.703  -8.610  3.862   1.00 0.00 ? 57  GLU A H    1  
ATOM 831   H HA   . GLU A 1 57  ? -6.698  -7.082  6.341   1.00 0.00 ? 57  GLU A HA   1  
ATOM 832   H HB2  . GLU A 1 57  ? -8.738  -8.300  5.362   1.00 0.00 ? 57  GLU A HB2  1  
ATOM 833   H HB3  . GLU A 1 57  ? -7.970  -9.778  5.925   1.00 0.00 ? 57  GLU A HB3  1  
ATOM 834   H HG2  . GLU A 1 57  ? -7.854  -8.509  8.201   1.00 0.00 ? 57  GLU A HG2  1  
ATOM 835   H HG3  . GLU A 1 57  ? -9.143  -7.536  7.495   1.00 0.00 ? 57  GLU A HG3  1  
ATOM 836   N N    . LYS A 1 58  ? -5.178  -8.421  7.778   1.00 0.00 ? 58  LYS A N    1  
ATOM 837   C CA   . LYS A 1 58  ? -4.164  -9.118  8.560   1.00 0.00 ? 58  LYS A CA   1  
ATOM 838   C C    . LYS A 1 58  ? -4.598  -10.549 8.861   1.00 0.00 ? 58  LYS A C    1  
ATOM 839   O O    . LYS A 1 58  ? -5.389  -10.790 9.771   1.00 0.00 ? 58  LYS A O    1  
ATOM 840   C CB   . LYS A 1 58  ? -3.895  -8.370  9.868   1.00 0.00 ? 58  LYS A CB   1  
ATOM 841   C CG   . LYS A 1 58  ? -2.471  -8.520  10.373  1.00 0.00 ? 58  LYS A CG   1  
ATOM 842   C CD   . LYS A 1 58  ? -1.568  -7.425  9.831   1.00 0.00 ? 58  LYS A CD   1  
ATOM 843   C CE   . LYS A 1 58  ? -0.238  -7.384  10.566  1.00 0.00 ? 58  LYS A CE   1  
ATOM 844   N NZ   . LYS A 1 58  ? 0.757   -8.314  9.965   1.00 0.00 ? 58  LYS A NZ   1  
ATOM 845   H H    . LYS A 1 58  ? -5.543  -7.575  8.114   1.00 0.00 ? 58  LYS A H    1  
ATOM 846   H HA   . LYS A 1 58  ? -3.256  -9.145  7.978   1.00 0.00 ? 58  LYS A HA   1  
ATOM 847   H HB2  . LYS A 1 58  ? -4.092  -7.319  9.715   1.00 0.00 ? 58  LYS A HB2  1  
ATOM 848   H HB3  . LYS A 1 58  ? -4.566  -8.746  10.628  1.00 0.00 ? 58  LYS A HB3  1  
ATOM 849   H HG2  . LYS A 1 58  ? -2.474  -8.468  11.452  1.00 0.00 ? 58  LYS A HG2  1  
ATOM 850   H HG3  . LYS A 1 58  ? -2.086  -9.480  10.058  1.00 0.00 ? 58  LYS A HG3  1  
ATOM 851   H HD2  . LYS A 1 58  ? -1.382  -7.610  8.783   1.00 0.00 ? 58  LYS A HD2  1  
ATOM 852   H HD3  . LYS A 1 58  ? -2.064  -6.471  9.947   1.00 0.00 ? 58  LYS A HD3  1  
ATOM 853   H HE2  . LYS A 1 58  ? 0.151   -6.378  10.524  1.00 0.00 ? 58  LYS A HE2  1  
ATOM 854   H HE3  . LYS A 1 58  ? -0.402  -7.663  11.596  1.00 0.00 ? 58  LYS A HE3  1  
ATOM 855   H HZ1  . LYS A 1 58  ? 1.359   -8.723  10.709  1.00 0.00 ? 58  LYS A HZ1  1  
ATOM 856   H HZ2  . LYS A 1 58  ? 1.361   -7.804  9.289   1.00 0.00 ? 58  LYS A HZ2  1  
ATOM 857   H HZ3  . LYS A 1 58  ? 0.270   -9.085  9.465   1.00 0.00 ? 58  LYS A HZ3  1  
ATOM 858   N N    . GLY A 1 59  ? -4.073  -11.496 8.089   1.00 0.00 ? 59  GLY A N    1  
ATOM 859   C CA   . GLY A 1 59  ? -4.417  -12.892 8.290   1.00 0.00 ? 59  GLY A CA   1  
ATOM 860   C C    . GLY A 1 59  ? -5.199  -13.469 7.126   1.00 0.00 ? 59  GLY A C    1  
ATOM 861   O O    . GLY A 1 59  ? -6.106  -14.279 7.319   1.00 0.00 ? 59  GLY A O    1  
ATOM 862   H H    . GLY A 1 59  ? -3.447  -11.245 7.377   1.00 0.00 ? 59  GLY A H    1  
ATOM 863   H HA2  . GLY A 1 59  ? -3.508  -13.461 8.417   1.00 0.00 ? 59  GLY A HA2  1  
ATOM 864   H HA3  . GLY A 1 59  ? -5.012  -12.978 9.187   1.00 0.00 ? 59  GLY A HA3  1  
ATOM 865   N N    . THR A 1 60  ? -4.848  -13.052 5.914   1.00 0.00 ? 60  THR A N    1  
ATOM 866   C CA   . THR A 1 60  ? -5.525  -13.530 4.715   1.00 0.00 ? 60  THR A CA   1  
ATOM 867   C C    . THR A 1 60  ? -4.528  -14.090 3.707   1.00 0.00 ? 60  THR A C    1  
ATOM 868   O O    . THR A 1 60  ? -4.870  -14.947 2.892   1.00 0.00 ? 60  THR A O    1  
ATOM 869   C CB   . THR A 1 60  ? -6.340  -12.408 4.045   1.00 0.00 ? 60  THR A CB   1  
ATOM 870   O OG1  . THR A 1 60  ? -6.811  -11.486 5.034   1.00 0.00 ? 60  THR A OG1  1  
ATOM 871   C CG2  . THR A 1 60  ? -7.521  -12.982 3.276   1.00 0.00 ? 60  THR A CG2  1  
ATOM 872   H H    . THR A 1 60  ? -4.117  -12.405 5.825   1.00 0.00 ? 60  THR A H    1  
ATOM 873   H HA   . THR A 1 60  ? -6.206  -14.316 5.008   1.00 0.00 ? 60  THR A HA   1  
ATOM 874   H HB   . THR A 1 60  ? -5.699  -11.884 3.351   1.00 0.00 ? 60  THR A HB   1  
ATOM 875   H HG1  . THR A 1 60  ? -6.366  -10.643 4.923   1.00 0.00 ? 60  THR A HG1  1  
ATOM 876   H HG21 . THR A 1 60  ? -7.941  -13.810 3.828   1.00 0.00 ? 60  THR A HG21 1  
ATOM 877   H HG22 . THR A 1 60  ? -7.187  -13.326 2.308   1.00 0.00 ? 60  THR A HG22 1  
ATOM 878   H HG23 . THR A 1 60  ? -8.272  -12.218 3.148   1.00 0.00 ? 60  THR A HG23 1  
ATOM 879   N N    . ASP A 1 61  ? -3.294  -13.602 3.769   1.00 0.00 ? 61  ASP A N    1  
ATOM 880   C CA   . ASP A 1 61  ? -2.246  -14.056 2.862   1.00 0.00 ? 61  ASP A CA   1  
ATOM 881   C C    . ASP A 1 61  ? -2.695  -13.936 1.409   1.00 0.00 ? 61  ASP A C    1  
ATOM 882   O O    . ASP A 1 61  ? -2.206  -14.652 0.535   1.00 0.00 ? 61  ASP A O    1  
ATOM 883   C CB   . ASP A 1 61  ? -1.865  -15.505 3.173   1.00 0.00 ? 61  ASP A CB   1  
ATOM 884   C CG   . ASP A 1 61  ? -2.869  -16.498 2.622   1.00 0.00 ? 61  ASP A CG   1  
ATOM 885   O OD1  . ASP A 1 61  ? -2.809  -16.793 1.410   1.00 0.00 ? 61  ASP A OD1  1  
ATOM 886   O OD2  . ASP A 1 61  ? -3.715  -16.981 3.403   1.00 0.00 ? 61  ASP A OD2  1  
ATOM 887   H H    . ASP A 1 61  ? -3.083  -12.921 4.441   1.00 0.00 ? 61  ASP A H    1  
ATOM 888   H HA   . ASP A 1 61  ? -1.382  -13.427 3.012   1.00 0.00 ? 61  ASP A HA   1  
ATOM 889   H HB2  . ASP A 1 61  ? -0.900  -15.718 2.737   1.00 0.00 ? 61  ASP A HB2  1  
ATOM 890   H HB3  . ASP A 1 61  ? -1.809  -15.633 4.244   1.00 0.00 ? 61  ASP A HB3  1  
ATOM 891   N N    . LYS A 1 62  ? -3.630  -13.025 1.158   1.00 0.00 ? 62  LYS A N    1  
ATOM 892   C CA   . LYS A 1 62  ? -4.146  -12.810 -0.189  1.00 0.00 ? 62  LYS A CA   1  
ATOM 893   C C    . LYS A 1 62  ? -4.162  -11.324 -0.533  1.00 0.00 ? 62  LYS A C    1  
ATOM 894   O O    . LYS A 1 62  ? -5.225  -10.713 -0.635  1.00 0.00 ? 62  LYS A O    1  
ATOM 895   C CB   . LYS A 1 62  ? -5.556  -13.389 -0.315  1.00 0.00 ? 62  LYS A CB   1  
ATOM 896   C CG   . LYS A 1 62  ? -6.113  -13.331 -1.727  1.00 0.00 ? 62  LYS A CG   1  
ATOM 897   C CD   . LYS A 1 62  ? -5.438  -14.346 -2.635  1.00 0.00 ? 62  LYS A CD   1  
ATOM 898   C CE   . LYS A 1 62  ? -6.075  -15.721 -2.505  1.00 0.00 ? 62  LYS A CE   1  
ATOM 899   N NZ   . LYS A 1 62  ? -5.473  -16.703 -3.448  1.00 0.00 ? 62  LYS A NZ   1  
ATOM 900   H H    . LYS A 1 62  ? -3.981  -12.484 1.897   1.00 0.00 ? 62  LYS A H    1  
ATOM 901   H HA   . LYS A 1 62  ? -3.492  -13.320 -0.880  1.00 0.00 ? 62  LYS A HA   1  
ATOM 902   H HB2  . LYS A 1 62  ? -5.538  -14.422 0.000   1.00 0.00 ? 62  LYS A HB2  1  
ATOM 903   H HB3  . LYS A 1 62  ? -6.220  -12.835 0.333   1.00 0.00 ? 62  LYS A HB3  1  
ATOM 904   H HG2  . LYS A 1 62  ? -7.172  -13.541 -1.696  1.00 0.00 ? 62  LYS A HG2  1  
ATOM 905   H HG3  . LYS A 1 62  ? -5.952  -12.340 -2.128  1.00 0.00 ? 62  LYS A HG3  1  
ATOM 906   H HD2  . LYS A 1 62  ? -5.527  -14.016 -3.659  1.00 0.00 ? 62  LYS A HD2  1  
ATOM 907   H HD3  . LYS A 1 62  ? -4.393  -14.416 -2.367  1.00 0.00 ? 62  LYS A HD3  1  
ATOM 908   H HE2  . LYS A 1 62  ? -5.936  -16.074 -1.494  1.00 0.00 ? 62  LYS A HE2  1  
ATOM 909   H HE3  . LYS A 1 62  ? -7.131  -15.635 -2.714  1.00 0.00 ? 62  LYS A HE3  1  
ATOM 910   H HZ1  . LYS A 1 62  ? -5.835  -16.543 -4.410  1.00 0.00 ? 62  LYS A HZ1  1  
ATOM 911   H HZ2  . LYS A 1 62  ? -5.713  -17.672 -3.157  1.00 0.00 ? 62  LYS A HZ2  1  
ATOM 912   H HZ3  . LYS A 1 62  ? -4.438  -16.602 -3.458  1.00 0.00 ? 62  LYS A HZ3  1  
ATOM 913   N N    . GLU A 1 63  ? -2.977  -10.750 -0.714  1.00 0.00 ? 63  GLU A N    1  
ATOM 914   C CA   . GLU A 1 63  ? -2.857  -9.335  -1.048  1.00 0.00 ? 63  GLU A CA   1  
ATOM 915   C C    . GLU A 1 63  ? -3.536  -9.032  -2.380  1.00 0.00 ? 63  GLU A C    1  
ATOM 916   O O    . GLU A 1 63  ? -3.643  -9.900  -3.245  1.00 0.00 ? 63  GLU A O    1  
ATOM 917   C CB   . GLU A 1 63  ? -1.383  -8.926  -1.109  1.00 0.00 ? 63  GLU A CB   1  
ATOM 918   C CG   . GLU A 1 63  ? -1.138  -7.477  -0.722  1.00 0.00 ? 63  GLU A CG   1  
ATOM 919   C CD   . GLU A 1 63  ? 0.315   -7.202  -0.384  1.00 0.00 ? 63  GLU A CD   1  
ATOM 920   O OE1  . GLU A 1 63  ? 1.166   -7.315  -1.292  1.00 0.00 ? 63  GLU A OE1  1  
ATOM 921   O OE2  . GLU A 1 63  ? 0.601   -6.875  0.786   1.00 0.00 ? 63  GLU A OE2  1  
ATOM 922   H H    . GLU A 1 63  ? -2.164  -11.289 -0.619  1.00 0.00 ? 63  GLU A H    1  
ATOM 923   H HA   . GLU A 1 63  ? -3.346  -8.768  -0.271  1.00 0.00 ? 63  GLU A HA   1  
ATOM 924   H HB2  . GLU A 1 63  ? -0.819  -9.557  -0.439  1.00 0.00 ? 63  GLU A HB2  1  
ATOM 925   H HB3  . GLU A 1 63  ? -1.023  -9.073  -2.116  1.00 0.00 ? 63  GLU A HB3  1  
ATOM 926   H HG2  . GLU A 1 63  ? -1.426  -6.844  -1.547  1.00 0.00 ? 63  GLU A HG2  1  
ATOM 927   H HG3  . GLU A 1 63  ? -1.743  -7.241  0.141   1.00 0.00 ? 63  GLU A HG3  1  
ATOM 928   N N    . GLN A 1 64  ? -3.992  -7.793  -2.536  1.00 0.00 ? 64  GLN A N    1  
ATOM 929   C CA   . GLN A 1 64  ? -4.662  -7.375  -3.762  1.00 0.00 ? 64  GLN A CA   1  
ATOM 930   C C    . GLN A 1 64  ? -3.980  -6.151  -4.365  1.00 0.00 ? 64  GLN A C    1  
ATOM 931   O O    . GLN A 1 64  ? -2.943  -5.702  -3.876  1.00 0.00 ? 64  GLN A O    1  
ATOM 932   C CB   . GLN A 1 64  ? -6.135  -7.068  -3.484  1.00 0.00 ? 64  GLN A CB   1  
ATOM 933   C CG   . GLN A 1 64  ? -6.982  -8.310  -3.257  1.00 0.00 ? 64  GLN A CG   1  
ATOM 934   C CD   . GLN A 1 64  ? -8.297  -8.001  -2.569  1.00 0.00 ? 64  GLN A CD   1  
ATOM 935   O OE1  . GLN A 1 64  ? -9.312  -7.759  -3.224  1.00 0.00 ? 64  GLN A OE1  1  
ATOM 936   N NE2  . GLN A 1 64  ? -8.287  -8.007  -1.241  1.00 0.00 ? 64  GLN A NE2  1  
ATOM 937   H H    . GLN A 1 64  ? -3.876  -7.146  -1.810  1.00 0.00 ? 64  GLN A H    1  
ATOM 938   H HA   . GLN A 1 64  ? -4.600  -8.190  -4.468  1.00 0.00 ? 64  GLN A HA   1  
ATOM 939   H HB2  . GLN A 1 64  ? -6.201  -6.447  -2.604  1.00 0.00 ? 64  GLN A HB2  1  
ATOM 940   H HB3  . GLN A 1 64  ? -6.543  -6.530  -4.327  1.00 0.00 ? 64  GLN A HB3  1  
ATOM 941   H HG2  . GLN A 1 64  ? -7.192  -8.767  -4.213  1.00 0.00 ? 64  GLN A HG2  1  
ATOM 942   H HG3  . GLN A 1 64  ? -6.425  -9.002  -2.643  1.00 0.00 ? 64  GLN A HG3  1  
ATOM 943   H HE21 . GLN A 1 64  ? -7.442  -8.207  -0.786  1.00 0.00 ? 64  GLN A HE21 1  
ATOM 944   H HE22 . GLN A 1 64  ? -9.123  -7.810  -0.771  1.00 0.00 ? 64  GLN A HE22 1  
ATOM 945   N N    . ASP A 1 65  ? -4.569  -5.616  -5.429  1.00 0.00 ? 65  ASP A N    1  
ATOM 946   C CA   . ASP A 1 65  ? -4.019  -4.443  -6.098  1.00 0.00 ? 65  ASP A CA   1  
ATOM 947   C C    . ASP A 1 65  ? -5.120  -3.648  -6.793  1.00 0.00 ? 65  ASP A C    1  
ATOM 948   O O    . ASP A 1 65  ? -5.989  -4.217  -7.452  1.00 0.00 ? 65  ASP A O    1  
ATOM 949   C CB   . ASP A 1 65  ? -2.955  -4.862  -7.115  1.00 0.00 ? 65  ASP A CB   1  
ATOM 950   C CG   . ASP A 1 65  ? -3.557  -5.497  -8.353  1.00 0.00 ? 65  ASP A CG   1  
ATOM 951   O OD1  . ASP A 1 65  ? -3.830  -6.716  -8.321  1.00 0.00 ? 65  ASP A OD1  1  
ATOM 952   O OD2  . ASP A 1 65  ? -3.754  -4.776  -9.353  1.00 0.00 ? 65  ASP A OD2  1  
ATOM 953   H H    . ASP A 1 65  ? -5.394  -6.020  -5.772  1.00 0.00 ? 65  ASP A H    1  
ATOM 954   H HA   . ASP A 1 65  ? -3.560  -3.818  -5.347  1.00 0.00 ? 65  ASP A HA   1  
ATOM 955   H HB2  . ASP A 1 65  ? -2.393  -3.990  -7.417  1.00 0.00 ? 65  ASP A HB2  1  
ATOM 956   H HB3  . ASP A 1 65  ? -2.287  -5.574  -6.654  1.00 0.00 ? 65  ASP A HB3  1  
ATOM 957   N N    . VAL A 1 66  ? -5.076  -2.328  -6.640  1.00 0.00 ? 66  VAL A N    1  
ATOM 958   C CA   . VAL A 1 66  ? -6.069  -1.454  -7.252  1.00 0.00 ? 66  VAL A CA   1  
ATOM 959   C C    . VAL A 1 66  ? -5.403  -0.336  -8.045  1.00 0.00 ? 66  VAL A C    1  
ATOM 960   O O    . VAL A 1 66  ? -4.424  0.260   -7.595  1.00 0.00 ? 66  VAL A O    1  
ATOM 961   C CB   . VAL A 1 66  ? -7.000  -0.834  -6.193  1.00 0.00 ? 66  VAL A CB   1  
ATOM 962   C CG1  . VAL A 1 66  ? -7.718  -1.923  -5.410  1.00 0.00 ? 66  VAL A CG1  1  
ATOM 963   C CG2  . VAL A 1 66  ? -6.215  0.076   -5.261  1.00 0.00 ? 66  VAL A CG2  1  
ATOM 964   H H    . VAL A 1 66  ? -4.358  -1.933  -6.102  1.00 0.00 ? 66  VAL A H    1  
ATOM 965   H HA   . VAL A 1 66  ? -6.670  -2.050  -7.924  1.00 0.00 ? 66  VAL A HA   1  
ATOM 966   H HB   . VAL A 1 66  ? -7.744  -0.238  -6.702  1.00 0.00 ? 66  VAL A HB   1  
ATOM 967   H HG11 . VAL A 1 66  ? -7.582  -2.872  -5.906  1.00 0.00 ? 66  VAL A HG11 1  
ATOM 968   H HG12 . VAL A 1 66  ? -7.311  -1.975  -4.410  1.00 0.00 ? 66  VAL A HG12 1  
ATOM 969   H HG13 . VAL A 1 66  ? -8.772  -1.693  -5.357  1.00 0.00 ? 66  VAL A HG13 1  
ATOM 970   H HG21 . VAL A 1 66  ? -5.162  -0.004  -5.485  1.00 0.00 ? 66  VAL A HG21 1  
ATOM 971   H HG22 . VAL A 1 66  ? -6.536  1.098   -5.400  1.00 0.00 ? 66  VAL A HG22 1  
ATOM 972   H HG23 . VAL A 1 66  ? -6.389  -0.220  -4.237  1.00 0.00 ? 66  VAL A HG23 1  
ATOM 973   N N    . ASP A 1 67  ? -5.940  -0.055  -9.227  1.00 0.00 ? 67  ASP A N    1  
ATOM 974   C CA   . ASP A 1 67  ? -5.398  0.994   -10.083 1.00 0.00 ? 67  ASP A CA   1  
ATOM 975   C C    . ASP A 1 67  ? -5.701  2.375   -9.509  1.00 0.00 ? 67  ASP A C    1  
ATOM 976   O O    . ASP A 1 67  ? -6.858  2.713   -9.255  1.00 0.00 ? 67  ASP A O    1  
ATOM 977   C CB   . ASP A 1 67  ? -5.974  0.878   -11.495 1.00 0.00 ? 67  ASP A CB   1  
ATOM 978   C CG   . ASP A 1 67  ? -5.133  -0.009  -12.392 1.00 0.00 ? 67  ASP A CG   1  
ATOM 979   O OD1  . ASP A 1 67  ? -4.507  -0.956  -11.872 1.00 0.00 ? 67  ASP A OD1  1  
ATOM 980   O OD2  . ASP A 1 67  ? -5.103  0.243   -13.615 1.00 0.00 ? 67  ASP A OD2  1  
ATOM 981   H H    . ASP A 1 67  ? -6.720  -0.565  -9.531  1.00 0.00 ? 67  ASP A H    1  
ATOM 982   H HA   . ASP A 1 67  ? -4.328  0.865   -10.129 1.00 0.00 ? 67  ASP A HA   1  
ATOM 983   H HB2  . ASP A 1 67  ? -6.969  0.460   -11.438 1.00 0.00 ? 67  ASP A HB2  1  
ATOM 984   H HB3  . ASP A 1 67  ? -6.026  1.862   -11.938 1.00 0.00 ? 67  ASP A HB3  1  
ATOM 985   N N    . VAL A 1 68  ? -4.654  3.168   -9.304  1.00 0.00 ? 68  VAL A N    1  
ATOM 986   C CA   . VAL A 1 68  ? -4.808  4.512   -8.760  1.00 0.00 ? 68  VAL A CA   1  
ATOM 987   C C    . VAL A 1 68  ? -3.810  5.477   -9.389  1.00 0.00 ? 68  VAL A C    1  
ATOM 988   O O    . VAL A 1 68  ? -2.636  5.147   -9.562  1.00 0.00 ? 68  VAL A O    1  
ATOM 989   C CB   . VAL A 1 68  ? -4.623  4.522   -7.231  1.00 0.00 ? 68  VAL A CB   1  
ATOM 990   C CG1  . VAL A 1 68  ? -4.891  5.910   -6.670  1.00 0.00 ? 68  VAL A CG1  1  
ATOM 991   C CG2  . VAL A 1 68  ? -5.528  3.490   -6.577  1.00 0.00 ? 68  VAL A CG2  1  
ATOM 992   H H    . VAL A 1 68  ? -3.757  2.842   -9.526  1.00 0.00 ? 68  VAL A H    1  
ATOM 993   H HA   . VAL A 1 68  ? -5.810  4.850   -8.982  1.00 0.00 ? 68  VAL A HA   1  
ATOM 994   H HB   . VAL A 1 68  ? -3.598  4.262   -7.011  1.00 0.00 ? 68  VAL A HB   1  
ATOM 995   H HG11 . VAL A 1 68  ? -5.877  5.935   -6.229  1.00 0.00 ? 68  VAL A HG11 1  
ATOM 996   H HG12 . VAL A 1 68  ? -4.153  6.144   -5.917  1.00 0.00 ? 68  VAL A HG12 1  
ATOM 997   H HG13 . VAL A 1 68  ? -4.836  6.637   -7.467  1.00 0.00 ? 68  VAL A HG13 1  
ATOM 998   H HG21 . VAL A 1 68  ? -5.058  2.519   -6.622  1.00 0.00 ? 68  VAL A HG21 1  
ATOM 999   H HG22 . VAL A 1 68  ? -5.697  3.760   -5.545  1.00 0.00 ? 68  VAL A HG22 1  
ATOM 1000  H HG23 . VAL A 1 68  ? -6.473  3.457   -7.099  1.00 0.00 ? 68  VAL A HG23 1  
ATOM 1001  N N    . SER A 1 69  ? -4.283  6.672   -9.728  1.00 0.00 ? 69  SER A N    1  
ATOM 1002  C CA   . SER A 1 69  ? -3.433  7.685   -10.341 1.00 0.00 ? 69  SER A CA   1  
ATOM 1003  C C    . SER A 1 69  ? -3.485  8.989   -9.550  1.00 0.00 ? 69  SER A C    1  
ATOM 1004  O O    . SER A 1 69  ? -3.496  10.077  -10.126 1.00 0.00 ? 69  SER A O    1  
ATOM 1005  C CB   . SER A 1 69  ? -3.864  7.936   -11.788 1.00 0.00 ? 69  SER A CB   1  
ATOM 1006  O OG   . SER A 1 69  ? -5.255  8.195   -11.868 1.00 0.00 ? 69  SER A OG   1  
ATOM 1007  H H    . SER A 1 69  ? -5.228  6.875   -9.565  1.00 0.00 ? 69  SER A H    1  
ATOM 1008  H HA   . SER A 1 69  ? -2.419  7.314   -10.336 1.00 0.00 ? 69  SER A HA   1  
ATOM 1009  H HB2  . SER A 1 69  ? -3.328  8.787   -12.178 1.00 0.00 ? 69  SER A HB2  1  
ATOM 1010  H HB3  . SER A 1 69  ? -3.637  7.063   -12.384 1.00 0.00 ? 69  SER A HB3  1  
ATOM 1011  H HG   . SER A 1 69  ? -5.741  7.378   -11.737 1.00 0.00 ? 69  SER A HG   1  
ATOM 1012  N N    . SER A 1 70  ? -3.516  8.870   -8.227  1.00 0.00 ? 70  SER A N    1  
ATOM 1013  C CA   . SER A 1 70  ? -3.571  10.037  -7.356  1.00 0.00 ? 70  SER A CA   1  
ATOM 1014  C C    . SER A 1 70  ? -2.740  9.814   -6.095  1.00 0.00 ? 70  SER A C    1  
ATOM 1015  O O    . SER A 1 70  ? -2.287  8.701   -5.825  1.00 0.00 ? 70  SER A O    1  
ATOM 1016  C CB   . SER A 1 70  ? -5.020  10.350  -6.976  1.00 0.00 ? 70  SER A CB   1  
ATOM 1017  O OG   . SER A 1 70  ? -5.694  9.184   -6.536  1.00 0.00 ? 70  SER A OG   1  
ATOM 1018  H H    . SER A 1 70  ? -3.505  7.974   -7.827  1.00 0.00 ? 70  SER A H    1  
ATOM 1019  H HA   . SER A 1 70  ? -3.161  10.876  -7.899  1.00 0.00 ? 70  SER A HA   1  
ATOM 1020  H HB2  . SER A 1 70  ? -5.032  11.080  -6.182  1.00 0.00 ? 70  SER A HB2  1  
ATOM 1021  H HB3  . SER A 1 70  ? -5.537  10.747  -7.838  1.00 0.00 ? 70  SER A HB3  1  
ATOM 1022  H HG   . SER A 1 70  ? -5.061  8.574   -6.152  1.00 0.00 ? 70  SER A HG   1  
ATOM 1023  N N    . HIS A 1 71  ? -2.545  10.881  -5.327  1.00 0.00 ? 71  HIS A N    1  
ATOM 1024  C CA   . HIS A 1 71  ? -1.769  10.802  -4.094  1.00 0.00 ? 71  HIS A CA   1  
ATOM 1025  C C    . HIS A 1 71  ? -2.684  10.610  -2.888  1.00 0.00 ? 71  HIS A C    1  
ATOM 1026  O O    . HIS A 1 71  ? -2.323  10.953  -1.762  1.00 0.00 ? 71  HIS A O    1  
ATOM 1027  C CB   . HIS A 1 71  ? -0.928  12.067  -3.914  1.00 0.00 ? 71  HIS A CB   1  
ATOM 1028  C CG   . HIS A 1 71  ? 0.027   12.316  -5.040  1.00 0.00 ? 71  HIS A CG   1  
ATOM 1029  N ND1  . HIS A 1 71  ? 0.127   13.529  -5.689  1.00 0.00 ? 71  HIS A ND1  1  
ATOM 1030  C CD2  . HIS A 1 71  ? 0.930   11.499  -5.632  1.00 0.00 ? 71  HIS A CD2  1  
ATOM 1031  C CE1  . HIS A 1 71  ? 1.048   13.447  -6.632  1.00 0.00 ? 71  HIS A CE1  1  
ATOM 1032  N NE2  . HIS A 1 71  ? 1.552   12.226  -6.618  1.00 0.00 ? 71  HIS A NE2  1  
ATOM 1033  H H    . HIS A 1 71  ? -2.931  11.740  -5.595  1.00 0.00 ? 71  HIS A H    1  
ATOM 1034  H HA   . HIS A 1 71  ? -1.111  9.951   -4.170  1.00 0.00 ? 71  HIS A HA   1  
ATOM 1035  H HB2  . HIS A 1 71  ? -1.585  12.921  -3.842  1.00 0.00 ? 71  HIS A HB2  1  
ATOM 1036  H HB3  . HIS A 1 71  ? -0.353  11.983  -3.003  1.00 0.00 ? 71  HIS A HB3  1  
ATOM 1037  H HD1  . HIS A 1 71  ? -0.401  14.329  -5.489  1.00 0.00 ? 71  HIS A HD1  1  
ATOM 1038  H HD2  . HIS A 1 71  ? 1.127   10.467  -5.377  1.00 0.00 ? 71  HIS A HD2  1  
ATOM 1039  H HE1  . HIS A 1 71  ? 1.341   14.243  -7.300  1.00 0.00 ? 71  HIS A HE1  1  
ATOM 1040  H HE2  . HIS A 1 71  ? 2.191   11.872  -7.270  1.00 0.00 ? 71  HIS A HE2  1  
ATOM 1041  N N    . SER A 1 72  ? -3.869  10.061  -3.132  1.00 0.00 ? 72  SER A N    1  
ATOM 1042  C CA   . SER A 1 72  ? -4.837  9.827   -2.067  1.00 0.00 ? 72  SER A CA   1  
ATOM 1043  C C    . SER A 1 72  ? -5.993  8.964   -2.563  1.00 0.00 ? 72  SER A C    1  
ATOM 1044  O O    . SER A 1 72  ? -6.703  9.335   -3.499  1.00 0.00 ? 72  SER A O    1  
ATOM 1045  C CB   . SER A 1 72  ? -5.372  11.158  -1.534  1.00 0.00 ? 72  SER A CB   1  
ATOM 1046  O OG   . SER A 1 72  ? -6.275  11.749  -2.452  1.00 0.00 ? 72  SER A OG   1  
ATOM 1047  H H    . SER A 1 72  ? -4.099  9.809   -4.051  1.00 0.00 ? 72  SER A H    1  
ATOM 1048  H HA   . SER A 1 72  ? -4.332  9.306   -1.268  1.00 0.00 ? 72  SER A HA   1  
ATOM 1049  H HB2  . SER A 1 72  ? -5.886  10.988  -0.600  1.00 0.00 ? 72  SER A HB2  1  
ATOM 1050  H HB3  . SER A 1 72  ? -4.546  11.835  -1.372  1.00 0.00 ? 72  SER A HB3  1  
ATOM 1051  H HG   . SER A 1 72  ? -7.176  11.560  -2.181  1.00 0.00 ? 72  SER A HG   1  
ATOM 1052  N N    . TYR A 1 73  ? -6.177  7.811   -1.930  1.00 0.00 ? 73  TYR A N    1  
ATOM 1053  C CA   . TYR A 1 73  ? -7.244  6.893   -2.307  1.00 0.00 ? 73  TYR A CA   1  
ATOM 1054  C C    . TYR A 1 73  ? -7.967  6.360   -1.073  1.00 0.00 ? 73  TYR A C    1  
ATOM 1055  O O    . TYR A 1 73  ? -7.358  6.150   -0.024  1.00 0.00 ? 73  TYR A O    1  
ATOM 1056  C CB   . TYR A 1 73  ? -6.680  5.728   -3.123  1.00 0.00 ? 73  TYR A CB   1  
ATOM 1057  C CG   . TYR A 1 73  ? -7.740  4.794   -3.659  1.00 0.00 ? 73  TYR A CG   1  
ATOM 1058  C CD1  . TYR A 1 73  ? -8.211  3.734   -2.894  1.00 0.00 ? 73  TYR A CD1  1  
ATOM 1059  C CD2  . TYR A 1 73  ? -8.271  4.970   -4.931  1.00 0.00 ? 73  TYR A CD2  1  
ATOM 1060  C CE1  . TYR A 1 73  ? -9.180  2.877   -3.380  1.00 0.00 ? 73  TYR A CE1  1  
ATOM 1061  C CE2  . TYR A 1 73  ? -9.241  4.119   -5.424  1.00 0.00 ? 73  TYR A CE2  1  
ATOM 1062  C CZ   . TYR A 1 73  ? -9.692  3.074   -4.645  1.00 0.00 ? 73  TYR A CZ   1  
ATOM 1063  O OH   . TYR A 1 73  ? -10.657 2.223   -5.133  1.00 0.00 ? 73  TYR A OH   1  
ATOM 1064  H H    . TYR A 1 73  ? -5.579  7.570   -1.191  1.00 0.00 ? 73  TYR A H    1  
ATOM 1065  H HA   . TYR A 1 73  ? -7.950  7.437   -2.917  1.00 0.00 ? 73  TYR A HA   1  
ATOM 1066  H HB2  . TYR A 1 73  ? -6.129  6.121   -3.964  1.00 0.00 ? 73  TYR A HB2  1  
ATOM 1067  H HB3  . TYR A 1 73  ? -6.013  5.151   -2.499  1.00 0.00 ? 73  TYR A HB3  1  
ATOM 1068  H HD1  . TYR A 1 73  ? -7.808  3.582   -1.903  1.00 0.00 ? 73  TYR A HD1  1  
ATOM 1069  H HD2  . TYR A 1 73  ? -7.916  5.790   -5.539  1.00 0.00 ? 73  TYR A HD2  1  
ATOM 1070  H HE1  . TYR A 1 73  ? -9.533  2.059   -2.770  1.00 0.00 ? 73  TYR A HE1  1  
ATOM 1071  H HE2  . TYR A 1 73  ? -9.642  4.273   -6.415  1.00 0.00 ? 73  TYR A HE2  1  
ATOM 1072  H HH   . TYR A 1 73  ? -11.275 2.004   -4.432  1.00 0.00 ? 73  TYR A HH   1  
ATOM 1073  N N    . THR A 1 74  ? -9.272  6.144   -1.207  1.00 0.00 ? 74  THR A N    1  
ATOM 1074  C CA   . THR A 1 74  ? -10.079 5.637   -0.105  1.00 0.00 ? 74  THR A CA   1  
ATOM 1075  C C    . THR A 1 74  ? -10.641 4.256   -0.425  1.00 0.00 ? 74  THR A C    1  
ATOM 1076  O O    . THR A 1 74  ? -11.299 4.066   -1.449  1.00 0.00 ? 74  THR A O    1  
ATOM 1077  C CB   . THR A 1 74  ? -11.244 6.590   0.222   1.00 0.00 ? 74  THR A CB   1  
ATOM 1078  O OG1  . THR A 1 74  ? -10.748 7.917   0.431   1.00 0.00 ? 74  THR A OG1  1  
ATOM 1079  C CG2  . THR A 1 74  ? -11.994 6.123   1.461   1.00 0.00 ? 74  THR A CG2  1  
ATOM 1080  H H    . THR A 1 74  ? -9.700  6.331   -2.068  1.00 0.00 ? 74  THR A H    1  
ATOM 1081  H HA   . THR A 1 74  ? -9.446  5.564   0.767   1.00 0.00 ? 74  THR A HA   1  
ATOM 1082  H HB   . THR A 1 74  ? -11.930 6.597   -0.613  1.00 0.00 ? 74  THR A HB   1  
ATOM 1083  H HG1  . THR A 1 74  ? -11.343 8.549   0.021   1.00 0.00 ? 74  THR A HG1  1  
ATOM 1084  H HG21 . THR A 1 74  ? -12.239 5.076   1.360   1.00 0.00 ? 74  THR A HG21 1  
ATOM 1085  H HG22 . THR A 1 74  ? -12.902 6.697   1.571   1.00 0.00 ? 74  THR A HG22 1  
ATOM 1086  H HG23 . THR A 1 74  ? -11.371 6.264   2.332   1.00 0.00 ? 74  THR A HG23 1  
ATOM 1087  N N    . ILE A 1 75  ? -10.380 3.297   0.456   1.00 0.00 ? 75  ILE A N    1  
ATOM 1088  C CA   . ILE A 1 75  ? -10.862 1.935   0.268   1.00 0.00 ? 75  ILE A CA   1  
ATOM 1089  C C    . ILE A 1 75  ? -12.058 1.645   1.168   1.00 0.00 ? 75  ILE A C    1  
ATOM 1090  O O    . ILE A 1 75  ? -11.912 1.488   2.379   1.00 0.00 ? 75  ILE A O    1  
ATOM 1091  C CB   . ILE A 1 75  ? -9.756  0.902   0.555   1.00 0.00 ? 75  ILE A CB   1  
ATOM 1092  C CG1  . ILE A 1 75  ? -8.639  1.016   -0.485  1.00 0.00 ? 75  ILE A CG1  1  
ATOM 1093  C CG2  . ILE A 1 75  ? -10.335 -0.505  0.566   1.00 0.00 ? 75  ILE A CG2  1  
ATOM 1094  C CD1  . ILE A 1 75  ? -7.405  0.214   -0.136  1.00 0.00 ? 75  ILE A CD1  1  
ATOM 1095  H H    . ILE A 1 75  ? -9.850  3.511   1.253   1.00 0.00 ? 75  ILE A H    1  
ATOM 1096  H HA   . ILE A 1 75  ? -11.166 1.829   -0.763  1.00 0.00 ? 75  ILE A HA   1  
ATOM 1097  H HB   . ILE A 1 75  ? -9.349  1.105   1.533   1.00 0.00 ? 75  ILE A HB   1  
ATOM 1098  H HG12 . ILE A 1 75  ? -9.004  0.663   -1.437  1.00 0.00 ? 75  ILE A HG12 1  
ATOM 1099  H HG13 . ILE A 1 75  ? -8.348  2.052   -0.577  1.00 0.00 ? 75  ILE A HG13 1  
ATOM 1100  H HG21 . ILE A 1 75  ? -11.092 -0.577  1.333   1.00 0.00 ? 75  ILE A HG21 1  
ATOM 1101  H HG22 . ILE A 1 75  ? -10.777 -0.719  -0.396  1.00 0.00 ? 75  ILE A HG22 1  
ATOM 1102  H HG23 . ILE A 1 75  ? -9.549  -1.217  0.768   1.00 0.00 ? 75  ILE A HG23 1  
ATOM 1103  H HD11 . ILE A 1 75  ? -7.693  -0.787  0.147   1.00 0.00 ? 75  ILE A HD11 1  
ATOM 1104  H HD12 . ILE A 1 75  ? -6.748  0.172   -0.992  1.00 0.00 ? 75  ILE A HD12 1  
ATOM 1105  H HD13 . ILE A 1 75  ? -6.890  0.686   0.689   1.00 0.00 ? 75  ILE A HD13 1  
ATOM 1106  N N    . ASN A 1 76  ? -13.241 1.575   0.566   1.00 0.00 ? 76  ASN A N    1  
ATOM 1107  C CA   . ASN A 1 76  ? -14.464 1.303   1.313   1.00 0.00 ? 76  ASN A CA   1  
ATOM 1108  C C    . ASN A 1 76  ? -14.794 -0.186  1.291   1.00 0.00 ? 76  ASN A C    1  
ATOM 1109  O O    . ASN A 1 76  ? -14.071 -0.985  0.698   1.00 0.00 ? 76  ASN A O    1  
ATOM 1110  C CB   . ASN A 1 76  ? -15.630 2.104   0.732   1.00 0.00 ? 76  ASN A CB   1  
ATOM 1111  C CG   . ASN A 1 76  ? -15.434 3.601   0.878   1.00 0.00 ? 76  ASN A CG   1  
ATOM 1112  O OD1  . ASN A 1 76  ? -16.012 4.230   1.764   1.00 0.00 ? 76  ASN A OD1  1  
ATOM 1113  N ND2  . ASN A 1 76  ? -14.614 4.178   0.007   1.00 0.00 ? 76  ASN A ND2  1  
ATOM 1114  H H    . ASN A 1 76  ? -13.293 1.710   -0.403  1.00 0.00 ? 76  ASN A H    1  
ATOM 1115  H HA   . ASN A 1 76  ? -14.302 1.609   2.336   1.00 0.00 ? 76  ASN A HA   1  
ATOM 1116  H HB2  . ASN A 1 76  ? -15.728 1.875   -0.319  1.00 0.00 ? 76  ASN A HB2  1  
ATOM 1117  H HB3  . ASN A 1 76  ? -16.540 1.827   1.243   1.00 0.00 ? 76  ASN A HB3  1  
ATOM 1118  H HD21 . ASN A 1 76  ? -14.188 3.614   -0.672  1.00 0.00 ? 76  ASN A HD21 1  
ATOM 1119  H HD22 . ASN A 1 76  ? -14.469 5.144   0.079   1.00 0.00 ? 76  ASN A HD22 1  
ATOM 1120  N N    . GLY A 1 77  ? -15.894 -0.553  1.943   1.00 0.00 ? 77  GLY A N    1  
ATOM 1121  C CA   . GLY A 1 77  ? -16.302 -1.945  1.986   1.00 0.00 ? 77  GLY A CA   1  
ATOM 1122  C C    . GLY A 1 77  ? -15.380 -2.793  2.840   1.00 0.00 ? 77  GLY A C    1  
ATOM 1123  O O    . GLY A 1 77  ? -14.886 -3.829  2.392   1.00 0.00 ? 77  GLY A O    1  
ATOM 1124  H H    . GLY A 1 77  ? -16.432 0.128   2.399   1.00 0.00 ? 77  GLY A H    1  
ATOM 1125  H HA2  . GLY A 1 77  ? -17.302 -2.003  2.388   1.00 0.00 ? 77  GLY A HA2  1  
ATOM 1126  H HA3  . GLY A 1 77  ? -16.305 -2.338  0.980   1.00 0.00 ? 77  GLY A HA3  1  
ATOM 1127  N N    . LEU A 1 78  ? -15.145 -2.353  4.071   1.00 0.00 ? 78  LEU A N    1  
ATOM 1128  C CA   . LEU A 1 78  ? -14.274 -3.079  4.989   1.00 0.00 ? 78  LEU A CA   1  
ATOM 1129  C C    . LEU A 1 78  ? -14.981 -3.347  6.313   1.00 0.00 ? 78  LEU A C    1  
ATOM 1130  O O    . LEU A 1 78  ? -16.009 -2.740  6.615   1.00 0.00 ? 78  LEU A O    1  
ATOM 1131  C CB   . LEU A 1 78  ? -12.988 -2.287  5.236   1.00 0.00 ? 78  LEU A CB   1  
ATOM 1132  C CG   . LEU A 1 78  ? -12.264 -1.777  3.990   1.00 0.00 ? 78  LEU A CG   1  
ATOM 1133  C CD1  . LEU A 1 78  ? -11.052 -0.945  4.380   1.00 0.00 ? 78  LEU A CD1  1  
ATOM 1134  C CD2  . LEU A 1 78  ? -11.850 -2.941  3.100   1.00 0.00 ? 78  LEU A CD2  1  
ATOM 1135  H H    . LEU A 1 78  ? -15.566 -1.521  4.371   1.00 0.00 ? 78  LEU A H    1  
ATOM 1136  H HA   . LEU A 1 78  ? -14.023 -4.024  4.531   1.00 0.00 ? 78  LEU A HA   1  
ATOM 1137  H HB2  . LEU A 1 78  ? -13.238 -1.433  5.846   1.00 0.00 ? 78  LEU A HB2  1  
ATOM 1138  H HB3  . LEU A 1 78  ? -12.306 -2.927  5.778   1.00 0.00 ? 78  LEU A HB3  1  
ATOM 1139  H HG   . LEU A 1 78  ? -12.935 -1.145  3.425   1.00 0.00 ? 78  LEU A HG   1  
ATOM 1140  H HD11 . LEU A 1 78  ? -10.380 -1.544  4.975   1.00 0.00 ? 78  LEU A HD11 1  
ATOM 1141  H HD12 . LEU A 1 78  ? -11.374 -0.088  4.953   1.00 0.00 ? 78  LEU A HD12 1  
ATOM 1142  H HD13 . LEU A 1 78  ? -10.544 -0.610  3.487   1.00 0.00 ? 78  LEU A HD13 1  
ATOM 1143  H HD21 . LEU A 1 78  ? -11.632 -3.802  3.714   1.00 0.00 ? 78  LEU A HD21 1  
ATOM 1144  H HD22 . LEU A 1 78  ? -10.969 -2.667  2.537   1.00 0.00 ? 78  LEU A HD22 1  
ATOM 1145  H HD23 . LEU A 1 78  ? -12.654 -3.177  2.419   1.00 0.00 ? 78  LEU A HD23 1  
ATOM 1146  N N    . LYS A 1 79  ? -14.424 -4.260  7.102   1.00 0.00 ? 79  LYS A N    1  
ATOM 1147  C CA   . LYS A 1 79  ? -14.998 -4.607  8.396   1.00 0.00 ? 79  LYS A CA   1  
ATOM 1148  C C    . LYS A 1 79  ? -14.744 -3.504  9.418   1.00 0.00 ? 79  LYS A C    1  
ATOM 1149  O O    . LYS A 1 79  ? -13.961 -2.586  9.174   1.00 0.00 ? 79  LYS A O    1  
ATOM 1150  C CB   . LYS A 1 79  ? -14.412 -5.928  8.900   1.00 0.00 ? 79  LYS A CB   1  
ATOM 1151  C CG   . LYS A 1 79  ? -14.918 -7.145  8.145   1.00 0.00 ? 79  LYS A CG   1  
ATOM 1152  C CD   . LYS A 1 79  ? -16.200 -7.686  8.756   1.00 0.00 ? 79  LYS A CD   1  
ATOM 1153  C CE   . LYS A 1 79  ? -15.916 -8.562  9.966   1.00 0.00 ? 79  LYS A CE   1  
ATOM 1154  N NZ   . LYS A 1 79  ? -15.629 -9.970  9.575   1.00 0.00 ? 79  LYS A NZ   1  
ATOM 1155  H H    . LYS A 1 79  ? -13.604 -4.710  6.806   1.00 0.00 ? 79  LYS A H    1  
ATOM 1156  H HA   . LYS A 1 79  ? -16.064 -4.723  8.266   1.00 0.00 ? 79  LYS A HA   1  
ATOM 1157  H HB2  . LYS A 1 79  ? -13.337 -5.891  8.801   1.00 0.00 ? 79  LYS A HB2  1  
ATOM 1158  H HB3  . LYS A 1 79  ? -14.665 -6.046  9.943   1.00 0.00 ? 79  LYS A HB3  1  
ATOM 1159  H HG2  . LYS A 1 79  ? -15.109 -6.868  7.119   1.00 0.00 ? 79  LYS A HG2  1  
ATOM 1160  H HG3  . LYS A 1 79  ? -14.162 -7.917  8.177   1.00 0.00 ? 79  LYS A HG3  1  
ATOM 1161  H HD2  . LYS A 1 79  ? -16.820 -6.856  9.064   1.00 0.00 ? 79  LYS A HD2  1  
ATOM 1162  H HD3  . LYS A 1 79  ? -16.724 -8.271  8.013   1.00 0.00 ? 79  LYS A HD3  1  
ATOM 1163  H HE2  . LYS A 1 79  ? -15.062 -8.162  10.491  1.00 0.00 ? 79  LYS A HE2  1  
ATOM 1164  H HE3  . LYS A 1 79  ? -16.778 -8.547  10.616  1.00 0.00 ? 79  LYS A HE3  1  
ATOM 1165  H HZ1  . LYS A 1 79  ? -15.924 -10.618 10.333  1.00 0.00 ? 79  LYS A HZ1  1  
ATOM 1166  H HZ2  . LYS A 1 79  ? -14.610 -10.094 9.406   1.00 0.00 ? 79  LYS A HZ2  1  
ATOM 1167  H HZ3  . LYS A 1 79  ? -16.146 -10.213 8.706   1.00 0.00 ? 79  LYS A HZ3  1  
ATOM 1168  N N    . LYS A 1 80  ? -15.411 -3.600  10.564  1.00 0.00 ? 80  LYS A N    1  
ATOM 1169  C CA   . LYS A 1 80  ? -15.256 -2.612  11.625  1.00 0.00 ? 80  LYS A CA   1  
ATOM 1170  C C    . LYS A 1 80  ? -14.312 -3.121  12.709  1.00 0.00 ? 80  LYS A C    1  
ATOM 1171  O O    . LYS A 1 80  ? -14.477 -4.230  13.219  1.00 0.00 ? 80  LYS A O    1  
ATOM 1172  C CB   . LYS A 1 80  ? -16.617 -2.273  12.237  1.00 0.00 ? 80  LYS A CB   1  
ATOM 1173  C CG   . LYS A 1 80  ? -17.654 -1.845  11.213  1.00 0.00 ? 80  LYS A CG   1  
ATOM 1174  C CD   . LYS A 1 80  ? -18.472 -3.027  10.720  1.00 0.00 ? 80  LYS A CD   1  
ATOM 1175  C CE   . LYS A 1 80  ? -18.983 -2.799  9.306   1.00 0.00 ? 80  LYS A CE   1  
ATOM 1176  N NZ   . LYS A 1 80  ? -19.963 -3.843  8.895   1.00 0.00 ? 80  LYS A NZ   1  
ATOM 1177  H H    . LYS A 1 80  ? -16.021 -4.355  10.699  1.00 0.00 ? 80  LYS A H    1  
ATOM 1178  H HA   . LYS A 1 80  ? -14.835 -1.719  11.188  1.00 0.00 ? 80  LYS A HA   1  
ATOM 1179  H HB2  . LYS A 1 80  ? -16.991 -3.143  12.756  1.00 0.00 ? 80  LYS A HB2  1  
ATOM 1180  H HB3  . LYS A 1 80  ? -16.489 -1.468  12.946  1.00 0.00 ? 80  LYS A HB3  1  
ATOM 1181  H HG2  . LYS A 1 80  ? -18.319 -1.125  11.667  1.00 0.00 ? 80  LYS A HG2  1  
ATOM 1182  H HG3  . LYS A 1 80  ? -17.150 -1.391  10.372  1.00 0.00 ? 80  LYS A HG3  1  
ATOM 1183  H HD2  . LYS A 1 80  ? -17.852 -3.911  10.728  1.00 0.00 ? 80  LYS A HD2  1  
ATOM 1184  H HD3  . LYS A 1 80  ? -19.316 -3.170  11.380  1.00 0.00 ? 80  LYS A HD3  1  
ATOM 1185  H HE2  . LYS A 1 80  ? -19.461 -1.832  9.261   1.00 0.00 ? 80  LYS A HE2  1  
ATOM 1186  H HE3  . LYS A 1 80  ? -18.144 -2.817  8.626   1.00 0.00 ? 80  LYS A HE3  1  
ATOM 1187  H HZ1  . LYS A 1 80  ? -19.844 -4.694  9.481   1.00 0.00 ? 80  LYS A HZ1  1  
ATOM 1188  H HZ2  . LYS A 1 80  ? -19.815 -4.099  7.898   1.00 0.00 ? 80  LYS A HZ2  1  
ATOM 1189  H HZ3  . LYS A 1 80  ? -20.933 -3.488  9.011   1.00 0.00 ? 80  LYS A HZ3  1  
ATOM 1190  N N    . TYR A 1 81  ? -13.323 -2.305  13.057  1.00 0.00 ? 81  TYR A N    1  
ATOM 1191  C CA   . TYR A 1 81  ? -12.352 -2.674  14.081  1.00 0.00 ? 81  TYR A CA   1  
ATOM 1192  C C    . TYR A 1 81  ? -11.424 -3.776  13.579  1.00 0.00 ? 81  TYR A C    1  
ATOM 1193  O O    . TYR A 1 81  ? -10.861 -4.538  14.366  1.00 0.00 ? 81  TYR A O    1  
ATOM 1194  C CB   . TYR A 1 81  ? -13.069 -3.135  15.351  1.00 0.00 ? 81  TYR A CB   1  
ATOM 1195  C CG   . TYR A 1 81  ? -12.178 -3.162  16.572  1.00 0.00 ? 81  TYR A CG   1  
ATOM 1196  C CD1  . TYR A 1 81  ? -11.631 -1.993  17.084  1.00 0.00 ? 81  TYR A CD1  1  
ATOM 1197  C CD2  . TYR A 1 81  ? -11.886 -4.359  17.216  1.00 0.00 ? 81  TYR A CD2  1  
ATOM 1198  C CE1  . TYR A 1 81  ? -10.816 -2.013  18.199  1.00 0.00 ? 81  TYR A CE1  1  
ATOM 1199  C CE2  . TYR A 1 81  ? -11.073 -4.389  18.333  1.00 0.00 ? 81  TYR A CE2  1  
ATOM 1200  C CZ   . TYR A 1 81  ? -10.540 -3.214  18.820  1.00 0.00 ? 81  TYR A CZ   1  
ATOM 1201  O OH   . TYR A 1 81  ? -9.730  -3.238  19.932  1.00 0.00 ? 81  TYR A OH   1  
ATOM 1202  H H    . TYR A 1 81  ? -13.243 -1.435  12.615  1.00 0.00 ? 81  TYR A H    1  
ATOM 1203  H HA   . TYR A 1 81  ? -11.763 -1.798  14.309  1.00 0.00 ? 81  TYR A HA   1  
ATOM 1204  H HB2  . TYR A 1 81  ? -13.891 -2.466  15.555  1.00 0.00 ? 81  TYR A HB2  1  
ATOM 1205  H HB3  . TYR A 1 81  ? -13.453 -4.133  15.197  1.00 0.00 ? 81  TYR A HB3  1  
ATOM 1206  H HD1  . TYR A 1 81  ? -11.849 -1.054  16.595  1.00 0.00 ? 81  TYR A HD1  1  
ATOM 1207  H HD2  . TYR A 1 81  ? -12.304 -5.278  16.832  1.00 0.00 ? 81  TYR A HD2  1  
ATOM 1208  H HE1  . TYR A 1 81  ? -10.399 -1.093  18.581  1.00 0.00 ? 81  TYR A HE1  1  
ATOM 1209  H HE2  . TYR A 1 81  ? -10.856 -5.329  18.819  1.00 0.00 ? 81  TYR A HE2  1  
ATOM 1210  H HH   . TYR A 1 81  ? -9.448  -2.345  20.142  1.00 0.00 ? 81  TYR A HH   1  
ATOM 1211  N N    . THR A 1 82  ? -11.267 -3.854  12.261  1.00 0.00 ? 82  THR A N    1  
ATOM 1212  C CA   . THR A 1 82  ? -10.408 -4.861  11.652  1.00 0.00 ? 82  THR A CA   1  
ATOM 1213  C C    . THR A 1 82  ? -9.141  -4.233  11.083  1.00 0.00 ? 82  THR A C    1  
ATOM 1214  O O    . THR A 1 82  ? -9.168  -3.112  10.575  1.00 0.00 ? 82  THR A O    1  
ATOM 1215  C CB   . THR A 1 82  ? -11.140 -5.619  10.528  1.00 0.00 ? 82  THR A CB   1  
ATOM 1216  O OG1  . THR A 1 82  ? -12.232 -6.368  11.074  1.00 0.00 ? 82  THR A OG1  1  
ATOM 1217  C CG2  . THR A 1 82  ? -10.190 -6.557  9.799   1.00 0.00 ? 82  THR A CG2  1  
ATOM 1218  H H    . THR A 1 82  ? -11.742 -3.218  11.686  1.00 0.00 ? 82  THR A H    1  
ATOM 1219  H HA   . THR A 1 82  ? -10.133 -5.572  12.417  1.00 0.00 ? 82  THR A HA   1  
ATOM 1220  H HB   . THR A 1 82  ? -11.525 -4.899  9.821   1.00 0.00 ? 82  THR A HB   1  
ATOM 1221  H HG1  . THR A 1 82  ? -12.852 -5.769  11.496  1.00 0.00 ? 82  THR A HG1  1  
ATOM 1222  H HG21 . THR A 1 82  ? -10.731 -7.097  9.036   1.00 0.00 ? 82  THR A HG21 1  
ATOM 1223  H HG22 . THR A 1 82  ? -9.765  -7.257  10.503  1.00 0.00 ? 82  THR A HG22 1  
ATOM 1224  H HG23 . THR A 1 82  ? -9.399  -5.982  9.341   1.00 0.00 ? 82  THR A HG23 1  
ATOM 1225  N N    . GLU A 1 83  ? -8.033  -4.962  11.172  1.00 0.00 ? 83  GLU A N    1  
ATOM 1226  C CA   . GLU A 1 83  ? -6.756  -4.474  10.665  1.00 0.00 ? 83  GLU A CA   1  
ATOM 1227  C C    . GLU A 1 83  ? -6.628  -4.737  9.167   1.00 0.00 ? 83  GLU A C    1  
ATOM 1228  O O    . GLU A 1 83  ? -7.201  -5.692  8.643   1.00 0.00 ? 83  GLU A O    1  
ATOM 1229  C CB   . GLU A 1 83  ? -5.598  -5.139  11.411  1.00 0.00 ? 83  GLU A CB   1  
ATOM 1230  C CG   . GLU A 1 83  ? -4.356  -4.269  11.508  1.00 0.00 ? 83  GLU A CG   1  
ATOM 1231  C CD   . GLU A 1 83  ? -3.499  -4.608  12.712  1.00 0.00 ? 83  GLU A CD   1  
ATOM 1232  O OE1  . GLU A 1 83  ? -3.775  -4.071  13.806  1.00 0.00 ? 83  GLU A OE1  1  
ATOM 1233  O OE2  . GLU A 1 83  ? -2.553  -5.408  12.562  1.00 0.00 ? 83  GLU A OE2  1  
ATOM 1234  H H    . GLU A 1 83  ? -8.075  -5.848  11.588  1.00 0.00 ? 83  GLU A H    1  
ATOM 1235  H HA   . GLU A 1 83  ? -6.717  -3.408  10.836  1.00 0.00 ? 83  GLU A HA   1  
ATOM 1236  H HB2  . GLU A 1 83  ? -5.922  -5.381  12.413  1.00 0.00 ? 83  GLU A HB2  1  
ATOM 1237  H HB3  . GLU A 1 83  ? -5.333  -6.052  10.899  1.00 0.00 ? 83  GLU A HB3  1  
ATOM 1238  H HG2  . GLU A 1 83  ? -3.765  -4.407  10.615  1.00 0.00 ? 83  GLU A HG2  1  
ATOM 1239  H HG3  . GLU A 1 83  ? -4.661  -3.236  11.580  1.00 0.00 ? 83  GLU A HG3  1  
ATOM 1240  N N    . TYR A 1 84  ? -5.873  -3.883  8.485   1.00 0.00 ? 84  TYR A N    1  
ATOM 1241  C CA   . TYR A 1 84  ? -5.672  -4.020  7.047   1.00 0.00 ? 84  TYR A CA   1  
ATOM 1242  C C    . TYR A 1 84  ? -4.315  -3.462  6.631   1.00 0.00 ? 84  TYR A C    1  
ATOM 1243  O O    . TYR A 1 84  ? -3.975  -2.323  6.951   1.00 0.00 ? 84  TYR A O    1  
ATOM 1244  C CB   . TYR A 1 84  ? -6.787  -3.302  6.284   1.00 0.00 ? 84  TYR A CB   1  
ATOM 1245  C CG   . TYR A 1 84  ? -8.139  -3.965  6.421   1.00 0.00 ? 84  TYR A CG   1  
ATOM 1246  C CD1  . TYR A 1 84  ? -8.456  -5.099  5.684   1.00 0.00 ? 84  TYR A CD1  1  
ATOM 1247  C CD2  . TYR A 1 84  ? -9.099  -3.457  7.288   1.00 0.00 ? 84  TYR A CD2  1  
ATOM 1248  C CE1  . TYR A 1 84  ? -9.691  -5.707  5.805   1.00 0.00 ? 84  TYR A CE1  1  
ATOM 1249  C CE2  . TYR A 1 84  ? -10.335 -4.060  7.417   1.00 0.00 ? 84  TYR A CE2  1  
ATOM 1250  C CZ   . TYR A 1 84  ? -10.626 -5.184  6.673   1.00 0.00 ? 84  TYR A CZ   1  
ATOM 1251  O OH   . TYR A 1 84  ? -11.857 -5.788  6.798   1.00 0.00 ? 84  TYR A OH   1  
ATOM 1252  H H    . TYR A 1 84  ? -5.442  -3.141  8.959   1.00 0.00 ? 84  TYR A H    1  
ATOM 1253  H HA   . TYR A 1 84  ? -5.706  -5.072  6.807   1.00 0.00 ? 84  TYR A HA   1  
ATOM 1254  H HB2  . TYR A 1 84  ? -6.874  -2.292  6.655   1.00 0.00 ? 84  TYR A HB2  1  
ATOM 1255  H HB3  . TYR A 1 84  ? -6.535  -3.274  5.234   1.00 0.00 ? 84  TYR A HB3  1  
ATOM 1256  H HD1  . TYR A 1 84  ? -7.721  -5.506  5.005   1.00 0.00 ? 84  TYR A HD1  1  
ATOM 1257  H HD2  . TYR A 1 84  ? -8.868  -2.576  7.870   1.00 0.00 ? 84  TYR A HD2  1  
ATOM 1258  H HE1  . TYR A 1 84  ? -9.919  -6.588  5.223   1.00 0.00 ? 84  TYR A HE1  1  
ATOM 1259  H HE2  . TYR A 1 84  ? -11.068 -3.651  8.096   1.00 0.00 ? 84  TYR A HE2  1  
ATOM 1260  H HH   . TYR A 1 84  ? -11.809 -6.684  6.457   1.00 0.00 ? 84  TYR A HH   1  
ATOM 1261  N N    . SER A 1 85  ? -3.543  -4.274  5.916   1.00 0.00 ? 85  SER A N    1  
ATOM 1262  C CA   . SER A 1 85  ? -2.221  -3.864  5.457   1.00 0.00 ? 85  SER A CA   1  
ATOM 1263  C C    . SER A 1 85  ? -2.320  -3.045  4.174   1.00 0.00 ? 85  SER A C    1  
ATOM 1264  O O    . SER A 1 85  ? -3.244  -3.222  3.381   1.00 0.00 ? 85  SER A O    1  
ATOM 1265  C CB   . SER A 1 85  ? -1.336  -5.090  5.226   1.00 0.00 ? 85  SER A CB   1  
ATOM 1266  O OG   . SER A 1 85  ? 0.038   -4.751  5.309   1.00 0.00 ? 85  SER A OG   1  
ATOM 1267  H H    . SER A 1 85  ? -3.870  -5.171  5.693   1.00 0.00 ? 85  SER A H    1  
ATOM 1268  H HA   . SER A 1 85  ? -1.778  -3.252  6.229   1.00 0.00 ? 85  SER A HA   1  
ATOM 1269  H HB2  . SER A 1 85  ? -1.555  -5.837  5.974   1.00 0.00 ? 85  SER A HB2  1  
ATOM 1270  H HB3  . SER A 1 85  ? -1.536  -5.495  4.244   1.00 0.00 ? 85  SER A HB3  1  
ATOM 1271  H HG   . SER A 1 85  ? 0.521   -5.196  4.609   1.00 0.00 ? 85  SER A HG   1  
ATOM 1272  N N    . PHE A 1 86  ? -1.361  -2.146  3.978   1.00 0.00 ? 86  PHE A N    1  
ATOM 1273  C CA   . PHE A 1 86  ? -1.339  -1.297  2.792   1.00 0.00 ? 86  PHE A CA   1  
ATOM 1274  C C    . PHE A 1 86  ? 0.094   -1.027  2.343   1.00 0.00 ? 86  PHE A C    1  
ATOM 1275  O O    . PHE A 1 86  ? 0.981   -0.801  3.166   1.00 0.00 ? 86  PHE A O    1  
ATOM 1276  C CB   . PHE A 1 86  ? -2.056  0.025   3.073   1.00 0.00 ? 86  PHE A CB   1  
ATOM 1277  C CG   . PHE A 1 86  ? -3.506  -0.142  3.428   1.00 0.00 ? 86  PHE A CG   1  
ATOM 1278  C CD1  . PHE A 1 86  ? -4.446  -0.413  2.447   1.00 0.00 ? 86  PHE A CD1  1  
ATOM 1279  C CD2  . PHE A 1 86  ? -3.928  -0.030  4.743   1.00 0.00 ? 86  PHE A CD2  1  
ATOM 1280  C CE1  . PHE A 1 86  ? -5.781  -0.567  2.772   1.00 0.00 ? 86  PHE A CE1  1  
ATOM 1281  C CE2  . PHE A 1 86  ? -5.261  -0.183  5.074   1.00 0.00 ? 86  PHE A CE2  1  
ATOM 1282  C CZ   . PHE A 1 86  ? -6.189  -0.453  4.087   1.00 0.00 ? 86  PHE A CZ   1  
ATOM 1283  H H    . PHE A 1 86  ? -0.651  -2.051  4.647   1.00 0.00 ? 86  PHE A H    1  
ATOM 1284  H HA   . PHE A 1 86  ? -1.859  -1.819  2.004   1.00 0.00 ? 86  PHE A HA   1  
ATOM 1285  H HB2  . PHE A 1 86  ? -1.568  0.523   3.897   1.00 0.00 ? 86  PHE A HB2  1  
ATOM 1286  H HB3  . PHE A 1 86  ? -1.998  0.650   2.195   1.00 0.00 ? 86  PHE A HB3  1  
ATOM 1287  H HD1  . PHE A 1 86  ? -4.129  -0.503  1.419   1.00 0.00 ? 86  PHE A HD1  1  
ATOM 1288  H HD2  . PHE A 1 86  ? -3.202  0.181   5.517   1.00 0.00 ? 86  PHE A HD2  1  
ATOM 1289  H HE1  . PHE A 1 86  ? -6.504  -0.778  1.998   1.00 0.00 ? 86  PHE A HE1  1  
ATOM 1290  H HE2  . PHE A 1 86  ? -5.576  -0.094  6.103   1.00 0.00 ? 86  PHE A HE2  1  
ATOM 1291  H HZ   . PHE A 1 86  ? -7.231  -0.572  4.342   1.00 0.00 ? 86  PHE A HZ   1  
ATOM 1292  N N    . ARG A 1 87  ? 0.311   -1.052  1.032   1.00 0.00 ? 87  ARG A N    1  
ATOM 1293  C CA   . ARG A 1 87  ? 1.635   -0.812  0.473   1.00 0.00 ? 87  ARG A CA   1  
ATOM 1294  C C    . ARG A 1 87  ? 1.534   -0.190  -0.917  1.00 0.00 ? 87  ARG A C    1  
ATOM 1295  O O    . ARG A 1 87  ? 0.701   -0.593  -1.730  1.00 0.00 ? 87  ARG A O    1  
ATOM 1296  C CB   . ARG A 1 87  ? 2.427   -2.119  0.402   1.00 0.00 ? 87  ARG A CB   1  
ATOM 1297  C CG   . ARG A 1 87  ? 1.810   -3.155  -0.523  1.00 0.00 ? 87  ARG A CG   1  
ATOM 1298  C CD   . ARG A 1 87  ? 2.774   -4.298  -0.801  1.00 0.00 ? 87  ARG A CD   1  
ATOM 1299  N NE   . ARG A 1 87  ? 2.681   -5.351  0.207   1.00 0.00 ? 87  ARG A NE   1  
ATOM 1300  C CZ   . ARG A 1 87  ? 3.606   -6.288  0.380   1.00 0.00 ? 87  ARG A CZ   1  
ATOM 1301  N NH1  . ARG A 1 87  ? 4.690   -6.302  -0.384  1.00 0.00 ? 87  ARG A NH1  1  
ATOM 1302  N NH2  . ARG A 1 87  ? 3.450   -7.212  1.319   1.00 0.00 ? 87  ARG A NH2  1  
ATOM 1303  H H    . ARG A 1 87  ? -0.437  -1.238  0.427   1.00 0.00 ? 87  ARG A H    1  
ATOM 1304  H HA   . ARG A 1 87  ? 2.151   -0.123  1.125   1.00 0.00 ? 87  ARG A HA   1  
ATOM 1305  H HB2  . ARG A 1 87  ? 3.425   -1.903  0.049   1.00 0.00 ? 87  ARG A HB2  1  
ATOM 1306  H HB3  . ARG A 1 87  ? 2.489   -2.542  1.393   1.00 0.00 ? 87  ARG A HB3  1  
ATOM 1307  H HG2  . ARG A 1 87  ? 0.921   -3.555  -0.058  1.00 0.00 ? 87  ARG A HG2  1  
ATOM 1308  H HG3  . ARG A 1 87  ? 1.549   -2.681  -1.457  1.00 0.00 ? 87  ARG A HG3  1  
ATOM 1309  H HD2  . ARG A 1 87  ? 2.544   -4.718  -1.768  1.00 0.00 ? 87  ARG A HD2  1  
ATOM 1310  H HD3  . ARG A 1 87  ? 3.781   -3.908  -0.808  1.00 0.00 ? 87  ARG A HD3  1  
ATOM 1311  H HE   . ARG A 1 87  ? 1.888   -5.358  0.783   1.00 0.00 ? 87  ARG A HE   1  
ATOM 1312  H HH11 . ARG A 1 87  ? 4.811   -5.607  -1.092  1.00 0.00 ? 87  ARG A HH11 1  
ATOM 1313  H HH12 . ARG A 1 87  ? 5.386   -7.008  -0.252  1.00 0.00 ? 87  ARG A HH12 1  
ATOM 1314  H HH21 . ARG A 1 87  ? 2.634   -7.204  1.897   1.00 0.00 ? 87  ARG A HH21 1  
ATOM 1315  H HH22 . ARG A 1 87  ? 4.147   -7.917  1.448   1.00 0.00 ? 87  ARG A HH22 1  
ATOM 1316  N N    . VAL A 1 88  ? 2.387   0.795   -1.183  1.00 0.00 ? 88  VAL A N    1  
ATOM 1317  C CA   . VAL A 1 88  ? 2.393   1.472   -2.474  1.00 0.00 ? 88  VAL A CA   1  
ATOM 1318  C C    . VAL A 1 88  ? 3.545   0.982   -3.346  1.00 0.00 ? 88  VAL A C    1  
ATOM 1319  O O    . VAL A 1 88  ? 4.639   0.710   -2.852  1.00 0.00 ? 88  VAL A O    1  
ATOM 1320  C CB   . VAL A 1 88  ? 2.505   2.999   -2.307  1.00 0.00 ? 88  VAL A CB   1  
ATOM 1321  C CG1  . VAL A 1 88  ? 2.595   3.680   -3.663  1.00 0.00 ? 88  VAL A CG1  1  
ATOM 1322  C CG2  . VAL A 1 88  ? 1.326   3.534   -1.509  1.00 0.00 ? 88  VAL A CG2  1  
ATOM 1323  H H    . VAL A 1 88  ? 3.027   1.071   -0.495  1.00 0.00 ? 88  VAL A H    1  
ATOM 1324  H HA   . VAL A 1 88  ? 1.460   1.253   -2.971  1.00 0.00 ? 88  VAL A HA   1  
ATOM 1325  H HB   . VAL A 1 88  ? 3.411   3.215   -1.759  1.00 0.00 ? 88  VAL A HB   1  
ATOM 1326  H HG11 . VAL A 1 88  ? 3.578   4.110   -3.786  1.00 0.00 ? 88  VAL A HG11 1  
ATOM 1327  H HG12 . VAL A 1 88  ? 2.418   2.954   -4.444  1.00 0.00 ? 88  VAL A HG12 1  
ATOM 1328  H HG13 . VAL A 1 88  ? 1.852   4.462   -3.723  1.00 0.00 ? 88  VAL A HG13 1  
ATOM 1329  H HG21 . VAL A 1 88  ? 1.602   3.612   -0.468  1.00 0.00 ? 88  VAL A HG21 1  
ATOM 1330  H HG22 . VAL A 1 88  ? 1.051   4.511   -1.882  1.00 0.00 ? 88  VAL A HG22 1  
ATOM 1331  H HG23 . VAL A 1 88  ? 0.487   2.862   -1.611  1.00 0.00 ? 88  VAL A HG23 1  
ATOM 1332  N N    . VAL A 1 89  ? 3.290   0.872   -4.646  1.00 0.00 ? 89  VAL A N    1  
ATOM 1333  C CA   . VAL A 1 89  ? 4.306   0.417   -5.588  1.00 0.00 ? 89  VAL A CA   1  
ATOM 1334  C C    . VAL A 1 89  ? 4.275   1.241   -6.870  1.00 0.00 ? 89  VAL A C    1  
ATOM 1335  O O    . VAL A 1 89  ? 3.209   1.518   -7.417  1.00 0.00 ? 89  VAL A O    1  
ATOM 1336  C CB   . VAL A 1 89  ? 4.116   -1.070  -5.942  1.00 0.00 ? 89  VAL A CB   1  
ATOM 1337  C CG1  . VAL A 1 89  ? 5.164   -1.518  -6.949  1.00 0.00 ? 89  VAL A CG1  1  
ATOM 1338  C CG2  . VAL A 1 89  ? 4.170   -1.928  -4.687  1.00 0.00 ? 89  VAL A CG2  1  
ATOM 1339  H H    . VAL A 1 89  ? 2.398   1.104   -4.980  1.00 0.00 ? 89  VAL A H    1  
ATOM 1340  H HA   . VAL A 1 89  ? 5.272   0.533   -5.119  1.00 0.00 ? 89  VAL A HA   1  
ATOM 1341  H HB   . VAL A 1 89  ? 3.141   -1.191  -6.393  1.00 0.00 ? 89  VAL A HB   1  
ATOM 1342  H HG11 . VAL A 1 89  ? 4.700   -1.654  -7.915  1.00 0.00 ? 89  VAL A HG11 1  
ATOM 1343  H HG12 . VAL A 1 89  ? 5.937   -0.767  -7.022  1.00 0.00 ? 89  VAL A HG12 1  
ATOM 1344  H HG13 . VAL A 1 89  ? 5.599   -2.452  -6.624  1.00 0.00 ? 89  VAL A HG13 1  
ATOM 1345  H HG21 . VAL A 1 89  ? 3.612   -2.838  -4.849  1.00 0.00 ? 89  VAL A HG21 1  
ATOM 1346  H HG22 . VAL A 1 89  ? 5.198   -2.172  -4.461  1.00 0.00 ? 89  VAL A HG22 1  
ATOM 1347  H HG23 . VAL A 1 89  ? 3.740   -1.384  -3.859  1.00 0.00 ? 89  VAL A HG23 1  
ATOM 1348  N N    . ALA A 1 90  ? 5.454   1.630   -7.344  1.00 0.00 ? 90  ALA A N    1  
ATOM 1349  C CA   . ALA A 1 90  ? 5.564   2.421   -8.564  1.00 0.00 ? 90  ALA A CA   1  
ATOM 1350  C C    . ALA A 1 90  ? 5.711   1.524   -9.788  1.00 0.00 ? 90  ALA A C    1  
ATOM 1351  O O    . ALA A 1 90  ? 6.619   0.696   -9.858  1.00 0.00 ? 90  ALA A O    1  
ATOM 1352  C CB   . ALA A 1 90  ? 6.740   3.381   -8.466  1.00 0.00 ? 90  ALA A CB   1  
ATOM 1353  H H    . ALA A 1 90  ? 6.270   1.378   -6.863  1.00 0.00 ? 90  ALA A H    1  
ATOM 1354  H HA   . ALA A 1 90  ? 4.660   3.005   -8.665  1.00 0.00 ? 90  ALA A HA   1  
ATOM 1355  H HB1  . ALA A 1 90  ? 7.205   3.479   -9.437  1.00 0.00 ? 90  ALA A HB1  1  
ATOM 1356  H HB2  . ALA A 1 90  ? 6.388   4.348   -8.136  1.00 0.00 ? 90  ALA A HB2  1  
ATOM 1357  H HB3  . ALA A 1 90  ? 7.459   2.998   -7.759  1.00 0.00 ? 90  ALA A HB3  1  
ATOM 1358  N N    . TYR A 1 91  ? 4.812   1.694   -10.751 1.00 0.00 ? 91  TYR A N    1  
ATOM 1359  C CA   . TYR A 1 91  ? 4.840   0.897   -11.972 1.00 0.00 ? 91  TYR A CA   1  
ATOM 1360  C C    . TYR A 1 91  ? 5.150   1.769   -13.185 1.00 0.00 ? 91  TYR A C    1  
ATOM 1361  O O    . TYR A 1 91  ? 4.352   2.621   -13.571 1.00 0.00 ? 91  TYR A O    1  
ATOM 1362  C CB   . TYR A 1 91  ? 3.501   0.185   -12.172 1.00 0.00 ? 91  TYR A CB   1  
ATOM 1363  C CG   . TYR A 1 91  ? 3.388   -1.117  -11.411 1.00 0.00 ? 91  TYR A CG   1  
ATOM 1364  C CD1  . TYR A 1 91  ? 2.892   -1.146  -10.114 1.00 0.00 ? 91  TYR A CD1  1  
ATOM 1365  C CD2  . TYR A 1 91  ? 3.778   -2.319  -11.990 1.00 0.00 ? 91  TYR A CD2  1  
ATOM 1366  C CE1  . TYR A 1 91  ? 2.788   -2.333  -9.415  1.00 0.00 ? 91  TYR A CE1  1  
ATOM 1367  C CE2  . TYR A 1 91  ? 3.676   -3.511  -11.299 1.00 0.00 ? 91  TYR A CE2  1  
ATOM 1368  C CZ   . TYR A 1 91  ? 3.181   -3.512  -10.012 1.00 0.00 ? 91  TYR A CZ   1  
ATOM 1369  O OH   . TYR A 1 91  ? 3.078   -4.697  -9.320  1.00 0.00 ? 91  TYR A OH   1  
ATOM 1370  H H    . TYR A 1 91  ? 4.111   2.370   -10.638 1.00 0.00 ? 91  TYR A H    1  
ATOM 1371  H HA   . TYR A 1 91  ? 5.618   0.156   -11.867 1.00 0.00 ? 91  TYR A HA   1  
ATOM 1372  H HB2  . TYR A 1 91  ? 2.704   0.832   -11.841 1.00 0.00 ? 91  TYR A HB2  1  
ATOM 1373  H HB3  . TYR A 1 91  ? 3.370   -0.032  -13.222 1.00 0.00 ? 91  TYR A HB3  1  
ATOM 1374  H HD1  . TYR A 1 91  ? 2.584   -0.220  -9.650  1.00 0.00 ? 91  TYR A HD1  1  
ATOM 1375  H HD2  . TYR A 1 91  ? 4.165   -2.314  -12.999 1.00 0.00 ? 91  TYR A HD2  1  
ATOM 1376  H HE1  . TYR A 1 91  ? 2.400   -2.334  -8.407  1.00 0.00 ? 91  TYR A HE1  1  
ATOM 1377  H HE2  . TYR A 1 91  ? 3.984   -4.435  -11.766 1.00 0.00 ? 91  TYR A HE2  1  
ATOM 1378  H HH   . TYR A 1 91  ? 3.717   -5.325  -9.663  1.00 0.00 ? 91  TYR A HH   1  
ATOM 1379  N N    . ASN A 1 92  ? 6.318   1.548   -13.781 1.00 0.00 ? 92  ASN A N    1  
ATOM 1380  C CA   . ASN A 1 92  ? 6.736   2.313   -14.950 1.00 0.00 ? 92  ASN A CA   1  
ATOM 1381  C C    . ASN A 1 92  ? 7.092   1.386   -16.108 1.00 0.00 ? 92  ASN A C    1  
ATOM 1382  O O    . ASN A 1 92  ? 7.157   0.167   -15.945 1.00 0.00 ? 92  ASN A O    1  
ATOM 1383  C CB   . ASN A 1 92  ? 7.935   3.199   -14.604 1.00 0.00 ? 92  ASN A CB   1  
ATOM 1384  C CG   . ASN A 1 92  ? 9.150   2.391   -14.192 1.00 0.00 ? 92  ASN A CG   1  
ATOM 1385  O OD1  . ASN A 1 92  ? 9.051   1.194   -13.921 1.00 0.00 ? 92  ASN A OD1  1  
ATOM 1386  N ND2  . ASN A 1 92  ? 10.305  3.044   -14.143 1.00 0.00 ? 92  ASN A ND2  1  
ATOM 1387  H H    . ASN A 1 92  ? 6.912   0.855   -13.426 1.00 0.00 ? 92  ASN A H    1  
ATOM 1388  H HA   . ASN A 1 92  ? 5.910   2.941   -15.248 1.00 0.00 ? 92  ASN A HA   1  
ATOM 1389  H HB2  . ASN A 1 92  ? 8.197   3.792   -15.468 1.00 0.00 ? 92  ASN A HB2  1  
ATOM 1390  H HB3  . ASN A 1 92  ? 7.667   3.855   -13.789 1.00 0.00 ? 92  ASN A HB3  1  
ATOM 1391  H HD21 . ASN A 1 92  ? 10.309  3.997   -14.372 1.00 0.00 ? 92  ASN A HD21 1  
ATOM 1392  H HD22 . ASN A 1 92  ? 11.107  2.546   -13.880 1.00 0.00 ? 92  ASN A HD22 1  
ATOM 1393  N N    . LYS A 1 93  ? 7.321   1.971   -17.279 1.00 0.00 ? 93  LYS A N    1  
ATOM 1394  C CA   . LYS A 1 93  ? 7.673   1.200   -18.465 1.00 0.00 ? 93  LYS A CA   1  
ATOM 1395  C C    . LYS A 1 93  ? 8.707   0.130   -18.131 1.00 0.00 ? 93  LYS A C    1  
ATOM 1396  O O    . LYS A 1 93  ? 8.604   -1.011  -18.584 1.00 0.00 ? 93  LYS A O    1  
ATOM 1397  C CB   . LYS A 1 93  ? 8.214   2.124   -19.558 1.00 0.00 ? 93  LYS A CB   1  
ATOM 1398  C CG   . LYS A 1 93  ? 9.433   2.923   -19.130 1.00 0.00 ? 93  LYS A CG   1  
ATOM 1399  C CD   . LYS A 1 93  ? 10.080  3.627   -20.311 1.00 0.00 ? 93  LYS A CD   1  
ATOM 1400  C CE   . LYS A 1 93  ? 10.791  4.901   -19.879 1.00 0.00 ? 93  LYS A CE   1  
ATOM 1401  N NZ   . LYS A 1 93  ? 9.861   6.063   -19.825 1.00 0.00 ? 93  LYS A NZ   1  
ATOM 1402  H H    . LYS A 1 93  ? 7.254   2.947   -17.346 1.00 0.00 ? 93  LYS A H    1  
ATOM 1403  H HA   . LYS A 1 93  ? 6.777   0.717   -18.824 1.00 0.00 ? 93  LYS A HA   1  
ATOM 1404  H HB2  . LYS A 1 93  ? 8.484   1.527   -20.416 1.00 0.00 ? 93  LYS A HB2  1  
ATOM 1405  H HB3  . LYS A 1 93  ? 7.437   2.818   -19.843 1.00 0.00 ? 93  LYS A HB3  1  
ATOM 1406  H HG2  . LYS A 1 93  ? 9.131   3.663   -18.405 1.00 0.00 ? 93  LYS A HG2  1  
ATOM 1407  H HG3  . LYS A 1 93  ? 10.153  2.251   -18.684 1.00 0.00 ? 93  LYS A HG3  1  
ATOM 1408  H HD2  . LYS A 1 93  ? 10.801  2.963   -20.765 1.00 0.00 ? 93  LYS A HD2  1  
ATOM 1409  H HD3  . LYS A 1 93  ? 9.316   3.878   -21.032 1.00 0.00 ? 93  LYS A HD3  1  
ATOM 1410  H HE2  . LYS A 1 93  ? 11.216  4.746   -18.900 1.00 0.00 ? 93  LYS A HE2  1  
ATOM 1411  H HE3  . LYS A 1 93  ? 11.580  5.114   -20.585 1.00 0.00 ? 93  LYS A HE3  1  
ATOM 1412  H HZ1  . LYS A 1 93  ? 10.244  6.852   -20.384 1.00 0.00 ? 93  LYS A HZ1  1  
ATOM 1413  H HZ2  . LYS A 1 93  ? 9.739   6.377   -18.842 1.00 0.00 ? 93  LYS A HZ2  1  
ATOM 1414  H HZ3  . LYS A 1 93  ? 8.933   5.797   -20.211 1.00 0.00 ? 93  LYS A HZ3  1  
ATOM 1415  N N    . HIS A 1 94  ? 9.704   0.504   -17.335 1.00 0.00 ? 94  HIS A N    1  
ATOM 1416  C CA   . HIS A 1 94  ? 10.756  -0.425  -16.939 1.00 0.00 ? 94  HIS A CA   1  
ATOM 1417  C C    . HIS A 1 94  ? 10.175  -1.611  -16.175 1.00 0.00 ? 94  HIS A C    1  
ATOM 1418  O O    . HIS A 1 94  ? 10.167  -2.737  -16.670 1.00 0.00 ? 94  HIS A O    1  
ATOM 1419  C CB   . HIS A 1 94  ? 11.799  0.289   -16.078 1.00 0.00 ? 94  HIS A CB   1  
ATOM 1420  C CG   . HIS A 1 94  ? 12.537  1.371   -16.805 1.00 0.00 ? 94  HIS A CG   1  
ATOM 1421  N ND1  . HIS A 1 94  ? 13.408  1.119   -17.845 1.00 0.00 ? 94  HIS A ND1  1  
ATOM 1422  C CD2  . HIS A 1 94  ? 12.529  2.714   -16.639 1.00 0.00 ? 94  HIS A CD2  1  
ATOM 1423  C CE1  . HIS A 1 94  ? 13.905  2.261   -18.285 1.00 0.00 ? 94  HIS A CE1  1  
ATOM 1424  N NE2  . HIS A 1 94  ? 13.387  3.244   -17.571 1.00 0.00 ? 94  HIS A NE2  1  
ATOM 1425  H H    . HIS A 1 94  ? 9.732   1.427   -17.006 1.00 0.00 ? 94  HIS A H    1  
ATOM 1426  H HA   . HIS A 1 94  ? 11.232  -0.789  -17.836 1.00 0.00 ? 94  HIS A HA   1  
ATOM 1427  H HB2  . HIS A 1 94  ? 11.307  0.739   -15.227 1.00 0.00 ? 94  HIS A HB2  1  
ATOM 1428  H HB3  . HIS A 1 94  ? 12.524  -0.432  -15.729 1.00 0.00 ? 94  HIS A HB3  1  
ATOM 1429  H HD1  . HIS A 1 94  ? 13.630  0.236   -18.204 1.00 0.00 ? 94  HIS A HD1  1  
ATOM 1430  H HD2  . HIS A 1 94  ? 11.955  3.267   -15.909 1.00 0.00 ? 94  HIS A HD2  1  
ATOM 1431  H HE1  . HIS A 1 94  ? 14.613  2.373   -19.092 1.00 0.00 ? 94  HIS A HE1  1  
ATOM 1432  H HE2  . HIS A 1 94  ? 13.651  4.186   -17.633 1.00 0.00 ? 94  HIS A HE2  1  
ATOM 1433  N N    . GLY A 1 95  ? 9.689   -1.349  -14.965 1.00 0.00 ? 95  GLY A N    1  
ATOM 1434  C CA   . GLY A 1 95  ? 9.113   -2.405  -14.153 1.00 0.00 ? 95  GLY A CA   1  
ATOM 1435  C C    . GLY A 1 95  ? 8.852   -1.961  -12.727 1.00 0.00 ? 95  GLY A C    1  
ATOM 1436  O O    . GLY A 1 95  ? 9.234   -0.866  -12.314 1.00 0.00 ? 95  GLY A O    1  
ATOM 1437  H H    . GLY A 1 95  ? 9.722   -0.431  -14.622 1.00 0.00 ? 95  GLY A H    1  
ATOM 1438  H HA2  . GLY A 1 95  ? 8.181   -2.719  -14.598 1.00 0.00 ? 95  GLY A HA2  1  
ATOM 1439  H HA3  . GLY A 1 95  ? 9.794   -3.243  -14.137 1.00 0.00 ? 95  GLY A HA3  1  
ATOM 1440  N N    . PRO A 1 96  ? 8.184   -2.825  -11.948 1.00 0.00 ? 96  PRO A N    1  
ATOM 1441  C CA   . PRO A 1 96  ? 7.856   -2.538  -10.548 1.00 0.00 ? 96  PRO A CA   1  
ATOM 1442  C C    . PRO A 1 96  ? 9.090   -2.533  -9.652  1.00 0.00 ? 96  PRO A C    1  
ATOM 1443  O O    . PRO A 1 96  ? 9.639   -3.586  -9.329  1.00 0.00 ? 96  PRO A O    1  
ATOM 1444  C CB   . PRO A 1 96  ? 6.919   -3.685  -10.161 1.00 0.00 ? 96  PRO A CB   1  
ATOM 1445  C CG   . PRO A 1 96  ? 7.282   -4.798  -11.082 1.00 0.00 ? 96  PRO A CG   1  
ATOM 1446  C CD   . PRO A 1 96  ? 7.698   -4.149  -12.373 1.00 0.00 ? 96  PRO A CD   1  
ATOM 1447  H HA   . PRO A 1 96  ? 7.336   -1.597  -10.447 1.00 0.00 ? 96  PRO A HA   1  
ATOM 1448  H HB2  . PRO A 1 96  ? 7.085   -3.956  -9.128  1.00 0.00 ? 96  PRO A HB2  1  
ATOM 1449  H HB3  . PRO A 1 96  ? 5.893   -3.378  -10.298 1.00 0.00 ? 96  PRO A HB3  1  
ATOM 1450  H HG2  . PRO A 1 96  ? 8.101   -5.366  -10.667 1.00 0.00 ? 96  PRO A HG2  1  
ATOM 1451  H HG3  . PRO A 1 96  ? 6.425   -5.435  -11.243 1.00 0.00 ? 96  PRO A HG3  1  
ATOM 1452  H HD2  . PRO A 1 96  ? 8.487   -4.716  -12.844 1.00 0.00 ? 96  PRO A HD2  1  
ATOM 1453  H HD3  . PRO A 1 96  ? 6.852   -4.053  -13.037 1.00 0.00 ? 96  PRO A HD3  1  
ATOM 1454  N N    . GLY A 1 97  ? 9.522   -1.340  -9.254  1.00 0.00 ? 97  GLY A N    1  
ATOM 1455  C CA   . GLY A 1 97  ? 10.688  -1.221  -8.399  1.00 0.00 ? 97  GLY A CA   1  
ATOM 1456  C C    . GLY A 1 97  ? 10.396  -1.608  -6.962  1.00 0.00 ? 97  GLY A C    1  
ATOM 1457  O O    . GLY A 1 97  ? 9.355   -2.195  -6.669  1.00 0.00 ? 97  GLY A O    1  
ATOM 1458  H H    . GLY A 1 97  ? 9.044   -0.535  -9.543  1.00 0.00 ? 97  GLY A H    1  
ATOM 1459  H HA2  . GLY A 1 97  ? 11.469  -1.862  -8.781  1.00 0.00 ? 97  GLY A HA2  1  
ATOM 1460  H HA3  . GLY A 1 97  ? 11.034  -0.198  -8.421  1.00 0.00 ? 97  GLY A HA3  1  
ATOM 1461  N N    . VAL A 1 98  ? 11.319  -1.279  -6.063  1.00 0.00 ? 98  VAL A N    1  
ATOM 1462  C CA   . VAL A 1 98  ? 11.155  -1.596  -4.650  1.00 0.00 ? 98  VAL A CA   1  
ATOM 1463  C C    . VAL A 1 98  ? 9.722   -1.350  -4.193  1.00 0.00 ? 98  VAL A C    1  
ATOM 1464  O O    . VAL A 1 98  ? 8.970   -0.621  -4.840  1.00 0.00 ? 98  VAL A O    1  
ATOM 1465  C CB   . VAL A 1 98  ? 12.111  -0.764  -3.774  1.00 0.00 ? 98  VAL A CB   1  
ATOM 1466  C CG1  . VAL A 1 98  ? 13.552  -0.962  -4.220  1.00 0.00 ? 98  VAL A CG1  1  
ATOM 1467  C CG2  . VAL A 1 98  ? 11.728  0.707   -3.817  1.00 0.00 ? 98  VAL A CG2  1  
ATOM 1468  H H    . VAL A 1 98  ? 12.128  -0.812  -6.358  1.00 0.00 ? 98  VAL A H    1  
ATOM 1469  H HA   . VAL A 1 98  ? 11.392  -2.641  -4.512  1.00 0.00 ? 98  VAL A HA   1  
ATOM 1470  H HB   . VAL A 1 98  ? 12.023  -1.108  -2.754  1.00 0.00 ? 98  VAL A HB   1  
ATOM 1471  H HG11 . VAL A 1 98  ? 13.623  -1.856  -4.821  1.00 0.00 ? 98  VAL A HG11 1  
ATOM 1472  H HG12 . VAL A 1 98  ? 13.870  -0.109  -4.802  1.00 0.00 ? 98  VAL A HG12 1  
ATOM 1473  H HG13 . VAL A 1 98  ? 14.187  -1.062  -3.351  1.00 0.00 ? 98  VAL A HG13 1  
ATOM 1474  H HG21 . VAL A 1 98  ? 12.526  1.273   -4.276  1.00 0.00 ? 98  VAL A HG21 1  
ATOM 1475  H HG22 . VAL A 1 98  ? 10.823  0.827   -4.395  1.00 0.00 ? 98  VAL A HG22 1  
ATOM 1476  H HG23 . VAL A 1 98  ? 11.564  1.067   -2.812  1.00 0.00 ? 98  VAL A HG23 1  
ATOM 1477  N N    . SER A 1 99  ? 9.349   -1.962  -3.074  1.00 0.00 ? 99  SER A N    1  
ATOM 1478  C CA   . SER A 1 99  ? 8.004   -1.812  -2.532  1.00 0.00 ? 99  SER A CA   1  
ATOM 1479  C C    . SER A 1 99  ? 8.049   -1.251  -1.114  1.00 0.00 ? 99  SER A C    1  
ATOM 1480  O O    . SER A 1 99  ? 8.834   -1.702  -0.279  1.00 0.00 ? 99  SER A O    1  
ATOM 1481  C CB   . SER A 1 99  ? 7.276   -3.158  -2.537  1.00 0.00 ? 99  SER A CB   1  
ATOM 1482  O OG   . SER A 1 99  ? 6.103   -3.106  -1.744  1.00 0.00 ? 99  SER A OG   1  
ATOM 1483  H H    . SER A 1 99  ? 9.994   -2.531  -2.603  1.00 0.00 ? 99  SER A H    1  
ATOM 1484  H HA   . SER A 1 99  ? 7.467   -1.120  -3.164  1.00 0.00 ? 99  SER A HA   1  
ATOM 1485  H HB2  . SER A 1 99  ? 7.002   -3.412  -3.549  1.00 0.00 ? 99  SER A HB2  1  
ATOM 1486  H HB3  . SER A 1 99  ? 7.932   -3.920  -2.139  1.00 0.00 ? 99  SER A HB3  1  
ATOM 1487  H HG   . SER A 1 99  ? 5.775   -2.204  -1.716  1.00 0.00 ? 99  SER A HG   1  
ATOM 1488  N N    . THR A 1 100 ? 7.201   -0.262  -0.848  1.00 0.00 ? 100 THR A N    1  
ATOM 1489  C CA   . THR A 1 100 ? 7.143   0.363   0.467   1.00 0.00 ? 100 THR A CA   1  
ATOM 1490  C C    . THR A 1 100 ? 6.793   -0.656  1.545   1.00 0.00 ? 100 THR A C    1  
ATOM 1491  O O    . THR A 1 100 ? 6.258   -1.730  1.268   1.00 0.00 ? 100 THR A O    1  
ATOM 1492  C CB   . THR A 1 100 ? 6.111   1.505   0.501   1.00 0.00 ? 100 THR A CB   1  
ATOM 1493  O OG1  . THR A 1 100 ? 5.044   1.229   -0.414  1.00 0.00 ? 100 THR A OG1  1  
ATOM 1494  C CG2  . THR A 1 100 ? 6.761   2.834   0.145   1.00 0.00 ? 100 THR A CG2  1  
ATOM 1495  H H    . THR A 1 100 ? 6.600   0.054   -1.555  1.00 0.00 ? 100 THR A H    1  
ATOM 1496  H HA   . THR A 1 100 ? 8.117   0.779   0.681   1.00 0.00 ? 100 THR A HA   1  
ATOM 1497  H HB   . THR A 1 100 ? 5.707   1.575   1.501   1.00 0.00 ? 100 THR A HB   1  
ATOM 1498  H HG1  . THR A 1 100 ? 4.667   2.056   -0.725  1.00 0.00 ? 100 THR A HG1  1  
ATOM 1499  H HG21 . THR A 1 100 ? 6.464   3.124   -0.852  1.00 0.00 ? 100 THR A HG21 1  
ATOM 1500  H HG22 . THR A 1 100 ? 7.835   2.731   0.185   1.00 0.00 ? 100 THR A HG22 1  
ATOM 1501  H HG23 . THR A 1 100 ? 6.445   3.589   0.849   1.00 0.00 ? 100 THR A HG23 1  
ATOM 1502  N N    . PRO A 1 101 ? 7.101   -0.314  2.805   1.00 0.00 ? 101 PRO A N    1  
ATOM 1503  C CA   . PRO A 1 101 ? 6.826   -1.186  3.951   1.00 0.00 ? 101 PRO A CA   1  
ATOM 1504  C C    . PRO A 1 101 ? 5.334   -1.307  4.244   1.00 0.00 ? 101 PRO A C    1  
ATOM 1505  O O    . PRO A 1 101 ? 4.601   -0.319  4.195   1.00 0.00 ? 101 PRO A O    1  
ATOM 1506  C CB   . PRO A 1 101 ? 7.543   -0.487  5.109   1.00 0.00 ? 101 PRO A CB   1  
ATOM 1507  C CG   . PRO A 1 101 ? 7.605   0.946   4.706   1.00 0.00 ? 101 PRO A CG   1  
ATOM 1508  C CD   . PRO A 1 101 ? 7.739   0.950   3.209   1.00 0.00 ? 101 PRO A CD   1  
ATOM 1509  H HA   . PRO A 1 101 ? 7.244   -2.172  3.809   1.00 0.00 ? 101 PRO A HA   1  
ATOM 1510  H HB2  . PRO A 1 101 ? 6.975   -0.619  6.019   1.00 0.00 ? 101 PRO A HB2  1  
ATOM 1511  H HB3  . PRO A 1 101 ? 8.531   -0.906  5.231   1.00 0.00 ? 101 PRO A HB3  1  
ATOM 1512  H HG2  . PRO A 1 101 ? 6.697   1.450   5.003   1.00 0.00 ? 101 PRO A HG2  1  
ATOM 1513  H HG3  . PRO A 1 101 ? 8.463   1.418   5.161   1.00 0.00 ? 101 PRO A HG3  1  
ATOM 1514  H HD2  . PRO A 1 101 ? 7.220   1.796   2.785   1.00 0.00 ? 101 PRO A HD2  1  
ATOM 1515  H HD3  . PRO A 1 101 ? 8.781   0.962   2.924   1.00 0.00 ? 101 PRO A HD3  1  
ATOM 1516  N N    . ASP A 1 102 ? 4.892   -2.522  4.548   1.00 0.00 ? 102 ASP A N    1  
ATOM 1517  C CA   . ASP A 1 102 ? 3.487   -2.770  4.850   1.00 0.00 ? 102 ASP A CA   1  
ATOM 1518  C C    . ASP A 1 102 ? 2.967   -1.772  5.879   1.00 0.00 ? 102 ASP A C    1  
ATOM 1519  O O    . ASP A 1 102 ? 3.657   -1.444  6.845   1.00 0.00 ? 102 ASP A O    1  
ATOM 1520  C CB   . ASP A 1 102 ? 3.299   -4.198  5.366   1.00 0.00 ? 102 ASP A CB   1  
ATOM 1521  C CG   . ASP A 1 102 ? 4.353   -4.589  6.383   1.00 0.00 ? 102 ASP A CG   1  
ATOM 1522  O OD1  . ASP A 1 102 ? 5.541   -4.664  6.007   1.00 0.00 ? 102 ASP A OD1  1  
ATOM 1523  O OD2  . ASP A 1 102 ? 3.989   -4.821  7.556   1.00 0.00 ? 102 ASP A OD2  1  
ATOM 1524  H H    . ASP A 1 102 ? 5.525   -3.269  4.571   1.00 0.00 ? 102 ASP A H    1  
ATOM 1525  H HA   . ASP A 1 102 ? 2.925   -2.651  3.936   1.00 0.00 ? 102 ASP A HA   1  
ATOM 1526  H HB2  . ASP A 1 102 ? 2.328   -4.281  5.832   1.00 0.00 ? 102 ASP A HB2  1  
ATOM 1527  H HB3  . ASP A 1 102 ? 3.355   -4.885  4.534   1.00 0.00 ? 102 ASP A HB3  1  
ATOM 1528  N N    . VAL A 1 103 ? 1.747   -1.290  5.665   1.00 0.00 ? 103 VAL A N    1  
ATOM 1529  C CA   . VAL A 1 103 ? 1.134   -0.328  6.574   1.00 0.00 ? 103 VAL A CA   1  
ATOM 1530  C C    . VAL A 1 103 ? -0.185  -0.857  7.126   1.00 0.00 ? 103 VAL A C    1  
ATOM 1531  O O    . VAL A 1 103 ? -1.250  -0.603  6.565   1.00 0.00 ? 103 VAL A O    1  
ATOM 1532  C CB   . VAL A 1 103 ? 0.882   1.022   5.877   1.00 0.00 ? 103 VAL A CB   1  
ATOM 1533  C CG1  . VAL A 1 103 ? 0.162   1.980   6.812   1.00 0.00 ? 103 VAL A CG1  1  
ATOM 1534  C CG2  . VAL A 1 103 ? 2.193   1.623   5.391   1.00 0.00 ? 103 VAL A CG2  1  
ATOM 1535  H H    . VAL A 1 103 ? 1.246   -1.589  4.878   1.00 0.00 ? 103 VAL A H    1  
ATOM 1536  H HA   . VAL A 1 103 ? 1.817   -0.163  7.395   1.00 0.00 ? 103 VAL A HA   1  
ATOM 1537  H HB   . VAL A 1 103 ? 0.250   0.848   5.018   1.00 0.00 ? 103 VAL A HB   1  
ATOM 1538  H HG11 . VAL A 1 103 ? 0.551   2.978   6.675   1.00 0.00 ? 103 VAL A HG11 1  
ATOM 1539  H HG12 . VAL A 1 103 ? -0.896  1.971   6.592   1.00 0.00 ? 103 VAL A HG12 1  
ATOM 1540  H HG13 . VAL A 1 103 ? 0.319   1.671   7.835   1.00 0.00 ? 103 VAL A HG13 1  
ATOM 1541  H HG21 . VAL A 1 103 ? 2.037   2.098   4.434   1.00 0.00 ? 103 VAL A HG21 1  
ATOM 1542  H HG22 . VAL A 1 103 ? 2.540   2.356   6.105   1.00 0.00 ? 103 VAL A HG22 1  
ATOM 1543  H HG23 . VAL A 1 103 ? 2.932   0.842   5.289   1.00 0.00 ? 103 VAL A HG23 1  
ATOM 1544  N N    . ALA A 1 104 ? -0.106  -1.593  8.230   1.00 0.00 ? 104 ALA A N    1  
ATOM 1545  C CA   . ALA A 1 104 ? -1.294  -2.155  8.860   1.00 0.00 ? 104 ALA A CA   1  
ATOM 1546  C C    . ALA A 1 104 ? -1.989  -1.123  9.741   1.00 0.00 ? 104 ALA A C    1  
ATOM 1547  O O    . ALA A 1 104 ? -1.340  -0.399  10.496  1.00 0.00 ? 104 ALA A O    1  
ATOM 1548  C CB   . ALA A 1 104 ? -0.927  -3.386  9.674   1.00 0.00 ? 104 ALA A CB   1  
ATOM 1549  H H    . ALA A 1 104 ? 0.772   -1.760  8.631   1.00 0.00 ? 104 ALA A H    1  
ATOM 1550  H HA   . ALA A 1 104 ? -1.973  -2.461  8.077   1.00 0.00 ? 104 ALA A HA   1  
ATOM 1551  H HB1  . ALA A 1 104 ? -1.820  -3.806  10.113  1.00 0.00 ? 104 ALA A HB1  1  
ATOM 1552  H HB2  . ALA A 1 104 ? -0.463  -4.119  9.031   1.00 0.00 ? 104 ALA A HB2  1  
ATOM 1553  H HB3  . ALA A 1 104 ? -0.238  -3.107  10.457  1.00 0.00 ? 104 ALA A HB3  1  
ATOM 1554  N N    . VAL A 1 105 ? -3.313  -1.060  9.640   1.00 0.00 ? 105 VAL A N    1  
ATOM 1555  C CA   . VAL A 1 105 ? -4.096  -0.117  10.428  1.00 0.00 ? 105 VAL A CA   1  
ATOM 1556  C C    . VAL A 1 105 ? -5.473  -0.684  10.756  1.00 0.00 ? 105 VAL A C    1  
ATOM 1557  O O    . VAL A 1 105 ? -6.120  -1.299  9.909   1.00 0.00 ? 105 VAL A O    1  
ATOM 1558  C CB   . VAL A 1 105 ? -4.268  1.224   9.690   1.00 0.00 ? 105 VAL A CB   1  
ATOM 1559  C CG1  . VAL A 1 105 ? -5.256  1.079   8.542   1.00 0.00 ? 105 VAL A CG1  1  
ATOM 1560  C CG2  . VAL A 1 105 ? -4.718  2.310   10.656  1.00 0.00 ? 105 VAL A CG2  1  
ATOM 1561  H H    . VAL A 1 105 ? -3.774  -1.664  9.020   1.00 0.00 ? 105 VAL A H    1  
ATOM 1562  H HA   . VAL A 1 105 ? -3.565  0.070   11.350  1.00 0.00 ? 105 VAL A HA   1  
ATOM 1563  H HB   . VAL A 1 105 ? -3.312  1.511   9.279   1.00 0.00 ? 105 VAL A HB   1  
ATOM 1564  H HG11 . VAL A 1 105 ? -6.264  1.156   8.923   1.00 0.00 ? 105 VAL A HG11 1  
ATOM 1565  H HG12 . VAL A 1 105 ? -5.082  1.861   7.817   1.00 0.00 ? 105 VAL A HG12 1  
ATOM 1566  H HG13 . VAL A 1 105 ? -5.122  0.116   8.072   1.00 0.00 ? 105 VAL A HG13 1  
ATOM 1567  H HG21 . VAL A 1 105 ? -5.693  2.670   10.364  1.00 0.00 ? 105 VAL A HG21 1  
ATOM 1568  H HG22 . VAL A 1 105 ? -4.770  1.904   11.656  1.00 0.00 ? 105 VAL A HG22 1  
ATOM 1569  H HG23 . VAL A 1 105 ? -4.011  3.126   10.636  1.00 0.00 ? 105 VAL A HG23 1  
ATOM 1570  N N    . ARG A 1 106 ? -5.914  -0.473  11.992  1.00 0.00 ? 106 ARG A N    1  
ATOM 1571  C CA   . ARG A 1 106 ? -7.214  -0.965  12.433  1.00 0.00 ? 106 ARG A CA   1  
ATOM 1572  C C    . ARG A 1 106 ? -8.301  0.079   12.189  1.00 0.00 ? 106 ARG A C    1  
ATOM 1573  O O    . ARG A 1 106 ? -8.102  1.269   12.435  1.00 0.00 ? 106 ARG A O    1  
ATOM 1574  C CB   . ARG A 1 106 ? -7.168  -1.331  13.917  1.00 0.00 ? 106 ARG A CB   1  
ATOM 1575  C CG   . ARG A 1 106 ? -8.270  -2.287  14.343  1.00 0.00 ? 106 ARG A CG   1  
ATOM 1576  C CD   . ARG A 1 106 ? -8.368  -2.386  15.858  1.00 0.00 ? 106 ARG A CD   1  
ATOM 1577  N NE   . ARG A 1 106 ? -7.223  -3.084  16.436  1.00 0.00 ? 106 ARG A NE   1  
ATOM 1578  C CZ   . ARG A 1 106 ? -7.065  -4.402  16.386  1.00 0.00 ? 106 ARG A CZ   1  
ATOM 1579  N NH1  . ARG A 1 106 ? -7.973  -5.160  15.788  1.00 0.00 ? 106 ARG A NH1  1  
ATOM 1580  N NH2  . ARG A 1 106 ? -5.996  -4.964  16.936  1.00 0.00 ? 106 ARG A NH2  1  
ATOM 1581  H H    . ARG A 1 106 ? -5.352  0.024   12.622  1.00 0.00 ? 106 ARG A H    1  
ATOM 1582  H HA   . ARG A 1 106 ? -7.446  -1.850  11.860  1.00 0.00 ? 106 ARG A HA   1  
ATOM 1583  H HB2  . ARG A 1 106 ? -6.216  -1.795  14.132  1.00 0.00 ? 106 ARG A HB2  1  
ATOM 1584  H HB3  . ARG A 1 106 ? -7.259  -0.428  14.501  1.00 0.00 ? 106 ARG A HB3  1  
ATOM 1585  H HG2  . ARG A 1 106 ? -9.213  -1.931  13.955  1.00 0.00 ? 106 ARG A HG2  1  
ATOM 1586  H HG3  . ARG A 1 106 ? -8.059  -3.266  13.940  1.00 0.00 ? 106 ARG A HG3  1  
ATOM 1587  H HD2  . ARG A 1 106 ? -8.413  -1.388  16.268  1.00 0.00 ? 106 ARG A HD2  1  
ATOM 1588  H HD3  . ARG A 1 106 ? -9.270  -2.920  16.112  1.00 0.00 ? 106 ARG A HD3  1  
ATOM 1589  H HE   . ARG A 1 106 ? -6.539  -2.543  16.882  1.00 0.00 ? 106 ARG A HE   1  
ATOM 1590  H HH11 . ARG A 1 106 ? -8.779  -4.739  15.373  1.00 0.00 ? 106 ARG A HH11 1  
ATOM 1591  H HH12 . ARG A 1 106 ? -7.851  -6.152  15.752  1.00 0.00 ? 106 ARG A HH12 1  
ATOM 1592  H HH21 . ARG A 1 106 ? -5.308  -4.396  17.387  1.00 0.00 ? 106 ARG A HH21 1  
ATOM 1593  H HH22 . ARG A 1 106 ? -5.878  -5.956  16.898  1.00 0.00 ? 106 ARG A HH22 1  
ATOM 1594  N N    . THR A 1 107 ? -9.452  -0.376  11.702  1.00 0.00 ? 107 THR A N    1  
ATOM 1595  C CA   . THR A 1 107 ? -10.569 0.517   11.423  1.00 0.00 ? 107 THR A CA   1  
ATOM 1596  C C    . THR A 1 107 ? -11.315 0.881   12.702  1.00 0.00 ? 107 THR A C    1  
ATOM 1597  O O    . THR A 1 107 ? -11.122 0.255   13.745  1.00 0.00 ? 107 THR A O    1  
ATOM 1598  C CB   . THR A 1 107 ? -11.559 -0.116  10.427  1.00 0.00 ? 107 THR A CB   1  
ATOM 1599  O OG1  . THR A 1 107 ? -11.834 -1.470  10.804  1.00 0.00 ? 107 THR A OG1  1  
ATOM 1600  C CG2  . THR A 1 107 ? -11.001 -0.081  9.013   1.00 0.00 ? 107 THR A CG2  1  
ATOM 1601  H H    . THR A 1 107 ? -9.549  -1.335  11.526  1.00 0.00 ? 107 THR A H    1  
ATOM 1602  H HA   . THR A 1 107 ? -10.173 1.419   10.980  1.00 0.00 ? 107 THR A HA   1  
ATOM 1603  H HB   . THR A 1 107 ? -12.480 0.450   10.449  1.00 0.00 ? 107 THR A HB   1  
ATOM 1604  H HG1  . THR A 1 107 ? -12.666 -1.748  10.413  1.00 0.00 ? 107 THR A HG1  1  
ATOM 1605  H HG21 . THR A 1 107 ? -10.845 -1.091  8.662   1.00 0.00 ? 107 THR A HG21 1  
ATOM 1606  H HG22 . THR A 1 107 ? -10.061 0.450   9.010   1.00 0.00 ? 107 THR A HG22 1  
ATOM 1607  H HG23 . THR A 1 107 ? -11.701 0.421   8.362   1.00 0.00 ? 107 THR A HG23 1  
ATOM 1608  N N    . LEU A 1 108 ? -12.167 1.896   12.615  1.00 0.00 ? 108 LEU A N    1  
ATOM 1609  C CA   . LEU A 1 108 ? -12.944 2.343   13.767  1.00 0.00 ? 108 LEU A CA   1  
ATOM 1610  C C    . LEU A 1 108 ? -13.980 1.297   14.164  1.00 0.00 ? 108 LEU A C    1  
ATOM 1611  O O    . LEU A 1 108 ? -14.523 0.592   13.313  1.00 0.00 ? 108 LEU A O    1  
ATOM 1612  C CB   . LEU A 1 108 ? -13.636 3.671   13.455  1.00 0.00 ? 108 LEU A CB   1  
ATOM 1613  C CG   . LEU A 1 108 ? -12.742 4.780   12.899  1.00 0.00 ? 108 LEU A CG   1  
ATOM 1614  C CD1  . LEU A 1 108 ? -13.564 6.019   12.581  1.00 0.00 ? 108 LEU A CD1  1  
ATOM 1615  C CD2  . LEU A 1 108 ? -11.631 5.113   13.884  1.00 0.00 ? 108 LEU A CD2  1  
ATOM 1616  H H    . LEU A 1 108 ? -12.278 2.356   11.758  1.00 0.00 ? 108 LEU A H    1  
ATOM 1617  H HA   . LEU A 1 108 ? -12.261 2.487   14.591  1.00 0.00 ? 108 LEU A HA   1  
ATOM 1618  H HB2  . LEU A 1 108 ? -14.412 3.477   12.730  1.00 0.00 ? 108 LEU A HB2  1  
ATOM 1619  H HB3  . LEU A 1 108 ? -14.083 4.033   14.370  1.00 0.00 ? 108 LEU A HB3  1  
ATOM 1620  H HG   . LEU A 1 108 ? -12.285 4.438   11.980  1.00 0.00 ? 108 LEU A HG   1  
ATOM 1621  H HD11 . LEU A 1 108 ? -14.580 5.730   12.357  1.00 0.00 ? 108 LEU A HD11 1  
ATOM 1622  H HD12 . LEU A 1 108 ? -13.138 6.524   11.727  1.00 0.00 ? 108 LEU A HD12 1  
ATOM 1623  H HD13 . LEU A 1 108 ? -13.557 6.684   13.432  1.00 0.00 ? 108 LEU A HD13 1  
ATOM 1624  H HD21 . LEU A 1 108 ? -10.678 5.078   13.376  1.00 0.00 ? 108 LEU A HD21 1  
ATOM 1625  H HD22 . LEU A 1 108 ? -11.636 4.393   14.690  1.00 0.00 ? 108 LEU A HD22 1  
ATOM 1626  H HD23 . LEU A 1 108 ? -11.790 6.104   14.284  1.00 0.00 ? 108 LEU A HD23 1  
ATOM 1627  N N    . SER A 1 109 ? -14.252 1.204   15.462  1.00 0.00 ? 109 SER A N    1  
ATOM 1628  C CA   . SER A 1 109 ? -15.223 0.243   15.972  1.00 0.00 ? 109 SER A CA   1  
ATOM 1629  C C    . SER A 1 109 ? -16.581 0.904   16.187  1.00 0.00 ? 109 SER A C    1  
ATOM 1630  O O    . SER A 1 109 ? -16.699 1.876   16.934  1.00 0.00 ? 109 SER A O    1  
ATOM 1631  C CB   . SER A 1 109 ? -14.727 -0.367  17.284  1.00 0.00 ? 109 SER A CB   1  
ATOM 1632  O OG   . SER A 1 109 ? -15.757 -1.094  17.931  1.00 0.00 ? 109 SER A OG   1  
ATOM 1633  H H    . SER A 1 109 ? -13.787 1.794   16.091  1.00 0.00 ? 109 SER A H    1  
ATOM 1634  H HA   . SER A 1 109 ? -15.330 -0.542  15.238  1.00 0.00 ? 109 SER A HA   1  
ATOM 1635  H HB2  . SER A 1 109 ? -13.905 -1.037  17.079  1.00 0.00 ? 109 SER A HB2  1  
ATOM 1636  H HB3  . SER A 1 109 ? -14.392 0.422   17.941  1.00 0.00 ? 109 SER A HB3  1  
ATOM 1637  H HG   . SER A 1 109 ? -16.409 -0.482  18.282  1.00 0.00 ? 109 SER A HG   1  
ATOM 1638  N N    . ASP A 1 110 ? -17.603 0.371   15.527  1.00 0.00 ? 110 ASP A N    1  
ATOM 1639  C CA   . ASP A 1 110 ? -18.954 0.908   15.646  1.00 0.00 ? 110 ASP A CA   1  
ATOM 1640  C C    . ASP A 1 110 ? -19.532 0.623   17.029  1.00 0.00 ? 110 ASP A C    1  
ATOM 1641  O O    . ASP A 1 110 ? -20.321 1.407   17.556  1.00 0.00 ? 110 ASP A O    1  
ATOM 1642  C CB   . ASP A 1 110 ? -19.859 0.311   14.568  1.00 0.00 ? 110 ASP A CB   1  
ATOM 1643  C CG   . ASP A 1 110 ? -21.328 0.389   14.937  1.00 0.00 ? 110 ASP A CG   1  
ATOM 1644  O OD1  . ASP A 1 110 ? -21.839 1.517   15.101  1.00 0.00 ? 110 ASP A OD1  1  
ATOM 1645  O OD2  . ASP A 1 110 ? -21.966 -0.677  15.061  1.00 0.00 ? 110 ASP A OD2  1  
ATOM 1646  H H    . ASP A 1 110 ? -17.445 -0.403  14.947  1.00 0.00 ? 110 ASP A H    1  
ATOM 1647  H HA   . ASP A 1 110 ? -18.899 1.977   15.506  1.00 0.00 ? 110 ASP A HA   1  
ATOM 1648  H HB2  . ASP A 1 110 ? -19.711 0.850   13.643  1.00 0.00 ? 110 ASP A HB2  1  
ATOM 1649  H HB3  . ASP A 1 110 ? -19.598 -0.727  14.422  1.00 0.00 ? 110 ASP A HB3  1  
ATOM 1650  N N    . SER A 1 111 ? -19.134 -0.504  17.610  1.00 0.00 ? 111 SER A N    1  
ATOM 1651  C CA   . SER A 1 111 ? -19.617 -0.895  18.930  1.00 0.00 ? 111 SER A CA   1  
ATOM 1652  C C    . SER A 1 111 ? -19.602 0.292   19.888  1.00 0.00 ? 111 SER A C    1  
ATOM 1653  O O    . SER A 1 111 ? -20.617 0.626   20.497  1.00 0.00 ? 111 SER A O    1  
ATOM 1654  C CB   . SER A 1 111 ? -18.760 -2.031  19.493  1.00 0.00 ? 111 SER A CB   1  
ATOM 1655  O OG   . SER A 1 111 ? -19.276 -2.493  20.729  1.00 0.00 ? 111 SER A OG   1  
ATOM 1656  H H    . SER A 1 111 ? -18.503 -1.088  17.139  1.00 0.00 ? 111 SER A H    1  
ATOM 1657  H HA   . SER A 1 111 ? -20.633 -1.242  18.821  1.00 0.00 ? 111 SER A HA   1  
ATOM 1658  H HB2  . SER A 1 111 ? -18.748 -2.851  18.792  1.00 0.00 ? 111 SER A HB2  1  
ATOM 1659  H HB3  . SER A 1 111 ? -17.752 -1.674  19.648  1.00 0.00 ? 111 SER A HB3  1  
ATOM 1660  H HG   . SER A 1 111 ? -19.659 -1.757  21.213  1.00 0.00 ? 111 SER A HG   1  
ATOM 1661  N N    . GLY A 1 112 ? -18.440 0.927   20.015  1.00 0.00 ? 112 GLY A N    1  
ATOM 1662  C CA   . GLY A 1 112 ? -18.313 2.070   20.900  1.00 0.00 ? 112 GLY A CA   1  
ATOM 1663  C C    . GLY A 1 112 ? -16.884 2.565   21.006  1.00 0.00 ? 112 GLY A C    1  
ATOM 1664  O O    . GLY A 1 112 ? -15.950 1.944   20.498  1.00 0.00 ? 112 GLY A O    1  
ATOM 1665  H H    . GLY A 1 112 ? -17.663 0.616   19.505  1.00 0.00 ? 112 GLY A H    1  
ATOM 1666  H HA2  . GLY A 1 112 ? -18.934 2.871   20.527  1.00 0.00 ? 112 GLY A HA2  1  
ATOM 1667  H HA3  . GLY A 1 112 ? -18.658 1.789   21.885  1.00 0.00 ? 112 GLY A HA3  1  
ATOM 1668  N N    . PRO A 1 113 ? -16.699 3.710   21.679  1.00 0.00 ? 113 PRO A N    1  
ATOM 1669  C CA   . PRO A 1 113 ? -15.376 4.314   21.865  1.00 0.00 ? 113 PRO A CA   1  
ATOM 1670  C C    . PRO A 1 113 ? -14.496 3.503   22.810  1.00 0.00 ? 113 PRO A C    1  
ATOM 1671  O O    . PRO A 1 113 ? -13.370 3.895   23.115  1.00 0.00 ? 113 PRO A O    1  
ATOM 1672  C CB   . PRO A 1 113 ? -15.693 5.683   22.473  1.00 0.00 ? 113 PRO A CB   1  
ATOM 1673  C CG   . PRO A 1 113 ? -17.011 5.503   23.144  1.00 0.00 ? 113 PRO A CG   1  
ATOM 1674  C CD   . PRO A 1 113 ? -17.766 4.504   22.311  1.00 0.00 ? 113 PRO A CD   1  
ATOM 1675  H HA   . PRO A 1 113 ? -14.865 4.447   20.923  1.00 0.00 ? 113 PRO A HA   1  
ATOM 1676  H HB2  . PRO A 1 113 ? -14.922 5.952   23.182  1.00 0.00 ? 113 PRO A HB2  1  
ATOM 1677  H HB3  . PRO A 1 113 ? -15.746 6.425   21.691  1.00 0.00 ? 113 PRO A HB3  1  
ATOM 1678  H HG2  . PRO A 1 113 ? -16.866 5.125   24.144  1.00 0.00 ? 113 PRO A HG2  1  
ATOM 1679  H HG3  . PRO A 1 113 ? -17.541 6.444   23.170  1.00 0.00 ? 113 PRO A HG3  1  
ATOM 1680  H HD2  . PRO A 1 113 ? -18.388 3.883   22.939  1.00 0.00 ? 113 PRO A HD2  1  
ATOM 1681  H HD3  . PRO A 1 113 ? -18.364 5.008   21.566  1.00 0.00 ? 113 PRO A HD3  1  
ATOM 1682  N N    . SER A 1 114 ? -15.016 2.369   23.268  1.00 0.00 ? 114 SER A N    1  
ATOM 1683  C CA   . SER A 1 114 ? -14.278 1.503   24.181  1.00 0.00 ? 114 SER A CA   1  
ATOM 1684  C C    . SER A 1 114 ? -12.785 1.529   23.866  1.00 0.00 ? 114 SER A C    1  
ATOM 1685  O O    . SER A 1 114 ? -12.341 0.975   22.861  1.00 0.00 ? 114 SER A O    1  
ATOM 1686  C CB   . SER A 1 114 ? -14.804 0.069   24.095  1.00 0.00 ? 114 SER A CB   1  
ATOM 1687  O OG   . SER A 1 114 ? -16.172 0.005   24.457  1.00 0.00 ? 114 SER A OG   1  
ATOM 1688  H H    . SER A 1 114 ? -15.919 2.109   22.988  1.00 0.00 ? 114 SER A H    1  
ATOM 1689  H HA   . SER A 1 114 ? -14.429 1.873   25.184  1.00 0.00 ? 114 SER A HA   1  
ATOM 1690  H HB2  . SER A 1 114 ? -14.694 -0.292  23.083  1.00 0.00 ? 114 SER A HB2  1  
ATOM 1691  H HB3  . SER A 1 114 ? -14.236 -0.560  24.765  1.00 0.00 ? 114 SER A HB3  1  
ATOM 1692  H HG   . SER A 1 114 ? -16.299 0.436   25.305  1.00 0.00 ? 114 SER A HG   1  
ATOM 1693  N N    . SER A 1 115 ? -12.015 2.178   24.734  1.00 0.00 ? 115 SER A N    1  
ATOM 1694  C CA   . SER A 1 115 ? -10.573 2.281   24.549  1.00 0.00 ? 115 SER A CA   1  
ATOM 1695  C C    . SER A 1 115 ? -9.930  0.897   24.511  1.00 0.00 ? 115 SER A C    1  
ATOM 1696  O O    . SER A 1 115 ? -10.285 0.014   25.290  1.00 0.00 ? 115 SER A O    1  
ATOM 1697  C CB   . SER A 1 115 ? -9.951  3.114   25.670  1.00 0.00 ? 115 SER A CB   1  
ATOM 1698  O OG   . SER A 1 115 ? -8.725  3.693   25.256  1.00 0.00 ? 115 SER A OG   1  
ATOM 1699  H H    . SER A 1 115 ? -12.428 2.600   25.517  1.00 0.00 ? 115 SER A H    1  
ATOM 1700  H HA   . SER A 1 115 ? -10.394 2.773   23.604  1.00 0.00 ? 115 SER A HA   1  
ATOM 1701  H HB2  . SER A 1 115 ? -10.632 3.904   25.949  1.00 0.00 ? 115 SER A HB2  1  
ATOM 1702  H HB3  . SER A 1 115 ? -9.765  2.480   26.526  1.00 0.00 ? 115 SER A HB3  1  
ATOM 1703  H HG   . SER A 1 115 ? -8.049  3.014   25.210  1.00 0.00 ? 115 SER A HG   1  
ATOM 1704  N N    . GLY A 1 116 ? -8.980  0.717   23.598  1.00 0.00 ? 116 GLY A N    1  
ATOM 1705  C CA   . GLY A 1 116 ? -8.302  -0.560  23.475  1.00 0.00 ? 116 GLY A CA   1  
ATOM 1706  C C    . GLY A 1 116 ? -6.907  -0.535  24.066  1.00 0.00 ? 116 GLY A C    1  
ATOM 1707  O O    . GLY A 1 116 ? -6.605  -1.287  24.993  1.00 0.00 ? 116 GLY A O    1  
ATOM 1708  H H    . GLY A 1 116 ? -8.738  1.458   23.003  1.00 0.00 ? 116 GLY A H    1  
ATOM 1709  H HA2  . GLY A 1 116 ? -8.884  -1.314  23.983  1.00 0.00 ? 116 GLY A HA2  1  
ATOM 1710  H HA3  . GLY A 1 116 ? -8.232  -0.818  22.428  1.00 0.00 ? 116 GLY A HA3  1  
ATOM 1711  N N    . GLY A 1 1   ? -7.418  -10.936 14.293  1.00 0.00 ? 1   GLY A N    2  
ATOM 1712  C CA   . GLY A 1 1   ? -7.570  -11.610 15.569  1.00 0.00 ? 1   GLY A CA   2  
ATOM 1713  C C    . GLY A 1 1   ? -6.625  -12.786 15.719  1.00 0.00 ? 1   GLY A C    2  
ATOM 1714  O O    . GLY A 1 1   ? -5.970  -12.937 16.750  1.00 0.00 ? 1   GLY A O    2  
ATOM 1715  H H1   . GLY A 1 1   ? -6.797  -11.291 13.623  1.00 0.00 ? 1   GLY A H1   2  
ATOM 1716  H HA2  . GLY A 1 1   ? -7.377  -10.903 16.362  1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1717  H HA3  . GLY A 1 1   ? -8.586  -11.966 15.657  1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1718  N N    . SER A 1 2   ? -6.556  -13.622 14.688  1.00 0.00 ? 2   SER A N    2  
ATOM 1719  C CA   . SER A 1 2   ? -5.688  -14.794 14.712  1.00 0.00 ? 2   SER A CA   2  
ATOM 1720  C C    . SER A 1 2   ? -4.224  -14.389 14.576  1.00 0.00 ? 2   SER A C    2  
ATOM 1721  O O    . SER A 1 2   ? -3.897  -13.422 13.887  1.00 0.00 ? 2   SER A O    2  
ATOM 1722  C CB   . SER A 1 2   ? -6.069  -15.760 13.588  1.00 0.00 ? 2   SER A CB   2  
ATOM 1723  O OG   . SER A 1 2   ? -5.565  -17.060 13.840  1.00 0.00 ? 2   SER A OG   2  
ATOM 1724  H H    . SER A 1 2   ? -7.103  -13.448 13.894  1.00 0.00 ? 2   SER A H    2  
ATOM 1725  H HA   . SER A 1 2   ? -5.826  -15.289 15.662  1.00 0.00 ? 2   SER A HA   2  
ATOM 1726  H HB2  . SER A 1 2   ? -7.145  -15.813 13.511  1.00 0.00 ? 2   SER A HB2  2  
ATOM 1727  H HB3  . SER A 1 2   ? -5.659  -15.401 12.655  1.00 0.00 ? 2   SER A HB3  2  
ATOM 1728  H HG   . SER A 1 2   ? -4.771  -16.997 14.376  1.00 0.00 ? 2   SER A HG   2  
ATOM 1729  N N    . SER A 1 3   ? -3.346  -15.136 15.237  1.00 0.00 ? 3   SER A N    2  
ATOM 1730  C CA   . SER A 1 3   ? -1.916  -14.854 15.193  1.00 0.00 ? 3   SER A CA   2  
ATOM 1731  C C    . SER A 1 3   ? -1.366  -15.051 13.784  1.00 0.00 ? 3   SER A C    2  
ATOM 1732  O O    . SER A 1 3   ? -1.242  -16.178 13.306  1.00 0.00 ? 3   SER A O    2  
ATOM 1733  C CB   . SER A 1 3   ? -1.166  -15.755 16.176  1.00 0.00 ? 3   SER A CB   2  
ATOM 1734  O OG   . SER A 1 3   ? -1.492  -15.430 17.517  1.00 0.00 ? 3   SER A OG   2  
ATOM 1735  H H    . SER A 1 3   ? -3.668  -15.894 15.769  1.00 0.00 ? 3   SER A H    2  
ATOM 1736  H HA   . SER A 1 3   ? -1.772  -13.823 15.482  1.00 0.00 ? 3   SER A HA   2  
ATOM 1737  H HB2  . SER A 1 3   ? -1.434  -16.784 15.994  1.00 0.00 ? 3   SER A HB2  2  
ATOM 1738  H HB3  . SER A 1 3   ? -0.102  -15.630 16.036  1.00 0.00 ? 3   SER A HB3  2  
ATOM 1739  H HG   . SER A 1 3   ? -0.732  -15.593 18.080  1.00 0.00 ? 3   SER A HG   2  
ATOM 1740  N N    . GLY A 1 4   ? -1.037  -13.945 13.123  1.00 0.00 ? 4   GLY A N    2  
ATOM 1741  C CA   . GLY A 1 4   ? -0.504  -14.017 11.775  1.00 0.00 ? 4   GLY A CA   2  
ATOM 1742  C C    . GLY A 1 4   ? 0.903   -14.578 11.737  1.00 0.00 ? 4   GLY A C    2  
ATOM 1743  O O    . GLY A 1 4   ? 1.325   -15.277 12.658  1.00 0.00 ? 4   GLY A O    2  
ATOM 1744  H H    . GLY A 1 4   ? -1.158  -13.073 13.554  1.00 0.00 ? 4   GLY A H    2  
ATOM 1745  H HA2  . GLY A 1 4   ? -1.148  -14.646 11.178  1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1746  H HA3  . GLY A 1 4   ? -0.495  -13.024 11.351  1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1747  N N    . SER A 1 5   ? 1.632   -14.274 10.668  1.00 0.00 ? 5   SER A N    2  
ATOM 1748  C CA   . SER A 1 5   ? 2.998   -14.757 10.511  1.00 0.00 ? 5   SER A CA   2  
ATOM 1749  C C    . SER A 1 5   ? 3.702   -14.035 9.365   1.00 0.00 ? 5   SER A C    2  
ATOM 1750  O O    . SER A 1 5   ? 3.056   -13.497 8.466   1.00 0.00 ? 5   SER A O    2  
ATOM 1751  C CB   . SER A 1 5   ? 3.002   -16.266 10.257  1.00 0.00 ? 5   SER A CB   2  
ATOM 1752  O OG   . SER A 1 5   ? 4.269   -16.703 9.796   1.00 0.00 ? 5   SER A OG   2  
ATOM 1753  H H    . SER A 1 5   ? 1.239   -13.712 9.967   1.00 0.00 ? 5   SER A H    2  
ATOM 1754  H HA   . SER A 1 5   ? 3.529   -14.554 11.429  1.00 0.00 ? 5   SER A HA   2  
ATOM 1755  H HB2  . SER A 1 5   ? 2.768   -16.784 11.174  1.00 0.00 ? 5   SER A HB2  2  
ATOM 1756  H HB3  . SER A 1 5   ? 2.259   -16.504 9.509   1.00 0.00 ? 5   SER A HB3  2  
ATOM 1757  H HG   . SER A 1 5   ? 4.921   -16.581 10.490  1.00 0.00 ? 5   SER A HG   2  
ATOM 1758  N N    . SER A 1 6   ? 5.030   -14.028 9.406   1.00 0.00 ? 6   SER A N    2  
ATOM 1759  C CA   . SER A 1 6   ? 5.823   -13.370 8.374   1.00 0.00 ? 6   SER A CA   2  
ATOM 1760  C C    . SER A 1 6   ? 5.846   -14.200 7.094   1.00 0.00 ? 6   SER A C    2  
ATOM 1761  O O    . SER A 1 6   ? 5.712   -15.422 7.131   1.00 0.00 ? 6   SER A O    2  
ATOM 1762  C CB   . SER A 1 6   ? 7.251   -13.137 8.870   1.00 0.00 ? 6   SER A CB   2  
ATOM 1763  O OG   . SER A 1 6   ? 7.358   -11.900 9.554   1.00 0.00 ? 6   SER A OG   2  
ATOM 1764  H H    . SER A 1 6   ? 5.488   -14.475 10.149  1.00 0.00 ? 6   SER A H    2  
ATOM 1765  H HA   . SER A 1 6   ? 5.364   -12.416 8.162   1.00 0.00 ? 6   SER A HA   2  
ATOM 1766  H HB2  . SER A 1 6   ? 7.530   -13.932 9.544   1.00 0.00 ? 6   SER A HB2  2  
ATOM 1767  H HB3  . SER A 1 6   ? 7.925   -13.127 8.026   1.00 0.00 ? 6   SER A HB3  2  
ATOM 1768  H HG   . SER A 1 6   ? 8.123   -11.419 9.229   1.00 0.00 ? 6   SER A HG   2  
ATOM 1769  N N    . GLY A 1 7   ? 6.017   -13.525 5.961   1.00 0.00 ? 7   GLY A N    2  
ATOM 1770  C CA   . GLY A 1 7   ? 6.054   -14.215 4.685   1.00 0.00 ? 7   GLY A CA   2  
ATOM 1771  C C    . GLY A 1 7   ? 7.458   -14.624 4.289   1.00 0.00 ? 7   GLY A C    2  
ATOM 1772  O O    . GLY A 1 7   ? 8.153   -15.300 5.048   1.00 0.00 ? 7   GLY A O    2  
ATOM 1773  H H    . GLY A 1 7   ? 6.118   -12.550 5.993   1.00 0.00 ? 7   GLY A H    2  
ATOM 1774  H HA2  . GLY A 1 7   ? 5.436   -15.098 4.748   1.00 0.00 ? 7   GLY A HA2  2  
ATOM 1775  H HA3  . GLY A 1 7   ? 5.654   -13.561 3.924   1.00 0.00 ? 7   GLY A HA3  2  
ATOM 1776  N N    . ARG A 1 8   ? 7.878   -14.216 3.095   1.00 0.00 ? 8   ARG A N    2  
ATOM 1777  C CA   . ARG A 1 8   ? 9.208   -14.548 2.598   1.00 0.00 ? 8   ARG A CA   2  
ATOM 1778  C C    . ARG A 1 8   ? 9.679   -13.517 1.577   1.00 0.00 ? 8   ARG A C    2  
ATOM 1779  O O    . ARG A 1 8   ? 8.875   -12.774 1.013   1.00 0.00 ? 8   ARG A O    2  
ATOM 1780  C CB   . ARG A 1 8   ? 9.207   -15.942 1.969   1.00 0.00 ? 8   ARG A CB   2  
ATOM 1781  C CG   . ARG A 1 8   ? 10.573  -16.609 1.965   1.00 0.00 ? 8   ARG A CG   2  
ATOM 1782  C CD   . ARG A 1 8   ? 10.541  -17.938 1.226   1.00 0.00 ? 8   ARG A CD   2  
ATOM 1783  N NE   . ARG A 1 8   ? 10.033  -19.019 2.065   1.00 0.00 ? 8   ARG A NE   2  
ATOM 1784  C CZ   . ARG A 1 8   ? 8.741   -19.288 2.216   1.00 0.00 ? 8   ARG A CZ   2  
ATOM 1785  N NH1  . ARG A 1 8   ? 7.831   -18.557 1.586   1.00 0.00 ? 8   ARG A NH1  2  
ATOM 1786  N NH2  . ARG A 1 8   ? 8.357   -20.289 2.997   1.00 0.00 ? 8   ARG A NH2  2  
ATOM 1787  H H    . ARG A 1 8   ? 7.278   -13.680 2.535   1.00 0.00 ? 8   ARG A H    2  
ATOM 1788  H HA   . ARG A 1 8   ? 9.887   -14.542 3.438   1.00 0.00 ? 8   ARG A HA   2  
ATOM 1789  H HB2  . ARG A 1 8   ? 8.524   -16.573 2.519   1.00 0.00 ? 8   ARG A HB2  2  
ATOM 1790  H HB3  . ARG A 1 8   ? 8.866   -15.862 0.947   1.00 0.00 ? 8   ARG A HB3  2  
ATOM 1791  H HG2  . ARG A 1 8   ? 11.281  -15.956 1.477   1.00 0.00 ? 8   ARG A HG2  2  
ATOM 1792  H HG3  . ARG A 1 8   ? 10.881  -16.781 2.985   1.00 0.00 ? 8   ARG A HG3  2  
ATOM 1793  H HD2  . ARG A 1 8   ? 9.904   -17.838 0.360   1.00 0.00 ? 8   ARG A HD2  2  
ATOM 1794  H HD3  . ARG A 1 8   ? 11.544  -18.181 0.909   1.00 0.00 ? 8   ARG A HD3  2  
ATOM 1795  H HE   . ARG A 1 8   ? 10.688  -19.572 2.540   1.00 0.00 ? 8   ARG A HE   2  
ATOM 1796  H HH11 . ARG A 1 8   ? 8.118   -17.803 0.996   1.00 0.00 ? 8   ARG A HH11 2  
ATOM 1797  H HH12 . ARG A 1 8   ? 6.859   -18.763 1.700   1.00 0.00 ? 8   ARG A HH12 2  
ATOM 1798  H HH21 . ARG A 1 8   ? 9.040   -20.842 3.474   1.00 0.00 ? 8   ARG A HH21 2  
ATOM 1799  H HH22 . ARG A 1 8   ? 7.384   -20.490 3.110   1.00 0.00 ? 8   ARG A HH22 2  
ATOM 1800  N N    . VAL A 1 9   ? 10.987  -13.477 1.344   1.00 0.00 ? 9   VAL A N    2  
ATOM 1801  C CA   . VAL A 1 9   ? 11.565  -12.538 0.390   1.00 0.00 ? 9   VAL A CA   2  
ATOM 1802  C C    . VAL A 1 9   ? 12.166  -13.269 -0.805  1.00 0.00 ? 9   VAL A C    2  
ATOM 1803  O O    . VAL A 1 9   ? 12.885  -14.255 -0.645  1.00 0.00 ? 9   VAL A O    2  
ATOM 1804  C CB   . VAL A 1 9   ? 12.655  -11.670 1.048   1.00 0.00 ? 9   VAL A CB   2  
ATOM 1805  C CG1  . VAL A 1 9   ? 12.071  -10.859 2.195   1.00 0.00 ? 9   VAL A CG1  2  
ATOM 1806  C CG2  . VAL A 1 9   ? 13.808  -12.538 1.530   1.00 0.00 ? 9   VAL A CG2  2  
ATOM 1807  H H    . VAL A 1 9   ? 11.577  -14.095 1.824   1.00 0.00 ? 9   VAL A H    2  
ATOM 1808  H HA   . VAL A 1 9   ? 10.777  -11.887 0.043   1.00 0.00 ? 9   VAL A HA   2  
ATOM 1809  H HB   . VAL A 1 9   ? 13.035  -10.982 0.307   1.00 0.00 ? 9   VAL A HB   2  
ATOM 1810  H HG11 . VAL A 1 9   ? 12.494  -11.201 3.128   1.00 0.00 ? 9   VAL A HG11 2  
ATOM 1811  H HG12 . VAL A 1 9   ? 12.306  -9.814  2.053   1.00 0.00 ? 9   VAL A HG12 2  
ATOM 1812  H HG13 . VAL A 1 9   ? 10.999  -10.988 2.217   1.00 0.00 ? 9   VAL A HG13 2  
ATOM 1813  H HG21 . VAL A 1 9   ? 13.475  -13.561 1.619   1.00 0.00 ? 9   VAL A HG21 2  
ATOM 1814  H HG22 . VAL A 1 9   ? 14.621  -12.484 0.820   1.00 0.00 ? 9   VAL A HG22 2  
ATOM 1815  H HG23 . VAL A 1 9   ? 14.147  -12.184 2.492   1.00 0.00 ? 9   VAL A HG23 2  
ATOM 1816  N N    . GLU A 1 10  ? 11.867  -12.778 -2.004  1.00 0.00 ? 10  GLU A N    2  
ATOM 1817  C CA   . GLU A 1 10  ? 12.378  -13.385 -3.227  1.00 0.00 ? 10  GLU A CA   2  
ATOM 1818  C C    . GLU A 1 10  ? 13.619  -12.649 -3.722  1.00 0.00 ? 10  GLU A C    2  
ATOM 1819  O O    . GLU A 1 10  ? 14.086  -11.700 -3.092  1.00 0.00 ? 10  GLU A O    2  
ATOM 1820  C CB   . GLU A 1 10  ? 11.301  -13.381 -4.314  1.00 0.00 ? 10  GLU A CB   2  
ATOM 1821  C CG   . GLU A 1 10  ? 11.033  -12.004 -4.900  1.00 0.00 ? 10  GLU A CG   2  
ATOM 1822  C CD   . GLU A 1 10  ? 10.274  -11.102 -3.947  1.00 0.00 ? 10  GLU A CD   2  
ATOM 1823  O OE1  . GLU A 1 10  ? 9.118   -11.435 -3.609  1.00 0.00 ? 10  GLU A OE1  2  
ATOM 1824  O OE2  . GLU A 1 10  ? 10.834  -10.064 -3.538  1.00 0.00 ? 10  GLU A OE2  2  
ATOM 1825  H H    . GLU A 1 10  ? 11.289  -11.989 -2.067  1.00 0.00 ? 10  GLU A H    2  
ATOM 1826  H HA   . GLU A 1 10  ? 12.645  -14.407 -3.003  1.00 0.00 ? 10  GLU A HA   2  
ATOM 1827  H HB2  . GLU A 1 10  ? 11.611  -14.036 -5.114  1.00 0.00 ? 10  GLU A HB2  2  
ATOM 1828  H HB3  . GLU A 1 10  ? 10.379  -13.754 -3.891  1.00 0.00 ? 10  GLU A HB3  2  
ATOM 1829  H HG2  . GLU A 1 10  ? 11.978  -11.538 -5.136  1.00 0.00 ? 10  GLU A HG2  2  
ATOM 1830  H HG3  . GLU A 1 10  ? 10.453  -12.118 -5.804  1.00 0.00 ? 10  GLU A HG3  2  
ATOM 1831  N N    . THR A 1 11  ? 14.150  -13.094 -4.857  1.00 0.00 ? 11  THR A N    2  
ATOM 1832  C CA   . THR A 1 11  ? 15.338  -12.480 -5.438  1.00 0.00 ? 11  THR A CA   2  
ATOM 1833  C C    . THR A 1 11  ? 14.993  -11.705 -6.704  1.00 0.00 ? 11  THR A C    2  
ATOM 1834  O O    . THR A 1 11  ? 13.929  -11.900 -7.291  1.00 0.00 ? 11  THR A O    2  
ATOM 1835  C CB   . THR A 1 11  ? 16.409  -13.535 -5.772  1.00 0.00 ? 11  THR A CB   2  
ATOM 1836  O OG1  . THR A 1 11  ? 15.883  -14.492 -6.698  1.00 0.00 ? 11  THR A OG1  2  
ATOM 1837  C CG2  . THR A 1 11  ? 16.880  -14.247 -4.512  1.00 0.00 ? 11  THR A CG2  2  
ATOM 1838  H H    . THR A 1 11  ? 13.732  -13.854 -5.314  1.00 0.00 ? 11  THR A H    2  
ATOM 1839  H HA   . THR A 1 11  ? 15.750  -11.797 -4.709  1.00 0.00 ? 11  THR A HA   2  
ATOM 1840  H HB   . THR A 1 11  ? 17.255  -13.037 -6.223  1.00 0.00 ? 11  THR A HB   2  
ATOM 1841  H HG1  . THR A 1 11  ? 15.043  -14.825 -6.372  1.00 0.00 ? 11  THR A HG1  2  
ATOM 1842  H HG21 . THR A 1 11  ? 16.155  -14.996 -4.229  1.00 0.00 ? 11  THR A HG21 2  
ATOM 1843  H HG22 . THR A 1 11  ? 16.987  -13.529 -3.712  1.00 0.00 ? 11  THR A HG22 2  
ATOM 1844  H HG23 . THR A 1 11  ? 17.831  -14.721 -4.701  1.00 0.00 ? 11  THR A HG23 2  
ATOM 1845  N N    . GLN A 1 12  ? 15.899  -10.825 -7.118  1.00 0.00 ? 12  GLN A N    2  
ATOM 1846  C CA   . GLN A 1 12  ? 15.689  -10.020 -8.316  1.00 0.00 ? 12  GLN A CA   2  
ATOM 1847  C C    . GLN A 1 12  ? 16.932  -9.200  -8.645  1.00 0.00 ? 12  GLN A C    2  
ATOM 1848  O O    . GLN A 1 12  ? 17.661  -8.749  -7.761  1.00 0.00 ? 12  GLN A O    2  
ATOM 1849  C CB   . GLN A 1 12  ? 14.487  -9.093  -8.129  1.00 0.00 ? 12  GLN A CB   2  
ATOM 1850  C CG   . GLN A 1 12  ? 14.539  -8.280  -6.845  1.00 0.00 ? 12  GLN A CG   2  
ATOM 1851  C CD   . GLN A 1 12  ? 13.447  -7.232  -6.773  1.00 0.00 ? 12  GLN A CD   2  
ATOM 1852  O OE1  . GLN A 1 12  ? 12.621  -7.115  -7.679  1.00 0.00 ? 12  GLN A OE1  2  
ATOM 1853  N NE2  . GLN A 1 12  ? 13.437  -6.460  -5.692  1.00 0.00 ? 12  GLN A NE2  2  
ATOM 1854  H H    . GLN A 1 12  ? 16.727  -10.715 -6.608  1.00 0.00 ? 12  GLN A H    2  
ATOM 1855  H HA   . GLN A 1 12  ? 15.489  -10.692 -9.136  1.00 0.00 ? 12  GLN A HA   2  
ATOM 1856  H HB2  . GLN A 1 12  ? 14.442  -8.408  -8.962  1.00 0.00 ? 12  GLN A HB2  2  
ATOM 1857  H HB3  . GLN A 1 12  ? 13.586  -9.690  -8.115  1.00 0.00 ? 12  GLN A HB3  2  
ATOM 1858  H HG2  . GLN A 1 12  ? 14.429  -8.950  -6.005  1.00 0.00 ? 12  GLN A HG2  2  
ATOM 1859  H HG3  . GLN A 1 12  ? 15.498  -7.786  -6.786  1.00 0.00 ? 12  GLN A HG3  2  
ATOM 1860  H HE21 . GLN A 1 12  ? 14.126  -6.609  -5.011  1.00 0.00 ? 12  GLN A HE21 2  
ATOM 1861  H HE22 . GLN A 1 12  ? 12.742  -5.774  -5.620  1.00 0.00 ? 12  GLN A HE22 2  
ATOM 1862  N N    . PRO A 1 13  ? 17.182  -9.000  -9.948  1.00 0.00 ? 13  PRO A N    2  
ATOM 1863  C CA   . PRO A 1 13  ? 18.337  -8.233  -10.423 1.00 0.00 ? 13  PRO A CA   2  
ATOM 1864  C C    . PRO A 1 13  ? 18.209  -6.744  -10.119 1.00 0.00 ? 13  PRO A C    2  
ATOM 1865  O O    . PRO A 1 13  ? 17.175  -6.288  -9.632  1.00 0.00 ? 13  PRO A O    2  
ATOM 1866  C CB   . PRO A 1 13  ? 18.324  -8.473  -11.935 1.00 0.00 ? 13  PRO A CB   2  
ATOM 1867  C CG   . PRO A 1 13  ? 16.903  -8.786  -12.257 1.00 0.00 ? 13  PRO A CG   2  
ATOM 1868  C CD   . PRO A 1 13  ? 16.356  -9.507  -11.056 1.00 0.00 ? 13  PRO A CD   2  
ATOM 1869  H HA   . PRO A 1 13  ? 19.261  -8.606  -10.006 1.00 0.00 ? 13  PRO A HA   2  
ATOM 1870  H HB2  . PRO A 1 13  ? 18.658  -7.581  -12.447 1.00 0.00 ? 13  PRO A HB2  2  
ATOM 1871  H HB3  . PRO A 1 13  ? 18.974  -9.299  -12.178 1.00 0.00 ? 13  PRO A HB3  2  
ATOM 1872  H HG2  . PRO A 1 13  ? 16.355  -7.871  -12.426 1.00 0.00 ? 13  PRO A HG2  2  
ATOM 1873  H HG3  . PRO A 1 13  ? 16.856  -9.421  -13.129 1.00 0.00 ? 13  PRO A HG3  2  
ATOM 1874  H HD2  . PRO A 1 13  ? 15.316  -9.258  -10.907 1.00 0.00 ? 13  PRO A HD2  2  
ATOM 1875  H HD3  . PRO A 1 13  ? 16.478  -10.574 -11.170 1.00 0.00 ? 13  PRO A HD3  2  
ATOM 1876  N N    . GLU A 1 14  ? 19.266  -5.992  -10.410 1.00 0.00 ? 14  GLU A N    2  
ATOM 1877  C CA   . GLU A 1 14  ? 19.271  -4.555  -10.167 1.00 0.00 ? 14  GLU A CA   2  
ATOM 1878  C C    . GLU A 1 14  ? 18.861  -3.789  -11.422 1.00 0.00 ? 14  GLU A C    2  
ATOM 1879  O O    . GLU A 1 14  ? 19.374  -4.042  -12.512 1.00 0.00 ? 14  GLU A O    2  
ATOM 1880  C CB   . GLU A 1 14  ? 20.656  -4.097  -9.706  1.00 0.00 ? 14  GLU A CB   2  
ATOM 1881  C CG   . GLU A 1 14  ? 21.755  -4.370  -10.719 1.00 0.00 ? 14  GLU A CG   2  
ATOM 1882  C CD   . GLU A 1 14  ? 23.139  -4.351  -10.098 1.00 0.00 ? 14  GLU A CD   2  
ATOM 1883  O OE1  . GLU A 1 14  ? 23.476  -5.310  -9.372  1.00 0.00 ? 14  GLU A OE1  2  
ATOM 1884  O OE2  . GLU A 1 14  ? 23.883  -3.377  -10.337 1.00 0.00 ? 14  GLU A OE2  2  
ATOM 1885  H H    . GLU A 1 14  ? 20.062  -6.414  -10.797 1.00 0.00 ? 14  GLU A H    2  
ATOM 1886  H HA   . GLU A 1 14  ? 18.555  -4.348  -9.385  1.00 0.00 ? 14  GLU A HA   2  
ATOM 1887  H HB2  . GLU A 1 14  ? 20.626  -3.034  -9.515  1.00 0.00 ? 14  GLU A HB2  2  
ATOM 1888  H HB3  . GLU A 1 14  ? 20.905  -4.611  -8.789  1.00 0.00 ? 14  GLU A HB3  2  
ATOM 1889  H HG2  . GLU A 1 14  ? 21.589  -5.343  -11.158 1.00 0.00 ? 14  GLU A HG2  2  
ATOM 1890  H HG3  . GLU A 1 14  ? 21.712  -3.616  -11.490 1.00 0.00 ? 14  GLU A HG3  2  
ATOM 1891  N N    . VAL A 1 15  ? 17.934  -2.851  -11.259 1.00 0.00 ? 15  VAL A N    2  
ATOM 1892  C CA   . VAL A 1 15  ? 17.455  -2.047  -12.378 1.00 0.00 ? 15  VAL A CA   2  
ATOM 1893  C C    . VAL A 1 15  ? 17.215  -0.603  -11.954 1.00 0.00 ? 15  VAL A C    2  
ATOM 1894  O O    . VAL A 1 15  ? 17.195  -0.291  -10.763 1.00 0.00 ? 15  VAL A O    2  
ATOM 1895  C CB   . VAL A 1 15  ? 16.152  -2.621  -12.964 1.00 0.00 ? 15  VAL A CB   2  
ATOM 1896  C CG1  . VAL A 1 15  ? 15.953  -2.142  -14.394 1.00 0.00 ? 15  VAL A CG1  2  
ATOM 1897  C CG2  . VAL A 1 15  ? 16.163  -4.141  -12.899 1.00 0.00 ? 15  VAL A CG2  2  
ATOM 1898  H H    . VAL A 1 15  ? 17.563  -2.695  -10.366 1.00 0.00 ? 15  VAL A H    2  
ATOM 1899  H HA   . VAL A 1 15  ? 18.211  -2.065  -13.149 1.00 0.00 ? 15  VAL A HA   2  
ATOM 1900  H HB   . VAL A 1 15  ? 15.325  -2.263  -12.370 1.00 0.00 ? 15  VAL A HB   2  
ATOM 1901  H HG11 . VAL A 1 15  ? 16.914  -2.041  -14.876 1.00 0.00 ? 15  VAL A HG11 2  
ATOM 1902  H HG12 . VAL A 1 15  ? 15.352  -2.859  -14.934 1.00 0.00 ? 15  VAL A HG12 2  
ATOM 1903  H HG13 . VAL A 1 15  ? 15.452  -1.185  -14.386 1.00 0.00 ? 15  VAL A HG13 2  
ATOM 1904  H HG21 . VAL A 1 15  ? 15.268  -4.527  -13.365 1.00 0.00 ? 15  VAL A HG21 2  
ATOM 1905  H HG22 . VAL A 1 15  ? 17.031  -4.518  -13.420 1.00 0.00 ? 15  VAL A HG22 2  
ATOM 1906  H HG23 . VAL A 1 15  ? 16.198  -4.458  -11.867 1.00 0.00 ? 15  VAL A HG23 2  
ATOM 1907  N N    . GLN A 1 16  ? 17.034  0.274   -12.936 1.00 0.00 ? 16  GLN A N    2  
ATOM 1908  C CA   . GLN A 1 16  ? 16.796  1.687   -12.664 1.00 0.00 ? 16  GLN A CA   2  
ATOM 1909  C C    . GLN A 1 16  ? 15.334  1.933   -12.304 1.00 0.00 ? 16  GLN A C    2  
ATOM 1910  O O    . GLN A 1 16  ? 14.706  2.860   -12.816 1.00 0.00 ? 16  GLN A O    2  
ATOM 1911  C CB   . GLN A 1 16  ? 17.185  2.534   -13.876 1.00 0.00 ? 16  GLN A CB   2  
ATOM 1912  C CG   . GLN A 1 16  ? 16.595  2.031   -15.184 1.00 0.00 ? 16  GLN A CG   2  
ATOM 1913  C CD   . GLN A 1 16  ? 17.500  1.041   -15.890 1.00 0.00 ? 16  GLN A CD   2  
ATOM 1914  O OE1  . GLN A 1 16  ? 18.706  1.001   -15.644 1.00 0.00 ? 16  GLN A OE1  2  
ATOM 1915  N NE2  . GLN A 1 16  ? 16.923  0.235   -16.773 1.00 0.00 ? 16  GLN A NE2  2  
ATOM 1916  H H    . GLN A 1 16  ? 17.061  -0.036  -13.864 1.00 0.00 ? 16  GLN A H    2  
ATOM 1917  H HA   . GLN A 1 16  ? 17.413  1.971   -11.825 1.00 0.00 ? 16  GLN A HA   2  
ATOM 1918  H HB2  . GLN A 1 16  ? 16.843  3.546   -13.718 1.00 0.00 ? 16  GLN A HB2  2  
ATOM 1919  H HB3  . GLN A 1 16  ? 18.261  2.536   -13.969 1.00 0.00 ? 16  GLN A HB3  2  
ATOM 1920  H HG2  . GLN A 1 16  ? 15.652  1.548   -14.977 1.00 0.00 ? 16  GLN A HG2  2  
ATOM 1921  H HG3  . GLN A 1 16  ? 16.430  2.875   -15.838 1.00 0.00 ? 16  GLN A HG3  2  
ATOM 1922  H HE21 . GLN A 1 16  ? 15.957  0.325   -16.918 1.00 0.00 ? 16  GLN A HE21 2  
ATOM 1923  H HE22 . GLN A 1 16  ? 17.484  -0.414  -17.244 1.00 0.00 ? 16  GLN A HE22 2  
ATOM 1924  N N    . LEU A 1 17  ? 14.799  1.097   -11.421 1.00 0.00 ? 17  LEU A N    2  
ATOM 1925  C CA   . LEU A 1 17  ? 13.410  1.224   -10.992 1.00 0.00 ? 17  LEU A CA   2  
ATOM 1926  C C    . LEU A 1 17  ? 13.259  2.331   -9.954  1.00 0.00 ? 17  LEU A C    2  
ATOM 1927  O O    . LEU A 1 17  ? 14.226  2.761   -9.324  1.00 0.00 ? 17  LEU A O    2  
ATOM 1928  C CB   . LEU A 1 17  ? 12.911  -0.102  -10.416 1.00 0.00 ? 17  LEU A CB   2  
ATOM 1929  C CG   . LEU A 1 17  ? 12.263  -1.065  -11.412 1.00 0.00 ? 17  LEU A CG   2  
ATOM 1930  C CD1  . LEU A 1 17  ? 12.884  -0.905  -12.791 1.00 0.00 ? 17  LEU A CD1  2  
ATOM 1931  C CD2  . LEU A 1 17  ? 12.398  -2.502  -10.928 1.00 0.00 ? 17  LEU A CD2  2  
ATOM 1932  H H    . LEU A 1 17  ? 15.349  0.378   -11.048 1.00 0.00 ? 17  LEU A H    2  
ATOM 1933  H HA   . LEU A 1 17  ? 12.818  1.476   -11.859 1.00 0.00 ? 17  LEU A HA   2  
ATOM 1934  H HB2  . LEU A 1 17  ? 13.754  -0.607  -9.969  1.00 0.00 ? 17  LEU A HB2  2  
ATOM 1935  H HB3  . LEU A 1 17  ? 12.182  0.124   -9.651  1.00 0.00 ? 17  LEU A HB3  2  
ATOM 1936  H HG   . LEU A 1 17  ? 11.209  -0.835  -11.491 1.00 0.00 ? 17  LEU A HG   2  
ATOM 1937  H HD11 . LEU A 1 17  ? 13.886  -0.516  -12.691 1.00 0.00 ? 17  LEU A HD11 2  
ATOM 1938  H HD12 . LEU A 1 17  ? 12.288  -0.219  -13.375 1.00 0.00 ? 17  LEU A HD12 2  
ATOM 1939  H HD13 . LEU A 1 17  ? 12.916  -1.865  -13.285 1.00 0.00 ? 17  LEU A HD13 2  
ATOM 1940  H HD21 . LEU A 1 17  ? 11.432  -2.866  -10.609 1.00 0.00 ? 17  LEU A HD21 2  
ATOM 1941  H HD22 . LEU A 1 17  ? 13.088  -2.540  -10.099 1.00 0.00 ? 17  LEU A HD22 2  
ATOM 1942  H HD23 . LEU A 1 17  ? 12.767  -3.119  -11.734 1.00 0.00 ? 17  LEU A HD23 2  
ATOM 1943  N N    . PRO A 1 18  ? 12.018  2.804   -9.769  1.00 0.00 ? 18  PRO A N    2  
ATOM 1944  C CA   . PRO A 1 18  ? 11.711  3.866   -8.806  1.00 0.00 ? 18  PRO A CA   2  
ATOM 1945  C C    . PRO A 1 18  ? 11.853  3.397   -7.362  1.00 0.00 ? 18  PRO A C    2  
ATOM 1946  O O    . PRO A 1 18  ? 12.051  2.212   -7.101  1.00 0.00 ? 18  PRO A O    2  
ATOM 1947  C CB   . PRO A 1 18  ? 10.252  4.213   -9.115  1.00 0.00 ? 18  PRO A CB   2  
ATOM 1948  C CG   . PRO A 1 18  ? 9.689   2.976   -9.725  1.00 0.00 ? 18  PRO A CG   2  
ATOM 1949  C CD   . PRO A 1 18  ? 10.819  2.338   -10.486 1.00 0.00 ? 18  PRO A CD   2  
ATOM 1950  H HA   . PRO A 1 18  ? 12.331  4.736   -8.964  1.00 0.00 ? 18  PRO A HA   2  
ATOM 1951  H HB2  . PRO A 1 18  ? 9.739   4.471   -8.198  1.00 0.00 ? 18  PRO A HB2  2  
ATOM 1952  H HB3  . PRO A 1 18  ? 10.214  5.045   -9.802  1.00 0.00 ? 18  PRO A HB3  2  
ATOM 1953  H HG2  . PRO A 1 18  ? 9.337   2.312   -8.950  1.00 0.00 ? 18  PRO A HG2  2  
ATOM 1954  H HG3  . PRO A 1 18  ? 8.883   3.233   -10.397 1.00 0.00 ? 18  PRO A HG3  2  
ATOM 1955  H HD2  . PRO A 1 18  ? 10.740  1.262   -10.447 1.00 0.00 ? 18  PRO A HD2  2  
ATOM 1956  H HD3  . PRO A 1 18  ? 10.825  2.681   -11.510 1.00 0.00 ? 18  PRO A HD3  2  
ATOM 1957  N N    . GLY A 1 19  ? 11.750  4.337   -6.427  1.00 0.00 ? 19  GLY A N    2  
ATOM 1958  C CA   . GLY A 1 19  ? 11.869  4.000   -5.020  1.00 0.00 ? 19  GLY A CA   2  
ATOM 1959  C C    . GLY A 1 19  ? 10.526  3.952   -4.319  1.00 0.00 ? 19  GLY A C    2  
ATOM 1960  O O    . GLY A 1 19  ? 9.487   4.266   -4.901  1.00 0.00 ? 19  GLY A O    2  
ATOM 1961  H H    . GLY A 1 19  ? 11.592  5.266   -6.694  1.00 0.00 ? 19  GLY A H    2  
ATOM 1962  H HA2  . GLY A 1 19  ? 12.344  3.034   -4.932  1.00 0.00 ? 19  GLY A HA2  2  
ATOM 1963  H HA3  . GLY A 1 19  ? 12.489  4.740   -4.536  1.00 0.00 ? 19  GLY A HA3  2  
ATOM 1964  N N    . PRO A 1 20  ? 10.536  3.551   -3.040  1.00 0.00 ? 20  PRO A N    2  
ATOM 1965  C CA   . PRO A 1 20  ? 9.317   3.453   -2.231  1.00 0.00 ? 20  PRO A CA   2  
ATOM 1966  C C    . PRO A 1 20  ? 8.730   4.820   -1.900  1.00 0.00 ? 20  PRO A C    2  
ATOM 1967  O O    . PRO A 1 20  ? 9.439   5.716   -1.441  1.00 0.00 ? 20  PRO A O    2  
ATOM 1968  C CB   . PRO A 1 20  ? 9.792   2.751   -0.957  1.00 0.00 ? 20  PRO A CB   2  
ATOM 1969  C CG   . PRO A 1 20  ? 11.244  3.073   -0.866  1.00 0.00 ? 20  PRO A CG   2  
ATOM 1970  C CD   . PRO A 1 20  ? 11.738  3.162   -2.283  1.00 0.00 ? 20  PRO A CD   2  
ATOM 1971  H HA   . PRO A 1 20  ? 8.566   2.848   -2.718  1.00 0.00 ? 20  PRO A HA   2  
ATOM 1972  H HB2  . PRO A 1 20  ? 9.247   3.137   -0.106  1.00 0.00 ? 20  PRO A HB2  2  
ATOM 1973  H HB3  . PRO A 1 20  ? 9.629   1.688   -1.044  1.00 0.00 ? 20  PRO A HB3  2  
ATOM 1974  H HG2  . PRO A 1 20  ? 11.380  4.018   -0.362  1.00 0.00 ? 20  PRO A HG2  2  
ATOM 1975  H HG3  . PRO A 1 20  ? 11.762  2.286   -0.337  1.00 0.00 ? 20  PRO A HG3  2  
ATOM 1976  H HD2  . PRO A 1 20  ? 12.508  3.914   -2.368  1.00 0.00 ? 20  PRO A HD2  2  
ATOM 1977  H HD3  . PRO A 1 20  ? 12.108  2.202   -2.615  1.00 0.00 ? 20  PRO A HD3  2  
ATOM 1978  N N    . ALA A 1 21  ? 7.431   4.974   -2.134  1.00 0.00 ? 21  ALA A N    2  
ATOM 1979  C CA   . ALA A 1 21  ? 6.748   6.232   -1.858  1.00 0.00 ? 21  ALA A CA   2  
ATOM 1980  C C    . ALA A 1 21  ? 6.963   6.667   -0.412  1.00 0.00 ? 21  ALA A C    2  
ATOM 1981  O O    . ALA A 1 21  ? 6.526   6.006   0.531   1.00 0.00 ? 21  ALA A O    2  
ATOM 1982  C CB   . ALA A 1 21  ? 5.262   6.103   -2.158  1.00 0.00 ? 21  ALA A CB   2  
ATOM 1983  H H    . ALA A 1 21  ? 6.919   4.223   -2.501  1.00 0.00 ? 21  ALA A H    2  
ATOM 1984  H HA   . ALA A 1 21  ? 7.159   6.986   -2.514  1.00 0.00 ? 21  ALA A HA   2  
ATOM 1985  H HB1  . ALA A 1 21  ? 4.727   6.905   -1.671  1.00 0.00 ? 21  ALA A HB1  2  
ATOM 1986  H HB2  . ALA A 1 21  ? 5.104   6.160   -3.224  1.00 0.00 ? 21  ALA A HB2  2  
ATOM 1987  H HB3  . ALA A 1 21  ? 4.902   5.154   -1.789  1.00 0.00 ? 21  ALA A HB3  2  
ATOM 1988  N N    . PRO A 1 22  ? 7.651   7.803   -0.231  1.00 0.00 ? 22  PRO A N    2  
ATOM 1989  C CA   . PRO A 1 22  ? 7.939   8.351   1.098   1.00 0.00 ? 22  PRO A CA   2  
ATOM 1990  C C    . PRO A 1 22  ? 6.688   8.883   1.789   1.00 0.00 ? 22  PRO A C    2  
ATOM 1991  O O    . PRO A 1 22  ? 5.586   8.801   1.248   1.00 0.00 ? 22  PRO A O    2  
ATOM 1992  C CB   . PRO A 1 22  ? 8.916   9.493   0.807   1.00 0.00 ? 22  PRO A CB   2  
ATOM 1993  C CG   . PRO A 1 22  ? 8.619   9.898   -0.595  1.00 0.00 ? 22  PRO A CG   2  
ATOM 1994  C CD   . PRO A 1 22  ? 8.201   8.642   -1.309  1.00 0.00 ? 22  PRO A CD   2  
ATOM 1995  H HA   . PRO A 1 22  ? 8.416   7.620   1.734   1.00 0.00 ? 22  PRO A HA   2  
ATOM 1996  H HB2  . PRO A 1 22  ? 8.741   10.305  1.499   1.00 0.00 ? 22  PRO A HB2  2  
ATOM 1997  H HB3  . PRO A 1 22  ? 9.931   9.138   0.909   1.00 0.00 ? 22  PRO A HB3  2  
ATOM 1998  H HG2  . PRO A 1 22  ? 7.817   10.620  -0.607  1.00 0.00 ? 22  PRO A HG2  2  
ATOM 1999  H HG3  . PRO A 1 22  ? 9.505   10.311  -1.053  1.00 0.00 ? 22  PRO A HG3  2  
ATOM 2000  H HD2  . PRO A 1 22  ? 7.447   8.862   -2.050  1.00 0.00 ? 22  PRO A HD2  2  
ATOM 2001  H HD3  . PRO A 1 22  ? 9.056   8.167   -1.768  1.00 0.00 ? 22  PRO A HD3  2  
ATOM 2002  N N    . ASN A 1 23  ? 6.867   9.430   2.987   1.00 0.00 ? 23  ASN A N    2  
ATOM 2003  C CA   . ASN A 1 23  ? 5.752   9.976   3.752   1.00 0.00 ? 23  ASN A CA   2  
ATOM 2004  C C    . ASN A 1 23  ? 4.526   9.074   3.646   1.00 0.00 ? 23  ASN A C    2  
ATOM 2005  O O    . ASN A 1 23  ? 3.421   9.540   3.363   1.00 0.00 ? 23  ASN A O    2  
ATOM 2006  C CB   . ASN A 1 23  ? 5.408   11.383  3.259   1.00 0.00 ? 23  ASN A CB   2  
ATOM 2007  C CG   . ASN A 1 23  ? 6.587   12.332  3.350   1.00 0.00 ? 23  ASN A CG   2  
ATOM 2008  O OD1  . ASN A 1 23  ? 7.545   12.081  4.082   1.00 0.00 ? 23  ASN A OD1  2  
ATOM 2009  N ND2  . ASN A 1 23  ? 6.522   13.430  2.605   1.00 0.00 ? 23  ASN A ND2  2  
ATOM 2010  H H    . ASN A 1 23  ? 7.770   9.467   3.367   1.00 0.00 ? 23  ASN A H    2  
ATOM 2011  H HA   . ASN A 1 23  ? 6.055   10.031  4.787   1.00 0.00 ? 23  ASN A HA   2  
ATOM 2012  H HB2  . ASN A 1 23  ? 5.094   11.329  2.227   1.00 0.00 ? 23  ASN A HB2  2  
ATOM 2013  H HB3  . ASN A 1 23  ? 4.602   11.781  3.856   1.00 0.00 ? 23  ASN A HB3  2  
ATOM 2014  H HD21 . ASN A 1 23  ? 5.728   13.564  2.047   1.00 0.00 ? 23  ASN A HD21 2  
ATOM 2015  H HD22 . ASN A 1 23  ? 7.271   14.060  2.645   1.00 0.00 ? 23  ASN A HD22 2  
ATOM 2016  N N    . LEU A 1 24  ? 4.728   7.781   3.875   1.00 0.00 ? 24  LEU A N    2  
ATOM 2017  C CA   . LEU A 1 24  ? 3.639   6.813   3.807   1.00 0.00 ? 24  LEU A CA   2  
ATOM 2018  C C    . LEU A 1 24  ? 2.756   6.897   5.048   1.00 0.00 ? 24  LEU A C    2  
ATOM 2019  O O    . LEU A 1 24  ? 3.113   6.389   6.111   1.00 0.00 ? 24  LEU A O    2  
ATOM 2020  C CB   . LEU A 1 24  ? 4.199   5.397   3.660   1.00 0.00 ? 24  LEU A CB   2  
ATOM 2021  C CG   . LEU A 1 24  ? 3.179   4.302   3.345   1.00 0.00 ? 24  LEU A CG   2  
ATOM 2022  C CD1  . LEU A 1 24  ? 2.417   4.633   2.071   1.00 0.00 ? 24  LEU A CD1  2  
ATOM 2023  C CD2  . LEU A 1 24  ? 3.869   2.951   3.219   1.00 0.00 ? 24  LEU A CD2  2  
ATOM 2024  H H    . LEU A 1 24  ? 5.630   7.470   4.096   1.00 0.00 ? 24  LEU A H    2  
ATOM 2025  H HA   . LEU A 1 24  ? 3.042   7.047   2.938   1.00 0.00 ? 24  LEU A HA   2  
ATOM 2026  H HB2  . LEU A 1 24  ? 4.927   5.410   2.864   1.00 0.00 ? 24  LEU A HB2  2  
ATOM 2027  H HB3  . LEU A 1 24  ? 4.688   5.137   4.588   1.00 0.00 ? 24  LEU A HB3  2  
ATOM 2028  H HG   . LEU A 1 24  ? 2.465   4.239   4.154   1.00 0.00 ? 24  LEU A HG   2  
ATOM 2029  H HD11 . LEU A 1 24  ? 2.991   5.330   1.479   1.00 0.00 ? 24  LEU A HD11 2  
ATOM 2030  H HD12 . LEU A 1 24  ? 1.465   5.077   2.327   1.00 0.00 ? 24  LEU A HD12 2  
ATOM 2031  H HD13 . LEU A 1 24  ? 2.251   3.728   1.505   1.00 0.00 ? 24  LEU A HD13 2  
ATOM 2032  H HD21 . LEU A 1 24  ? 4.206   2.627   4.192   1.00 0.00 ? 24  LEU A HD21 2  
ATOM 2033  H HD22 . LEU A 1 24  ? 4.718   3.041   2.556   1.00 0.00 ? 24  LEU A HD22 2  
ATOM 2034  H HD23 . LEU A 1 24  ? 3.174   2.228   2.819   1.00 0.00 ? 24  LEU A HD23 2  
ATOM 2035  N N    . ARG A 1 25  ? 1.602   7.540   4.904   1.00 0.00 ? 25  ARG A N    2  
ATOM 2036  C CA   . ARG A 1 25  ? 0.668   7.690   6.013   1.00 0.00 ? 25  ARG A CA   2  
ATOM 2037  C C    . ARG A 1 25  ? -0.744  7.290   5.592   1.00 0.00 ? 25  ARG A C    2  
ATOM 2038  O O    . ARG A 1 25  ? -1.226  7.698   4.536   1.00 0.00 ? 25  ARG A O    2  
ATOM 2039  C CB   . ARG A 1 25  ? 0.671   9.133   6.519   1.00 0.00 ? 25  ARG A CB   2  
ATOM 2040  C CG   . ARG A 1 25  ? 0.992   10.156  5.441   1.00 0.00 ? 25  ARG A CG   2  
ATOM 2041  C CD   . ARG A 1 25  ? 1.688   11.377  6.022   1.00 0.00 ? 25  ARG A CD   2  
ATOM 2042  N NE   . ARG A 1 25  ? 0.735   12.346  6.558   1.00 0.00 ? 25  ARG A NE   2  
ATOM 2043  C CZ   . ARG A 1 25  ? 1.067   13.307  7.413   1.00 0.00 ? 25  ARG A CZ   2  
ATOM 2044  N NH1  . ARG A 1 25  ? 2.320   13.426  7.828   1.00 0.00 ? 25  ARG A NH1  2  
ATOM 2045  N NH2  . ARG A 1 25  ? 0.143   14.151  7.856   1.00 0.00 ? 25  ARG A NH2  2  
ATOM 2046  H H    . ARG A 1 25  ? 1.374   7.924   4.031   1.00 0.00 ? 25  ARG A H    2  
ATOM 2047  H HA   . ARG A 1 25  ? 0.991   7.037   6.810   1.00 0.00 ? 25  ARG A HA   2  
ATOM 2048  H HB2  . ARG A 1 25  ? -0.304  9.363   6.923   1.00 0.00 ? 25  ARG A HB2  2  
ATOM 2049  H HB3  . ARG A 1 25  ? 1.407   9.225   7.303   1.00 0.00 ? 25  ARG A HB3  2  
ATOM 2050  H HG2  . ARG A 1 25  ? 1.641   9.701   4.708   1.00 0.00 ? 25  ARG A HG2  2  
ATOM 2051  H HG3  . ARG A 1 25  ? 0.073   10.467  4.968   1.00 0.00 ? 25  ARG A HG3  2  
ATOM 2052  H HD2  . ARG A 1 25  ? 2.345   11.057  6.816   1.00 0.00 ? 25  ARG A HD2  2  
ATOM 2053  H HD3  . ARG A 1 25  ? 2.268   11.849  5.243   1.00 0.00 ? 25  ARG A HD3  2  
ATOM 2054  H HE   . ARG A 1 25  ? -0.197  12.277  6.264   1.00 0.00 ? 25  ARG A HE   2  
ATOM 2055  H HH11 . ARG A 1 25  ? 3.019   12.792  7.496   1.00 0.00 ? 25  ARG A HH11 2  
ATOM 2056  H HH12 . ARG A 1 25  ? 2.568   14.150  8.472   1.00 0.00 ? 25  ARG A HH12 2  
ATOM 2057  H HH21 . ARG A 1 25  ? -0.803  14.064  7.545   1.00 0.00 ? 25  ARG A HH21 2  
ATOM 2058  H HH22 . ARG A 1 25  ? 0.394   14.873  8.500   1.00 0.00 ? 25  ARG A HH22 2  
ATOM 2059  N N    . ALA A 1 26  ? -1.399  6.489   6.425   1.00 0.00 ? 26  ALA A N    2  
ATOM 2060  C CA   . ALA A 1 26  ? -2.755  6.035   6.141   1.00 0.00 ? 26  ALA A CA   2  
ATOM 2061  C C    . ALA A 1 26  ? -3.657  6.202   7.359   1.00 0.00 ? 26  ALA A C    2  
ATOM 2062  O O    . ALA A 1 26  ? -3.282  5.842   8.475   1.00 0.00 ? 26  ALA A O    2  
ATOM 2063  C CB   . ALA A 1 26  ? -2.741  4.583   5.687   1.00 0.00 ? 26  ALA A CB   2  
ATOM 2064  H H    . ALA A 1 26  ? -0.961  6.197   7.251   1.00 0.00 ? 26  ALA A H    2  
ATOM 2065  H HA   . ALA A 1 26  ? -3.145  6.636   5.331   1.00 0.00 ? 26  ALA A HA   2  
ATOM 2066  H HB1  . ALA A 1 26  ? -2.846  3.937   6.547   1.00 0.00 ? 26  ALA A HB1  2  
ATOM 2067  H HB2  . ALA A 1 26  ? -3.561  4.411   5.006   1.00 0.00 ? 26  ALA A HB2  2  
ATOM 2068  H HB3  . ALA A 1 26  ? -1.807  4.370   5.188   1.00 0.00 ? 26  ALA A HB3  2  
ATOM 2069  N N    . TYR A 1 27  ? -4.846  6.751   7.137   1.00 0.00 ? 27  TYR A N    2  
ATOM 2070  C CA   . TYR A 1 27  ? -5.800  6.969   8.218   1.00 0.00 ? 27  TYR A CA   2  
ATOM 2071  C C    . TYR A 1 27  ? -7.189  6.473   7.827   1.00 0.00 ? 27  TYR A C    2  
ATOM 2072  O O    . TYR A 1 27  ? -7.646  6.692   6.706   1.00 0.00 ? 27  TYR A O    2  
ATOM 2073  C CB   . TYR A 1 27  ? -5.861  8.454   8.581   1.00 0.00 ? 27  TYR A CB   2  
ATOM 2074  C CG   . TYR A 1 27  ? -6.083  9.360   7.391   1.00 0.00 ? 27  TYR A CG   2  
ATOM 2075  C CD1  . TYR A 1 27  ? -7.348  9.514   6.837   1.00 0.00 ? 27  TYR A CD1  2  
ATOM 2076  C CD2  . TYR A 1 27  ? -5.028  10.061  6.820   1.00 0.00 ? 27  TYR A CD2  2  
ATOM 2077  C CE1  . TYR A 1 27  ? -7.555  10.340  5.749   1.00 0.00 ? 27  TYR A CE1  2  
ATOM 2078  C CE2  . TYR A 1 27  ? -5.226  10.890  5.733   1.00 0.00 ? 27  TYR A CE2  2  
ATOM 2079  C CZ   . TYR A 1 27  ? -6.491  11.026  5.201   1.00 0.00 ? 27  TYR A CZ   2  
ATOM 2080  O OH   . TYR A 1 27  ? -6.692  11.850  4.118   1.00 0.00 ? 27  TYR A OH   2  
ATOM 2081  H H    . TYR A 1 27  ? -5.088  7.018   6.226   1.00 0.00 ? 27  TYR A H    2  
ATOM 2082  H HA   . TYR A 1 27  ? -5.460  6.412   9.078   1.00 0.00 ? 27  TYR A HA   2  
ATOM 2083  H HB2  . TYR A 1 27  ? -6.672  8.615   9.275   1.00 0.00 ? 27  TYR A HB2  2  
ATOM 2084  H HB3  . TYR A 1 27  ? -4.931  8.742   9.049   1.00 0.00 ? 27  TYR A HB3  2  
ATOM 2085  H HD1  . TYR A 1 27  ? -8.179  8.975   7.268   1.00 0.00 ? 27  TYR A HD1  2  
ATOM 2086  H HD2  . TYR A 1 27  ? -4.038  9.951   7.239   1.00 0.00 ? 27  TYR A HD2  2  
ATOM 2087  H HE1  . TYR A 1 27  ? -8.545  10.447  5.332   1.00 0.00 ? 27  TYR A HE1  2  
ATOM 2088  H HE2  . TYR A 1 27  ? -4.393  11.427  5.304   1.00 0.00 ? 27  TYR A HE2  2  
ATOM 2089  H HH   . TYR A 1 27  ? -6.009  11.690  3.463   1.00 0.00 ? 27  TYR A HH   2  
ATOM 2090  N N    . ALA A 1 28  ? -7.855  5.802   8.761   1.00 0.00 ? 28  ALA A N    2  
ATOM 2091  C CA   . ALA A 1 28  ? -9.192  5.276   8.517   1.00 0.00 ? 28  ALA A CA   2  
ATOM 2092  C C    . ALA A 1 28  ? -10.232 6.391   8.532   1.00 0.00 ? 28  ALA A C    2  
ATOM 2093  O O    . ALA A 1 28  ? -10.534 6.956   9.583   1.00 0.00 ? 28  ALA A O    2  
ATOM 2094  C CB   . ALA A 1 28  ? -9.538  4.214   9.551   1.00 0.00 ? 28  ALA A CB   2  
ATOM 2095  H H    . ALA A 1 28  ? -7.437  5.659   9.636   1.00 0.00 ? 28  ALA A H    2  
ATOM 2096  H HA   . ALA A 1 28  ? -9.194  4.809   7.543   1.00 0.00 ? 28  ALA A HA   2  
ATOM 2097  H HB1  . ALA A 1 28  ? -10.586 3.961   9.468   1.00 0.00 ? 28  ALA A HB1  2  
ATOM 2098  H HB2  . ALA A 1 28  ? -8.939  3.333   9.376   1.00 0.00 ? 28  ALA A HB2  2  
ATOM 2099  H HB3  . ALA A 1 28  ? -9.338  4.597   10.540  1.00 0.00 ? 28  ALA A HB3  2  
ATOM 2100  N N    . ALA A 1 29  ? -10.775 6.703   7.360   1.00 0.00 ? 29  ALA A N    2  
ATOM 2101  C CA   . ALA A 1 29  ? -11.782 7.750   7.240   1.00 0.00 ? 29  ALA A CA   2  
ATOM 2102  C C    . ALA A 1 29  ? -13.111 7.305   7.840   1.00 0.00 ? 29  ALA A C    2  
ATOM 2103  O O    . ALA A 1 29  ? -13.901 8.128   8.303   1.00 0.00 ? 29  ALA A O    2  
ATOM 2104  C CB   . ALA A 1 29  ? -11.965 8.141   5.781   1.00 0.00 ? 29  ALA A CB   2  
ATOM 2105  H H    . ALA A 1 29  ? -10.493 6.217   6.558   1.00 0.00 ? 29  ALA A H    2  
ATOM 2106  H HA   . ALA A 1 29  ? -11.428 8.618   7.778   1.00 0.00 ? 29  ALA A HA   2  
ATOM 2107  H HB1  . ALA A 1 29  ? -12.536 9.057   5.723   1.00 0.00 ? 29  ALA A HB1  2  
ATOM 2108  H HB2  . ALA A 1 29  ? -10.998 8.291   5.325   1.00 0.00 ? 29  ALA A HB2  2  
ATOM 2109  H HB3  . ALA A 1 29  ? -12.491 7.355   5.261   1.00 0.00 ? 29  ALA A HB3  2  
ATOM 2110  N N    . SER A 1 30  ? -13.353 5.998   7.829   1.00 0.00 ? 30  SER A N    2  
ATOM 2111  C CA   . SER A 1 30  ? -14.589 5.444   8.369   1.00 0.00 ? 30  SER A CA   2  
ATOM 2112  C C    . SER A 1 30  ? -14.366 4.029   8.894   1.00 0.00 ? 30  SER A C    2  
ATOM 2113  O O    . SER A 1 30  ? -13.390 3.360   8.555   1.00 0.00 ? 30  SER A O    2  
ATOM 2114  C CB   . SER A 1 30  ? -15.680 5.437   7.296   1.00 0.00 ? 30  SER A CB   2  
ATOM 2115  O OG   . SER A 1 30  ? -16.430 6.639   7.323   1.00 0.00 ? 30  SER A OG   2  
ATOM 2116  H H    . SER A 1 30  ? -12.684 5.392   7.446   1.00 0.00 ? 30  SER A H    2  
ATOM 2117  H HA   . SER A 1 30  ? -14.905 6.074   9.187   1.00 0.00 ? 30  SER A HA   2  
ATOM 2118  H HB2  . SER A 1 30  ? -15.224 5.332   6.324   1.00 0.00 ? 30  SER A HB2  2  
ATOM 2119  H HB3  . SER A 1 30  ? -16.348 4.605   7.472   1.00 0.00 ? 30  SER A HB3  2  
ATOM 2120  H HG   . SER A 1 30  ? -15.833 7.387   7.397   1.00 0.00 ? 30  SER A HG   2  
ATOM 2121  N N    . PRO A 1 31  ? -15.294 3.561   9.742   1.00 0.00 ? 31  PRO A N    2  
ATOM 2122  C CA   . PRO A 1 31  ? -15.223 2.221   10.333  1.00 0.00 ? 31  PRO A CA   2  
ATOM 2123  C C    . PRO A 1 31  ? -15.466 1.121   9.305   1.00 0.00 ? 31  PRO A C    2  
ATOM 2124  O O    . PRO A 1 31  ? -15.452 -0.065  9.635   1.00 0.00 ? 31  PRO A O    2  
ATOM 2125  C CB   . PRO A 1 31  ? -16.341 2.234   11.378  1.00 0.00 ? 31  PRO A CB   2  
ATOM 2126  C CG   . PRO A 1 31  ? -17.308 3.255   10.885  1.00 0.00 ? 31  PRO A CG   2  
ATOM 2127  C CD   . PRO A 1 31  ? -16.484 4.304   10.190  1.00 0.00 ? 31  PRO A CD   2  
ATOM 2128  H HA   . PRO A 1 31  ? -14.274 2.053   10.821  1.00 0.00 ? 31  PRO A HA   2  
ATOM 2129  H HB2  . PRO A 1 31  ? -16.795 1.255   11.435  1.00 0.00 ? 31  PRO A HB2  2  
ATOM 2130  H HB3  . PRO A 1 31  ? -15.936 2.507   12.341  1.00 0.00 ? 31  PRO A HB3  2  
ATOM 2131  H HG2  . PRO A 1 31  ? -18.000 2.802   10.192  1.00 0.00 ? 31  PRO A HG2  2  
ATOM 2132  H HG3  . PRO A 1 31  ? -17.840 3.689   11.719  1.00 0.00 ? 31  PRO A HG3  2  
ATOM 2133  H HD2  . PRO A 1 31  ? -17.024 4.710   9.347   1.00 0.00 ? 31  PRO A HD2  2  
ATOM 2134  H HD3  . PRO A 1 31  ? -16.212 5.088   10.880  1.00 0.00 ? 31  PRO A HD3  2  
ATOM 2135  N N    . THR A 1 32  ? -15.689 1.522   8.058   1.00 0.00 ? 32  THR A N    2  
ATOM 2136  C CA   . THR A 1 32  ? -15.936 0.570   6.982   1.00 0.00 ? 32  THR A CA   2  
ATOM 2137  C C    . THR A 1 32  ? -15.040 0.852   5.781   1.00 0.00 ? 32  THR A C    2  
ATOM 2138  O O    . THR A 1 32  ? -15.068 0.124   4.789   1.00 0.00 ? 32  THR A O    2  
ATOM 2139  C CB   . THR A 1 32  ? -17.408 0.604   6.529   1.00 0.00 ? 32  THR A CB   2  
ATOM 2140  O OG1  . THR A 1 32  ? -17.732 1.900   6.014   1.00 0.00 ? 32  THR A OG1  2  
ATOM 2141  C CG2  . THR A 1 32  ? -18.337 0.264   7.684   1.00 0.00 ? 32  THR A CG2  2  
ATOM 2142  H H    . THR A 1 32  ? -15.687 2.481   7.857   1.00 0.00 ? 32  THR A H    2  
ATOM 2143  H HA   . THR A 1 32  ? -15.719 -0.420  7.356   1.00 0.00 ? 32  THR A HA   2  
ATOM 2144  H HB   . THR A 1 32  ? -17.545 -0.130  5.748   1.00 0.00 ? 32  THR A HB   2  
ATOM 2145  H HG1  . THR A 1 32  ? -17.173 2.560   6.432   1.00 0.00 ? 32  THR A HG1  2  
ATOM 2146  H HG21 . THR A 1 32  ? -18.116 -0.729  8.044   1.00 0.00 ? 32  THR A HG21 2  
ATOM 2147  H HG22 . THR A 1 32  ? -19.362 0.305   7.345   1.00 0.00 ? 32  THR A HG22 2  
ATOM 2148  H HG23 . THR A 1 32  ? -18.194 0.977   8.482   1.00 0.00 ? 32  THR A HG23 2  
ATOM 2149  N N    . SER A 1 33  ? -14.245 1.913   5.878   1.00 0.00 ? 33  SER A N    2  
ATOM 2150  C CA   . SER A 1 33  ? -13.342 2.294   4.798   1.00 0.00 ? 33  SER A CA   2  
ATOM 2151  C C    . SER A 1 33  ? -12.011 2.792   5.353   1.00 0.00 ? 33  SER A C    2  
ATOM 2152  O O    . SER A 1 33  ? -11.844 2.929   6.565   1.00 0.00 ? 33  SER A O    2  
ATOM 2153  C CB   . SER A 1 33  ? -13.982 3.376   3.927   1.00 0.00 ? 33  SER A CB   2  
ATOM 2154  O OG   . SER A 1 33  ? -13.774 4.664   4.479   1.00 0.00 ? 33  SER A OG   2  
ATOM 2155  H H    . SER A 1 33  ? -14.269 2.455   6.695   1.00 0.00 ? 33  SER A H    2  
ATOM 2156  H HA   . SER A 1 33  ? -13.161 1.417   4.194   1.00 0.00 ? 33  SER A HA   2  
ATOM 2157  H HB2  . SER A 1 33  ? -13.546 3.345   2.941   1.00 0.00 ? 33  SER A HB2  2  
ATOM 2158  H HB3  . SER A 1 33  ? -15.045 3.195   3.856   1.00 0.00 ? 33  SER A HB3  2  
ATOM 2159  H HG   . SER A 1 33  ? -12.859 4.925   4.348   1.00 0.00 ? 33  SER A HG   2  
ATOM 2160  N N    . ILE A 1 34  ? -11.068 3.062   4.457   1.00 0.00 ? 34  ILE A N    2  
ATOM 2161  C CA   . ILE A 1 34  ? -9.753  3.547   4.856   1.00 0.00 ? 34  ILE A CA   2  
ATOM 2162  C C    . ILE A 1 34  ? -9.133  4.416   3.766   1.00 0.00 ? 34  ILE A C    2  
ATOM 2163  O O    . ILE A 1 34  ? -9.120  4.044   2.592   1.00 0.00 ? 34  ILE A O    2  
ATOM 2164  C CB   . ILE A 1 34  ? -8.796  2.382   5.173   1.00 0.00 ? 34  ILE A CB   2  
ATOM 2165  C CG1  . ILE A 1 34  ? -9.274  1.625   6.414   1.00 0.00 ? 34  ILE A CG1  2  
ATOM 2166  C CG2  . ILE A 1 34  ? -7.380  2.900   5.374   1.00 0.00 ? 34  ILE A CG2  2  
ATOM 2167  C CD1  . ILE A 1 34  ? -8.510  0.345   6.672   1.00 0.00 ? 34  ILE A CD1  2  
ATOM 2168  H H    . ILE A 1 34  ? -11.262 2.933   3.505   1.00 0.00 ? 34  ILE A H    2  
ATOM 2169  H HA   . ILE A 1 34  ? -9.874  4.141   5.750   1.00 0.00 ? 34  ILE A HA   2  
ATOM 2170  H HB   . ILE A 1 34  ? -8.791  1.709   4.329   1.00 0.00 ? 34  ILE A HB   2  
ATOM 2171  H HG12 . ILE A 1 34  ? -9.161  2.258   7.280   1.00 0.00 ? 34  ILE A HG12 2  
ATOM 2172  H HG13 . ILE A 1 34  ? -10.317 1.371   6.292   1.00 0.00 ? 34  ILE A HG13 2  
ATOM 2173  H HG21 . ILE A 1 34  ? -7.415  3.930   5.696   1.00 0.00 ? 34  ILE A HG21 2  
ATOM 2174  H HG22 . ILE A 1 34  ? -6.883  2.305   6.127   1.00 0.00 ? 34  ILE A HG22 2  
ATOM 2175  H HG23 . ILE A 1 34  ? -6.836  2.832   4.444   1.00 0.00 ? 34  ILE A HG23 2  
ATOM 2176  H HD11 . ILE A 1 34  ? -9.106  -0.500  6.362   1.00 0.00 ? 34  ILE A HD11 2  
ATOM 2177  H HD12 . ILE A 1 34  ? -7.585  0.359   6.116   1.00 0.00 ? 34  ILE A HD12 2  
ATOM 2178  H HD13 . ILE A 1 34  ? -8.293  0.263   7.728   1.00 0.00 ? 34  ILE A HD13 2  
ATOM 2179  N N    . THR A 1 35  ? -8.619  5.576   4.163   1.00 0.00 ? 35  THR A N    2  
ATOM 2180  C CA   . THR A 1 35  ? -7.997  6.498   3.221   1.00 0.00 ? 35  THR A CA   2  
ATOM 2181  C C    . THR A 1 35  ? -6.478  6.468   3.344   1.00 0.00 ? 35  THR A C    2  
ATOM 2182  O O    . THR A 1 35  ? -5.903  7.108   4.225   1.00 0.00 ? 35  THR A O    2  
ATOM 2183  C CB   . THR A 1 35  ? -8.490  7.941   3.439   1.00 0.00 ? 35  THR A CB   2  
ATOM 2184  O OG1  . THR A 1 35  ? -9.903  8.014   3.219   1.00 0.00 ? 35  THR A OG1  2  
ATOM 2185  C CG2  . THR A 1 35  ? -7.775  8.904   2.503   1.00 0.00 ? 35  THR A CG2  2  
ATOM 2186  H H    . THR A 1 35  ? -8.660  5.816   5.112   1.00 0.00 ? 35  THR A H    2  
ATOM 2187  H HA   . THR A 1 35  ? -8.273  6.192   2.223   1.00 0.00 ? 35  THR A HA   2  
ATOM 2188  H HB   . THR A 1 35  ? -8.277  8.228   4.459   1.00 0.00 ? 35  THR A HB   2  
ATOM 2189  H HG1  . THR A 1 35  ? -10.073 8.223   2.297   1.00 0.00 ? 35  THR A HG1  2  
ATOM 2190  H HG21 . THR A 1 35  ? -8.501  9.537   2.015   1.00 0.00 ? 35  THR A HG21 2  
ATOM 2191  H HG22 . THR A 1 35  ? -7.227  8.344   1.760   1.00 0.00 ? 35  THR A HG22 2  
ATOM 2192  H HG23 . THR A 1 35  ? -7.090  9.515   3.071   1.00 0.00 ? 35  THR A HG23 2  
ATOM 2193  N N    . VAL A 1 36  ? -5.831  5.721   2.455   1.00 0.00 ? 36  VAL A N    2  
ATOM 2194  C CA   . VAL A 1 36  ? -4.377  5.610   2.463   1.00 0.00 ? 36  VAL A CA   2  
ATOM 2195  C C    . VAL A 1 36  ? -3.736  6.714   1.630   1.00 0.00 ? 36  VAL A C    2  
ATOM 2196  O O    . VAL A 1 36  ? -4.207  7.036   0.538   1.00 0.00 ? 36  VAL A O    2  
ATOM 2197  C CB   . VAL A 1 36  ? -3.916  4.242   1.925   1.00 0.00 ? 36  VAL A CB   2  
ATOM 2198  C CG1  . VAL A 1 36  ? -2.423  4.056   2.150   1.00 0.00 ? 36  VAL A CG1  2  
ATOM 2199  C CG2  . VAL A 1 36  ? -4.706  3.119   2.580   1.00 0.00 ? 36  VAL A CG2  2  
ATOM 2200  H H    . VAL A 1 36  ? -6.343  5.234   1.777   1.00 0.00 ? 36  VAL A H    2  
ATOM 2201  H HA   . VAL A 1 36  ? -4.041  5.703   3.486   1.00 0.00 ? 36  VAL A HA   2  
ATOM 2202  H HB   . VAL A 1 36  ? -4.104  4.214   0.862   1.00 0.00 ? 36  VAL A HB   2  
ATOM 2203  H HG11 . VAL A 1 36  ? -2.112  4.638   3.004   1.00 0.00 ? 36  VAL A HG11 2  
ATOM 2204  H HG12 . VAL A 1 36  ? -2.213  3.011   2.329   1.00 0.00 ? 36  VAL A HG12 2  
ATOM 2205  H HG13 . VAL A 1 36  ? -1.884  4.387   1.274   1.00 0.00 ? 36  VAL A HG13 2  
ATOM 2206  H HG21 . VAL A 1 36  ? -5.759  3.355   2.548   1.00 0.00 ? 36  VAL A HG21 2  
ATOM 2207  H HG22 . VAL A 1 36  ? -4.528  2.196   2.047   1.00 0.00 ? 36  VAL A HG22 2  
ATOM 2208  H HG23 . VAL A 1 36  ? -4.392  3.008   3.607   1.00 0.00 ? 36  VAL A HG23 2  
ATOM 2209  N N    . THR A 1 37  ? -2.658  7.291   2.150   1.00 0.00 ? 37  THR A N    2  
ATOM 2210  C CA   . THR A 1 37  ? -1.952  8.360   1.455   1.00 0.00 ? 37  THR A CA   2  
ATOM 2211  C C    . THR A 1 37  ? -0.469  8.037   1.311   1.00 0.00 ? 37  THR A C    2  
ATOM 2212  O O    . THR A 1 37  ? 0.082   7.251   2.082   1.00 0.00 ? 37  THR A O    2  
ATOM 2213  C CB   . THR A 1 37  ? -2.104  9.705   2.191   1.00 0.00 ? 37  THR A CB   2  
ATOM 2214  O OG1  . THR A 1 37  ? -1.036  9.872   3.130   1.00 0.00 ? 37  THR A OG1  2  
ATOM 2215  C CG2  . THR A 1 37  ? -3.440  9.778   2.915   1.00 0.00 ? 37  THR A CG2  2  
ATOM 2216  H H    . THR A 1 37  ? -2.331  6.990   3.024   1.00 0.00 ? 37  THR A H    2  
ATOM 2217  H HA   . THR A 1 37  ? -2.386  8.461   0.471   1.00 0.00 ? 37  THR A HA   2  
ATOM 2218  H HB   . THR A 1 37  ? -2.062  10.503  1.463   1.00 0.00 ? 37  THR A HB   2  
ATOM 2219  H HG1  . THR A 1 37  ? -0.731  9.011   3.425   1.00 0.00 ? 37  THR A HG1  2  
ATOM 2220  H HG21 . THR A 1 37  ? -4.146  9.117   2.434   1.00 0.00 ? 37  THR A HG21 2  
ATOM 2221  H HG22 . THR A 1 37  ? -3.813  10.791  2.881   1.00 0.00 ? 37  THR A HG22 2  
ATOM 2222  H HG23 . THR A 1 37  ? -3.308  9.476   3.943   1.00 0.00 ? 37  THR A HG23 2  
ATOM 2223  N N    . TRP A 1 38  ? 0.171   8.647   0.321   1.00 0.00 ? 38  TRP A N    2  
ATOM 2224  C CA   . TRP A 1 38  ? 1.591   8.424   0.077   1.00 0.00 ? 38  TRP A CA   2  
ATOM 2225  C C    . TRP A 1 38  ? 2.169   9.519   -0.813  1.00 0.00 ? 38  TRP A C    2  
ATOM 2226  O O    . TRP A 1 38  ? 1.438   10.188  -1.542  1.00 0.00 ? 38  TRP A O    2  
ATOM 2227  C CB   . TRP A 1 38  ? 1.810   7.056   -0.570  1.00 0.00 ? 38  TRP A CB   2  
ATOM 2228  C CG   . TRP A 1 38  ? 1.043   6.872   -1.845  1.00 0.00 ? 38  TRP A CG   2  
ATOM 2229  C CD1  . TRP A 1 38  ? 1.481   7.138   -3.110  1.00 0.00 ? 38  TRP A CD1  2  
ATOM 2230  C CD2  . TRP A 1 38  ? -0.296  6.384   -1.976  1.00 0.00 ? 38  TRP A CD2  2  
ATOM 2231  N NE1  . TRP A 1 38  ? 0.495   6.845   -4.021  1.00 0.00 ? 38  TRP A NE1  2  
ATOM 2232  C CE2  . TRP A 1 38  ? -0.605  6.379   -3.350  1.00 0.00 ? 38  TRP A CE2  2  
ATOM 2233  C CE3  . TRP A 1 38  ? -1.264  5.947   -1.067  1.00 0.00 ? 38  TRP A CE3  2  
ATOM 2234  C CZ2  . TRP A 1 38  ? -1.841  5.957   -3.834  1.00 0.00 ? 38  TRP A CZ2  2  
ATOM 2235  C CZ3  . TRP A 1 38  ? -2.490  5.529   -1.549  1.00 0.00 ? 38  TRP A CZ3  2  
ATOM 2236  C CH2  . TRP A 1 38  ? -2.769  5.536   -2.922  1.00 0.00 ? 38  TRP A CH2  2  
ATOM 2237  H H    . TRP A 1 38  ? -0.323  9.263   -0.261  1.00 0.00 ? 38  TRP A H    2  
ATOM 2238  H HA   . TRP A 1 38  ? 2.098   8.447   1.031   1.00 0.00 ? 38  TRP A HA   2  
ATOM 2239  H HB2  . TRP A 1 38  ? 2.860   6.933   -0.792  1.00 0.00 ? 38  TRP A HB2  2  
ATOM 2240  H HB3  . TRP A 1 38  ? 1.499   6.286   0.121   1.00 0.00 ? 38  TRP A HB3  2  
ATOM 2241  H HD1  . TRP A 1 38  ? 2.461   7.525   -3.346  1.00 0.00 ? 38  TRP A HD1  2  
ATOM 2242  H HE1  . TRP A 1 38  ? 0.569   6.950   -4.993  1.00 0.00 ? 38  TRP A HE1  2  
ATOM 2243  H HE3  . TRP A 1 38  ? -1.067  5.935   -0.005  1.00 0.00 ? 38  TRP A HE3  2  
ATOM 2244  H HZ2  . TRP A 1 38  ? -2.071  5.956   -4.889  1.00 0.00 ? 38  TRP A HZ2  2  
ATOM 2245  H HZ3  . TRP A 1 38  ? -3.250  5.189   -0.861  1.00 0.00 ? 38  TRP A HZ3  2  
ATOM 2246  H HH2  . TRP A 1 38  ? -3.740  5.201   -3.253  1.00 0.00 ? 38  TRP A HH2  2  
ATOM 2247  N N    . GLU A 1 39  ? 3.485   9.696   -0.747  1.00 0.00 ? 39  GLU A N    2  
ATOM 2248  C CA   . GLU A 1 39  ? 4.160   10.712  -1.548  1.00 0.00 ? 39  GLU A CA   2  
ATOM 2249  C C    . GLU A 1 39  ? 4.992   10.068  -2.654  1.00 0.00 ? 39  GLU A C    2  
ATOM 2250  O O    . GLU A 1 39  ? 5.258   8.866   -2.628  1.00 0.00 ? 39  GLU A O    2  
ATOM 2251  C CB   . GLU A 1 39  ? 5.054   11.581  -0.661  1.00 0.00 ? 39  GLU A CB   2  
ATOM 2252  C CG   . GLU A 1 39  ? 4.351   12.807  -0.103  1.00 0.00 ? 39  GLU A CG   2  
ATOM 2253  C CD   . GLU A 1 39  ? 3.500   13.513  -1.140  1.00 0.00 ? 39  GLU A CD   2  
ATOM 2254  O OE1  . GLU A 1 39  ? 4.033   13.849  -2.218  1.00 0.00 ? 39  GLU A OE1  2  
ATOM 2255  O OE2  . GLU A 1 39  ? 2.299   13.730  -0.872  1.00 0.00 ? 39  GLU A OE2  2  
ATOM 2256  H H    . GLU A 1 39  ? 4.015   9.131   -0.146  1.00 0.00 ? 39  GLU A H    2  
ATOM 2257  H HA   . GLU A 1 39  ? 3.403   11.334  -2.000  1.00 0.00 ? 39  GLU A HA   2  
ATOM 2258  H HB2  . GLU A 1 39  ? 5.407   10.985  0.167   1.00 0.00 ? 39  GLU A HB2  2  
ATOM 2259  H HB3  . GLU A 1 39  ? 5.903   11.911  -1.242  1.00 0.00 ? 39  GLU A HB3  2  
ATOM 2260  H HG2  . GLU A 1 39  ? 3.716   12.501  0.714   1.00 0.00 ? 39  GLU A HG2  2  
ATOM 2261  H HG3  . GLU A 1 39  ? 5.096   13.498  0.261   1.00 0.00 ? 39  GLU A HG3  2  
ATOM 2262  N N    . THR A 1 40  ? 5.400   10.878  -3.626  1.00 0.00 ? 40  THR A N    2  
ATOM 2263  C CA   . THR A 1 40  ? 6.199   10.389  -4.742  1.00 0.00 ? 40  THR A CA   2  
ATOM 2264  C C    . THR A 1 40  ? 7.684   10.388  -4.396  1.00 0.00 ? 40  THR A C    2  
ATOM 2265  O O    . THR A 1 40  ? 8.222   11.357  -3.859  1.00 0.00 ? 40  THR A O    2  
ATOM 2266  C CB   . THR A 1 40  ? 5.980   11.242  -6.006  1.00 0.00 ? 40  THR A CB   2  
ATOM 2267  O OG1  . THR A 1 40  ? 4.612   11.158  -6.422  1.00 0.00 ? 40  THR A OG1  2  
ATOM 2268  C CG2  . THR A 1 40  ? 6.888   10.779  -7.136  1.00 0.00 ? 40  THR A CG2  2  
ATOM 2269  H H    . THR A 1 40  ? 5.155   11.826  -3.591  1.00 0.00 ? 40  THR A H    2  
ATOM 2270  H HA   . THR A 1 40  ? 5.889   9.377   -4.957  1.00 0.00 ? 40  THR A HA   2  
ATOM 2271  H HB   . THR A 1 40  ? 6.215   12.271  -5.774  1.00 0.00 ? 40  THR A HB   2  
ATOM 2272  H HG1  . THR A 1 40  ? 4.378   11.949  -6.915  1.00 0.00 ? 40  THR A HG1  2  
ATOM 2273  H HG21 . THR A 1 40  ? 7.715   10.219  -6.726  1.00 0.00 ? 40  THR A HG21 2  
ATOM 2274  H HG22 . THR A 1 40  ? 7.264   11.638  -7.671  1.00 0.00 ? 40  THR A HG22 2  
ATOM 2275  H HG23 . THR A 1 40  ? 6.328   10.150  -7.812  1.00 0.00 ? 40  THR A HG23 2  
ATOM 2276  N N    . PRO A 1 41  ? 8.364   9.275   -4.709  1.00 0.00 ? 41  PRO A N    2  
ATOM 2277  C CA   . PRO A 1 41  ? 9.797   9.122   -4.441  1.00 0.00 ? 41  PRO A CA   2  
ATOM 2278  C C    . PRO A 1 41  ? 10.653  10.014  -5.333  1.00 0.00 ? 41  PRO A C    2  
ATOM 2279  O O    . PRO A 1 41  ? 10.760  9.785   -6.538  1.00 0.00 ? 41  PRO A O    2  
ATOM 2280  C CB   . PRO A 1 41  ? 10.060  7.646   -4.751  1.00 0.00 ? 41  PRO A CB   2  
ATOM 2281  C CG   . PRO A 1 41  ? 8.996   7.268   -5.722  1.00 0.00 ? 41  PRO A CG   2  
ATOM 2282  C CD   . PRO A 1 41  ? 7.787   8.082   -5.350  1.00 0.00 ? 41  PRO A CD   2  
ATOM 2283  H HA   . PRO A 1 41  ? 10.030  9.321   -3.405  1.00 0.00 ? 41  PRO A HA   2  
ATOM 2284  H HB2  . PRO A 1 41  ? 11.046  7.536   -5.181  1.00 0.00 ? 41  PRO A HB2  2  
ATOM 2285  H HB3  . PRO A 1 41  ? 9.990   7.066   -3.843  1.00 0.00 ? 41  PRO A HB3  2  
ATOM 2286  H HG2  . PRO A 1 41  ? 9.313   7.505   -6.726  1.00 0.00 ? 41  PRO A HG2  2  
ATOM 2287  H HG3  . PRO A 1 41  ? 8.778   6.213   -5.635  1.00 0.00 ? 41  PRO A HG3  2  
ATOM 2288  H HD2  . PRO A 1 41  ? 7.227   8.351   -6.233  1.00 0.00 ? 41  PRO A HD2  2  
ATOM 2289  H HD3  . PRO A 1 41  ? 7.164   7.536   -4.657  1.00 0.00 ? 41  PRO A HD3  2  
ATOM 2290  N N    . VAL A 1 42  ? 11.262  11.033  -4.734  1.00 0.00 ? 42  VAL A N    2  
ATOM 2291  C CA   . VAL A 1 42  ? 12.110  11.959  -5.474  1.00 0.00 ? 42  VAL A CA   2  
ATOM 2292  C C    . VAL A 1 42  ? 13.088  11.211  -6.373  1.00 0.00 ? 42  VAL A C    2  
ATOM 2293  O O    . VAL A 1 42  ? 13.321  11.602  -7.516  1.00 0.00 ? 42  VAL A O    2  
ATOM 2294  C CB   . VAL A 1 42  ? 12.902  12.877  -4.524  1.00 0.00 ? 42  VAL A CB   2  
ATOM 2295  C CG1  . VAL A 1 42  ? 11.960  13.611  -3.582  1.00 0.00 ? 42  VAL A CG1  2  
ATOM 2296  C CG2  . VAL A 1 42  ? 13.931  12.074  -3.744  1.00 0.00 ? 42  VAL A CG2  2  
ATOM 2297  H H    . VAL A 1 42  ? 11.138  11.164  -3.771  1.00 0.00 ? 42  VAL A H    2  
ATOM 2298  H HA   . VAL A 1 42  ? 11.472  12.577  -6.089  1.00 0.00 ? 42  VAL A HA   2  
ATOM 2299  H HB   . VAL A 1 42  ? 13.425  13.612  -5.119  1.00 0.00 ? 42  VAL A HB   2  
ATOM 2300  H HG11 . VAL A 1 42  ? 11.273  14.214  -4.158  1.00 0.00 ? 42  VAL A HG11 2  
ATOM 2301  H HG12 . VAL A 1 42  ? 11.406  12.893  -2.995  1.00 0.00 ? 42  VAL A HG12 2  
ATOM 2302  H HG13 . VAL A 1 42  ? 12.533  14.248  -2.925  1.00 0.00 ? 42  VAL A HG13 2  
ATOM 2303  H HG21 . VAL A 1 42  ? 14.306  12.670  -2.925  1.00 0.00 ? 42  VAL A HG21 2  
ATOM 2304  H HG22 . VAL A 1 42  ? 13.470  11.178  -3.355  1.00 0.00 ? 42  VAL A HG22 2  
ATOM 2305  H HG23 . VAL A 1 42  ? 14.748  11.804  -4.396  1.00 0.00 ? 42  VAL A HG23 2  
ATOM 2306  N N    . SER A 1 43  ? 13.658  10.131  -5.847  1.00 0.00 ? 43  SER A N    2  
ATOM 2307  C CA   . SER A 1 43  ? 14.614  9.328   -6.600  1.00 0.00 ? 43  SER A CA   2  
ATOM 2308  C C    . SER A 1 43  ? 13.916  8.556   -7.716  1.00 0.00 ? 43  SER A C    2  
ATOM 2309  O O    . SER A 1 43  ? 12.690  8.557   -7.813  1.00 0.00 ? 43  SER A O    2  
ATOM 2310  C CB   . SER A 1 43  ? 15.341  8.356   -5.669  1.00 0.00 ? 43  SER A CB   2  
ATOM 2311  O OG   . SER A 1 43  ? 16.321  9.026   -4.896  1.00 0.00 ? 43  SER A OG   2  
ATOM 2312  H H    . SER A 1 43  ? 13.431  9.870   -4.930  1.00 0.00 ? 43  SER A H    2  
ATOM 2313  H HA   . SER A 1 43  ? 15.337  9.999   -7.040  1.00 0.00 ? 43  SER A HA   2  
ATOM 2314  H HB2  . SER A 1 43  ? 14.626  7.897   -5.003  1.00 0.00 ? 43  SER A HB2  2  
ATOM 2315  H HB3  . SER A 1 43  ? 15.825  7.591   -6.259  1.00 0.00 ? 43  SER A HB3  2  
ATOM 2316  H HG   . SER A 1 43  ? 16.591  9.830   -5.347  1.00 0.00 ? 43  SER A HG   2  
ATOM 2317  N N    . GLY A 1 44  ? 14.708  7.898   -8.557  1.00 0.00 ? 44  GLY A N    2  
ATOM 2318  C CA   . GLY A 1 44  ? 14.149  7.131   -9.655  1.00 0.00 ? 44  GLY A CA   2  
ATOM 2319  C C    . GLY A 1 44  ? 14.595  7.647   -11.009 1.00 0.00 ? 44  GLY A C    2  
ATOM 2320  O O    . GLY A 1 44  ? 15.529  8.442   -11.100 1.00 0.00 ? 44  GLY A O    2  
ATOM 2321  H H    . GLY A 1 44  ? 15.679  7.933   -8.430  1.00 0.00 ? 44  GLY A H    2  
ATOM 2322  H HA2  . GLY A 1 44  ? 14.459  6.101   -9.555  1.00 0.00 ? 44  GLY A HA2  2  
ATOM 2323  H HA3  . GLY A 1 44  ? 13.072  7.179   -9.601  1.00 0.00 ? 44  GLY A HA3  2  
ATOM 2324  N N    . ASN A 1 45  ? 13.926  7.193   -12.063 1.00 0.00 ? 45  ASN A N    2  
ATOM 2325  C CA   . ASN A 1 45  ? 14.260  7.613   -13.419 1.00 0.00 ? 45  ASN A CA   2  
ATOM 2326  C C    . ASN A 1 45  ? 12.997  7.877   -14.234 1.00 0.00 ? 45  ASN A C    2  
ATOM 2327  O O    . ASN A 1 45  ? 12.098  7.039   -14.294 1.00 0.00 ? 45  ASN A O    2  
ATOM 2328  C CB   . ASN A 1 45  ? 15.112  6.547   -14.110 1.00 0.00 ? 45  ASN A CB   2  
ATOM 2329  C CG   . ASN A 1 45  ? 15.819  7.080   -15.342 1.00 0.00 ? 45  ASN A CG   2  
ATOM 2330  O OD1  . ASN A 1 45  ? 15.207  7.254   -16.395 1.00 0.00 ? 45  ASN A OD1  2  
ATOM 2331  N ND2  . ASN A 1 45  ? 17.114  7.341   -15.213 1.00 0.00 ? 45  ASN A ND2  2  
ATOM 2332  H H    . ASN A 1 45  ? 13.190  6.560   -11.927 1.00 0.00 ? 45  ASN A H    2  
ATOM 2333  H HA   . ASN A 1 45  ? 14.828  8.528   -13.352 1.00 0.00 ? 45  ASN A HA   2  
ATOM 2334  H HB2  . ASN A 1 45  ? 15.859  6.187   -13.418 1.00 0.00 ? 45  ASN A HB2  2  
ATOM 2335  H HB3  . ASN A 1 45  ? 14.478  5.725   -14.408 1.00 0.00 ? 45  ASN A HB3  2  
ATOM 2336  H HD21 . ASN A 1 45  ? 17.536  7.178   -14.344 1.00 0.00 ? 45  ASN A HD21 2  
ATOM 2337  H HD22 . ASN A 1 45  ? 17.596  7.687   -15.993 1.00 0.00 ? 45  ASN A HD22 2  
ATOM 2338  N N    . GLY A 1 46  ? 12.936  9.049   -14.859 1.00 0.00 ? 46  GLY A N    2  
ATOM 2339  C CA   . GLY A 1 46  ? 11.780  9.402   -15.662 1.00 0.00 ? 46  GLY A CA   2  
ATOM 2340  C C    . GLY A 1 46  ? 10.580  9.777   -14.816 1.00 0.00 ? 46  GLY A C    2  
ATOM 2341  O O    . GLY A 1 46  ? 10.730  10.303  -13.714 1.00 0.00 ? 46  GLY A O    2  
ATOM 2342  H H    . GLY A 1 46  ? 13.683  9.678   -14.775 1.00 0.00 ? 46  GLY A H    2  
ATOM 2343  H HA2  . GLY A 1 46  ? 12.037  10.238  -16.295 1.00 0.00 ? 46  GLY A HA2  2  
ATOM 2344  H HA3  . GLY A 1 46  ? 11.518  8.560   -16.285 1.00 0.00 ? 46  GLY A HA3  2  
ATOM 2345  N N    . GLU A 1 47  ? 9.385   9.508   -15.334 1.00 0.00 ? 47  GLU A N    2  
ATOM 2346  C CA   . GLU A 1 47  ? 8.154   9.824   -14.618 1.00 0.00 ? 47  GLU A CA   2  
ATOM 2347  C C    . GLU A 1 47  ? 7.340   8.561   -14.354 1.00 0.00 ? 47  GLU A C    2  
ATOM 2348  O O    . GLU A 1 47  ? 7.368   7.615   -15.142 1.00 0.00 ? 47  GLU A O    2  
ATOM 2349  C CB   . GLU A 1 47  ? 7.318   10.826  -15.416 1.00 0.00 ? 47  GLU A CB   2  
ATOM 2350  C CG   . GLU A 1 47  ? 6.188   11.451  -14.614 1.00 0.00 ? 47  GLU A CG   2  
ATOM 2351  C CD   . GLU A 1 47  ? 5.797   12.823  -15.128 1.00 0.00 ? 47  GLU A CD   2  
ATOM 2352  O OE1  . GLU A 1 47  ? 5.438   12.930  -16.319 1.00 0.00 ? 47  GLU A OE1  2  
ATOM 2353  O OE2  . GLU A 1 47  ? 5.849   13.789  -14.338 1.00 0.00 ? 47  GLU A OE2  2  
ATOM 2354  H H    . GLU A 1 47  ? 9.331   9.088   -16.218 1.00 0.00 ? 47  GLU A H    2  
ATOM 2355  H HA   . GLU A 1 47  ? 8.425   10.267  -13.672 1.00 0.00 ? 47  GLU A HA   2  
ATOM 2356  H HB2  . GLU A 1 47  ? 7.963   11.617  -15.767 1.00 0.00 ? 47  GLU A HB2  2  
ATOM 2357  H HB3  . GLU A 1 47  ? 6.888   10.320  -16.268 1.00 0.00 ? 47  GLU A HB3  2  
ATOM 2358  H HG2  . GLU A 1 47  ? 5.326   10.804  -14.667 1.00 0.00 ? 47  GLU A HG2  2  
ATOM 2359  H HG3  . GLU A 1 47  ? 6.504   11.544  -13.585 1.00 0.00 ? 47  GLU A HG3  2  
ATOM 2360  N N    . ILE A 1 48  ? 6.615   8.554   -13.240 1.00 0.00 ? 48  ILE A N    2  
ATOM 2361  C CA   . ILE A 1 48  ? 5.792   7.408   -12.872 1.00 0.00 ? 48  ILE A CA   2  
ATOM 2362  C C    . ILE A 1 48  ? 4.560   7.307   -13.765 1.00 0.00 ? 48  ILE A C    2  
ATOM 2363  O O    . ILE A 1 48  ? 3.890   8.305   -14.030 1.00 0.00 ? 48  ILE A O    2  
ATOM 2364  C CB   . ILE A 1 48  ? 5.342   7.488   -11.401 1.00 0.00 ? 48  ILE A CB   2  
ATOM 2365  C CG1  . ILE A 1 48  ? 6.528   7.837   -10.500 1.00 0.00 ? 48  ILE A CG1  2  
ATOM 2366  C CG2  . ILE A 1 48  ? 4.709   6.174   -10.969 1.00 0.00 ? 48  ILE A CG2  2  
ATOM 2367  C CD1  . ILE A 1 48  ? 7.540   6.720   -10.375 1.00 0.00 ? 48  ILE A CD1  2  
ATOM 2368  H H    . ILE A 1 48  ? 6.634   9.338   -12.653 1.00 0.00 ? 48  ILE A H    2  
ATOM 2369  H HA   . ILE A 1 48  ? 6.389   6.516   -12.997 1.00 0.00 ? 48  ILE A HA   2  
ATOM 2370  H HB   . ILE A 1 48  ? 4.596   8.264   -11.318 1.00 0.00 ? 48  ILE A HB   2  
ATOM 2371  H HG12 . ILE A 1 48  ? 7.036   8.700   -10.901 1.00 0.00 ? 48  ILE A HG12 2  
ATOM 2372  H HG13 . ILE A 1 48  ? 6.163   8.067   -9.510  1.00 0.00 ? 48  ILE A HG13 2  
ATOM 2373  H HG21 . ILE A 1 48  ? 4.636   5.513   -11.820 1.00 0.00 ? 48  ILE A HG21 2  
ATOM 2374  H HG22 . ILE A 1 48  ? 5.321   5.714   -10.208 1.00 0.00 ? 48  ILE A HG22 2  
ATOM 2375  H HG23 . ILE A 1 48  ? 3.723   6.362   -10.573 1.00 0.00 ? 48  ILE A HG23 2  
ATOM 2376  H HD11 . ILE A 1 48  ? 7.579   6.163   -11.299 1.00 0.00 ? 48  ILE A HD11 2  
ATOM 2377  H HD12 . ILE A 1 48  ? 8.513   7.137   -10.163 1.00 0.00 ? 48  ILE A HD12 2  
ATOM 2378  H HD13 . ILE A 1 48  ? 7.249   6.059   -9.570  1.00 0.00 ? 48  ILE A HD13 2  
ATOM 2379  N N    . GLN A 1 49  ? 4.267   6.095   -14.224 1.00 0.00 ? 49  GLN A N    2  
ATOM 2380  C CA   . GLN A 1 49  ? 3.114   5.863   -15.086 1.00 0.00 ? 49  GLN A CA   2  
ATOM 2381  C C    . GLN A 1 49  ? 1.832   5.765   -14.265 1.00 0.00 ? 49  GLN A C    2  
ATOM 2382  O O    . GLN A 1 49  ? 0.818   6.374   -14.605 1.00 0.00 ? 49  GLN A O    2  
ATOM 2383  C CB   . GLN A 1 49  ? 3.310   4.584   -15.902 1.00 0.00 ? 49  GLN A CB   2  
ATOM 2384  C CG   . GLN A 1 49  ? 4.157   4.782   -17.149 1.00 0.00 ? 49  GLN A CG   2  
ATOM 2385  C CD   . GLN A 1 49  ? 4.495   3.475   -17.838 1.00 0.00 ? 49  GLN A CD   2  
ATOM 2386  O OE1  . GLN A 1 49  ? 4.206   2.395   -17.322 1.00 0.00 ? 49  GLN A OE1  2  
ATOM 2387  N NE2  . GLN A 1 49  ? 5.109   3.566   -19.012 1.00 0.00 ? 49  GLN A NE2  2  
ATOM 2388  H H    . GLN A 1 49  ? 4.839   5.339   -13.977 1.00 0.00 ? 49  GLN A H    2  
ATOM 2389  H HA   . GLN A 1 49  ? 3.031   6.701   -15.761 1.00 0.00 ? 49  GLN A HA   2  
ATOM 2390  H HB2  . GLN A 1 49  ? 3.790   3.844   -15.280 1.00 0.00 ? 49  GLN A HB2  2  
ATOM 2391  H HB3  . GLN A 1 49  ? 2.342   4.214   -16.207 1.00 0.00 ? 49  GLN A HB3  2  
ATOM 2392  H HG2  . GLN A 1 49  ? 3.614   5.407   -17.842 1.00 0.00 ? 49  GLN A HG2  2  
ATOM 2393  H HG3  . GLN A 1 49  ? 5.077   5.273   -16.868 1.00 0.00 ? 49  GLN A HG3  2  
ATOM 2394  H HE21 . GLN A 1 49  ? 5.308   4.461   -19.361 1.00 0.00 ? 49  GLN A HE21 2  
ATOM 2395  H HE22 . GLN A 1 49  ? 5.339   2.737   -19.479 1.00 0.00 ? 49  GLN A HE22 2  
ATOM 2396  N N    . ASN A 1 50  ? 1.884   4.994   -13.184 1.00 0.00 ? 50  ASN A N    2  
ATOM 2397  C CA   . ASN A 1 50  ? 0.726   4.816   -12.316 1.00 0.00 ? 50  ASN A CA   2  
ATOM 2398  C C    . ASN A 1 50  ? 1.153   4.340   -10.931 1.00 0.00 ? 50  ASN A C    2  
ATOM 2399  O O    . ASN A 1 50  ? 2.289   3.907   -10.734 1.00 0.00 ? 50  ASN A O    2  
ATOM 2400  C CB   . ASN A 1 50  ? -0.251  3.813   -12.933 1.00 0.00 ? 50  ASN A CB   2  
ATOM 2401  C CG   . ASN A 1 50  ? 0.309   2.404   -12.964 1.00 0.00 ? 50  ASN A CG   2  
ATOM 2402  O OD1  . ASN A 1 50  ? 0.943   1.997   -13.938 1.00 0.00 ? 50  ASN A OD1  2  
ATOM 2403  N ND2  . ASN A 1 50  ? 0.077   1.652   -11.895 1.00 0.00 ? 50  ASN A ND2  2  
ATOM 2404  H H    . ASN A 1 50  ? 2.721   4.534   -12.965 1.00 0.00 ? 50  ASN A H    2  
ATOM 2405  H HA   . ASN A 1 50  ? 0.234   5.772   -12.219 1.00 0.00 ? 50  ASN A HA   2  
ATOM 2406  H HB2  . ASN A 1 50  ? -1.163  3.805   -12.353 1.00 0.00 ? 50  ASN A HB2  2  
ATOM 2407  H HB3  . ASN A 1 50  ? -0.476  4.114   -13.945 1.00 0.00 ? 50  ASN A HB3  2  
ATOM 2408  H HD21 . ASN A 1 50  ? -0.436  2.042   -11.156 1.00 0.00 ? 50  ASN A HD21 2  
ATOM 2409  H HD22 . ASN A 1 50  ? 0.428   0.737   -11.888 1.00 0.00 ? 50  ASN A HD22 2  
ATOM 2410  N N    . TYR A 1 51  ? 0.235   4.422   -9.974  1.00 0.00 ? 51  TYR A N    2  
ATOM 2411  C CA   . TYR A 1 51  ? 0.517   4.002   -8.606  1.00 0.00 ? 51  TYR A CA   2  
ATOM 2412  C C    . TYR A 1 51  ? -0.362  2.820   -8.208  1.00 0.00 ? 51  TYR A C    2  
ATOM 2413  O O    . TYR A 1 51  ? -1.588  2.929   -8.166  1.00 0.00 ? 51  TYR A O    2  
ATOM 2414  C CB   . TYR A 1 51  ? 0.297   5.165   -7.638  1.00 0.00 ? 51  TYR A CB   2  
ATOM 2415  C CG   . TYR A 1 51  ? 1.312   6.276   -7.785  1.00 0.00 ? 51  TYR A CG   2  
ATOM 2416  C CD1  . TYR A 1 51  ? 2.557   6.190   -7.174  1.00 0.00 ? 51  TYR A CD1  2  
ATOM 2417  C CD2  . TYR A 1 51  ? 1.026   7.411   -8.533  1.00 0.00 ? 51  TYR A CD2  2  
ATOM 2418  C CE1  . TYR A 1 51  ? 3.488   7.203   -7.305  1.00 0.00 ? 51  TYR A CE1  2  
ATOM 2419  C CE2  . TYR A 1 51  ? 1.951   8.427   -8.671  1.00 0.00 ? 51  TYR A CE2  2  
ATOM 2420  C CZ   . TYR A 1 51  ? 3.180   8.319   -8.055  1.00 0.00 ? 51  TYR A CZ   2  
ATOM 2421  O OH   . TYR A 1 51  ? 4.104   9.330   -8.188  1.00 0.00 ? 51  TYR A OH   2  
ATOM 2422  H H    . TYR A 1 51  ? -0.652  4.776   -10.192 1.00 0.00 ? 51  TYR A H    2  
ATOM 2423  H HA   . TYR A 1 51  ? 1.552   3.698   -8.559  1.00 0.00 ? 51  TYR A HA   2  
ATOM 2424  H HB2  . TYR A 1 51  ? -0.682  5.586   -7.808  1.00 0.00 ? 51  TYR A HB2  2  
ATOM 2425  H HB3  . TYR A 1 51  ? 0.353   4.796   -6.624  1.00 0.00 ? 51  TYR A HB3  2  
ATOM 2426  H HD1  . TYR A 1 51  ? 2.796   5.315   -6.588  1.00 0.00 ? 51  TYR A HD1  2  
ATOM 2427  H HD2  . TYR A 1 51  ? 0.062   7.492   -9.014  1.00 0.00 ? 51  TYR A HD2  2  
ATOM 2428  H HE1  . TYR A 1 51  ? 4.451   7.118   -6.823  1.00 0.00 ? 51  TYR A HE1  2  
ATOM 2429  H HE2  . TYR A 1 51  ? 1.710   9.302   -9.257  1.00 0.00 ? 51  TYR A HE2  2  
ATOM 2430  H HH   . TYR A 1 51  ? 4.469   9.546   -7.327  1.00 0.00 ? 51  TYR A HH   2  
ATOM 2431  N N    . LYS A 1 52  ? 0.273   1.691   -7.915  1.00 0.00 ? 52  LYS A N    2  
ATOM 2432  C CA   . LYS A 1 52  ? -0.448  0.487   -7.518  1.00 0.00 ? 52  LYS A CA   2  
ATOM 2433  C C    . LYS A 1 52  ? -0.604  0.423   -6.002  1.00 0.00 ? 52  LYS A C    2  
ATOM 2434  O O    . LYS A 1 52  ? 0.383   0.363   -5.268  1.00 0.00 ? 52  LYS A O    2  
ATOM 2435  C CB   . LYS A 1 52  ? 0.284   -0.760  -8.019  1.00 0.00 ? 52  LYS A CB   2  
ATOM 2436  C CG   . LYS A 1 52  ? -0.601  -1.991  -8.105  1.00 0.00 ? 52  LYS A CG   2  
ATOM 2437  C CD   . LYS A 1 52  ? -1.402  -2.014  -9.396  1.00 0.00 ? 52  LYS A CD   2  
ATOM 2438  C CE   . LYS A 1 52  ? -0.600  -2.619  -10.538 1.00 0.00 ? 52  LYS A CE   2  
ATOM 2439  N NZ   . LYS A 1 52  ? -1.108  -2.176  -11.867 1.00 0.00 ? 52  LYS A NZ   2  
ATOM 2440  H H    . LYS A 1 52  ? 1.252   1.666   -7.968  1.00 0.00 ? 52  LYS A H    2  
ATOM 2441  H HA   . LYS A 1 52  ? -1.428  0.524   -7.968  1.00 0.00 ? 52  LYS A HA   2  
ATOM 2442  H HB2  . LYS A 1 52  ? 0.681   -0.558  -9.003  1.00 0.00 ? 52  LYS A HB2  2  
ATOM 2443  H HB3  . LYS A 1 52  ? 1.103   -0.976  -7.348  1.00 0.00 ? 52  LYS A HB3  2  
ATOM 2444  H HG2  . LYS A 1 52  ? 0.021   -2.874  -8.064  1.00 0.00 ? 52  LYS A HG2  2  
ATOM 2445  H HG3  . LYS A 1 52  ? -1.284  -1.991  -7.267  1.00 0.00 ? 52  LYS A HG3  2  
ATOM 2446  H HD2  . LYS A 1 52  ? -2.294  -2.604  -9.245  1.00 0.00 ? 52  LYS A HD2  2  
ATOM 2447  H HD3  . LYS A 1 52  ? -1.677  -1.002  -9.656  1.00 0.00 ? 52  LYS A HD3  2  
ATOM 2448  H HE2  . LYS A 1 52  ? 0.431   -2.316  -10.437 1.00 0.00 ? 52  LYS A HE2  2  
ATOM 2449  H HE3  . LYS A 1 52  ? -0.667  -3.695  -10.477 1.00 0.00 ? 52  LYS A HE3  2  
ATOM 2450  H HZ1  . LYS A 1 52  ? -0.555  -2.622  -12.627 1.00 0.00 ? 52  LYS A HZ1  2  
ATOM 2451  H HZ2  . LYS A 1 52  ? -1.027  -1.144  -11.954 1.00 0.00 ? 52  LYS A HZ2  2  
ATOM 2452  H HZ3  . LYS A 1 52  ? -2.106  -2.446  -11.976 1.00 0.00 ? 52  LYS A HZ3  2  
ATOM 2453  N N    . LEU A 1 53  ? -1.850  0.433   -5.540  1.00 0.00 ? 53  LEU A N    2  
ATOM 2454  C CA   . LEU A 1 53  ? -2.135  0.374   -4.110  1.00 0.00 ? 53  LEU A CA   2  
ATOM 2455  C C    . LEU A 1 53  ? -2.709  -0.986  -3.726  1.00 0.00 ? 53  LEU A C    2  
ATOM 2456  O O    . LEU A 1 53  ? -3.732  -1.413  -4.261  1.00 0.00 ? 53  LEU A O    2  
ATOM 2457  C CB   . LEU A 1 53  ? -3.114  1.483   -3.720  1.00 0.00 ? 53  LEU A CB   2  
ATOM 2458  C CG   . LEU A 1 53  ? -3.787  1.334   -2.354  1.00 0.00 ? 53  LEU A CG   2  
ATOM 2459  C CD1  . LEU A 1 53  ? -2.808  1.665   -1.239  1.00 0.00 ? 53  LEU A CD1  2  
ATOM 2460  C CD2  . LEU A 1 53  ? -5.018  2.224   -2.267  1.00 0.00 ? 53  LEU A CD2  2  
ATOM 2461  H H    . LEU A 1 53  ? -2.595  0.482   -6.173  1.00 0.00 ? 53  LEU A H    2  
ATOM 2462  H HA   . LEU A 1 53  ? -1.206  0.522   -3.580  1.00 0.00 ? 53  LEU A HA   2  
ATOM 2463  H HB2  . LEU A 1 53  ? -2.574  2.417   -3.722  1.00 0.00 ? 53  LEU A HB2  2  
ATOM 2464  H HB3  . LEU A 1 53  ? -3.891  1.516   -4.470  1.00 0.00 ? 53  LEU A HB3  2  
ATOM 2465  H HG   . LEU A 1 53  ? -4.104  0.308   -2.226  1.00 0.00 ? 53  LEU A HG   2  
ATOM 2466  H HD11 . LEU A 1 53  ? -2.078  0.875   -1.154  1.00 0.00 ? 53  LEU A HD11 2  
ATOM 2467  H HD12 . LEU A 1 53  ? -3.344  1.761   -0.306  1.00 0.00 ? 53  LEU A HD12 2  
ATOM 2468  H HD13 . LEU A 1 53  ? -2.308  2.596   -1.463  1.00 0.00 ? 53  LEU A HD13 2  
ATOM 2469  H HD21 . LEU A 1 53  ? -5.845  1.744   -2.771  1.00 0.00 ? 53  LEU A HD21 2  
ATOM 2470  H HD22 . LEU A 1 53  ? -4.811  3.173   -2.739  1.00 0.00 ? 53  LEU A HD22 2  
ATOM 2471  H HD23 . LEU A 1 53  ? -5.273  2.385   -1.230  1.00 0.00 ? 53  LEU A HD23 2  
ATOM 2472  N N    . TYR A 1 54  ? -2.046  -1.659  -2.793  1.00 0.00 ? 54  TYR A N    2  
ATOM 2473  C CA   . TYR A 1 54  ? -2.490  -2.971  -2.336  1.00 0.00 ? 54  TYR A CA   2  
ATOM 2474  C C    . TYR A 1 54  ? -3.162  -2.873  -0.970  1.00 0.00 ? 54  TYR A C    2  
ATOM 2475  O O    . TYR A 1 54  ? -2.911  -1.940  -0.207  1.00 0.00 ? 54  TYR A O    2  
ATOM 2476  C CB   . TYR A 1 54  ? -1.307  -3.938  -2.267  1.00 0.00 ? 54  TYR A CB   2  
ATOM 2477  C CG   . TYR A 1 54  ? -0.668  -4.210  -3.610  1.00 0.00 ? 54  TYR A CG   2  
ATOM 2478  C CD1  . TYR A 1 54  ? -0.156  -3.173  -4.381  1.00 0.00 ? 54  TYR A CD1  2  
ATOM 2479  C CD2  . TYR A 1 54  ? -0.575  -5.504  -4.108  1.00 0.00 ? 54  TYR A CD2  2  
ATOM 2480  C CE1  . TYR A 1 54  ? 0.427   -3.418  -5.609  1.00 0.00 ? 54  TYR A CE1  2  
ATOM 2481  C CE2  . TYR A 1 54  ? 0.008   -5.758  -5.334  1.00 0.00 ? 54  TYR A CE2  2  
ATOM 2482  C CZ   . TYR A 1 54  ? 0.507   -4.711  -6.081  1.00 0.00 ? 54  TYR A CZ   2  
ATOM 2483  O OH   . TYR A 1 54  ? 1.089   -4.959  -7.303  1.00 0.00 ? 54  TYR A OH   2  
ATOM 2484  H H    . TYR A 1 54  ? -1.237  -1.266  -2.403  1.00 0.00 ? 54  TYR A H    2  
ATOM 2485  H HA   . TYR A 1 54  ? -3.207  -3.346  -3.051  1.00 0.00 ? 54  TYR A HA   2  
ATOM 2486  H HB2  . TYR A 1 54  ? -0.550  -3.524  -1.618  1.00 0.00 ? 54  TYR A HB2  2  
ATOM 2487  H HB3  . TYR A 1 54  ? -1.644  -4.881  -1.863  1.00 0.00 ? 54  TYR A HB3  2  
ATOM 2488  H HD1  . TYR A 1 54  ? -0.220  -2.161  -4.008  1.00 0.00 ? 54  TYR A HD1  2  
ATOM 2489  H HD2  . TYR A 1 54  ? -0.967  -6.322  -3.520  1.00 0.00 ? 54  TYR A HD2  2  
ATOM 2490  H HE1  . TYR A 1 54  ? 0.819   -2.598  -6.194  1.00 0.00 ? 54  TYR A HE1  2  
ATOM 2491  H HE2  . TYR A 1 54  ? 0.071   -6.770  -5.704  1.00 0.00 ? 54  TYR A HE2  2  
ATOM 2492  H HH   . TYR A 1 54  ? 1.921   -5.421  -7.174  1.00 0.00 ? 54  TYR A HH   2  
ATOM 2493  N N    . TYR A 1 55  ? -4.016  -3.845  -0.667  1.00 0.00 ? 55  TYR A N    2  
ATOM 2494  C CA   . TYR A 1 55  ? -4.726  -3.869  0.606   1.00 0.00 ? 55  TYR A CA   2  
ATOM 2495  C C    . TYR A 1 55  ? -5.207  -5.279  0.934   1.00 0.00 ? 55  TYR A C    2  
ATOM 2496  O O    . TYR A 1 55  ? -5.775  -5.966  0.086   1.00 0.00 ? 55  TYR A O    2  
ATOM 2497  C CB   . TYR A 1 55  ? -5.915  -2.908  0.569   1.00 0.00 ? 55  TYR A CB   2  
ATOM 2498  C CG   . TYR A 1 55  ? -7.020  -3.347  -0.366  1.00 0.00 ? 55  TYR A CG   2  
ATOM 2499  C CD1  . TYR A 1 55  ? -6.870  -3.249  -1.744  1.00 0.00 ? 55  TYR A CD1  2  
ATOM 2500  C CD2  . TYR A 1 55  ? -8.213  -3.858  0.128   1.00 0.00 ? 55  TYR A CD2  2  
ATOM 2501  C CE1  . TYR A 1 55  ? -7.876  -3.649  -2.602  1.00 0.00 ? 55  TYR A CE1  2  
ATOM 2502  C CE2  . TYR A 1 55  ? -9.225  -4.261  -0.722  1.00 0.00 ? 55  TYR A CE2  2  
ATOM 2503  C CZ   . TYR A 1 55  ? -9.051  -4.154  -2.086  1.00 0.00 ? 55  TYR A CZ   2  
ATOM 2504  O OH   . TYR A 1 55  ? -10.057 -4.553  -2.937  1.00 0.00 ? 55  TYR A OH   2  
ATOM 2505  H H    . TYR A 1 55  ? -4.174  -4.562  -1.316  1.00 0.00 ? 55  TYR A H    2  
ATOM 2506  H HA   . TYR A 1 55  ? -4.039  -3.547  1.375   1.00 0.00 ? 55  TYR A HA   2  
ATOM 2507  H HB2  . TYR A 1 55  ? -6.334  -2.825  1.560   1.00 0.00 ? 55  TYR A HB2  2  
ATOM 2508  H HB3  . TYR A 1 55  ? -5.574  -1.935  0.245   1.00 0.00 ? 55  TYR A HB3  2  
ATOM 2509  H HD1  . TYR A 1 55  ? -5.948  -2.853  -2.145  1.00 0.00 ? 55  TYR A HD1  2  
ATOM 2510  H HD2  . TYR A 1 55  ? -8.346  -3.940  1.198   1.00 0.00 ? 55  TYR A HD2  2  
ATOM 2511  H HE1  . TYR A 1 55  ? -7.741  -3.565  -3.671  1.00 0.00 ? 55  TYR A HE1  2  
ATOM 2512  H HE2  . TYR A 1 55  ? -10.145 -4.657  -0.319  1.00 0.00 ? 55  TYR A HE2  2  
ATOM 2513  H HH   . TYR A 1 55  ? -9.997  -4.058  -3.757  1.00 0.00 ? 55  TYR A HH   2  
ATOM 2514  N N    . MET A 1 56  ? -4.977  -5.702  2.173   1.00 0.00 ? 56  MET A N    2  
ATOM 2515  C CA   . MET A 1 56  ? -5.388  -7.030  2.615   1.00 0.00 ? 56  MET A CA   2  
ATOM 2516  C C    . MET A 1 56  ? -5.648  -7.045  4.118   1.00 0.00 ? 56  MET A C    2  
ATOM 2517  O O    . MET A 1 56  ? -5.184  -6.168  4.846   1.00 0.00 ? 56  MET A O    2  
ATOM 2518  C CB   . MET A 1 56  ? -4.317  -8.064  2.261   1.00 0.00 ? 56  MET A CB   2  
ATOM 2519  C CG   . MET A 1 56  ? -3.277  -8.259  3.351   1.00 0.00 ? 56  MET A CG   2  
ATOM 2520  S SD   . MET A 1 56  ? -1.755  -9.004  2.734   1.00 0.00 ? 56  MET A SD   2  
ATOM 2521  C CE   . MET A 1 56  ? -1.488  -10.289 3.952   1.00 0.00 ? 56  MET A CE   2  
ATOM 2522  H H    . MET A 1 56  ? -4.520  -5.109  2.805   1.00 0.00 ? 56  MET A H    2  
ATOM 2523  H HA   . MET A 1 56  ? -6.303  -7.281  2.101   1.00 0.00 ? 56  MET A HA   2  
ATOM 2524  H HB2  . MET A 1 56  ? -4.798  -9.013  2.076   1.00 0.00 ? 56  MET A HB2  2  
ATOM 2525  H HB3  . MET A 1 56  ? -3.810  -7.745  1.362   1.00 0.00 ? 56  MET A HB3  2  
ATOM 2526  H HG2  . MET A 1 56  ? -3.041  -7.298  3.783   1.00 0.00 ? 56  MET A HG2  2  
ATOM 2527  H HG3  . MET A 1 56  ? -3.692  -8.902  4.114   1.00 0.00 ? 56  MET A HG3  2  
ATOM 2528  H HE1  . MET A 1 56  ? -0.516  -10.162 4.403   1.00 0.00 ? 56  MET A HE1  2  
ATOM 2529  H HE2  . MET A 1 56  ? -2.250  -10.226 4.714   1.00 0.00 ? 56  MET A HE2  2  
ATOM 2530  H HE3  . MET A 1 56  ? -1.538  -11.256 3.471   1.00 0.00 ? 56  MET A HE3  2  
ATOM 2531  N N    . GLU A 1 57  ? -6.393  -8.047  4.575   1.00 0.00 ? 57  GLU A N    2  
ATOM 2532  C CA   . GLU A 1 57  ? -6.715  -8.175  5.992   1.00 0.00 ? 57  GLU A CA   2  
ATOM 2533  C C    . GLU A 1 57  ? -5.659  -9.003  6.717   1.00 0.00 ? 57  GLU A C    2  
ATOM 2534  O O    . GLU A 1 57  ? -5.255  -10.066 6.246   1.00 0.00 ? 57  GLU A O    2  
ATOM 2535  C CB   . GLU A 1 57  ? -8.092  -8.816  6.169   1.00 0.00 ? 57  GLU A CB   2  
ATOM 2536  C CG   . GLU A 1 57  ? -8.497  -8.998  7.622   1.00 0.00 ? 57  GLU A CG   2  
ATOM 2537  C CD   . GLU A 1 57  ? -9.923  -9.491  7.773   1.00 0.00 ? 57  GLU A CD   2  
ATOM 2538  O OE1  . GLU A 1 57  ? -10.756 -9.173  6.898   1.00 0.00 ? 57  GLU A OE1  2  
ATOM 2539  O OE2  . GLU A 1 57  ? -10.207 -10.193 8.766   1.00 0.00 ? 57  GLU A OE2  2  
ATOM 2540  H H    . GLU A 1 57  ? -6.734  -8.716  3.945   1.00 0.00 ? 57  GLU A H    2  
ATOM 2541  H HA   . GLU A 1 57  ? -6.733  -7.183  6.418   1.00 0.00 ? 57  GLU A HA   2  
ATOM 2542  H HB2  . GLU A 1 57  ? -8.831  -8.194  5.685   1.00 0.00 ? 57  GLU A HB2  2  
ATOM 2543  H HB3  . GLU A 1 57  ? -8.087  -9.787  5.695   1.00 0.00 ? 57  GLU A HB3  2  
ATOM 2544  H HG2  . GLU A 1 57  ? -7.834  -9.717  8.080   1.00 0.00 ? 57  GLU A HG2  2  
ATOM 2545  H HG3  . GLU A 1 57  ? -8.404  -8.049  8.130   1.00 0.00 ? 57  GLU A HG3  2  
ATOM 2546  N N    . LYS A 1 58  ? -5.215  -8.508  7.868   1.00 0.00 ? 58  LYS A N    2  
ATOM 2547  C CA   . LYS A 1 58  ? -4.206  -9.201  8.661   1.00 0.00 ? 58  LYS A CA   2  
ATOM 2548  C C    . LYS A 1 58  ? -4.668  -10.610 9.017   1.00 0.00 ? 58  LYS A C    2  
ATOM 2549  O O    . LYS A 1 58  ? -5.423  -10.804 9.969   1.00 0.00 ? 58  LYS A O    2  
ATOM 2550  C CB   . LYS A 1 58  ? -3.903  -8.414  9.938   1.00 0.00 ? 58  LYS A CB   2  
ATOM 2551  C CG   . LYS A 1 58  ? -2.480  -8.592  10.439  1.00 0.00 ? 58  LYS A CG   2  
ATOM 2552  C CD   . LYS A 1 58  ? -1.545  -7.553  9.844   1.00 0.00 ? 58  LYS A CD   2  
ATOM 2553  C CE   . LYS A 1 58  ? -0.121  -7.729  10.350  1.00 0.00 ? 58  LYS A CE   2  
ATOM 2554  N NZ   . LYS A 1 58  ? 0.519   -8.952  9.791   1.00 0.00 ? 58  LYS A NZ   2  
ATOM 2555  H H    . LYS A 1 58  ? -5.575  -7.656  8.192   1.00 0.00 ? 58  LYS A H    2  
ATOM 2556  H HA   . LYS A 1 58  ? -3.307  -9.269  8.068   1.00 0.00 ? 58  LYS A HA   2  
ATOM 2557  H HB2  . LYS A 1 58  ? -4.066  -7.363  9.746   1.00 0.00 ? 58  LYS A HB2  2  
ATOM 2558  H HB3  . LYS A 1 58  ? -4.579  -8.738  10.715  1.00 0.00 ? 58  LYS A HB3  2  
ATOM 2559  H HG2  . LYS A 1 58  ? -2.472  -8.494  11.514  1.00 0.00 ? 58  LYS A HG2  2  
ATOM 2560  H HG3  . LYS A 1 58  ? -2.132  -9.577  10.162  1.00 0.00 ? 58  LYS A HG3  2  
ATOM 2561  H HD2  . LYS A 1 58  ? -1.547  -7.652  8.768   1.00 0.00 ? 58  LYS A HD2  2  
ATOM 2562  H HD3  . LYS A 1 58  ? -1.896  -6.567  10.117  1.00 0.00 ? 58  LYS A HD3  2  
ATOM 2563  H HE2  . LYS A 1 58  ? 0.459   -6.866  10.061  1.00 0.00 ? 58  LYS A HE2  2  
ATOM 2564  H HE3  . LYS A 1 58  ? -0.143  -7.804  11.427  1.00 0.00 ? 58  LYS A HE3  2  
ATOM 2565  H HZ1  . LYS A 1 58  ? 1.363   -8.694  9.242   1.00 0.00 ? 58  LYS A HZ1  2  
ATOM 2566  H HZ2  . LYS A 1 58  ? -0.147  -9.450  9.168   1.00 0.00 ? 58  LYS A HZ2  2  
ATOM 2567  H HZ3  . LYS A 1 58  ? 0.801   -9.591  10.561  1.00 0.00 ? 58  LYS A HZ3  2  
ATOM 2568  N N    . GLY A 1 59  ? -4.207  -11.592 8.248   1.00 0.00 ? 59  GLY A N    2  
ATOM 2569  C CA   . GLY A 1 59  ? -4.583  -12.971 8.500   1.00 0.00 ? 59  GLY A CA   2  
ATOM 2570  C C    . GLY A 1 59  ? -5.369  -13.576 7.354   1.00 0.00 ? 59  GLY A C    2  
ATOM 2571  O O    . GLY A 1 59  ? -6.322  -14.325 7.572   1.00 0.00 ? 59  GLY A O    2  
ATOM 2572  H H    . GLY A 1 59  ? -3.607  -11.377 7.503   1.00 0.00 ? 59  GLY A H    2  
ATOM 2573  H HA2  . GLY A 1 59  ? -3.687  -13.553 8.656   1.00 0.00 ? 59  GLY A HA2  2  
ATOM 2574  H HA3  . GLY A 1 59  ? -5.186  -13.009 9.395   1.00 0.00 ? 59  GLY A HA3  2  
ATOM 2575  N N    . THR A 1 60  ? -4.972  -13.249 6.128   1.00 0.00 ? 60  THR A N    2  
ATOM 2576  C CA   . THR A 1 60  ? -5.648  -13.764 4.943   1.00 0.00 ? 60  THR A CA   2  
ATOM 2577  C C    . THR A 1 60  ? -4.660  -14.429 3.992   1.00 0.00 ? 60  THR A C    2  
ATOM 2578  O O    . THR A 1 60  ? -5.016  -15.349 3.256   1.00 0.00 ? 60  THR A O    2  
ATOM 2579  C CB   . THR A 1 60  ? -6.393  -12.645 4.192   1.00 0.00 ? 60  THR A CB   2  
ATOM 2580  O OG1  . THR A 1 60  ? -6.853  -11.654 5.118   1.00 0.00 ? 60  THR A OG1  2  
ATOM 2581  C CG2  . THR A 1 60  ? -7.575  -13.208 3.416   1.00 0.00 ? 60  THR A CG2  2  
ATOM 2582  H H    . THR A 1 60  ? -4.206  -12.648 6.019   1.00 0.00 ? 60  THR A H    2  
ATOM 2583  H HA   . THR A 1 60  ? -6.373  -14.497 5.265   1.00 0.00 ? 60  THR A HA   2  
ATOM 2584  H HB   . THR A 1 60  ? -5.710  -12.184 3.493   1.00 0.00 ? 60  THR A HB   2  
ATOM 2585  H HG1  . THR A 1 60  ? -6.353  -10.844 4.994   1.00 0.00 ? 60  THR A HG1  2  
ATOM 2586  H HG21 . THR A 1 60  ? -8.195  -12.396 3.065   1.00 0.00 ? 60  THR A HG21 2  
ATOM 2587  H HG22 . THR A 1 60  ? -8.154  -13.852 4.061   1.00 0.00 ? 60  THR A HG22 2  
ATOM 2588  H HG23 . THR A 1 60  ? -7.213  -13.774 2.572   1.00 0.00 ? 60  THR A HG23 2  
ATOM 2589  N N    . ASP A 1 61  ? -3.418  -13.958 4.012   1.00 0.00 ? 61  ASP A N    2  
ATOM 2590  C CA   . ASP A 1 61  ? -2.377  -14.508 3.151   1.00 0.00 ? 61  ASP A CA   2  
ATOM 2591  C C    . ASP A 1 61  ? -2.689  -14.241 1.682   1.00 0.00 ? 61  ASP A C    2  
ATOM 2592  O O    . ASP A 1 61  ? -2.340  -15.034 0.808   1.00 0.00 ? 61  ASP A O    2  
ATOM 2593  C CB   . ASP A 1 61  ? -2.232  -16.012 3.389   1.00 0.00 ? 61  ASP A CB   2  
ATOM 2594  C CG   . ASP A 1 61  ? -0.895  -16.547 2.916   1.00 0.00 ? 61  ASP A CG   2  
ATOM 2595  O OD1  . ASP A 1 61  ? 0.081   -15.768 2.893   1.00 0.00 ? 61  ASP A OD1  2  
ATOM 2596  O OD2  . ASP A 1 61  ? -0.824  -17.744 2.569   1.00 0.00 ? 61  ASP A OD2  2  
ATOM 2597  H H    . ASP A 1 61  ? -3.196  -13.222 4.621   1.00 0.00 ? 61  ASP A H    2  
ATOM 2598  H HA   . ASP A 1 61  ? -1.447  -14.022 3.403   1.00 0.00 ? 61  ASP A HA   2  
ATOM 2599  H HB2  . ASP A 1 61  ? -2.326  -16.214 4.446   1.00 0.00 ? 61  ASP A HB2  2  
ATOM 2600  H HB3  . ASP A 1 61  ? -3.016  -16.531 2.857   1.00 0.00 ? 61  ASP A HB3  2  
ATOM 2601  N N    . LYS A 1 62  ? -3.348  -13.118 1.418   1.00 0.00 ? 62  LYS A N    2  
ATOM 2602  C CA   . LYS A 1 62  ? -3.708  -12.744 0.055   1.00 0.00 ? 62  LYS A CA   2  
ATOM 2603  C C    . LYS A 1 62  ? -3.779  -11.227 -0.092  1.00 0.00 ? 62  LYS A C    2  
ATOM 2604  O O    . LYS A 1 62  ? -4.623  -10.575 0.520   1.00 0.00 ? 62  LYS A O    2  
ATOM 2605  C CB   . LYS A 1 62  ? -5.051  -13.368 -0.330  1.00 0.00 ? 62  LYS A CB   2  
ATOM 2606  C CG   . LYS A 1 62  ? -4.924  -14.741 -0.965  1.00 0.00 ? 62  LYS A CG   2  
ATOM 2607  C CD   . LYS A 1 62  ? -4.678  -14.643 -2.461  1.00 0.00 ? 62  LYS A CD   2  
ATOM 2608  C CE   . LYS A 1 62  ? -4.727  -16.011 -3.126  1.00 0.00 ? 62  LYS A CE   2  
ATOM 2609  N NZ   . LYS A 1 62  ? -6.120  -16.413 -3.465  1.00 0.00 ? 62  LYS A NZ   2  
ATOM 2610  H H    . LYS A 1 62  ? -3.599  -12.525 2.158   1.00 0.00 ? 62  LYS A H    2  
ATOM 2611  H HA   . LYS A 1 62  ? -2.942  -13.122 -0.606  1.00 0.00 ? 62  LYS A HA   2  
ATOM 2612  H HB2  . LYS A 1 62  ? -5.659  -13.460 0.558   1.00 0.00 ? 62  LYS A HB2  2  
ATOM 2613  H HB3  . LYS A 1 62  ? -5.550  -12.715 -1.031  1.00 0.00 ? 62  LYS A HB3  2  
ATOM 2614  H HG2  . LYS A 1 62  ? -4.097  -15.264 -0.509  1.00 0.00 ? 62  LYS A HG2  2  
ATOM 2615  H HG3  . LYS A 1 62  ? -5.838  -15.293 -0.796  1.00 0.00 ? 62  LYS A HG3  2  
ATOM 2616  H HD2  . LYS A 1 62  ? -5.437  -14.014 -2.902  1.00 0.00 ? 62  LYS A HD2  2  
ATOM 2617  H HD3  . LYS A 1 62  ? -3.704  -14.206 -2.629  1.00 0.00 ? 62  LYS A HD3  2  
ATOM 2618  H HE2  . LYS A 1 62  ? -4.140  -15.978 -4.031  1.00 0.00 ? 62  LYS A HE2  2  
ATOM 2619  H HE3  . LYS A 1 62  ? -4.305  -16.740 -2.450  1.00 0.00 ? 62  LYS A HE3  2  
ATOM 2620  H HZ1  . LYS A 1 62  ? -6.373  -17.285 -2.958  1.00 0.00 ? 62  LYS A HZ1  2  
ATOM 2621  H HZ2  . LYS A 1 62  ? -6.204  -16.583 -4.487  1.00 0.00 ? 62  LYS A HZ2  2  
ATOM 2622  H HZ3  . LYS A 1 62  ? -6.785  -15.661 -3.194  1.00 0.00 ? 62  LYS A HZ3  2  
ATOM 2623  N N    . GLU A 1 63  ? -2.888  -10.674 -0.909  1.00 0.00 ? 63  GLU A N    2  
ATOM 2624  C CA   . GLU A 1 63  ? -2.852  -9.234  -1.136  1.00 0.00 ? 63  GLU A CA   2  
ATOM 2625  C C    . GLU A 1 63  ? -3.600  -8.866  -2.414  1.00 0.00 ? 63  GLU A C    2  
ATOM 2626  O O    . GLU A 1 63  ? -3.690  -9.667  -3.345  1.00 0.00 ? 63  GLU A O    2  
ATOM 2627  C CB   . GLU A 1 63  ? -1.404  -8.745  -1.221  1.00 0.00 ? 63  GLU A CB   2  
ATOM 2628  C CG   . GLU A 1 63  ? -1.241  -7.268  -0.906  1.00 0.00 ? 63  GLU A CG   2  
ATOM 2629  C CD   . GLU A 1 63  ? -1.093  -7.001  0.580   1.00 0.00 ? 63  GLU A CD   2  
ATOM 2630  O OE1  . GLU A 1 63  ? -0.035  -7.353  1.142   1.00 0.00 ? 63  GLU A OE1  2  
ATOM 2631  O OE2  . GLU A 1 63  ? -2.035  -6.441  1.179   1.00 0.00 ? 63  GLU A OE2  2  
ATOM 2632  H H    . GLU A 1 63  ? -2.240  -11.247 -1.369  1.00 0.00 ? 63  GLU A H    2  
ATOM 2633  H HA   . GLU A 1 63  ? -3.336  -8.754  -0.299  1.00 0.00 ? 63  GLU A HA   2  
ATOM 2634  H HB2  . GLU A 1 63  ? -0.805  -9.310  -0.522  1.00 0.00 ? 63  GLU A HB2  2  
ATOM 2635  H HB3  . GLU A 1 63  ? -1.036  -8.921  -2.221  1.00 0.00 ? 63  GLU A HB3  2  
ATOM 2636  H HG2  . GLU A 1 63  ? -0.361  -6.900  -1.411  1.00 0.00 ? 63  GLU A HG2  2  
ATOM 2637  H HG3  . GLU A 1 63  ? -2.111  -6.738  -1.267  1.00 0.00 ? 63  GLU A HG3  2  
ATOM 2638  N N    . GLN A 1 64  ? -4.134  -7.649  -2.451  1.00 0.00 ? 64  GLN A N    2  
ATOM 2639  C CA   . GLN A 1 64  ? -4.875  -7.176  -3.614  1.00 0.00 ? 64  GLN A CA   2  
ATOM 2640  C C    . GLN A 1 64  ? -4.168  -5.991  -4.264  1.00 0.00 ? 64  GLN A C    2  
ATOM 2641  O O    . GLN A 1 64  ? -3.109  -5.561  -3.808  1.00 0.00 ? 64  GLN A O    2  
ATOM 2642  C CB   . GLN A 1 64  ? -6.297  -6.779  -3.211  1.00 0.00 ? 64  GLN A CB   2  
ATOM 2643  C CG   . GLN A 1 64  ? -7.198  -7.966  -2.914  1.00 0.00 ? 64  GLN A CG   2  
ATOM 2644  C CD   . GLN A 1 64  ? -8.616  -7.551  -2.573  1.00 0.00 ? 64  GLN A CD   2  
ATOM 2645  O OE1  . GLN A 1 64  ? -9.310  -6.943  -3.389  1.00 0.00 ? 64  GLN A OE1  2  
ATOM 2646  N NE2  . GLN A 1 64  ? -9.055  -7.878  -1.363  1.00 0.00 ? 64  GLN A NE2  2  
ATOM 2647  H H    . GLN A 1 64  ? -4.027  -7.057  -1.678  1.00 0.00 ? 64  GLN A H    2  
ATOM 2648  H HA   . GLN A 1 64  ? -4.925  -7.984  -4.327  1.00 0.00 ? 64  GLN A HA   2  
ATOM 2649  H HB2  . GLN A 1 64  ? -6.249  -6.160  -2.328  1.00 0.00 ? 64  GLN A HB2  2  
ATOM 2650  H HB3  . GLN A 1 64  ? -6.740  -6.210  -4.016  1.00 0.00 ? 64  GLN A HB3  2  
ATOM 2651  H HG2  . GLN A 1 64  ? -7.227  -8.607  -3.783  1.00 0.00 ? 64  GLN A HG2  2  
ATOM 2652  H HG3  . GLN A 1 64  ? -6.788  -8.512  -2.078  1.00 0.00 ? 64  GLN A HG3  2  
ATOM 2653  H HE21 . GLN A 1 64  ? -8.446  -8.361  -0.766  1.00 0.00 ? 64  GLN A HE21 2  
ATOM 2654  H HE22 . GLN A 1 64  ? -9.967  -7.621  -1.117  1.00 0.00 ? 64  GLN A HE22 2  
ATOM 2655  N N    . ASP A 1 65  ? -4.761  -5.468  -5.332  1.00 0.00 ? 65  ASP A N    2  
ATOM 2656  C CA   . ASP A 1 65  ? -4.189  -4.332  -6.045  1.00 0.00 ? 65  ASP A CA   2  
ATOM 2657  C C    . ASP A 1 65  ? -5.284  -3.485  -6.685  1.00 0.00 ? 65  ASP A C    2  
ATOM 2658  O O    . ASP A 1 65  ? -6.241  -4.012  -7.251  1.00 0.00 ? 65  ASP A O    2  
ATOM 2659  C CB   . ASP A 1 65  ? -3.210  -4.816  -7.116  1.00 0.00 ? 65  ASP A CB   2  
ATOM 2660  C CG   . ASP A 1 65  ? -3.904  -5.171  -8.416  1.00 0.00 ? 65  ASP A CG   2  
ATOM 2661  O OD1  . ASP A 1 65  ? -4.995  -5.777  -8.361  1.00 0.00 ? 65  ASP A OD1  2  
ATOM 2662  O OD2  . ASP A 1 65  ? -3.356  -4.843  -9.489  1.00 0.00 ? 65  ASP A OD2  2  
ATOM 2663  H H    . ASP A 1 65  ? -5.605  -5.855  -5.648  1.00 0.00 ? 65  ASP A H    2  
ATOM 2664  H HA   . ASP A 1 65  ? -3.654  -3.726  -5.329  1.00 0.00 ? 65  ASP A HA   2  
ATOM 2665  H HB2  . ASP A 1 65  ? -2.490  -4.035  -7.315  1.00 0.00 ? 65  ASP A HB2  2  
ATOM 2666  H HB3  . ASP A 1 65  ? -2.693  -5.692  -6.753  1.00 0.00 ? 65  ASP A HB3  2  
ATOM 2667  N N    . VAL A 1 66  ? -5.137  -2.167  -6.590  1.00 0.00 ? 66  VAL A N    2  
ATOM 2668  C CA   . VAL A 1 66  ? -6.113  -1.245  -7.159  1.00 0.00 ? 66  VAL A CA   2  
ATOM 2669  C C    . VAL A 1 66  ? -5.426  -0.130  -7.938  1.00 0.00 ? 66  VAL A C    2  
ATOM 2670  O O    . VAL A 1 66  ? -4.314  0.280   -7.606  1.00 0.00 ? 66  VAL A O    2  
ATOM 2671  C CB   . VAL A 1 66  ? -7.000  -0.622  -6.065  1.00 0.00 ? 66  VAL A CB   2  
ATOM 2672  C CG1  . VAL A 1 66  ? -8.025  -1.631  -5.570  1.00 0.00 ? 66  VAL A CG1  2  
ATOM 2673  C CG2  . VAL A 1 66  ? -6.147  -0.108  -4.916  1.00 0.00 ? 66  VAL A CG2  2  
ATOM 2674  H H    . VAL A 1 66  ? -4.352  -1.806  -6.126  1.00 0.00 ? 66  VAL A H    2  
ATOM 2675  H HA   . VAL A 1 66  ? -6.747  -1.804  -7.832  1.00 0.00 ? 66  VAL A HA   2  
ATOM 2676  H HB   . VAL A 1 66  ? -7.531  0.215   -6.494  1.00 0.00 ? 66  VAL A HB   2  
ATOM 2677  H HG11 . VAL A 1 66  ? -7.845  -2.587  -6.039  1.00 0.00 ? 66  VAL A HG11 2  
ATOM 2678  H HG12 . VAL A 1 66  ? -7.941  -1.733  -4.498  1.00 0.00 ? 66  VAL A HG12 2  
ATOM 2679  H HG13 . VAL A 1 66  ? -9.018  -1.288  -5.822  1.00 0.00 ? 66  VAL A HG13 2  
ATOM 2680  H HG21 . VAL A 1 66  ? -6.180  -0.815  -4.100  1.00 0.00 ? 66  VAL A HG21 2  
ATOM 2681  H HG22 . VAL A 1 66  ? -5.126  0.009   -5.249  1.00 0.00 ? 66  VAL A HG22 2  
ATOM 2682  H HG23 . VAL A 1 66  ? -6.528  0.845   -4.582  1.00 0.00 ? 66  VAL A HG23 2  
ATOM 2683  N N    . ASP A 1 67  ? -6.096  0.359   -8.976  1.00 0.00 ? 67  ASP A N    2  
ATOM 2684  C CA   . ASP A 1 67  ? -5.551  1.429   -9.803  1.00 0.00 ? 67  ASP A CA   2  
ATOM 2685  C C    . ASP A 1 67  ? -5.847  2.794   -9.189  1.00 0.00 ? 67  ASP A C    2  
ATOM 2686  O O    . ASP A 1 67  ? -7.003  3.137   -8.938  1.00 0.00 ? 67  ASP A O    2  
ATOM 2687  C CB   . ASP A 1 67  ? -6.131  1.356   -11.216 1.00 0.00 ? 67  ASP A CB   2  
ATOM 2688  C CG   . ASP A 1 67  ? -5.284  2.102   -12.228 1.00 0.00 ? 67  ASP A CG   2  
ATOM 2689  O OD1  . ASP A 1 67  ? -4.080  2.301   -11.963 1.00 0.00 ? 67  ASP A OD1  2  
ATOM 2690  O OD2  . ASP A 1 67  ? -5.825  2.486   -13.286 1.00 0.00 ? 67  ASP A OD2  2  
ATOM 2691  H H    . ASP A 1 67  ? -6.979  -0.009  -9.191  1.00 0.00 ? 67  ASP A H    2  
ATOM 2692  H HA   . ASP A 1 67  ? -4.481  1.296   -9.855  1.00 0.00 ? 67  ASP A HA   2  
ATOM 2693  H HB2  . ASP A 1 67  ? -6.193  0.321   -11.520 1.00 0.00 ? 67  ASP A HB2  2  
ATOM 2694  H HB3  . ASP A 1 67  ? -7.121  1.787   -11.215 1.00 0.00 ? 67  ASP A HB3  2  
ATOM 2695  N N    . VAL A 1 68  ? -4.794  3.569   -8.947  1.00 0.00 ? 68  VAL A N    2  
ATOM 2696  C CA   . VAL A 1 68  ? -4.941  4.897   -8.362  1.00 0.00 ? 68  VAL A CA   2  
ATOM 2697  C C    . VAL A 1 68  ? -4.175  5.940   -9.168  1.00 0.00 ? 68  VAL A C    2  
ATOM 2698  O O    . VAL A 1 68  ? -2.995  5.762   -9.470  1.00 0.00 ? 68  VAL A O    2  
ATOM 2699  C CB   . VAL A 1 68  ? -4.445  4.925   -6.904  1.00 0.00 ? 68  VAL A CB   2  
ATOM 2700  C CG1  . VAL A 1 68  ? -4.899  6.201   -6.211  1.00 0.00 ? 68  VAL A CG1  2  
ATOM 2701  C CG2  . VAL A 1 68  ? -4.935  3.697   -6.152  1.00 0.00 ? 68  VAL A CG2  2  
ATOM 2702  H H    . VAL A 1 68  ? -3.898  3.241   -9.168  1.00 0.00 ? 68  VAL A H    2  
ATOM 2703  H HA   . VAL A 1 68  ? -5.991  5.151   -8.369  1.00 0.00 ? 68  VAL A HA   2  
ATOM 2704  H HB   . VAL A 1 68  ? -3.365  4.911   -6.912  1.00 0.00 ? 68  VAL A HB   2  
ATOM 2705  H HG11 . VAL A 1 68  ? -5.955  6.137   -5.995  1.00 0.00 ? 68  VAL A HG11 2  
ATOM 2706  H HG12 . VAL A 1 68  ? -4.349  6.326   -5.290  1.00 0.00 ? 68  VAL A HG12 2  
ATOM 2707  H HG13 . VAL A 1 68  ? -4.715  7.047   -6.857  1.00 0.00 ? 68  VAL A HG13 2  
ATOM 2708  H HG21 . VAL A 1 68  ? -4.958  3.910   -5.093  1.00 0.00 ? 68  VAL A HG21 2  
ATOM 2709  H HG22 . VAL A 1 68  ? -5.928  3.440   -6.489  1.00 0.00 ? 68  VAL A HG22 2  
ATOM 2710  H HG23 . VAL A 1 68  ? -4.266  2.870   -6.338  1.00 0.00 ? 68  VAL A HG23 2  
ATOM 2711  N N    . SER A 1 69  ? -4.854  7.029   -9.513  1.00 0.00 ? 69  SER A N    2  
ATOM 2712  C CA   . SER A 1 69  ? -4.239  8.100   -10.287 1.00 0.00 ? 69  SER A CA   2  
ATOM 2713  C C    . SER A 1 69  ? -3.753  9.222   -9.373  1.00 0.00 ? 69  SER A C    2  
ATOM 2714  O O    . SER A 1 69  ? -2.861  9.989   -9.734  1.00 0.00 ? 69  SER A O    2  
ATOM 2715  C CB   . SER A 1 69  ? -5.232  8.655   -11.310 1.00 0.00 ? 69  SER A CB   2  
ATOM 2716  O OG   . SER A 1 69  ? -5.318  7.813   -12.447 1.00 0.00 ? 69  SER A OG   2  
ATOM 2717  H H    . SER A 1 69  ? -5.793  7.112   -9.243  1.00 0.00 ? 69  SER A H    2  
ATOM 2718  H HA   . SER A 1 69  ? -3.390  7.686   -10.811 1.00 0.00 ? 69  SER A HA   2  
ATOM 2719  H HB2  . SER A 1 69  ? -6.209  8.728   -10.857 1.00 0.00 ? 69  SER A HB2  2  
ATOM 2720  H HB3  . SER A 1 69  ? -4.909  9.636   -11.627 1.00 0.00 ? 69  SER A HB3  2  
ATOM 2721  H HG   . SER A 1 69  ? -5.440  8.349   -13.234 1.00 0.00 ? 69  SER A HG   2  
ATOM 2722  N N    . SER A 1 70  ? -4.348  9.309   -8.188  1.00 0.00 ? 70  SER A N    2  
ATOM 2723  C CA   . SER A 1 70  ? -3.980  10.338  -7.222  1.00 0.00 ? 70  SER A CA   2  
ATOM 2724  C C    . SER A 1 70  ? -3.085  9.762   -6.130  1.00 0.00 ? 70  SER A C    2  
ATOM 2725  O O    . SER A 1 70  ? -2.971  8.545   -5.981  1.00 0.00 ? 70  SER A O    2  
ATOM 2726  C CB   . SER A 1 70  ? -5.234  10.954  -6.598  1.00 0.00 ? 70  SER A CB   2  
ATOM 2727  O OG   . SER A 1 70  ? -5.001  12.294  -6.203  1.00 0.00 ? 70  SER A OG   2  
ATOM 2728  H H    . SER A 1 70  ? -5.053  8.668   -7.958  1.00 0.00 ? 70  SER A H    2  
ATOM 2729  H HA   . SER A 1 70  ? -3.436  11.108  -7.749  1.00 0.00 ? 70  SER A HA   2  
ATOM 2730  H HB2  . SER A 1 70  ? -6.037  10.938  -7.320  1.00 0.00 ? 70  SER A HB2  2  
ATOM 2731  H HB3  . SER A 1 70  ? -5.519  10.378  -5.729  1.00 0.00 ? 70  SER A HB3  2  
ATOM 2732  H HG   . SER A 1 70  ? -4.796  12.321  -5.265  1.00 0.00 ? 70  SER A HG   2  
ATOM 2733  N N    . HIS A 1 71  ? -2.450  10.646  -5.366  1.00 0.00 ? 71  HIS A N    2  
ATOM 2734  C CA   . HIS A 1 71  ? -1.564  10.227  -4.286  1.00 0.00 ? 71  HIS A CA   2  
ATOM 2735  C C    . HIS A 1 71  ? -2.360  9.905   -3.025  1.00 0.00 ? 71  HIS A C    2  
ATOM 2736  O O    . HIS A 1 71  ? -1.794  9.760   -1.942  1.00 0.00 ? 71  HIS A O    2  
ATOM 2737  C CB   . HIS A 1 71  ? -0.536  11.319  -3.988  1.00 0.00 ? 71  HIS A CB   2  
ATOM 2738  C CG   . HIS A 1 71  ? 0.407   11.579  -5.122  1.00 0.00 ? 71  HIS A CG   2  
ATOM 2739  N ND1  . HIS A 1 71  ? 0.374   12.730  -5.881  1.00 0.00 ? 71  HIS A ND1  2  
ATOM 2740  C CD2  . HIS A 1 71  ? 1.415   10.828  -5.625  1.00 0.00 ? 71  HIS A CD2  2  
ATOM 2741  C CE1  . HIS A 1 71  ? 1.319   12.676  -6.801  1.00 0.00 ? 71  HIS A CE1  2  
ATOM 2742  N NE2  . HIS A 1 71  ? 1.966   11.532  -6.667  1.00 0.00 ? 71  HIS A NE2  2  
ATOM 2743  H H    . HIS A 1 71  ? -2.581  11.603  -5.533  1.00 0.00 ? 71  HIS A H    2  
ATOM 2744  H HA   . HIS A 1 71  ? -1.047  9.336   -4.608  1.00 0.00 ? 71  HIS A HA   2  
ATOM 2745  H HB2  . HIS A 1 71  ? -1.053  12.242  -3.770  1.00 0.00 ? 71  HIS A HB2  2  
ATOM 2746  H HB3  . HIS A 1 71  ? 0.050   11.028  -3.128  1.00 0.00 ? 71  HIS A HB3  2  
ATOM 2747  H HD1  . HIS A 1 71  ? -0.251  13.475  -5.762  1.00 0.00 ? 71  HIS A HD1  2  
ATOM 2748  H HD2  . HIS A 1 71  ? 1.729   9.856   -5.272  1.00 0.00 ? 71  HIS A HD2  2  
ATOM 2749  H HE1  . HIS A 1 71  ? 1.529   13.437  -7.538  1.00 0.00 ? 71  HIS A HE1  2  
ATOM 2750  H HE2  . HIS A 1 71  ? 2.658   11.201  -7.276  1.00 0.00 ? 71  HIS A HE2  2  
ATOM 2751  N N    . SER A 1 72  ? -3.677  9.795   -3.174  1.00 0.00 ? 72  SER A N    2  
ATOM 2752  C CA   . SER A 1 72  ? -4.551  9.494   -2.046  1.00 0.00 ? 72  SER A CA   2  
ATOM 2753  C C    . SER A 1 72  ? -5.792  8.735   -2.508  1.00 0.00 ? 72  SER A C    2  
ATOM 2754  O O    . SER A 1 72  ? -6.587  9.245   -3.298  1.00 0.00 ? 72  SER A O    2  
ATOM 2755  C CB   . SER A 1 72  ? -4.964  10.784  -1.335  1.00 0.00 ? 72  SER A CB   2  
ATOM 2756  O OG   . SER A 1 72  ? -5.528  11.710  -2.247  1.00 0.00 ? 72  SER A OG   2  
ATOM 2757  H H    . SER A 1 72  ? -4.069  9.921   -4.063  1.00 0.00 ? 72  SER A H    2  
ATOM 2758  H HA   . SER A 1 72  ? -4.000  8.873   -1.356  1.00 0.00 ? 72  SER A HA   2  
ATOM 2759  H HB2  . SER A 1 72  ? -5.695  10.555  -0.575  1.00 0.00 ? 72  SER A HB2  2  
ATOM 2760  H HB3  . SER A 1 72  ? -4.094  11.232  -0.876  1.00 0.00 ? 72  SER A HB3  2  
ATOM 2761  H HG   . SER A 1 72  ? -5.136  12.576  -2.109  1.00 0.00 ? 72  SER A HG   2  
ATOM 2762  N N    . TYR A 1 73  ? -5.950  7.514   -2.010  1.00 0.00 ? 73  TYR A N    2  
ATOM 2763  C CA   . TYR A 1 73  ? -7.091  6.682   -2.373  1.00 0.00 ? 73  TYR A CA   2  
ATOM 2764  C C    . TYR A 1 73  ? -7.860  6.241   -1.131  1.00 0.00 ? 73  TYR A C    2  
ATOM 2765  O O    . TYR A 1 73  ? -7.318  6.220   -0.025  1.00 0.00 ? 73  TYR A O    2  
ATOM 2766  C CB   . TYR A 1 73  ? -6.626  5.457   -3.161  1.00 0.00 ? 73  TYR A CB   2  
ATOM 2767  C CG   . TYR A 1 73  ? -7.762  4.614   -3.696  1.00 0.00 ? 73  TYR A CG   2  
ATOM 2768  C CD1  . TYR A 1 73  ? -8.375  4.923   -4.904  1.00 0.00 ? 73  TYR A CD1  2  
ATOM 2769  C CD2  . TYR A 1 73  ? -8.223  3.508   -2.992  1.00 0.00 ? 73  TYR A CD2  2  
ATOM 2770  C CE1  . TYR A 1 73  ? -9.413  4.156   -5.395  1.00 0.00 ? 73  TYR A CE1  2  
ATOM 2771  C CE2  . TYR A 1 73  ? -9.260  2.734   -3.476  1.00 0.00 ? 73  TYR A CE2  2  
ATOM 2772  C CZ   . TYR A 1 73  ? -9.852  3.063   -4.678  1.00 0.00 ? 73  TYR A CZ   2  
ATOM 2773  O OH   . TYR A 1 73  ? -10.886 2.295   -5.164  1.00 0.00 ? 73  TYR A OH   2  
ATOM 2774  H H    . TYR A 1 73  ? -5.282  7.162   -1.385  1.00 0.00 ? 73  TYR A H    2  
ATOM 2775  H HA   . TYR A 1 73  ? -7.746  7.272   -2.997  1.00 0.00 ? 73  TYR A HA   2  
ATOM 2776  H HB2  . TYR A 1 73  ? -6.032  5.782   -4.001  1.00 0.00 ? 73  TYR A HB2  2  
ATOM 2777  H HB3  . TYR A 1 73  ? -6.023  4.832   -2.520  1.00 0.00 ? 73  TYR A HB3  2  
ATOM 2778  H HD1  . TYR A 1 73  ? -8.028  5.780   -5.463  1.00 0.00 ? 73  TYR A HD1  2  
ATOM 2779  H HD2  . TYR A 1 73  ? -7.757  3.253   -2.051  1.00 0.00 ? 73  TYR A HD2  2  
ATOM 2780  H HE1  . TYR A 1 73  ? -9.877  4.413   -6.336  1.00 0.00 ? 73  TYR A HE1  2  
ATOM 2781  H HE2  . TYR A 1 73  ? -9.604  1.878   -2.915  1.00 0.00 ? 73  TYR A HE2  2  
ATOM 2782  H HH   . TYR A 1 73  ? -10.530 1.588   -5.708  1.00 0.00 ? 73  TYR A HH   2  
ATOM 2783  N N    . THR A 1 74  ? -9.127  5.886   -1.322  1.00 0.00 ? 74  THR A N    2  
ATOM 2784  C CA   . THR A 1 74  ? -9.971  5.445   -0.219  1.00 0.00 ? 74  THR A CA   2  
ATOM 2785  C C    . THR A 1 74  ? -10.618 4.099   -0.527  1.00 0.00 ? 74  THR A C    2  
ATOM 2786  O O    . THR A 1 74  ? -11.335 3.956   -1.517  1.00 0.00 ? 74  THR A O    2  
ATOM 2787  C CB   . THR A 1 74  ? -11.076 6.474   0.089   1.00 0.00 ? 74  THR A CB   2  
ATOM 2788  O OG1  . THR A 1 74  ? -10.496 7.764   0.309   1.00 0.00 ? 74  THR A OG1  2  
ATOM 2789  C CG2  . THR A 1 74  ? -11.877 6.057   1.313   1.00 0.00 ? 74  THR A CG2  2  
ATOM 2790  H H    . THR A 1 74  ? -9.501  5.924   -2.227  1.00 0.00 ? 74  THR A H    2  
ATOM 2791  H HA   . THR A 1 74  ? -9.349  5.343   0.658   1.00 0.00 ? 74  THR A HA   2  
ATOM 2792  H HB   . THR A 1 74  ? -11.743 6.527   -0.759  1.00 0.00 ? 74  THR A HB   2  
ATOM 2793  H HG1  . THR A 1 74  ? -9.668  7.830   -0.174  1.00 0.00 ? 74  THR A HG1  2  
ATOM 2794  H HG21 . THR A 1 74  ? -11.333 6.324   2.207   1.00 0.00 ? 74  THR A HG21 2  
ATOM 2795  H HG22 . THR A 1 74  ? -12.036 4.989   1.293   1.00 0.00 ? 74  THR A HG22 2  
ATOM 2796  H HG23 . THR A 1 74  ? -12.831 6.563   1.308   1.00 0.00 ? 74  THR A HG23 2  
ATOM 2797  N N    . ILE A 1 75  ? -10.360 3.115   0.329   1.00 0.00 ? 75  ILE A N    2  
ATOM 2798  C CA   . ILE A 1 75  ? -10.919 1.781   0.148   1.00 0.00 ? 75  ILE A CA   2  
ATOM 2799  C C    . ILE A 1 75  ? -12.145 1.575   1.032   1.00 0.00 ? 75  ILE A C    2  
ATOM 2800  O O    . ILE A 1 75  ? -12.072 1.706   2.252   1.00 0.00 ? 75  ILE A O    2  
ATOM 2801  C CB   . ILE A 1 75  ? -9.881  0.688   0.467   1.00 0.00 ? 75  ILE A CB   2  
ATOM 2802  C CG1  . ILE A 1 75  ? -8.733  0.735   -0.544  1.00 0.00 ? 75  ILE A CG1  2  
ATOM 2803  C CG2  . ILE A 1 75  ? -10.540 -0.683  0.466   1.00 0.00 ? 75  ILE A CG2  2  
ATOM 2804  C CD1  . ILE A 1 75  ? -7.505  -0.027  -0.099  1.00 0.00 ? 75  ILE A CD1  2  
ATOM 2805  H H    . ILE A 1 75  ? -9.781  3.291   1.099   1.00 0.00 ? 75  ILE A H    2  
ATOM 2806  H HA   . ILE A 1 75  ? -11.213 1.680   -0.887  1.00 0.00 ? 75  ILE A HA   2  
ATOM 2807  H HB   . ILE A 1 75  ? -9.489  0.873   1.455   1.00 0.00 ? 75  ILE A HB   2  
ATOM 2808  H HG12 . ILE A 1 75  ? -9.066  0.309   -1.477  1.00 0.00 ? 75  ILE A HG12 2  
ATOM 2809  H HG13 . ILE A 1 75  ? -8.446  1.764   -0.704  1.00 0.00 ? 75  ILE A HG13 2  
ATOM 2810  H HG21 . ILE A 1 75  ? -11.341 -0.697  -0.257  1.00 0.00 ? 75  ILE A HG21 2  
ATOM 2811  H HG22 . ILE A 1 75  ? -9.808  -1.433  0.206   1.00 0.00 ? 75  ILE A HG22 2  
ATOM 2812  H HG23 . ILE A 1 75  ? -10.937 -0.892  1.448   1.00 0.00 ? 75  ILE A HG23 2  
ATOM 2813  H HD11 . ILE A 1 75  ? -7.802  -0.977  0.322   1.00 0.00 ? 75  ILE A HD11 2  
ATOM 2814  H HD12 . ILE A 1 75  ? -6.858  -0.195  -0.946  1.00 0.00 ? 75  ILE A HD12 2  
ATOM 2815  H HD13 . ILE A 1 75  ? -6.977  0.547   0.649   1.00 0.00 ? 75  ILE A HD13 2  
ATOM 2816  N N    . ASN A 1 76  ? -13.271 1.250   0.405   1.00 0.00 ? 76  ASN A N    2  
ATOM 2817  C CA   . ASN A 1 76  ? -14.513 1.024   1.134   1.00 0.00 ? 76  ASN A CA   2  
ATOM 2818  C C    . ASN A 1 76  ? -14.878 -0.458  1.141   1.00 0.00 ? 76  ASN A C    2  
ATOM 2819  O O    . ASN A 1 76  ? -14.428 -1.223  0.289   1.00 0.00 ? 76  ASN A O    2  
ATOM 2820  C CB   . ASN A 1 76  ? -15.650 1.837   0.511   1.00 0.00 ? 76  ASN A CB   2  
ATOM 2821  C CG   . ASN A 1 76  ? -15.380 3.329   0.546   1.00 0.00 ? 76  ASN A CG   2  
ATOM 2822  O OD1  . ASN A 1 76  ? -15.910 4.047   1.394   1.00 0.00 ? 76  ASN A OD1  2  
ATOM 2823  N ND2  . ASN A 1 76  ? -14.551 3.802   -0.378  1.00 0.00 ? 76  ASN A ND2  2  
ATOM 2824  H H    . ASN A 1 76  ? -13.266 1.160   -0.571  1.00 0.00 ? 76  ASN A H    2  
ATOM 2825  H HA   . ASN A 1 76  ? -14.365 1.351   2.152   1.00 0.00 ? 76  ASN A HA   2  
ATOM 2826  H HB2  . ASN A 1 76  ? -15.775 1.538   -0.520  1.00 0.00 ? 76  ASN A HB2  2  
ATOM 2827  H HB3  . ASN A 1 76  ? -16.563 1.642   1.052   1.00 0.00 ? 76  ASN A HB3  2  
ATOM 2828  H HD21 . ASN A 1 76  ? -14.166 3.171   -1.021  1.00 0.00 ? 76  ASN A HD21 2  
ATOM 2829  H HD22 . ASN A 1 76  ? -14.359 4.763   -0.378  1.00 0.00 ? 76  ASN A HD22 2  
ATOM 2830  N N    . GLY A 1 77  ? -15.698 -0.855  2.110   1.00 0.00 ? 77  GLY A N    2  
ATOM 2831  C CA   . GLY A 1 77  ? -16.110 -2.243  2.210   1.00 0.00 ? 77  GLY A CA   2  
ATOM 2832  C C    . GLY A 1 77  ? -15.222 -3.046  3.139   1.00 0.00 ? 77  GLY A C    2  
ATOM 2833  O O    . GLY A 1 77  ? -14.728 -4.113  2.771   1.00 0.00 ? 77  GLY A O    2  
ATOM 2834  H H    . GLY A 1 77  ? -16.026 -0.201  2.761   1.00 0.00 ? 77  GLY A H    2  
ATOM 2835  H HA2  . GLY A 1 77  ? -17.125 -2.281  2.577   1.00 0.00 ? 77  GLY A HA2  2  
ATOM 2836  H HA3  . GLY A 1 77  ? -16.077 -2.688  1.226   1.00 0.00 ? 77  GLY A HA3  2  
ATOM 2837  N N    . LEU A 1 78  ? -15.016 -2.533  4.347   1.00 0.00 ? 78  LEU A N    2  
ATOM 2838  C CA   . LEU A 1 78  ? -14.179 -3.209  5.333   1.00 0.00 ? 78  LEU A CA   2  
ATOM 2839  C C    . LEU A 1 78  ? -14.926 -3.387  6.651   1.00 0.00 ? 78  LEU A C    2  
ATOM 2840  O O    . LEU A 1 78  ? -15.983 -2.792  6.863   1.00 0.00 ? 78  LEU A O    2  
ATOM 2841  C CB   . LEU A 1 78  ? -12.891 -2.417  5.566   1.00 0.00 ? 78  LEU A CB   2  
ATOM 2842  C CG   . LEU A 1 78  ? -12.162 -1.936  4.311   1.00 0.00 ? 78  LEU A CG   2  
ATOM 2843  C CD1  . LEU A 1 78  ? -10.963 -1.079  4.686   1.00 0.00 ? 78  LEU A CD1  2  
ATOM 2844  C CD2  . LEU A 1 78  ? -11.727 -3.121  3.461   1.00 0.00 ? 78  LEU A CD2  2  
ATOM 2845  H H    . LEU A 1 78  ? -15.436 -1.680  4.583   1.00 0.00 ? 78  LEU A H    2  
ATOM 2846  H HA   . LEU A 1 78  ? -13.927 -4.183  4.941   1.00 0.00 ? 78  LEU A HA   2  
ATOM 2847  H HB2  . LEU A 1 78  ? -13.140 -1.549  6.157   1.00 0.00 ? 78  LEU A HB2  2  
ATOM 2848  H HB3  . LEU A 1 78  ? -12.213 -3.047  6.124   1.00 0.00 ? 78  LEU A HB3  2  
ATOM 2849  H HG   . LEU A 1 78  ? -12.835 -1.329  3.722   1.00 0.00 ? 78  LEU A HG   2  
ATOM 2850  H HD11 . LEU A 1 78  ? -10.176 -1.709  5.070   1.00 0.00 ? 78  LEU A HD11 2  
ATOM 2851  H HD12 . LEU A 1 78  ? -11.254 -0.365  5.442   1.00 0.00 ? 78  LEU A HD12 2  
ATOM 2852  H HD13 . LEU A 1 78  ? -10.610 -0.552  3.811   1.00 0.00 ? 78  LEU A HD13 2  
ATOM 2853  H HD21 . LEU A 1 78  ? -12.587 -3.734  3.232   1.00 0.00 ? 78  LEU A HD21 2  
ATOM 2854  H HD22 . LEU A 1 78  ? -11.001 -3.707  4.005   1.00 0.00 ? 78  LEU A HD22 2  
ATOM 2855  H HD23 . LEU A 1 78  ? -11.287 -2.762  2.542   1.00 0.00 ? 78  LEU A HD23 2  
ATOM 2856  N N    . LYS A 1 79  ? -14.369 -4.208  7.534   1.00 0.00 ? 79  LYS A N    2  
ATOM 2857  C CA   . LYS A 1 79  ? -14.979 -4.463  8.834   1.00 0.00 ? 79  LYS A CA   2  
ATOM 2858  C C    . LYS A 1 79  ? -14.610 -3.370  9.832   1.00 0.00 ? 79  LYS A C    2  
ATOM 2859  O O    . LYS A 1 79  ? -13.632 -2.647  9.643   1.00 0.00 ? 79  LYS A O    2  
ATOM 2860  C CB   . LYS A 1 79  ? -14.538 -5.827  9.369   1.00 0.00 ? 79  LYS A CB   2  
ATOM 2861  C CG   . LYS A 1 79  ? -15.069 -6.998  8.560   1.00 0.00 ? 79  LYS A CG   2  
ATOM 2862  C CD   . LYS A 1 79  ? -14.610 -8.327  9.136   1.00 0.00 ? 79  LYS A CD   2  
ATOM 2863  C CE   . LYS A 1 79  ? -15.461 -8.742  10.326  1.00 0.00 ? 79  LYS A CE   2  
ATOM 2864  N NZ   . LYS A 1 79  ? -15.463 -10.219 10.519  1.00 0.00 ? 79  LYS A NZ   2  
ATOM 2865  H H    . LYS A 1 79  ? -13.525 -4.653  7.307   1.00 0.00 ? 79  LYS A H    2  
ATOM 2866  H HA   . LYS A 1 79  ? -16.050 -4.466  8.702   1.00 0.00 ? 79  LYS A HA   2  
ATOM 2867  H HB2  . LYS A 1 79  ? -13.459 -5.871  9.362   1.00 0.00 ? 79  LYS A HB2  2  
ATOM 2868  H HB3  . LYS A 1 79  ? -14.887 -5.932  10.386  1.00 0.00 ? 79  LYS A HB3  2  
ATOM 2869  H HG2  . LYS A 1 79  ? -16.148 -6.969  8.566   1.00 0.00 ? 79  LYS A HG2  2  
ATOM 2870  H HG3  . LYS A 1 79  ? -14.710 -6.914  7.544   1.00 0.00 ? 79  LYS A HG3  2  
ATOM 2871  H HD2  . LYS A 1 79  ? -14.686 -9.087  8.372   1.00 0.00 ? 79  LYS A HD2  2  
ATOM 2872  H HD3  . LYS A 1 79  ? -13.581 -8.236  9.455   1.00 0.00 ? 79  LYS A HD3  2  
ATOM 2873  H HE2  . LYS A 1 79  ? -15.068 -8.272  11.215  1.00 0.00 ? 79  LYS A HE2  2  
ATOM 2874  H HE3  . LYS A 1 79  ? -16.475 -8.408  10.161  1.00 0.00 ? 79  LYS A HE3  2  
ATOM 2875  H HZ1  . LYS A 1 79  ? -14.979 -10.683 9.724   1.00 0.00 ? 79  LYS A HZ1  2  
ATOM 2876  H HZ2  . LYS A 1 79  ? -16.440 -10.571 10.569  1.00 0.00 ? 79  LYS A HZ2  2  
ATOM 2877  H HZ3  . LYS A 1 79  ? -14.972 -10.465 11.402  1.00 0.00 ? 79  LYS A HZ3  2  
ATOM 2878  N N    . LYS A 1 80  ? -15.397 -3.256  10.896  1.00 0.00 ? 80  LYS A N    2  
ATOM 2879  C CA   . LYS A 1 80  ? -15.152 -2.254  11.926  1.00 0.00 ? 80  LYS A CA   2  
ATOM 2880  C C    . LYS A 1 80  ? -14.108 -2.744  12.924  1.00 0.00 ? 80  LYS A C    2  
ATOM 2881  O O    . LYS A 1 80  ? -14.145 -3.894  13.362  1.00 0.00 ? 80  LYS A O    2  
ATOM 2882  C CB   . LYS A 1 80  ? -16.453 -1.916  12.658  1.00 0.00 ? 80  LYS A CB   2  
ATOM 2883  C CG   . LYS A 1 80  ? -17.545 -1.386  11.744  1.00 0.00 ? 80  LYS A CG   2  
ATOM 2884  C CD   . LYS A 1 80  ? -18.400 -2.511  11.186  1.00 0.00 ? 80  LYS A CD   2  
ATOM 2885  C CE   . LYS A 1 80  ? -19.641 -1.974  10.489  1.00 0.00 ? 80  LYS A CE   2  
ATOM 2886  N NZ   . LYS A 1 80  ? -20.600 -3.061  10.149  1.00 0.00 ? 80  LYS A NZ   2  
ATOM 2887  H H    . LYS A 1 80  ? -16.162 -3.863  10.991  1.00 0.00 ? 80  LYS A H    2  
ATOM 2888  H HA   . LYS A 1 80  ? -14.780 -1.364  11.441  1.00 0.00 ? 80  LYS A HA   2  
ATOM 2889  H HB2  . LYS A 1 80  ? -16.821 -2.808  13.143  1.00 0.00 ? 80  LYS A HB2  2  
ATOM 2890  H HB3  . LYS A 1 80  ? -16.246 -1.167  13.409  1.00 0.00 ? 80  LYS A HB3  2  
ATOM 2891  H HG2  . LYS A 1 80  ? -18.176 -0.713  12.305  1.00 0.00 ? 80  LYS A HG2  2  
ATOM 2892  H HG3  . LYS A 1 80  ? -17.087 -0.852  10.924  1.00 0.00 ? 80  LYS A HG3  2  
ATOM 2893  H HD2  . LYS A 1 80  ? -17.817 -3.075  10.474  1.00 0.00 ? 80  LYS A HD2  2  
ATOM 2894  H HD3  . LYS A 1 80  ? -18.704 -3.157  11.997  1.00 0.00 ? 80  LYS A HD3  2  
ATOM 2895  H HE2  . LYS A 1 80  ? -20.128 -1.267  11.143  1.00 0.00 ? 80  LYS A HE2  2  
ATOM 2896  H HE3  . LYS A 1 80  ? -19.339 -1.475  9.580   1.00 0.00 ? 80  LYS A HE3  2  
ATOM 2897  H HZ1  . LYS A 1 80  ? -20.858 -3.591  11.007  1.00 0.00 ? 80  LYS A HZ1  2  
ATOM 2898  H HZ2  . LYS A 1 80  ? -20.170 -3.717  9.467   1.00 0.00 ? 80  LYS A HZ2  2  
ATOM 2899  H HZ3  . LYS A 1 80  ? -21.463 -2.659  9.731   1.00 0.00 ? 80  LYS A HZ3  2  
ATOM 2900  N N    . TYR A 1 81  ? -13.179 -1.864  13.281  1.00 0.00 ? 81  TYR A N    2  
ATOM 2901  C CA   . TYR A 1 81  ? -12.124 -2.207  14.227  1.00 0.00 ? 81  TYR A CA   2  
ATOM 2902  C C    . TYR A 1 81  ? -11.303 -3.390  13.721  1.00 0.00 ? 81  TYR A C    2  
ATOM 2903  O O    . TYR A 1 81  ? -10.975 -4.303  14.479  1.00 0.00 ? 81  TYR A O    2  
ATOM 2904  C CB   . TYR A 1 81  ? -12.724 -2.536  15.595  1.00 0.00 ? 81  TYR A CB   2  
ATOM 2905  C CG   . TYR A 1 81  ? -11.800 -2.226  16.751  1.00 0.00 ? 81  TYR A CG   2  
ATOM 2906  C CD1  . TYR A 1 81  ? -11.435 -0.918  17.043  1.00 0.00 ? 81  TYR A CD1  2  
ATOM 2907  C CD2  . TYR A 1 81  ? -11.294 -3.242  17.553  1.00 0.00 ? 81  TYR A CD2  2  
ATOM 2908  C CE1  . TYR A 1 81  ? -10.591 -0.630  18.098  1.00 0.00 ? 81  TYR A CE1  2  
ATOM 2909  C CE2  . TYR A 1 81  ? -10.451 -2.963  18.611  1.00 0.00 ? 81  TYR A CE2  2  
ATOM 2910  C CZ   . TYR A 1 81  ? -10.102 -1.656  18.879  1.00 0.00 ? 81  TYR A CZ   2  
ATOM 2911  O OH   . TYR A 1 81  ? -9.262  -1.373  19.932  1.00 0.00 ? 81  TYR A OH   2  
ATOM 2912  H H    . TYR A 1 81  ? -13.202 -0.962  12.898  1.00 0.00 ? 81  TYR A H    2  
ATOM 2913  H HA   . TYR A 1 81  ? -11.475 -1.349  14.326  1.00 0.00 ? 81  TYR A HA   2  
ATOM 2914  H HB2  . TYR A 1 81  ? -13.628 -1.963  15.731  1.00 0.00 ? 81  TYR A HB2  2  
ATOM 2915  H HB3  . TYR A 1 81  ? -12.961 -3.589  15.632  1.00 0.00 ? 81  TYR A HB3  2  
ATOM 2916  H HD1  . TYR A 1 81  ? -11.820 -0.116  16.429  1.00 0.00 ? 81  TYR A HD1  2  
ATOM 2917  H HD2  . TYR A 1 81  ? -11.570 -4.264  17.341  1.00 0.00 ? 81  TYR A HD2  2  
ATOM 2918  H HE1  . TYR A 1 81  ? -10.318 0.394   18.308  1.00 0.00 ? 81  TYR A HE1  2  
ATOM 2919  H HE2  . TYR A 1 81  ? -10.067 -3.766  19.223  1.00 0.00 ? 81  TYR A HE2  2  
ATOM 2920  H HH   . TYR A 1 81  ? -8.809  -2.175  20.204  1.00 0.00 ? 81  TYR A HH   2  
ATOM 2921  N N    . THR A 1 82  ? -10.973 -3.365  12.434  1.00 0.00 ? 82  THR A N    2  
ATOM 2922  C CA   . THR A 1 82  ? -10.191 -4.434  11.825  1.00 0.00 ? 82  THR A CA   2  
ATOM 2923  C C    . THR A 1 82  ? -8.915  -3.890  11.192  1.00 0.00 ? 82  THR A C    2  
ATOM 2924  O O    . THR A 1 82  ? -8.934  -2.853  10.529  1.00 0.00 ? 82  THR A O    2  
ATOM 2925  C CB   . THR A 1 82  ? -11.003 -5.184  10.752  1.00 0.00 ? 82  THR A CB   2  
ATOM 2926  O OG1  . THR A 1 82  ? -12.168 -5.772  11.342  1.00 0.00 ? 82  THR A OG1  2  
ATOM 2927  C CG2  . THR A 1 82  ? -10.161 -6.266  10.094  1.00 0.00 ? 82  THR A CG2  2  
ATOM 2928  H H    . THR A 1 82  ? -11.263 -2.610  11.881  1.00 0.00 ? 82  THR A H    2  
ATOM 2929  H HA   . THR A 1 82  ? -9.925  -5.136  12.601  1.00 0.00 ? 82  THR A HA   2  
ATOM 2930  H HB   . THR A 1 82  ? -11.310 -4.476  9.995   1.00 0.00 ? 82  THR A HB   2  
ATOM 2931  H HG1  . THR A 1 82  ? -12.908 -5.165  11.262  1.00 0.00 ? 82  THR A HG1  2  
ATOM 2932  H HG21 . THR A 1 82  ? -9.784  -5.903  9.149   1.00 0.00 ? 82  THR A HG21 2  
ATOM 2933  H HG22 . THR A 1 82  ? -10.768 -7.143  9.927   1.00 0.00 ? 82  THR A HG22 2  
ATOM 2934  H HG23 . THR A 1 82  ? -9.333  -6.519  10.738  1.00 0.00 ? 82  THR A HG23 2  
ATOM 2935  N N    . GLU A 1 83  ? -7.808  -4.596  11.401  1.00 0.00 ? 83  GLU A N    2  
ATOM 2936  C CA   . GLU A 1 83  ? -6.523  -4.182  10.850  1.00 0.00 ? 83  GLU A CA   2  
ATOM 2937  C C    . GLU A 1 83  ? -6.437  -4.514  9.363   1.00 0.00 ? 83  GLU A C    2  
ATOM 2938  O O    . GLU A 1 83  ? -7.032  -5.486  8.897   1.00 0.00 ? 83  GLU A O    2  
ATOM 2939  C CB   . GLU A 1 83  ? -5.378  -4.861  11.602  1.00 0.00 ? 83  GLU A CB   2  
ATOM 2940  C CG   . GLU A 1 83  ? -4.097  -4.044  11.628  1.00 0.00 ? 83  GLU A CG   2  
ATOM 2941  C CD   . GLU A 1 83  ? -3.033  -4.655  12.518  1.00 0.00 ? 83  GLU A CD   2  
ATOM 2942  O OE1  . GLU A 1 83  ? -2.347  -5.595  12.065  1.00 0.00 ? 83  GLU A OE1  2  
ATOM 2943  O OE2  . GLU A 1 83  ? -2.886  -4.193  13.669  1.00 0.00 ? 83  GLU A OE2  2  
ATOM 2944  H H    . GLU A 1 83  ? -7.857  -5.414  11.938  1.00 0.00 ? 83  GLU A H    2  
ATOM 2945  H HA   . GLU A 1 83  ? -6.439  -3.113  10.973  1.00 0.00 ? 83  GLU A HA   2  
ATOM 2946  H HB2  . GLU A 1 83  ? -5.688  -5.039  12.622  1.00 0.00 ? 83  GLU A HB2  2  
ATOM 2947  H HB3  . GLU A 1 83  ? -5.165  -5.809  11.130  1.00 0.00 ? 83  GLU A HB3  2  
ATOM 2948  H HG2  . GLU A 1 83  ? -3.708  -3.977  10.623  1.00 0.00 ? 83  GLU A HG2  2  
ATOM 2949  H HG3  . GLU A 1 83  ? -4.324  -3.053  11.991  1.00 0.00 ? 83  GLU A HG3  2  
ATOM 2950  N N    . TYR A 1 84  ? -5.693  -3.699  8.623   1.00 0.00 ? 84  TYR A N    2  
ATOM 2951  C CA   . TYR A 1 84  ? -5.531  -3.903  7.189   1.00 0.00 ? 84  TYR A CA   2  
ATOM 2952  C C    . TYR A 1 84  ? -4.161  -3.421  6.721   1.00 0.00 ? 84  TYR A C    2  
ATOM 2953  O O    . TYR A 1 84  ? -3.767  -2.285  6.985   1.00 0.00 ? 84  TYR A O    2  
ATOM 2954  C CB   . TYR A 1 84  ? -6.631  -3.169  6.420   1.00 0.00 ? 84  TYR A CB   2  
ATOM 2955  C CG   . TYR A 1 84  ? -8.014  -3.735  6.654   1.00 0.00 ? 84  TYR A CG   2  
ATOM 2956  C CD1  . TYR A 1 84  ? -8.429  -4.896  6.014   1.00 0.00 ? 84  TYR A CD1  2  
ATOM 2957  C CD2  . TYR A 1 84  ? -8.905  -3.109  7.517   1.00 0.00 ? 84  TYR A CD2  2  
ATOM 2958  C CE1  . TYR A 1 84  ? -9.691  -5.416  6.225   1.00 0.00 ? 84  TYR A CE1  2  
ATOM 2959  C CE2  . TYR A 1 84  ? -10.169 -3.622  7.735   1.00 0.00 ? 84  TYR A CE2  2  
ATOM 2960  C CZ   . TYR A 1 84  ? -10.557 -4.775  7.086   1.00 0.00 ? 84  TYR A CZ   2  
ATOM 2961  O OH   . TYR A 1 84  ? -11.815 -5.291  7.300   1.00 0.00 ? 84  TYR A OH   2  
ATOM 2962  H H    . TYR A 1 84  ? -5.244  -2.941  9.051   1.00 0.00 ? 84  TYR A H    2  
ATOM 2963  H HA   . TYR A 1 84  ? -5.613  -4.962  6.993   1.00 0.00 ? 84  TYR A HA   2  
ATOM 2964  H HB2  . TYR A 1 84  ? -6.642  -2.133  6.721   1.00 0.00 ? 84  TYR A HB2  2  
ATOM 2965  H HB3  . TYR A 1 84  ? -6.423  -3.229  5.362   1.00 0.00 ? 84  TYR A HB3  2  
ATOM 2966  H HD1  . TYR A 1 84  ? -7.747  -5.395  5.340   1.00 0.00 ? 84  TYR A HD1  2  
ATOM 2967  H HD2  . TYR A 1 84  ? -8.597  -2.205  8.024   1.00 0.00 ? 84  TYR A HD2  2  
ATOM 2968  H HE1  . TYR A 1 84  ? -9.995  -6.319  5.717   1.00 0.00 ? 84  TYR A HE1  2  
ATOM 2969  H HE2  . TYR A 1 84  ? -10.847 -3.121  8.409   1.00 0.00 ? 84  TYR A HE2  2  
ATOM 2970  H HH   . TYR A 1 84  ? -11.764 -6.002  7.942   1.00 0.00 ? 84  TYR A HH   2  
ATOM 2971  N N    . SER A 1 85  ? -3.439  -4.294  6.025   1.00 0.00 ? 85  SER A N    2  
ATOM 2972  C CA   . SER A 1 85  ? -2.112  -3.960  5.523   1.00 0.00 ? 85  SER A CA   2  
ATOM 2973  C C    . SER A 1 85  ? -2.205  -3.196  4.206   1.00 0.00 ? 85  SER A C    2  
ATOM 2974  O O    . SER A 1 85  ? -3.017  -3.525  3.340   1.00 0.00 ? 85  SER A O    2  
ATOM 2975  C CB   . SER A 1 85  ? -1.282  -5.231  5.330   1.00 0.00 ? 85  SER A CB   2  
ATOM 2976  O OG   . SER A 1 85  ? 0.102   -4.964  5.481   1.00 0.00 ? 85  SER A OG   2  
ATOM 2977  H H    . SER A 1 85  ? -3.808  -5.185  5.848   1.00 0.00 ? 85  SER A H    2  
ATOM 2978  H HA   . SER A 1 85  ? -1.628  -3.332  6.256   1.00 0.00 ? 85  SER A HA   2  
ATOM 2979  H HB2  . SER A 1 85  ? -1.577  -5.965  6.064   1.00 0.00 ? 85  SER A HB2  2  
ATOM 2980  H HB3  . SER A 1 85  ? -1.455  -5.624  4.339   1.00 0.00 ? 85  SER A HB3  2  
ATOM 2981  H HG   . SER A 1 85  ? 0.341   -5.027  6.409   1.00 0.00 ? 85  SER A HG   2  
ATOM 2982  N N    . PHE A 1 86  ? -1.369  -2.174  4.061   1.00 0.00 ? 86  PHE A N    2  
ATOM 2983  C CA   . PHE A 1 86  ? -1.356  -1.361  2.851   1.00 0.00 ? 86  PHE A CA   2  
ATOM 2984  C C    . PHE A 1 86  ? 0.073   -1.097  2.387   1.00 0.00 ? 86  PHE A C    2  
ATOM 2985  O O    . PHE A 1 86  ? 0.959   -0.823  3.196   1.00 0.00 ? 86  PHE A O    2  
ATOM 2986  C CB   . PHE A 1 86  ? -2.078  -0.034  3.095   1.00 0.00 ? 86  PHE A CB   2  
ATOM 2987  C CG   . PHE A 1 86  ? -3.532  -0.197  3.436   1.00 0.00 ? 86  PHE A CG   2  
ATOM 2988  C CD1  . PHE A 1 86  ? -4.459  -0.496  2.451   1.00 0.00 ? 86  PHE A CD1  2  
ATOM 2989  C CD2  . PHE A 1 86  ? -3.971  -0.050  4.742   1.00 0.00 ? 86  PHE A CD2  2  
ATOM 2990  C CE1  . PHE A 1 86  ? -5.797  -0.645  2.762   1.00 0.00 ? 86  PHE A CE1  2  
ATOM 2991  C CE2  . PHE A 1 86  ? -5.308  -0.198  5.059   1.00 0.00 ? 86  PHE A CE2  2  
ATOM 2992  C CZ   . PHE A 1 86  ? -6.222  -0.497  4.068   1.00 0.00 ? 86  PHE A CZ   2  
ATOM 2993  H H    . PHE A 1 86  ? -0.744  -1.961  4.787   1.00 0.00 ? 86  PHE A H    2  
ATOM 2994  H HA   . PHE A 1 86  ? -1.877  -1.908  2.080   1.00 0.00 ? 86  PHE A HA   2  
ATOM 2995  H HB2  . PHE A 1 86  ? -1.601  0.482   3.914   1.00 0.00 ? 86  PHE A HB2  2  
ATOM 2996  H HB3  . PHE A 1 86  ? -2.011  0.573   2.204   1.00 0.00 ? 86  PHE A HB3  2  
ATOM 2997  H HD1  . PHE A 1 86  ? -4.128  -0.614  1.429   1.00 0.00 ? 86  PHE A HD1  2  
ATOM 2998  H HD2  . PHE A 1 86  ? -3.256  0.184   5.518   1.00 0.00 ? 86  PHE A HD2  2  
ATOM 2999  H HE1  . PHE A 1 86  ? -6.510  -0.880  1.986   1.00 0.00 ? 86  PHE A HE1  2  
ATOM 3000  H HE2  . PHE A 1 86  ? -5.637  -0.081  6.081   1.00 0.00 ? 86  PHE A HE2  2  
ATOM 3001  H HZ   . PHE A 1 86  ? -7.267  -0.613  4.314   1.00 0.00 ? 86  PHE A HZ   2  
ATOM 3002  N N    . ARG A 1 87  ? 0.290   -1.184  1.078   1.00 0.00 ? 87  ARG A N    2  
ATOM 3003  C CA   . ARG A 1 87  ? 1.611   -0.957  0.506   1.00 0.00 ? 87  ARG A CA   2  
ATOM 3004  C C    . ARG A 1 87  ? 1.503   -0.308  -0.871  1.00 0.00 ? 87  ARG A C    2  
ATOM 3005  O O    . ARG A 1 87  ? 0.736   -0.758  -1.722  1.00 0.00 ? 87  ARG A O    2  
ATOM 3006  C CB   . ARG A 1 87  ? 2.379   -2.276  0.402   1.00 0.00 ? 87  ARG A CB   2  
ATOM 3007  C CG   . ARG A 1 87  ? 1.727   -3.288  -0.527  1.00 0.00 ? 87  ARG A CG   2  
ATOM 3008  C CD   . ARG A 1 87  ? 2.644   -4.471  -0.792  1.00 0.00 ? 87  ARG A CD   2  
ATOM 3009  N NE   . ARG A 1 87  ? 2.261   -5.201  -1.998  1.00 0.00 ? 87  ARG A NE   2  
ATOM 3010  C CZ   . ARG A 1 87  ? 3.015   -6.138  -2.561  1.00 0.00 ? 87  ARG A CZ   2  
ATOM 3011  N NH1  . ARG A 1 87  ? 4.187   -6.459  -2.029  1.00 0.00 ? 87  ARG A NH1  2  
ATOM 3012  N NH2  . ARG A 1 87  ? 2.598   -6.758  -3.657  1.00 0.00 ? 87  ARG A NH2  2  
ATOM 3013  H H    . ARG A 1 87  ? -0.457  -1.406  0.483   1.00 0.00 ? 87  ARG A H    2  
ATOM 3014  H HA   . ARG A 1 87  ? 2.147   -0.289  1.164   1.00 0.00 ? 87  ARG A HA   2  
ATOM 3015  H HB2  . ARG A 1 87  ? 3.374   -2.072  0.034   1.00 0.00 ? 87  ARG A HB2  2  
ATOM 3016  H HB3  . ARG A 1 87  ? 2.450   -2.715  1.385   1.00 0.00 ? 87  ARG A HB3  2  
ATOM 3017  H HG2  . ARG A 1 87  ? 0.817   -3.648  -0.070  1.00 0.00 ? 87  ARG A HG2  2  
ATOM 3018  H HG3  . ARG A 1 87  ? 1.496   -2.805  -1.464  1.00 0.00 ? 87  ARG A HG3  2  
ATOM 3019  H HD2  . ARG A 1 87  ? 3.654   -4.108  -0.909  1.00 0.00 ? 87  ARG A HD2  2  
ATOM 3020  H HD3  . ARG A 1 87  ? 2.599   -5.141  0.053   1.00 0.00 ? 87  ARG A HD3  2  
ATOM 3021  H HE   . ARG A 1 87  ? 1.399   -4.980  -2.408  1.00 0.00 ? 87  ARG A HE   2  
ATOM 3022  H HH11 . ARG A 1 87  ? 4.504   -5.994  -1.202  1.00 0.00 ? 87  ARG A HH11 2  
ATOM 3023  H HH12 . ARG A 1 87  ? 4.752   -7.166  -2.454  1.00 0.00 ? 87  ARG A HH12 2  
ATOM 3024  H HH21 . ARG A 1 87  ? 1.715   -6.519  -4.061  1.00 0.00 ? 87  ARG A HH21 2  
ATOM 3025  H HH22 . ARG A 1 87  ? 3.166   -7.463  -4.080  1.00 0.00 ? 87  ARG A HH22 2  
ATOM 3026  N N    . VAL A 1 88  ? 2.277   0.752   -1.083  1.00 0.00 ? 88  VAL A N    2  
ATOM 3027  C CA   . VAL A 1 88  ? 2.269   1.462   -2.356  1.00 0.00 ? 88  VAL A CA   2  
ATOM 3028  C C    . VAL A 1 88  ? 3.406   0.990   -3.256  1.00 0.00 ? 88  VAL A C    2  
ATOM 3029  O O    . VAL A 1 88  ? 4.510   0.715   -2.787  1.00 0.00 ? 88  VAL A O    2  
ATOM 3030  C CB   . VAL A 1 88  ? 2.389   2.984   -2.151  1.00 0.00 ? 88  VAL A CB   2  
ATOM 3031  C CG1  . VAL A 1 88  ? 2.761   3.671   -3.456  1.00 0.00 ? 88  VAL A CG1  2  
ATOM 3032  C CG2  . VAL A 1 88  ? 1.092   3.549   -1.592  1.00 0.00 ? 88  VAL A CG2  2  
ATOM 3033  H H    . VAL A 1 88  ? 2.868   1.063   -0.366  1.00 0.00 ? 88  VAL A H    2  
ATOM 3034  H HA   . VAL A 1 88  ? 1.327   1.259   -2.846  1.00 0.00 ? 88  VAL A HA   2  
ATOM 3035  H HB   . VAL A 1 88  ? 3.177   3.169   -1.435  1.00 0.00 ? 88  VAL A HB   2  
ATOM 3036  H HG11 . VAL A 1 88  ? 2.131   3.299   -4.251  1.00 0.00 ? 88  VAL A HG11 2  
ATOM 3037  H HG12 . VAL A 1 88  ? 2.623   4.737   -3.354  1.00 0.00 ? 88  VAL A HG12 2  
ATOM 3038  H HG13 . VAL A 1 88  ? 3.795   3.462   -3.691  1.00 0.00 ? 88  VAL A HG13 2  
ATOM 3039  H HG21 . VAL A 1 88  ? 1.310   4.421   -0.993  1.00 0.00 ? 88  VAL A HG21 2  
ATOM 3040  H HG22 . VAL A 1 88  ? 0.439   3.827   -2.406  1.00 0.00 ? 88  VAL A HG22 2  
ATOM 3041  H HG23 . VAL A 1 88  ? 0.608   2.803   -0.980  1.00 0.00 ? 88  VAL A HG23 2  
ATOM 3042  N N    . VAL A 1 89  ? 3.128   0.899   -4.553  1.00 0.00 ? 89  VAL A N    2  
ATOM 3043  C CA   . VAL A 1 89  ? 4.128   0.462   -5.520  1.00 0.00 ? 89  VAL A CA   2  
ATOM 3044  C C    . VAL A 1 89  ? 4.155   1.381   -6.736  1.00 0.00 ? 89  VAL A C    2  
ATOM 3045  O O    . VAL A 1 89  ? 3.115   1.692   -7.315  1.00 0.00 ? 89  VAL A O    2  
ATOM 3046  C CB   . VAL A 1 89  ? 3.863   -0.982  -5.987  1.00 0.00 ? 89  VAL A CB   2  
ATOM 3047  C CG1  . VAL A 1 89  ? 4.901   -1.410  -7.013  1.00 0.00 ? 89  VAL A CG1  2  
ATOM 3048  C CG2  . VAL A 1 89  ? 3.852   -1.932  -4.799  1.00 0.00 ? 89  VAL A CG2  2  
ATOM 3049  H H    . VAL A 1 89  ? 2.229   1.132   -4.867  1.00 0.00 ? 89  VAL A H    2  
ATOM 3050  H HA   . VAL A 1 89  ? 5.094   0.490   -5.037  1.00 0.00 ? 89  VAL A HA   2  
ATOM 3051  H HB   . VAL A 1 89  ? 2.891   -1.014  -6.456  1.00 0.00 ? 89  VAL A HB   2  
ATOM 3052  H HG11 . VAL A 1 89  ? 5.884   -1.116  -6.675  1.00 0.00 ? 89  VAL A HG11 2  
ATOM 3053  H HG12 . VAL A 1 89  ? 4.866   -2.483  -7.135  1.00 0.00 ? 89  VAL A HG12 2  
ATOM 3054  H HG13 . VAL A 1 89  ? 4.690   -0.933  -7.959  1.00 0.00 ? 89  VAL A HG13 2  
ATOM 3055  H HG21 . VAL A 1 89  ? 4.205   -2.904  -5.113  1.00 0.00 ? 89  VAL A HG21 2  
ATOM 3056  H HG22 . VAL A 1 89  ? 4.500   -1.548  -4.024  1.00 0.00 ? 89  VAL A HG22 2  
ATOM 3057  H HG23 . VAL A 1 89  ? 2.846   -2.020  -4.417  1.00 0.00 ? 89  VAL A HG23 2  
ATOM 3058  N N    . ALA A 1 90  ? 5.353   1.812   -7.118  1.00 0.00 ? 90  ALA A N    2  
ATOM 3059  C CA   . ALA A 1 90  ? 5.516   2.694   -8.267  1.00 0.00 ? 90  ALA A CA   2  
ATOM 3060  C C    . ALA A 1 90  ? 5.651   1.894   -9.558  1.00 0.00 ? 90  ALA A C    2  
ATOM 3061  O O    . ALA A 1 90  ? 6.427   0.941   -9.632  1.00 0.00 ? 90  ALA A O    2  
ATOM 3062  C CB   . ALA A 1 90  ? 6.727   3.594   -8.073  1.00 0.00 ? 90  ALA A CB   2  
ATOM 3063  H H    . ALA A 1 90  ? 6.145   1.529   -6.616  1.00 0.00 ? 90  ALA A H    2  
ATOM 3064  H HA   . ALA A 1 90  ? 4.639   3.321   -8.334  1.00 0.00 ? 90  ALA A HA   2  
ATOM 3065  H HB1  . ALA A 1 90  ? 7.544   3.232   -8.681  1.00 0.00 ? 90  ALA A HB1  2  
ATOM 3066  H HB2  . ALA A 1 90  ? 6.477   4.602   -8.368  1.00 0.00 ? 90  ALA A HB2  2  
ATOM 3067  H HB3  . ALA A 1 90  ? 7.020   3.584   -7.034  1.00 0.00 ? 90  ALA A HB3  2  
ATOM 3068  N N    . TYR A 1 91  ? 4.889   2.286   -10.573 1.00 0.00 ? 91  TYR A N    2  
ATOM 3069  C CA   . TYR A 1 91  ? 4.921   1.603   -11.861 1.00 0.00 ? 91  TYR A CA   2  
ATOM 3070  C C    . TYR A 1 91  ? 5.291   2.570   -12.982 1.00 0.00 ? 91  TYR A C    2  
ATOM 3071  O O    . TYR A 1 91  ? 4.573   3.533   -13.248 1.00 0.00 ? 91  TYR A O    2  
ATOM 3072  C CB   . TYR A 1 91  ? 3.565   0.960   -12.155 1.00 0.00 ? 91  TYR A CB   2  
ATOM 3073  C CG   . TYR A 1 91  ? 3.417   -0.431  -11.580 1.00 0.00 ? 91  TYR A CG   2  
ATOM 3074  C CD1  . TYR A 1 91  ? 2.961   -0.624  -10.282 1.00 0.00 ? 91  TYR A CD1  2  
ATOM 3075  C CD2  . TYR A 1 91  ? 3.734   -1.553  -12.337 1.00 0.00 ? 91  TYR A CD2  2  
ATOM 3076  C CE1  . TYR A 1 91  ? 2.826   -1.892  -9.753  1.00 0.00 ? 91  TYR A CE1  2  
ATOM 3077  C CE2  . TYR A 1 91  ? 3.600   -2.826  -11.816 1.00 0.00 ? 91  TYR A CE2  2  
ATOM 3078  C CZ   . TYR A 1 91  ? 3.146   -2.990  -10.524 1.00 0.00 ? 91  TYR A CZ   2  
ATOM 3079  O OH   . TYR A 1 91  ? 3.011   -4.256  -10.002 1.00 0.00 ? 91  TYR A OH   2  
ATOM 3080  H H    . TYR A 1 91  ? 4.290   3.052   -10.454 1.00 0.00 ? 91  TYR A H    2  
ATOM 3081  H HA   . TYR A 1 91  ? 5.672   0.828   -11.807 1.00 0.00 ? 91  TYR A HA   2  
ATOM 3082  H HB2  . TYR A 1 91  ? 2.784   1.575   -11.736 1.00 0.00 ? 91  TYR A HB2  2  
ATOM 3083  H HB3  . TYR A 1 91  ? 3.429   0.893   -13.224 1.00 0.00 ? 91  TYR A HB3  2  
ATOM 3084  H HD1  . TYR A 1 91  ? 2.711   0.239   -9.681  1.00 0.00 ? 91  TYR A HD1  2  
ATOM 3085  H HD2  . TYR A 1 91  ? 4.089   -1.421  -13.348 1.00 0.00 ? 91  TYR A HD2  2  
ATOM 3086  H HE1  . TYR A 1 91  ? 2.470   -2.021  -8.742  1.00 0.00 ? 91  TYR A HE1  2  
ATOM 3087  H HE2  . TYR A 1 91  ? 3.851   -3.686  -12.419 1.00 0.00 ? 91  TYR A HE2  2  
ATOM 3088  H HH   . TYR A 1 91  ? 2.300   -4.262  -9.356  1.00 0.00 ? 91  TYR A HH   2  
ATOM 3089  N N    . ASN A 1 92  ? 6.417   2.305   -13.636 1.00 0.00 ? 92  ASN A N    2  
ATOM 3090  C CA   . ASN A 1 92  ? 6.884   3.151   -14.728 1.00 0.00 ? 92  ASN A CA   2  
ATOM 3091  C C    . ASN A 1 92  ? 7.345   2.305   -15.912 1.00 0.00 ? 92  ASN A C    2  
ATOM 3092  O O    . ASN A 1 92  ? 7.514   1.092   -15.794 1.00 0.00 ? 92  ASN A O    2  
ATOM 3093  C CB   . ASN A 1 92  ? 8.028   4.049   -14.253 1.00 0.00 ? 92  ASN A CB   2  
ATOM 3094  C CG   . ASN A 1 92  ? 9.223   3.253   -13.764 1.00 0.00 ? 92  ASN A CG   2  
ATOM 3095  O OD1  . ASN A 1 92  ? 9.144   2.037   -13.591 1.00 0.00 ? 92  ASN A OD1  2  
ATOM 3096  N ND2  . ASN A 1 92  ? 10.337  3.938   -13.538 1.00 0.00 ? 92  ASN A ND2  2  
ATOM 3097  H H    . ASN A 1 92  ? 6.947   1.522   -13.378 1.00 0.00 ? 92  ASN A H    2  
ATOM 3098  H HA   . ASN A 1 92  ? 6.058   3.771   -15.043 1.00 0.00 ? 92  ASN A HA   2  
ATOM 3099  H HB2  . ASN A 1 92  ? 8.349   4.676   -15.071 1.00 0.00 ? 92  ASN A HB2  2  
ATOM 3100  H HB3  . ASN A 1 92  ? 7.677   4.671   -13.443 1.00 0.00 ? 92  ASN A HB3  2  
ATOM 3101  H HD21 . ASN A 1 92  ? 10.327  4.906   -13.697 1.00 0.00 ? 92  ASN A HD21 2  
ATOM 3102  H HD22 . ASN A 1 92  ? 11.125  3.449   -13.221 1.00 0.00 ? 92  ASN A HD22 2  
ATOM 3103  N N    . LYS A 1 93  ? 7.546   2.955   -17.053 1.00 0.00 ? 93  LYS A N    2  
ATOM 3104  C CA   . LYS A 1 93  ? 7.989   2.266   -18.259 1.00 0.00 ? 93  LYS A CA   2  
ATOM 3105  C C    . LYS A 1 93  ? 9.030   1.202   -17.926 1.00 0.00 ? 93  LYS A C    2  
ATOM 3106  O O    . LYS A 1 93  ? 9.018   0.109   -18.493 1.00 0.00 ? 93  LYS A O    2  
ATOM 3107  C CB   . LYS A 1 93  ? 8.570   3.267   -19.260 1.00 0.00 ? 93  LYS A CB   2  
ATOM 3108  C CG   . LYS A 1 93  ? 9.872   3.901   -18.800 1.00 0.00 ? 93  LYS A CG   2  
ATOM 3109  C CD   . LYS A 1 93  ? 11.076  3.098   -19.262 1.00 0.00 ? 93  LYS A CD   2  
ATOM 3110  C CE   . LYS A 1 93  ? 11.351  3.307   -20.743 1.00 0.00 ? 93  LYS A CE   2  
ATOM 3111  N NZ   . LYS A 1 93  ? 12.136  4.548   -20.992 1.00 0.00 ? 93  LYS A NZ   2  
ATOM 3112  H H    . LYS A 1 93  ? 7.394   3.924   -17.085 1.00 0.00 ? 93  LYS A H    2  
ATOM 3113  H HA   . LYS A 1 93  ? 7.129   1.786   -18.702 1.00 0.00 ? 93  LYS A HA   2  
ATOM 3114  H HB2  . LYS A 1 93  ? 8.752   2.759   -20.195 1.00 0.00 ? 93  LYS A HB2  2  
ATOM 3115  H HB3  . LYS A 1 93  ? 7.848   4.055   -19.422 1.00 0.00 ? 93  LYS A HB3  2  
ATOM 3116  H HG2  . LYS A 1 93  ? 9.940   4.899   -19.208 1.00 0.00 ? 93  LYS A HG2  2  
ATOM 3117  H HG3  . LYS A 1 93  ? 9.876   3.950   -17.720 1.00 0.00 ? 93  LYS A HG3  2  
ATOM 3118  H HD2  . LYS A 1 93  ? 11.943  3.410   -18.699 1.00 0.00 ? 93  LYS A HD2  2  
ATOM 3119  H HD3  . LYS A 1 93  ? 10.888  2.049   -19.084 1.00 0.00 ? 93  LYS A HD3  2  
ATOM 3120  H HE2  . LYS A 1 93  ? 11.906  2.460   -21.116 1.00 0.00 ? 93  LYS A HE2  2  
ATOM 3121  H HE3  . LYS A 1 93  ? 10.407  3.377   -21.264 1.00 0.00 ? 93  LYS A HE3  2  
ATOM 3122  H HZ1  . LYS A 1 93  ? 12.350  5.022   -20.091 1.00 0.00 ? 93  LYS A HZ1  2  
ATOM 3123  H HZ2  . LYS A 1 93  ? 11.592  5.200   -21.593 1.00 0.00 ? 93  LYS A HZ2  2  
ATOM 3124  H HZ3  . LYS A 1 93  ? 13.029  4.316   -21.470 1.00 0.00 ? 93  LYS A HZ3  2  
ATOM 3125  N N    . HIS A 1 94  ? 9.928   1.528   -17.003 1.00 0.00 ? 94  HIS A N    2  
ATOM 3126  C CA   . HIS A 1 94  ? 10.975  0.598   -16.593 1.00 0.00 ? 94  HIS A CA   2  
ATOM 3127  C C    . HIS A 1 94  ? 10.373  -0.672  -16.000 1.00 0.00 ? 94  HIS A C    2  
ATOM 3128  O O    . HIS A 1 94  ? 10.482  -1.751  -16.580 1.00 0.00 ? 94  HIS A O    2  
ATOM 3129  C CB   . HIS A 1 94  ? 11.903  1.260   -15.574 1.00 0.00 ? 94  HIS A CB   2  
ATOM 3130  C CG   . HIS A 1 94  ? 12.669  2.422   -16.127 1.00 0.00 ? 94  HIS A CG   2  
ATOM 3131  N ND1  . HIS A 1 94  ? 13.607  2.297   -17.130 1.00 0.00 ? 94  HIS A ND1  2  
ATOM 3132  C CD2  . HIS A 1 94  ? 12.630  3.738   -15.813 1.00 0.00 ? 94  HIS A CD2  2  
ATOM 3133  C CE1  . HIS A 1 94  ? 14.113  3.485   -17.407 1.00 0.00 ? 94  HIS A CE1  2  
ATOM 3134  N NE2  . HIS A 1 94  ? 13.537  4.377   -16.622 1.00 0.00 ? 94  HIS A NE2  2  
ATOM 3135  H H    . HIS A 1 94  ? 9.886   2.414   -16.587 1.00 0.00 ? 94  HIS A H    2  
ATOM 3136  H HA   . HIS A 1 94  ? 11.547  0.335   -17.470 1.00 0.00 ? 94  HIS A HA   2  
ATOM 3137  H HB2  . HIS A 1 94  ? 11.316  1.617   -14.740 1.00 0.00 ? 94  HIS A HB2  2  
ATOM 3138  H HB3  . HIS A 1 94  ? 12.617  0.530   -15.219 1.00 0.00 ? 94  HIS A HB3  2  
ATOM 3139  H HD1  . HIS A 1 94  ? 13.865  1.461   -17.571 1.00 0.00 ? 94  HIS A HD1  2  
ATOM 3140  H HD2  . HIS A 1 94  ? 12.003  4.201   -15.064 1.00 0.00 ? 94  HIS A HD2  2  
ATOM 3141  H HE1  . HIS A 1 94  ? 14.869  3.692   -18.150 1.00 0.00 ? 94  HIS A HE1  2  
ATOM 3142  H HE2  . HIS A 1 94  ? 13.790  5.322   -16.561 1.00 0.00 ? 94  HIS A HE2  2  
ATOM 3143  N N    . GLY A 1 95  ? 9.737   -0.535  -14.841 1.00 0.00 ? 95  GLY A N    2  
ATOM 3144  C CA   . GLY A 1 95  ? 9.127   -1.679  -14.189 1.00 0.00 ? 95  GLY A CA   2  
ATOM 3145  C C    . GLY A 1 95  ? 8.751   -1.393  -12.749 1.00 0.00 ? 95  GLY A C    2  
ATOM 3146  O O    . GLY A 1 95  ? 9.075   -0.342  -12.197 1.00 0.00 ? 95  GLY A O    2  
ATOM 3147  H H    . GLY A 1 95  ? 9.681   0.351   -14.425 1.00 0.00 ? 95  GLY A H    2  
ATOM 3148  H HA2  . GLY A 1 95  ? 8.238   -1.958  -14.734 1.00 0.00 ? 95  GLY A HA2  2  
ATOM 3149  H HA3  . GLY A 1 95  ? 9.824   -2.504  -14.210 1.00 0.00 ? 95  GLY A HA3  2  
ATOM 3150  N N    . PRO A 1 96  ? 8.048   -2.345  -12.117 1.00 0.00 ? 96  PRO A N    2  
ATOM 3151  C CA   . PRO A 1 96  ? 7.611   -2.213  -10.724 1.00 0.00 ? 96  PRO A CA   2  
ATOM 3152  C C    . PRO A 1 96  ? 8.775   -2.283  -9.742  1.00 0.00 ? 96  PRO A C    2  
ATOM 3153  O O    . PRO A 1 96  ? 9.231   -3.366  -9.380  1.00 0.00 ? 96  PRO A O    2  
ATOM 3154  C CB   . PRO A 1 96  ? 6.676   -3.409  -10.531 1.00 0.00 ? 96  PRO A CB   2  
ATOM 3155  C CG   . PRO A 1 96  ? 7.133   -4.413  -11.532 1.00 0.00 ? 96  PRO A CG   2  
ATOM 3156  C CD   . PRO A 1 96  ? 7.627   -3.624  -12.713 1.00 0.00 ? 96  PRO A CD   2  
ATOM 3157  H HA   . PRO A 1 96  ? 7.062   -1.296  -10.566 1.00 0.00 ? 96  PRO A HA   2  
ATOM 3158  H HB2  . PRO A 1 96  ? 6.772   -3.785  -9.521  1.00 0.00 ? 96  PRO A HB2  2  
ATOM 3159  H HB3  . PRO A 1 96  ? 5.656   -3.107  -10.712 1.00 0.00 ? 96  PRO A HB3  2  
ATOM 3160  H HG2  . PRO A 1 96  ? 7.932   -5.008  -11.118 1.00 0.00 ? 96  PRO A HG2  2  
ATOM 3161  H HG3  . PRO A 1 96  ? 6.306   -5.044  -11.823 1.00 0.00 ? 96  PRO A HG3  2  
ATOM 3162  H HD2  . PRO A 1 96  ? 8.462   -4.126  -13.179 1.00 0.00 ? 96  PRO A HD2  2  
ATOM 3163  H HD3  . PRO A 1 96  ? 6.830   -3.472  -13.426 1.00 0.00 ? 96  PRO A HD3  2  
ATOM 3164  N N    . GLY A 1 97  ? 9.252   -1.118  -9.312  1.00 0.00 ? 97  GLY A N    2  
ATOM 3165  C CA   . GLY A 1 97  ? 10.359  -1.070  -8.375  1.00 0.00 ? 97  GLY A CA   2  
ATOM 3166  C C    . GLY A 1 97  ? 10.003  -1.664  -7.027  1.00 0.00 ? 97  GLY A C    2  
ATOM 3167  O O    . GLY A 1 97  ? 8.956   -2.293  -6.874  1.00 0.00 ? 97  GLY A O    2  
ATOM 3168  H H    . GLY A 1 97  ? 8.849   -0.285  -9.635  1.00 0.00 ? 97  GLY A H    2  
ATOM 3169  H HA2  . GLY A 1 97  ? 11.192  -1.618  -8.790  1.00 0.00 ? 97  GLY A HA2  2  
ATOM 3170  H HA3  . GLY A 1 97  ? 10.653  -0.040  -8.235  1.00 0.00 ? 97  GLY A HA3  2  
ATOM 3171  N N    . VAL A 1 98  ? 10.878  -1.465  -6.045  1.00 0.00 ? 98  VAL A N    2  
ATOM 3172  C CA   . VAL A 1 98  ? 10.651  -1.986  -4.703  1.00 0.00 ? 98  VAL A CA   2  
ATOM 3173  C C    . VAL A 1 98  ? 9.234   -1.684  -4.228  1.00 0.00 ? 98  VAL A C    2  
ATOM 3174  O O    . VAL A 1 98  ? 8.474   -0.996  -4.908  1.00 0.00 ? 98  VAL A O    2  
ATOM 3175  C CB   . VAL A 1 98  ? 11.656  -1.397  -3.695  1.00 0.00 ? 98  VAL A CB   2  
ATOM 3176  C CG1  . VAL A 1 98  ? 13.041  -1.985  -3.915  1.00 0.00 ? 98  VAL A CG1  2  
ATOM 3177  C CG2  . VAL A 1 98  ? 11.688  0.120   -3.802  1.00 0.00 ? 98  VAL A CG2  2  
ATOM 3178  H H    . VAL A 1 98  ? 11.694  -0.956  -6.228  1.00 0.00 ? 98  VAL A H    2  
ATOM 3179  H HA   . VAL A 1 98  ? 10.790  -3.058  -4.732  1.00 0.00 ? 98  VAL A HA   2  
ATOM 3180  H HB   . VAL A 1 98  ? 11.331  -1.660  -2.698  1.00 0.00 ? 98  VAL A HB   2  
ATOM 3181  H HG11 . VAL A 1 98  ? 13.124  -2.919  -3.378  1.00 0.00 ? 98  VAL A HG11 2  
ATOM 3182  H HG12 . VAL A 1 98  ? 13.195  -2.159  -4.970  1.00 0.00 ? 98  VAL A HG12 2  
ATOM 3183  H HG13 . VAL A 1 98  ? 13.787  -1.294  -3.551  1.00 0.00 ? 98  VAL A HG13 2  
ATOM 3184  H HG21 . VAL A 1 98  ? 11.055  0.548   -3.039  1.00 0.00 ? 98  VAL A HG21 2  
ATOM 3185  H HG22 . VAL A 1 98  ? 12.702  0.470   -3.665  1.00 0.00 ? 98  VAL A HG22 2  
ATOM 3186  H HG23 . VAL A 1 98  ? 11.333  0.421   -4.776  1.00 0.00 ? 98  VAL A HG23 2  
ATOM 3187  N N    . SER A 1 99  ? 8.886   -2.203  -3.055  1.00 0.00 ? 99  SER A N    2  
ATOM 3188  C CA   . SER A 1 99  ? 7.559   -1.992  -2.489  1.00 0.00 ? 99  SER A CA   2  
ATOM 3189  C C    . SER A 1 99  ? 7.655   -1.454  -1.065  1.00 0.00 ? 99  SER A C    2  
ATOM 3190  O O    . SER A 1 99  ? 8.452   -1.934  -0.259  1.00 0.00 ? 99  SER A O    2  
ATOM 3191  C CB   . SER A 1 99  ? 6.762   -3.298  -2.500  1.00 0.00 ? 99  SER A CB   2  
ATOM 3192  O OG   . SER A 1 99  ? 5.437   -3.091  -2.043  1.00 0.00 ? 99  SER A OG   2  
ATOM 3193  H H    . SER A 1 99  ? 9.537   -2.744  -2.559  1.00 0.00 ? 99  SER A H    2  
ATOM 3194  H HA   . SER A 1 99  ? 7.049   -1.264  -3.103  1.00 0.00 ? 99  SER A HA   2  
ATOM 3195  H HB2  . SER A 1 99  ? 6.727   -3.687  -3.507  1.00 0.00 ? 99  SER A HB2  2  
ATOM 3196  H HB3  . SER A 1 99  ? 7.246   -4.017  -1.854  1.00 0.00 ? 99  SER A HB3  2  
ATOM 3197  H HG   . SER A 1 99  ? 5.454   -2.571  -1.237  1.00 0.00 ? 99  SER A HG   2  
ATOM 3198  N N    . THR A 1 100 ? 6.835   -0.452  -0.761  1.00 0.00 ? 100 THR A N    2  
ATOM 3199  C CA   . THR A 1 100 ? 6.827   0.154   0.565   1.00 0.00 ? 100 THR A CA   2  
ATOM 3200  C C    . THR A 1 100 ? 6.542   -0.886  1.643   1.00 0.00 ? 100 THR A C    2  
ATOM 3201  O O    . THR A 1 100 ? 5.971   -1.945  1.382   1.00 0.00 ? 100 THR A O    2  
ATOM 3202  C CB   . THR A 1 100 ? 5.778   1.278   0.662   1.00 0.00 ? 100 THR A CB   2  
ATOM 3203  O OG1  . THR A 1 100 ? 4.656   0.975   -0.174  1.00 0.00 ? 100 THR A OG1  2  
ATOM 3204  C CG2  . THR A 1 100 ? 6.378   2.614   0.251   1.00 0.00 ? 100 THR A CG2  2  
ATOM 3205  H H    . THR A 1 100 ? 6.222   -0.113  -1.446  1.00 0.00 ? 100 THR A H    2  
ATOM 3206  H HA   . THR A 1 100 ? 7.802   0.583   0.741   1.00 0.00 ? 100 THR A HA   2  
ATOM 3207  H HB   . THR A 1 100 ? 5.444   1.350   1.688   1.00 0.00 ? 100 THR A HB   2  
ATOM 3208  H HG1  . THR A 1 100 ? 4.873   1.180   -1.087  1.00 0.00 ? 100 THR A HG1  2  
ATOM 3209  H HG21 . THR A 1 100 ? 7.369   2.457   -0.147  1.00 0.00 ? 100 THR A HG21 2  
ATOM 3210  H HG22 . THR A 1 100 ? 6.434   3.263   1.112   1.00 0.00 ? 100 THR A HG22 2  
ATOM 3211  H HG23 . THR A 1 100 ? 5.756   3.070   -0.504  1.00 0.00 ? 100 THR A HG23 2  
ATOM 3212  N N    . PRO A 1 101 ? 6.948   -0.580  2.884   1.00 0.00 ? 101 PRO A N    2  
ATOM 3213  C CA   . PRO A 1 101 ? 6.745   -1.475  4.027   1.00 0.00 ? 101 PRO A CA   2  
ATOM 3214  C C    . PRO A 1 101 ? 5.278   -1.581  4.427   1.00 0.00 ? 101 PRO A C    2  
ATOM 3215  O O    . PRO A 1 101 ? 4.583   -0.572  4.549   1.00 0.00 ? 101 PRO A O    2  
ATOM 3216  C CB   . PRO A 1 101 ? 7.558   -0.814  5.143   1.00 0.00 ? 101 PRO A CB   2  
ATOM 3217  C CG   . PRO A 1 101 ? 7.612   0.627   4.770   1.00 0.00 ? 101 PRO A CG   2  
ATOM 3218  C CD   . PRO A 1 101 ? 7.635   0.665   3.267   1.00 0.00 ? 101 PRO A CD   2  
ATOM 3219  H HA   . PRO A 1 101 ? 7.136   -2.463  3.831   1.00 0.00 ? 101 PRO A HA   2  
ATOM 3220  H HB2  . PRO A 1 101 ? 7.058   -0.960  6.090   1.00 0.00 ? 101 PRO A HB2  2  
ATOM 3221  H HB3  . PRO A 1 101 ? 8.545   -1.250  5.181   1.00 0.00 ? 101 PRO A HB3  2  
ATOM 3222  H HG2  . PRO A 1 101 ? 6.738   1.137   5.145   1.00 0.00 ? 101 PRO A HG2  2  
ATOM 3223  H HG3  . PRO A 1 101 ? 8.510   1.076   5.169   1.00 0.00 ? 101 PRO A HG3  2  
ATOM 3224  H HD2  . PRO A 1 101 ? 7.099   1.529   2.903   1.00 0.00 ? 101 PRO A HD2  2  
ATOM 3225  H HD3  . PRO A 1 101 ? 8.652   0.670   2.905   1.00 0.00 ? 101 PRO A HD3  2  
ATOM 3226  N N    . ASP A 1 102 ? 4.813   -2.809  4.631   1.00 0.00 ? 102 ASP A N    2  
ATOM 3227  C CA   . ASP A 1 102 ? 3.427   -3.046  5.020   1.00 0.00 ? 102 ASP A CA   2  
ATOM 3228  C C    . ASP A 1 102 ? 2.950   -1.986  6.007   1.00 0.00 ? 102 ASP A C    2  
ATOM 3229  O O    . ASP A 1 102 ? 3.645   -1.663  6.971   1.00 0.00 ? 102 ASP A O    2  
ATOM 3230  C CB   . ASP A 1 102 ? 3.280   -4.438  5.636   1.00 0.00 ? 102 ASP A CB   2  
ATOM 3231  C CG   . ASP A 1 102 ? 3.607   -5.545  4.653   1.00 0.00 ? 102 ASP A CG   2  
ATOM 3232  O OD1  . ASP A 1 102 ? 4.726   -5.535  4.099   1.00 0.00 ? 102 ASP A OD1  2  
ATOM 3233  O OD2  . ASP A 1 102 ? 2.743   -6.421  4.438   1.00 0.00 ? 102 ASP A OD2  2  
ATOM 3234  H H    . ASP A 1 102 ? 5.416   -3.573  4.518   1.00 0.00 ? 102 ASP A H    2  
ATOM 3235  H HA   . ASP A 1 102 ? 2.819   -2.991  4.129   1.00 0.00 ? 102 ASP A HA   2  
ATOM 3236  H HB2  . ASP A 1 102 ? 3.949   -4.523  6.480   1.00 0.00 ? 102 ASP A HB2  2  
ATOM 3237  H HB3  . ASP A 1 102 ? 2.262   -4.569  5.974   1.00 0.00 ? 102 ASP A HB3  2  
ATOM 3238  N N    . VAL A 1 103 ? 1.761   -1.446  5.759   1.00 0.00 ? 103 VAL A N    2  
ATOM 3239  C CA   . VAL A 1 103 ? 1.190   -0.422  6.626   1.00 0.00 ? 103 VAL A CA   2  
ATOM 3240  C C    . VAL A 1 103 ? -0.126  -0.890  7.237   1.00 0.00 ? 103 VAL A C    2  
ATOM 3241  O O    . VAL A 1 103 ? -1.203  -0.570  6.735   1.00 0.00 ? 103 VAL A O    2  
ATOM 3242  C CB   . VAL A 1 103 ? 0.950   0.892   5.859   1.00 0.00 ? 103 VAL A CB   2  
ATOM 3243  C CG1  . VAL A 1 103 ? 0.397   1.960   6.791   1.00 0.00 ? 103 VAL A CG1  2  
ATOM 3244  C CG2  . VAL A 1 103 ? 2.235   1.364   5.196   1.00 0.00 ? 103 VAL A CG2  2  
ATOM 3245  H H    . VAL A 1 103 ? 1.254   -1.745  4.976   1.00 0.00 ? 103 VAL A H    2  
ATOM 3246  H HA   . VAL A 1 103 ? 1.896   -0.227  7.421   1.00 0.00 ? 103 VAL A HA   2  
ATOM 3247  H HB   . VAL A 1 103 ? 0.218   0.705   5.087   1.00 0.00 ? 103 VAL A HB   2  
ATOM 3248  H HG11 . VAL A 1 103 ? -0.077  1.488   7.639   1.00 0.00 ? 103 VAL A HG11 2  
ATOM 3249  H HG12 . VAL A 1 103 ? 1.203   2.592   7.133   1.00 0.00 ? 103 VAL A HG12 2  
ATOM 3250  H HG13 . VAL A 1 103 ? -0.330  2.558   6.261   1.00 0.00 ? 103 VAL A HG13 2  
ATOM 3251  H HG21 . VAL A 1 103 ? 2.947   1.651   5.955   1.00 0.00 ? 103 VAL A HG21 2  
ATOM 3252  H HG22 . VAL A 1 103 ? 2.648   0.563   4.599   1.00 0.00 ? 103 VAL A HG22 2  
ATOM 3253  H HG23 . VAL A 1 103 ? 2.022   2.212   4.562   1.00 0.00 ? 103 VAL A HG23 2  
ATOM 3254  N N    . ALA A 1 104 ? -0.031  -1.648  8.324   1.00 0.00 ? 104 ALA A N    2  
ATOM 3255  C CA   . ALA A 1 104 ? -1.214  -2.158  9.006   1.00 0.00 ? 104 ALA A CA   2  
ATOM 3256  C C    . ALA A 1 104 ? -1.859  -1.078  9.868   1.00 0.00 ? 104 ALA A C    2  
ATOM 3257  O O    . ALA A 1 104 ? -1.208  -0.482  10.726  1.00 0.00 ? 104 ALA A O    2  
ATOM 3258  C CB   . ALA A 1 104 ? -0.854  -3.368  9.855   1.00 0.00 ? 104 ALA A CB   2  
ATOM 3259  H H    . ALA A 1 104 ? 0.856   -1.869  8.677   1.00 0.00 ? 104 ALA A H    2  
ATOM 3260  H HA   . ALA A 1 104 ? -1.922  -2.475  8.254   1.00 0.00 ? 104 ALA A HA   2  
ATOM 3261  H HB1  . ALA A 1 104 ? -0.764  -4.238  9.221   1.00 0.00 ? 104 ALA A HB1  2  
ATOM 3262  H HB2  . ALA A 1 104 ? 0.086   -3.189  10.356  1.00 0.00 ? 104 ALA A HB2  2  
ATOM 3263  H HB3  . ALA A 1 104 ? -1.628  -3.535  10.589  1.00 0.00 ? 104 ALA A HB3  2  
ATOM 3264  N N    . VAL A 1 105 ? -3.144  -0.829  9.633   1.00 0.00 ? 105 VAL A N    2  
ATOM 3265  C CA   . VAL A 1 105 ? -3.877  0.180   10.388  1.00 0.00 ? 105 VAL A CA   2  
ATOM 3266  C C    . VAL A 1 105 ? -5.234  -0.350  10.840  1.00 0.00 ? 105 VAL A C    2  
ATOM 3267  O O    . VAL A 1 105 ? -5.882  -1.116  10.125  1.00 0.00 ? 105 VAL A O    2  
ATOM 3268  C CB   . VAL A 1 105 ? -4.089  1.459   9.557   1.00 0.00 ? 105 VAL A CB   2  
ATOM 3269  C CG1  . VAL A 1 105 ? -5.118  1.221   8.463   1.00 0.00 ? 105 VAL A CG1  2  
ATOM 3270  C CG2  . VAL A 1 105 ? -4.511  2.613   10.455  1.00 0.00 ? 105 VAL A CG2  2  
ATOM 3271  H H    . VAL A 1 105 ? -3.609  -1.336  8.936   1.00 0.00 ? 105 VAL A H    2  
ATOM 3272  H HA   . VAL A 1 105 ? -3.293  0.435   11.260  1.00 0.00 ? 105 VAL A HA   2  
ATOM 3273  H HB   . VAL A 1 105 ? -3.152  1.719   9.089   1.00 0.00 ? 105 VAL A HB   2  
ATOM 3274  H HG11 . VAL A 1 105 ? -5.438  2.169   8.057   1.00 0.00 ? 105 VAL A HG11 2  
ATOM 3275  H HG12 . VAL A 1 105 ? -4.678  0.622   7.679   1.00 0.00 ? 105 VAL A HG12 2  
ATOM 3276  H HG13 . VAL A 1 105 ? -5.970  0.702   8.877   1.00 0.00 ? 105 VAL A HG13 2  
ATOM 3277  H HG21 . VAL A 1 105 ? -5.581  2.583   10.599  1.00 0.00 ? 105 VAL A HG21 2  
ATOM 3278  H HG22 . VAL A 1 105 ? -4.017  2.525   11.411  1.00 0.00 ? 105 VAL A HG22 2  
ATOM 3279  H HG23 . VAL A 1 105 ? -4.236  3.549   9.992   1.00 0.00 ? 105 VAL A HG23 2  
ATOM 3280  N N    . ARG A 1 106 ? -5.658  0.062   12.030  1.00 0.00 ? 106 ARG A N    2  
ATOM 3281  C CA   . ARG A 1 106 ? -6.937  -0.372  12.578  1.00 0.00 ? 106 ARG A CA   2  
ATOM 3282  C C    . ARG A 1 106 ? -8.042  0.622   12.232  1.00 0.00 ? 106 ARG A C    2  
ATOM 3283  O O    . ARG A 1 106 ? -7.890  1.829   12.424  1.00 0.00 ? 106 ARG A O    2  
ATOM 3284  C CB   . ARG A 1 106 ? -6.838  -0.533  14.096  1.00 0.00 ? 106 ARG A CB   2  
ATOM 3285  C CG   . ARG A 1 106 ? -7.840  -1.521  14.670  1.00 0.00 ? 106 ARG A CG   2  
ATOM 3286  C CD   . ARG A 1 106 ? -7.717  -1.624  16.182  1.00 0.00 ? 106 ARG A CD   2  
ATOM 3287  N NE   . ARG A 1 106 ? -6.463  -2.255  16.587  1.00 0.00 ? 106 ARG A NE   2  
ATOM 3288  C CZ   . ARG A 1 106 ? -5.320  -1.595  16.728  1.00 0.00 ? 106 ARG A CZ   2  
ATOM 3289  N NH1  . ARG A 1 106 ? -5.271  -0.290  16.498  1.00 0.00 ? 106 ARG A NH1  2  
ATOM 3290  N NH2  . ARG A 1 106 ? -4.221  -2.240  17.100  1.00 0.00 ? 106 ARG A NH2  2  
ATOM 3291  H H    . ARG A 1 106 ? -5.096  0.672   12.553  1.00 0.00 ? 106 ARG A H    2  
ATOM 3292  H HA   . ARG A 1 106 ? -7.179  -1.329  12.138  1.00 0.00 ? 106 ARG A HA   2  
ATOM 3293  H HB2  . ARG A 1 106 ? -5.845  -0.875  14.346  1.00 0.00 ? 106 ARG A HB2  2  
ATOM 3294  H HB3  . ARG A 1 106 ? -7.006  0.428   14.559  1.00 0.00 ? 106 ARG A HB3  2  
ATOM 3295  H HG2  . ARG A 1 106 ? -8.839  -1.191  14.424  1.00 0.00 ? 106 ARG A HG2  2  
ATOM 3296  H HG3  . ARG A 1 106 ? -7.663  -2.493  14.236  1.00 0.00 ? 106 ARG A HG3  2  
ATOM 3297  H HD2  . ARG A 1 106 ? -7.760  -0.630  16.603  1.00 0.00 ? 106 ARG A HD2  2  
ATOM 3298  H HD3  . ARG A 1 106 ? -8.542  -2.210  16.559  1.00 0.00 ? 106 ARG A HD3  2  
ATOM 3299  H HE   . ARG A 1 106 ? -6.477  -3.219  16.762  1.00 0.00 ? 106 ARG A HE   2  
ATOM 3300  H HH11 . ARG A 1 106 ? -6.097  0.199   16.219  1.00 0.00 ? 106 ARG A HH11 2  
ATOM 3301  H HH12 . ARG A 1 106 ? -4.409  0.205   16.606  1.00 0.00 ? 106 ARG A HH12 2  
ATOM 3302  H HH21 . ARG A 1 106 ? -4.254  -3.223  17.274  1.00 0.00 ? 106 ARG A HH21 2  
ATOM 3303  H HH22 . ARG A 1 106 ? -3.361  -1.742  17.205  1.00 0.00 ? 106 ARG A HH22 2  
ATOM 3304  N N    . THR A 1 107 ? -9.155  0.107   11.719  1.00 0.00 ? 107 THR A N    2  
ATOM 3305  C CA   . THR A 1 107 ? -10.285 0.948   11.344  1.00 0.00 ? 107 THR A CA   2  
ATOM 3306  C C    . THR A 1 107 ? -11.050 1.421   12.575  1.00 0.00 ? 107 THR A C    2  
ATOM 3307  O O    . THR A 1 107 ? -10.762 1.002   13.697  1.00 0.00 ? 107 THR A O    2  
ATOM 3308  C CB   . THR A 1 107 ? -11.253 0.203   10.406  1.00 0.00 ? 107 THR A CB   2  
ATOM 3309  O OG1  . THR A 1 107 ? -11.506 -1.114  10.908  1.00 0.00 ? 107 THR A OG1  2  
ATOM 3310  C CG2  . THR A 1 107 ? -10.683 0.114   8.999   1.00 0.00 ? 107 THR A CG2  2  
ATOM 3311  H H    . THR A 1 107 ? -9.217  -0.863  11.590  1.00 0.00 ? 107 THR A H    2  
ATOM 3312  H HA   . THR A 1 107 ? -9.899  1.810   10.819  1.00 0.00 ? 107 THR A HA   2  
ATOM 3313  H HB   . THR A 1 107 ? -12.185 0.750   10.368  1.00 0.00 ? 107 THR A HB   2  
ATOM 3314  H HG1  . THR A 1 107 ? -12.365 -1.414  10.602  1.00 0.00 ? 107 THR A HG1  2  
ATOM 3315  H HG21 . THR A 1 107 ? -11.444 0.388   8.284   1.00 0.00 ? 107 THR A HG21 2  
ATOM 3316  H HG22 . THR A 1 107 ? -10.355 -0.896  8.807   1.00 0.00 ? 107 THR A HG22 2  
ATOM 3317  H HG23 . THR A 1 107 ? -9.845  0.789   8.908   1.00 0.00 ? 107 THR A HG23 2  
ATOM 3318  N N    . LEU A 1 108 ? -12.027 2.295   12.359  1.00 0.00 ? 108 LEU A N    2  
ATOM 3319  C CA   . LEU A 1 108 ? -12.835 2.825   13.451  1.00 0.00 ? 108 LEU A CA   2  
ATOM 3320  C C    . LEU A 1 108 ? -13.895 1.817   13.883  1.00 0.00 ? 108 LEU A C    2  
ATOM 3321  O O    . LEU A 1 108 ? -14.360 1.008   13.080  1.00 0.00 ? 108 LEU A O    2  
ATOM 3322  C CB   . LEU A 1 108 ? -13.503 4.135   13.029  1.00 0.00 ? 108 LEU A CB   2  
ATOM 3323  C CG   . LEU A 1 108 ? -12.573 5.212   12.469  1.00 0.00 ? 108 LEU A CG   2  
ATOM 3324  C CD1  . LEU A 1 108 ? -13.378 6.381   11.924  1.00 0.00 ? 108 LEU A CD1  2  
ATOM 3325  C CD2  . LEU A 1 108 ? -11.599 5.685   13.538  1.00 0.00 ? 108 LEU A CD2  2  
ATOM 3326  H H    . LEU A 1 108 ? -12.209 2.591   11.443  1.00 0.00 ? 108 LEU A H    2  
ATOM 3327  H HA   . LEU A 1 108 ? -12.178 3.018   14.286  1.00 0.00 ? 108 LEU A HA   2  
ATOM 3328  H HB2  . LEU A 1 108 ? -14.235 3.903   12.271  1.00 0.00 ? 108 LEU A HB2  2  
ATOM 3329  H HB3  . LEU A 1 108 ? -14.001 4.545   13.896  1.00 0.00 ? 108 LEU A HB3  2  
ATOM 3330  H HG   . LEU A 1 108 ? -11.999 4.794   11.653  1.00 0.00 ? 108 LEU A HG   2  
ATOM 3331  H HD11 . LEU A 1 108 ? -13.421 6.317   10.847  1.00 0.00 ? 108 LEU A HD11 2  
ATOM 3332  H HD12 . LEU A 1 108 ? -12.905 7.308   12.211  1.00 0.00 ? 108 LEU A HD12 2  
ATOM 3333  H HD13 . LEU A 1 108 ? -14.380 6.348   12.327  1.00 0.00 ? 108 LEU A HD13 2  
ATOM 3334  H HD21 . LEU A 1 108 ? -10.590 5.626   13.157  1.00 0.00 ? 108 LEU A HD21 2  
ATOM 3335  H HD22 . LEU A 1 108 ? -11.691 5.056   14.412  1.00 0.00 ? 108 LEU A HD22 2  
ATOM 3336  H HD23 . LEU A 1 108 ? -11.825 6.707   13.804  1.00 0.00 ? 108 LEU A HD23 2  
ATOM 3337  N N    . SER A 1 109 ? -14.275 1.872   15.156  1.00 0.00 ? 109 SER A N    2  
ATOM 3338  C CA   . SER A 1 109 ? -15.279 0.963   15.695  1.00 0.00 ? 109 SER A CA   2  
ATOM 3339  C C    . SER A 1 109 ? -16.650 1.631   15.735  1.00 0.00 ? 109 SER A C    2  
ATOM 3340  O O    . SER A 1 109 ? -16.840 2.644   16.408  1.00 0.00 ? 109 SER A O    2  
ATOM 3341  C CB   . SER A 1 109 ? -14.881 0.504   17.099  1.00 0.00 ? 109 SER A CB   2  
ATOM 3342  O OG   . SER A 1 109 ? -16.025 0.220   17.886  1.00 0.00 ? 109 SER A OG   2  
ATOM 3343  H H    . SER A 1 109 ? -13.867 2.540   15.747  1.00 0.00 ? 109 SER A H    2  
ATOM 3344  H HA   . SER A 1 109 ? -15.330 0.102   15.045  1.00 0.00 ? 109 SER A HA   2  
ATOM 3345  H HB2  . SER A 1 109 ? -14.279 -0.388  17.026  1.00 0.00 ? 109 SER A HB2  2  
ATOM 3346  H HB3  . SER A 1 109 ? -14.311 1.285   17.582  1.00 0.00 ? 109 SER A HB3  2  
ATOM 3347  H HG   . SER A 1 109 ? -15.771 0.159   18.809  1.00 0.00 ? 109 SER A HG   2  
ATOM 3348  N N    . ASP A 1 110 ? -17.603 1.055   15.009  1.00 0.00 ? 110 ASP A N    2  
ATOM 3349  C CA   . ASP A 1 110 ? -18.958 1.593   14.962  1.00 0.00 ? 110 ASP A CA   2  
ATOM 3350  C C    . ASP A 1 110 ? -19.801 1.043   16.108  1.00 0.00 ? 110 ASP A C    2  
ATOM 3351  O O    . ASP A 1 110 ? -20.307 1.798   16.937  1.00 0.00 ? 110 ASP A O    2  
ATOM 3352  C CB   . ASP A 1 110 ? -19.615 1.258   13.622  1.00 0.00 ? 110 ASP A CB   2  
ATOM 3353  C CG   . ASP A 1 110 ? -20.888 2.047   13.389  1.00 0.00 ? 110 ASP A CG   2  
ATOM 3354  O OD1  . ASP A 1 110 ? -20.880 3.273   13.632  1.00 0.00 ? 110 ASP A OD1  2  
ATOM 3355  O OD2  . ASP A 1 110 ? -21.892 1.441   12.961  1.00 0.00 ? 110 ASP A OD2  2  
ATOM 3356  H H    . ASP A 1 110 ? -17.390 0.249   14.494  1.00 0.00 ? 110 ASP A H    2  
ATOM 3357  H HA   . ASP A 1 110 ? -18.893 2.665   15.062  1.00 0.00 ? 110 ASP A HA   2  
ATOM 3358  H HB2  . ASP A 1 110 ? -18.924 1.481   12.823  1.00 0.00 ? 110 ASP A HB2  2  
ATOM 3359  H HB3  . ASP A 1 110 ? -19.857 0.205   13.600  1.00 0.00 ? 110 ASP A HB3  2  
ATOM 3360  N N    . SER A 1 111 ? -19.948 -0.278  16.147  1.00 0.00 ? 111 SER A N    2  
ATOM 3361  C CA   . SER A 1 111 ? -20.734 -0.929  17.189  1.00 0.00 ? 111 SER A CA   2  
ATOM 3362  C C    . SER A 1 111 ? -19.924 -1.066  18.474  1.00 0.00 ? 111 SER A C    2  
ATOM 3363  O O    . SER A 1 111 ? -18.775 -1.505  18.453  1.00 0.00 ? 111 SER A O    2  
ATOM 3364  C CB   . SER A 1 111 ? -21.202 -2.307  16.717  1.00 0.00 ? 111 SER A CB   2  
ATOM 3365  O OG   . SER A 1 111 ? -22.434 -2.661  17.322  1.00 0.00 ? 111 SER A OG   2  
ATOM 3366  H H    . SER A 1 111 ? -19.520 -0.827  15.457  1.00 0.00 ? 111 SER A H    2  
ATOM 3367  H HA   . SER A 1 111 ? -21.598 -0.312  17.386  1.00 0.00 ? 111 SER A HA   2  
ATOM 3368  H HB2  . SER A 1 111 ? -21.332 -2.293  15.646  1.00 0.00 ? 111 SER A HB2  2  
ATOM 3369  H HB3  . SER A 1 111 ? -20.460 -3.046  16.981  1.00 0.00 ? 111 SER A HB3  2  
ATOM 3370  H HG   . SER A 1 111 ? -22.282 -3.333  17.990  1.00 0.00 ? 111 SER A HG   2  
ATOM 3371  N N    . GLY A 1 112 ? -20.534 -0.688  19.594  1.00 0.00 ? 112 GLY A N    2  
ATOM 3372  C CA   . GLY A 1 112 ? -19.856 -0.776  20.874  1.00 0.00 ? 112 GLY A CA   2  
ATOM 3373  C C    . GLY A 1 112 ? -20.098 -2.102  21.568  1.00 0.00 ? 112 GLY A C    2  
ATOM 3374  O O    . GLY A 1 112 ? -21.186 -2.674  21.499  1.00 0.00 ? 112 GLY A O    2  
ATOM 3375  H H    . GLY A 1 112 ? -21.451 -0.346  19.550  1.00 0.00 ? 112 GLY A H    2  
ATOM 3376  H HA2  . GLY A 1 112 ? -18.795 -0.652  20.716  1.00 0.00 ? 112 GLY A HA2  2  
ATOM 3377  H HA3  . GLY A 1 112 ? -20.210 0.020   21.512  1.00 0.00 ? 112 GLY A HA3  2  
ATOM 3378  N N    . PRO A 1 113 ? -19.064 -2.612  22.254  1.00 0.00 ? 113 PRO A N    2  
ATOM 3379  C CA   . PRO A 1 113 ? -19.145 -3.886  22.975  1.00 0.00 ? 113 PRO A CA   2  
ATOM 3380  C C    . PRO A 1 113 ? -20.045 -3.800  24.204  1.00 0.00 ? 113 PRO A C    2  
ATOM 3381  O O    . PRO A 1 113 ? -20.184 -2.738  24.810  1.00 0.00 ? 113 PRO A O    2  
ATOM 3382  C CB   . PRO A 1 113 ? -17.696 -4.150  23.392  1.00 0.00 ? 113 PRO A CB   2  
ATOM 3383  C CG   . PRO A 1 113 ? -17.066 -2.801  23.448  1.00 0.00 ? 113 PRO A CG   2  
ATOM 3384  C CD   . PRO A 1 113 ? -17.738 -1.985  22.378  1.00 0.00 ? 113 PRO A CD   2  
ATOM 3385  H HA   . PRO A 1 113 ? -19.488 -4.684  22.334  1.00 0.00 ? 113 PRO A HA   2  
ATOM 3386  H HB2  . PRO A 1 113 ? -17.679 -4.636  24.357  1.00 0.00 ? 113 PRO A HB2  2  
ATOM 3387  H HB3  . PRO A 1 113 ? -17.216 -4.779  22.657  1.00 0.00 ? 113 PRO A HB3  2  
ATOM 3388  H HG2  . PRO A 1 113 ? -17.233 -2.358  24.418  1.00 0.00 ? 113 PRO A HG2  2  
ATOM 3389  H HG3  . PRO A 1 113 ? -16.008 -2.882  23.248  1.00 0.00 ? 113 PRO A HG3  2  
ATOM 3390  H HD2  . PRO A 1 113 ? -17.826 -0.955  22.689  1.00 0.00 ? 113 PRO A HD2  2  
ATOM 3391  H HD3  . PRO A 1 113 ? -17.190 -2.056  21.450  1.00 0.00 ? 113 PRO A HD3  2  
ATOM 3392  N N    . SER A 1 114 ? -20.653 -4.926  24.566  1.00 0.00 ? 114 SER A N    2  
ATOM 3393  C CA   . SER A 1 114 ? -21.542 -4.977  25.720  1.00 0.00 ? 114 SER A CA   2  
ATOM 3394  C C    . SER A 1 114 ? -20.992 -5.917  26.789  1.00 0.00 ? 114 SER A C    2  
ATOM 3395  O O    . SER A 1 114 ? -20.133 -6.754  26.512  1.00 0.00 ? 114 SER A O    2  
ATOM 3396  C CB   . SER A 1 114 ? -22.939 -5.432  25.295  1.00 0.00 ? 114 SER A CB   2  
ATOM 3397  O OG   . SER A 1 114 ? -22.963 -6.824  25.030  1.00 0.00 ? 114 SER A OG   2  
ATOM 3398  H H    . SER A 1 114 ? -20.501 -5.740  24.042  1.00 0.00 ? 114 SER A H    2  
ATOM 3399  H HA   . SER A 1 114 ? -21.607 -3.981  26.133  1.00 0.00 ? 114 SER A HA   2  
ATOM 3400  H HB2  . SER A 1 114 ? -23.642 -5.216  26.085  1.00 0.00 ? 114 SER A HB2  2  
ATOM 3401  H HB3  . SER A 1 114 ? -23.230 -4.902  24.399  1.00 0.00 ? 114 SER A HB3  2  
ATOM 3402  H HG   . SER A 1 114 ? -22.868 -6.972  24.086  1.00 0.00 ? 114 SER A HG   2  
ATOM 3403  N N    . SER A 1 115 ? -21.493 -5.771  28.011  1.00 0.00 ? 115 SER A N    2  
ATOM 3404  C CA   . SER A 1 115 ? -21.050 -6.603  29.123  1.00 0.00 ? 115 SER A CA   2  
ATOM 3405  C C    . SER A 1 115 ? -22.100 -6.637  30.229  1.00 0.00 ? 115 SER A C    2  
ATOM 3406  O O    . SER A 1 115 ? -22.730 -5.625  30.534  1.00 0.00 ? 115 SER A O    2  
ATOM 3407  C CB   . SER A 1 115 ? -19.723 -6.083  29.680  1.00 0.00 ? 115 SER A CB   2  
ATOM 3408  O OG   . SER A 1 115 ? -19.068 -7.077  30.449  1.00 0.00 ? 115 SER A OG   2  
ATOM 3409  H H    . SER A 1 115 ? -22.175 -5.085  28.169  1.00 0.00 ? 115 SER A H    2  
ATOM 3410  H HA   . SER A 1 115 ? -20.905 -7.606  28.749  1.00 0.00 ? 115 SER A HA   2  
ATOM 3411  H HB2  . SER A 1 115 ? -19.080 -5.795  28.863  1.00 0.00 ? 115 SER A HB2  2  
ATOM 3412  H HB3  . SER A 1 115 ? -19.912 -5.225  30.310  1.00 0.00 ? 115 SER A HB3  2  
ATOM 3413  H HG   . SER A 1 115 ? -19.571 -7.248  31.248  1.00 0.00 ? 115 SER A HG   2  
ATOM 3414  N N    . GLY A 1 116 ? -22.285 -7.811  30.826  1.00 0.00 ? 116 GLY A N    2  
ATOM 3415  C CA   . GLY A 1 116 ? -23.260 -7.957  31.891  1.00 0.00 ? 116 GLY A CA   2  
ATOM 3416  C C    . GLY A 1 116 ? -23.738 -9.386  32.047  1.00 0.00 ? 116 GLY A C    2  
ATOM 3417  O O    . GLY A 1 116 ? -24.587 -9.675  32.891  1.00 0.00 ? 116 GLY A O    2  
ATOM 3418  H H    . GLY A 1 116 ? -21.754 -8.584  30.541  1.00 0.00 ? 116 GLY A H    2  
ATOM 3419  H HA2  . GLY A 1 116 ? -22.813 -7.634  32.819  1.00 0.00 ? 116 GLY A HA2  2  
ATOM 3420  H HA3  . GLY A 1 116 ? -24.110 -7.327  31.673  1.00 0.00 ? 116 GLY A HA3  2  
ATOM 3421  N N    . GLY A 1 1   ? -10.569 -28.050 3.777   1.00 0.00 ? 1   GLY A N    3  
ATOM 3422  C CA   . GLY A 1 1   ? -9.377  -27.325 4.179   1.00 0.00 ? 1   GLY A CA   3  
ATOM 3423  C C    . GLY A 1 1   ? -9.700  -25.994 4.827   1.00 0.00 ? 1   GLY A C    3  
ATOM 3424  O O    . GLY A 1 1   ? -10.485 -25.209 4.294   1.00 0.00 ? 1   GLY A O    3  
ATOM 3425  H H1   . GLY A 1 1   ? -11.239 -27.612 3.212   1.00 0.00 ? 1   GLY A H1   3  
ATOM 3426  H HA2  . GLY A 1 1   ? -8.821  -27.930 4.879   1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3427  H HA3  . GLY A 1 1   ? -8.766  -27.148 3.306   1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3428  N N    . SER A 1 2   ? -9.094  -25.738 5.983   1.00 0.00 ? 2   SER A N    3  
ATOM 3429  C CA   . SER A 1 2   ? -9.325  -24.494 6.708   1.00 0.00 ? 2   SER A CA   3  
ATOM 3430  C C    . SER A 1 2   ? -8.005  -23.866 7.145   1.00 0.00 ? 2   SER A C    3  
ATOM 3431  O O    . SER A 1 2   ? -7.809  -22.657 7.022   1.00 0.00 ? 2   SER A O    3  
ATOM 3432  C CB   . SER A 1 2   ? -10.211 -24.748 7.929   1.00 0.00 ? 2   SER A CB   3  
ATOM 3433  O OG   . SER A 1 2   ? -9.683  -25.788 8.734   1.00 0.00 ? 2   SER A OG   3  
ATOM 3434  H H    . SER A 1 2   ? -8.479  -26.403 6.357   1.00 0.00 ? 2   SER A H    3  
ATOM 3435  H HA   . SER A 1 2   ? -9.832  -23.811 6.042   1.00 0.00 ? 2   SER A HA   3  
ATOM 3436  H HB2  . SER A 1 2   ? -10.272 -23.847 8.520   1.00 0.00 ? 2   SER A HB2  3  
ATOM 3437  H HB3  . SER A 1 2   ? -11.201 -25.031 7.600   1.00 0.00 ? 2   SER A HB3  3  
ATOM 3438  H HG   . SER A 1 2   ? -9.001  -25.433 9.309   1.00 0.00 ? 2   SER A HG   3  
ATOM 3439  N N    . SER A 1 3   ? -7.103  -24.698 7.656   1.00 0.00 ? 3   SER A N    3  
ATOM 3440  C CA   . SER A 1 3   ? -5.802  -24.225 8.115   1.00 0.00 ? 3   SER A CA   3  
ATOM 3441  C C    . SER A 1 3   ? -5.128  -23.367 7.049   1.00 0.00 ? 3   SER A C    3  
ATOM 3442  O O    . SER A 1 3   ? -4.646  -22.271 7.332   1.00 0.00 ? 3   SER A O    3  
ATOM 3443  C CB   . SER A 1 3   ? -4.903  -25.410 8.475   1.00 0.00 ? 3   SER A CB   3  
ATOM 3444  O OG   . SER A 1 3   ? -4.560  -26.158 7.321   1.00 0.00 ? 3   SER A OG   3  
ATOM 3445  H H    . SER A 1 3   ? -7.318  -25.651 7.728   1.00 0.00 ? 3   SER A H    3  
ATOM 3446  H HA   . SER A 1 3   ? -5.960  -23.624 8.998   1.00 0.00 ? 3   SER A HA   3  
ATOM 3447  H HB2  . SER A 1 3   ? -3.998  -25.045 8.935   1.00 0.00 ? 3   SER A HB2  3  
ATOM 3448  H HB3  . SER A 1 3   ? -5.424  -26.056 9.167   1.00 0.00 ? 3   SER A HB3  3  
ATOM 3449  H HG   . SER A 1 3   ? -4.727  -27.090 7.482   1.00 0.00 ? 3   SER A HG   3  
ATOM 3450  N N    . GLY A 1 4   ? -5.099  -23.874 5.820   1.00 0.00 ? 4   GLY A N    3  
ATOM 3451  C CA   . GLY A 1 4   ? -4.482  -23.142 4.730   1.00 0.00 ? 4   GLY A CA   3  
ATOM 3452  C C    . GLY A 1 4   ? -3.190  -23.780 4.260   1.00 0.00 ? 4   GLY A C    3  
ATOM 3453  O O    . GLY A 1 4   ? -2.852  -24.890 4.673   1.00 0.00 ? 4   GLY A O    3  
ATOM 3454  H H    . GLY A 1 4   ? -5.499  -24.753 5.654   1.00 0.00 ? 4   GLY A H    3  
ATOM 3455  H HA2  . GLY A 1 4   ? -5.174  -23.102 3.901   1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3456  H HA3  . GLY A 1 4   ? -4.274  -22.135 5.060   1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3457  N N    . SER A 1 5   ? -2.466  -23.079 3.394   1.00 0.00 ? 5   SER A N    3  
ATOM 3458  C CA   . SER A 1 5   ? -1.206  -23.586 2.864   1.00 0.00 ? 5   SER A CA   3  
ATOM 3459  C C    . SER A 1 5   ? -0.148  -22.486 2.831   1.00 0.00 ? 5   SER A C    3  
ATOM 3460  O O    . SER A 1 5   ? -0.390  -21.393 2.319   1.00 0.00 ? 5   SER A O    3  
ATOM 3461  C CB   . SER A 1 5   ? -1.411  -24.154 1.458   1.00 0.00 ? 5   SER A CB   3  
ATOM 3462  O OG   . SER A 1 5   ? -1.982  -25.450 1.511   1.00 0.00 ? 5   SER A OG   3  
ATOM 3463  H H    . SER A 1 5   ? -2.788  -22.200 3.103   1.00 0.00 ? 5   SER A H    3  
ATOM 3464  H HA   . SER A 1 5   ? -0.866  -24.376 3.516   1.00 0.00 ? 5   SER A HA   3  
ATOM 3465  H HB2  . SER A 1 5   ? -2.072  -23.505 0.904   1.00 0.00 ? 5   SER A HB2  3  
ATOM 3466  H HB3  . SER A 1 5   ? -0.458  -24.213 0.954   1.00 0.00 ? 5   SER A HB3  3  
ATOM 3467  H HG   . SER A 1 5   ? -1.316  -26.102 1.281   1.00 0.00 ? 5   SER A HG   3  
ATOM 3468  N N    . SER A 1 6   ? 1.024   -22.785 3.381   1.00 0.00 ? 6   SER A N    3  
ATOM 3469  C CA   . SER A 1 6   ? 2.118   -21.821 3.418   1.00 0.00 ? 6   SER A CA   3  
ATOM 3470  C C    . SER A 1 6   ? 2.706   -21.612 2.026   1.00 0.00 ? 6   SER A C    3  
ATOM 3471  O O    . SER A 1 6   ? 2.494   -22.420 1.123   1.00 0.00 ? 6   SER A O    3  
ATOM 3472  C CB   . SER A 1 6   ? 3.210   -22.295 4.379   1.00 0.00 ? 6   SER A CB   3  
ATOM 3473  O OG   . SER A 1 6   ? 2.746   -22.297 5.718   1.00 0.00 ? 6   SER A OG   3  
ATOM 3474  H H    . SER A 1 6   ? 1.155   -23.674 3.773   1.00 0.00 ? 6   SER A H    3  
ATOM 3475  H HA   . SER A 1 6   ? 1.721   -20.882 3.774   1.00 0.00 ? 6   SER A HA   3  
ATOM 3476  H HB2  . SER A 1 6   ? 3.510   -23.298 4.114   1.00 0.00 ? 6   SER A HB2  3  
ATOM 3477  H HB3  . SER A 1 6   ? 4.062   -21.634 4.307   1.00 0.00 ? 6   SER A HB3  3  
ATOM 3478  H HG   . SER A 1 6   ? 3.436   -21.964 6.297   1.00 0.00 ? 6   SER A HG   3  
ATOM 3479  N N    . GLY A 1 7   ? 3.446   -20.520 1.861   1.00 0.00 ? 7   GLY A N    3  
ATOM 3480  C CA   . GLY A 1 7   ? 4.054   -20.223 0.577   1.00 0.00 ? 7   GLY A CA   3  
ATOM 3481  C C    . GLY A 1 7   ? 4.631   -18.823 0.519   1.00 0.00 ? 7   GLY A C    3  
ATOM 3482  O O    . GLY A 1 7   ? 3.933   -17.845 0.787   1.00 0.00 ? 7   GLY A O    3  
ATOM 3483  H H    . GLY A 1 7   ? 3.581   -19.911 2.617   1.00 0.00 ? 7   GLY A H    3  
ATOM 3484  H HA2  . GLY A 1 7   ? 4.844   -20.935 0.391   1.00 0.00 ? 7   GLY A HA2  3  
ATOM 3485  H HA3  . GLY A 1 7   ? 3.304   -20.323 -0.195  1.00 0.00 ? 7   GLY A HA3  3  
ATOM 3486  N N    . ARG A 1 8   ? 5.910   -18.726 0.170   1.00 0.00 ? 8   ARG A N    3  
ATOM 3487  C CA   . ARG A 1 8   ? 6.582   -17.435 0.081   1.00 0.00 ? 8   ARG A CA   3  
ATOM 3488  C C    . ARG A 1 8   ? 7.352   -17.312 -1.231  1.00 0.00 ? 8   ARG A C    3  
ATOM 3489  O O    . ARG A 1 8   ? 8.375   -17.968 -1.426  1.00 0.00 ? 8   ARG A O    3  
ATOM 3490  C CB   . ARG A 1 8   ? 7.534   -17.249 1.263   1.00 0.00 ? 8   ARG A CB   3  
ATOM 3491  C CG   . ARG A 1 8   ? 6.830   -17.192 2.609   1.00 0.00 ? 8   ARG A CG   3  
ATOM 3492  C CD   . ARG A 1 8   ? 7.825   -17.201 3.759   1.00 0.00 ? 8   ARG A CD   3  
ATOM 3493  N NE   . ARG A 1 8   ? 8.366   -18.536 4.004   1.00 0.00 ? 8   ARG A NE   3  
ATOM 3494  C CZ   . ARG A 1 8   ? 9.189   -18.823 5.006   1.00 0.00 ? 8   ARG A CZ   3  
ATOM 3495  N NH1  . ARG A 1 8   ? 9.564   -17.874 5.853   1.00 0.00 ? 8   ARG A NH1  3  
ATOM 3496  N NH2  . ARG A 1 8   ? 9.639   -20.061 5.163   1.00 0.00 ? 8   ARG A NH2  3  
ATOM 3497  H H    . ARG A 1 8   ? 6.414   -19.542 -0.032  1.00 0.00 ? 8   ARG A H    3  
ATOM 3498  H HA   . ARG A 1 8   ? 5.826   -16.664 0.114   1.00 0.00 ? 8   ARG A HA   3  
ATOM 3499  H HB2  . ARG A 1 8   ? 8.232   -18.073 1.282   1.00 0.00 ? 8   ARG A HB2  3  
ATOM 3500  H HB3  . ARG A 1 8   ? 8.081   -16.328 1.128   1.00 0.00 ? 8   ARG A HB3  3  
ATOM 3501  H HG2  . ARG A 1 8   ? 6.246   -16.285 2.661   1.00 0.00 ? 8   ARG A HG2  3  
ATOM 3502  H HG3  . ARG A 1 8   ? 6.179   -18.048 2.701   1.00 0.00 ? 8   ARG A HG3  3  
ATOM 3503  H HD2  . ARG A 1 8   ? 8.638   -16.532 3.520   1.00 0.00 ? 8   ARG A HD2  3  
ATOM 3504  H HD3  . ARG A 1 8   ? 7.326   -16.856 4.652   1.00 0.00 ? 8   ARG A HD3  3  
ATOM 3505  H HE   . ARG A 1 8   ? 8.102   -19.252 3.390   1.00 0.00 ? 8   ARG A HE   3  
ATOM 3506  H HH11 . ARG A 1 8   ? 9.226   -16.940 5.738   1.00 0.00 ? 8   ARG A HH11 3  
ATOM 3507  H HH12 . ARG A 1 8   ? 10.183  -18.093 6.608   1.00 0.00 ? 8   ARG A HH12 3  
ATOM 3508  H HH21 . ARG A 1 8   ? 9.359   -20.779 4.527   1.00 0.00 ? 8   ARG A HH21 3  
ATOM 3509  H HH22 . ARG A 1 8   ? 10.258  -20.276 5.917   1.00 0.00 ? 8   ARG A HH22 3  
ATOM 3510  N N    . VAL A 1 9   ? 6.852   -16.468 -2.128  1.00 0.00 ? 9   VAL A N    3  
ATOM 3511  C CA   . VAL A 1 9   ? 7.493   -16.259 -3.421  1.00 0.00 ? 9   VAL A CA   3  
ATOM 3512  C C    . VAL A 1 9   ? 7.984   -14.822 -3.565  1.00 0.00 ? 9   VAL A C    3  
ATOM 3513  O O    . VAL A 1 9   ? 7.222   -13.875 -3.375  1.00 0.00 ? 9   VAL A O    3  
ATOM 3514  C CB   . VAL A 1 9   ? 6.534   -16.581 -4.582  1.00 0.00 ? 9   VAL A CB   3  
ATOM 3515  C CG1  . VAL A 1 9   ? 7.172   -16.226 -5.916  1.00 0.00 ? 9   VAL A CG1  3  
ATOM 3516  C CG2  . VAL A 1 9   ? 6.130   -18.047 -4.547  1.00 0.00 ? 9   VAL A CG2  3  
ATOM 3517  H H    . VAL A 1 9   ? 6.034   -15.973 -1.915  1.00 0.00 ? 9   VAL A H    3  
ATOM 3518  H HA   . VAL A 1 9   ? 8.340   -16.926 -3.486  1.00 0.00 ? 9   VAL A HA   3  
ATOM 3519  H HB   . VAL A 1 9   ? 5.643   -15.981 -4.463  1.00 0.00 ? 9   VAL A HB   3  
ATOM 3520  H HG11 . VAL A 1 9   ? 6.791   -16.885 -6.683  1.00 0.00 ? 9   VAL A HG11 3  
ATOM 3521  H HG12 . VAL A 1 9   ? 6.935   -15.203 -6.168  1.00 0.00 ? 9   VAL A HG12 3  
ATOM 3522  H HG13 . VAL A 1 9   ? 8.244   -16.341 -5.844  1.00 0.00 ? 9   VAL A HG13 3  
ATOM 3523  H HG21 . VAL A 1 9   ? 7.012   -18.660 -4.433  1.00 0.00 ? 9   VAL A HG21 3  
ATOM 3524  H HG22 . VAL A 1 9   ? 5.463   -18.218 -3.715  1.00 0.00 ? 9   VAL A HG22 3  
ATOM 3525  H HG23 . VAL A 1 9   ? 5.629   -18.305 -5.468  1.00 0.00 ? 9   VAL A HG23 3  
ATOM 3526  N N    . GLU A 1 10  ? 9.260   -14.670 -3.902  1.00 0.00 ? 10  GLU A N    3  
ATOM 3527  C CA   . GLU A 1 10  ? 9.852   -13.348 -4.072  1.00 0.00 ? 10  GLU A CA   3  
ATOM 3528  C C    . GLU A 1 10  ? 10.832  -13.336 -5.242  1.00 0.00 ? 10  GLU A C    3  
ATOM 3529  O O    . GLU A 1 10  ? 11.345  -14.379 -5.648  1.00 0.00 ? 10  GLU A O    3  
ATOM 3530  C CB   . GLU A 1 10  ? 10.567  -12.917 -2.790  1.00 0.00 ? 10  GLU A CB   3  
ATOM 3531  C CG   . GLU A 1 10  ? 11.883  -13.639 -2.554  1.00 0.00 ? 10  GLU A CG   3  
ATOM 3532  C CD   . GLU A 1 10  ? 11.690  -15.034 -1.991  1.00 0.00 ? 10  GLU A CD   3  
ATOM 3533  O OE1  . GLU A 1 10  ? 10.777  -15.215 -1.157  1.00 0.00 ? 10  GLU A OE1  3  
ATOM 3534  O OE2  . GLU A 1 10  ? 12.450  -15.943 -2.383  1.00 0.00 ? 10  GLU A OE2  3  
ATOM 3535  H H    . GLU A 1 10  ? 9.817   -15.464 -4.040  1.00 0.00 ? 10  GLU A H    3  
ATOM 3536  H HA   . GLU A 1 10  ? 9.054   -12.651 -4.279  1.00 0.00 ? 10  GLU A HA   3  
ATOM 3537  H HB2  . GLU A 1 10  ? 10.767  -11.856 -2.842  1.00 0.00 ? 10  GLU A HB2  3  
ATOM 3538  H HB3  . GLU A 1 10  ? 9.919   -13.110 -1.948  1.00 0.00 ? 10  GLU A HB3  3  
ATOM 3539  H HG2  . GLU A 1 10  ? 12.410  -13.717 -3.493  1.00 0.00 ? 10  GLU A HG2  3  
ATOM 3540  H HG3  . GLU A 1 10  ? 12.475  -13.065 -1.857  1.00 0.00 ? 10  GLU A HG3  3  
ATOM 3541  N N    . THR A 1 11  ? 11.086  -12.148 -5.781  1.00 0.00 ? 11  THR A N    3  
ATOM 3542  C CA   . THR A 1 11  ? 12.002  -11.999 -6.905  1.00 0.00 ? 11  THR A CA   3  
ATOM 3543  C C    . THR A 1 11  ? 12.652  -10.620 -6.906  1.00 0.00 ? 11  THR A C    3  
ATOM 3544  O O    . THR A 1 11  ? 12.023  -9.628  -6.539  1.00 0.00 ? 11  THR A O    3  
ATOM 3545  C CB   . THR A 1 11  ? 11.281  -12.214 -8.249  1.00 0.00 ? 11  THR A CB   3  
ATOM 3546  O OG1  . THR A 1 11  ? 10.646  -13.498 -8.264  1.00 0.00 ? 11  THR A OG1  3  
ATOM 3547  C CG2  . THR A 1 11  ? 12.259  -12.113 -9.410  1.00 0.00 ? 11  THR A CG2  3  
ATOM 3548  H H    . THR A 1 11  ? 10.646  -11.353 -5.414  1.00 0.00 ? 11  THR A H    3  
ATOM 3549  H HA   . THR A 1 11  ? 12.772  -12.750 -6.810  1.00 0.00 ? 11  THR A HA   3  
ATOM 3550  H HB   . THR A 1 11  ? 10.528  -11.447 -8.364  1.00 0.00 ? 11  THR A HB   3  
ATOM 3551  H HG1  . THR A 1 11  ? 10.553  -13.798 -9.172  1.00 0.00 ? 11  THR A HG1  3  
ATOM 3552  H HG21 . THR A 1 11  ? 11.710  -12.020 -10.336 1.00 0.00 ? 11  THR A HG21 3  
ATOM 3553  H HG22 . THR A 1 11  ? 12.871  -13.002 -9.443  1.00 0.00 ? 11  THR A HG22 3  
ATOM 3554  H HG23 . THR A 1 11  ? 12.888  -11.247 -9.276  1.00 0.00 ? 11  THR A HG23 3  
ATOM 3555  N N    . GLN A 1 12  ? 13.913  -10.566 -7.321  1.00 0.00 ? 12  GLN A N    3  
ATOM 3556  C CA   . GLN A 1 12  ? 14.648  -9.308  -7.369  1.00 0.00 ? 12  GLN A CA   3  
ATOM 3557  C C    . GLN A 1 12  ? 14.340  -8.546  -8.654  1.00 0.00 ? 12  GLN A C    3  
ATOM 3558  O O    . GLN A 1 12  ? 14.370  -9.099  -9.754  1.00 0.00 ? 12  GLN A O    3  
ATOM 3559  C CB   . GLN A 1 12  ? 16.152  -9.566  -7.263  1.00 0.00 ? 12  GLN A CB   3  
ATOM 3560  C CG   . GLN A 1 12  ? 16.747  -10.214 -8.503  1.00 0.00 ? 12  GLN A CG   3  
ATOM 3561  C CD   . GLN A 1 12  ? 17.195  -9.198  -9.535  1.00 0.00 ? 12  GLN A CD   3  
ATOM 3562  O OE1  . GLN A 1 12  ? 16.771  -9.241  -10.690 1.00 0.00 ? 12  GLN A OE1  3  
ATOM 3563  N NE2  . GLN A 1 12  ? 18.057  -8.276  -9.122  1.00 0.00 ? 12  GLN A NE2  3  
ATOM 3564  H H    . GLN A 1 12  ? 14.360  -11.391 -7.601  1.00 0.00 ? 12  GLN A H    3  
ATOM 3565  H HA   . GLN A 1 12  ? 14.335  -8.709  -6.527  1.00 0.00 ? 12  GLN A HA   3  
ATOM 3566  H HB2  . GLN A 1 12  ? 16.656  -8.626  -7.097  1.00 0.00 ? 12  GLN A HB2  3  
ATOM 3567  H HB3  . GLN A 1 12  ? 16.335  -10.217 -6.421  1.00 0.00 ? 12  GLN A HB3  3  
ATOM 3568  H HG2  . GLN A 1 12  ? 17.601  -10.807 -8.210  1.00 0.00 ? 12  GLN A HG2  3  
ATOM 3569  H HG3  . GLN A 1 12  ? 16.002  -10.856 -8.950  1.00 0.00 ? 12  GLN A HG3  3  
ATOM 3570  H HE21 . GLN A 1 12  ? 18.352  -8.305  -8.188  1.00 0.00 ? 12  GLN A HE21 3  
ATOM 3571  H HE22 . GLN A 1 12  ? 18.364  -7.608  -9.768  1.00 0.00 ? 12  GLN A HE22 3  
ATOM 3572  N N    . PRO A 1 13  ? 14.038  -7.247  -8.514  1.00 0.00 ? 13  PRO A N    3  
ATOM 3573  C CA   . PRO A 1 13  ? 13.719  -6.382  -9.654  1.00 0.00 ? 13  PRO A CA   3  
ATOM 3574  C C    . PRO A 1 13  ? 14.936  -6.105  -10.530 1.00 0.00 ? 13  PRO A C    3  
ATOM 3575  O O    . PRO A 1 13  ? 15.963  -6.771  -10.408 1.00 0.00 ? 13  PRO A O    3  
ATOM 3576  C CB   . PRO A 1 13  ? 13.230  -5.090  -8.993  1.00 0.00 ? 13  PRO A CB   3  
ATOM 3577  C CG   . PRO A 1 13  ? 13.880  -5.082  -7.652  1.00 0.00 ? 13  PRO A CG   3  
ATOM 3578  C CD   . PRO A 1 13  ? 13.984  -6.522  -7.234  1.00 0.00 ? 13  PRO A CD   3  
ATOM 3579  H HA   . PRO A 1 13  ? 12.928  -6.799  -10.260 1.00 0.00 ? 13  PRO A HA   3  
ATOM 3580  H HB2  . PRO A 1 13  ? 13.537  -4.241  -9.587  1.00 0.00 ? 13  PRO A HB2  3  
ATOM 3581  H HB3  . PRO A 1 13  ? 12.154  -5.108  -8.910  1.00 0.00 ? 13  PRO A HB3  3  
ATOM 3582  H HG2  . PRO A 1 13  ? 14.862  -4.640  -7.723  1.00 0.00 ? 13  PRO A HG2  3  
ATOM 3583  H HG3  . PRO A 1 13  ? 13.269  -4.532  -6.952  1.00 0.00 ? 13  PRO A HG3  3  
ATOM 3584  H HD2  . PRO A 1 13  ? 14.885  -6.685  -6.661  1.00 0.00 ? 13  PRO A HD2  3  
ATOM 3585  H HD3  . PRO A 1 13  ? 13.114  -6.813  -6.663  1.00 0.00 ? 13  PRO A HD3  3  
ATOM 3586  N N    . GLU A 1 14  ? 14.812  -5.118  -11.412 1.00 0.00 ? 14  GLU A N    3  
ATOM 3587  C CA   . GLU A 1 14  ? 15.903  -4.754  -12.308 1.00 0.00 ? 14  GLU A CA   3  
ATOM 3588  C C    . GLU A 1 14  ? 16.345  -3.313  -12.070 1.00 0.00 ? 14  GLU A C    3  
ATOM 3589  O O    . GLU A 1 14  ? 15.721  -2.579  -11.304 1.00 0.00 ? 14  GLU A O    3  
ATOM 3590  C CB   . GLU A 1 14  ? 15.476  -4.934  -13.767 1.00 0.00 ? 14  GLU A CB   3  
ATOM 3591  C CG   . GLU A 1 14  ? 15.005  -6.341  -14.094 1.00 0.00 ? 14  GLU A CG   3  
ATOM 3592  C CD   . GLU A 1 14  ? 13.526  -6.539  -13.820 1.00 0.00 ? 14  GLU A CD   3  
ATOM 3593  O OE1  . GLU A 1 14  ? 13.179  -6.929  -12.686 1.00 0.00 ? 14  GLU A OE1  3  
ATOM 3594  O OE2  . GLU A 1 14  ? 12.716  -6.303  -14.741 1.00 0.00 ? 14  GLU A OE2  3  
ATOM 3595  H H    . GLU A 1 14  ? 13.967  -4.623  -11.461 1.00 0.00 ? 14  GLU A H    3  
ATOM 3596  H HA   . GLU A 1 14  ? 16.734  -5.411  -12.103 1.00 0.00 ? 14  GLU A HA   3  
ATOM 3597  H HB2  . GLU A 1 14  ? 14.670  -4.247  -13.981 1.00 0.00 ? 14  GLU A HB2  3  
ATOM 3598  H HB3  . GLU A 1 14  ? 16.315  -4.700  -14.406 1.00 0.00 ? 14  GLU A HB3  3  
ATOM 3599  H HG2  . GLU A 1 14  ? 15.190  -6.535  -15.139 1.00 0.00 ? 14  GLU A HG2  3  
ATOM 3600  H HG3  . GLU A 1 14  ? 15.564  -7.043  -13.494 1.00 0.00 ? 14  GLU A HG3  3  
ATOM 3601  N N    . VAL A 1 15  ? 17.427  -2.915  -12.732 1.00 0.00 ? 15  VAL A N    3  
ATOM 3602  C CA   . VAL A 1 15  ? 17.954  -1.563  -12.594 1.00 0.00 ? 15  VAL A CA   3  
ATOM 3603  C C    . VAL A 1 15  ? 17.104  -0.560  -13.366 1.00 0.00 ? 15  VAL A C    3  
ATOM 3604  O O    . VAL A 1 15  ? 16.349  -0.934  -14.264 1.00 0.00 ? 15  VAL A O    3  
ATOM 3605  C CB   . VAL A 1 15  ? 19.410  -1.474  -13.089 1.00 0.00 ? 15  VAL A CB   3  
ATOM 3606  C CG1  . VAL A 1 15  ? 20.317  -2.351  -12.240 1.00 0.00 ? 15  VAL A CG1  3  
ATOM 3607  C CG2  . VAL A 1 15  ? 19.497  -1.865  -14.557 1.00 0.00 ? 15  VAL A CG2  3  
ATOM 3608  H H    . VAL A 1 15  ? 17.882  -3.546  -13.328 1.00 0.00 ? 15  VAL A H    3  
ATOM 3609  H HA   . VAL A 1 15  ? 17.936  -1.303  -11.545 1.00 0.00 ? 15  VAL A HA   3  
ATOM 3610  H HB   . VAL A 1 15  ? 19.740  -0.450  -12.991 1.00 0.00 ? 15  VAL A HB   3  
ATOM 3611  H HG11 . VAL A 1 15  ? 19.737  -2.816  -11.457 1.00 0.00 ? 15  VAL A HG11 3  
ATOM 3612  H HG12 . VAL A 1 15  ? 20.765  -3.114  -12.861 1.00 0.00 ? 15  VAL A HG12 3  
ATOM 3613  H HG13 . VAL A 1 15  ? 21.094  -1.744  -11.799 1.00 0.00 ? 15  VAL A HG13 3  
ATOM 3614  H HG21 . VAL A 1 15  ? 20.535  -1.928  -14.850 1.00 0.00 ? 15  VAL A HG21 3  
ATOM 3615  H HG22 . VAL A 1 15  ? 19.023  -2.824  -14.703 1.00 0.00 ? 15  VAL A HG22 3  
ATOM 3616  H HG23 . VAL A 1 15  ? 18.997  -1.121  -15.159 1.00 0.00 ? 15  VAL A HG23 3  
ATOM 3617  N N    . GLN A 1 16  ? 17.232  0.714   -13.011 1.00 0.00 ? 16  GLN A N    3  
ATOM 3618  C CA   . GLN A 1 16  ? 16.475  1.771   -13.671 1.00 0.00 ? 16  GLN A CA   3  
ATOM 3619  C C    . GLN A 1 16  ? 15.015  1.751   -13.231 1.00 0.00 ? 16  GLN A C    3  
ATOM 3620  O O    . GLN A 1 16  ? 14.107  1.909   -14.048 1.00 0.00 ? 16  GLN A O    3  
ATOM 3621  C CB   . GLN A 1 16  ? 16.563  1.617   -15.191 1.00 0.00 ? 16  GLN A CB   3  
ATOM 3622  C CG   . GLN A 1 16  ? 16.411  2.929   -15.944 1.00 0.00 ? 16  GLN A CG   3  
ATOM 3623  C CD   . GLN A 1 16  ? 16.204  2.726   -17.432 1.00 0.00 ? 16  GLN A CD   3  
ATOM 3624  O OE1  . GLN A 1 16  ? 15.957  1.610   -17.890 1.00 0.00 ? 16  GLN A OE1  3  
ATOM 3625  N NE2  . GLN A 1 16  ? 16.304  3.807   -18.197 1.00 0.00 ? 16  GLN A NE2  3  
ATOM 3626  H H    . GLN A 1 16  ? 17.850  0.949   -12.288 1.00 0.00 ? 16  GLN A H    3  
ATOM 3627  H HA   . GLN A 1 16  ? 16.910  2.717   -13.388 1.00 0.00 ? 16  GLN A HA   3  
ATOM 3628  H HB2  . GLN A 1 16  ? 17.523  1.191   -15.442 1.00 0.00 ? 16  GLN A HB2  3  
ATOM 3629  H HB3  . GLN A 1 16  ? 15.783  0.946   -15.519 1.00 0.00 ? 16  GLN A HB3  3  
ATOM 3630  H HG2  . GLN A 1 16  ? 15.559  3.461   -15.548 1.00 0.00 ? 16  GLN A HG2  3  
ATOM 3631  H HG3  . GLN A 1 16  ? 17.303  3.519   -15.797 1.00 0.00 ? 16  GLN A HG3  3  
ATOM 3632  H HE21 . GLN A 1 16  ? 16.505  4.664   -17.763 1.00 0.00 ? 16  GLN A HE21 3  
ATOM 3633  H HE22 . GLN A 1 16  ? 16.176  3.705   -19.162 1.00 0.00 ? 16  GLN A HE22 3  
ATOM 3634  N N    . LEU A 1 17  ? 14.796  1.555   -11.935 1.00 0.00 ? 17  LEU A N    3  
ATOM 3635  C CA   . LEU A 1 17  ? 13.445  1.514   -11.385 1.00 0.00 ? 17  LEU A CA   3  
ATOM 3636  C C    . LEU A 1 17  ? 13.235  2.636   -10.373 1.00 0.00 ? 17  LEU A C    3  
ATOM 3637  O O    . LEU A 1 17  ? 14.184  3.187   -9.814  1.00 0.00 ? 17  LEU A O    3  
ATOM 3638  C CB   . LEU A 1 17  ? 13.183  0.160   -10.724 1.00 0.00 ? 17  LEU A CB   3  
ATOM 3639  C CG   . LEU A 1 17  ? 12.598  -0.926  -11.628 1.00 0.00 ? 17  LEU A CG   3  
ATOM 3640  C CD1  . LEU A 1 17  ? 13.055  -0.728  -13.065 1.00 0.00 ? 17  LEU A CD1  3  
ATOM 3641  C CD2  . LEU A 1 17  ? 12.992  -2.307  -11.126 1.00 0.00 ? 17  LEU A CD2  3  
ATOM 3642  H H    . LEU A 1 17  ? 15.559  1.436   -11.333 1.00 0.00 ? 17  LEU A H    3  
ATOM 3643  H HA   . LEU A 1 17  ? 12.751  1.648   -12.201 1.00 0.00 ? 17  LEU A HA   3  
ATOM 3644  H HB2  . LEU A 1 17  ? 14.121  -0.205  -10.335 1.00 0.00 ? 17  LEU A HB2  3  
ATOM 3645  H HB3  . LEU A 1 17  ? 12.494  0.319   -9.907  1.00 0.00 ? 17  LEU A HB3  3  
ATOM 3646  H HG   . LEU A 1 17  ? 11.519  -0.857  -11.609 1.00 0.00 ? 17  LEU A HG   3  
ATOM 3647  H HD11 . LEU A 1 17  ? 12.444  0.025   -13.537 1.00 0.00 ? 17  LEU A HD11 3  
ATOM 3648  H HD12 . LEU A 1 17  ? 12.960  -1.659  -13.604 1.00 0.00 ? 17  LEU A HD12 3  
ATOM 3649  H HD13 . LEU A 1 17  ? 14.088  -0.412  -13.073 1.00 0.00 ? 17  LEU A HD13 3  
ATOM 3650  H HD21 . LEU A 1 17  ? 13.589  -2.805  -11.875 1.00 0.00 ? 17  LEU A HD21 3  
ATOM 3651  H HD22 . LEU A 1 17  ? 12.101  -2.887  -10.933 1.00 0.00 ? 17  LEU A HD22 3  
ATOM 3652  H HD23 . LEU A 1 17  ? 13.563  -2.210  -10.215 1.00 0.00 ? 17  LEU A HD23 3  
ATOM 3653  N N    . PRO A 1 18  ? 11.963  2.983   -10.129 1.00 0.00 ? 18  PRO A N    3  
ATOM 3654  C CA   . PRO A 1 18  ? 11.598  4.039   -9.181  1.00 0.00 ? 18  PRO A CA   3  
ATOM 3655  C C    . PRO A 1 18  ? 11.870  3.640   -7.734  1.00 0.00 ? 18  PRO A C    3  
ATOM 3656  O O    . PRO A 1 18  ? 12.465  2.596   -7.470  1.00 0.00 ? 18  PRO A O    3  
ATOM 3657  C CB   . PRO A 1 18  ? 10.096  4.221   -9.412  1.00 0.00 ? 18  PRO A CB   3  
ATOM 3658  C CG   . PRO A 1 18  ? 9.635   2.911   -9.952  1.00 0.00 ? 18  PRO A CG   3  
ATOM 3659  C CD   . PRO A 1 18  ? 10.782  2.369   -10.759 1.00 0.00 ? 18  PRO A CD   3  
ATOM 3660  H HA   . PRO A 1 18  ? 12.112  4.964   -9.400  1.00 0.00 ? 18  PRO A HA   3  
ATOM 3661  H HB2  . PRO A 1 18  ? 9.610   4.456   -8.476  1.00 0.00 ? 18  PRO A HB2  3  
ATOM 3662  H HB3  . PRO A 1 18  ? 9.931   5.019   -10.120 1.00 0.00 ? 18  PRO A HB3  3  
ATOM 3663  H HG2  . PRO A 1 18  ? 9.399   2.242   -9.139  1.00 0.00 ? 18  PRO A HG2  3  
ATOM 3664  H HG3  . PRO A 1 18  ? 8.770   3.058   -10.582 1.00 0.00 ? 18  PRO A HG3  3  
ATOM 3665  H HD2  . PRO A 1 18  ? 10.820  1.292   -10.684 1.00 0.00 ? 18  PRO A HD2  3  
ATOM 3666  H HD3  . PRO A 1 18  ? 10.694  2.674   -11.792 1.00 0.00 ? 18  PRO A HD3  3  
ATOM 3667  N N    . GLY A 1 19  ? 11.428  4.477   -6.801  1.00 0.00 ? 19  GLY A N    3  
ATOM 3668  C CA   . GLY A 1 19  ? 11.633  4.193   -5.392  1.00 0.00 ? 19  GLY A CA   3  
ATOM 3669  C C    . GLY A 1 19  ? 10.336  4.180   -4.609  1.00 0.00 ? 19  GLY A C    3  
ATOM 3670  O O    . GLY A 1 19  ? 9.262   4.465   -5.140  1.00 0.00 ? 19  GLY A O    3  
ATOM 3671  H H    . GLY A 1 19  ? 10.960  5.295   -7.071  1.00 0.00 ? 19  GLY A H    3  
ATOM 3672  H HA2  . GLY A 1 19  ? 12.109  3.229   -5.297  1.00 0.00 ? 19  GLY A HA2  3  
ATOM 3673  H HA3  . GLY A 1 19  ? 12.284  4.948   -4.976  1.00 0.00 ? 19  GLY A HA3  3  
ATOM 3674  N N    . PRO A 1 20  ? 10.425  3.843   -3.314  1.00 0.00 ? 20  PRO A N    3  
ATOM 3675  C CA   . PRO A 1 20  ? 9.258   3.785   -2.428  1.00 0.00 ? 20  PRO A CA   3  
ATOM 3676  C C    . PRO A 1 20  ? 8.688   5.167   -2.129  1.00 0.00 ? 20  PRO A C    3  
ATOM 3677  O O    . PRO A 1 20  ? 9.386   6.038   -1.611  1.00 0.00 ? 20  PRO A O    3  
ATOM 3678  C CB   . PRO A 1 20  ? 9.813   3.148   -1.152  1.00 0.00 ? 20  PRO A CB   3  
ATOM 3679  C CG   . PRO A 1 20  ? 11.267  3.474   -1.166  1.00 0.00 ? 20  PRO A CG   3  
ATOM 3680  C CD   . PRO A 1 20  ? 11.673  3.492   -2.614  1.00 0.00 ? 20  PRO A CD   3  
ATOM 3681  H HA   . PRO A 1 20  ? 8.481   3.157   -2.837  1.00 0.00 ? 20  PRO A HA   3  
ATOM 3682  H HB2  . PRO A 1 20  ? 9.320   3.575   -0.290  1.00 0.00 ? 20  PRO A HB2  3  
ATOM 3683  H HB3  . PRO A 1 20  ? 9.648   2.081   -1.176  1.00 0.00 ? 20  PRO A HB3  3  
ATOM 3684  H HG2  . PRO A 1 20  ? 11.430  4.443   -0.719  1.00 0.00 ? 20  PRO A HG2  3  
ATOM 3685  H HG3  . PRO A 1 20  ? 11.818  2.714   -0.632  1.00 0.00 ? 20  PRO A HG3  3  
ATOM 3686  H HD2  . PRO A 1 20  ? 12.433  4.240   -2.784  1.00 0.00 ? 20  PRO A HD2  3  
ATOM 3687  H HD3  . PRO A 1 20  ? 12.024  2.517   -2.920  1.00 0.00 ? 20  PRO A HD3  3  
ATOM 3688  N N    . ALA A 1 21  ? 7.416   5.361   -2.459  1.00 0.00 ? 21  ALA A N    3  
ATOM 3689  C CA   . ALA A 1 21  ? 6.751   6.637   -2.224  1.00 0.00 ? 21  ALA A CA   3  
ATOM 3690  C C    . ALA A 1 21  ? 6.879   7.061   -0.765  1.00 0.00 ? 21  ALA A C    3  
ATOM 3691  O O    . ALA A 1 21  ? 6.412   6.380   0.148   1.00 0.00 ? 21  ALA A O    3  
ATOM 3692  C CB   . ALA A 1 21  ? 5.286   6.551   -2.624  1.00 0.00 ? 21  ALA A CB   3  
ATOM 3693  H H    . ALA A 1 21  ? 6.911   4.628   -2.870  1.00 0.00 ? 21  ALA A H    3  
ATOM 3694  H HA   . ALA A 1 21  ? 7.226   7.381   -2.847  1.00 0.00 ? 21  ALA A HA   3  
ATOM 3695  H HB1  . ALA A 1 21  ? 4.903   5.571   -2.377  1.00 0.00 ? 21  ALA A HB1  3  
ATOM 3696  H HB2  . ALA A 1 21  ? 4.723   7.303   -2.091  1.00 0.00 ? 21  ALA A HB2  3  
ATOM 3697  H HB3  . ALA A 1 21  ? 5.193   6.717   -3.687  1.00 0.00 ? 21  ALA A HB3  3  
ATOM 3698  N N    . PRO A 1 22  ? 7.528   8.213   -0.537  1.00 0.00 ? 22  PRO A N    3  
ATOM 3699  C CA   . PRO A 1 22  ? 7.733   8.753   0.810   1.00 0.00 ? 22  PRO A CA   3  
ATOM 3700  C C    . PRO A 1 22  ? 6.434   9.246   1.440   1.00 0.00 ? 22  PRO A C    3  
ATOM 3701  O O    . PRO A 1 22  ? 5.357   9.090   0.867   1.00 0.00 ? 22  PRO A O    3  
ATOM 3702  C CB   . PRO A 1 22  ? 8.694   9.923   0.581   1.00 0.00 ? 22  PRO A CB   3  
ATOM 3703  C CG   . PRO A 1 22  ? 8.459   10.335  -0.831  1.00 0.00 ? 22  PRO A CG   3  
ATOM 3704  C CD   . PRO A 1 22  ? 8.111   9.076   -1.577  1.00 0.00 ? 22  PRO A CD   3  
ATOM 3705  H HA   . PRO A 1 22  ? 8.195   8.027   1.463   1.00 0.00 ? 22  PRO A HA   3  
ATOM 3706  H HB2  . PRO A 1 22  ? 8.462   10.722  1.271   1.00 0.00 ? 22  PRO A HB2  3  
ATOM 3707  H HB3  . PRO A 1 22  ? 9.710   9.592   0.732   1.00 0.00 ? 22  PRO A HB3  3  
ATOM 3708  H HG2  . PRO A 1 22  ? 7.640   11.037  -0.878  1.00 0.00 ? 22  PRO A HG2  3  
ATOM 3709  H HG3  . PRO A 1 22  ? 9.357   10.776  -1.238  1.00 0.00 ? 22  PRO A HG3  3  
ATOM 3710  H HD2  . PRO A 1 22  ? 7.391   9.285   -2.354  1.00 0.00 ? 22  PRO A HD2  3  
ATOM 3711  H HD3  . PRO A 1 22  ? 9.001   8.628   -1.996  1.00 0.00 ? 22  PRO A HD3  3  
ATOM 3712  N N    . ASN A 1 23  ? 6.545   9.843   2.623   1.00 0.00 ? 23  ASN A N    3  
ATOM 3713  C CA   . ASN A 1 23  ? 5.379   10.359  3.331   1.00 0.00 ? 23  ASN A CA   3  
ATOM 3714  C C    . ASN A 1 23  ? 4.192   9.412   3.186   1.00 0.00 ? 23  ASN A C    3  
ATOM 3715  O O    . ASN A 1 23  ? 3.088   9.832   2.835   1.00 0.00 ? 23  ASN A O    3  
ATOM 3716  C CB   . ASN A 1 23  ? 5.008   11.745  2.802   1.00 0.00 ? 23  ASN A CB   3  
ATOM 3717  C CG   . ASN A 1 23  ? 6.158   12.728  2.898   1.00 0.00 ? 23  ASN A CG   3  
ATOM 3718  O OD1  . ASN A 1 23  ? 6.560   13.330  1.902   1.00 0.00 ? 23  ASN A OD1  3  
ATOM 3719  N ND2  . ASN A 1 23  ? 6.694   12.895  4.102   1.00 0.00 ? 23  ASN A ND2  3  
ATOM 3720  H H    . ASN A 1 23  ? 7.432   9.938   3.030   1.00 0.00 ? 23  ASN A H    3  
ATOM 3721  H HA   . ASN A 1 23  ? 5.635   10.439  4.377   1.00 0.00 ? 23  ASN A HA   3  
ATOM 3722  H HB2  . ASN A 1 23  ? 4.717   11.662  1.764   1.00 0.00 ? 23  ASN A HB2  3  
ATOM 3723  H HB3  . ASN A 1 23  ? 4.178   12.132  3.374   1.00 0.00 ? 23  ASN A HB3  3  
ATOM 3724  H HD21 . ASN A 1 23  ? 6.323   12.382  4.849   1.00 0.00 ? 23  ASN A HD21 3  
ATOM 3725  H HD22 . ASN A 1 23  ? 7.439   13.525  4.193   1.00 0.00 ? 23  ASN A HD22 3  
ATOM 3726  N N    . LEU A 1 24  ? 4.425   8.133   3.458   1.00 0.00 ? 24  LEU A N    3  
ATOM 3727  C CA   . LEU A 1 24  ? 3.375   7.125   3.359   1.00 0.00 ? 24  LEU A CA   3  
ATOM 3728  C C    . LEU A 1 24  ? 2.532   7.090   4.630   1.00 0.00 ? 24  LEU A C    3  
ATOM 3729  O O    . LEU A 1 24  ? 2.939   6.519   5.641   1.00 0.00 ? 24  LEU A O    3  
ATOM 3730  C CB   . LEU A 1 24  ? 3.986   5.747   3.101   1.00 0.00 ? 24  LEU A CB   3  
ATOM 3731  C CG   . LEU A 1 24  ? 2.998   4.586   2.983   1.00 0.00 ? 24  LEU A CG   3  
ATOM 3732  C CD1  . LEU A 1 24  ? 2.019   4.832   1.846   1.00 0.00 ? 24  LEU A CD1  3  
ATOM 3733  C CD2  . LEU A 1 24  ? 3.739   3.273   2.777   1.00 0.00 ? 24  LEU A CD2  3  
ATOM 3734  H H    . LEU A 1 24  ? 5.325   7.858   3.733   1.00 0.00 ? 24  LEU A H    3  
ATOM 3735  H HA   . LEU A 1 24  ? 2.740   7.390   2.527   1.00 0.00 ? 24  LEU A HA   3  
ATOM 3736  H HB2  . LEU A 1 24  ? 4.545   5.800   2.180   1.00 0.00 ? 24  LEU A HB2  3  
ATOM 3737  H HB3  . LEU A 1 24  ? 4.660   5.527   3.917   1.00 0.00 ? 24  LEU A HB3  3  
ATOM 3738  H HG   . LEU A 1 24  ? 2.430   4.510   3.901   1.00 0.00 ? 24  LEU A HG   3  
ATOM 3739  H HD11 . LEU A 1 24  ? 1.505   3.913   1.608   1.00 0.00 ? 24  LEU A HD11 3  
ATOM 3740  H HD12 . LEU A 1 24  ? 2.557   5.178   0.976   1.00 0.00 ? 24  LEU A HD12 3  
ATOM 3741  H HD13 . LEU A 1 24  ? 1.300   5.580   2.145   1.00 0.00 ? 24  LEU A HD13 3  
ATOM 3742  H HD21 . LEU A 1 24  ? 4.711   3.332   3.244   1.00 0.00 ? 24  LEU A HD21 3  
ATOM 3743  H HD22 . LEU A 1 24  ? 3.859   3.090   1.718   1.00 0.00 ? 24  LEU A HD22 3  
ATOM 3744  H HD23 . LEU A 1 24  ? 3.175   2.467   3.220   1.00 0.00 ? 24  LEU A HD23 3  
ATOM 3745  N N    . ARG A 1 25  ? 1.354   7.704   4.570   1.00 0.00 ? 25  ARG A N    3  
ATOM 3746  C CA   . ARG A 1 25  ? 0.454   7.742   5.715   1.00 0.00 ? 25  ARG A CA   3  
ATOM 3747  C C    . ARG A 1 25  ? -0.819  6.949   5.433   1.00 0.00 ? 25  ARG A C    3  
ATOM 3748  O O    . ARG A 1 25  ? -1.276  6.875   4.293   1.00 0.00 ? 25  ARG A O    3  
ATOM 3749  C CB   . ARG A 1 25  ? 0.098   9.189   6.064   1.00 0.00 ? 25  ARG A CB   3  
ATOM 3750  C CG   . ARG A 1 25  ? 1.245   10.165  5.854   1.00 0.00 ? 25  ARG A CG   3  
ATOM 3751  C CD   . ARG A 1 25  ? 2.184   10.186  7.050   1.00 0.00 ? 25  ARG A CD   3  
ATOM 3752  N NE   . ARG A 1 25  ? 3.090   9.042   7.055   1.00 0.00 ? 25  ARG A NE   3  
ATOM 3753  C CZ   . ARG A 1 25  ? 3.779   8.654   8.123   1.00 0.00 ? 25  ARG A CZ   3  
ATOM 3754  N NH1  . ARG A 1 25  ? 3.664   9.316   9.266   1.00 0.00 ? 25  ARG A NH1  3  
ATOM 3755  N NH2  . ARG A 1 25  ? 4.584   7.602   8.049   1.00 0.00 ? 25  ARG A NH2  3  
ATOM 3756  H H    . ARG A 1 25  ? 1.085   8.142   3.735   1.00 0.00 ? 25  ARG A H    3  
ATOM 3757  H HA   . ARG A 1 25  ? 0.964   7.294   6.554   1.00 0.00 ? 25  ARG A HA   3  
ATOM 3758  H HB2  . ARG A 1 25  ? -0.730  9.503   5.445   1.00 0.00 ? 25  ARG A HB2  3  
ATOM 3759  H HB3  . ARG A 1 25  ? -0.199  9.234   7.100   1.00 0.00 ? 25  ARG A HB3  3  
ATOM 3760  H HG2  . ARG A 1 25  ? 1.803   9.868   4.978   1.00 0.00 ? 25  ARG A HG2  3  
ATOM 3761  H HG3  . ARG A 1 25  ? 0.840   11.155  5.707   1.00 0.00 ? 25  ARG A HG3  3  
ATOM 3762  H HD2  . ARG A 1 25  ? 2.766   11.095  7.017   1.00 0.00 ? 25  ARG A HD2  3  
ATOM 3763  H HD3  . ARG A 1 25  ? 1.593   10.170  7.954   1.00 0.00 ? 25  ARG A HD3  3  
ATOM 3764  H HE   . ARG A 1 25  ? 3.190   8.538   6.221   1.00 0.00 ? 25  ARG A HE   3  
ATOM 3765  H HH11 . ARG A 1 25  ? 3.057   10.108  9.325   1.00 0.00 ? 25  ARG A HH11 3  
ATOM 3766  H HH12 . ARG A 1 25  ? 4.182   9.021   10.069  1.00 0.00 ? 25  ARG A HH12 3  
ATOM 3767  H HH21 . ARG A 1 25  ? 4.673   7.100   7.189   1.00 0.00 ? 25  ARG A HH21 3  
ATOM 3768  H HH22 . ARG A 1 25  ? 5.101   7.311   8.853   1.00 0.00 ? 25  ARG A HH22 3  
ATOM 3769  N N    . ALA A 1 26  ? -1.385  6.356   6.479   1.00 0.00 ? 26  ALA A N    3  
ATOM 3770  C CA   . ALA A 1 26  ? -2.605  5.570   6.344   1.00 0.00 ? 26  ALA A CA   3  
ATOM 3771  C C    . ALA A 1 26  ? -3.454  5.654   7.608   1.00 0.00 ? 26  ALA A C    3  
ATOM 3772  O O    . ALA A 1 26  ? -2.971  5.396   8.711   1.00 0.00 ? 26  ALA A O    3  
ATOM 3773  C CB   . ALA A 1 26  ? -2.266  4.121   6.029   1.00 0.00 ? 26  ALA A CB   3  
ATOM 3774  H H    . ALA A 1 26  ? -0.973  6.452   7.363   1.00 0.00 ? 26  ALA A H    3  
ATOM 3775  H HA   . ALA A 1 26  ? -3.170  5.971   5.515   1.00 0.00 ? 26  ALA A HA   3  
ATOM 3776  H HB1  . ALA A 1 26  ? -2.220  3.988   4.958   1.00 0.00 ? 26  ALA A HB1  3  
ATOM 3777  H HB2  . ALA A 1 26  ? -1.310  3.872   6.464   1.00 0.00 ? 26  ALA A HB2  3  
ATOM 3778  H HB3  . ALA A 1 26  ? -3.028  3.475   6.440   1.00 0.00 ? 26  ALA A HB3  3  
ATOM 3779  N N    . TYR A 1 27  ? -4.721  6.016   7.440   1.00 0.00 ? 27  TYR A N    3  
ATOM 3780  C CA   . TYR A 1 27  ? -5.637  6.137   8.568   1.00 0.00 ? 27  TYR A CA   3  
ATOM 3781  C C    . TYR A 1 27  ? -7.041  5.680   8.181   1.00 0.00 ? 27  TYR A C    3  
ATOM 3782  O O    . TYR A 1 27  ? -7.435  5.766   7.019   1.00 0.00 ? 27  TYR A O    3  
ATOM 3783  C CB   . TYR A 1 27  ? -5.679  7.583   9.066   1.00 0.00 ? 27  TYR A CB   3  
ATOM 3784  C CG   . TYR A 1 27  ? -5.936  8.593   7.971   1.00 0.00 ? 27  TYR A CG   3  
ATOM 3785  C CD1  . TYR A 1 27  ? -4.962  8.883   7.023   1.00 0.00 ? 27  TYR A CD1  3  
ATOM 3786  C CD2  . TYR A 1 27  ? -7.153  9.257   7.883   1.00 0.00 ? 27  TYR A CD2  3  
ATOM 3787  C CE1  . TYR A 1 27  ? -5.193  9.806   6.021   1.00 0.00 ? 27  TYR A CE1  3  
ATOM 3788  C CE2  . TYR A 1 27  ? -7.393  10.181  6.884   1.00 0.00 ? 27  TYR A CE2  3  
ATOM 3789  C CZ   . TYR A 1 27  ? -6.409  10.452  5.956   1.00 0.00 ? 27  TYR A CZ   3  
ATOM 3790  O OH   . TYR A 1 27  ? -6.643  11.371  4.958   1.00 0.00 ? 27  TYR A OH   3  
ATOM 3791  H H    . TYR A 1 27  ? -5.048  6.209   6.537   1.00 0.00 ? 27  TYR A H    3  
ATOM 3792  H HA   . TYR A 1 27  ? -5.271  5.504   9.362   1.00 0.00 ? 27  TYR A HA   3  
ATOM 3793  H HB2  . TYR A 1 27  ? -6.465  7.682   9.798   1.00 0.00 ? 27  TYR A HB2  3  
ATOM 3794  H HB3  . TYR A 1 27  ? -4.732  7.825   9.526   1.00 0.00 ? 27  TYR A HB3  3  
ATOM 3795  H HD1  . TYR A 1 27  ? -4.010  8.374   7.077   1.00 0.00 ? 27  TYR A HD1  3  
ATOM 3796  H HD2  . TYR A 1 27  ? -7.922  9.043   8.611   1.00 0.00 ? 27  TYR A HD2  3  
ATOM 3797  H HE1  . TYR A 1 27  ? -4.423  10.018  5.294   1.00 0.00 ? 27  TYR A HE1  3  
ATOM 3798  H HE2  . TYR A 1 27  ? -8.346  10.687  6.832   1.00 0.00 ? 27  TYR A HE2  3  
ATOM 3799  H HH   . TYR A 1 27  ? -7.461  11.839  5.140   1.00 0.00 ? 27  TYR A HH   3  
ATOM 3800  N N    . ALA A 1 28  ? -7.790  5.194   9.166   1.00 0.00 ? 28  ALA A N    3  
ATOM 3801  C CA   . ALA A 1 28  ? -9.150  4.726   8.931   1.00 0.00 ? 28  ALA A CA   3  
ATOM 3802  C C    . ALA A 1 28  ? -10.149 5.874   9.020   1.00 0.00 ? 28  ALA A C    3  
ATOM 3803  O O    . ALA A 1 28  ? -10.458 6.358   10.109  1.00 0.00 ? 28  ALA A O    3  
ATOM 3804  C CB   . ALA A 1 28  ? -9.511  3.632   9.925   1.00 0.00 ? 28  ALA A CB   3  
ATOM 3805  H H    . ALA A 1 28  ? -7.419  5.151   10.072  1.00 0.00 ? 28  ALA A H    3  
ATOM 3806  H HA   . ALA A 1 28  ? -9.190  4.303   7.937   1.00 0.00 ? 28  ALA A HA   3  
ATOM 3807  H HB1  . ALA A 1 28  ? -9.900  4.081   10.827  1.00 0.00 ? 28  ALA A HB1  3  
ATOM 3808  H HB2  . ALA A 1 28  ? -10.259 2.985   9.492   1.00 0.00 ? 28  ALA A HB2  3  
ATOM 3809  H HB3  . ALA A 1 28  ? -8.629  3.055   10.161  1.00 0.00 ? 28  ALA A HB3  3  
ATOM 3810  N N    . ALA A 1 29  ? -10.651 6.307   7.868   1.00 0.00 ? 29  ALA A N    3  
ATOM 3811  C CA   . ALA A 1 29  ? -11.616 7.398   7.816   1.00 0.00 ? 29  ALA A CA   3  
ATOM 3812  C C    . ALA A 1 29  ? -13.000 6.927   8.249   1.00 0.00 ? 29  ALA A C    3  
ATOM 3813  O O    . ALA A 1 29  ? -13.912 7.733   8.431   1.00 0.00 ? 29  ALA A O    3  
ATOM 3814  C CB   . ALA A 1 29  ? -11.671 7.988   6.415   1.00 0.00 ? 29  ALA A CB   3  
ATOM 3815  H H    . ALA A 1 29  ? -10.366 5.881   7.032   1.00 0.00 ? 29  ALA A H    3  
ATOM 3816  H HA   . ALA A 1 29  ? -11.282 8.171   8.493   1.00 0.00 ? 29  ALA A HA   3  
ATOM 3817  H HB1  . ALA A 1 29  ? -10.666 8.156   6.056   1.00 0.00 ? 29  ALA A HB1  3  
ATOM 3818  H HB2  . ALA A 1 29  ? -12.180 7.301   5.755   1.00 0.00 ? 29  ALA A HB2  3  
ATOM 3819  H HB3  . ALA A 1 29  ? -12.206 8.925   6.440   1.00 0.00 ? 29  ALA A HB3  3  
ATOM 3820  N N    . SER A 1 30  ? -13.151 5.616   8.411   1.00 0.00 ? 30  SER A N    3  
ATOM 3821  C CA   . SER A 1 30  ? -14.426 5.037   8.818   1.00 0.00 ? 30  SER A CA   3  
ATOM 3822  C C    . SER A 1 30  ? -14.265 3.561   9.169   1.00 0.00 ? 30  SER A C    3  
ATOM 3823  O O    . SER A 1 30  ? -13.294 2.908   8.787   1.00 0.00 ? 30  SER A O    3  
ATOM 3824  C CB   . SER A 1 30  ? -15.462 5.198   7.704   1.00 0.00 ? 30  SER A CB   3  
ATOM 3825  O OG   . SER A 1 30  ? -16.169 6.419   7.838   1.00 0.00 ? 30  SER A OG   3  
ATOM 3826  H H    . SER A 1 30  ? -12.386 5.024   8.251   1.00 0.00 ? 30  SER A H    3  
ATOM 3827  H HA   . SER A 1 30  ? -14.766 5.569   9.695   1.00 0.00 ? 30  SER A HA   3  
ATOM 3828  H HB2  . SER A 1 30  ? -14.962 5.189   6.747   1.00 0.00 ? 30  SER A HB2  3  
ATOM 3829  H HB3  . SER A 1 30  ? -16.166 4.381   7.751   1.00 0.00 ? 30  SER A HB3  3  
ATOM 3830  H HG   . SER A 1 30  ? -16.993 6.262   8.305   1.00 0.00 ? 30  SER A HG   3  
ATOM 3831  N N    . PRO A 1 31  ? -15.240 3.022   9.915   1.00 0.00 ? 31  PRO A N    3  
ATOM 3832  C CA   . PRO A 1 31  ? -15.231 1.617   10.335  1.00 0.00 ? 31  PRO A CA   3  
ATOM 3833  C C    . PRO A 1 31  ? -15.461 0.662   9.168   1.00 0.00 ? 31  PRO A C    3  
ATOM 3834  O O    . PRO A 1 31  ? -15.441 -0.557  9.337   1.00 0.00 ? 31  PRO A O    3  
ATOM 3835  C CB   . PRO A 1 31  ? -16.392 1.536   11.329  1.00 0.00 ? 31  PRO A CB   3  
ATOM 3836  C CG   . PRO A 1 31  ? -17.308 2.642   10.932  1.00 0.00 ? 31  PRO A CG   3  
ATOM 3837  C CD   . PRO A 1 31  ? -16.427 3.741   10.407  1.00 0.00 ? 31  PRO A CD   3  
ATOM 3838  H HA   . PRO A 1 31  ? -14.309 1.358   10.834  1.00 0.00 ? 31  PRO A HA   3  
ATOM 3839  H HB2  . PRO A 1 31  ? -16.875 0.573   11.245  1.00 0.00 ? 31  PRO A HB2  3  
ATOM 3840  H HB3  . PRO A 1 31  ? -16.021 1.673   12.333  1.00 0.00 ? 31  PRO A HB3  3  
ATOM 3841  H HG2  . PRO A 1 31  ? -17.983 2.301   10.162  1.00 0.00 ? 31  PRO A HG2  3  
ATOM 3842  H HG3  . PRO A 1 31  ? -17.862 2.986   11.793  1.00 0.00 ? 31  PRO A HG3  3  
ATOM 3843  H HD2  . PRO A 1 31  ? -16.920 4.268   9.602   1.00 0.00 ? 31  PRO A HD2  3  
ATOM 3844  H HD3  . PRO A 1 31  ? -16.162 4.424   11.200  1.00 0.00 ? 31  PRO A HD3  3  
ATOM 3845  N N    . THR A 1 32  ? -15.680 1.225   7.983   1.00 0.00 ? 32  THR A N    3  
ATOM 3846  C CA   . THR A 1 32  ? -15.914 0.423   6.789   1.00 0.00 ? 32  THR A CA   3  
ATOM 3847  C C    . THR A 1 32  ? -15.025 0.879   5.638   1.00 0.00 ? 32  THR A C    3  
ATOM 3848  O O    . THR A 1 32  ? -15.023 0.274   4.565   1.00 0.00 ? 32  THR A O    3  
ATOM 3849  C CB   . THR A 1 32  ? -17.387 0.496   6.344   1.00 0.00 ? 32  THR A CB   3  
ATOM 3850  O OG1  . THR A 1 32  ? -17.746 1.852   6.058   1.00 0.00 ? 32  THR A OG1  3  
ATOM 3851  C CG2  . THR A 1 32  ? -18.306 -0.060  7.421   1.00 0.00 ? 32  THR A CG2  3  
ATOM 3852  H H    . THR A 1 32  ? -15.683 2.202   7.913   1.00 0.00 ? 32  THR A H    3  
ATOM 3853  H HA   . THR A 1 32  ? -15.682 -0.605  7.026   1.00 0.00 ? 32  THR A HA   3  
ATOM 3854  H HB   . THR A 1 32  ? -17.507 -0.097  5.448   1.00 0.00 ? 32  THR A HB   3  
ATOM 3855  H HG1  . THR A 1 32  ? -18.695 1.960   6.155   1.00 0.00 ? 32  THR A HG1  3  
ATOM 3856  H HG21 . THR A 1 32  ? -18.290 -1.140  7.386   1.00 0.00 ? 32  THR A HG21 3  
ATOM 3857  H HG22 . THR A 1 32  ? -19.313 0.291   7.252   1.00 0.00 ? 32  THR A HG22 3  
ATOM 3858  H HG23 . THR A 1 32  ? -17.966 0.273   8.390   1.00 0.00 ? 32  THR A HG23 3  
ATOM 3859  N N    . SER A 1 33  ? -14.269 1.948   5.867   1.00 0.00 ? 33  SER A N    3  
ATOM 3860  C CA   . SER A 1 33  ? -13.376 2.486   4.847   1.00 0.00 ? 33  SER A CA   3  
ATOM 3861  C C    . SER A 1 33  ? -12.014 2.828   5.443   1.00 0.00 ? 33  SER A C    3  
ATOM 3862  O O    . SER A 1 33  ? -11.834 2.805   6.661   1.00 0.00 ? 33  SER A O    3  
ATOM 3863  C CB   . SER A 1 33  ? -13.992 3.732   4.207   1.00 0.00 ? 33  SER A CB   3  
ATOM 3864  O OG   . SER A 1 33  ? -13.656 4.899   4.937   1.00 0.00 ? 33  SER A OG   3  
ATOM 3865  H H    . SER A 1 33  ? -14.315 2.386   6.743   1.00 0.00 ? 33  SER A H    3  
ATOM 3866  H HA   . SER A 1 33  ? -13.245 1.729   4.089   1.00 0.00 ? 33  SER A HA   3  
ATOM 3867  H HB2  . SER A 1 33  ? -13.623 3.834   3.198   1.00 0.00 ? 33  SER A HB2  3  
ATOM 3868  H HB3  . SER A 1 33  ? -15.067 3.630   4.189   1.00 0.00 ? 33  SER A HB3  3  
ATOM 3869  H HG   . SER A 1 33  ? -12.768 5.178   4.704   1.00 0.00 ? 33  SER A HG   3  
ATOM 3870  N N    . ILE A 1 34  ? -11.058 3.143   4.576   1.00 0.00 ? 34  ILE A N    3  
ATOM 3871  C CA   . ILE A 1 34  ? -9.712  3.490   5.015   1.00 0.00 ? 34  ILE A CA   3  
ATOM 3872  C C    . ILE A 1 34  ? -9.016  4.388   3.998   1.00 0.00 ? 34  ILE A C    3  
ATOM 3873  O O    . ILE A 1 34  ? -8.826  4.006   2.843   1.00 0.00 ? 34  ILE A O    3  
ATOM 3874  C CB   . ILE A 1 34  ? -8.853  2.232   5.245   1.00 0.00 ? 34  ILE A CB   3  
ATOM 3875  C CG1  . ILE A 1 34  ? -9.360  1.457   6.463   1.00 0.00 ? 34  ILE A CG1  3  
ATOM 3876  C CG2  . ILE A 1 34  ? -7.392  2.614   5.423   1.00 0.00 ? 34  ILE A CG2  3  
ATOM 3877  C CD1  . ILE A 1 34  ? -8.509  0.256   6.812   1.00 0.00 ? 34  ILE A CD1  3  
ATOM 3878  H H    . ILE A 1 34  ? -11.263 3.143   3.618   1.00 0.00 ? 34  ILE A H    3  
ATOM 3879  H HA   . ILE A 1 34  ? -9.795  4.021   5.952   1.00 0.00 ? 34  ILE A HA   3  
ATOM 3880  H HB   . ILE A 1 34  ? -8.932  1.605   4.370   1.00 0.00 ? 34  ILE A HB   3  
ATOM 3881  H HG12 . ILE A 1 34  ? -9.373  2.113   7.319   1.00 0.00 ? 34  ILE A HG12 3  
ATOM 3882  H HG13 . ILE A 1 34  ? -10.363 1.108   6.266   1.00 0.00 ? 34  ILE A HG13 3  
ATOM 3883  H HG21 . ILE A 1 34  ? -7.327  3.545   5.968   1.00 0.00 ? 34  ILE A HG21 3  
ATOM 3884  H HG22 . ILE A 1 34  ? -6.882  1.839   5.975   1.00 0.00 ? 34  ILE A HG22 3  
ATOM 3885  H HG23 . ILE A 1 34  ? -6.929  2.731   4.455   1.00 0.00 ? 34  ILE A HG23 3  
ATOM 3886  H HD11 . ILE A 1 34  ? -7.860  0.021   5.981   1.00 0.00 ? 34  ILE A HD11 3  
ATOM 3887  H HD12 . ILE A 1 34  ? -7.914  0.477   7.685   1.00 0.00 ? 34  ILE A HD12 3  
ATOM 3888  H HD13 . ILE A 1 34  ? -9.149  -0.590  7.018   1.00 0.00 ? 34  ILE A HD13 3  
ATOM 3889  N N    . THR A 1 35  ? -8.637  5.585   4.436   1.00 0.00 ? 35  THR A N    3  
ATOM 3890  C CA   . THR A 1 35  ? -7.961  6.538   3.565   1.00 0.00 ? 35  THR A CA   3  
ATOM 3891  C C    . THR A 1 35  ? -6.448  6.366   3.630   1.00 0.00 ? 35  THR A C    3  
ATOM 3892  O O    . THR A 1 35  ? -5.877  6.212   4.709   1.00 0.00 ? 35  THR A O    3  
ATOM 3893  C CB   . THR A 1 35  ? -8.318  7.990   3.937   1.00 0.00 ? 35  THR A CB   3  
ATOM 3894  O OG1  . THR A 1 35  ? -9.711  8.226   3.709   1.00 0.00 ? 35  THR A OG1  3  
ATOM 3895  C CG2  . THR A 1 35  ? -7.491  8.975   3.125   1.00 0.00 ? 35  THR A CG2  3  
ATOM 3896  H H    . THR A 1 35  ? -8.817  5.831   5.367   1.00 0.00 ? 35  THR A H    3  
ATOM 3897  H HA   . THR A 1 35  ? -8.292  6.357   2.552   1.00 0.00 ? 35  THR A HA   3  
ATOM 3898  H HB   . THR A 1 35  ? -8.102  8.140   4.986   1.00 0.00 ? 35  THR A HB   3  
ATOM 3899  H HG1  . THR A 1 35  ? -9.974  9.041   4.144   1.00 0.00 ? 35  THR A HG1  3  
ATOM 3900  H HG21 . THR A 1 35  ? -8.143  9.717   2.688   1.00 0.00 ? 35  THR A HG21 3  
ATOM 3901  H HG22 . THR A 1 35  ? -6.970  8.447   2.341   1.00 0.00 ? 35  THR A HG22 3  
ATOM 3902  H HG23 . THR A 1 35  ? -6.775  9.461   3.770   1.00 0.00 ? 35  THR A HG23 3  
ATOM 3903  N N    . VAL A 1 36  ? -5.804  6.392   2.468   1.00 0.00 ? 36  VAL A N    3  
ATOM 3904  C CA   . VAL A 1 36  ? -4.356  6.241   2.393   1.00 0.00 ? 36  VAL A CA   3  
ATOM 3905  C C    . VAL A 1 36  ? -3.733  7.332   1.529   1.00 0.00 ? 36  VAL A C    3  
ATOM 3906  O O    . VAL A 1 36  ? -4.067  7.474   0.352   1.00 0.00 ? 36  VAL A O    3  
ATOM 3907  C CB   . VAL A 1 36  ? -3.964  4.864   1.824   1.00 0.00 ? 36  VAL A CB   3  
ATOM 3908  C CG1  . VAL A 1 36  ? -2.475  4.613   2.009   1.00 0.00 ? 36  VAL A CG1  3  
ATOM 3909  C CG2  . VAL A 1 36  ? -4.784  3.764   2.480   1.00 0.00 ? 36  VAL A CG2  3  
ATOM 3910  H H    . VAL A 1 36  ? -6.314  6.518   1.641   1.00 0.00 ? 36  VAL A H    3  
ATOM 3911  H HA   . VAL A 1 36  ? -3.959  6.318   3.395   1.00 0.00 ? 36  VAL A HA   3  
ATOM 3912  H HB   . VAL A 1 36  ? -4.178  4.861   0.765   1.00 0.00 ? 36  VAL A HB   3  
ATOM 3913  H HG11 . VAL A 1 36  ? -1.941  4.963   1.138   1.00 0.00 ? 36  VAL A HG11 3  
ATOM 3914  H HG12 . VAL A 1 36  ? -2.127  5.143   2.884   1.00 0.00 ? 36  VAL A HG12 3  
ATOM 3915  H HG13 . VAL A 1 36  ? -2.302  3.555   2.135   1.00 0.00 ? 36  VAL A HG13 3  
ATOM 3916  H HG21 . VAL A 1 36  ? -5.214  3.133   1.717   1.00 0.00 ? 36  VAL A HG21 3  
ATOM 3917  H HG22 . VAL A 1 36  ? -4.146  3.171   3.119   1.00 0.00 ? 36  VAL A HG22 3  
ATOM 3918  H HG23 . VAL A 1 36  ? -5.573  4.206   3.070   1.00 0.00 ? 36  VAL A HG23 3  
ATOM 3919  N N    . THR A 1 37  ? -2.824  8.101   2.120   1.00 0.00 ? 37  THR A N    3  
ATOM 3920  C CA   . THR A 1 37  ? -2.154  9.180   1.406   1.00 0.00 ? 37  THR A CA   3  
ATOM 3921  C C    . THR A 1 37  ? -0.647  8.955   1.359   1.00 0.00 ? 37  THR A C    3  
ATOM 3922  O O    . THR A 1 37  ? -0.038  8.558   2.352   1.00 0.00 ? 37  THR A O    3  
ATOM 3923  C CB   . THR A 1 37  ? -2.438  10.546  2.058   1.00 0.00 ? 37  THR A CB   3  
ATOM 3924  O OG1  . THR A 1 37  ? -1.726  10.656  3.295   1.00 0.00 ? 37  THR A OG1  3  
ATOM 3925  C CG2  . THR A 1 37  ? -3.927  10.729  2.305   1.00 0.00 ? 37  THR A CG2  3  
ATOM 3926  H H    . THR A 1 37  ? -2.600  7.938   3.060   1.00 0.00 ? 37  THR A H    3  
ATOM 3927  H HA   . THR A 1 37  ? -2.537  9.199   0.396   1.00 0.00 ? 37  THR A HA   3  
ATOM 3928  H HB   . THR A 1 37  ? -2.101  11.324  1.387   1.00 0.00 ? 37  THR A HB   3  
ATOM 3929  H HG1  . THR A 1 37  ? -1.763  9.817   3.761   1.00 0.00 ? 37  THR A HG1  3  
ATOM 3930  H HG21 . THR A 1 37  ? -4.147  10.526  3.343   1.00 0.00 ? 37  THR A HG21 3  
ATOM 3931  H HG22 . THR A 1 37  ? -4.483  10.046  1.679   1.00 0.00 ? 37  THR A HG22 3  
ATOM 3932  H HG23 . THR A 1 37  ? -4.209  11.744  2.070   1.00 0.00 ? 37  THR A HG23 3  
ATOM 3933  N N    . TRP A 1 38  ? -0.052  9.212   0.200   1.00 0.00 ? 38  TRP A N    3  
ATOM 3934  C CA   . TRP A 1 38  ? 1.386   9.038   0.024   1.00 0.00 ? 38  TRP A CA   3  
ATOM 3935  C C    . TRP A 1 38  ? 1.965   10.146  -0.849  1.00 0.00 ? 38  TRP A C    3  
ATOM 3936  O O    . TRP A 1 38  ? 1.227   10.947  -1.422  1.00 0.00 ? 38  TRP A O    3  
ATOM 3937  C CB   . TRP A 1 38  ? 1.683   7.673   -0.599  1.00 0.00 ? 38  TRP A CB   3  
ATOM 3938  C CG   . TRP A 1 38  ? 1.003   7.461   -1.918  1.00 0.00 ? 38  TRP A CG   3  
ATOM 3939  C CD1  . TRP A 1 38  ? 1.513   7.735   -3.155  1.00 0.00 ? 38  TRP A CD1  3  
ATOM 3940  C CD2  . TRP A 1 38  ? -0.310  6.933   -2.130  1.00 0.00 ? 38  TRP A CD2  3  
ATOM 3941  N NE1  . TRP A 1 38  ? 0.594   7.408   -4.124  1.00 0.00 ? 38  TRP A NE1  3  
ATOM 3942  C CE2  . TRP A 1 38  ? -0.532  6.914   -3.521  1.00 0.00 ? 38  TRP A CE2  3  
ATOM 3943  C CE3  . TRP A 1 38  ? -1.320  6.473   -1.280  1.00 0.00 ? 38  TRP A CE3  3  
ATOM 3944  C CZ2  . TRP A 1 38  ? -1.722  6.454   -4.078  1.00 0.00 ? 38  TRP A CZ2  3  
ATOM 3945  C CZ3  . TRP A 1 38  ? -2.501  6.017   -1.835  1.00 0.00 ? 38  TRP A CZ3  3  
ATOM 3946  C CH2  . TRP A 1 38  ? -2.693  6.009   -3.223  1.00 0.00 ? 38  TRP A CH2  3  
ATOM 3947  H H    . TRP A 1 38  ? -0.591  9.526   -0.556  1.00 0.00 ? 38  TRP A H    3  
ATOM 3948  H HA   . TRP A 1 38  ? 1.846   9.087   1.000   1.00 0.00 ? 38  TRP A HA   3  
ATOM 3949  H HB2  . TRP A 1 38  ? 2.747   7.579   -0.753  1.00 0.00 ? 38  TRP A HB2  3  
ATOM 3950  H HB3  . TRP A 1 38  ? 1.351   6.898   0.077   1.00 0.00 ? 38  TRP A HB3  3  
ATOM 3951  H HD1  . TRP A 1 38  ? 2.494   8.148   -3.331  1.00 0.00 ? 38  TRP A HD1  3  
ATOM 3952  H HE1  . TRP A 1 38  ? 0.726   7.511   -5.090  1.00 0.00 ? 38  TRP A HE1  3  
ATOM 3953  H HE3  . TRP A 1 38  ? -1.190  6.471   -0.208  1.00 0.00 ? 38  TRP A HE3  3  
ATOM 3954  H HZ2  . TRP A 1 38  ? -1.885  6.440   -5.146  1.00 0.00 ? 38  TRP A HZ2  3  
ATOM 3955  H HZ3  . TRP A 1 38  ? -3.293  5.658   -1.195  1.00 0.00 ? 38  TRP A HZ3  3  
ATOM 3956  H HH2  . TRP A 1 38  ? -3.631  5.644   -3.613  1.00 0.00 ? 38  TRP A HH2  3  
ATOM 3957  N N    . GLU A 1 39  ? 3.291   10.185  -0.947  1.00 0.00 ? 39  GLU A N    3  
ATOM 3958  C CA   . GLU A 1 39  ? 3.968   11.196  -1.750  1.00 0.00 ? 39  GLU A CA   3  
ATOM 3959  C C    . GLU A 1 39  ? 4.781   10.548  -2.867  1.00 0.00 ? 39  GLU A C    3  
ATOM 3960  O O    . GLU A 1 39  ? 5.034   9.343   -2.848  1.00 0.00 ? 39  GLU A O    3  
ATOM 3961  C CB   . GLU A 1 39  ? 4.881   12.052  -0.870  1.00 0.00 ? 39  GLU A CB   3  
ATOM 3962  C CG   . GLU A 1 39  ? 4.139   13.112  -0.073  1.00 0.00 ? 39  GLU A CG   3  
ATOM 3963  C CD   . GLU A 1 39  ? 3.431   14.118  -0.959  1.00 0.00 ? 39  GLU A CD   3  
ATOM 3964  O OE1  . GLU A 1 39  ? 4.073   14.644  -1.892  1.00 0.00 ? 39  GLU A OE1  3  
ATOM 3965  O OE2  . GLU A 1 39  ? 2.233   14.380  -0.719  1.00 0.00 ? 39  GLU A OE2  3  
ATOM 3966  H H    . GLU A 1 39  ? 3.825   9.518   -0.467  1.00 0.00 ? 39  GLU A H    3  
ATOM 3967  H HA   . GLU A 1 39  ? 3.213   11.828  -2.192  1.00 0.00 ? 39  GLU A HA   3  
ATOM 3968  H HB2  . GLU A 1 39  ? 5.400   11.407  -0.177  1.00 0.00 ? 39  GLU A HB2  3  
ATOM 3969  H HB3  . GLU A 1 39  ? 5.606   12.546  -1.499  1.00 0.00 ? 39  GLU A HB3  3  
ATOM 3970  H HG2  . GLU A 1 39  ? 3.404   12.626  0.551   1.00 0.00 ? 39  GLU A HG2  3  
ATOM 3971  H HG3  . GLU A 1 39  ? 4.848   13.638  0.549   1.00 0.00 ? 39  GLU A HG3  3  
ATOM 3972  N N    . THR A 1 40  ? 5.187   11.357  -3.841  1.00 0.00 ? 40  THR A N    3  
ATOM 3973  C CA   . THR A 1 40  ? 5.970   10.864  -4.967  1.00 0.00 ? 40  THR A CA   3  
ATOM 3974  C C    . THR A 1 40  ? 7.458   10.846  -4.637  1.00 0.00 ? 40  THR A C    3  
ATOM 3975  O O    . THR A 1 40  ? 8.019   11.821  -4.135  1.00 0.00 ? 40  THR A O    3  
ATOM 3976  C CB   . THR A 1 40  ? 5.745   11.722  -6.226  1.00 0.00 ? 40  THR A CB   3  
ATOM 3977  O OG1  . THR A 1 40  ? 4.466   11.426  -6.799  1.00 0.00 ? 40  THR A OG1  3  
ATOM 3978  C CG2  . THR A 1 40  ? 6.837   11.471  -7.255  1.00 0.00 ? 40  THR A CG2  3  
ATOM 3979  H H    . THR A 1 40  ? 4.954   12.307  -3.800  1.00 0.00 ? 40  THR A H    3  
ATOM 3980  H HA   . THR A 1 40  ? 5.647   9.855   -5.182  1.00 0.00 ? 40  THR A HA   3  
ATOM 3981  H HB   . THR A 1 40  ? 5.771   12.764  -5.942  1.00 0.00 ? 40  THR A HB   3  
ATOM 3982  H HG1  . THR A 1 40  ? 4.369   11.902  -7.628  1.00 0.00 ? 40  THR A HG1  3  
ATOM 3983  H HG21 . THR A 1 40  ? 6.640   12.057  -8.140  1.00 0.00 ? 40  THR A HG21 3  
ATOM 3984  H HG22 . THR A 1 40  ? 6.854   10.423  -7.513  1.00 0.00 ? 40  THR A HG22 3  
ATOM 3985  H HG23 . THR A 1 40  ? 7.793   11.755  -6.841  1.00 0.00 ? 40  THR A HG23 3  
ATOM 3986  N N    . PRO A 1 41  ? 8.116   9.713   -4.925  1.00 0.00 ? 41  PRO A N    3  
ATOM 3987  C CA   . PRO A 1 41  ? 9.549   9.543   -4.668  1.00 0.00 ? 41  PRO A CA   3  
ATOM 3988  C C    . PRO A 1 41  ? 10.410  10.394  -5.595  1.00 0.00 ? 41  PRO A C    3  
ATOM 3989  O O    . PRO A 1 41  ? 10.419  10.191  -6.810  1.00 0.00 ? 41  PRO A O    3  
ATOM 3990  C CB   . PRO A 1 41  ? 9.783   8.054   -4.937  1.00 0.00 ? 41  PRO A CB   3  
ATOM 3991  C CG   . PRO A 1 41  ? 8.701   7.666   -5.885  1.00 0.00 ? 41  PRO A CG   3  
ATOM 3992  C CD   . PRO A 1 41  ? 7.511   8.512   -5.524  1.00 0.00 ? 41  PRO A CD   3  
ATOM 3993  H HA   . PRO A 1 41  ? 9.797   9.768   -3.641  1.00 0.00 ? 41  PRO A HA   3  
ATOM 3994  H HB2  . PRO A 1 41  ? 10.762  7.915   -5.374  1.00 0.00 ? 41  PRO A HB2  3  
ATOM 3995  H HB3  . PRO A 1 41  ? 9.714   7.502   -4.012  1.00 0.00 ? 41  PRO A HB3  3  
ATOM 3996  H HG2  . PRO A 1 41  ? 9.011   7.868   -6.899  1.00 0.00 ? 41  PRO A HG2  3  
ATOM 3997  H HG3  . PRO A 1 41  ? 8.466   6.619   -5.765  1.00 0.00 ? 41  PRO A HG3  3  
ATOM 3998  H HD2  . PRO A 1 41  ? 6.946   8.765   -6.409  1.00 0.00 ? 41  PRO A HD2  3  
ATOM 3999  H HD3  . PRO A 1 41  ? 6.886   7.998   -4.809  1.00 0.00 ? 41  PRO A HD3  3  
ATOM 4000  N N    . VAL A 1 42  ? 11.133  11.347  -5.016  1.00 0.00 ? 42  VAL A N    3  
ATOM 4001  C CA   . VAL A 1 42  ? 11.998  12.228  -5.790  1.00 0.00 ? 42  VAL A CA   3  
ATOM 4002  C C    . VAL A 1 42  ? 13.035  11.430  -6.574  1.00 0.00 ? 42  VAL A C    3  
ATOM 4003  O O    . VAL A 1 42  ? 13.659  11.945  -7.501  1.00 0.00 ? 42  VAL A O    3  
ATOM 4004  C CB   . VAL A 1 42  ? 12.724  13.240  -4.885  1.00 0.00 ? 42  VAL A CB   3  
ATOM 4005  C CG1  . VAL A 1 42  ? 11.726  13.984  -4.010  1.00 0.00 ? 42  VAL A CG1  3  
ATOM 4006  C CG2  . VAL A 1 42  ? 13.772  12.539  -4.034  1.00 0.00 ? 42  VAL A CG2  3  
ATOM 4007  H H    . VAL A 1 42  ? 11.083  11.460  -4.043  1.00 0.00 ? 42  VAL A H    3  
ATOM 4008  H HA   . VAL A 1 42  ? 11.380  12.777  -6.486  1.00 0.00 ? 42  VAL A HA   3  
ATOM 4009  H HB   . VAL A 1 42  ? 13.225  13.961  -5.514  1.00 0.00 ? 42  VAL A HB   3  
ATOM 4010  H HG11 . VAL A 1 42  ? 11.100  14.610  -4.629  1.00 0.00 ? 42  VAL A HG11 3  
ATOM 4011  H HG12 . VAL A 1 42  ? 11.112  13.273  -3.478  1.00 0.00 ? 42  VAL A HG12 3  
ATOM 4012  H HG13 . VAL A 1 42  ? 12.260  14.601  -3.301  1.00 0.00 ? 42  VAL A HG13 3  
ATOM 4013  H HG21 . VAL A 1 42  ? 14.003  13.149  -3.174  1.00 0.00 ? 42  VAL A HG21 3  
ATOM 4014  H HG22 . VAL A 1 42  ? 13.389  11.583  -3.706  1.00 0.00 ? 42  VAL A HG22 3  
ATOM 4015  H HG23 . VAL A 1 42  ? 14.667  12.386  -4.619  1.00 0.00 ? 42  VAL A HG23 3  
ATOM 4016  N N    . SER A 1 43  ? 13.213  10.168  -6.195  1.00 0.00 ? 43  SER A N    3  
ATOM 4017  C CA   . SER A 1 43  ? 14.176  9.299   -6.859  1.00 0.00 ? 43  SER A CA   3  
ATOM 4018  C C    . SER A 1 43  ? 13.484  8.401   -7.881  1.00 0.00 ? 43  SER A C    3  
ATOM 4019  O O    . SER A 1 43  ? 12.421  7.843   -7.614  1.00 0.00 ? 43  SER A O    3  
ATOM 4020  C CB   . SER A 1 43  ? 14.917  8.443   -5.831  1.00 0.00 ? 43  SER A CB   3  
ATOM 4021  O OG   . SER A 1 43  ? 16.005  7.757   -6.426  1.00 0.00 ? 43  SER A OG   3  
ATOM 4022  H H    . SER A 1 43  ? 12.685  9.815   -5.448  1.00 0.00 ? 43  SER A H    3  
ATOM 4023  H HA   . SER A 1 43  ? 14.889  9.926   -7.374  1.00 0.00 ? 43  SER A HA   3  
ATOM 4024  H HB2  . SER A 1 43  ? 15.295  9.077   -5.043  1.00 0.00 ? 43  SER A HB2  3  
ATOM 4025  H HB3  . SER A 1 43  ? 14.235  7.717   -5.412  1.00 0.00 ? 43  SER A HB3  3  
ATOM 4026  H HG   . SER A 1 43  ? 15.694  7.263   -7.189  1.00 0.00 ? 43  SER A HG   3  
ATOM 4027  N N    . GLY A 1 44  ? 14.096  8.268   -9.054  1.00 0.00 ? 44  GLY A N    3  
ATOM 4028  C CA   . GLY A 1 44  ? 13.525  7.438   -10.098 1.00 0.00 ? 44  GLY A CA   3  
ATOM 4029  C C    . GLY A 1 44  ? 13.915  7.904   -11.487 1.00 0.00 ? 44  GLY A C    3  
ATOM 4030  O O    . GLY A 1 44  ? 14.465  8.992   -11.652 1.00 0.00 ? 44  GLY A O    3  
ATOM 4031  H H    . GLY A 1 44  ? 14.942  8.737   -9.211  1.00 0.00 ? 44  GLY A H    3  
ATOM 4032  H HA2  . GLY A 1 44  ? 13.865  6.422   -9.962  1.00 0.00 ? 44  GLY A HA2  3  
ATOM 4033  H HA3  . GLY A 1 44  ? 12.449  7.461   -10.013 1.00 0.00 ? 44  GLY A HA3  3  
ATOM 4034  N N    . ASN A 1 45  ? 13.632  7.077   -12.488 1.00 0.00 ? 45  ASN A N    3  
ATOM 4035  C CA   . ASN A 1 45  ? 13.959  7.409   -13.870 1.00 0.00 ? 45  ASN A CA   3  
ATOM 4036  C C    . ASN A 1 45  ? 12.696  7.710   -14.670 1.00 0.00 ? 45  ASN A C    3  
ATOM 4037  O O    . ASN A 1 45  ? 11.764  6.908   -14.704 1.00 0.00 ? 45  ASN A O    3  
ATOM 4038  C CB   . ASN A 1 45  ? 14.729  6.260   -14.524 1.00 0.00 ? 45  ASN A CB   3  
ATOM 4039  C CG   . ASN A 1 45  ? 15.224  6.613   -15.913 1.00 0.00 ? 45  ASN A CG   3  
ATOM 4040  O OD1  . ASN A 1 45  ? 14.432  6.800   -16.838 1.00 0.00 ? 45  ASN A OD1  3  
ATOM 4041  N ND2  . ASN A 1 45  ? 16.540  6.706   -16.067 1.00 0.00 ? 45  ASN A ND2  3  
ATOM 4042  H H    . ASN A 1 45  ? 13.193  6.222   -12.293 1.00 0.00 ? 45  ASN A H    3  
ATOM 4043  H HA   . ASN A 1 45  ? 14.583  8.290   -13.860 1.00 0.00 ? 45  ASN A HA   3  
ATOM 4044  H HB2  . ASN A 1 45  ? 15.584  6.013   -13.911 1.00 0.00 ? 45  ASN A HB2  3  
ATOM 4045  H HB3  . ASN A 1 45  ? 14.084  5.398   -14.599 1.00 0.00 ? 45  ASN A HB3  3  
ATOM 4046  H HD21 . ASN A 1 45  ? 17.110  6.545   -15.286 1.00 0.00 ? 45  ASN A HD21 3  
ATOM 4047  H HD22 . ASN A 1 45  ? 16.887  6.934   -16.955 1.00 0.00 ? 45  ASN A HD22 3  
ATOM 4048  N N    . GLY A 1 46  ? 12.673  8.873   -15.315 1.00 0.00 ? 46  GLY A N    3  
ATOM 4049  C CA   . GLY A 1 46  ? 11.520  9.259   -16.107 1.00 0.00 ? 46  GLY A CA   3  
ATOM 4050  C C    . GLY A 1 46  ? 10.387  9.799   -15.257 1.00 0.00 ? 46  GLY A C    3  
ATOM 4051  O O    . GLY A 1 46  ? 10.614  10.577  -14.331 1.00 0.00 ? 46  GLY A O    3  
ATOM 4052  H H    . GLY A 1 46  ? 13.445  9.473   -15.252 1.00 0.00 ? 46  GLY A H    3  
ATOM 4053  H HA2  . GLY A 1 46  ? 11.820  10.020  -16.813 1.00 0.00 ? 46  GLY A HA2  3  
ATOM 4054  H HA3  . GLY A 1 46  ? 11.166  8.396   -16.652 1.00 0.00 ? 46  GLY A HA3  3  
ATOM 4055  N N    . GLU A 1 47  ? 9.164   9.386   -15.574 1.00 0.00 ? 47  GLU A N    3  
ATOM 4056  C CA   . GLU A 1 47  ? 7.991   9.836   -14.833 1.00 0.00 ? 47  GLU A CA   3  
ATOM 4057  C C    . GLU A 1 47  ? 7.060   8.667   -14.526 1.00 0.00 ? 47  GLU A C    3  
ATOM 4058  O O    . GLU A 1 47  ? 6.836   7.799   -15.372 1.00 0.00 ? 47  GLU A O    3  
ATOM 4059  C CB   . GLU A 1 47  ? 7.239   10.907  -15.626 1.00 0.00 ? 47  GLU A CB   3  
ATOM 4060  C CG   . GLU A 1 47  ? 5.877   11.249  -15.046 1.00 0.00 ? 47  GLU A CG   3  
ATOM 4061  C CD   . GLU A 1 47  ? 5.238   12.446  -15.724 1.00 0.00 ? 47  GLU A CD   3  
ATOM 4062  O OE1  . GLU A 1 47  ? 4.817   12.312  -16.892 1.00 0.00 ? 47  GLU A OE1  3  
ATOM 4063  O OE2  . GLU A 1 47  ? 5.159   13.516  -15.085 1.00 0.00 ? 47  GLU A OE2  3  
ATOM 4064  H H    . GLU A 1 47  ? 9.047   8.766   -16.323 1.00 0.00 ? 47  GLU A H    3  
ATOM 4065  H HA   . GLU A 1 47  ? 8.331   10.263  -13.901 1.00 0.00 ? 47  GLU A HA   3  
ATOM 4066  H HB2  . GLU A 1 47  ? 7.835   11.807  -15.647 1.00 0.00 ? 47  GLU A HB2  3  
ATOM 4067  H HB3  . GLU A 1 47  ? 7.098   10.556  -16.637 1.00 0.00 ? 47  GLU A HB3  3  
ATOM 4068  H HG2  . GLU A 1 47  ? 5.224   10.397  -15.165 1.00 0.00 ? 47  GLU A HG2  3  
ATOM 4069  H HG3  . GLU A 1 47  ? 5.992   11.468  -13.995 1.00 0.00 ? 47  GLU A HG3  3  
ATOM 4070  N N    . ILE A 1 48  ? 6.520   8.650   -13.312 1.00 0.00 ? 48  ILE A N    3  
ATOM 4071  C CA   . ILE A 1 48  ? 5.613   7.589   -12.894 1.00 0.00 ? 48  ILE A CA   3  
ATOM 4072  C C    . ILE A 1 48  ? 4.432   7.466   -13.851 1.00 0.00 ? 48  ILE A C    3  
ATOM 4073  O O    . ILE A 1 48  ? 3.941   8.465   -14.376 1.00 0.00 ? 48  ILE A O    3  
ATOM 4074  C CB   . ILE A 1 48  ? 5.082   7.831   -11.469 1.00 0.00 ? 48  ILE A CB   3  
ATOM 4075  C CG1  . ILE A 1 48  ? 6.240   8.124   -10.513 1.00 0.00 ? 48  ILE A CG1  3  
ATOM 4076  C CG2  . ILE A 1 48  ? 4.284   6.627   -10.990 1.00 0.00 ? 48  ILE A CG2  3  
ATOM 4077  C CD1  . ILE A 1 48  ? 7.391   7.151   -10.642 1.00 0.00 ? 48  ILE A CD1  3  
ATOM 4078  H H    . ILE A 1 48  ? 6.736   9.369   -12.683 1.00 0.00 ? 48  ILE A H    3  
ATOM 4079  H HA   . ILE A 1 48  ? 6.164   6.659   -12.899 1.00 0.00 ? 48  ILE A HA   3  
ATOM 4080  H HB   . ILE A 1 48  ? 4.421   8.683   -11.495 1.00 0.00 ? 48  ILE A HB   3  
ATOM 4081  H HG12 . ILE A 1 48  ? 6.619   9.114   -10.710 1.00 0.00 ? 48  ILE A HG12 3  
ATOM 4082  H HG13 . ILE A 1 48  ? 5.877   8.078   -9.496  1.00 0.00 ? 48  ILE A HG13 3  
ATOM 4083  H HG21 . ILE A 1 48  ? 4.856   5.726   -11.157 1.00 0.00 ? 48  ILE A HG21 3  
ATOM 4084  H HG22 . ILE A 1 48  ? 4.076   6.730   -9.935  1.00 0.00 ? 48  ILE A HG22 3  
ATOM 4085  H HG23 . ILE A 1 48  ? 3.354   6.570   -11.536 1.00 0.00 ? 48  ILE A HG23 3  
ATOM 4086  H HD11 . ILE A 1 48  ? 7.768   6.907   -9.659  1.00 0.00 ? 48  ILE A HD11 3  
ATOM 4087  H HD12 . ILE A 1 48  ? 7.050   6.252   -11.131 1.00 0.00 ? 48  ILE A HD12 3  
ATOM 4088  H HD13 . ILE A 1 48  ? 8.179   7.603   -11.227 1.00 0.00 ? 48  ILE A HD13 3  
ATOM 4089  N N    . GLN A 1 49  ? 3.980   6.236   -14.071 1.00 0.00 ? 49  GLN A N    3  
ATOM 4090  C CA   . GLN A 1 49  ? 2.855   5.984   -14.963 1.00 0.00 ? 49  GLN A CA   3  
ATOM 4091  C C    . GLN A 1 49  ? 1.577   5.729   -14.170 1.00 0.00 ? 49  GLN A C    3  
ATOM 4092  O O    . GLN A 1 49  ? 0.522   6.280   -14.482 1.00 0.00 ? 49  GLN A O    3  
ATOM 4093  C CB   . GLN A 1 49  ? 3.154   4.788   -15.869 1.00 0.00 ? 49  GLN A CB   3  
ATOM 4094  C CG   . GLN A 1 49  ? 4.278   5.041   -16.860 1.00 0.00 ? 49  GLN A CG   3  
ATOM 4095  C CD   . GLN A 1 49  ? 3.830   5.858   -18.055 1.00 0.00 ? 49  GLN A CD   3  
ATOM 4096  O OE1  . GLN A 1 49  ? 2.636   6.083   -18.256 1.00 0.00 ? 49  GLN A OE1  3  
ATOM 4097  N NE2  . GLN A 1 49  ? 4.788   6.308   -18.858 1.00 0.00 ? 49  GLN A NE2  3  
ATOM 4098  H H    . GLN A 1 49  ? 4.413   5.480   -13.622 1.00 0.00 ? 49  GLN A H    3  
ATOM 4099  H HA   . GLN A 1 49  ? 2.715   6.861   -15.576 1.00 0.00 ? 49  GLN A HA   3  
ATOM 4100  H HB2  . GLN A 1 49  ? 3.428   3.944   -15.253 1.00 0.00 ? 49  GLN A HB2  3  
ATOM 4101  H HB3  . GLN A 1 49  ? 2.262   4.541   -16.426 1.00 0.00 ? 49  GLN A HB3  3  
ATOM 4102  H HG2  . GLN A 1 49  ? 5.071   5.574   -16.357 1.00 0.00 ? 49  GLN A HG2  3  
ATOM 4103  H HG3  . GLN A 1 49  ? 4.652   4.090   -17.211 1.00 0.00 ? 49  GLN A HG3  3  
ATOM 4104  H HE21 . GLN A 1 49  ? 5.717   6.089   -18.637 1.00 0.00 ? 49  GLN A HE21 3  
ATOM 4105  H HE22 . GLN A 1 49  ? 4.526   6.838   -19.639 1.00 0.00 ? 49  GLN A HE22 3  
ATOM 4106  N N    . ASN A 1 50  ? 1.680   4.891   -13.144 1.00 0.00 ? 50  ASN A N    3  
ATOM 4107  C CA   . ASN A 1 50  ? 0.532   4.563   -12.307 1.00 0.00 ? 50  ASN A CA   3  
ATOM 4108  C C    . ASN A 1 50  ? 0.981   4.124   -10.916 1.00 0.00 ? 50  ASN A C    3  
ATOM 4109  O O    . ASN A 1 50  ? 2.093   3.627   -10.739 1.00 0.00 ? 50  ASN A O    3  
ATOM 4110  C CB   . ASN A 1 50  ? -0.302  3.458   -12.959 1.00 0.00 ? 50  ASN A CB   3  
ATOM 4111  C CG   . ASN A 1 50  ? 0.244   2.074   -12.666 1.00 0.00 ? 50  ASN A CG   3  
ATOM 4112  O OD1  . ASN A 1 50  ? 0.933   1.478   -13.494 1.00 0.00 ? 50  ASN A OD1  3  
ATOM 4113  N ND2  . ASN A 1 50  ? -0.064  1.555   -11.483 1.00 0.00 ? 50  ASN A ND2  3  
ATOM 4114  H H    . ASN A 1 50  ? 2.549   4.483   -12.945 1.00 0.00 ? 50  ASN A H    3  
ATOM 4115  H HA   . ASN A 1 50  ? -0.074  5.452   -12.213 1.00 0.00 ? 50  ASN A HA   3  
ATOM 4116  H HB2  . ASN A 1 50  ? -1.314  3.512   -12.585 1.00 0.00 ? 50  ASN A HB2  3  
ATOM 4117  H HB3  . ASN A 1 50  ? -0.309  3.604   -14.028 1.00 0.00 ? 50  ASN A HB3  3  
ATOM 4118  H HD21 . ASN A 1 50  ? -0.617  2.087   -10.873 1.00 0.00 ? 50  ASN A HD21 3  
ATOM 4119  H HD22 . ASN A 1 50  ? 0.276   0.662   -11.267 1.00 0.00 ? 50  ASN A HD22 3  
ATOM 4120  N N    . TYR A 1 51  ? 0.107   4.311   -9.933  1.00 0.00 ? 51  TYR A N    3  
ATOM 4121  C CA   . TYR A 1 51  ? 0.413   3.936   -8.558  1.00 0.00 ? 51  TYR A CA   3  
ATOM 4122  C C    . TYR A 1 51  ? -0.365  2.690   -8.146  1.00 0.00 ? 51  TYR A C    3  
ATOM 4123  O O    . TYR A 1 51  ? -1.596  2.673   -8.178  1.00 0.00 ? 51  TYR A O    3  
ATOM 4124  C CB   . TYR A 1 51  ? 0.089   5.090   -7.608  1.00 0.00 ? 51  TYR A CB   3  
ATOM 4125  C CG   . TYR A 1 51  ? 1.187   6.125   -7.515  1.00 0.00 ? 51  TYR A CG   3  
ATOM 4126  C CD1  . TYR A 1 51  ? 2.487   5.759   -7.188  1.00 0.00 ? 51  TYR A CD1  3  
ATOM 4127  C CD2  . TYR A 1 51  ? 0.926   7.468   -7.752  1.00 0.00 ? 51  TYR A CD2  3  
ATOM 4128  C CE1  . TYR A 1 51  ? 3.494   6.701   -7.100  1.00 0.00 ? 51  TYR A CE1  3  
ATOM 4129  C CE2  . TYR A 1 51  ? 1.926   8.417   -7.669  1.00 0.00 ? 51  TYR A CE2  3  
ATOM 4130  C CZ   . TYR A 1 51  ? 3.209   8.028   -7.343  1.00 0.00 ? 51  TYR A CZ   3  
ATOM 4131  O OH   . TYR A 1 51  ? 4.208   8.970   -7.257  1.00 0.00 ? 51  TYR A OH   3  
ATOM 4132  H H    . TYR A 1 51  ? -0.764  4.712   -10.136 1.00 0.00 ? 51  TYR A H    3  
ATOM 4133  H HA   . TYR A 1 51  ? 1.471   3.722   -8.500  1.00 0.00 ? 51  TYR A HA   3  
ATOM 4134  H HB2  . TYR A 1 51  ? -0.806  5.587   -7.949  1.00 0.00 ? 51  TYR A HB2  3  
ATOM 4135  H HB3  . TYR A 1 51  ? -0.080  4.695   -6.617  1.00 0.00 ? 51  TYR A HB3  3  
ATOM 4136  H HD1  . TYR A 1 51  ? 2.708   4.718   -6.998  1.00 0.00 ? 51  TYR A HD1  3  
ATOM 4137  H HD2  . TYR A 1 51  ? -0.080  7.770   -8.007  1.00 0.00 ? 51  TYR A HD2  3  
ATOM 4138  H HE1  . TYR A 1 51  ? 4.499   6.397   -6.845  1.00 0.00 ? 51  TYR A HE1  3  
ATOM 4139  H HE2  . TYR A 1 51  ? 1.703   9.457   -7.858  1.00 0.00 ? 51  TYR A HE2  3  
ATOM 4140  H HH   . TYR A 1 51  ? 4.776   8.905   -8.029  1.00 0.00 ? 51  TYR A HH   3  
ATOM 4141  N N    . LYS A 1 52  ? 0.362   1.647   -7.759  1.00 0.00 ? 52  LYS A N    3  
ATOM 4142  C CA   . LYS A 1 52  ? -0.257  0.396   -7.339  1.00 0.00 ? 52  LYS A CA   3  
ATOM 4143  C C    . LYS A 1 52  ? -0.510  0.392   -5.835  1.00 0.00 ? 52  LYS A C    3  
ATOM 4144  O O    . LYS A 1 52  ? 0.427   0.337   -5.038  1.00 0.00 ? 52  LYS A O    3  
ATOM 4145  C CB   . LYS A 1 52  ? 0.631   -0.790  -7.721  1.00 0.00 ? 52  LYS A CB   3  
ATOM 4146  C CG   . LYS A 1 52  ? -0.138  -2.081  -7.940  1.00 0.00 ? 52  LYS A CG   3  
ATOM 4147  C CD   . LYS A 1 52  ? -0.869  -2.076  -9.272  1.00 0.00 ? 52  LYS A CD   3  
ATOM 4148  C CE   . LYS A 1 52  ? -1.076  -3.487  -9.800  1.00 0.00 ? 52  LYS A CE   3  
ATOM 4149  N NZ   . LYS A 1 52  ? -1.185  -3.513  -11.285 1.00 0.00 ? 52  LYS A NZ   3  
ATOM 4150  H H    . LYS A 1 52  ? 1.340   1.721   -7.756  1.00 0.00 ? 52  LYS A H    3  
ATOM 4151  H HA   . LYS A 1 52  ? -1.203  0.305   -7.851  1.00 0.00 ? 52  LYS A HA   3  
ATOM 4152  H HB2  . LYS A 1 52  ? 1.159   -0.551  -8.632  1.00 0.00 ? 52  LYS A HB2  3  
ATOM 4153  H HB3  . LYS A 1 52  ? 1.351   -0.954  -6.931  1.00 0.00 ? 52  LYS A HB3  3  
ATOM 4154  H HG2  . LYS A 1 52  ? 0.555   -2.910  -7.925  1.00 0.00 ? 52  LYS A HG2  3  
ATOM 4155  H HG3  . LYS A 1 52  ? -0.859  -2.199  -7.143  1.00 0.00 ? 52  LYS A HG3  3  
ATOM 4156  H HD2  . LYS A 1 52  ? -1.834  -1.607  -9.141  1.00 0.00 ? 52  LYS A HD2  3  
ATOM 4157  H HD3  . LYS A 1 52  ? -0.288  -1.513  -9.989  1.00 0.00 ? 52  LYS A HD3  3  
ATOM 4158  H HE2  . LYS A 1 52  ? -0.239  -4.096  -9.498  1.00 0.00 ? 52  LYS A HE2  3  
ATOM 4159  H HE3  . LYS A 1 52  ? -1.985  -3.887  -9.374  1.00 0.00 ? 52  LYS A HE3  3  
ATOM 4160  H HZ1  . LYS A 1 52  ? -2.185  -3.491  -11.570 1.00 0.00 ? 52  LYS A HZ1  3  
ATOM 4161  H HZ2  . LYS A 1 52  ? -0.748  -4.378  -11.660 1.00 0.00 ? 52  LYS A HZ2  3  
ATOM 4162  H HZ3  . LYS A 1 52  ? -0.702  -2.688  -11.693 1.00 0.00 ? 52  LYS A HZ3  3  
ATOM 4163  N N    . LEU A 1 53  ? -1.781  0.450   -5.453  1.00 0.00 ? 53  LEU A N    3  
ATOM 4164  C CA   . LEU A 1 53  ? -2.158  0.452   -4.044  1.00 0.00 ? 53  LEU A CA   3  
ATOM 4165  C C    . LEU A 1 53  ? -2.701  -0.910  -3.624  1.00 0.00 ? 53  LEU A C    3  
ATOM 4166  O O    . LEU A 1 53  ? -3.690  -1.393  -4.177  1.00 0.00 ? 53  LEU A O    3  
ATOM 4167  C CB   . LEU A 1 53  ? -3.204  1.536   -3.776  1.00 0.00 ? 53  LEU A CB   3  
ATOM 4168  C CG   . LEU A 1 53  ? -3.817  1.545   -2.376  1.00 0.00 ? 53  LEU A CG   3  
ATOM 4169  C CD1  . LEU A 1 53  ? -2.755  1.846   -1.330  1.00 0.00 ? 53  LEU A CD1  3  
ATOM 4170  C CD2  . LEU A 1 53  ? -4.948  2.560   -2.296  1.00 0.00 ? 53  LEU A CD2  3  
ATOM 4171  H H    . LEU A 1 53  ? -2.484  0.493   -6.135  1.00 0.00 ? 53  LEU A H    3  
ATOM 4172  H HA   . LEU A 1 53  ? -1.272  0.667   -3.465  1.00 0.00 ? 53  LEU A HA   3  
ATOM 4173  H HB2  . LEU A 1 53  ? -2.735  2.494   -3.939  1.00 0.00 ? 53  LEU A HB2  3  
ATOM 4174  H HB3  . LEU A 1 53  ? -4.005  1.403   -4.489  1.00 0.00 ? 53  LEU A HB3  3  
ATOM 4175  H HG   . LEU A 1 53  ? -4.227  0.568   -2.163  1.00 0.00 ? 53  LEU A HG   3  
ATOM 4176  H HD11 . LEU A 1 53  ? -3.227  2.220   -0.434  1.00 0.00 ? 53  LEU A HD11 3  
ATOM 4177  H HD12 . LEU A 1 53  ? -2.071  2.588   -1.714  1.00 0.00 ? 53  LEU A HD12 3  
ATOM 4178  H HD13 . LEU A 1 53  ? -2.211  0.941   -1.100  1.00 0.00 ? 53  LEU A HD13 3  
ATOM 4179  H HD21 . LEU A 1 53  ? -5.781  2.217   -2.893  1.00 0.00 ? 53  LEU A HD21 3  
ATOM 4180  H HD22 . LEU A 1 53  ? -4.604  3.513   -2.671  1.00 0.00 ? 53  LEU A HD22 3  
ATOM 4181  H HD23 . LEU A 1 53  ? -5.262  2.669   -1.269  1.00 0.00 ? 53  LEU A HD23 3  
ATOM 4182  N N    . TYR A 1 54  ? -2.051  -1.524  -2.642  1.00 0.00 ? 54  TYR A N    3  
ATOM 4183  C CA   . TYR A 1 54  ? -2.468  -2.830  -2.147  1.00 0.00 ? 54  TYR A CA   3  
ATOM 4184  C C    . TYR A 1 54  ? -3.263  -2.694  -0.852  1.00 0.00 ? 54  TYR A C    3  
ATOM 4185  O O    . TYR A 1 54  ? -3.141  -1.699  -0.137  1.00 0.00 ? 54  TYR A O    3  
ATOM 4186  C CB   . TYR A 1 54  ? -1.249  -3.726  -1.919  1.00 0.00 ? 54  TYR A CB   3  
ATOM 4187  C CG   . TYR A 1 54  ? -0.546  -4.128  -3.195  1.00 0.00 ? 54  TYR A CG   3  
ATOM 4188  C CD1  . TYR A 1 54  ? 0.016   -3.173  -4.033  1.00 0.00 ? 54  TYR A CD1  3  
ATOM 4189  C CD2  . TYR A 1 54  ? -0.441  -5.464  -3.563  1.00 0.00 ? 54  TYR A CD2  3  
ATOM 4190  C CE1  . TYR A 1 54  ? 0.659   -3.536  -5.200  1.00 0.00 ? 54  TYR A CE1  3  
ATOM 4191  C CE2  . TYR A 1 54  ? 0.201   -5.836  -4.727  1.00 0.00 ? 54  TYR A CE2  3  
ATOM 4192  C CZ   . TYR A 1 54  ? 0.749   -4.869  -5.543  1.00 0.00 ? 54  TYR A CZ   3  
ATOM 4193  O OH   . TYR A 1 54  ? 1.390   -5.234  -6.705  1.00 0.00 ? 54  TYR A OH   3  
ATOM 4194  H H    . TYR A 1 54  ? -1.269  -1.089  -2.241  1.00 0.00 ? 54  TYR A H    3  
ATOM 4195  H HA   . TYR A 1 54  ? -3.099  -3.283  -2.898  1.00 0.00 ? 54  TYR A HA   3  
ATOM 4196  H HB2  . TYR A 1 54  ? -0.538  -3.202  -1.299  1.00 0.00 ? 54  TYR A HB2  3  
ATOM 4197  H HB3  . TYR A 1 54  ? -1.564  -4.628  -1.415  1.00 0.00 ? 54  TYR A HB3  3  
ATOM 4198  H HD1  . TYR A 1 54  ? -0.056  -2.129  -3.761  1.00 0.00 ? 54  TYR A HD1  3  
ATOM 4199  H HD2  . TYR A 1 54  ? -0.872  -6.220  -2.922  1.00 0.00 ? 54  TYR A HD2  3  
ATOM 4200  H HE1  . TYR A 1 54  ? 1.089   -2.778  -5.839  1.00 0.00 ? 54  TYR A HE1  3  
ATOM 4201  H HE2  . TYR A 1 54  ? 0.272   -6.880  -4.996  1.00 0.00 ? 54  TYR A HE2  3  
ATOM 4202  H HH   . TYR A 1 54  ? 1.614   -4.448  -7.208  1.00 0.00 ? 54  TYR A HH   3  
ATOM 4203  N N    . TYR A 1 55  ? -4.078  -3.701  -0.557  1.00 0.00 ? 55  TYR A N    3  
ATOM 4204  C CA   . TYR A 1 55  ? -4.895  -3.694  0.650   1.00 0.00 ? 55  TYR A CA   3  
ATOM 4205  C C    . TYR A 1 55  ? -5.385  -5.100  0.984   1.00 0.00 ? 55  TYR A C    3  
ATOM 4206  O O    . TYR A 1 55  ? -5.852  -5.830  0.110   1.00 0.00 ? 55  TYR A O    3  
ATOM 4207  C CB   . TYR A 1 55  ? -6.088  -2.753  0.478   1.00 0.00 ? 55  TYR A CB   3  
ATOM 4208  C CG   . TYR A 1 55  ? -7.136  -3.273  -0.480  1.00 0.00 ? 55  TYR A CG   3  
ATOM 4209  C CD1  . TYR A 1 55  ? -6.891  -3.326  -1.847  1.00 0.00 ? 55  TYR A CD1  3  
ATOM 4210  C CD2  . TYR A 1 55  ? -8.372  -3.711  -0.019  1.00 0.00 ? 55  TYR A CD2  3  
ATOM 4211  C CE1  . TYR A 1 55  ? -7.846  -3.799  -2.726  1.00 0.00 ? 55  TYR A CE1  3  
ATOM 4212  C CE2  . TYR A 1 55  ? -9.332  -4.187  -0.890  1.00 0.00 ? 55  TYR A CE2  3  
ATOM 4213  C CZ   . TYR A 1 55  ? -9.064  -4.229  -2.243  1.00 0.00 ? 55  TYR A CZ   3  
ATOM 4214  O OH   . TYR A 1 55  ? -10.018 -4.702  -3.115  1.00 0.00 ? 55  TYR A OH   3  
ATOM 4215  H H    . TYR A 1 55  ? -4.132  -4.466  -1.167  1.00 0.00 ? 55  TYR A H    3  
ATOM 4216  H HA   . TYR A 1 55  ? -4.281  -3.337  1.464   1.00 0.00 ? 55  TYR A HA   3  
ATOM 4217  H HB2  . TYR A 1 55  ? -6.561  -2.604  1.436   1.00 0.00 ? 55  TYR A HB2  3  
ATOM 4218  H HB3  . TYR A 1 55  ? -5.738  -1.803  0.103   1.00 0.00 ? 55  TYR A HB3  3  
ATOM 4219  H HD1  . TYR A 1 55  ? -5.936  -2.988  -2.222  1.00 0.00 ? 55  TYR A HD1  3  
ATOM 4220  H HD2  . TYR A 1 55  ? -8.578  -3.676  1.041   1.00 0.00 ? 55  TYR A HD2  3  
ATOM 4221  H HE1  . TYR A 1 55  ? -7.637  -3.833  -3.785  1.00 0.00 ? 55  TYR A HE1  3  
ATOM 4222  H HE2  . TYR A 1 55  ? -10.286 -4.524  -0.513  1.00 0.00 ? 55  TYR A HE2  3  
ATOM 4223  H HH   . TYR A 1 55  ? -10.485 -5.437  -2.710  1.00 0.00 ? 55  TYR A HH   3  
ATOM 4224  N N    . MET A 1 56  ? -5.276  -5.472  2.255   1.00 0.00 ? 56  MET A N    3  
ATOM 4225  C CA   . MET A 1 56  ? -5.709  -6.789  2.706   1.00 0.00 ? 56  MET A CA   3  
ATOM 4226  C C    . MET A 1 56  ? -6.022  -6.777  4.199   1.00 0.00 ? 56  MET A C    3  
ATOM 4227  O O    . MET A 1 56  ? -5.606  -5.872  4.921   1.00 0.00 ? 56  MET A O    3  
ATOM 4228  C CB   . MET A 1 56  ? -4.633  -7.834  2.407   1.00 0.00 ? 56  MET A CB   3  
ATOM 4229  C CG   . MET A 1 56  ? -3.671  -8.063  3.561   1.00 0.00 ? 56  MET A CG   3  
ATOM 4230  S SD   . MET A 1 56  ? -2.037  -8.590  3.010   1.00 0.00 ? 56  MET A SD   3  
ATOM 4231  C CE   . MET A 1 56  ? -1.441  -9.431  4.474   1.00 0.00 ? 56  MET A CE   3  
ATOM 4232  H H    . MET A 1 56  ? -4.895  -4.845  2.906   1.00 0.00 ? 56  MET A H    3  
ATOM 4233  H HA   . MET A 1 56  ? -6.607  -7.045  2.164   1.00 0.00 ? 56  MET A HA   3  
ATOM 4234  H HB2  . MET A 1 56  ? -5.113  -8.773  2.175   1.00 0.00 ? 56  MET A HB2  3  
ATOM 4235  H HB3  . MET A 1 56  ? -4.061  -7.510  1.550   1.00 0.00 ? 56  MET A HB3  3  
ATOM 4236  H HG2  . MET A 1 56  ? -3.568  -7.142  4.116   1.00 0.00 ? 56  MET A HG2  3  
ATOM 4237  H HG3  . MET A 1 56  ? -4.081  -8.825  4.207   1.00 0.00 ? 56  MET A HG3  3  
ATOM 4238  H HE1  . MET A 1 56  ? -0.872  -10.302 4.183   1.00 0.00 ? 56  MET A HE1  3  
ATOM 4239  H HE2  . MET A 1 56  ? -0.810  -8.763  5.042   1.00 0.00 ? 56  MET A HE2  3  
ATOM 4240  H HE3  . MET A 1 56  ? -2.281  -9.736  5.081   1.00 0.00 ? 56  MET A HE3  3  
ATOM 4241  N N    . GLU A 1 57  ? -6.758  -7.787  4.653   1.00 0.00 ? 57  GLU A N    3  
ATOM 4242  C CA   . GLU A 1 57  ? -7.126  -7.890  6.060   1.00 0.00 ? 57  GLU A CA   3  
ATOM 4243  C C    . GLU A 1 57  ? -6.099  -8.712  6.833   1.00 0.00 ? 57  GLU A C    3  
ATOM 4244  O O    . GLU A 1 57  ? -6.108  -9.942  6.784   1.00 0.00 ? 57  GLU A O    3  
ATOM 4245  C CB   . GLU A 1 57  ? -8.513  -8.522  6.202   1.00 0.00 ? 57  GLU A CB   3  
ATOM 4246  C CG   . GLU A 1 57  ? -9.181  -8.230  7.535   1.00 0.00 ? 57  GLU A CG   3  
ATOM 4247  C CD   . GLU A 1 57  ? -10.623 -8.696  7.579   1.00 0.00 ? 57  GLU A CD   3  
ATOM 4248  O OE1  . GLU A 1 57  ? -11.379 -8.373  6.639   1.00 0.00 ? 57  GLU A OE1  3  
ATOM 4249  O OE2  . GLU A 1 57  ? -10.996 -9.383  8.553   1.00 0.00 ? 57  GLU A OE2  3  
ATOM 4250  H H    . GLU A 1 57  ? -7.060  -8.478  4.027   1.00 0.00 ? 57  GLU A H    3  
ATOM 4251  H HA   . GLU A 1 57  ? -7.153  -6.892  6.470   1.00 0.00 ? 57  GLU A HA   3  
ATOM 4252  H HB2  . GLU A 1 57  ? -9.149  -8.147  5.414   1.00 0.00 ? 57  GLU A HB2  3  
ATOM 4253  H HB3  . GLU A 1 57  ? -8.419  -9.593  6.097   1.00 0.00 ? 57  GLU A HB3  3  
ATOM 4254  H HG2  . GLU A 1 57  ? -8.632  -8.734  8.316   1.00 0.00 ? 57  GLU A HG2  3  
ATOM 4255  H HG3  . GLU A 1 57  ? -9.157  -7.164  7.710   1.00 0.00 ? 57  GLU A HG3  3  
ATOM 4256  N N    . LYS A 1 58  ? -5.213  -8.023  7.545   1.00 0.00 ? 58  LYS A N    3  
ATOM 4257  C CA   . LYS A 1 58  ? -4.179  -8.687  8.329   1.00 0.00 ? 58  LYS A CA   3  
ATOM 4258  C C    . LYS A 1 58  ? -4.688  -10.010 8.892   1.00 0.00 ? 58  LYS A C    3  
ATOM 4259  O O    . LYS A 1 58  ? -5.420  -10.035 9.881   1.00 0.00 ? 58  LYS A O    3  
ATOM 4260  C CB   . LYS A 1 58  ? -3.714  -7.780  9.471   1.00 0.00 ? 58  LYS A CB   3  
ATOM 4261  C CG   . LYS A 1 58  ? -2.326  -8.115  9.987   1.00 0.00 ? 58  LYS A CG   3  
ATOM 4262  C CD   . LYS A 1 58  ? -1.244  -7.460  9.144   1.00 0.00 ? 58  LYS A CD   3  
ATOM 4263  C CE   . LYS A 1 58  ? 0.136   -7.995  9.494   1.00 0.00 ? 58  LYS A CE   3  
ATOM 4264  N NZ   . LYS A 1 58  ? 1.067   -7.929  8.333   1.00 0.00 ? 58  LYS A NZ   3  
ATOM 4265  H H    . LYS A 1 58  ? -5.257  -7.044  7.544   1.00 0.00 ? 58  LYS A H    3  
ATOM 4266  H HA   . LYS A 1 58  ? -3.343  -8.886  7.675   1.00 0.00 ? 58  LYS A HA   3  
ATOM 4267  H HB2  . LYS A 1 58  ? -3.710  -6.758  9.122   1.00 0.00 ? 58  LYS A HB2  3  
ATOM 4268  H HB3  . LYS A 1 58  ? -4.412  -7.869  10.291  1.00 0.00 ? 58  LYS A HB3  3  
ATOM 4269  H HG2  . LYS A 1 58  ? -2.235  -7.764  11.004  1.00 0.00 ? 58  LYS A HG2  3  
ATOM 4270  H HG3  . LYS A 1 58  ? -2.191  -9.187  9.960   1.00 0.00 ? 58  LYS A HG3  3  
ATOM 4271  H HD2  . LYS A 1 58  ? -1.442  -7.661  8.101   1.00 0.00 ? 58  LYS A HD2  3  
ATOM 4272  H HD3  . LYS A 1 58  ? -1.262  -6.393  9.316   1.00 0.00 ? 58  LYS A HD3  3  
ATOM 4273  H HE2  . LYS A 1 58  ? 0.540   -7.408  10.303  1.00 0.00 ? 58  LYS A HE2  3  
ATOM 4274  H HE3  . LYS A 1 58  ? 0.039   -9.024  9.808   1.00 0.00 ? 58  LYS A HE3  3  
ATOM 4275  H HZ1  . LYS A 1 58  ? 0.914   -7.047  7.803   1.00 0.00 ? 58  LYS A HZ1  3  
ATOM 4276  H HZ2  . LYS A 1 58  ? 0.904   -8.735  7.697   1.00 0.00 ? 58  LYS A HZ2  3  
ATOM 4277  H HZ3  . LYS A 1 58  ? 2.053   -7.956  8.664   1.00 0.00 ? 58  LYS A HZ3  3  
ATOM 4278  N N    . GLY A 1 59  ? -4.295  -11.110 8.256   1.00 0.00 ? 59  GLY A N    3  
ATOM 4279  C CA   . GLY A 1 59  ? -4.720  -12.421 8.709   1.00 0.00 ? 59  GLY A CA   3  
ATOM 4280  C C    . GLY A 1 59  ? -5.327  -13.251 7.596   1.00 0.00 ? 59  GLY A C    3  
ATOM 4281  O O    . GLY A 1 59  ? -5.740  -14.391 7.813   1.00 0.00 ? 59  GLY A O    3  
ATOM 4282  H H    . GLY A 1 59  ? -3.711  -11.030 7.473   1.00 0.00 ? 59  GLY A H    3  
ATOM 4283  H HA2  . GLY A 1 59  ? -3.866  -12.946 9.110   1.00 0.00 ? 59  GLY A HA2  3  
ATOM 4284  H HA3  . GLY A 1 59  ? -5.454  -12.298 9.492   1.00 0.00 ? 59  GLY A HA3  3  
ATOM 4285  N N    . THR A 1 60  ? -5.385  -12.678 6.397   1.00 0.00 ? 60  THR A N    3  
ATOM 4286  C CA   . THR A 1 60  ? -5.948  -13.371 5.245   1.00 0.00 ? 60  THR A CA   3  
ATOM 4287  C C    . THR A 1 60  ? -4.852  -13.851 4.301   1.00 0.00 ? 60  THR A C    3  
ATOM 4288  O O    . THR A 1 60  ? -5.022  -14.840 3.589   1.00 0.00 ? 60  THR A O    3  
ATOM 4289  C CB   . THR A 1 60  ? -6.921  -12.466 4.466   1.00 0.00 ? 60  THR A CB   3  
ATOM 4290  O OG1  . THR A 1 60  ? -7.463  -11.465 5.336   1.00 0.00 ? 60  THR A OG1  3  
ATOM 4291  C CG2  . THR A 1 60  ? -8.052  -13.282 3.859   1.00 0.00 ? 60  THR A CG2  3  
ATOM 4292  H H    . THR A 1 60  ? -5.040  -11.768 6.287   1.00 0.00 ? 60  THR A H    3  
ATOM 4293  H HA   . THR A 1 60  ? -6.499  -14.227 5.608   1.00 0.00 ? 60  THR A HA   3  
ATOM 4294  H HB   . THR A 1 60  ? -6.377  -11.981 3.668   1.00 0.00 ? 60  THR A HB   3  
ATOM 4295  H HG1  . THR A 1 60  ? -6.909  -10.681 5.306   1.00 0.00 ? 60  THR A HG1  3  
ATOM 4296  H HG21 . THR A 1 60  ? -7.696  -13.785 2.972   1.00 0.00 ? 60  THR A HG21 3  
ATOM 4297  H HG22 . THR A 1 60  ? -8.870  -12.627 3.598   1.00 0.00 ? 60  THR A HG22 3  
ATOM 4298  H HG23 . THR A 1 60  ? -8.392  -14.015 4.576   1.00 0.00 ? 60  THR A HG23 3  
ATOM 4299  N N    . ASP A 1 61  ? -3.727  -13.144 4.301   1.00 0.00 ? 61  ASP A N    3  
ATOM 4300  C CA   . ASP A 1 61  ? -2.601  -13.499 3.445   1.00 0.00 ? 61  ASP A CA   3  
ATOM 4301  C C    . ASP A 1 61  ? -2.990  -13.412 1.972   1.00 0.00 ? 61  ASP A C    3  
ATOM 4302  O O    . ASP A 1 61  ? -2.395  -14.075 1.122   1.00 0.00 ? 61  ASP A O    3  
ATOM 4303  C CB   . ASP A 1 61  ? -2.109  -14.910 3.773   1.00 0.00 ? 61  ASP A CB   3  
ATOM 4304  C CG   . ASP A 1 61  ? -1.525  -15.010 5.168   1.00 0.00 ? 61  ASP A CG   3  
ATOM 4305  O OD1  . ASP A 1 61  ? -2.208  -14.598 6.129   1.00 0.00 ? 61  ASP A OD1  3  
ATOM 4306  O OD2  . ASP A 1 61  ? -0.384  -15.500 5.299   1.00 0.00 ? 61  ASP A OD2  3  
ATOM 4307  H H    . ASP A 1 61  ? -3.652  -12.365 4.892   1.00 0.00 ? 61  ASP A H    3  
ATOM 4308  H HA   . ASP A 1 61  ? -1.804  -12.797 3.636   1.00 0.00 ? 61  ASP A HA   3  
ATOM 4309  H HB2  . ASP A 1 61  ? -2.938  -15.599 3.700   1.00 0.00 ? 61  ASP A HB2  3  
ATOM 4310  H HB3  . ASP A 1 61  ? -1.347  -15.193 3.061   1.00 0.00 ? 61  ASP A HB3  3  
ATOM 4311  N N    . LYS A 1 62  ? -3.991  -12.590 1.678   1.00 0.00 ? 62  LYS A N    3  
ATOM 4312  C CA   . LYS A 1 62  ? -4.460  -12.415 0.308   1.00 0.00 ? 62  LYS A CA   3  
ATOM 4313  C C    . LYS A 1 62  ? -4.344  -10.957 -0.124  1.00 0.00 ? 62  LYS A C    3  
ATOM 4314  O O    . LYS A 1 62  ? -5.348  -10.260 -0.264  1.00 0.00 ? 62  LYS A O    3  
ATOM 4315  C CB   . LYS A 1 62  ? -5.912  -12.881 0.181   1.00 0.00 ? 62  LYS A CB   3  
ATOM 4316  C CG   . LYS A 1 62  ? -6.249  -13.457 -1.184  1.00 0.00 ? 62  LYS A CG   3  
ATOM 4317  C CD   . LYS A 1 62  ? -5.710  -12.585 -2.305  1.00 0.00 ? 62  LYS A CD   3  
ATOM 4318  C CE   . LYS A 1 62  ? -6.071  -13.148 -3.672  1.00 0.00 ? 62  LYS A CE   3  
ATOM 4319  N NZ   . LYS A 1 62  ? -5.270  -12.521 -4.759  1.00 0.00 ? 62  LYS A NZ   3  
ATOM 4320  H H    . LYS A 1 62  ? -4.426  -12.089 2.400   1.00 0.00 ? 62  LYS A H    3  
ATOM 4321  H HA   . LYS A 1 62  ? -3.839  -13.020 -0.335  1.00 0.00 ? 62  LYS A HA   3  
ATOM 4322  H HB2  . LYS A 1 62  ? -6.101  -13.641 0.925   1.00 0.00 ? 62  LYS A HB2  3  
ATOM 4323  H HB3  . LYS A 1 62  ? -6.565  -12.040 0.364   1.00 0.00 ? 62  LYS A HB3  3  
ATOM 4324  H HG2  . LYS A 1 62  ? -5.813  -14.442 -1.267  1.00 0.00 ? 62  LYS A HG2  3  
ATOM 4325  H HG3  . LYS A 1 62  ? -7.323  -13.528 -1.279  1.00 0.00 ? 62  LYS A HG3  3  
ATOM 4326  H HD2  . LYS A 1 62  ? -6.130  -11.595 -2.214  1.00 0.00 ? 62  LYS A HD2  3  
ATOM 4327  H HD3  . LYS A 1 62  ? -4.633  -12.530 -2.221  1.00 0.00 ? 62  LYS A HD3  3  
ATOM 4328  H HE2  . LYS A 1 62  ? -5.889  -14.211 -3.668  1.00 0.00 ? 62  LYS A HE2  3  
ATOM 4329  H HE3  . LYS A 1 62  ? -7.119  -12.963 -3.856  1.00 0.00 ? 62  LYS A HE3  3  
ATOM 4330  H HZ1  . LYS A 1 62  ? -4.674  -13.238 -5.221  1.00 0.00 ? 62  LYS A HZ1  3  
ATOM 4331  H HZ2  . LYS A 1 62  ? -4.657  -11.778 -4.368  1.00 0.00 ? 62  LYS A HZ2  3  
ATOM 4332  H HZ3  . LYS A 1 62  ? -5.900  -12.098 -5.470  1.00 0.00 ? 62  LYS A HZ3  3  
ATOM 4333  N N    . GLU A 1 63  ? -3.112  -10.504 -0.336  1.00 0.00 ? 63  GLU A N    3  
ATOM 4334  C CA   . GLU A 1 63  ? -2.866  -9.129  -0.754  1.00 0.00 ? 63  GLU A CA   3  
ATOM 4335  C C    . GLU A 1 63  ? -3.513  -8.847  -2.107  1.00 0.00 ? 63  GLU A C    3  
ATOM 4336  O O    . GLU A 1 63  ? -3.579  -9.723  -2.968  1.00 0.00 ? 63  GLU A O    3  
ATOM 4337  C CB   . GLU A 1 63  ? -1.362  -8.856  -0.829  1.00 0.00 ? 63  GLU A CB   3  
ATOM 4338  C CG   . GLU A 1 63  ? -1.010  -7.378  -0.810  1.00 0.00 ? 63  GLU A CG   3  
ATOM 4339  C CD   . GLU A 1 63  ? -0.794  -6.848  0.594   1.00 0.00 ? 63  GLU A CD   3  
ATOM 4340  O OE1  . GLU A 1 63  ? 0.355   -6.909  1.081   1.00 0.00 ? 63  GLU A OE1  3  
ATOM 4341  O OE2  . GLU A 1 63  ? -1.773  -6.372  1.206   1.00 0.00 ? 63  GLU A OE2  3  
ATOM 4342  H H    . GLU A 1 63  ? -2.351  -11.108 -0.209  1.00 0.00 ? 63  GLU A H    3  
ATOM 4343  H HA   . GLU A 1 63  ? -3.305  -8.475  -0.016  1.00 0.00 ? 63  GLU A HA   3  
ATOM 4344  H HB2  . GLU A 1 63  ? -0.880  -9.331  0.013   1.00 0.00 ? 63  GLU A HB2  3  
ATOM 4345  H HB3  . GLU A 1 63  ? -0.976  -9.285  -1.742  1.00 0.00 ? 63  GLU A HB3  3  
ATOM 4346  H HG2  . GLU A 1 63  ? -0.103  -7.230  -1.377  1.00 0.00 ? 63  GLU A HG2  3  
ATOM 4347  H HG3  . GLU A 1 63  ? -1.815  -6.823  -1.269  1.00 0.00 ? 63  GLU A HG3  3  
ATOM 4348  N N    . GLN A 1 64  ? -3.988  -7.619  -2.285  1.00 0.00 ? 64  GLN A N    3  
ATOM 4349  C CA   . GLN A 1 64  ? -4.631  -7.222  -3.532  1.00 0.00 ? 64  GLN A CA   3  
ATOM 4350  C C    . GLN A 1 64  ? -3.982  -5.965  -4.103  1.00 0.00 ? 64  GLN A C    3  
ATOM 4351  O O    . GLN A 1 64  ? -3.049  -5.416  -3.517  1.00 0.00 ? 64  GLN A O    3  
ATOM 4352  C CB   . GLN A 1 64  ? -6.125  -6.981  -3.306  1.00 0.00 ? 64  GLN A CB   3  
ATOM 4353  C CG   . GLN A 1 64  ? -6.949  -8.258  -3.278  1.00 0.00 ? 64  GLN A CG   3  
ATOM 4354  C CD   . GLN A 1 64  ? -8.345  -8.039  -2.729  1.00 0.00 ? 64  GLN A CD   3  
ATOM 4355  O OE1  . GLN A 1 64  ? -9.062  -7.138  -3.164  1.00 0.00 ? 64  GLN A OE1  3  
ATOM 4356  N NE2  . GLN A 1 64  ? -8.739  -8.865  -1.766  1.00 0.00 ? 64  GLN A NE2  3  
ATOM 4357  H H    . GLN A 1 64  ? -3.906  -6.965  -1.560  1.00 0.00 ? 64  GLN A H    3  
ATOM 4358  H HA   . GLN A 1 64  ? -4.509  -8.028  -4.239  1.00 0.00 ? 64  GLN A HA   3  
ATOM 4359  H HB2  . GLN A 1 64  ? -6.257  -6.472  -2.364  1.00 0.00 ? 64  GLN A HB2  3  
ATOM 4360  H HB3  . GLN A 1 64  ? -6.500  -6.354  -4.101  1.00 0.00 ? 64  GLN A HB3  3  
ATOM 4361  H HG2  . GLN A 1 64  ? -7.032  -8.640  -4.285  1.00 0.00 ? 64  GLN A HG2  3  
ATOM 4362  H HG3  . GLN A 1 64  ? -6.444  -8.984  -2.659  1.00 0.00 ? 64  GLN A HG3  3  
ATOM 4363  H HE21 . GLN A 1 64  ? -8.113  -9.559  -1.468  1.00 0.00 ? 64  GLN A HE21 3  
ATOM 4364  H HE22 . GLN A 1 64  ? -9.636  -8.746  -1.392  1.00 0.00 ? 64  GLN A HE22 3  
ATOM 4365  N N    . ASP A 1 65  ? -4.482  -5.516  -5.249  1.00 0.00 ? 65  ASP A N    3  
ATOM 4366  C CA   . ASP A 1 65  ? -3.951  -4.324  -5.900  1.00 0.00 ? 65  ASP A CA   3  
ATOM 4367  C C    . ASP A 1 65  ? -5.052  -3.576  -6.645  1.00 0.00 ? 65  ASP A C    3  
ATOM 4368  O O    . ASP A 1 65  ? -5.912  -4.187  -7.280  1.00 0.00 ? 65  ASP A O    3  
ATOM 4369  C CB   . ASP A 1 65  ? -2.828  -4.702  -6.867  1.00 0.00 ? 65  ASP A CB   3  
ATOM 4370  C CG   . ASP A 1 65  ? -3.235  -5.805  -7.824  1.00 0.00 ? 65  ASP A CG   3  
ATOM 4371  O OD1  . ASP A 1 65  ? -4.416  -5.835  -8.227  1.00 0.00 ? 65  ASP A OD1  3  
ATOM 4372  O OD2  . ASP A 1 65  ? -2.372  -6.640  -8.168  1.00 0.00 ? 65  ASP A OD2  3  
ATOM 4373  H H    . ASP A 1 65  ? -5.226  -5.998  -5.668  1.00 0.00 ? 65  ASP A H    3  
ATOM 4374  H HA   . ASP A 1 65  ? -3.550  -3.678  -5.133  1.00 0.00 ? 65  ASP A HA   3  
ATOM 4375  H HB2  . ASP A 1 65  ? -2.553  -3.832  -7.446  1.00 0.00 ? 65  ASP A HB2  3  
ATOM 4376  H HB3  . ASP A 1 65  ? -1.972  -5.038  -6.301  1.00 0.00 ? 65  ASP A HB3  3  
ATOM 4377  N N    . VAL A 1 66  ? -5.019  -2.250  -6.564  1.00 0.00 ? 66  VAL A N    3  
ATOM 4378  C CA   . VAL A 1 66  ? -6.014  -1.418  -7.231  1.00 0.00 ? 66  VAL A CA   3  
ATOM 4379  C C    . VAL A 1 66  ? -5.355  -0.259  -7.969  1.00 0.00 ? 66  VAL A C    3  
ATOM 4380  O O    . VAL A 1 66  ? -4.519  0.452   -7.410  1.00 0.00 ? 66  VAL A O    3  
ATOM 4381  C CB   . VAL A 1 66  ? -7.040  -0.857  -6.228  1.00 0.00 ? 66  VAL A CB   3  
ATOM 4382  C CG1  . VAL A 1 66  ? -7.585  -1.968  -5.344  1.00 0.00 ? 66  VAL A CG1  3  
ATOM 4383  C CG2  . VAL A 1 66  ? -6.414  0.246   -5.387  1.00 0.00 ? 66  VAL A CG2  3  
ATOM 4384  H H    . VAL A 1 66  ? -4.309  -1.820  -6.043  1.00 0.00 ? 66  VAL A H    3  
ATOM 4385  H HA   . VAL A 1 66  ? -6.540  -2.035  -7.945  1.00 0.00 ? 66  VAL A HA   3  
ATOM 4386  H HB   . VAL A 1 66  ? -7.862  -0.434  -6.785  1.00 0.00 ? 66  VAL A HB   3  
ATOM 4387  H HG11 . VAL A 1 66  ? -7.216  -2.921  -5.695  1.00 0.00 ? 66  VAL A HG11 3  
ATOM 4388  H HG12 . VAL A 1 66  ? -7.264  -1.809  -4.325  1.00 0.00 ? 66  VAL A HG12 3  
ATOM 4389  H HG13 . VAL A 1 66  ? -8.665  -1.964  -5.387  1.00 0.00 ? 66  VAL A HG13 3  
ATOM 4390  H HG21 . VAL A 1 66  ? -7.041  0.444   -4.531  1.00 0.00 ? 66  VAL A HG21 3  
ATOM 4391  H HG22 . VAL A 1 66  ? -5.436  -0.068  -5.052  1.00 0.00 ? 66  VAL A HG22 3  
ATOM 4392  H HG23 . VAL A 1 66  ? -6.320  1.142   -5.981  1.00 0.00 ? 66  VAL A HG23 3  
ATOM 4393  N N    . ASP A 1 67  ? -5.736  -0.073  -9.228  1.00 0.00 ? 67  ASP A N    3  
ATOM 4394  C CA   . ASP A 1 67  ? -5.184  1.002   -10.044 1.00 0.00 ? 67  ASP A CA   3  
ATOM 4395  C C    . ASP A 1 67  ? -5.666  2.362   -9.550  1.00 0.00 ? 67  ASP A C    3  
ATOM 4396  O O    . ASP A 1 67  ? -6.868  2.625   -9.497  1.00 0.00 ? 67  ASP A O    3  
ATOM 4397  C CB   . ASP A 1 67  ? -5.574  0.810   -11.510 1.00 0.00 ? 67  ASP A CB   3  
ATOM 4398  C CG   . ASP A 1 67  ? -6.912  1.442   -11.840 1.00 0.00 ? 67  ASP A CG   3  
ATOM 4399  O OD1  . ASP A 1 67  ? -7.923  1.045   -11.224 1.00 0.00 ? 67  ASP A OD1  3  
ATOM 4400  O OD2  . ASP A 1 67  ? -6.949  2.332   -12.716 1.00 0.00 ? 67  ASP A OD2  3  
ATOM 4401  H H    . ASP A 1 67  ? -6.407  -0.673  -9.618  1.00 0.00 ? 67  ASP A H    3  
ATOM 4402  H HA   . ASP A 1 67  ? -4.108  0.963   -9.959  1.00 0.00 ? 67  ASP A HA   3  
ATOM 4403  H HB2  . ASP A 1 67  ? -4.820  1.261   -12.139 1.00 0.00 ? 67  ASP A HB2  3  
ATOM 4404  H HB3  . ASP A 1 67  ? -5.631  -0.246  -11.725 1.00 0.00 ? 67  ASP A HB3  3  
ATOM 4405  N N    . VAL A 1 68  ? -4.721  3.224   -9.188  1.00 0.00 ? 68  VAL A N    3  
ATOM 4406  C CA   . VAL A 1 68  ? -5.049  4.558   -8.698  1.00 0.00 ? 68  VAL A CA   3  
ATOM 4407  C C    . VAL A 1 68  ? -4.446  5.635   -9.592  1.00 0.00 ? 68  VAL A C    3  
ATOM 4408  O O    . VAL A 1 68  ? -3.452  5.402   -10.279 1.00 0.00 ? 68  VAL A O    3  
ATOM 4409  C CB   . VAL A 1 68  ? -4.551  4.764   -7.255  1.00 0.00 ? 68  VAL A CB   3  
ATOM 4410  C CG1  . VAL A 1 68  ? -4.889  6.165   -6.769  1.00 0.00 ? 68  VAL A CG1  3  
ATOM 4411  C CG2  . VAL A 1 68  ? -5.145  3.712   -6.331  1.00 0.00 ? 68  VAL A CG2  3  
ATOM 4412  H H    . VAL A 1 68  ? -3.780  2.957   -9.253  1.00 0.00 ? 68  VAL A H    3  
ATOM 4413  H HA   . VAL A 1 68  ? -6.125  4.660   -8.703  1.00 0.00 ? 68  VAL A HA   3  
ATOM 4414  H HB   . VAL A 1 68  ? -3.476  4.654   -7.248  1.00 0.00 ? 68  VAL A HB   3  
ATOM 4415  H HG11 . VAL A 1 68  ? -4.407  6.893   -7.406  1.00 0.00 ? 68  VAL A HG11 3  
ATOM 4416  H HG12 . VAL A 1 68  ? -5.959  6.309   -6.799  1.00 0.00 ? 68  VAL A HG12 3  
ATOM 4417  H HG13 . VAL A 1 68  ? -4.538  6.288   -5.754  1.00 0.00 ? 68  VAL A HG13 3  
ATOM 4418  H HG21 . VAL A 1 68  ? -4.359  3.063   -5.974  1.00 0.00 ? 68  VAL A HG21 3  
ATOM 4419  H HG22 . VAL A 1 68  ? -5.620  4.197   -5.491  1.00 0.00 ? 68  VAL A HG22 3  
ATOM 4420  H HG23 . VAL A 1 68  ? -5.876  3.130   -6.871  1.00 0.00 ? 68  VAL A HG23 3  
ATOM 4421  N N    . SER A 1 69  ? -5.054  6.817   -9.577  1.00 0.00 ? 69  SER A N    3  
ATOM 4422  C CA   . SER A 1 69  ? -4.579  7.931   -10.389 1.00 0.00 ? 69  SER A CA   3  
ATOM 4423  C C    . SER A 1 69  ? -4.112  9.085   -9.507  1.00 0.00 ? 69  SER A C    3  
ATOM 4424  O O    . SER A 1 69  ? -3.148  9.779   -9.833  1.00 0.00 ? 69  SER A O    3  
ATOM 4425  C CB   . SER A 1 69  ? -5.685  8.411   -11.332 1.00 0.00 ? 69  SER A CB   3  
ATOM 4426  O OG   . SER A 1 69  ? -5.246  9.505   -12.117 1.00 0.00 ? 69  SER A OG   3  
ATOM 4427  H H    . SER A 1 69  ? -5.843  6.941   -9.008  1.00 0.00 ? 69  SER A H    3  
ATOM 4428  H HA   . SER A 1 69  ? -3.744  7.581   -10.976 1.00 0.00 ? 69  SER A HA   3  
ATOM 4429  H HB2  . SER A 1 69  ? -5.970  7.603   -11.989 1.00 0.00 ? 69  SER A HB2  3  
ATOM 4430  H HB3  . SER A 1 69  ? -6.541  8.720   -10.750 1.00 0.00 ? 69  SER A HB3  3  
ATOM 4431  H HG   . SER A 1 69  ? -4.547  9.972   -11.654 1.00 0.00 ? 69  SER A HG   3  
ATOM 4432  N N    . SER A 1 70  ? -4.801  9.284   -8.389  1.00 0.00 ? 70  SER A N    3  
ATOM 4433  C CA   . SER A 1 70  ? -4.460  10.356  -7.461  1.00 0.00 ? 70  SER A CA   3  
ATOM 4434  C C    . SER A 1 70  ? -3.444  9.878   -6.429  1.00 0.00 ? 70  SER A C    3  
ATOM 4435  O O    . SER A 1 70  ? -3.218  8.678   -6.272  1.00 0.00 ? 70  SER A O    3  
ATOM 4436  C CB   . SER A 1 70  ? -5.718  10.869  -6.756  1.00 0.00 ? 70  SER A CB   3  
ATOM 4437  O OG   . SER A 1 70  ? -5.571  12.225  -6.374  1.00 0.00 ? 70  SER A OG   3  
ATOM 4438  H H    . SER A 1 70  ? -5.560  8.698   -8.184  1.00 0.00 ? 70  SER A H    3  
ATOM 4439  H HA   . SER A 1 70  ? -4.024  11.163  -8.032  1.00 0.00 ? 70  SER A HA   3  
ATOM 4440  H HB2  . SER A 1 70  ? -6.561  10.785  -7.424  1.00 0.00 ? 70  SER A HB2  3  
ATOM 4441  H HB3  . SER A 1 70  ? -5.898  10.275  -5.871  1.00 0.00 ? 70  SER A HB3  3  
ATOM 4442  H HG   . SER A 1 70  ? -5.520  12.285  -5.417  1.00 0.00 ? 70  SER A HG   3  
ATOM 4443  N N    . HIS A 1 71  ? -2.833  10.827  -5.726  1.00 0.00 ? 71  HIS A N    3  
ATOM 4444  C CA   . HIS A 1 71  ? -1.840  10.503  -4.707  1.00 0.00 ? 71  HIS A CA   3  
ATOM 4445  C C    . HIS A 1 71  ? -2.495  9.831   -3.504  1.00 0.00 ? 71  HIS A C    3  
ATOM 4446  O O    . HIS A 1 71  ? -1.843  9.100   -2.758  1.00 0.00 ? 71  HIS A O    3  
ATOM 4447  C CB   . HIS A 1 71  ? -1.105  11.768  -4.262  1.00 0.00 ? 71  HIS A CB   3  
ATOM 4448  C CG   . HIS A 1 71  ? -0.042  12.212  -5.220  1.00 0.00 ? 71  HIS A CG   3  
ATOM 4449  N ND1  . HIS A 1 71  ? -0.036  13.457  -5.812  1.00 0.00 ? 71  HIS A ND1  3  
ATOM 4450  C CD2  . HIS A 1 71  ? 1.053   11.569  -5.687  1.00 0.00 ? 71  HIS A CD2  3  
ATOM 4451  C CE1  . HIS A 1 71  ? 1.017   13.560  -6.604  1.00 0.00 ? 71  HIS A CE1  3  
ATOM 4452  N NE2  . HIS A 1 71  ? 1.695   12.428  -6.545  1.00 0.00 ? 71  HIS A NE2  3  
ATOM 4453  H H    . HIS A 1 71  ? -3.055  11.765  -5.896  1.00 0.00 ? 71  HIS A H    3  
ATOM 4454  H HA   . HIS A 1 71  ? -1.128  9.818   -5.143  1.00 0.00 ? 71  HIS A HA   3  
ATOM 4455  H HB2  . HIS A 1 71  ? -1.817  12.574  -4.161  1.00 0.00 ? 71  HIS A HB2  3  
ATOM 4456  H HB3  . HIS A 1 71  ? -0.635  11.586  -3.306  1.00 0.00 ? 71  HIS A HB3  3  
ATOM 4457  H HD1  . HIS A 1 71  ? -0.704  14.160  -5.675  1.00 0.00 ? 71  HIS A HD1  3  
ATOM 4458  H HD2  . HIS A 1 71  ? 1.366   10.566  -5.433  1.00 0.00 ? 71  HIS A HD2  3  
ATOM 4459  H HE1  . HIS A 1 71  ? 1.280   14.423  -7.197  1.00 0.00 ? 71  HIS A HE1  3  
ATOM 4460  H HE2  . HIS A 1 71  ? 2.471   12.206  -7.100  1.00 0.00 ? 71  HIS A HE2  3  
ATOM 4461  N N    . SER A 1 72  ? -3.786  10.086  -3.321  1.00 0.00 ? 72  SER A N    3  
ATOM 4462  C CA   . SER A 1 72  ? -4.528  9.509   -2.206  1.00 0.00 ? 72  SER A CA   3  
ATOM 4463  C C    . SER A 1 72  ? -5.756  8.752   -2.703  1.00 0.00 ? 72  SER A C    3  
ATOM 4464  O O    . SER A 1 72  ? -6.431  9.187   -3.637  1.00 0.00 ? 72  SER A O    3  
ATOM 4465  C CB   . SER A 1 72  ? -4.953  10.605  -1.227  1.00 0.00 ? 72  SER A CB   3  
ATOM 4466  O OG   . SER A 1 72  ? -6.072  11.323  -1.719  1.00 0.00 ? 72  SER A OG   3  
ATOM 4467  H H    . SER A 1 72  ? -4.251  10.677  -3.950  1.00 0.00 ? 72  SER A H    3  
ATOM 4468  H HA   . SER A 1 72  ? -3.875  8.817   -1.696  1.00 0.00 ? 72  SER A HA   3  
ATOM 4469  H HB2  . SER A 1 72  ? -5.216  10.158  -0.281  1.00 0.00 ? 72  SER A HB2  3  
ATOM 4470  H HB3  . SER A 1 72  ? -4.133  11.294  -1.084  1.00 0.00 ? 72  SER A HB3  3  
ATOM 4471  H HG   . SER A 1 72  ? -6.053  11.326  -2.679  1.00 0.00 ? 72  SER A HG   3  
ATOM 4472  N N    . TYR A 1 73  ? -6.039  7.617   -2.073  1.00 0.00 ? 73  TYR A N    3  
ATOM 4473  C CA   . TYR A 1 73  ? -7.183  6.798   -2.452  1.00 0.00 ? 73  TYR A CA   3  
ATOM 4474  C C    . TYR A 1 73  ? -7.911  6.274   -1.218  1.00 0.00 ? 73  TYR A C    3  
ATOM 4475  O O    . TYR A 1 73  ? -7.287  5.930   -0.213  1.00 0.00 ? 73  TYR A O    3  
ATOM 4476  C CB   . TYR A 1 73  ? -6.731  5.627   -3.327  1.00 0.00 ? 73  TYR A CB   3  
ATOM 4477  C CG   . TYR A 1 73  ? -7.871  4.765   -3.822  1.00 0.00 ? 73  TYR A CG   3  
ATOM 4478  C CD1  . TYR A 1 73  ? -8.326  3.685   -3.076  1.00 0.00 ? 73  TYR A CD1  3  
ATOM 4479  C CD2  . TYR A 1 73  ? -8.492  5.031   -5.036  1.00 0.00 ? 73  TYR A CD2  3  
ATOM 4480  C CE1  . TYR A 1 73  ? -9.366  2.895   -3.525  1.00 0.00 ? 73  TYR A CE1  3  
ATOM 4481  C CE2  . TYR A 1 73  ? -9.534  4.247   -5.492  1.00 0.00 ? 73  TYR A CE2  3  
ATOM 4482  C CZ   . TYR A 1 73  ? -9.968  3.180   -4.733  1.00 0.00 ? 73  TYR A CZ   3  
ATOM 4483  O OH   . TYR A 1 73  ? -11.004 2.396   -5.184  1.00 0.00 ? 73  TYR A OH   3  
ATOM 4484  H H    . TYR A 1 73  ? -5.464  7.323   -1.336  1.00 0.00 ? 73  TYR A H    3  
ATOM 4485  H HA   . TYR A 1 73  ? -7.862  7.417   -3.020  1.00 0.00 ? 73  TYR A HA   3  
ATOM 4486  H HB2  . TYR A 1 73  ? -6.208  6.011   -4.189  1.00 0.00 ? 73  TYR A HB2  3  
ATOM 4487  H HB3  . TYR A 1 73  ? -6.063  4.998   -2.757  1.00 0.00 ? 73  TYR A HB3  3  
ATOM 4488  H HD1  . TYR A 1 73  ? -7.853  3.464   -2.130  1.00 0.00 ? 73  TYR A HD1  3  
ATOM 4489  H HD2  . TYR A 1 73  ? -8.150  5.867   -5.628  1.00 0.00 ? 73  TYR A HD2  3  
ATOM 4490  H HE1  . TYR A 1 73  ? -9.706  2.059   -2.931  1.00 0.00 ? 73  TYR A HE1  3  
ATOM 4491  H HE2  . TYR A 1 73  ? -10.005 4.470   -6.438  1.00 0.00 ? 73  TYR A HE2  3  
ATOM 4492  H HH   . TYR A 1 73  ? -11.262 2.681   -6.064  1.00 0.00 ? 73  TYR A HH   3  
ATOM 4493  N N    . THR A 1 74  ? -9.237  6.214   -1.301  1.00 0.00 ? 74  THR A N    3  
ATOM 4494  C CA   . THR A 1 74  ? -10.051 5.733   -0.193  1.00 0.00 ? 74  THR A CA   3  
ATOM 4495  C C    . THR A 1 74  ? -10.721 4.407   -0.537  1.00 0.00 ? 74  THR A C    3  
ATOM 4496  O O    . THR A 1 74  ? -11.416 4.297   -1.548  1.00 0.00 ? 74  THR A O    3  
ATOM 4497  C CB   . THR A 1 74  ? -11.134 6.757   0.194   1.00 0.00 ? 74  THR A CB   3  
ATOM 4498  O OG1  . THR A 1 74  ? -10.533 8.028   0.465   1.00 0.00 ? 74  THR A OG1  3  
ATOM 4499  C CG2  . THR A 1 74  ? -11.911 6.288   1.415   1.00 0.00 ? 74  THR A CG2  3  
ATOM 4500  H H    . THR A 1 74  ? -9.676  6.501   -2.129  1.00 0.00 ? 74  THR A H    3  
ATOM 4501  H HA   . THR A 1 74  ? -9.403  5.586   0.659   1.00 0.00 ? 74  THR A HA   3  
ATOM 4502  H HB   . THR A 1 74  ? -11.822 6.861   -0.633  1.00 0.00 ? 74  THR A HB   3  
ATOM 4503  H HG1  . THR A 1 74  ? -11.171 8.598   0.900   1.00 0.00 ? 74  THR A HG1  3  
ATOM 4504  H HG21 . THR A 1 74  ? -12.795 6.896   1.535   1.00 0.00 ? 74  THR A HG21 3  
ATOM 4505  H HG22 . THR A 1 74  ? -11.290 6.378   2.294   1.00 0.00 ? 74  THR A HG22 3  
ATOM 4506  H HG23 . THR A 1 74  ? -12.200 5.256   1.283   1.00 0.00 ? 74  THR A HG23 3  
ATOM 4507  N N    . ILE A 1 75  ? -10.509 3.405   0.308   1.00 0.00 ? 75  ILE A N    3  
ATOM 4508  C CA   . ILE A 1 75  ? -11.094 2.087   0.093   1.00 0.00 ? 75  ILE A CA   3  
ATOM 4509  C C    . ILE A 1 75  ? -12.343 1.895   0.946   1.00 0.00 ? 75  ILE A C    3  
ATOM 4510  O O    . ILE A 1 75  ? -12.351 2.214   2.135   1.00 0.00 ? 75  ILE A O    3  
ATOM 4511  C CB   . ILE A 1 75  ? -10.089 0.965   0.414   1.00 0.00 ? 75  ILE A CB   3  
ATOM 4512  C CG1  . ILE A 1 75  ? -8.930  0.989   -0.584  1.00 0.00 ? 75  ILE A CG1  3  
ATOM 4513  C CG2  . ILE A 1 75  ? -10.783 -0.388  0.397   1.00 0.00 ? 75  ILE A CG2  3  
ATOM 4514  C CD1  . ILE A 1 75  ? -7.702  0.247   -0.102  1.00 0.00 ? 75  ILE A CD1  3  
ATOM 4515  H H    . ILE A 1 75  ? -9.946  3.555   1.096   1.00 0.00 ? 75  ILE A H    3  
ATOM 4516  H HA   . ILE A 1 75  ? -11.368 2.011   -0.949  1.00 0.00 ? 75  ILE A HA   3  
ATOM 4517  H HB   . ILE A 1 75  ? -9.702  1.132   1.408   1.00 0.00 ? 75  ILE A HB   3  
ATOM 4518  H HG12 . ILE A 1 75  ? -9.250  0.533   -1.508  1.00 0.00 ? 75  ILE A HG12 3  
ATOM 4519  H HG13 . ILE A 1 75  ? -8.647  2.014   -0.772  1.00 0.00 ? 75  ILE A HG13 3  
ATOM 4520  H HG21 . ILE A 1 75  ? -10.076 -1.152  0.108   1.00 0.00 ? 75  ILE A HG21 3  
ATOM 4521  H HG22 . ILE A 1 75  ? -11.166 -0.608  1.382   1.00 0.00 ? 75  ILE A HG22 3  
ATOM 4522  H HG23 . ILE A 1 75  ? -11.599 -0.366  -0.310  1.00 0.00 ? 75  ILE A HG23 3  
ATOM 4523  H HD11 . ILE A 1 75  ? -8.004  -0.647  0.423   1.00 0.00 ? 75  ILE A HD11 3  
ATOM 4524  H HD12 . ILE A 1 75  ? -7.088  -0.021  -0.948  1.00 0.00 ? 75  ILE A HD12 3  
ATOM 4525  H HD13 . ILE A 1 75  ? -7.138  0.882   0.566   1.00 0.00 ? 75  ILE A HD13 3  
ATOM 4526  N N    . ASN A 1 76  ? -13.398 1.370   0.332   1.00 0.00 ? 76  ASN A N    3  
ATOM 4527  C CA   . ASN A 1 76  ? -14.653 1.133   1.035   1.00 0.00 ? 76  ASN A CA   3  
ATOM 4528  C C    . ASN A 1 76  ? -14.994 -0.354  1.055   1.00 0.00 ? 76  ASN A C    3  
ATOM 4529  O O    . ASN A 1 76  ? -14.508 -1.124  0.227   1.00 0.00 ? 76  ASN A O    3  
ATOM 4530  C CB   . ASN A 1 76  ? -15.788 1.919   0.375   1.00 0.00 ? 76  ASN A CB   3  
ATOM 4531  C CG   . ASN A 1 76  ? -15.303 3.203   -0.269  1.00 0.00 ? 76  ASN A CG   3  
ATOM 4532  O OD1  . ASN A 1 76  ? -15.253 3.316   -1.493  1.00 0.00 ? 76  ASN A OD1  3  
ATOM 4533  N ND2  . ASN A 1 76  ? -14.944 4.180   0.557   1.00 0.00 ? 76  ASN A ND2  3  
ATOM 4534  H H    . ASN A 1 76  ? -13.331 1.136   -0.618  1.00 0.00 ? 76  ASN A H    3  
ATOM 4535  H HA   . ASN A 1 76  ? -14.533 1.476   2.052   1.00 0.00 ? 76  ASN A HA   3  
ATOM 4536  H HB2  . ASN A 1 76  ? -16.245 1.306   -0.389  1.00 0.00 ? 76  ASN A HB2  3  
ATOM 4537  H HB3  . ASN A 1 76  ? -16.528 2.168   1.121   1.00 0.00 ? 76  ASN A HB3  3  
ATOM 4538  H HD21 . ASN A 1 76  ? -15.011 4.019   1.521   1.00 0.00 ? 76  ASN A HD21 3  
ATOM 4539  H HD22 . ASN A 1 76  ? -14.627 5.021   0.167   1.00 0.00 ? 76  ASN A HD22 3  
ATOM 4540  N N    . GLY A 1 77  ? -15.833 -0.751  2.007   1.00 0.00 ? 77  GLY A N    3  
ATOM 4541  C CA   . GLY A 1 77  ? -16.225 -2.144  2.116   1.00 0.00 ? 77  GLY A CA   3  
ATOM 4542  C C    . GLY A 1 77  ? -15.272 -2.949  2.978   1.00 0.00 ? 77  GLY A C    3  
ATOM 4543  O O    . GLY A 1 77  ? -14.710 -3.948  2.528   1.00 0.00 ? 77  GLY A O    3  
ATOM 4544  H H    . GLY A 1 77  ? -16.189 -0.093  2.640   1.00 0.00 ? 77  GLY A H    3  
ATOM 4545  H HA2  . GLY A 1 77  ? -17.214 -2.196  2.547   1.00 0.00 ? 77  GLY A HA2  3  
ATOM 4546  H HA3  . GLY A 1 77  ? -16.251 -2.578  1.127   1.00 0.00 ? 77  GLY A HA3  3  
ATOM 4547  N N    . LEU A 1 78  ? -15.087 -2.512  4.219   1.00 0.00 ? 78  LEU A N    3  
ATOM 4548  C CA   . LEU A 1 78  ? -14.193 -3.198  5.145   1.00 0.00 ? 78  LEU A CA   3  
ATOM 4549  C C    . LEU A 1 78  ? -14.894 -3.481  6.470   1.00 0.00 ? 78  LEU A C    3  
ATOM 4550  O O    . LEU A 1 78  ? -15.917 -2.873  6.786   1.00 0.00 ? 78  LEU A O    3  
ATOM 4551  C CB   . LEU A 1 78  ? -12.937 -2.358  5.389   1.00 0.00 ? 78  LEU A CB   3  
ATOM 4552  C CG   . LEU A 1 78  ? -12.278 -1.760  4.146   1.00 0.00 ? 78  LEU A CG   3  
ATOM 4553  C CD1  . LEU A 1 78  ? -11.243 -0.718  4.540   1.00 0.00 ? 78  LEU A CD1  3  
ATOM 4554  C CD2  . LEU A 1 78  ? -11.641 -2.855  3.302   1.00 0.00 ? 78  LEU A CD2  3  
ATOM 4555  H H    . LEU A 1 78  ? -15.562 -1.710  4.520   1.00 0.00 ? 78  LEU A H    3  
ATOM 4556  H HA   . LEU A 1 78  ? -13.906 -4.137  4.696   1.00 0.00 ? 78  LEU A HA   3  
ATOM 4557  H HB2  . LEU A 1 78  ? -13.207 -1.544  6.044   1.00 0.00 ? 78  LEU A HB2  3  
ATOM 4558  H HB3  . LEU A 1 78  ? -12.210 -2.988  5.881   1.00 0.00 ? 78  LEU A HB3  3  
ATOM 4559  H HG   . LEU A 1 78  ? -13.032 -1.270  3.546   1.00 0.00 ? 78  LEU A HG   3  
ATOM 4560  H HD11 . LEU A 1 78  ? -10.411 -1.203  5.028   1.00 0.00 ? 78  LEU A HD11 3  
ATOM 4561  H HD12 . LEU A 1 78  ? -11.690 -0.004  5.216   1.00 0.00 ? 78  LEU A HD12 3  
ATOM 4562  H HD13 . LEU A 1 78  ? -10.893 -0.205  3.656   1.00 0.00 ? 78  LEU A HD13 3  
ATOM 4563  H HD21 . LEU A 1 78  ? -11.174 -2.413  2.434   1.00 0.00 ? 78  LEU A HD21 3  
ATOM 4564  H HD22 . LEU A 1 78  ? -12.402 -3.553  2.985   1.00 0.00 ? 78  LEU A HD22 3  
ATOM 4565  H HD23 . LEU A 1 78  ? -10.896 -3.373  3.887   1.00 0.00 ? 78  LEU A HD23 3  
ATOM 4566  N N    . LYS A 1 79  ? -14.337 -4.407  7.243   1.00 0.00 ? 79  LYS A N    3  
ATOM 4567  C CA   . LYS A 1 79  ? -14.906 -4.769  8.535   1.00 0.00 ? 79  LYS A CA   3  
ATOM 4568  C C    . LYS A 1 79  ? -14.649 -3.677  9.568   1.00 0.00 ? 79  LYS A C    3  
ATOM 4569  O O    . LYS A 1 79  ? -13.946 -2.703  9.296   1.00 0.00 ? 79  LYS A O    3  
ATOM 4570  C CB   . LYS A 1 79  ? -14.316 -6.095  9.021   1.00 0.00 ? 79  LYS A CB   3  
ATOM 4571  C CG   . LYS A 1 79  ? -15.059 -7.316  8.508   1.00 0.00 ? 79  LYS A CG   3  
ATOM 4572  C CD   . LYS A 1 79  ? -16.212 -7.692  9.423   1.00 0.00 ? 79  LYS A CD   3  
ATOM 4573  C CE   . LYS A 1 79  ? -15.731 -8.481  10.631  1.00 0.00 ? 79  LYS A CE   3  
ATOM 4574  N NZ   . LYS A 1 79  ? -16.865 -8.965  11.466  1.00 0.00 ? 79  LYS A NZ   3  
ATOM 4575  H H    . LYS A 1 79  ? -13.521 -4.857  6.936   1.00 0.00 ? 79  LYS A H    3  
ATOM 4576  H HA   . LYS A 1 79  ? -15.971 -4.884  8.408   1.00 0.00 ? 79  LYS A HA   3  
ATOM 4577  H HB2  . LYS A 1 79  ? -13.289 -6.160  8.693   1.00 0.00 ? 79  LYS A HB2  3  
ATOM 4578  H HB3  . LYS A 1 79  ? -14.341 -6.112  10.102  1.00 0.00 ? 79  LYS A HB3  3  
ATOM 4579  H HG2  . LYS A 1 79  ? -15.450 -7.102  7.525   1.00 0.00 ? 79  LYS A HG2  3  
ATOM 4580  H HG3  . LYS A 1 79  ? -14.371 -8.147  8.451   1.00 0.00 ? 79  LYS A HG3  3  
ATOM 4581  H HD2  . LYS A 1 79  ? -16.697 -6.790  9.767   1.00 0.00 ? 79  LYS A HD2  3  
ATOM 4582  H HD3  . LYS A 1 79  ? -16.919 -8.294  8.869   1.00 0.00 ? 79  LYS A HD3  3  
ATOM 4583  H HE2  . LYS A 1 79  ? -15.161 -9.330  10.287  1.00 0.00 ? 79  LYS A HE2  3  
ATOM 4584  H HE3  . LYS A 1 79  ? -15.099 -7.843  11.232  1.00 0.00 ? 79  LYS A HE3  3  
ATOM 4585  H HZ1  . LYS A 1 79  ? -16.986 -9.991  11.344  1.00 0.00 ? 79  LYS A HZ1  3  
ATOM 4586  H HZ2  . LYS A 1 79  ? -17.745 -8.488  11.184  1.00 0.00 ? 79  LYS A HZ2  3  
ATOM 4587  H HZ3  . LYS A 1 79  ? -16.682 -8.765  12.470  1.00 0.00 ? 79  LYS A HZ3  3  
ATOM 4588  N N    . LYS A 1 80  ? -15.220 -3.845  10.756  1.00 0.00 ? 80  LYS A N    3  
ATOM 4589  C CA   . LYS A 1 80  ? -15.051 -2.876  11.832  1.00 0.00 ? 80  LYS A CA   3  
ATOM 4590  C C    . LYS A 1 80  ? -14.086 -3.400  12.890  1.00 0.00 ? 80  LYS A C    3  
ATOM 4591  O O    . LYS A 1 80  ? -14.139 -4.571  13.267  1.00 0.00 ? 80  LYS A O    3  
ATOM 4592  C CB   . LYS A 1 80  ? -16.403 -2.555  12.473  1.00 0.00 ? 80  LYS A CB   3  
ATOM 4593  C CG   . LYS A 1 80  ? -17.475 -2.165  11.471  1.00 0.00 ? 80  LYS A CG   3  
ATOM 4594  C CD   . LYS A 1 80  ? -18.279 -3.372  11.017  1.00 0.00 ? 80  LYS A CD   3  
ATOM 4595  C CE   . LYS A 1 80  ? -19.067 -3.072  9.750   1.00 0.00 ? 80  LYS A CE   3  
ATOM 4596  N NZ   . LYS A 1 80  ? -19.969 -4.197  9.379   1.00 0.00 ? 80  LYS A NZ   3  
ATOM 4597  H H    . LYS A 1 80  ? -15.770 -4.643  10.913  1.00 0.00 ? 80  LYS A H    3  
ATOM 4598  H HA   . LYS A 1 80  ? -14.642 -1.973  11.404  1.00 0.00 ? 80  LYS A HA   3  
ATOM 4599  H HB2  . LYS A 1 80  ? -16.746 -3.423  13.016  1.00 0.00 ? 80  LYS A HB2  3  
ATOM 4600  H HB3  . LYS A 1 80  ? -16.273 -1.736  13.167  1.00 0.00 ? 80  LYS A HB3  3  
ATOM 4601  H HG2  . LYS A 1 80  ? -18.144 -1.453  11.931  1.00 0.00 ? 80  LYS A HG2  3  
ATOM 4602  H HG3  . LYS A 1 80  ? -17.003 -1.714  10.610  1.00 0.00 ? 80  LYS A HG3  3  
ATOM 4603  H HD2  . LYS A 1 80  ? -17.604 -4.191  10.822  1.00 0.00 ? 80  LYS A HD2  3  
ATOM 4604  H HD3  . LYS A 1 80  ? -18.969 -3.650  11.802  1.00 0.00 ? 80  LYS A HD3  3  
ATOM 4605  H HE2  . LYS A 1 80  ? -19.660 -2.185  9.912   1.00 0.00 ? 80  LYS A HE2  3  
ATOM 4606  H HE3  . LYS A 1 80  ? -18.371 -2.898  8.943   1.00 0.00 ? 80  LYS A HE3  3  
ATOM 4607  H HZ1  . LYS A 1 80  ? -20.784 -4.230  10.025  1.00 0.00 ? 80  LYS A HZ1  3  
ATOM 4608  H HZ2  . LYS A 1 80  ? -19.457 -5.100  9.440   1.00 0.00 ? 80  LYS A HZ2  3  
ATOM 4609  H HZ3  . LYS A 1 80  ? -20.315 -4.072  8.407   1.00 0.00 ? 80  LYS A HZ3  3  
ATOM 4610  N N    . TYR A 1 81  ? -13.206 -2.526  13.365  1.00 0.00 ? 81  TYR A N    3  
ATOM 4611  C CA   . TYR A 1 81  ? -12.228 -2.902  14.379  1.00 0.00 ? 81  TYR A CA   3  
ATOM 4612  C C    . TYR A 1 81  ? -11.336 -4.036  13.883  1.00 0.00 ? 81  TYR A C    3  
ATOM 4613  O O    . TYR A 1 81  ? -11.065 -4.993  14.609  1.00 0.00 ? 81  TYR A O    3  
ATOM 4614  C CB   . TYR A 1 81  ? -12.935 -3.322  15.669  1.00 0.00 ? 81  TYR A CB   3  
ATOM 4615  C CG   . TYR A 1 81  ? -12.105 -3.102  16.914  1.00 0.00 ? 81  TYR A CG   3  
ATOM 4616  C CD1  . TYR A 1 81  ? -11.693 -1.828  17.282  1.00 0.00 ? 81  TYR A CD1  3  
ATOM 4617  C CD2  . TYR A 1 81  ? -11.734 -4.170  17.722  1.00 0.00 ? 81  TYR A CD2  3  
ATOM 4618  C CE1  . TYR A 1 81  ? -10.934 -1.623  18.418  1.00 0.00 ? 81  TYR A CE1  3  
ATOM 4619  C CE2  . TYR A 1 81  ? -10.977 -3.974  18.861  1.00 0.00 ? 81  TYR A CE2  3  
ATOM 4620  C CZ   . TYR A 1 81  ? -10.578 -2.699  19.204  1.00 0.00 ? 81  TYR A CZ   3  
ATOM 4621  O OH   . TYR A 1 81  ? -9.824  -2.499  20.337  1.00 0.00 ? 81  TYR A OH   3  
ATOM 4622  H H    . TYR A 1 81  ? -13.212 -1.607  13.025  1.00 0.00 ? 81  TYR A H    3  
ATOM 4623  H HA   . TYR A 1 81  ? -11.612 -2.038  14.583  1.00 0.00 ? 81  TYR A HA   3  
ATOM 4624  H HB2  . TYR A 1 81  ? -13.846 -2.753  15.774  1.00 0.00 ? 81  TYR A HB2  3  
ATOM 4625  H HB3  . TYR A 1 81  ? -13.177 -4.373  15.613  1.00 0.00 ? 81  TYR A HB3  3  
ATOM 4626  H HD1  . TYR A 1 81  ? -11.973 -0.987  16.664  1.00 0.00 ? 81  TYR A HD1  3  
ATOM 4627  H HD2  . TYR A 1 81  ? -12.048 -5.168  17.451  1.00 0.00 ? 81  TYR A HD2  3  
ATOM 4628  H HE1  . TYR A 1 81  ? -10.622 -0.624  18.687  1.00 0.00 ? 81  TYR A HE1  3  
ATOM 4629  H HE2  . TYR A 1 81  ? -10.698 -4.816  19.477  1.00 0.00 ? 81  TYR A HE2  3  
ATOM 4630  H HH   . TYR A 1 81  ? -10.155 -3.057  21.045  1.00 0.00 ? 81  TYR A HH   3  
ATOM 4631  N N    . THR A 1 82  ? -10.880 -3.920  12.639  1.00 0.00 ? 82  THR A N    3  
ATOM 4632  C CA   . THR A 1 82  ? -10.019 -4.934  12.043  1.00 0.00 ? 82  THR A CA   3  
ATOM 4633  C C    . THR A 1 82  ? -8.786  -4.303  11.407  1.00 0.00 ? 82  THR A C    3  
ATOM 4634  O O    . THR A 1 82  ? -8.863  -3.224  10.821  1.00 0.00 ? 82  THR A O    3  
ATOM 4635  C CB   . THR A 1 82  ? -10.771 -5.754  10.977  1.00 0.00 ? 82  THR A CB   3  
ATOM 4636  O OG1  . THR A 1 82  ? -11.780 -6.558  11.599  1.00 0.00 ? 82  THR A OG1  3  
ATOM 4637  C CG2  . THR A 1 82  ? -9.811  -6.644  10.203  1.00 0.00 ? 82  THR A CG2  3  
ATOM 4638  H H    . THR A 1 82  ? -11.131 -3.134  12.111  1.00 0.00 ? 82  THR A H    3  
ATOM 4639  H HA   . THR A 1 82  ? -9.704  -5.607  12.828  1.00 0.00 ? 82  THR A HA   3  
ATOM 4640  H HB   . THR A 1 82  ? -11.242 -5.070  10.286  1.00 0.00 ? 82  THR A HB   3  
ATOM 4641  H HG1  . THR A 1 82  ? -12.522 -6.002  11.850  1.00 0.00 ? 82  THR A HG1  3  
ATOM 4642  H HG21 . THR A 1 82  ? -10.350 -7.487  9.796   1.00 0.00 ? 82  THR A HG21 3  
ATOM 4643  H HG22 . THR A 1 82  ? -9.036  -6.999  10.866  1.00 0.00 ? 82  THR A HG22 3  
ATOM 4644  H HG23 . THR A 1 82  ? -9.366  -6.079  9.398   1.00 0.00 ? 82  THR A HG23 3  
ATOM 4645  N N    . GLU A 1 83  ? -7.651  -4.984  11.526  1.00 0.00 ? 83  GLU A N    3  
ATOM 4646  C CA   . GLU A 1 83  ? -6.401  -4.489  10.961  1.00 0.00 ? 83  GLU A CA   3  
ATOM 4647  C C    . GLU A 1 83  ? -6.376  -4.676  9.447   1.00 0.00 ? 83  GLU A C    3  
ATOM 4648  O O    . GLU A 1 83  ? -7.010  -5.586  8.913   1.00 0.00 ? 83  GLU A O    3  
ATOM 4649  C CB   . GLU A 1 83  ? -5.208  -5.208  11.595  1.00 0.00 ? 83  GLU A CB   3  
ATOM 4650  C CG   . GLU A 1 83  ? -3.950  -4.359  11.660  1.00 0.00 ? 83  GLU A CG   3  
ATOM 4651  C CD   . GLU A 1 83  ? -2.869  -4.983  12.522  1.00 0.00 ? 83  GLU A CD   3  
ATOM 4652  O OE1  . GLU A 1 83  ? -2.870  -4.734  13.746  1.00 0.00 ? 83  GLU A OE1  3  
ATOM 4653  O OE2  . GLU A 1 83  ? -2.023  -5.719  11.973  1.00 0.00 ? 83  GLU A OE2  3  
ATOM 4654  H H    . GLU A 1 83  ? -7.653  -5.839  12.005  1.00 0.00 ? 83  GLU A H    3  
ATOM 4655  H HA   . GLU A 1 83  ? -6.332  -3.434  11.182  1.00 0.00 ? 83  GLU A HA   3  
ATOM 4656  H HB2  . GLU A 1 83  ? -5.473  -5.501  12.600  1.00 0.00 ? 83  GLU A HB2  3  
ATOM 4657  H HB3  . GLU A 1 83  ? -4.990  -6.094  11.018  1.00 0.00 ? 83  GLU A HB3  3  
ATOM 4658  H HG2  . GLU A 1 83  ? -3.563  -4.234  10.659  1.00 0.00 ? 83  GLU A HG2  3  
ATOM 4659  H HG3  . GLU A 1 83  ? -4.204  -3.392  12.070  1.00 0.00 ? 83  GLU A HG3  3  
ATOM 4660  N N    . TYR A 1 84  ? -5.640  -3.809  8.762   1.00 0.00 ? 84  TYR A N    3  
ATOM 4661  C CA   . TYR A 1 84  ? -5.534  -3.876  7.309   1.00 0.00 ? 84  TYR A CA   3  
ATOM 4662  C C    . TYR A 1 84  ? -4.167  -3.386  6.839   1.00 0.00 ? 84  TYR A C    3  
ATOM 4663  O O    . TYR A 1 84  ? -3.741  -2.282  7.178   1.00 0.00 ? 84  TYR A O    3  
ATOM 4664  C CB   . TYR A 1 84  ? -6.639  -3.043  6.657   1.00 0.00 ? 84  TYR A CB   3  
ATOM 4665  C CG   . TYR A 1 84  ? -8.014  -3.657  6.784   1.00 0.00 ? 84  TYR A CG   3  
ATOM 4666  C CD1  . TYR A 1 84  ? -8.395  -4.729  5.985   1.00 0.00 ? 84  TYR A CD1  3  
ATOM 4667  C CD2  . TYR A 1 84  ? -8.934  -3.166  7.703   1.00 0.00 ? 84  TYR A CD2  3  
ATOM 4668  C CE1  . TYR A 1 84  ? -9.651  -5.292  6.097   1.00 0.00 ? 84  TYR A CE1  3  
ATOM 4669  C CE2  . TYR A 1 84  ? -10.192 -3.724  7.822   1.00 0.00 ? 84  TYR A CE2  3  
ATOM 4670  C CZ   . TYR A 1 84  ? -10.546 -4.787  7.017   1.00 0.00 ? 84  TYR A CZ   3  
ATOM 4671  O OH   . TYR A 1 84  ? -11.798 -5.346  7.133   1.00 0.00 ? 84  TYR A OH   3  
ATOM 4672  H H    . TYR A 1 84  ? -5.157  -3.105  9.244   1.00 0.00 ? 84  TYR A H    3  
ATOM 4673  H HA   . TYR A 1 84  ? -5.654  -4.908  7.015   1.00 0.00 ? 84  TYR A HA   3  
ATOM 4674  H HB2  . TYR A 1 84  ? -6.667  -2.069  7.120   1.00 0.00 ? 84  TYR A HB2  3  
ATOM 4675  H HB3  . TYR A 1 84  ? -6.421  -2.930  5.605   1.00 0.00 ? 84  TYR A HB3  3  
ATOM 4676  H HD1  . TYR A 1 84  ? -7.691  -5.123  5.266   1.00 0.00 ? 84  TYR A HD1  3  
ATOM 4677  H HD2  . TYR A 1 84  ? -8.654  -2.333  8.332   1.00 0.00 ? 84  TYR A HD2  3  
ATOM 4678  H HE1  . TYR A 1 84  ? -9.928  -6.125  5.468   1.00 0.00 ? 84  TYR A HE1  3  
ATOM 4679  H HE2  . TYR A 1 84  ? -10.893 -3.328  8.542   1.00 0.00 ? 84  TYR A HE2  3  
ATOM 4680  H HH   . TYR A 1 84  ? -11.715 -6.262  7.408   1.00 0.00 ? 84  TYR A HH   3  
ATOM 4681  N N    . SER A 1 85  ? -3.486  -4.215  6.056   1.00 0.00 ? 85  SER A N    3  
ATOM 4682  C CA   . SER A 1 85  ? -2.166  -3.869  5.540   1.00 0.00 ? 85  SER A CA   3  
ATOM 4683  C C    . SER A 1 85  ? -2.281  -3.073  4.244   1.00 0.00 ? 85  SER A C    3  
ATOM 4684  O O    . SER A 1 85  ? -3.194  -3.290  3.447   1.00 0.00 ? 85  SER A O    3  
ATOM 4685  C CB   . SER A 1 85  ? -1.340  -5.135  5.303   1.00 0.00 ? 85  SER A CB   3  
ATOM 4686  O OG   . SER A 1 85  ? 0.047   -4.867  5.417   1.00 0.00 ? 85  SER A OG   3  
ATOM 4687  H H    . SER A 1 85  ? -3.879  -5.082  5.820   1.00 0.00 ? 85  SER A H    3  
ATOM 4688  H HA   . SER A 1 85  ? -1.671  -3.260  6.281   1.00 0.00 ? 85  SER A HA   3  
ATOM 4689  H HB2  . SER A 1 85  ? -1.611  -5.881  6.035   1.00 0.00 ? 85  SER A HB2  3  
ATOM 4690  H HB3  . SER A 1 85  ? -1.542  -5.513  4.311   1.00 0.00 ? 85  SER A HB3  3  
ATOM 4691  H HG   . SER A 1 85  ? 0.214   -4.382  6.228   1.00 0.00 ? 85  SER A HG   3  
ATOM 4692  N N    . PHE A 1 86  ? -1.347  -2.149  4.040   1.00 0.00 ? 86  PHE A N    3  
ATOM 4693  C CA   . PHE A 1 86  ? -1.342  -1.319  2.842   1.00 0.00 ? 86  PHE A CA   3  
ATOM 4694  C C    . PHE A 1 86  ? 0.084   -1.053  2.370   1.00 0.00 ? 86  PHE A C    3  
ATOM 4695  O O    . PHE A 1 86  ? 0.975   -0.779  3.174   1.00 0.00 ? 86  PHE A O    3  
ATOM 4696  C CB   . PHE A 1 86  ? -2.057  0.007   3.111   1.00 0.00 ? 86  PHE A CB   3  
ATOM 4697  C CG   . PHE A 1 86  ? -3.522  -0.151  3.404   1.00 0.00 ? 86  PHE A CG   3  
ATOM 4698  C CD1  . PHE A 1 86  ? -4.431  -0.343  2.376   1.00 0.00 ? 86  PHE A CD1  3  
ATOM 4699  C CD2  . PHE A 1 86  ? -3.991  -0.107  4.707   1.00 0.00 ? 86  PHE A CD2  3  
ATOM 4700  C CE1  . PHE A 1 86  ? -5.779  -0.488  2.642   1.00 0.00 ? 86  PHE A CE1  3  
ATOM 4701  C CE2  . PHE A 1 86  ? -5.338  -0.251  4.980   1.00 0.00 ? 86  PHE A CE2  3  
ATOM 4702  C CZ   . PHE A 1 86  ? -6.233  -0.443  3.946   1.00 0.00 ? 86  PHE A CZ   3  
ATOM 4703  H H    . PHE A 1 86  ? -0.645  -2.023  4.713   1.00 0.00 ? 86  PHE A H    3  
ATOM 4704  H HA   . PHE A 1 86  ? -1.872  -1.852  2.068   1.00 0.00 ? 86  PHE A HA   3  
ATOM 4705  H HB2  . PHE A 1 86  ? -1.600  0.488   3.963   1.00 0.00 ? 86  PHE A HB2  3  
ATOM 4706  H HB3  . PHE A 1 86  ? -1.957  0.644   2.246   1.00 0.00 ? 86  PHE A HB3  3  
ATOM 4707  H HD1  . PHE A 1 86  ? -4.077  -0.380  1.356   1.00 0.00 ? 86  PHE A HD1  3  
ATOM 4708  H HD2  . PHE A 1 86  ? -3.291  0.043   5.517   1.00 0.00 ? 86  PHE A HD2  3  
ATOM 4709  H HE1  . PHE A 1 86  ? -6.477  -0.638  1.832   1.00 0.00 ? 86  PHE A HE1  3  
ATOM 4710  H HE2  . PHE A 1 86  ? -5.689  -0.215  6.000   1.00 0.00 ? 86  PHE A HE2  3  
ATOM 4711  H HZ   . PHE A 1 86  ? -7.286  -0.555  4.156   1.00 0.00 ? 86  PHE A HZ   3  
ATOM 4712  N N    . ARG A 1 87  ? 0.293   -1.137  1.060   1.00 0.00 ? 87  ARG A N    3  
ATOM 4713  C CA   . ARG A 1 87  ? 1.610   -0.908  0.480   1.00 0.00 ? 87  ARG A CA   3  
ATOM 4714  C C    . ARG A 1 87  ? 1.492   -0.311  -0.919  1.00 0.00 ? 87  ARG A C    3  
ATOM 4715  O O    . ARG A 1 87  ? 0.711   -0.785  -1.744  1.00 0.00 ? 87  ARG A O    3  
ATOM 4716  C CB   . ARG A 1 87  ? 2.400   -2.217  0.422   1.00 0.00 ? 87  ARG A CB   3  
ATOM 4717  C CG   . ARG A 1 87  ? 1.762   -3.275  -0.463  1.00 0.00 ? 87  ARG A CG   3  
ATOM 4718  C CD   . ARG A 1 87  ? 2.725   -4.417  -0.749  1.00 0.00 ? 87  ARG A CD   3  
ATOM 4719  N NE   . ARG A 1 87  ? 2.089   -5.493  -1.504  1.00 0.00 ? 87  ARG A NE   3  
ATOM 4720  C CZ   . ARG A 1 87  ? 2.762   -6.382  -2.225  1.00 0.00 ? 87  ARG A CZ   3  
ATOM 4721  N NH1  . ARG A 1 87  ? 4.085   -6.324  -2.289  1.00 0.00 ? 87  ARG A NH1  3  
ATOM 4722  N NH2  . ARG A 1 87  ? 2.112   -7.333  -2.885  1.00 0.00 ? 87  ARG A NH2  3  
ATOM 4723  H H    . ARG A 1 87  ? -0.457  -1.359  0.469   1.00 0.00 ? 87  ARG A H    3  
ATOM 4724  H HA   . ARG A 1 87  ? 2.135   -0.209  1.114   1.00 0.00 ? 87  ARG A HA   3  
ATOM 4725  H HB2  . ARG A 1 87  ? 3.390   -2.011  0.042   1.00 0.00 ? 87  ARG A HB2  3  
ATOM 4726  H HB3  . ARG A 1 87  ? 2.484   -2.617  1.421   1.00 0.00 ? 87  ARG A HB3  3  
ATOM 4727  H HG2  . ARG A 1 87  ? 0.890   -3.671  0.037   1.00 0.00 ? 87  ARG A HG2  3  
ATOM 4728  H HG3  . ARG A 1 87  ? 1.469   -2.820  -1.397  1.00 0.00 ? 87  ARG A HG3  3  
ATOM 4729  H HD2  . ARG A 1 87  ? 3.558   -4.034  -1.319  1.00 0.00 ? 87  ARG A HD2  3  
ATOM 4730  H HD3  . ARG A 1 87  ? 3.083   -4.811  0.190   1.00 0.00 ? 87  ARG A HD3  3  
ATOM 4731  H HE   . ARG A 1 87  ? 1.112   -5.555  -1.471  1.00 0.00 ? 87  ARG A HE   3  
ATOM 4732  H HH11 . ARG A 1 87  ? 4.578   -5.610  -1.792  1.00 0.00 ? 87  ARG A HH11 3  
ATOM 4733  H HH12 . ARG A 1 87  ? 4.590   -6.996  -2.831  1.00 0.00 ? 87  ARG A HH12 3  
ATOM 4734  H HH21 . ARG A 1 87  ? 1.114   -7.380  -2.839  1.00 0.00 ? 87  ARG A HH21 3  
ATOM 4735  H HH22 . ARG A 1 87  ? 2.619   -8.001  -3.427  1.00 0.00 ? 87  ARG A HH22 3  
ATOM 4736  N N    . VAL A 1 88  ? 2.273   0.733   -1.180  1.00 0.00 ? 88  VAL A N    3  
ATOM 4737  C CA   . VAL A 1 88  ? 2.257   1.395   -2.479  1.00 0.00 ? 88  VAL A CA   3  
ATOM 4738  C C    . VAL A 1 88  ? 3.468   0.996   -3.314  1.00 0.00 ? 88  VAL A C    3  
ATOM 4739  O O    . VAL A 1 88  ? 4.560   0.786   -2.784  1.00 0.00 ? 88  VAL A O    3  
ATOM 4740  C CB   . VAL A 1 88  ? 2.233   2.927   -2.327  1.00 0.00 ? 88  VAL A CB   3  
ATOM 4741  C CG1  . VAL A 1 88  ? 2.353   3.600   -3.686  1.00 0.00 ? 88  VAL A CG1  3  
ATOM 4742  C CG2  . VAL A 1 88  ? 0.967   3.372   -1.613  1.00 0.00 ? 88  VAL A CG2  3  
ATOM 4743  H H    . VAL A 1 88  ? 2.875   1.065   -0.482  1.00 0.00 ? 88  VAL A H    3  
ATOM 4744  H HA   . VAL A 1 88  ? 1.359   1.091   -2.997  1.00 0.00 ? 88  VAL A HA   3  
ATOM 4745  H HB   . VAL A 1 88  ? 3.082   3.223   -1.728  1.00 0.00 ? 88  VAL A HB   3  
ATOM 4746  H HG11 . VAL A 1 88  ? 1.747   3.069   -4.405  1.00 0.00 ? 88  VAL A HG11 3  
ATOM 4747  H HG12 . VAL A 1 88  ? 2.014   4.623   -3.613  1.00 0.00 ? 88  VAL A HG12 3  
ATOM 4748  H HG13 . VAL A 1 88  ? 3.385   3.585   -4.006  1.00 0.00 ? 88  VAL A HG13 3  
ATOM 4749  H HG21 . VAL A 1 88  ? 1.228   4.012   -0.782  1.00 0.00 ? 88  VAL A HG21 3  
ATOM 4750  H HG22 . VAL A 1 88  ? 0.336   3.917   -2.301  1.00 0.00 ? 88  VAL A HG22 3  
ATOM 4751  H HG23 . VAL A 1 88  ? 0.435   2.506   -1.247  1.00 0.00 ? 88  VAL A HG23 3  
ATOM 4752  N N    . VAL A 1 89  ? 3.269   0.894   -4.624  1.00 0.00 ? 89  VAL A N    3  
ATOM 4753  C CA   . VAL A 1 89  ? 4.345   0.521   -5.534  1.00 0.00 ? 89  VAL A CA   3  
ATOM 4754  C C    . VAL A 1 89  ? 4.329   1.388   -6.788  1.00 0.00 ? 89  VAL A C    3  
ATOM 4755  O O    . VAL A 1 89  ? 3.271   1.656   -7.356  1.00 0.00 ? 89  VAL A O    3  
ATOM 4756  C CB   . VAL A 1 89  ? 4.245   -0.959  -5.946  1.00 0.00 ? 89  VAL A CB   3  
ATOM 4757  C CG1  . VAL A 1 89  ? 5.437   -1.357  -6.804  1.00 0.00 ? 89  VAL A CG1  3  
ATOM 4758  C CG2  . VAL A 1 89  ? 4.143   -1.848  -4.716  1.00 0.00 ? 89  VAL A CG2  3  
ATOM 4759  H H    . VAL A 1 89  ? 2.377   1.073   -4.987  1.00 0.00 ? 89  VAL A H    3  
ATOM 4760  H HA   . VAL A 1 89  ? 5.284   0.667   -5.019  1.00 0.00 ? 89  VAL A HA   3  
ATOM 4761  H HB   . VAL A 1 89  ? 3.348   -1.089  -6.534  1.00 0.00 ? 89  VAL A HB   3  
ATOM 4762  H HG11 . VAL A 1 89  ? 6.239   -0.648  -6.656  1.00 0.00 ? 89  VAL A HG11 3  
ATOM 4763  H HG12 . VAL A 1 89  ? 5.771   -2.345  -6.521  1.00 0.00 ? 89  VAL A HG12 3  
ATOM 4764  H HG13 . VAL A 1 89  ? 5.147   -1.359  -7.844  1.00 0.00 ? 89  VAL A HG13 3  
ATOM 4765  H HG21 . VAL A 1 89  ? 4.070   -1.232  -3.832  1.00 0.00 ? 89  VAL A HG21 3  
ATOM 4766  H HG22 . VAL A 1 89  ? 3.264   -2.472  -4.794  1.00 0.00 ? 89  VAL A HG22 3  
ATOM 4767  H HG23 . VAL A 1 89  ? 5.021   -2.473  -4.649  1.00 0.00 ? 89  VAL A HG23 3  
ATOM 4768  N N    . ALA A 1 90  ? 5.510   1.824   -7.215  1.00 0.00 ? 90  ALA A N    3  
ATOM 4769  C CA   . ALA A 1 90  ? 5.632   2.659   -8.404  1.00 0.00 ? 90  ALA A CA   3  
ATOM 4770  C C    . ALA A 1 90  ? 5.751   1.807   -9.663  1.00 0.00 ? 90  ALA A C    3  
ATOM 4771  O O    . ALA A 1 90  ? 6.529   0.854   -9.708  1.00 0.00 ? 90  ALA A O    3  
ATOM 4772  C CB   . ALA A 1 90  ? 6.832   3.586   -8.276  1.00 0.00 ? 90  ALA A CB   3  
ATOM 4773  H H    . ALA A 1 90  ? 6.318   1.577   -6.720  1.00 0.00 ? 90  ALA A H    3  
ATOM 4774  H HA   . ALA A 1 90  ? 4.743   3.269   -8.476  1.00 0.00 ? 90  ALA A HA   3  
ATOM 4775  H HB1  . ALA A 1 90  ? 6.758   4.143   -7.353  1.00 0.00 ? 90  ALA A HB1  3  
ATOM 4776  H HB2  . ALA A 1 90  ? 7.740   3.002   -8.274  1.00 0.00 ? 90  ALA A HB2  3  
ATOM 4777  H HB3  . ALA A 1 90  ? 6.846   4.272   -9.110  1.00 0.00 ? 90  ALA A HB3  3  
ATOM 4778  N N    . TYR A 1 91  ? 4.975   2.157   -10.683 1.00 0.00 ? 91  TYR A N    3  
ATOM 4779  C CA   . TYR A 1 91  ? 4.991   1.422   -11.942 1.00 0.00 ? 91  TYR A CA   3  
ATOM 4780  C C    . TYR A 1 91  ? 5.327   2.347   -13.108 1.00 0.00 ? 91  TYR A C    3  
ATOM 4781  O O    . TYR A 1 91  ? 4.561   3.251   -13.438 1.00 0.00 ? 91  TYR A O    3  
ATOM 4782  C CB   . TYR A 1 91  ? 3.638   0.750   -12.183 1.00 0.00 ? 91  TYR A CB   3  
ATOM 4783  C CG   . TYR A 1 91  ? 3.531   -0.630  -11.575 1.00 0.00 ? 91  TYR A CG   3  
ATOM 4784  C CD1  . TYR A 1 91  ? 3.142   -0.801  -10.252 1.00 0.00 ? 91  TYR A CD1  3  
ATOM 4785  C CD2  . TYR A 1 91  ? 3.818   -1.765  -12.325 1.00 0.00 ? 91  TYR A CD2  3  
ATOM 4786  C CE1  . TYR A 1 91  ? 3.044   -2.060  -9.694  1.00 0.00 ? 91  TYR A CE1  3  
ATOM 4787  C CE2  . TYR A 1 91  ? 3.720   -3.028  -11.775 1.00 0.00 ? 91  TYR A CE2  3  
ATOM 4788  C CZ   . TYR A 1 91  ? 3.334   -3.171  -10.459 1.00 0.00 ? 91  TYR A CZ   3  
ATOM 4789  O OH   . TYR A 1 91  ? 3.235   -4.427  -9.906  1.00 0.00 ? 91  TYR A OH   3  
ATOM 4790  H H    . TYR A 1 91  ? 4.376   2.926   -10.587 1.00 0.00 ? 91  TYR A H    3  
ATOM 4791  H HA   . TYR A 1 91  ? 5.753   0.659   -11.871 1.00 0.00 ? 91  TYR A HA   3  
ATOM 4792  H HB2  . TYR A 1 91  ? 2.859   1.362   -11.754 1.00 0.00 ? 91  TYR A HB2  3  
ATOM 4793  H HB3  . TYR A 1 91  ? 3.473   0.659   -13.246 1.00 0.00 ? 91  TYR A HB3  3  
ATOM 4794  H HD1  . TYR A 1 91  ? 2.916   0.071   -9.656  1.00 0.00 ? 91  TYR A HD1  3  
ATOM 4795  H HD2  . TYR A 1 91  ? 4.120   -1.650  -13.356 1.00 0.00 ? 91  TYR A HD2  3  
ATOM 4796  H HE1  . TYR A 1 91  ? 2.741   -2.172  -8.663  1.00 0.00 ? 91  TYR A HE1  3  
ATOM 4797  H HE2  . TYR A 1 91  ? 3.947   -3.898  -12.374 1.00 0.00 ? 91  TYR A HE2  3  
ATOM 4798  H HH   . TYR A 1 91  ? 2.328   -4.734  -9.970  1.00 0.00 ? 91  TYR A HH   3  
ATOM 4799  N N    . ASN A 1 92  ? 6.479   2.112   -13.728 1.00 0.00 ? 92  ASN A N    3  
ATOM 4800  C CA   . ASN A 1 92  ? 6.918   2.923   -14.858 1.00 0.00 ? 92  ASN A CA   3  
ATOM 4801  C C    . ASN A 1 92  ? 7.243   2.046   -16.064 1.00 0.00 ? 92  ASN A C    3  
ATOM 4802  O O    . ASN A 1 92  ? 7.570   0.868   -15.919 1.00 0.00 ? 92  ASN A O    3  
ATOM 4803  C CB   . ASN A 1 92  ? 8.144   3.753   -14.472 1.00 0.00 ? 92  ASN A CB   3  
ATOM 4804  C CG   . ASN A 1 92  ? 9.311   2.890   -14.034 1.00 0.00 ? 92  ASN A CG   3  
ATOM 4805  O OD1  . ASN A 1 92  ? 9.159   1.690   -13.805 1.00 0.00 ? 92  ASN A OD1  3  
ATOM 4806  N ND2  . ASN A 1 92  ? 10.485  3.499   -13.915 1.00 0.00 ? 92  ASN A ND2  3  
ATOM 4807  H H    . ASN A 1 92  ? 7.048   1.376   -13.419 1.00 0.00 ? 92  ASN A H    3  
ATOM 4808  H HA   . ASN A 1 92  ? 6.111   3.590   -15.121 1.00 0.00 ? 92  ASN A HA   3  
ATOM 4809  H HB2  . ASN A 1 92  ? 8.455   4.341   -15.322 1.00 0.00 ? 92  ASN A HB2  3  
ATOM 4810  H HB3  . ASN A 1 92  ? 7.882   4.413   -13.658 1.00 0.00 ? 92  ASN A HB3  3  
ATOM 4811  H HD21 . ASN A 1 92  ? 10.532  4.458   -14.114 1.00 0.00 ? 92  ASN A HD21 3  
ATOM 4812  H HD22 . ASN A 1 92  ? 11.257  2.965   -13.634 1.00 0.00 ? 92  ASN A HD22 3  
ATOM 4813  N N    . LYS A 1 93  ? 7.153   2.629   -17.254 1.00 0.00 ? 93  LYS A N    3  
ATOM 4814  C CA   . LYS A 1 93  ? 7.439   1.903   -18.486 1.00 0.00 ? 93  LYS A CA   3  
ATOM 4815  C C    . LYS A 1 93  ? 8.570   0.901   -18.277 1.00 0.00 ? 93  LYS A C    3  
ATOM 4816  O O    . LYS A 1 93  ? 8.576   -0.177  -18.871 1.00 0.00 ? 93  LYS A O    3  
ATOM 4817  C CB   . LYS A 1 93  ? 7.809   2.880   -19.604 1.00 0.00 ? 93  LYS A CB   3  
ATOM 4818  C CG   . LYS A 1 93  ? 8.964   3.801   -19.249 1.00 0.00 ? 93  LYS A CG   3  
ATOM 4819  C CD   . LYS A 1 93  ? 9.066   4.967   -20.219 1.00 0.00 ? 93  LYS A CD   3  
ATOM 4820  C CE   . LYS A 1 93  ? 9.704   6.182   -19.564 1.00 0.00 ? 93  LYS A CE   3  
ATOM 4821  N NZ   . LYS A 1 93  ? 9.868   7.308   -20.525 1.00 0.00 ? 93  LYS A NZ   3  
ATOM 4822  H H    . LYS A 1 93  ? 6.887   3.572   -17.306 1.00 0.00 ? 93  LYS A H    3  
ATOM 4823  H HA   . LYS A 1 93  ? 6.546   1.366   -18.770 1.00 0.00 ? 93  LYS A HA   3  
ATOM 4824  H HB2  . LYS A 1 93  ? 8.083   2.316   -20.483 1.00 0.00 ? 93  LYS A HB2  3  
ATOM 4825  H HB3  . LYS A 1 93  ? 6.947   3.491   -19.832 1.00 0.00 ? 93  LYS A HB3  3  
ATOM 4826  H HG2  . LYS A 1 93  ? 8.811   4.188   -18.253 1.00 0.00 ? 93  LYS A HG2  3  
ATOM 4827  H HG3  . LYS A 1 93  ? 9.885   3.236   -19.281 1.00 0.00 ? 93  LYS A HG3  3  
ATOM 4828  H HD2  . LYS A 1 93  ? 9.668   4.669   -21.064 1.00 0.00 ? 93  LYS A HD2  3  
ATOM 4829  H HD3  . LYS A 1 93  ? 8.073   5.230   -20.556 1.00 0.00 ? 93  LYS A HD3  3  
ATOM 4830  H HE2  . LYS A 1 93  ? 9.078   6.505   -18.747 1.00 0.00 ? 93  LYS A HE2  3  
ATOM 4831  H HE3  . LYS A 1 93  ? 10.675  5.900   -19.183 1.00 0.00 ? 93  LYS A HE3  3  
ATOM 4832  H HZ1  . LYS A 1 93  ? 10.550  7.048   -21.266 1.00 0.00 ? 93  LYS A HZ1  3  
ATOM 4833  H HZ2  . LYS A 1 93  ? 10.218  8.152   -20.029 1.00 0.00 ? 93  LYS A HZ2  3  
ATOM 4834  H HZ3  . LYS A 1 93  ? 8.956   7.533   -20.970 1.00 0.00 ? 93  LYS A HZ3  3  
ATOM 4835  N N    . HIS A 1 94  ? 9.526   1.264   -17.427 1.00 0.00 ? 94  HIS A N    3  
ATOM 4836  C CA   . HIS A 1 94  ? 10.662  0.395   -17.138 1.00 0.00 ? 94  HIS A CA   3  
ATOM 4837  C C    . HIS A 1 94  ? 10.210  -0.861  -16.399 1.00 0.00 ? 94  HIS A C    3  
ATOM 4838  O O    . HIS A 1 94  ? 10.456  -1.980  -16.848 1.00 0.00 ? 94  HIS A O    3  
ATOM 4839  C CB   . HIS A 1 94  ? 11.704  1.143   -16.307 1.00 0.00 ? 94  HIS A CB   3  
ATOM 4840  C CG   . HIS A 1 94  ? 11.991  2.525   -16.809 1.00 0.00 ? 94  HIS A CG   3  
ATOM 4841  N ND1  . HIS A 1 94  ? 13.146  2.855   -17.486 1.00 0.00 ? 94  HIS A ND1  3  
ATOM 4842  C CD2  . HIS A 1 94  ? 11.264  3.664   -16.731 1.00 0.00 ? 94  HIS A CD2  3  
ATOM 4843  C CE1  . HIS A 1 94  ? 13.118  4.138   -17.800 1.00 0.00 ? 94  HIS A CE1  3  
ATOM 4844  N NE2  . HIS A 1 94  ? 11.986  4.652   -17.354 1.00 0.00 ? 94  HIS A NE2  3  
ATOM 4845  H H    . HIS A 1 94  ? 9.466   2.136   -16.984 1.00 0.00 ? 94  HIS A H    3  
ATOM 4846  H HA   . HIS A 1 94  ? 11.104  0.105   -18.079 1.00 0.00 ? 94  HIS A HA   3  
ATOM 4847  H HB2  . HIS A 1 94  ? 11.352  1.227   -15.290 1.00 0.00 ? 94  HIS A HB2  3  
ATOM 4848  H HB3  . HIS A 1 94  ? 12.630  0.587   -16.317 1.00 0.00 ? 94  HIS A HB3  3  
ATOM 4849  H HD1  . HIS A 1 94  ? 13.878  2.241   -17.701 1.00 0.00 ? 94  HIS A HD1  3  
ATOM 4850  H HD2  . HIS A 1 94  ? 10.295  3.776   -16.264 1.00 0.00 ? 94  HIS A HD2  3  
ATOM 4851  H HE1  . HIS A 1 94  ? 13.888  4.676   -18.332 1.00 0.00 ? 94  HIS A HE1  3  
ATOM 4852  H HE2  . HIS A 1 94  ? 11.750  5.602   -17.378 1.00 0.00 ? 94  HIS A HE2  3  
ATOM 4853  N N    . GLY A 1 95  ? 9.549   -0.667  -15.262 1.00 0.00 ? 95  GLY A N    3  
ATOM 4854  C CA   . GLY A 1 95  ? 9.076   -1.793  -14.478 1.00 0.00 ? 95  GLY A CA   3  
ATOM 4855  C C    . GLY A 1 95  ? 8.837   -1.430  -13.026 1.00 0.00 ? 95  GLY A C    3  
ATOM 4856  O O    . GLY A 1 95  ? 9.268   -0.380  -12.548 1.00 0.00 ? 95  GLY A O    3  
ATOM 4857  H H    . GLY A 1 95  ? 9.382   0.248   -14.952 1.00 0.00 ? 95  GLY A H    3  
ATOM 4858  H HA2  . GLY A 1 95  ? 8.151   -2.151  -14.905 1.00 0.00 ? 95  GLY A HA2  3  
ATOM 4859  H HA3  . GLY A 1 95  ? 9.811   -2.583  -14.523 1.00 0.00 ? 95  GLY A HA3  3  
ATOM 4860  N N    . PRO A 1 96  ? 8.134   -2.311  -12.299 1.00 0.00 ? 96  PRO A N    3  
ATOM 4861  C CA   . PRO A 1 96  ? 7.822   -2.098  -10.882 1.00 0.00 ? 96  PRO A CA   3  
ATOM 4862  C C    . PRO A 1 96  ? 9.058   -2.204  -9.995  1.00 0.00 ? 96  PRO A C    3  
ATOM 4863  O O    . PRO A 1 96  ? 9.666   -3.267  -9.885  1.00 0.00 ? 96  PRO A O    3  
ATOM 4864  C CB   . PRO A 1 96  ? 6.837   -3.225  -10.563 1.00 0.00 ? 96  PRO A CB   3  
ATOM 4865  C CG   . PRO A 1 96  ? 7.148   -4.293  -11.554 1.00 0.00 ? 96  PRO A CG   3  
ATOM 4866  C CD   . PRO A 1 96  ? 7.589   -3.582  -12.804 1.00 0.00 ? 96  PRO A CD   3  
ATOM 4867  H HA   . PRO A 1 96  ? 7.344   -1.143  -10.720 1.00 0.00 ? 96  PRO A HA   3  
ATOM 4868  H HB2  . PRO A 1 96  ? 6.993   -3.568  -9.550  1.00 0.00 ? 96  PRO A HB2  3  
ATOM 4869  H HB3  . PRO A 1 96  ? 5.825   -2.866  -10.676 1.00 0.00 ? 96  PRO A HB3  3  
ATOM 4870  H HG2  . PRO A 1 96  ? 7.942   -4.921  -11.180 1.00 0.00 ? 96  PRO A HG2  3  
ATOM 4871  H HG3  . PRO A 1 96  ? 6.264   -4.881  -11.750 1.00 0.00 ? 96  PRO A HG3  3  
ATOM 4872  H HD2  . PRO A 1 96  ? 8.351   -4.153  -13.314 1.00 0.00 ? 96  PRO A HD2  3  
ATOM 4873  H HD3  . PRO A 1 96  ? 6.746   -3.408  -13.456 1.00 0.00 ? 96  PRO A HD3  3  
ATOM 4874  N N    . GLY A 1 97  ? 9.423   -1.093  -9.362  1.00 0.00 ? 97  GLY A N    3  
ATOM 4875  C CA   . GLY A 1 97  ? 10.584  -1.082  -8.492  1.00 0.00 ? 97  GLY A CA   3  
ATOM 4876  C C    . GLY A 1 97  ? 10.324  -1.776  -7.169  1.00 0.00 ? 97  GLY A C    3  
ATOM 4877  O O    . GLY A 1 97  ? 9.658   -2.810  -7.123  1.00 0.00 ? 97  GLY A O    3  
ATOM 4878  H H    . GLY A 1 97  ? 8.900   -0.273  -9.488  1.00 0.00 ? 97  GLY A H    3  
ATOM 4879  H HA2  . GLY A 1 97  ? 11.401  -1.581  -8.993  1.00 0.00 ? 97  GLY A HA2  3  
ATOM 4880  H HA3  . GLY A 1 97  ? 10.866  -0.058  -8.299  1.00 0.00 ? 97  GLY A HA3  3  
ATOM 4881  N N    . VAL A 1 98  ? 10.851  -1.206  -6.090  1.00 0.00 ? 98  VAL A N    3  
ATOM 4882  C CA   . VAL A 1 98  ? 10.672  -1.775  -4.760  1.00 0.00 ? 98  VAL A CA   3  
ATOM 4883  C C    . VAL A 1 98  ? 9.229   -1.635  -4.291  1.00 0.00 ? 98  VAL A C    3  
ATOM 4884  O O    . VAL A 1 98  ? 8.373   -1.140  -5.024  1.00 0.00 ? 98  VAL A O    3  
ATOM 4885  C CB   . VAL A 1 98  ? 11.602  -1.104  -3.732  1.00 0.00 ? 98  VAL A CB   3  
ATOM 4886  C CG1  . VAL A 1 98  ? 13.052  -1.191  -4.186  1.00 0.00 ? 98  VAL A CG1  3  
ATOM 4887  C CG2  . VAL A 1 98  ? 11.191  0.344   -3.509  1.00 0.00 ? 98  VAL A CG2  3  
ATOM 4888  H H    . VAL A 1 98  ? 11.372  -0.382  -6.191  1.00 0.00 ? 98  VAL A H    3  
ATOM 4889  H HA   . VAL A 1 98  ? 10.924  -2.825  -4.810  1.00 0.00 ? 98  VAL A HA   3  
ATOM 4890  H HB   . VAL A 1 98  ? 11.510  -1.631  -2.795  1.00 0.00 ? 98  VAL A HB   3  
ATOM 4891  H HG11 . VAL A 1 98  ? 13.544  -1.998  -3.664  1.00 0.00 ? 98  VAL A HG11 3  
ATOM 4892  H HG12 . VAL A 1 98  ? 13.086  -1.375  -5.250  1.00 0.00 ? 98  VAL A HG12 3  
ATOM 4893  H HG13 . VAL A 1 98  ? 13.554  -0.261  -3.965  1.00 0.00 ? 98  VAL A HG13 3  
ATOM 4894  H HG21 . VAL A 1 98  ? 10.125  0.439   -3.645  1.00 0.00 ? 98  VAL A HG21 3  
ATOM 4895  H HG22 . VAL A 1 98  ? 11.454  0.642   -2.504  1.00 0.00 ? 98  VAL A HG22 3  
ATOM 4896  H HG23 . VAL A 1 98  ? 11.704  0.977   -4.217  1.00 0.00 ? 98  VAL A HG23 3  
ATOM 4897  N N    . SER A 1 99  ? 8.965   -2.073  -3.064  1.00 0.00 ? 99  SER A N    3  
ATOM 4898  C CA   . SER A 1 99  ? 7.624   -1.999  -2.498  1.00 0.00 ? 99  SER A CA   3  
ATOM 4899  C C    . SER A 1 99  ? 7.669   -1.489  -1.060  1.00 0.00 ? 99  SER A C    3  
ATOM 4900  O O    . SER A 1 99  ? 8.365   -2.047  -0.212  1.00 0.00 ? 99  SER A O    3  
ATOM 4901  C CB   . SER A 1 99  ? 6.952   -3.373  -2.543  1.00 0.00 ? 99  SER A CB   3  
ATOM 4902  O OG   . SER A 1 99  ? 5.726   -3.364  -1.832  1.00 0.00 ? 99  SER A OG   3  
ATOM 4903  H H    . SER A 1 99  ? 9.691   -2.458  -2.529  1.00 0.00 ? 99  SER A H    3  
ATOM 4904  H HA   . SER A 1 99  ? 7.049   -1.307  -3.095  1.00 0.00 ? 99  SER A HA   3  
ATOM 4905  H HB2  . SER A 1 99  ? 6.757   -3.641  -3.570  1.00 0.00 ? 99  SER A HB2  3  
ATOM 4906  H HB3  . SER A 1 99  ? 7.608   -4.106  -2.097  1.00 0.00 ? 99  SER A HB3  3  
ATOM 4907  H HG   . SER A 1 99  ? 5.377   -2.470  -1.806  1.00 0.00 ? 99  SER A HG   3  
ATOM 4908  N N    . THR A 1 100 ? 6.920   -0.424  -0.793  1.00 0.00 ? 100 THR A N    3  
ATOM 4909  C CA   . THR A 1 100 ? 6.874   0.164   0.540   1.00 0.00 ? 100 THR A CA   3  
ATOM 4910  C C    . THR A 1 100 ? 6.597   -0.897  1.598   1.00 0.00 ? 100 THR A C    3  
ATOM 4911  O O    . THR A 1 100 ? 6.026   -1.952  1.320   1.00 0.00 ? 100 THR A O    3  
ATOM 4912  C CB   . THR A 1 100 ? 5.796   1.260   0.634   1.00 0.00 ? 100 THR A CB   3  
ATOM 4913  O OG1  . THR A 1 100 ? 4.600   0.829   -0.025  1.00 0.00 ? 100 THR A OG1  3  
ATOM 4914  C CG2  . THR A 1 100 ? 6.287   2.557   0.007   1.00 0.00 ? 100 THR A CG2  3  
ATOM 4915  H H    . THR A 1 100 ? 6.387   -0.023  -1.512  1.00 0.00 ? 100 THR A H    3  
ATOM 4916  H HA   . THR A 1 100 ? 7.835   0.615   0.739   1.00 0.00 ? 100 THR A HA   3  
ATOM 4917  H HB   . THR A 1 100 ? 5.578   1.441   1.676   1.00 0.00 ? 100 THR A HB   3  
ATOM 4918  H HG1  . THR A 1 100 ? 4.229   0.078   0.444   1.00 0.00 ? 100 THR A HG1  3  
ATOM 4919  H HG21 . THR A 1 100 ? 5.620   2.846   -0.791  1.00 0.00 ? 100 THR A HG21 3  
ATOM 4920  H HG22 . THR A 1 100 ? 7.281   2.411   -0.389  1.00 0.00 ? 100 THR A HG22 3  
ATOM 4921  H HG23 . THR A 1 100 ? 6.308   3.333   0.757   1.00 0.00 ? 100 THR A HG23 3  
ATOM 4922  N N    . PRO A 1 101 ? 7.009   -0.614  2.843   1.00 0.00 ? 101 PRO A N    3  
ATOM 4923  C CA   . PRO A 1 101 ? 6.814   -1.532  3.969   1.00 0.00 ? 101 PRO A CA   3  
ATOM 4924  C C    . PRO A 1 101 ? 5.349   -1.648  4.376   1.00 0.00 ? 101 PRO A C    3  
ATOM 4925  O O    . PRO A 1 101 ? 4.662   -0.642  4.551   1.00 0.00 ? 101 PRO A O    3  
ATOM 4926  C CB   . PRO A 1 101 ? 7.632   -0.892  5.094   1.00 0.00 ? 101 PRO A CB   3  
ATOM 4927  C CG   . PRO A 1 101 ? 7.682   0.556   4.749   1.00 0.00 ? 101 PRO A CG   3  
ATOM 4928  C CD   . PRO A 1 101 ? 7.696   0.624   3.247   1.00 0.00 ? 101 PRO A CD   3  
ATOM 4929  H HA   . PRO A 1 101 ? 7.205   -2.515  3.752   1.00 0.00 ? 101 PRO A HA   3  
ATOM 4930  H HB2  . PRO A 1 101 ? 7.137   -1.057  6.041   1.00 0.00 ? 101 PRO A HB2  3  
ATOM 4931  H HB3  . PRO A 1 101 ? 8.620   -1.326  5.118   1.00 0.00 ? 101 PRO A HB3  3  
ATOM 4932  H HG2  . PRO A 1 101 ? 6.808   1.057   5.138   1.00 0.00 ? 101 PRO A HG2  3  
ATOM 4933  H HG3  . PRO A 1 101 ? 8.581   0.999   5.152   1.00 0.00 ? 101 PRO A HG3  3  
ATOM 4934  H HD2  . PRO A 1 101 ? 7.157   1.494   2.903   1.00 0.00 ? 101 PRO A HD2  3  
ATOM 4935  H HD3  . PRO A 1 101 ? 8.711   0.638   2.879   1.00 0.00 ? 101 PRO A HD3  3  
ATOM 4936  N N    . ASP A 1 102 ? 4.877   -2.881  4.524   1.00 0.00 ? 102 ASP A N    3  
ATOM 4937  C CA   . ASP A 1 102 ? 3.493   -3.129  4.912   1.00 0.00 ? 102 ASP A CA   3  
ATOM 4938  C C    . ASP A 1 102 ? 3.033   -2.119  5.959   1.00 0.00 ? 102 ASP A C    3  
ATOM 4939  O O    . ASP A 1 102 ? 3.714   -1.892  6.959   1.00 0.00 ? 102 ASP A O    3  
ATOM 4940  C CB   . ASP A 1 102 ? 3.340   -4.551  5.455   1.00 0.00 ? 102 ASP A CB   3  
ATOM 4941  C CG   . ASP A 1 102 ? 4.148   -5.562  4.666   1.00 0.00 ? 102 ASP A CG   3  
ATOM 4942  O OD1  . ASP A 1 102 ? 3.958   -5.641  3.434   1.00 0.00 ? 102 ASP A OD1  3  
ATOM 4943  O OD2  . ASP A 1 102 ? 4.969   -6.276  5.280   1.00 0.00 ? 102 ASP A OD2  3  
ATOM 4944  H H    . ASP A 1 102 ? 5.474   -3.643  4.370   1.00 0.00 ? 102 ASP A H    3  
ATOM 4945  H HA   . ASP A 1 102 ? 2.878   -3.022  4.032   1.00 0.00 ? 102 ASP A HA   3  
ATOM 4946  H HB2  . ASP A 1 102 ? 3.674   -4.575  6.482   1.00 0.00 ? 102 ASP A HB2  3  
ATOM 4947  H HB3  . ASP A 1 102 ? 2.299   -4.835  5.412   1.00 0.00 ? 102 ASP A HB3  3  
ATOM 4948  N N    . VAL A 1 103 ? 1.873   -1.514  5.720   1.00 0.00 ? 103 VAL A N    3  
ATOM 4949  C CA   . VAL A 1 103 ? 1.322   -0.529  6.642   1.00 0.00 ? 103 VAL A CA   3  
ATOM 4950  C C    . VAL A 1 103 ? 0.002   -1.008  7.234   1.00 0.00 ? 103 VAL A C    3  
ATOM 4951  O O    . VAL A 1 103 ? -1.072  -0.679  6.732   1.00 0.00 ? 103 VAL A O    3  
ATOM 4952  C CB   . VAL A 1 103 ? 1.097   0.827   5.945   1.00 0.00 ? 103 VAL A CB   3  
ATOM 4953  C CG1  . VAL A 1 103 ? 0.438   1.814   6.897   1.00 0.00 ? 103 VAL A CG1  3  
ATOM 4954  C CG2  . VAL A 1 103 ? 2.412   1.379   5.417   1.00 0.00 ? 103 VAL A CG2  3  
ATOM 4955  H H    . VAL A 1 103 ? 1.377   -1.738  4.906   1.00 0.00 ? 103 VAL A H    3  
ATOM 4956  H HA   . VAL A 1 103 ? 2.033   -0.384  7.442   1.00 0.00 ? 103 VAL A HA   3  
ATOM 4957  H HB   . VAL A 1 103 ? 0.433   0.672   5.107   1.00 0.00 ? 103 VAL A HB   3  
ATOM 4958  H HG11 . VAL A 1 103 ? 0.956   2.761   6.848   1.00 0.00 ? 103 VAL A HG11 3  
ATOM 4959  H HG12 . VAL A 1 103 ? -0.595  1.952   6.615   1.00 0.00 ? 103 VAL A HG12 3  
ATOM 4960  H HG13 . VAL A 1 103 ? 0.489   1.429   7.905   1.00 0.00 ? 103 VAL A HG13 3  
ATOM 4961  H HG21 . VAL A 1 103 ? 3.123   1.448   6.227   1.00 0.00 ? 103 VAL A HG21 3  
ATOM 4962  H HG22 . VAL A 1 103 ? 2.799   0.720   4.653   1.00 0.00 ? 103 VAL A HG22 3  
ATOM 4963  H HG23 . VAL A 1 103 ? 2.248   2.360   4.996   1.00 0.00 ? 103 VAL A HG23 3  
ATOM 4964  N N    . ALA A 1 104 ? 0.090   -1.789  8.307   1.00 0.00 ? 104 ALA A N    3  
ATOM 4965  C CA   . ALA A 1 104 ? -1.098  -2.312  8.970   1.00 0.00 ? 104 ALA A CA   3  
ATOM 4966  C C    . ALA A 1 104 ? -1.783  -1.233  9.802   1.00 0.00 ? 104 ALA A C    3  
ATOM 4967  O O    . ALA A 1 104 ? -1.133  -0.518  10.565  1.00 0.00 ? 104 ALA A O    3  
ATOM 4968  C CB   . ALA A 1 104 ? -0.733  -3.503  9.844   1.00 0.00 ? 104 ALA A CB   3  
ATOM 4969  H H    . ALA A 1 104 ? 0.975   -2.016  8.661   1.00 0.00 ? 104 ALA A H    3  
ATOM 4970  H HA   . ALA A 1 104 ? -1.783  -2.654  8.207   1.00 0.00 ? 104 ALA A HA   3  
ATOM 4971  H HB1  . ALA A 1 104 ? -1.340  -3.492  10.738  1.00 0.00 ? 104 ALA A HB1  3  
ATOM 4972  H HB2  . ALA A 1 104 ? -0.910  -4.417  9.299   1.00 0.00 ? 104 ALA A HB2  3  
ATOM 4973  H HB3  . ALA A 1 104 ? 0.310   -3.442  10.117  1.00 0.00 ? 104 ALA A HB3  3  
ATOM 4974  N N    . VAL A 1 105 ? -3.098  -1.120  9.649   1.00 0.00 ? 105 VAL A N    3  
ATOM 4975  C CA   . VAL A 1 105 ? -3.871  -0.128  10.387  1.00 0.00 ? 105 VAL A CA   3  
ATOM 4976  C C    . VAL A 1 105 ? -5.223  -0.691  10.813  1.00 0.00 ? 105 VAL A C    3  
ATOM 4977  O O    . VAL A 1 105 ? -5.884  -1.392  10.047  1.00 0.00 ? 105 VAL A O    3  
ATOM 4978  C CB   . VAL A 1 105 ? -4.098  1.144   9.548   1.00 0.00 ? 105 VAL A CB   3  
ATOM 4979  C CG1  . VAL A 1 105 ? -5.276  0.958   8.604   1.00 0.00 ? 105 VAL A CG1  3  
ATOM 4980  C CG2  . VAL A 1 105 ? -4.314  2.347   10.454  1.00 0.00 ? 105 VAL A CG2  3  
ATOM 4981  H H    . VAL A 1 105 ? -3.560  -1.719  9.026   1.00 0.00 ? 105 VAL A H    3  
ATOM 4982  H HA   . VAL A 1 105 ? -3.311  0.143   11.270  1.00 0.00 ? 105 VAL A HA   3  
ATOM 4983  H HB   . VAL A 1 105 ? -3.213  1.321   8.955   1.00 0.00 ? 105 VAL A HB   3  
ATOM 4984  H HG11 . VAL A 1 105 ? -6.169  0.761   9.178   1.00 0.00 ? 105 VAL A HG11 3  
ATOM 4985  H HG12 . VAL A 1 105 ? -5.412  1.855   8.018   1.00 0.00 ? 105 VAL A HG12 3  
ATOM 4986  H HG13 . VAL A 1 105 ? -5.081  0.124   7.946   1.00 0.00 ? 105 VAL A HG13 3  
ATOM 4987  H HG21 . VAL A 1 105 ? -4.671  3.179   9.866   1.00 0.00 ? 105 VAL A HG21 3  
ATOM 4988  H HG22 . VAL A 1 105 ? -5.046  2.101   11.211  1.00 0.00 ? 105 VAL A HG22 3  
ATOM 4989  H HG23 . VAL A 1 105 ? -3.382  2.613   10.929  1.00 0.00 ? 105 VAL A HG23 3  
ATOM 4990  N N    . ARG A 1 106 ? -5.628  -0.378  12.039  1.00 0.00 ? 106 ARG A N    3  
ATOM 4991  C CA   . ARG A 1 106 ? -6.901  -0.852  12.567  1.00 0.00 ? 106 ARG A CA   3  
ATOM 4992  C C    . ARG A 1 106 ? -8.009  0.167   12.315  1.00 0.00 ? 106 ARG A C    3  
ATOM 4993  O O    . ARG A 1 106 ? -7.844  1.358   12.581  1.00 0.00 ? 106 ARG A O    3  
ATOM 4994  C CB   . ARG A 1 106 ? -6.783  -1.132  14.067  1.00 0.00 ? 106 ARG A CB   3  
ATOM 4995  C CG   . ARG A 1 106 ? -7.882  -2.032  14.607  1.00 0.00 ? 106 ARG A CG   3  
ATOM 4996  C CD   . ARG A 1 106 ? -7.721  -2.274  16.099  1.00 0.00 ? 106 ARG A CD   3  
ATOM 4997  N NE   . ARG A 1 106 ? -6.630  -3.201  16.389  1.00 0.00 ? 106 ARG A NE   3  
ATOM 4998  C CZ   . ARG A 1 106 ? -6.095  -3.354  17.595  1.00 0.00 ? 106 ARG A CZ   3  
ATOM 4999  N NH1  . ARG A 1 106 ? -6.549  -2.645  18.619  1.00 0.00 ? 106 ARG A NH1  3  
ATOM 5000  N NH2  . ARG A 1 106 ? -5.105  -4.218  17.779  1.00 0.00 ? 106 ARG A NH2  3  
ATOM 5001  H H    . ARG A 1 106 ? -5.057  0.185   12.603  1.00 0.00 ? 106 ARG A H    3  
ATOM 5002  H HA   . ARG A 1 106 ? -7.151  -1.771  12.057  1.00 0.00 ? 106 ARG A HA   3  
ATOM 5003  H HB2  . ARG A 1 106 ? -5.832  -1.608  14.259  1.00 0.00 ? 106 ARG A HB2  3  
ATOM 5004  H HB3  . ARG A 1 106 ? -6.821  -0.194  14.600  1.00 0.00 ? 106 ARG A HB3  3  
ATOM 5005  H HG2  . ARG A 1 106 ? -8.839  -1.562  14.431  1.00 0.00 ? 106 ARG A HG2  3  
ATOM 5006  H HG3  . ARG A 1 106 ? -7.845  -2.980  14.091  1.00 0.00 ? 106 ARG A HG3  3  
ATOM 5007  H HD2  . ARG A 1 106 ? -7.517  -1.331  16.584  1.00 0.00 ? 106 ARG A HD2  3  
ATOM 5008  H HD3  . ARG A 1 106 ? -8.642  -2.685  16.485  1.00 0.00 ? 106 ARG A HD3  3  
ATOM 5009  H HE   . ARG A 1 106 ? -6.279  -3.735  15.646  1.00 0.00 ? 106 ARG A HE   3  
ATOM 5010  H HH11 . ARG A 1 106 ? -7.296  -1.994  18.484  1.00 0.00 ? 106 ARG A HH11 3  
ATOM 5011  H HH12 . ARG A 1 106 ? -6.146  -2.762  19.527  1.00 0.00 ? 106 ARG A HH12 3  
ATOM 5012  H HH21 . ARG A 1 106 ? -4.761  -4.754  17.009  1.00 0.00 ? 106 ARG A HH21 3  
ATOM 5013  H HH22 . ARG A 1 106 ? -4.704  -4.332  18.687  1.00 0.00 ? 106 ARG A HH22 3  
ATOM 5014  N N    . THR A 1 107 ? -9.138  -0.309  11.799  1.00 0.00 ? 107 THR A N    3  
ATOM 5015  C CA   . THR A 1 107 ? -10.271 0.560   11.509  1.00 0.00 ? 107 THR A CA   3  
ATOM 5016  C C    . THR A 1 107 ? -11.008 0.947   12.786  1.00 0.00 ? 107 THR A C    3  
ATOM 5017  O O    . THR A 1 107 ? -10.716 0.429   13.865  1.00 0.00 ? 107 THR A O    3  
ATOM 5018  C CB   . THR A 1 107 ? -11.263 -0.114  10.542  1.00 0.00 ? 107 THR A CB   3  
ATOM 5019  O OG1  . THR A 1 107 ? -11.492 -1.469  10.942  1.00 0.00 ? 107 THR A OG1  3  
ATOM 5020  C CG2  . THR A 1 107 ? -10.733 -0.083  9.116   1.00 0.00 ? 107 THR A CG2  3  
ATOM 5021  H H    . THR A 1 107 ? -9.208  -1.267  11.609  1.00 0.00 ? 107 THR A H    3  
ATOM 5022  H HA   . THR A 1 107 ? -9.893  1.456   11.038  1.00 0.00 ? 107 THR A HA   3  
ATOM 5023  H HB   . THR A 1 107 ? -12.198 0.427   10.575  1.00 0.00 ? 107 THR A HB   3  
ATOM 5024  H HG1  . THR A 1 107 ? -12.382 -1.552  11.295  1.00 0.00 ? 107 THR A HG1  3  
ATOM 5025  H HG21 . THR A 1 107 ? -11.401 -0.635  8.472   1.00 0.00 ? 107 THR A HG21 3  
ATOM 5026  H HG22 . THR A 1 107 ? -9.751  -0.531  9.087   1.00 0.00 ? 107 THR A HG22 3  
ATOM 5027  H HG23 . THR A 1 107 ? -10.672 0.940   8.778   1.00 0.00 ? 107 THR A HG23 3  
ATOM 5028  N N    . LEU A 1 108 ? -11.965 1.859   12.658  1.00 0.00 ? 108 LEU A N    3  
ATOM 5029  C CA   . LEU A 1 108 ? -12.746 2.316   13.803  1.00 0.00 ? 108 LEU A CA   3  
ATOM 5030  C C    . LEU A 1 108 ? -13.809 1.289   14.181  1.00 0.00 ? 108 LEU A C    3  
ATOM 5031  O O    . LEU A 1 108 ? -14.364 0.609   13.318  1.00 0.00 ? 108 LEU A O    3  
ATOM 5032  C CB   . LEU A 1 108 ? -13.406 3.660   13.492  1.00 0.00 ? 108 LEU A CB   3  
ATOM 5033  C CG   . LEU A 1 108 ? -12.531 4.687   12.774  1.00 0.00 ? 108 LEU A CG   3  
ATOM 5034  C CD1  . LEU A 1 108 ? -13.367 5.870   12.311  1.00 0.00 ? 108 LEU A CD1  3  
ATOM 5035  C CD2  . LEU A 1 108 ? -11.402 5.153   13.681  1.00 0.00 ? 108 LEU A CD2  3  
ATOM 5036  H H    . LEU A 1 108 ? -12.152 2.236   11.773  1.00 0.00 ? 108 LEU A H    3  
ATOM 5037  H HA   . LEU A 1 108 ? -12.070 2.440   14.636  1.00 0.00 ? 108 LEU A HA   3  
ATOM 5038  H HB2  . LEU A 1 108 ? -14.268 3.469   12.872  1.00 0.00 ? 108 LEU A HB2  3  
ATOM 5039  H HB3  . LEU A 1 108 ? -13.728 4.094   14.428  1.00 0.00 ? 108 LEU A HB3  3  
ATOM 5040  H HG   . LEU A 1 108 ? -12.091 4.228   11.899  1.00 0.00 ? 108 LEU A HG   3  
ATOM 5041  H HD11 . LEU A 1 108 ? -12.877 6.354   11.480  1.00 0.00 ? 108 LEU A HD11 3  
ATOM 5042  H HD12 . LEU A 1 108 ? -13.477 6.573   13.123  1.00 0.00 ? 108 LEU A HD12 3  
ATOM 5043  H HD13 . LEU A 1 108 ? -14.342 5.523   12.002  1.00 0.00 ? 108 LEU A HD13 3  
ATOM 5044  H HD21 . LEU A 1 108 ? -11.448 6.227   13.790  1.00 0.00 ? 108 LEU A HD21 3  
ATOM 5045  H HD22 . LEU A 1 108 ? -10.452 4.876   13.245  1.00 0.00 ? 108 LEU A HD22 3  
ATOM 5046  H HD23 . LEU A 1 108 ? -11.503 4.688   14.650  1.00 0.00 ? 108 LEU A HD23 3  
ATOM 5047  N N    . SER A 1 109 ? -14.089 1.184   15.476  1.00 0.00 ? 109 SER A N    3  
ATOM 5048  C CA   . SER A 1 109 ? -15.085 0.239   15.969  1.00 0.00 ? 109 SER A CA   3  
ATOM 5049  C C    . SER A 1 109 ? -16.454 0.903   16.083  1.00 0.00 ? 109 SER A C    3  
ATOM 5050  O O    . SER A 1 109 ? -16.599 1.947   16.720  1.00 0.00 ? 109 SER A O    3  
ATOM 5051  C CB   . SER A 1 109 ? -14.661 -0.318  17.329  1.00 0.00 ? 109 SER A CB   3  
ATOM 5052  O OG   . SER A 1 109 ? -15.771 -0.850  18.030  1.00 0.00 ? 109 SER A OG   3  
ATOM 5053  H H    . SER A 1 109 ? -13.612 1.754   16.116  1.00 0.00 ? 109 SER A H    3  
ATOM 5054  H HA   . SER A 1 109 ? -15.150 -0.573  15.261  1.00 0.00 ? 109 SER A HA   3  
ATOM 5055  H HB2  . SER A 1 109 ? -13.933 -1.101  17.183  1.00 0.00 ? 109 SER A HB2  3  
ATOM 5056  H HB3  . SER A 1 109 ? -14.224 0.475   17.919  1.00 0.00 ? 109 SER A HB3  3  
ATOM 5057  H HG   . SER A 1 109 ? -16.428 -1.159  17.403  1.00 0.00 ? 109 SER A HG   3  
ATOM 5058  N N    . ASP A 1 110 ? -17.455 0.290   15.461  1.00 0.00 ? 110 ASP A N    3  
ATOM 5059  C CA   . ASP A 1 110 ? -18.813 0.820   15.492  1.00 0.00 ? 110 ASP A CA   3  
ATOM 5060  C C    . ASP A 1 110 ? -19.518 0.431   16.788  1.00 0.00 ? 110 ASP A C    3  
ATOM 5061  O O    . ASP A 1 110 ? -19.659 -0.751  17.099  1.00 0.00 ? 110 ASP A O    3  
ATOM 5062  C CB   . ASP A 1 110 ? -19.610 0.310   14.291  1.00 0.00 ? 110 ASP A CB   3  
ATOM 5063  C CG   . ASP A 1 110 ? -21.107 0.436   14.493  1.00 0.00 ? 110 ASP A CG   3  
ATOM 5064  O OD1  . ASP A 1 110 ? -21.577 1.561   14.762  1.00 0.00 ? 110 ASP A OD1  3  
ATOM 5065  O OD2  . ASP A 1 110 ? -21.809 -0.591  14.382  1.00 0.00 ? 110 ASP A OD2  3  
ATOM 5066  H H    . ASP A 1 110 ? -17.276 -0.539  14.969  1.00 0.00 ? 110 ASP A H    3  
ATOM 5067  H HA   . ASP A 1 110 ? -18.751 1.896   15.440  1.00 0.00 ? 110 ASP A HA   3  
ATOM 5068  H HB2  . ASP A 1 110 ? -19.335 0.881   13.416  1.00 0.00 ? 110 ASP A HB2  3  
ATOM 5069  H HB3  . ASP A 1 110 ? -19.373 -0.731  14.125  1.00 0.00 ? 110 ASP A HB3  3  
ATOM 5070  N N    . SER A 1 111 ? -19.958 1.435   17.540  1.00 0.00 ? 111 SER A N    3  
ATOM 5071  C CA   . SER A 1 111 ? -20.644 1.199   18.805  1.00 0.00 ? 111 SER A CA   3  
ATOM 5072  C C    . SER A 1 111 ? -22.139 0.991   18.582  1.00 0.00 ? 111 SER A C    3  
ATOM 5073  O O    . SER A 1 111 ? -22.748 0.098   19.170  1.00 0.00 ? 111 SER A O    3  
ATOM 5074  C CB   . SER A 1 111 ? -20.417 2.373   19.760  1.00 0.00 ? 111 SER A CB   3  
ATOM 5075  O OG   . SER A 1 111 ? -20.886 3.585   19.197  1.00 0.00 ? 111 SER A OG   3  
ATOM 5076  H H    . SER A 1 111 ? -19.815 2.357   17.238  1.00 0.00 ? 111 SER A H    3  
ATOM 5077  H HA   . SER A 1 111 ? -20.229 0.303   19.245  1.00 0.00 ? 111 SER A HA   3  
ATOM 5078  H HB2  . SER A 1 111 ? -20.946 2.190   20.683  1.00 0.00 ? 111 SER A HB2  3  
ATOM 5079  H HB3  . SER A 1 111 ? -19.360 2.468   19.963  1.00 0.00 ? 111 SER A HB3  3  
ATOM 5080  H HG   . SER A 1 111 ? -21.662 3.883   19.677  1.00 0.00 ? 111 SER A HG   3  
ATOM 5081  N N    . GLY A 1 112 ? -22.724 1.824   17.727  1.00 0.00 ? 112 GLY A N    3  
ATOM 5082  C CA   . GLY A 1 112 ? -24.143 1.716   17.440  1.00 0.00 ? 112 GLY A CA   3  
ATOM 5083  C C    . GLY A 1 112 ? -24.859 3.047   17.550  1.00 0.00 ? 112 GLY A C    3  
ATOM 5084  O O    . GLY A 1 112 ? -25.005 3.780   16.571  1.00 0.00 ? 112 GLY A O    3  
ATOM 5085  H H    . GLY A 1 112 ? -22.189 2.516   17.286  1.00 0.00 ? 112 GLY A H    3  
ATOM 5086  H HA2  . GLY A 1 112 ? -24.268 1.333   16.438  1.00 0.00 ? 112 GLY A HA2  3  
ATOM 5087  H HA3  . GLY A 1 112 ? -24.588 1.023   18.138  1.00 0.00 ? 112 GLY A HA3  3  
ATOM 5088  N N    . PRO A 1 113 ? -25.322 3.376   18.765  1.00 0.00 ? 113 PRO A N    3  
ATOM 5089  C CA   . PRO A 1 113 ? -26.036 4.629   19.027  1.00 0.00 ? 113 PRO A CA   3  
ATOM 5090  C C    . PRO A 1 113 ? -25.122 5.847   18.938  1.00 0.00 ? 113 PRO A C    3  
ATOM 5091  O O    . PRO A 1 113 ? -23.915 5.715   18.734  1.00 0.00 ? 113 PRO A O    3  
ATOM 5092  C CB   . PRO A 1 113 ? -26.551 4.451   20.457  1.00 0.00 ? 113 PRO A CB   3  
ATOM 5093  C CG   . PRO A 1 113 ? -25.612 3.477   21.080  1.00 0.00 ? 113 PRO A CG   3  
ATOM 5094  C CD   . PRO A 1 113 ? -25.184 2.550   19.976  1.00 0.00 ? 113 PRO A CD   3  
ATOM 5095  H HA   . PRO A 1 113 ? -26.872 4.758   18.355  1.00 0.00 ? 113 PRO A HA   3  
ATOM 5096  H HB2  . PRO A 1 113 ? -26.533 5.403   20.970  1.00 0.00 ? 113 PRO A HB2  3  
ATOM 5097  H HB3  . PRO A 1 113 ? -27.560 4.067   20.435  1.00 0.00 ? 113 PRO A HB3  3  
ATOM 5098  H HG2  . PRO A 1 113 ? -24.757 3.999   21.484  1.00 0.00 ? 113 PRO A HG2  3  
ATOM 5099  H HG3  . PRO A 1 113 ? -26.118 2.925   21.858  1.00 0.00 ? 113 PRO A HG3  3  
ATOM 5100  H HD2  . PRO A 1 113 ? -24.159 2.242   20.118  1.00 0.00 ? 113 PRO A HD2  3  
ATOM 5101  H HD3  . PRO A 1 113 ? -25.836 1.690   19.932  1.00 0.00 ? 113 PRO A HD3  3  
ATOM 5102  N N    . SER A 1 114 ? -25.705 7.031   19.094  1.00 0.00 ? 114 SER A N    3  
ATOM 5103  C CA   . SER A 1 114 ? -24.943 8.273   19.028  1.00 0.00 ? 114 SER A CA   3  
ATOM 5104  C C    . SER A 1 114 ? -25.671 9.397   19.759  1.00 0.00 ? 114 SER A C    3  
ATOM 5105  O O    . SER A 1 114 ? -26.755 9.815   19.355  1.00 0.00 ? 114 SER A O    3  
ATOM 5106  C CB   . SER A 1 114 ? -24.701 8.670   17.570  1.00 0.00 ? 114 SER A CB   3  
ATOM 5107  O OG   . SER A 1 114 ? -23.517 9.438   17.441  1.00 0.00 ? 114 SER A OG   3  
ATOM 5108  H H    . SER A 1 114 ? -26.671 7.071   19.254  1.00 0.00 ? 114 SER A H    3  
ATOM 5109  H HA   . SER A 1 114 ? -23.991 8.103   19.508  1.00 0.00 ? 114 SER A HA   3  
ATOM 5110  H HB2  . SER A 1 114 ? -24.606 7.780   16.968  1.00 0.00 ? 114 SER A HB2  3  
ATOM 5111  H HB3  . SER A 1 114 ? -25.537 9.257   17.217  1.00 0.00 ? 114 SER A HB3  3  
ATOM 5112  H HG   . SER A 1 114 ? -23.343 9.900   18.264  1.00 0.00 ? 114 SER A HG   3  
ATOM 5113  N N    . SER A 1 115 ? -25.065 9.881   20.839  1.00 0.00 ? 115 SER A N    3  
ATOM 5114  C CA   . SER A 1 115 ? -25.656 10.953  21.630  1.00 0.00 ? 115 SER A CA   3  
ATOM 5115  C C    . SER A 1 115 ? -24.574 11.776  22.324  1.00 0.00 ? 115 SER A C    3  
ATOM 5116  O O    . SER A 1 115 ? -23.552 11.242  22.753  1.00 0.00 ? 115 SER A O    3  
ATOM 5117  C CB   . SER A 1 115 ? -26.620 10.378  22.669  1.00 0.00 ? 115 SER A CB   3  
ATOM 5118  O OG   . SER A 1 115 ? -27.887 10.106  22.094  1.00 0.00 ? 115 SER A OG   3  
ATOM 5119  H H    . SER A 1 115 ? -24.201 9.506   21.111  1.00 0.00 ? 115 SER A H    3  
ATOM 5120  H HA   . SER A 1 115 ? -26.205 11.597  20.959  1.00 0.00 ? 115 SER A HA   3  
ATOM 5121  H HB2  . SER A 1 115 ? -26.213 9.459   23.064  1.00 0.00 ? 115 SER A HB2  3  
ATOM 5122  H HB3  . SER A 1 115 ? -26.747 11.090  23.472  1.00 0.00 ? 115 SER A HB3  3  
ATOM 5123  H HG   . SER A 1 115 ? -28.160 9.216   22.327  1.00 0.00 ? 115 SER A HG   3  
ATOM 5124  N N    . GLY A 1 116 ? -24.808 13.080  22.431  1.00 0.00 ? 116 GLY A N    3  
ATOM 5125  C CA   . GLY A 1 116 ? -23.846 13.956  23.073  1.00 0.00 ? 116 GLY A CA   3  
ATOM 5126  C C    . GLY A 1 116 ? -24.139 14.159  24.547  1.00 0.00 ? 116 GLY A C    3  
ATOM 5127  O O    . GLY A 1 116 ? -23.623 15.088  25.167  1.00 0.00 ? 116 GLY A O    3  
ATOM 5128  H H    . GLY A 1 116 ? -25.641 13.451  22.070  1.00 0.00 ? 116 GLY A H    3  
ATOM 5129  H HA2  . GLY A 1 116 ? -22.860 13.528  22.969  1.00 0.00 ? 116 GLY A HA2  3  
ATOM 5130  H HA3  . GLY A 1 116 ? -23.865 14.917  22.579  1.00 0.00 ? 116 GLY A HA3  3  
ATOM 5131  N N    . GLY A 1 1   ? -14.516 -17.821 -25.799 1.00 0.00 ? 1   GLY A N    4  
ATOM 5132  C CA   . GLY A 1 1   ? -13.823 -18.413 -24.670 1.00 0.00 ? 1   GLY A CA   4  
ATOM 5133  C C    . GLY A 1 1   ? -12.829 -19.477 -25.092 1.00 0.00 ? 1   GLY A C    4  
ATOM 5134  O O    . GLY A 1 1   ? -13.030 -20.160 -26.096 1.00 0.00 ? 1   GLY A O    4  
ATOM 5135  H H1   . GLY A 1 1   ? -14.230 -18.032 -26.712 1.00 0.00 ? 1   GLY A H1   4  
ATOM 5136  H HA2  . GLY A 1 1   ? -13.297 -17.635 -24.136 1.00 0.00 ? 1   GLY A HA2  4  
ATOM 5137  H HA3  . GLY A 1 1   ? -14.551 -18.860 -24.009 1.00 0.00 ? 1   GLY A HA3  4  
ATOM 5138  N N    . SER A 1 2   ? -11.752 -19.616 -24.326 1.00 0.00 ? 2   SER A N    4  
ATOM 5139  C CA   . SER A 1 2   ? -10.720 -20.601 -24.629 1.00 0.00 ? 2   SER A CA   4  
ATOM 5140  C C    . SER A 1 2   ? -9.971  -21.011 -23.365 1.00 0.00 ? 2   SER A C    4  
ATOM 5141  O O    . SER A 1 2   ? -10.206 -20.464 -22.287 1.00 0.00 ? 2   SER A O    4  
ATOM 5142  C CB   . SER A 1 2   ? -9.737  -20.039 -25.658 1.00 0.00 ? 2   SER A CB   4  
ATOM 5143  O OG   . SER A 1 2   ? -8.903  -19.051 -25.080 1.00 0.00 ? 2   SER A OG   4  
ATOM 5144  H H    . SER A 1 2   ? -11.649 -19.042 -23.538 1.00 0.00 ? 2   SER A H    4  
ATOM 5145  H HA   . SER A 1 2   ? -11.205 -21.472 -25.045 1.00 0.00 ? 2   SER A HA   4  
ATOM 5146  H HB2  . SER A 1 2   ? -9.119  -20.839 -26.035 1.00 0.00 ? 2   SER A HB2  4  
ATOM 5147  H HB3  . SER A 1 2   ? -10.289 -19.595 -26.474 1.00 0.00 ? 2   SER A HB3  4  
ATOM 5148  H HG   . SER A 1 2   ? -8.350  -19.453 -24.405 1.00 0.00 ? 2   SER A HG   4  
ATOM 5149  N N    . SER A 1 3   ? -9.070  -21.977 -23.505 1.00 0.00 ? 3   SER A N    4  
ATOM 5150  C CA   . SER A 1 3   ? -8.288  -22.464 -22.375 1.00 0.00 ? 3   SER A CA   4  
ATOM 5151  C C    . SER A 1 3   ? -6.970  -23.069 -22.846 1.00 0.00 ? 3   SER A C    4  
ATOM 5152  O O    . SER A 1 3   ? -6.759  -23.274 -24.041 1.00 0.00 ? 3   SER A O    4  
ATOM 5153  C CB   . SER A 1 3   ? -9.087  -23.503 -21.586 1.00 0.00 ? 3   SER A CB   4  
ATOM 5154  O OG   . SER A 1 3   ? -8.440  -23.825 -20.366 1.00 0.00 ? 3   SER A OG   4  
ATOM 5155  H H    . SER A 1 3   ? -8.928  -22.373 -24.391 1.00 0.00 ? 3   SER A H    4  
ATOM 5156  H HA   . SER A 1 3   ? -8.075  -21.623 -21.732 1.00 0.00 ? 3   SER A HA   4  
ATOM 5157  H HB2  . SER A 1 3   ? -10.067 -23.110 -21.366 1.00 0.00 ? 3   SER A HB2  4  
ATOM 5158  H HB3  . SER A 1 3   ? -9.184  -24.403 -22.177 1.00 0.00 ? 3   SER A HB3  4  
ATOM 5159  H HG   . SER A 1 3   ? -8.550  -23.101 -19.745 1.00 0.00 ? 3   SER A HG   4  
ATOM 5160  N N    . GLY A 1 4   ? -6.083  -23.354 -21.896 1.00 0.00 ? 4   GLY A N    4  
ATOM 5161  C CA   . GLY A 1 4   ? -4.796  -23.933 -22.233 1.00 0.00 ? 4   GLY A CA   4  
ATOM 5162  C C    . GLY A 1 4   ? -3.789  -23.803 -21.107 1.00 0.00 ? 4   GLY A C    4  
ATOM 5163  O O    . GLY A 1 4   ? -3.909  -22.920 -20.257 1.00 0.00 ? 4   GLY A O    4  
ATOM 5164  H H    . GLY A 1 4   ? -6.306  -23.170 -20.960 1.00 0.00 ? 4   GLY A H    4  
ATOM 5165  H HA2  . GLY A 1 4   ? -4.933  -24.980 -22.461 1.00 0.00 ? 4   GLY A HA2  4  
ATOM 5166  H HA3  . GLY A 1 4   ? -4.407  -23.433 -23.108 1.00 0.00 ? 4   GLY A HA3  4  
ATOM 5167  N N    . SER A 1 5   ? -2.795  -24.685 -21.099 1.00 0.00 ? 5   SER A N    4  
ATOM 5168  C CA   . SER A 1 5   ? -1.767  -24.668 -20.066 1.00 0.00 ? 5   SER A CA   4  
ATOM 5169  C C    . SER A 1 5   ? -0.447  -24.140 -20.621 1.00 0.00 ? 5   SER A C    4  
ATOM 5170  O O    . SER A 1 5   ? 0.031   -24.601 -21.657 1.00 0.00 ? 5   SER A O    4  
ATOM 5171  C CB   . SER A 1 5   ? -1.567  -26.072 -19.492 1.00 0.00 ? 5   SER A CB   4  
ATOM 5172  O OG   . SER A 1 5   ? -0.768  -26.036 -18.322 1.00 0.00 ? 5   SER A OG   4  
ATOM 5173  H H    . SER A 1 5   ? -2.754  -25.365 -21.804 1.00 0.00 ? 5   SER A H    4  
ATOM 5174  H HA   . SER A 1 5   ? -2.100  -24.011 -19.277 1.00 0.00 ? 5   SER A HA   4  
ATOM 5175  H HB2  . SER A 1 5   ? -2.527  -26.498 -19.245 1.00 0.00 ? 5   SER A HB2  4  
ATOM 5176  H HB3  . SER A 1 5   ? -1.077  -26.692 -20.229 1.00 0.00 ? 5   SER A HB3  4  
ATOM 5177  H HG   . SER A 1 5   ? -0.188  -26.801 -18.307 1.00 0.00 ? 5   SER A HG   4  
ATOM 5178  N N    . SER A 1 6   ? 0.136   -23.171 -19.923 1.00 0.00 ? 6   SER A N    4  
ATOM 5179  C CA   . SER A 1 6   ? 1.398   -22.577 -20.347 1.00 0.00 ? 6   SER A CA   4  
ATOM 5180  C C    . SER A 1 6   ? 2.276   -22.248 -19.143 1.00 0.00 ? 6   SER A C    4  
ATOM 5181  O O    . SER A 1 6   ? 1.803   -21.703 -18.146 1.00 0.00 ? 6   SER A O    4  
ATOM 5182  C CB   . SER A 1 6   ? 1.140   -21.310 -21.165 1.00 0.00 ? 6   SER A CB   4  
ATOM 5183  O OG   . SER A 1 6   ? 2.333   -20.565 -21.340 1.00 0.00 ? 6   SER A OG   4  
ATOM 5184  H H    . SER A 1 6   ? -0.295  -22.846 -19.104 1.00 0.00 ? 6   SER A H    4  
ATOM 5185  H HA   . SER A 1 6   ? 1.912   -23.297 -20.966 1.00 0.00 ? 6   SER A HA   4  
ATOM 5186  H HB2  . SER A 1 6   ? 0.756   -21.584 -22.136 1.00 0.00 ? 6   SER A HB2  4  
ATOM 5187  H HB3  . SER A 1 6   ? 0.417   -20.694 -20.651 1.00 0.00 ? 6   SER A HB3  4  
ATOM 5188  H HG   . SER A 1 6   ? 2.979   -21.099 -21.807 1.00 0.00 ? 6   SER A HG   4  
ATOM 5189  N N    . GLY A 1 7   ? 3.558   -22.585 -19.243 1.00 0.00 ? 7   GLY A N    4  
ATOM 5190  C CA   . GLY A 1 7   ? 4.482   -22.319 -18.156 1.00 0.00 ? 7   GLY A CA   4  
ATOM 5191  C C    . GLY A 1 7   ? 4.392   -20.891 -17.655 1.00 0.00 ? 7   GLY A C    4  
ATOM 5192  O O    . GLY A 1 7   ? 3.921   -20.005 -18.368 1.00 0.00 ? 7   GLY A O    4  
ATOM 5193  H H    . GLY A 1 7   ? 3.879   -23.018 -20.062 1.00 0.00 ? 7   GLY A H    4  
ATOM 5194  H HA2  . GLY A 1 7   ? 4.263   -22.990 -17.340 1.00 0.00 ? 7   GLY A HA2  4  
ATOM 5195  H HA3  . GLY A 1 7   ? 5.489   -22.504 -18.502 1.00 0.00 ? 7   GLY A HA3  4  
ATOM 5196  N N    . ARG A 1 8   ? 4.843   -20.667 -16.425 1.00 0.00 ? 8   ARG A N    4  
ATOM 5197  C CA   . ARG A 1 8   ? 4.809   -19.338 -15.829 1.00 0.00 ? 8   ARG A CA   4  
ATOM 5198  C C    . ARG A 1 8   ? 5.542   -18.328 -16.708 1.00 0.00 ? 8   ARG A C    4  
ATOM 5199  O O    . ARG A 1 8   ? 6.606   -18.622 -17.253 1.00 0.00 ? 8   ARG A O    4  
ATOM 5200  C CB   . ARG A 1 8   ? 5.435   -19.365 -14.433 1.00 0.00 ? 8   ARG A CB   4  
ATOM 5201  C CG   . ARG A 1 8   ? 6.874   -19.856 -14.421 1.00 0.00 ? 8   ARG A CG   4  
ATOM 5202  C CD   . ARG A 1 8   ? 7.523   -19.643 -13.062 1.00 0.00 ? 8   ARG A CD   4  
ATOM 5203  N NE   . ARG A 1 8   ? 7.121   -20.664 -12.098 1.00 0.00 ? 8   ARG A NE   4  
ATOM 5204  C CZ   . ARG A 1 8   ? 7.414   -20.608 -10.804 1.00 0.00 ? 8   ARG A CZ   4  
ATOM 5205  N NH1  . ARG A 1 8   ? 8.107   -19.586 -10.321 1.00 0.00 ? 8   ARG A NH1  4  
ATOM 5206  N NH2  . ARG A 1 8   ? 7.013   -21.576 -9.989  1.00 0.00 ? 8   ARG A NH2  4  
ATOM 5207  H H    . ARG A 1 8   ? 5.208   -21.415 -15.906 1.00 0.00 ? 8   ARG A H    4  
ATOM 5208  H HA   . ARG A 1 8   ? 3.775   -19.039 -15.744 1.00 0.00 ? 8   ARG A HA   4  
ATOM 5209  H HB2  . ARG A 1 8   ? 5.415   -18.366 -14.023 1.00 0.00 ? 8   ARG A HB2  4  
ATOM 5210  H HB3  . ARG A 1 8   ? 4.850   -20.017 -13.802 1.00 0.00 ? 8   ARG A HB3  4  
ATOM 5211  H HG2  . ARG A 1 8   ? 6.887   -20.910 -14.653 1.00 0.00 ? 8   ARG A HG2  4  
ATOM 5212  H HG3  . ARG A 1 8   ? 7.435   -19.314 -15.168 1.00 0.00 ? 8   ARG A HG3  4  
ATOM 5213  H HD2  . ARG A 1 8   ? 8.596   -19.677 -13.182 1.00 0.00 ? 8   ARG A HD2  4  
ATOM 5214  H HD3  . ARG A 1 8   ? 7.233   -18.673 -12.688 1.00 0.00 ? 8   ARG A HD3  4  
ATOM 5215  H HE   . ARG A 1 8   ? 6.608   -21.428 -12.434 1.00 0.00 ? 8   ARG A HE   4  
ATOM 5216  H HH11 . ARG A 1 8   ? 8.409   -18.855 -10.932 1.00 0.00 ? 8   ARG A HH11 4  
ATOM 5217  H HH12 . ARG A 1 8   ? 8.325   -19.545 -9.346  1.00 0.00 ? 8   ARG A HH12 4  
ATOM 5218  H HH21 . ARG A 1 8   ? 6.490   -22.347 -10.349 1.00 0.00 ? 8   ARG A HH21 4  
ATOM 5219  H HH22 . ARG A 1 8   ? 7.234   -21.532 -9.015  1.00 0.00 ? 8   ARG A HH22 4  
ATOM 5220  N N    . VAL A 1 9   ? 4.966   -17.138 -16.840 1.00 0.00 ? 9   VAL A N    4  
ATOM 5221  C CA   . VAL A 1 9   ? 5.564   -16.085 -17.652 1.00 0.00 ? 9   VAL A CA   4  
ATOM 5222  C C    . VAL A 1 9   ? 6.299   -15.072 -16.782 1.00 0.00 ? 9   VAL A C    4  
ATOM 5223  O O    . VAL A 1 9   ? 5.772   -14.609 -15.772 1.00 0.00 ? 9   VAL A O    4  
ATOM 5224  C CB   . VAL A 1 9   ? 4.501   -15.350 -18.490 1.00 0.00 ? 9   VAL A CB   4  
ATOM 5225  C CG1  . VAL A 1 9   ? 5.135   -14.215 -19.280 1.00 0.00 ? 9   VAL A CG1  4  
ATOM 5226  C CG2  . VAL A 1 9   ? 3.789   -16.323 -19.418 1.00 0.00 ? 9   VAL A CG2  4  
ATOM 5227  H H    . VAL A 1 9   ? 4.118   -16.964 -16.381 1.00 0.00 ? 9   VAL A H    4  
ATOM 5228  H HA   . VAL A 1 9   ? 6.271   -16.545 -18.328 1.00 0.00 ? 9   VAL A HA   4  
ATOM 5229  H HB   . VAL A 1 9   ? 3.770   -14.927 -17.817 1.00 0.00 ? 9   VAL A HB   4  
ATOM 5230  H HG11 . VAL A 1 9   ? 4.518   -13.332 -19.198 1.00 0.00 ? 9   VAL A HG11 4  
ATOM 5231  H HG12 . VAL A 1 9   ? 6.119   -14.007 -18.886 1.00 0.00 ? 9   VAL A HG12 4  
ATOM 5232  H HG13 . VAL A 1 9   ? 5.216   -14.501 -20.319 1.00 0.00 ? 9   VAL A HG13 4  
ATOM 5233  H HG21 . VAL A 1 9   ? 3.593   -15.840 -20.364 1.00 0.00 ? 9   VAL A HG21 4  
ATOM 5234  H HG22 . VAL A 1 9   ? 4.413   -17.190 -19.579 1.00 0.00 ? 9   VAL A HG22 4  
ATOM 5235  H HG23 . VAL A 1 9   ? 2.856   -16.630 -18.970 1.00 0.00 ? 9   VAL A HG23 4  
ATOM 5236  N N    . GLU A 1 10  ? 7.520   -14.732 -17.183 1.00 0.00 ? 10  GLU A N    4  
ATOM 5237  C CA   . GLU A 1 10  ? 8.328   -13.772 -16.439 1.00 0.00 ? 10  GLU A CA   4  
ATOM 5238  C C    . GLU A 1 10  ? 9.056   -12.823 -17.386 1.00 0.00 ? 10  GLU A C    4  
ATOM 5239  O O    . GLU A 1 10  ? 9.341   -13.169 -18.533 1.00 0.00 ? 10  GLU A O    4  
ATOM 5240  C CB   . GLU A 1 10  ? 9.341   -14.503 -15.554 1.00 0.00 ? 10  GLU A CB   4  
ATOM 5241  C CG   . GLU A 1 10  ? 10.200  -13.571 -14.716 1.00 0.00 ? 10  GLU A CG   4  
ATOM 5242  C CD   . GLU A 1 10  ? 10.765  -14.249 -13.483 1.00 0.00 ? 10  GLU A CD   4  
ATOM 5243  O OE1  . GLU A 1 10  ? 10.120  -15.192 -12.978 1.00 0.00 ? 10  GLU A OE1  4  
ATOM 5244  O OE2  . GLU A 1 10  ? 11.850  -13.837 -13.023 1.00 0.00 ? 10  GLU A OE2  4  
ATOM 5245  H H    . GLU A 1 10  ? 7.886   -15.135 -17.997 1.00 0.00 ? 10  GLU A H    4  
ATOM 5246  H HA   . GLU A 1 10  ? 7.665   -13.197 -15.811 1.00 0.00 ? 10  GLU A HA   4  
ATOM 5247  H HB2  . GLU A 1 10  ? 8.807   -15.164 -14.887 1.00 0.00 ? 10  GLU A HB2  4  
ATOM 5248  H HB3  . GLU A 1 10  ? 9.992   -15.091 -16.183 1.00 0.00 ? 10  GLU A HB3  4  
ATOM 5249  H HG2  . GLU A 1 10  ? 11.022  -13.218 -15.322 1.00 0.00 ? 10  GLU A HG2  4  
ATOM 5250  H HG3  . GLU A 1 10  ? 9.598   -12.731 -14.403 1.00 0.00 ? 10  GLU A HG3  4  
ATOM 5251  N N    . THR A 1 11  ? 9.354   -11.623 -16.899 1.00 0.00 ? 11  THR A N    4  
ATOM 5252  C CA   . THR A 1 11  ? 10.047  -10.622 -17.701 1.00 0.00 ? 11  THR A CA   4  
ATOM 5253  C C    . THR A 1 11  ? 11.253  -10.060 -16.957 1.00 0.00 ? 11  THR A C    4  
ATOM 5254  O O    . THR A 1 11  ? 11.109  -9.442  -15.902 1.00 0.00 ? 11  THR A O    4  
ATOM 5255  C CB   . THR A 1 11  ? 9.109   -9.463  -18.086 1.00 0.00 ? 11  THR A CB   4  
ATOM 5256  O OG1  . THR A 1 11  ? 7.998   -9.962  -18.840 1.00 0.00 ? 11  THR A OG1  4  
ATOM 5257  C CG2  . THR A 1 11  ? 9.851   -8.414  -18.899 1.00 0.00 ? 11  THR A CG2  4  
ATOM 5258  H H    . THR A 1 11  ? 9.101   -11.406 -15.977 1.00 0.00 ? 11  THR A H    4  
ATOM 5259  H HA   . THR A 1 11  ? 10.387  -11.100 -18.609 1.00 0.00 ? 11  THR A HA   4  
ATOM 5260  H HB   . THR A 1 11  ? 8.741   -9.002  -17.180 1.00 0.00 ? 11  THR A HB   4  
ATOM 5261  H HG1  . THR A 1 11  ? 8.316   -10.562 -19.519 1.00 0.00 ? 11  THR A HG1  4  
ATOM 5262  H HG21 . THR A 1 11  ? 10.373  -8.893  -19.714 1.00 0.00 ? 11  THR A HG21 4  
ATOM 5263  H HG22 . THR A 1 11  ? 10.562  -7.904  -18.266 1.00 0.00 ? 11  THR A HG22 4  
ATOM 5264  H HG23 . THR A 1 11  ? 9.144   -7.700  -19.295 1.00 0.00 ? 11  THR A HG23 4  
ATOM 5265  N N    . GLN A 1 12  ? 12.440  -10.278 -17.513 1.00 0.00 ? 12  GLN A N    4  
ATOM 5266  C CA   . GLN A 1 12  ? 13.671  -9.791  -16.901 1.00 0.00 ? 12  GLN A CA   4  
ATOM 5267  C C    . GLN A 1 12  ? 13.483  -8.384  -16.344 1.00 0.00 ? 12  GLN A C    4  
ATOM 5268  O O    . GLN A 1 12  ? 12.736  -7.570  -16.888 1.00 0.00 ? 12  GLN A O    4  
ATOM 5269  C CB   . GLN A 1 12  ? 14.811  -9.801  -17.921 1.00 0.00 ? 12  GLN A CB   4  
ATOM 5270  C CG   . GLN A 1 12  ? 14.640  -8.779  -19.034 1.00 0.00 ? 12  GLN A CG   4  
ATOM 5271  C CD   . GLN A 1 12  ? 15.890  -8.621  -19.877 1.00 0.00 ? 12  GLN A CD   4  
ATOM 5272  O OE1  . GLN A 1 12  ? 16.965  -8.313  -19.362 1.00 0.00 ? 12  GLN A OE1  4  
ATOM 5273  N NE2  . GLN A 1 12  ? 15.755  -8.831  -21.181 1.00 0.00 ? 12  GLN A NE2  4  
ATOM 5274  H H    . GLN A 1 12  ? 12.489  -10.777 -18.354 1.00 0.00 ? 12  GLN A H    4  
ATOM 5275  H HA   . GLN A 1 12  ? 13.921  -10.456 -16.088 1.00 0.00 ? 12  GLN A HA   4  
ATOM 5276  H HB2  . GLN A 1 12  ? 15.738  -9.592  -17.408 1.00 0.00 ? 12  GLN A HB2  4  
ATOM 5277  H HB3  . GLN A 1 12  ? 14.869  -10.782 -18.368 1.00 0.00 ? 12  GLN A HB3  4  
ATOM 5278  H HG2  . GLN A 1 12  ? 13.831  -9.096  -19.674 1.00 0.00 ? 12  GLN A HG2  4  
ATOM 5279  H HG3  . GLN A 1 12  ? 14.397  -7.824  -18.593 1.00 0.00 ? 12  GLN A HG3  4  
ATOM 5280  H HE21 . GLN A 1 12  ? 14.868  -9.073  -21.521 1.00 0.00 ? 12  GLN A HE21 4  
ATOM 5281  H HE22 . GLN A 1 12  ? 16.547  -8.735  -21.749 1.00 0.00 ? 12  GLN A HE22 4  
ATOM 5282  N N    . PRO A 1 13  ? 14.175  -8.089  -15.234 1.00 0.00 ? 13  PRO A N    4  
ATOM 5283  C CA   . PRO A 1 13  ? 14.100  -6.779  -14.579 1.00 0.00 ? 13  PRO A CA   4  
ATOM 5284  C C    . PRO A 1 13  ? 14.764  -5.681  -15.403 1.00 0.00 ? 13  PRO A C    4  
ATOM 5285  O O    . PRO A 1 13  ? 15.356  -5.949  -16.447 1.00 0.00 ? 13  PRO A O    4  
ATOM 5286  C CB   . PRO A 1 13  ? 14.858  -6.995  -13.267 1.00 0.00 ? 13  PRO A CB   4  
ATOM 5287  C CG   . PRO A 1 13  ? 15.793  -8.120  -13.550 1.00 0.00 ? 13  PRO A CG   4  
ATOM 5288  C CD   . PRO A 1 13  ? 15.084  -9.011  -14.532 1.00 0.00 ? 13  PRO A CD   4  
ATOM 5289  H HA   . PRO A 1 13  ? 13.079  -6.500  -14.366 1.00 0.00 ? 13  PRO A HA   4  
ATOM 5290  H HB2  . PRO A 1 13  ? 15.392  -6.093  -13.004 1.00 0.00 ? 13  PRO A HB2  4  
ATOM 5291  H HB3  . PRO A 1 13  ? 14.161  -7.249  -12.482 1.00 0.00 ? 13  PRO A HB3  4  
ATOM 5292  H HG2  . PRO A 1 13  ? 16.706  -7.739  -13.980 1.00 0.00 ? 13  PRO A HG2  4  
ATOM 5293  H HG3  . PRO A 1 13  ? 16.002  -8.661  -12.638 1.00 0.00 ? 13  PRO A HG3  4  
ATOM 5294  H HD2  . PRO A 1 13  ? 15.790  -9.453  -15.219 1.00 0.00 ? 13  PRO A HD2  4  
ATOM 5295  H HD3  . PRO A 1 13  ? 14.528  -9.778  -14.013 1.00 0.00 ? 13  PRO A HD3  4  
ATOM 5296  N N    . GLU A 1 14  ? 14.661  -4.445  -14.925 1.00 0.00 ? 14  GLU A N    4  
ATOM 5297  C CA   . GLU A 1 14  ? 15.252  -3.307  -15.618 1.00 0.00 ? 14  GLU A CA   4  
ATOM 5298  C C    . GLU A 1 14  ? 15.961  -2.379  -14.636 1.00 0.00 ? 14  GLU A C    4  
ATOM 5299  O O    . GLU A 1 14  ? 15.833  -2.528  -13.421 1.00 0.00 ? 14  GLU A O    4  
ATOM 5300  C CB   . GLU A 1 14  ? 14.176  -2.532  -16.383 1.00 0.00 ? 14  GLU A CB   4  
ATOM 5301  C CG   . GLU A 1 14  ? 13.437  -3.372  -17.411 1.00 0.00 ? 14  GLU A CG   4  
ATOM 5302  C CD   . GLU A 1 14  ? 14.373  -4.050  -18.393 1.00 0.00 ? 14  GLU A CD   4  
ATOM 5303  O OE1  . GLU A 1 14  ? 15.502  -3.549  -18.579 1.00 0.00 ? 14  GLU A OE1  4  
ATOM 5304  O OE2  . GLU A 1 14  ? 13.977  -5.082  -18.974 1.00 0.00 ? 14  GLU A OE2  4  
ATOM 5305  H H    . GLU A 1 14  ? 14.176  -4.295  -14.086 1.00 0.00 ? 14  GLU A H    4  
ATOM 5306  H HA   . GLU A 1 14  ? 15.977  -3.687  -16.322 1.00 0.00 ? 14  GLU A HA   4  
ATOM 5307  H HB2  . GLU A 1 14  ? 13.455  -2.148  -15.676 1.00 0.00 ? 14  GLU A HB2  4  
ATOM 5308  H HB3  . GLU A 1 14  ? 14.642  -1.703  -16.894 1.00 0.00 ? 14  GLU A HB3  4  
ATOM 5309  H HG2  . GLU A 1 14  ? 12.869  -4.132  -16.896 1.00 0.00 ? 14  GLU A HG2  4  
ATOM 5310  H HG3  . GLU A 1 14  ? 12.763  -2.732  -17.962 1.00 0.00 ? 14  GLU A HG3  4  
ATOM 5311  N N    . VAL A 1 15  ? 16.709  -1.420  -15.171 1.00 0.00 ? 15  VAL A N    4  
ATOM 5312  C CA   . VAL A 1 15  ? 17.438  -0.466  -14.343 1.00 0.00 ? 15  VAL A CA   4  
ATOM 5313  C C    . VAL A 1 15  ? 16.745  0.891   -14.328 1.00 0.00 ? 15  VAL A C    4  
ATOM 5314  O O    . VAL A 1 15  ? 15.762  1.104   -15.037 1.00 0.00 ? 15  VAL A O    4  
ATOM 5315  C CB   . VAL A 1 15  ? 18.886  -0.286  -14.837 1.00 0.00 ? 15  VAL A CB   4  
ATOM 5316  C CG1  . VAL A 1 15  ? 19.648  -1.599  -14.750 1.00 0.00 ? 15  VAL A CG1  4  
ATOM 5317  C CG2  . VAL A 1 15  ? 18.900  0.254   -16.259 1.00 0.00 ? 15  VAL A CG2  4  
ATOM 5318  H H    . VAL A 1 15  ? 16.772  -1.351  -16.147 1.00 0.00 ? 15  VAL A H    4  
ATOM 5319  H HA   . VAL A 1 15  ? 17.470  -0.855  -13.336 1.00 0.00 ? 15  VAL A HA   4  
ATOM 5320  H HB   . VAL A 1 15  ? 19.377  0.433   -14.197 1.00 0.00 ? 15  VAL A HB   4  
ATOM 5321  H HG11 . VAL A 1 15  ? 19.401  -2.098  -13.824 1.00 0.00 ? 15  VAL A HG11 4  
ATOM 5322  H HG12 . VAL A 1 15  ? 19.376  -2.230  -15.583 1.00 0.00 ? 15  VAL A HG12 4  
ATOM 5323  H HG13 . VAL A 1 15  ? 20.710  -1.402  -14.779 1.00 0.00 ? 15  VAL A HG13 4  
ATOM 5324  H HG21 . VAL A 1 15  ? 18.229  -0.330  -16.872 1.00 0.00 ? 15  VAL A HG21 4  
ATOM 5325  H HG22 . VAL A 1 15  ? 18.578  1.286   -16.257 1.00 0.00 ? 15  VAL A HG22 4  
ATOM 5326  H HG23 . VAL A 1 15  ? 19.901  0.191   -16.659 1.00 0.00 ? 15  VAL A HG23 4  
ATOM 5327  N N    . GLN A 1 16  ? 17.265  1.806   -13.516 1.00 0.00 ? 16  GLN A N    4  
ATOM 5328  C CA   . GLN A 1 16  ? 16.695  3.144   -13.408 1.00 0.00 ? 16  GLN A CA   4  
ATOM 5329  C C    . GLN A 1 16  ? 15.246  3.082   -12.936 1.00 0.00 ? 16  GLN A C    4  
ATOM 5330  O O    . GLN A 1 16  ? 14.400  3.852   -13.392 1.00 0.00 ? 16  GLN A O    4  
ATOM 5331  C CB   . GLN A 1 16  ? 16.775  3.865   -14.755 1.00 0.00 ? 16  GLN A CB   4  
ATOM 5332  C CG   . GLN A 1 16  ? 18.198  4.098   -15.237 1.00 0.00 ? 16  GLN A CG   4  
ATOM 5333  C CD   . GLN A 1 16  ? 18.265  5.033   -16.428 1.00 0.00 ? 16  GLN A CD   4  
ATOM 5334  O OE1  . GLN A 1 16  ? 18.140  4.605   -17.576 1.00 0.00 ? 16  GLN A OE1  4  
ATOM 5335  N NE2  . GLN A 1 16  ? 18.463  6.318   -16.161 1.00 0.00 ? 16  GLN A NE2  4  
ATOM 5336  H H    . GLN A 1 16  ? 18.049  1.575   -12.976 1.00 0.00 ? 16  GLN A H    4  
ATOM 5337  H HA   . GLN A 1 16  ? 17.274  3.693   -12.681 1.00 0.00 ? 16  GLN A HA   4  
ATOM 5338  H HB2  . GLN A 1 16  ? 16.258  3.274   -15.497 1.00 0.00 ? 16  GLN A HB2  4  
ATOM 5339  H HB3  . GLN A 1 16  ? 16.287  4.824   -14.666 1.00 0.00 ? 16  GLN A HB3  4  
ATOM 5340  H HG2  . GLN A 1 16  ? 18.772  4.527   -14.429 1.00 0.00 ? 16  GLN A HG2  4  
ATOM 5341  H HG3  . GLN A 1 16  ? 18.629  3.148   -15.518 1.00 0.00 ? 16  GLN A HG3  4  
ATOM 5342  H HE21 . GLN A 1 16  ? 18.555  6.587   -15.222 1.00 0.00 ? 16  GLN A HE21 4  
ATOM 5343  H HE22 . GLN A 1 16  ? 18.511  6.945   -16.912 1.00 0.00 ? 16  GLN A HE22 4  
ATOM 5344  N N    . LEU A 1 17  ? 14.966  2.161   -12.021 1.00 0.00 ? 17  LEU A N    4  
ATOM 5345  C CA   . LEU A 1 17  ? 13.618  1.998   -11.487 1.00 0.00 ? 17  LEU A CA   4  
ATOM 5346  C C    . LEU A 1 17  ? 13.320  3.057   -10.430 1.00 0.00 ? 17  LEU A C    4  
ATOM 5347  O O    . LEU A 1 17  ? 14.221  3.673   -9.861  1.00 0.00 ? 17  LEU A O    4  
ATOM 5348  C CB   . LEU A 1 17  ? 13.452  0.601   -10.887 1.00 0.00 ? 17  LEU A CB   4  
ATOM 5349  C CG   . LEU A 1 17  ? 12.954  -0.485  -11.842 1.00 0.00 ? 17  LEU A CG   4  
ATOM 5350  C CD1  . LEU A 1 17  ? 13.494  -0.251  -13.244 1.00 0.00 ? 17  LEU A CD1  4  
ATOM 5351  C CD2  . LEU A 1 17  ? 13.355  -1.864  -11.337 1.00 0.00 ? 17  LEU A CD2  4  
ATOM 5352  H H    . LEU A 1 17  ? 15.682  1.576   -11.696 1.00 0.00 ? 17  LEU A H    4  
ATOM 5353  H HA   . LEU A 1 17  ? 12.922  2.116   -12.303 1.00 0.00 ? 17  LEU A HA   4  
ATOM 5354  H HB2  . LEU A 1 17  ? 14.411  0.289   -10.503 1.00 0.00 ? 17  LEU A HB2  4  
ATOM 5355  H HB3  . LEU A 1 17  ? 12.747  0.674   -10.071 1.00 0.00 ? 17  LEU A HB3  4  
ATOM 5356  H HG   . LEU A 1 17  ? 11.874  -0.446  -11.890 1.00 0.00 ? 17  LEU A HG   4  
ATOM 5357  H HD11 . LEU A 1 17  ? 13.260  -1.101  -13.867 1.00 0.00 ? 17  LEU A HD11 4  
ATOM 5358  H HD12 . LEU A 1 17  ? 14.565  -0.121  -13.200 1.00 0.00 ? 17  LEU A HD12 4  
ATOM 5359  H HD13 . LEU A 1 17  ? 13.041  0.637   -13.660 1.00 0.00 ? 17  LEU A HD13 4  
ATOM 5360  H HD21 . LEU A 1 17  ? 13.800  -2.426  -12.144 1.00 0.00 ? 17  LEU A HD21 4  
ATOM 5361  H HD22 . LEU A 1 17  ? 12.479  -2.383  -10.977 1.00 0.00 ? 17  LEU A HD22 4  
ATOM 5362  H HD23 . LEU A 1 17  ? 14.068  -1.759  -10.534 1.00 0.00 ? 17  LEU A HD23 4  
ATOM 5363  N N    . PRO A 1 18  ? 12.024  3.273   -10.158 1.00 0.00 ? 18  PRO A N    4  
ATOM 5364  C CA   . PRO A 1 18  ? 11.577  4.255   -9.166  1.00 0.00 ? 18  PRO A CA   4  
ATOM 5365  C C    . PRO A 1 18  ? 11.907  3.829   -7.739  1.00 0.00 ? 18  PRO A C    4  
ATOM 5366  O O    . PRO A 1 18  ? 12.544  2.800   -7.520  1.00 0.00 ? 18  PRO A O    4  
ATOM 5367  C CB   . PRO A 1 18  ? 10.061  4.303   -9.373  1.00 0.00 ? 18  PRO A CB   4  
ATOM 5368  C CG   . PRO A 1 18  ? 9.716   2.976   -9.957  1.00 0.00 ? 18  PRO A CG   4  
ATOM 5369  C CD   . PRO A 1 18  ? 10.897  2.575   -10.797 1.00 0.00 ? 18  PRO A CD   4  
ATOM 5370  H HA   . PRO A 1 18  ? 11.999  5.231   -9.355  1.00 0.00 ? 18  PRO A HA   4  
ATOM 5371  H HB2  . PRO A 1 18  ? 9.570   4.456   -8.422  1.00 0.00 ? 18  PRO A HB2  4  
ATOM 5372  H HB3  . PRO A 1 18  ? 9.811   5.108   -10.047 1.00 0.00 ? 18  PRO A HB3  4  
ATOM 5373  H HG2  . PRO A 1 18  ? 9.556   2.258   -9.167  1.00 0.00 ? 18  PRO A HG2  4  
ATOM 5374  H HG3  . PRO A 1 18  ? 8.832   3.064   -10.571 1.00 0.00 ? 18  PRO A HG3  4  
ATOM 5375  H HD2  . PRO A 1 18  ? 11.037  1.504   -10.764 1.00 0.00 ? 18  PRO A HD2  4  
ATOM 5376  H HD3  . PRO A 1 18  ? 10.765  2.908   -11.816 1.00 0.00 ? 18  PRO A HD3  4  
ATOM 5377  N N    . GLY A 1 19  ? 11.467  4.628   -6.771  1.00 0.00 ? 19  GLY A N    4  
ATOM 5378  C CA   . GLY A 1 19  ? 11.725  4.316   -5.378  1.00 0.00 ? 19  GLY A CA   4  
ATOM 5379  C C    . GLY A 1 19  ? 10.452  4.204   -4.563  1.00 0.00 ? 19  GLY A C    4  
ATOM 5380  O O    . GLY A 1 19  ? 9.347   4.403   -5.068  1.00 0.00 ? 19  GLY A O    4  
ATOM 5381  H H    . GLY A 1 19  ? 10.963  5.435   -7.006  1.00 0.00 ? 19  GLY A H    4  
ATOM 5382  H HA2  . GLY A 1 19  ? 12.259  3.379   -5.323  1.00 0.00 ? 19  GLY A HA2  4  
ATOM 5383  H HA3  . GLY A 1 19  ? 12.341  5.096   -4.954  1.00 0.00 ? 19  GLY A HA3  4  
ATOM 5384  N N    . PRO A 1 20  ? 10.598  3.875   -3.271  1.00 0.00 ? 20  PRO A N    4  
ATOM 5385  C CA   . PRO A 1 20  ? 9.461   3.728   -2.358  1.00 0.00 ? 20  PRO A CA   4  
ATOM 5386  C C    . PRO A 1 20  ? 8.792   5.062   -2.044  1.00 0.00 ? 20  PRO A C    4  
ATOM 5387  O O    . PRO A 1 20  ? 9.456   6.024   -1.660  1.00 0.00 ? 20  PRO A O    4  
ATOM 5388  C CB   . PRO A 1 20  ? 10.093  3.137   -1.096  1.00 0.00 ? 20  PRO A CB   4  
ATOM 5389  C CG   . PRO A 1 20  ? 11.516  3.575   -1.145  1.00 0.00 ? 20  PRO A CG   4  
ATOM 5390  C CD   . PRO A 1 20  ? 11.885  3.623   -2.602  1.00 0.00 ? 20  PRO A CD   4  
ATOM 5391  H HA   . PRO A 1 20  ? 8.724   3.041   -2.749  1.00 0.00 ? 20  PRO A HA   4  
ATOM 5392  H HB2  . PRO A 1 20  ? 9.589   3.525   -0.222  1.00 0.00 ? 20  PRO A HB2  4  
ATOM 5393  H HB3  . PRO A 1 20  ? 10.011  2.061   -1.117  1.00 0.00 ? 20  PRO A HB3  4  
ATOM 5394  H HG2  . PRO A 1 20  ? 11.615  4.554   -0.700  1.00 0.00 ? 20  PRO A HG2  4  
ATOM 5395  H HG3  . PRO A 1 20  ? 12.138  2.861   -0.624  1.00 0.00 ? 20  PRO A HG3  4  
ATOM 5396  H HD2  . PRO A 1 20  ? 12.581  4.427   -2.789  1.00 0.00 ? 20  PRO A HD2  4  
ATOM 5397  H HD3  . PRO A 1 20  ? 12.304  2.678   -2.916  1.00 0.00 ? 20  PRO A HD3  4  
ATOM 5398  N N    . ALA A 1 21  ? 7.475   5.112   -2.211  1.00 0.00 ? 21  ALA A N    4  
ATOM 5399  C CA   . ALA A 1 21  ? 6.717   6.328   -1.944  1.00 0.00 ? 21  ALA A CA   4  
ATOM 5400  C C    . ALA A 1 21  ? 6.903   6.785   -0.501  1.00 0.00 ? 21  ALA A C    4  
ATOM 5401  O O    . ALA A 1 21  ? 6.428   6.153   0.443   1.00 0.00 ? 21  ALA A O    4  
ATOM 5402  C CB   . ALA A 1 21  ? 5.241   6.107   -2.242  1.00 0.00 ? 21  ALA A CB   4  
ATOM 5403  H H    . ALA A 1 21  ? 7.001   4.312   -2.520  1.00 0.00 ? 21  ALA A H    4  
ATOM 5404  H HA   . ALA A 1 21  ? 7.080   7.101   -2.605  1.00 0.00 ? 21  ALA A HA   4  
ATOM 5405  H HB1  . ALA A 1 21  ? 5.048   6.331   -3.281  1.00 0.00 ? 21  ALA A HB1  4  
ATOM 5406  H HB2  . ALA A 1 21  ? 4.984   5.077   -2.041  1.00 0.00 ? 21  ALA A HB2  4  
ATOM 5407  H HB3  . ALA A 1 21  ? 4.646   6.755   -1.617  1.00 0.00 ? 21  ALA A HB3  4  
ATOM 5408  N N    . PRO A 1 22  ? 7.613   7.909   -0.323  1.00 0.00 ? 22  PRO A N    4  
ATOM 5409  C CA   . PRO A 1 22  ? 7.879   8.475   1.003   1.00 0.00 ? 22  PRO A CA   4  
ATOM 5410  C C    . PRO A 1 22  ? 6.624   9.049   1.651   1.00 0.00 ? 22  PRO A C    4  
ATOM 5411  O O    . PRO A 1 22  ? 5.535   8.982   1.083   1.00 0.00 ? 22  PRO A O    4  
ATOM 5412  C CB   . PRO A 1 22  ? 8.890   9.589   0.717   1.00 0.00 ? 22  PRO A CB   4  
ATOM 5413  C CG   . PRO A 1 22  ? 8.638   9.973   -0.700  1.00 0.00 ? 22  PRO A CG   4  
ATOM 5414  C CD   . PRO A 1 22  ? 8.210   8.714   -1.401  1.00 0.00 ? 22  PRO A CD   4  
ATOM 5415  H HA   . PRO A 1 22  ? 8.323   7.745   1.665   1.00 0.00 ? 22  PRO A HA   4  
ATOM 5416  H HB2  . PRO A 1 22  ? 8.716   10.418  1.389   1.00 0.00 ? 22  PRO A HB2  4  
ATOM 5417  H HB3  . PRO A 1 22  ? 9.893   9.213   0.852   1.00 0.00 ? 22  PRO A HB3  4  
ATOM 5418  H HG2  . PRO A 1 22  ? 7.854   10.713  -0.746  1.00 0.00 ? 22  PRO A HG2  4  
ATOM 5419  H HG3  . PRO A 1 22  ? 9.546   10.358  -1.142  1.00 0.00 ? 22  PRO A HG3  4  
ATOM 5420  H HD2  . PRO A 1 22  ? 7.480   8.937   -2.165  1.00 0.00 ? 22  PRO A HD2  4  
ATOM 5421  H HD3  . PRO A 1 22  ? 9.065   8.211   -1.829  1.00 0.00 ? 22  PRO A HD3  4  
ATOM 5422  N N    . ASN A 1 23  ? 6.784   9.613   2.844   1.00 0.00 ? 23  ASN A N    4  
ATOM 5423  C CA   . ASN A 1 23  ? 5.663   10.199  3.569   1.00 0.00 ? 23  ASN A CA   4  
ATOM 5424  C C    . ASN A 1 23  ? 4.436   9.295   3.496   1.00 0.00 ? 23  ASN A C    4  
ATOM 5425  O O    . ASN A 1 23  ? 3.319   9.763   3.273   1.00 0.00 ? 23  ASN A O    4  
ATOM 5426  C CB   . ASN A 1 23  ? 5.327   11.580  3.003   1.00 0.00 ? 23  ASN A CB   4  
ATOM 5427  C CG   . ASN A 1 23  ? 6.536   12.494  2.953   1.00 0.00 ? 23  ASN A CG   4  
ATOM 5428  O OD1  . ASN A 1 23  ? 6.876   13.036  1.901   1.00 0.00 ? 23  ASN A OD1  4  
ATOM 5429  N ND2  . ASN A 1 23  ? 7.192   12.669  4.094   1.00 0.00 ? 23  ASN A ND2  4  
ATOM 5430  H H    . ASN A 1 23  ? 7.678   9.636   3.246   1.00 0.00 ? 23  ASN A H    4  
ATOM 5431  H HA   . ASN A 1 23  ? 5.956   10.305  4.603   1.00 0.00 ? 23  ASN A HA   4  
ATOM 5432  H HB2  . ASN A 1 23  ? 4.944   11.467  1.999   1.00 0.00 ? 23  ASN A HB2  4  
ATOM 5433  H HB3  . ASN A 1 23  ? 4.573   12.043  3.621   1.00 0.00 ? 23  ASN A HB3  4  
ATOM 5434  H HD21 . ASN A 1 23  ? 6.864   12.205  4.893   1.00 0.00 ? 23  ASN A HD21 4  
ATOM 5435  H HD22 . ASN A 1 23  ? 7.978   13.256  4.091   1.00 0.00 ? 23  ASN A HD22 4  
ATOM 5436  N N    . LEU A 1 24  ? 4.651   7.998   3.685   1.00 0.00 ? 24  LEU A N    4  
ATOM 5437  C CA   . LEU A 1 24  ? 3.563   7.027   3.641   1.00 0.00 ? 24  LEU A CA   4  
ATOM 5438  C C    . LEU A 1 24  ? 2.748   7.064   4.930   1.00 0.00 ? 24  LEU A C    4  
ATOM 5439  O O    . LEU A 1 24  ? 3.193   6.580   5.971   1.00 0.00 ? 24  LEU A O    4  
ATOM 5440  C CB   . LEU A 1 24  ? 4.118   5.620   3.415   1.00 0.00 ? 24  LEU A CB   4  
ATOM 5441  C CG   . LEU A 1 24  ? 3.088   4.534   3.102   1.00 0.00 ? 24  LEU A CG   4  
ATOM 5442  C CD1  . LEU A 1 24  ? 2.412   4.809   1.768   1.00 0.00 ? 24  LEU A CD1  4  
ATOM 5443  C CD2  . LEU A 1 24  ? 3.744   3.161   3.097   1.00 0.00 ? 24  LEU A CD2  4  
ATOM 5444  H H    . LEU A 1 24  ? 5.563   7.685   3.859   1.00 0.00 ? 24  LEU A H    4  
ATOM 5445  H HA   . LEU A 1 24  ? 2.919   7.288   2.815   1.00 0.00 ? 24  LEU A HA   4  
ATOM 5446  H HB2  . LEU A 1 24  ? 4.811   5.666   2.589   1.00 0.00 ? 24  LEU A HB2  4  
ATOM 5447  H HB3  . LEU A 1 24  ? 4.648   5.326   4.311   1.00 0.00 ? 24  LEU A HB3  4  
ATOM 5448  H HG   . LEU A 1 24  ? 2.325   4.539   3.869   1.00 0.00 ? 24  LEU A HG   4  
ATOM 5449  H HD11 . LEU A 1 24  ? 2.273   3.880   1.236   1.00 0.00 ? 24  LEU A HD11 4  
ATOM 5450  H HD12 . LEU A 1 24  ? 3.032   5.470   1.180   1.00 0.00 ? 24  LEU A HD12 4  
ATOM 5451  H HD13 . LEU A 1 24  ? 1.452   5.274   1.939   1.00 0.00 ? 24  LEU A HD13 4  
ATOM 5452  H HD21 . LEU A 1 24  ? 2.993   2.405   2.925   1.00 0.00 ? 24  LEU A HD21 4  
ATOM 5453  H HD22 . LEU A 1 24  ? 4.220   2.986   4.051   1.00 0.00 ? 24  LEU A HD22 4  
ATOM 5454  H HD23 . LEU A 1 24  ? 4.484   3.119   2.312   1.00 0.00 ? 24  LEU A HD23 4  
ATOM 5455  N N    . ARG A 1 25  ? 1.553   7.640   4.852   1.00 0.00 ? 25  ARG A N    4  
ATOM 5456  C CA   . ARG A 1 25  ? 0.676   7.739   6.012   1.00 0.00 ? 25  ARG A CA   4  
ATOM 5457  C C    . ARG A 1 25  ? -0.749  7.329   5.652   1.00 0.00 ? 25  ARG A C    4  
ATOM 5458  O O    . ARG A 1 25  ? -1.312  7.804   4.666   1.00 0.00 ? 25  ARG A O    4  
ATOM 5459  C CB   . ARG A 1 25  ? 0.683   9.166   6.564   1.00 0.00 ? 25  ARG A CB   4  
ATOM 5460  C CG   . ARG A 1 25  ? 1.068   10.215  5.534   1.00 0.00 ? 25  ARG A CG   4  
ATOM 5461  C CD   . ARG A 1 25  ? 1.482   11.520  6.196   1.00 0.00 ? 25  ARG A CD   4  
ATOM 5462  N NE   . ARG A 1 25  ? 0.331   12.357  6.522   1.00 0.00 ? 25  ARG A NE   4  
ATOM 5463  C CZ   . ARG A 1 25  ? 0.432   13.572  7.051   1.00 0.00 ? 25  ARG A CZ   4  
ATOM 5464  N NH1  . ARG A 1 25  ? 1.625   14.088  7.311   1.00 0.00 ? 25  ARG A NH1  4  
ATOM 5465  N NH2  . ARG A 1 25  ? -0.662  14.273  7.320   1.00 0.00 ? 25  ARG A NH2  4  
ATOM 5466  H H    . ARG A 1 25  ? 1.255   8.008   3.994   1.00 0.00 ? 25  ARG A H    4  
ATOM 5467  H HA   . ARG A 1 25  ? 1.050   7.067   6.770   1.00 0.00 ? 25  ARG A HA   4  
ATOM 5468  H HB2  . ARG A 1 25  ? -0.303  9.401   6.935   1.00 0.00 ? 25  ARG A HB2  4  
ATOM 5469  H HB3  . ARG A 1 25  ? 1.388   9.219   7.380   1.00 0.00 ? 25  ARG A HB3  4  
ATOM 5470  H HG2  . ARG A 1 25  ? 1.894   9.844   4.947   1.00 0.00 ? 25  ARG A HG2  4  
ATOM 5471  H HG3  . ARG A 1 25  ? 0.221   10.401  4.890   1.00 0.00 ? 25  ARG A HG3  4  
ATOM 5472  H HD2  . ARG A 1 25  ? 2.019   11.293  7.105   1.00 0.00 ? 25  ARG A HD2  4  
ATOM 5473  H HD3  . ARG A 1 25  ? 2.129   12.060  5.521   1.00 0.00 ? 25  ARG A HD3  4  
ATOM 5474  H HE   . ARG A 1 25  ? -0.561  11.995  6.338   1.00 0.00 ? 25  ARG A HE   4  
ATOM 5475  H HH11 . ARG A 1 25  ? 2.451   13.563  7.108   1.00 0.00 ? 25  ARG A HH11 4  
ATOM 5476  H HH12 . ARG A 1 25  ? 1.699   15.003  7.708   1.00 0.00 ? 25  ARG A HH12 4  
ATOM 5477  H HH21 . ARG A 1 25  ? -1.563  13.887  7.126   1.00 0.00 ? 25  ARG A HH21 4  
ATOM 5478  H HH22 . ARG A 1 25  ? -0.585  15.186  7.718   1.00 0.00 ? 25  ARG A HH22 4  
ATOM 5479  N N    . ALA A 1 26  ? -1.327  6.444   6.458   1.00 0.00 ? 26  ALA A N    4  
ATOM 5480  C CA   . ALA A 1 26  ? -2.686  5.971   6.226   1.00 0.00 ? 26  ALA A CA   4  
ATOM 5481  C C    . ALA A 1 26  ? -3.548  6.144   7.472   1.00 0.00 ? 26  ALA A C    4  
ATOM 5482  O O    . ALA A 1 26  ? -3.086  5.925   8.592   1.00 0.00 ? 26  ALA A O    4  
ATOM 5483  C CB   . ALA A 1 26  ? -2.671  4.514   5.789   1.00 0.00 ? 26  ALA A CB   4  
ATOM 5484  H H    . ALA A 1 26  ? -0.827  6.102   7.228   1.00 0.00 ? 26  ALA A H    4  
ATOM 5485  H HA   . ALA A 1 26  ? -3.110  6.557   5.423   1.00 0.00 ? 26  ALA A HA   4  
ATOM 5486  H HB1  . ALA A 1 26  ? -3.001  4.443   4.763   1.00 0.00 ? 26  ALA A HB1  4  
ATOM 5487  H HB2  . ALA A 1 26  ? -1.667  4.124   5.873   1.00 0.00 ? 26  ALA A HB2  4  
ATOM 5488  H HB3  . ALA A 1 26  ? -3.333  3.942   6.422   1.00 0.00 ? 26  ALA A HB3  4  
ATOM 5489  N N    . TYR A 1 27  ? -4.800  6.537   7.270   1.00 0.00 ? 27  TYR A N    4  
ATOM 5490  C CA   . TYR A 1 27  ? -5.725  6.742   8.378   1.00 0.00 ? 27  TYR A CA   4  
ATOM 5491  C C    . TYR A 1 27  ? -7.137  6.305   7.996   1.00 0.00 ? 27  TYR A C    4  
ATOM 5492  O O    . TYR A 1 27  ? -7.610  6.589   6.896   1.00 0.00 ? 27  TYR A O    4  
ATOM 5493  C CB   . TYR A 1 27  ? -5.731  8.212   8.801   1.00 0.00 ? 27  TYR A CB   4  
ATOM 5494  C CG   . TYR A 1 27  ? -5.942  9.171   7.652   1.00 0.00 ? 27  TYR A CG   4  
ATOM 5495  C CD1  . TYR A 1 27  ? -7.223  9.533   7.250   1.00 0.00 ? 27  TYR A CD1  4  
ATOM 5496  C CD2  . TYR A 1 27  ? -4.863  9.716   6.967   1.00 0.00 ? 27  TYR A CD2  4  
ATOM 5497  C CE1  . TYR A 1 27  ? -7.421  10.409  6.201   1.00 0.00 ? 27  TYR A CE1  4  
ATOM 5498  C CE2  . TYR A 1 27  ? -5.052  10.594  5.917   1.00 0.00 ? 27  TYR A CE2  4  
ATOM 5499  C CZ   . TYR A 1 27  ? -6.333  10.937  5.538   1.00 0.00 ? 27  TYR A CZ   4  
ATOM 5500  O OH   . TYR A 1 27  ? -6.526  11.810  4.492   1.00 0.00 ? 27  TYR A OH   4  
ATOM 5501  H H    . TYR A 1 27  ? -5.110  6.695   6.353   1.00 0.00 ? 27  TYR A H    4  
ATOM 5502  H HA   . TYR A 1 27  ? -5.387  6.140   9.208   1.00 0.00 ? 27  TYR A HA   4  
ATOM 5503  H HB2  . TYR A 1 27  ? -6.523  8.371   9.515   1.00 0.00 ? 27  TYR A HB2  4  
ATOM 5504  H HB3  . TYR A 1 27  ? -4.783  8.450   9.262   1.00 0.00 ? 27  TYR A HB3  4  
ATOM 5505  H HD1  . TYR A 1 27  ? -8.073  9.118   7.771   1.00 0.00 ? 27  TYR A HD1  4  
ATOM 5506  H HD2  . TYR A 1 27  ? -3.861  9.444   7.267   1.00 0.00 ? 27  TYR A HD2  4  
ATOM 5507  H HE1  . TYR A 1 27  ? -8.424  10.678  5.903   1.00 0.00 ? 27  TYR A HE1  4  
ATOM 5508  H HE2  . TYR A 1 27  ? -4.200  11.007  5.398   1.00 0.00 ? 27  TYR A HE2  4  
ATOM 5509  H HH   . TYR A 1 27  ? -5.876  11.636  3.806   1.00 0.00 ? 27  TYR A HH   4  
ATOM 5510  N N    . ALA A 1 28  ? -7.804  5.615   8.915   1.00 0.00 ? 28  ALA A N    4  
ATOM 5511  C CA   . ALA A 1 28  ? -9.162  5.141   8.678   1.00 0.00 ? 28  ALA A CA   4  
ATOM 5512  C C    . ALA A 1 28  ? -10.178 6.258   8.891   1.00 0.00 ? 28  ALA A C    4  
ATOM 5513  O O    . ALA A 1 28  ? -10.462 6.644   10.024  1.00 0.00 ? 28  ALA A O    4  
ATOM 5514  C CB   . ALA A 1 28  ? -9.475  3.960   9.585   1.00 0.00 ? 28  ALA A CB   4  
ATOM 5515  H H    . ALA A 1 28  ? -7.373  5.420   9.773   1.00 0.00 ? 28  ALA A H    4  
ATOM 5516  H HA   . ALA A 1 28  ? -9.223  4.803   7.653   1.00 0.00 ? 28  ALA A HA   4  
ATOM 5517  H HB1  . ALA A 1 28  ? -9.655  4.316   10.589  1.00 0.00 ? 28  ALA A HB1  4  
ATOM 5518  H HB2  . ALA A 1 28  ? -10.354 3.450   9.220   1.00 0.00 ? 28  ALA A HB2  4  
ATOM 5519  H HB3  . ALA A 1 28  ? -8.638  3.278   9.589   1.00 0.00 ? 28  ALA A HB3  4  
ATOM 5520  N N    . ALA A 1 29  ? -10.721 6.775   7.793   1.00 0.00 ? 29  ALA A N    4  
ATOM 5521  C CA   . ALA A 1 29  ? -11.707 7.847   7.861   1.00 0.00 ? 29  ALA A CA   4  
ATOM 5522  C C    . ALA A 1 29  ? -13.030 7.341   8.424   1.00 0.00 ? 29  ALA A C    4  
ATOM 5523  O O    . ALA A 1 29  ? -13.796 8.103   9.014   1.00 0.00 ? 29  ALA A O    4  
ATOM 5524  C CB   . ALA A 1 29  ? -11.916 8.458   6.483   1.00 0.00 ? 29  ALA A CB   4  
ATOM 5525  H H    . ALA A 1 29  ? -10.454 6.425   6.918   1.00 0.00 ? 29  ALA A H    4  
ATOM 5526  H HA   . ALA A 1 29  ? -11.319 8.615   8.514   1.00 0.00 ? 29  ALA A HA   4  
ATOM 5527  H HB1  . ALA A 1 29  ? -11.030 9.003   6.194   1.00 0.00 ? 29  ALA A HB1  4  
ATOM 5528  H HB2  . ALA A 1 29  ? -12.107 7.673   5.767   1.00 0.00 ? 29  ALA A HB2  4  
ATOM 5529  H HB3  . ALA A 1 29  ? -12.759 9.132   6.513   1.00 0.00 ? 29  ALA A HB3  4  
ATOM 5530  N N    . SER A 1 30  ? -13.294 6.052   8.238   1.00 0.00 ? 30  SER A N    4  
ATOM 5531  C CA   . SER A 1 30  ? -14.528 5.445   8.724   1.00 0.00 ? 30  SER A CA   4  
ATOM 5532  C C    . SER A 1 30  ? -14.299 3.990   9.120   1.00 0.00 ? 30  SER A C    4  
ATOM 5533  O O    . SER A 1 30  ? -13.332 3.351   8.703   1.00 0.00 ? 30  SER A O    4  
ATOM 5534  C CB   . SER A 1 30  ? -15.618 5.529   7.653   1.00 0.00 ? 30  SER A CB   4  
ATOM 5535  O OG   . SER A 1 30  ? -16.325 6.754   7.741   1.00 0.00 ? 30  SER A OG   4  
ATOM 5536  H H    . SER A 1 30  ? -12.643 5.495   7.759   1.00 0.00 ? 30  SER A H    4  
ATOM 5537  H HA   . SER A 1 30  ? -14.847 5.997   9.595   1.00 0.00 ? 30  SER A HA   4  
ATOM 5538  H HB2  . SER A 1 30  ? -15.166 5.457   6.676   1.00 0.00 ? 30  SER A HB2  4  
ATOM 5539  H HB3  . SER A 1 30  ? -16.314 4.714   7.789   1.00 0.00 ? 30  SER A HB3  4  
ATOM 5540  H HG   . SER A 1 30  ? -17.151 6.614   8.209   1.00 0.00 ? 30  SER A HG   4  
ATOM 5541  N N    . PRO A 1 31  ? -15.209 3.452   9.945   1.00 0.00 ? 31  PRO A N    4  
ATOM 5542  C CA   . PRO A 1 31  ? -15.129 2.066   10.415  1.00 0.00 ? 31  PRO A CA   4  
ATOM 5543  C C    . PRO A 1 31  ? -15.399 1.059   9.302   1.00 0.00 ? 31  PRO A C    4  
ATOM 5544  O O    . PRO A 1 31  ? -15.280 -0.150  9.502   1.00 0.00 ? 31  PRO A O    4  
ATOM 5545  C CB   . PRO A 1 31  ? -16.225 1.990   11.482  1.00 0.00 ? 31  PRO A CB   4  
ATOM 5546  C CG   . PRO A 1 31  ? -17.199 3.051   11.100  1.00 0.00 ? 31  PRO A CG   4  
ATOM 5547  C CD   . PRO A 1 31  ? -16.387 4.154   10.480  1.00 0.00 ? 31  PRO A CD   4  
ATOM 5548  H HA   . PRO A 1 31  ? -14.171 1.854   10.866  1.00 0.00 ? 31  PRO A HA   4  
ATOM 5549  H HB2  . PRO A 1 31  ? -16.681 1.010   11.464  1.00 0.00 ? 31  PRO A HB2  4  
ATOM 5550  H HB3  . PRO A 1 31  ? -15.798 2.177   12.456  1.00 0.00 ? 31  PRO A HB3  4  
ATOM 5551  H HG2  . PRO A 1 31  ? -17.907 2.660   10.386  1.00 0.00 ? 31  PRO A HG2  4  
ATOM 5552  H HG3  . PRO A 1 31  ? -17.711 3.412   11.980  1.00 0.00 ? 31  PRO A HG3  4  
ATOM 5553  H HD2  . PRO A 1 31  ? -16.944 4.633   9.688   1.00 0.00 ? 31  PRO A HD2  4  
ATOM 5554  H HD3  . PRO A 1 31  ? -16.097 4.876   11.230  1.00 0.00 ? 31  PRO A HD3  4  
ATOM 5555  N N    . THR A 1 32  ? -15.762 1.565   8.128   1.00 0.00 ? 32  THR A N    4  
ATOM 5556  C CA   . THR A 1 32  ? -16.048 0.710   6.983   1.00 0.00 ? 32  THR A CA   4  
ATOM 5557  C C    . THR A 1 32  ? -15.190 1.092   5.783   1.00 0.00 ? 32  THR A C    4  
ATOM 5558  O O    . THR A 1 32  ? -15.194 0.405   4.761   1.00 0.00 ? 32  THR A O    4  
ATOM 5559  C CB   . THR A 1 32  ? -17.534 0.787   6.582   1.00 0.00 ? 32  THR A CB   4  
ATOM 5560  O OG1  . THR A 1 32  ? -17.812 2.052   5.972   1.00 0.00 ? 32  THR A OG1  4  
ATOM 5561  C CG2  . THR A 1 32  ? -18.432 0.595   7.795   1.00 0.00 ? 32  THR A CG2  4  
ATOM 5562  H H    . THR A 1 32  ? -15.839 2.537   8.031   1.00 0.00 ? 32  THR A H    4  
ATOM 5563  H HA   . THR A 1 32  ? -15.825 -0.309  7.264   1.00 0.00 ? 32  THR A HA   4  
ATOM 5564  H HB   . THR A 1 32  ? -17.740 -0.001  5.872   1.00 0.00 ? 32  THR A HB   4  
ATOM 5565  H HG1  . THR A 1 32  ? -17.399 2.086   5.105   1.00 0.00 ? 32  THR A HG1  4  
ATOM 5566  H HG21 . THR A 1 32  ? -18.088 -0.254  8.368   1.00 0.00 ? 32  THR A HG21 4  
ATOM 5567  H HG22 . THR A 1 32  ? -19.446 0.422   7.468   1.00 0.00 ? 32  THR A HG22 4  
ATOM 5568  H HG23 . THR A 1 32  ? -18.398 1.481   8.411   1.00 0.00 ? 32  THR A HG23 4  
ATOM 5569  N N    . SER A 1 33  ? -14.453 2.191   5.913   1.00 0.00 ? 33  SER A N    4  
ATOM 5570  C CA   . SER A 1 33  ? -13.591 2.666   4.837   1.00 0.00 ? 33  SER A CA   4  
ATOM 5571  C C    . SER A 1 33  ? -12.303 3.262   5.396   1.00 0.00 ? 33  SER A C    4  
ATOM 5572  O O    . SER A 1 33  ? -12.268 3.736   6.532   1.00 0.00 ? 33  SER A O    4  
ATOM 5573  C CB   . SER A 1 33  ? -14.324 3.708   3.991   1.00 0.00 ? 33  SER A CB   4  
ATOM 5574  O OG   . SER A 1 33  ? -15.575 3.214   3.543   1.00 0.00 ? 33  SER A OG   4  
ATOM 5575  H H    . SER A 1 33  ? -14.493 2.695   6.753   1.00 0.00 ? 33  SER A H    4  
ATOM 5576  H HA   . SER A 1 33  ? -13.342 1.820   4.215   1.00 0.00 ? 33  SER A HA   4  
ATOM 5577  H HB2  . SER A 1 33  ? -14.492 4.595   4.582   1.00 0.00 ? 33  SER A HB2  4  
ATOM 5578  H HB3  . SER A 1 33  ? -13.720 3.958   3.130   1.00 0.00 ? 33  SER A HB3  4  
ATOM 5579  H HG   . SER A 1 33  ? -15.958 3.833   2.917   1.00 0.00 ? 33  SER A HG   4  
ATOM 5580  N N    . ILE A 1 34  ? -11.247 3.235   4.590   1.00 0.00 ? 34  ILE A N    4  
ATOM 5581  C CA   . ILE A 1 34  ? -9.957  3.773   5.003   1.00 0.00 ? 34  ILE A CA   4  
ATOM 5582  C C    . ILE A 1 34  ? -9.390  4.714   3.945   1.00 0.00 ? 34  ILE A C    4  
ATOM 5583  O O    . ILE A 1 34  ? -9.667  4.566   2.754   1.00 0.00 ? 34  ILE A O    4  
ATOM 5584  C CB   . ILE A 1 34  ? -8.939  2.650   5.274   1.00 0.00 ? 34  ILE A CB   4  
ATOM 5585  C CG1  . ILE A 1 34  ? -9.414  1.770   6.433   1.00 0.00 ? 34  ILE A CG1  4  
ATOM 5586  C CG2  . ILE A 1 34  ? -7.569  3.239   5.576   1.00 0.00 ? 34  ILE A CG2  4  
ATOM 5587  C CD1  . ILE A 1 34  ? -8.550  0.549   6.658   1.00 0.00 ? 34  ILE A CD1  4  
ATOM 5588  H H    . ILE A 1 34  ? -11.338 2.844   3.697   1.00 0.00 ? 34  ILE A H    4  
ATOM 5589  H HA   . ILE A 1 34  ? -10.106 4.327   5.919   1.00 0.00 ? 34  ILE A HA   4  
ATOM 5590  H HB   . ILE A 1 34  ? -8.857  2.047   4.384   1.00 0.00 ? 34  ILE A HB   4  
ATOM 5591  H HG12 . ILE A 1 34  ? -9.410  2.350   7.342   1.00 0.00 ? 34  ILE A HG12 4  
ATOM 5592  H HG13 . ILE A 1 34  ? -10.420 1.433   6.230   1.00 0.00 ? 34  ILE A HG13 4  
ATOM 5593  H HG21 . ILE A 1 34  ? -6.902  2.452   5.895   1.00 0.00 ? 34  ILE A HG21 4  
ATOM 5594  H HG22 . ILE A 1 34  ? -7.175  3.706   4.686   1.00 0.00 ? 34  ILE A HG22 4  
ATOM 5595  H HG23 . ILE A 1 34  ? -7.658  3.975   6.360   1.00 0.00 ? 34  ILE A HG23 4  
ATOM 5596  H HD11 . ILE A 1 34  ? -7.682  0.599   6.018   1.00 0.00 ? 34  ILE A HD11 4  
ATOM 5597  H HD12 . ILE A 1 34  ? -8.237  0.514   7.690   1.00 0.00 ? 34  ILE A HD12 4  
ATOM 5598  H HD13 . ILE A 1 34  ? -9.117  -0.341  6.424   1.00 0.00 ? 34  ILE A HD13 4  
ATOM 5599  N N    . THR A 1 35  ? -8.593  5.681   4.387   1.00 0.00 ? 35  THR A N    4  
ATOM 5600  C CA   . THR A 1 35  ? -7.985  6.646   3.479   1.00 0.00 ? 35  THR A CA   4  
ATOM 5601  C C    . THR A 1 35  ? -6.464  6.548   3.511   1.00 0.00 ? 35  THR A C    4  
ATOM 5602  O O    . THR A 1 35  ? -5.816  7.087   4.407   1.00 0.00 ? 35  THR A O    4  
ATOM 5603  C CB   . THR A 1 35  ? -8.403  8.087   3.829   1.00 0.00 ? 35  THR A CB   4  
ATOM 5604  O OG1  . THR A 1 35  ? -9.830  8.203   3.803   1.00 0.00 ? 35  THR A OG1  4  
ATOM 5605  C CG2  . THR A 1 35  ? -7.791  9.079   2.852   1.00 0.00 ? 35  THR A CG2  4  
ATOM 5606  H H    . THR A 1 35  ? -8.410  5.747   5.348   1.00 0.00 ? 35  THR A H    4  
ATOM 5607  H HA   . THR A 1 35  ? -8.330  6.426   2.479   1.00 0.00 ? 35  THR A HA   4  
ATOM 5608  H HB   . THR A 1 35  ? -8.049  8.317   4.823   1.00 0.00 ? 35  THR A HB   4  
ATOM 5609  H HG1  . THR A 1 35  ? -10.118 8.409   2.910   1.00 0.00 ? 35  THR A HG1  4  
ATOM 5610  H HG21 . THR A 1 35  ? -6.815  8.730   2.549   1.00 0.00 ? 35  THR A HG21 4  
ATOM 5611  H HG22 . THR A 1 35  ? -7.696  10.043  3.331   1.00 0.00 ? 35  THR A HG22 4  
ATOM 5612  H HG23 . THR A 1 35  ? -8.427  9.169   1.985   1.00 0.00 ? 35  THR A HG23 4  
ATOM 5613  N N    . VAL A 1 36  ? -5.900  5.857   2.525   1.00 0.00 ? 36  VAL A N    4  
ATOM 5614  C CA   . VAL A 1 36  ? -4.454  5.690   2.439   1.00 0.00 ? 36  VAL A CA   4  
ATOM 5615  C C    . VAL A 1 36  ? -3.818  6.815   1.630   1.00 0.00 ? 36  VAL A C    4  
ATOM 5616  O O    . VAL A 1 36  ? -4.273  7.140   0.532   1.00 0.00 ? 36  VAL A O    4  
ATOM 5617  C CB   . VAL A 1 36  ? -4.082  4.339   1.800   1.00 0.00 ? 36  VAL A CB   4  
ATOM 5618  C CG1  . VAL A 1 36  ? -2.576  4.130   1.833   1.00 0.00 ? 36  VAL A CG1  4  
ATOM 5619  C CG2  . VAL A 1 36  ? -4.802  3.200   2.506   1.00 0.00 ? 36  VAL A CG2  4  
ATOM 5620  H H    . VAL A 1 36  ? -6.469  5.450   1.840   1.00 0.00 ? 36  VAL A H    4  
ATOM 5621  H HA   . VAL A 1 36  ? -4.055  5.712   3.443   1.00 0.00 ? 36  VAL A HA   4  
ATOM 5622  H HB   . VAL A 1 36  ? -4.399  4.353   0.768   1.00 0.00 ? 36  VAL A HB   4  
ATOM 5623  H HG11 . VAL A 1 36  ? -2.358  3.074   1.761   1.00 0.00 ? 36  VAL A HG11 4  
ATOM 5624  H HG12 . VAL A 1 36  ? -2.121  4.650   1.002   1.00 0.00 ? 36  VAL A HG12 4  
ATOM 5625  H HG13 . VAL A 1 36  ? -2.179  4.517   2.760   1.00 0.00 ? 36  VAL A HG13 4  
ATOM 5626  H HG21 . VAL A 1 36  ? -5.844  3.205   2.224   1.00 0.00 ? 36  VAL A HG21 4  
ATOM 5627  H HG22 . VAL A 1 36  ? -4.356  2.259   2.219   1.00 0.00 ? 36  VAL A HG22 4  
ATOM 5628  H HG23 . VAL A 1 36  ? -4.717  3.327   3.575   1.00 0.00 ? 36  VAL A HG23 4  
ATOM 5629  N N    . THR A 1 37  ? -2.763  7.408   2.179   1.00 0.00 ? 37  THR A N    4  
ATOM 5630  C CA   . THR A 1 37  ? -2.064  8.498   1.509   1.00 0.00 ? 37  THR A CA   4  
ATOM 5631  C C    . THR A 1 37  ? -0.575  8.198   1.377   1.00 0.00 ? 37  THR A C    4  
ATOM 5632  O O    . THR A 1 37  ? -0.020  7.416   2.149   1.00 0.00 ? 37  THR A O    4  
ATOM 5633  C CB   . THR A 1 37  ? -2.243  9.828   2.264   1.00 0.00 ? 37  THR A CB   4  
ATOM 5634  O OG1  . THR A 1 37  ? -1.186  9.998   3.215   1.00 0.00 ? 37  THR A OG1  4  
ATOM 5635  C CG2  . THR A 1 37  ? -3.586  9.869   2.977   1.00 0.00 ? 37  THR A CG2  4  
ATOM 5636  H H    . THR A 1 37  ? -2.448  7.105   3.056   1.00 0.00 ? 37  THR A H    4  
ATOM 5637  H HA   . THR A 1 37  ? -2.488  8.609   0.521   1.00 0.00 ? 37  THR A HA   4  
ATOM 5638  H HB   . THR A 1 37  ? -2.207  10.638  1.549   1.00 0.00 ? 37  THR A HB   4  
ATOM 5639  H HG1  . THR A 1 37  ? -0.918  9.140   3.552   1.00 0.00 ? 37  THR A HG1  4  
ATOM 5640  H HG21 . THR A 1 37  ? -3.986  10.871  2.935   1.00 0.00 ? 37  THR A HG21 4  
ATOM 5641  H HG22 . THR A 1 37  ? -3.454  9.577   4.009   1.00 0.00 ? 37  THR A HG22 4  
ATOM 5642  H HG23 . THR A 1 37  ? -4.270  9.188   2.495   1.00 0.00 ? 37  THR A HG23 4  
ATOM 5643  N N    . TRP A 1 38  ? 0.065   8.824   0.396   1.00 0.00 ? 38  TRP A N    4  
ATOM 5644  C CA   . TRP A 1 38  ? 1.491   8.623   0.165   1.00 0.00 ? 38  TRP A CA   4  
ATOM 5645  C C    . TRP A 1 38  ? 2.062   9.735   -0.709  1.00 0.00 ? 38  TRP A C    4  
ATOM 5646  O O    . TRP A 1 38  ? 1.317   10.483  -1.341  1.00 0.00 ? 38  TRP A O    4  
ATOM 5647  C CB   . TRP A 1 38  ? 1.736   7.264   -0.492  1.00 0.00 ? 38  TRP A CB   4  
ATOM 5648  C CG   . TRP A 1 38  ? 1.052   7.113   -1.818  1.00 0.00 ? 38  TRP A CG   4  
ATOM 5649  C CD1  . TRP A 1 38  ? 1.559   7.441   -3.043  1.00 0.00 ? 38  TRP A CD1  4  
ATOM 5650  C CD2  . TRP A 1 38  ? -0.263  6.598   -2.050  1.00 0.00 ? 38  TRP A CD2  4  
ATOM 5651  N NE1  . TRP A 1 38  ? 0.637   7.161   -4.023  1.00 0.00 ? 38  TRP A NE1  4  
ATOM 5652  C CE2  . TRP A 1 38  ? -0.489  6.642   -3.439  1.00 0.00 ? 38  TRP A CE2  4  
ATOM 5653  C CE3  . TRP A 1 38  ? -1.272  6.103   -1.219  1.00 0.00 ? 38  TRP A CE3  4  
ATOM 5654  C CZ2  . TRP A 1 38  ? -1.681  6.210   -4.014  1.00 0.00 ? 38  TRP A CZ2  4  
ATOM 5655  C CZ3  . TRP A 1 38  ? -2.455  5.675   -1.790  1.00 0.00 ? 38  TRP A CZ3  4  
ATOM 5656  C CH2  . TRP A 1 38  ? -2.652  5.730   -3.177  1.00 0.00 ? 38  TRP A CH2  4  
ATOM 5657  H H    . TRP A 1 38  ? -0.433  9.435   -0.186  1.00 0.00 ? 38  TRP A H    4  
ATOM 5658  H HA   . TRP A 1 38  ? 1.988   8.644   1.124   1.00 0.00 ? 38  TRP A HA   4  
ATOM 5659  H HB2  . TRP A 1 38  ? 2.796   7.132   -0.648  1.00 0.00 ? 38  TRP A HB2  4  
ATOM 5660  H HB3  . TRP A 1 38  ? 1.372   6.485   0.162   1.00 0.00 ? 38  TRP A HB3  4  
ATOM 5661  H HD1  . TRP A 1 38  ? 2.540   7.860   -3.203  1.00 0.00 ? 38  TRP A HD1  4  
ATOM 5662  H HE1  . TRP A 1 38  ? 0.766   7.307   -4.984  1.00 0.00 ? 38  TRP A HE1  4  
ATOM 5663  H HE3  . TRP A 1 38  ? -1.139  6.052   -0.148  1.00 0.00 ? 38  TRP A HE3  4  
ATOM 5664  H HZ2  . TRP A 1 38  ? -1.848  6.246   -5.080  1.00 0.00 ? 38  TRP A HZ2  4  
ATOM 5665  H HZ3  . TRP A 1 38  ? -3.246  5.289   -1.164  1.00 0.00 ? 38  TRP A HZ3  4  
ATOM 5666  H HH2  . TRP A 1 38  ? -3.592  5.385   -3.579  1.00 0.00 ? 38  TRP A HH2  4  
ATOM 5667  N N    . GLU A 1 39  ? 3.387   9.836   -0.740  1.00 0.00 ? 39  GLU A N    4  
ATOM 5668  C CA   . GLU A 1 39  ? 4.056   10.857  -1.537  1.00 0.00 ? 39  GLU A CA   4  
ATOM 5669  C C    . GLU A 1 39  ? 4.849   10.225  -2.677  1.00 0.00 ? 39  GLU A C    4  
ATOM 5670  O O    . GLU A 1 39  ? 5.097   9.018   -2.683  1.00 0.00 ? 39  GLU A O    4  
ATOM 5671  C CB   . GLU A 1 39  ? 4.987   11.694  -0.657  1.00 0.00 ? 39  GLU A CB   4  
ATOM 5672  C CG   . GLU A 1 39  ? 4.290   12.853  0.036   1.00 0.00 ? 39  GLU A CG   4  
ATOM 5673  C CD   . GLU A 1 39  ? 4.028   14.019  -0.897  1.00 0.00 ? 39  GLU A CD   4  
ATOM 5674  O OE1  . GLU A 1 39  ? 4.787   14.179  -1.875  1.00 0.00 ? 39  GLU A OE1  4  
ATOM 5675  O OE2  . GLU A 1 39  ? 3.062   14.771  -0.649  1.00 0.00 ? 39  GLU A OE2  4  
ATOM 5676  H H    . GLU A 1 39  ? 3.927   9.209   -0.215  1.00 0.00 ? 39  GLU A H    4  
ATOM 5677  H HA   . GLU A 1 39  ? 3.298   11.500  -1.956  1.00 0.00 ? 39  GLU A HA   4  
ATOM 5678  H HB2  . GLU A 1 39  ? 5.418   11.055  0.099   1.00 0.00 ? 39  GLU A HB2  4  
ATOM 5679  H HB3  . GLU A 1 39  ? 5.780   12.095  -1.272  1.00 0.00 ? 39  GLU A HB3  4  
ATOM 5680  H HG2  . GLU A 1 39  ? 3.345   12.506  0.427   1.00 0.00 ? 39  GLU A HG2  4  
ATOM 5681  H HG3  . GLU A 1 39  ? 4.911   13.195  0.851   1.00 0.00 ? 39  GLU A HG3  4  
ATOM 5682  N N    . THR A 1 40  ? 5.246   11.048  -3.643  1.00 0.00 ? 40  THR A N    4  
ATOM 5683  C CA   . THR A 1 40  ? 6.009   10.571  -4.789  1.00 0.00 ? 40  THR A CA   4  
ATOM 5684  C C    . THR A 1 40  ? 7.502   10.539  -4.481  1.00 0.00 ? 40  THR A C    4  
ATOM 5685  O O    . THR A 1 40  ? 8.072   11.494  -3.952  1.00 0.00 ? 40  THR A O    4  
ATOM 5686  C CB   . THR A 1 40  ? 5.771   11.453  -6.029  1.00 0.00 ? 40  THR A CB   4  
ATOM 5687  O OG1  . THR A 1 40  ? 4.461   11.216  -6.555  1.00 0.00 ? 40  THR A OG1  4  
ATOM 5688  C CG2  . THR A 1 40  ? 6.813   11.172  -7.101  1.00 0.00 ? 40  THR A CG2  4  
ATOM 5689  H H    . THR A 1 40  ? 5.018   11.999  -3.581  1.00 0.00 ? 40  THR A H    4  
ATOM 5690  H HA   . THR A 1 40  ? 5.677   9.569   -5.017  1.00 0.00 ? 40  THR A HA   4  
ATOM 5691  H HB   . THR A 1 40  ? 5.850   12.490  -5.735  1.00 0.00 ? 40  THR A HB   4  
ATOM 5692  H HG1  . THR A 1 40  ? 4.266   11.866  -7.234  1.00 0.00 ? 40  THR A HG1  4  
ATOM 5693  H HG21 . THR A 1 40  ? 6.669   11.849  -7.930  1.00 0.00 ? 40  THR A HG21 4  
ATOM 5694  H HG22 . THR A 1 40  ? 6.709   10.154  -7.446  1.00 0.00 ? 40  THR A HG22 4  
ATOM 5695  H HG23 . THR A 1 40  ? 7.801   11.313  -6.689  1.00 0.00 ? 40  THR A HG23 4  
ATOM 5696  N N    . PRO A 1 41  ? 8.153   9.416   -4.819  1.00 0.00 ? 41  PRO A N    4  
ATOM 5697  C CA   . PRO A 1 41  ? 9.589   9.234   -4.589  1.00 0.00 ? 41  PRO A CA   4  
ATOM 5698  C C    . PRO A 1 41  ? 10.438  10.116  -5.497  1.00 0.00 ? 41  PRO A C    4  
ATOM 5699  O O    . PRO A 1 41  ? 10.366  10.016  -6.722  1.00 0.00 ? 41  PRO A O    4  
ATOM 5700  C CB   . PRO A 1 41  ? 9.815   7.756   -4.916  1.00 0.00 ? 41  PRO A CB   4  
ATOM 5701  C CG   . PRO A 1 41  ? 8.720   7.405   -5.862  1.00 0.00 ? 41  PRO A CG   4  
ATOM 5702  C CD   . PRO A 1 41  ? 7.537   8.239   -5.454  1.00 0.00 ? 41  PRO A CD   4  
ATOM 5703  H HA   . PRO A 1 41  ? 9.852   9.421   -3.558  1.00 0.00 ? 41  PRO A HA   4  
ATOM 5704  H HB2  . PRO A 1 41  ? 10.788  7.630   -5.372  1.00 0.00 ? 41  PRO A HB2  4  
ATOM 5705  H HB3  . PRO A 1 41  ? 9.758   7.170   -4.011  1.00 0.00 ? 41  PRO A HB3  4  
ATOM 5706  H HG2  . PRO A 1 41  ? 9.016   7.643   -6.872  1.00 0.00 ? 41  PRO A HG2  4  
ATOM 5707  H HG3  . PRO A 1 41  ? 8.484   6.354   -5.777  1.00 0.00 ? 41  PRO A HG3  4  
ATOM 5708  H HD2  . PRO A 1 41  ? 6.960   8.525   -6.320  1.00 0.00 ? 41  PRO A HD2  4  
ATOM 5709  H HD3  . PRO A 1 41  ? 6.921   7.700   -4.749  1.00 0.00 ? 41  PRO A HD3  4  
ATOM 5710  N N    . VAL A 1 42  ? 11.244  10.981  -4.889  1.00 0.00 ? 42  VAL A N    4  
ATOM 5711  C CA   . VAL A 1 42  ? 12.109  11.881  -5.643  1.00 0.00 ? 42  VAL A CA   4  
ATOM 5712  C C    . VAL A 1 42  ? 13.342  11.151  -6.161  1.00 0.00 ? 42  VAL A C    4  
ATOM 5713  O O    . VAL A 1 42  ? 13.957  11.569  -7.143  1.00 0.00 ? 42  VAL A O    4  
ATOM 5714  C CB   . VAL A 1 42  ? 12.558  13.079  -4.784  1.00 0.00 ? 42  VAL A CB   4  
ATOM 5715  C CG1  . VAL A 1 42  ? 11.369  13.691  -4.058  1.00 0.00 ? 42  VAL A CG1  4  
ATOM 5716  C CG2  . VAL A 1 42  ? 13.634  12.652  -3.797  1.00 0.00 ? 42  VAL A CG2  4  
ATOM 5717  H H    . VAL A 1 42  ? 11.257  11.015  -3.909  1.00 0.00 ? 42  VAL A H    4  
ATOM 5718  H HA   . VAL A 1 42  ? 11.546  12.259  -6.484  1.00 0.00 ? 42  VAL A HA   4  
ATOM 5719  H HB   . VAL A 1 42  ? 12.976  13.829  -5.439  1.00 0.00 ? 42  VAL A HB   4  
ATOM 5720  H HG11 . VAL A 1 42  ? 10.678  14.099  -4.781  1.00 0.00 ? 42  VAL A HG11 4  
ATOM 5721  H HG12 . VAL A 1 42  ? 10.873  12.930  -3.474  1.00 0.00 ? 42  VAL A HG12 4  
ATOM 5722  H HG13 . VAL A 1 42  ? 11.714  14.479  -3.405  1.00 0.00 ? 42  VAL A HG13 4  
ATOM 5723  H HG21 . VAL A 1 42  ? 13.212  11.962  -3.082  1.00 0.00 ? 42  VAL A HG21 4  
ATOM 5724  H HG22 . VAL A 1 42  ? 14.441  12.170  -4.330  1.00 0.00 ? 42  VAL A HG22 4  
ATOM 5725  H HG23 . VAL A 1 42  ? 14.013  13.521  -3.280  1.00 0.00 ? 42  VAL A HG23 4  
ATOM 5726  N N    . SER A 1 43  ? 13.699  10.057  -5.496  1.00 0.00 ? 43  SER A N    4  
ATOM 5727  C CA   . SER A 1 43  ? 14.862  9.269   -5.888  1.00 0.00 ? 43  SER A CA   4  
ATOM 5728  C C    . SER A 1 43  ? 14.673  8.679   -7.282  1.00 0.00 ? 43  SER A C    4  
ATOM 5729  O O    . SER A 1 43  ? 15.590  8.691   -8.103  1.00 0.00 ? 43  SER A O    4  
ATOM 5730  C CB   . SER A 1 43  ? 15.110  8.148   -4.877  1.00 0.00 ? 43  SER A CB   4  
ATOM 5731  O OG   . SER A 1 43  ? 16.350  7.508   -5.119  1.00 0.00 ? 43  SER A OG   4  
ATOM 5732  H H    . SER A 1 43  ? 13.168  9.774   -4.722  1.00 0.00 ? 43  SER A H    4  
ATOM 5733  H HA   . SER A 1 43  ? 15.718  9.926   -5.901  1.00 0.00 ? 43  SER A HA   4  
ATOM 5734  H HB2  . SER A 1 43  ? 15.121  8.563   -3.880  1.00 0.00 ? 43  SER A HB2  4  
ATOM 5735  H HB3  . SER A 1 43  ? 14.319  7.417   -4.954  1.00 0.00 ? 43  SER A HB3  4  
ATOM 5736  H HG   . SER A 1 43  ? 16.820  7.396   -4.289  1.00 0.00 ? 43  SER A HG   4  
ATOM 5737  N N    . GLY A 1 44  ? 13.477  8.161   -7.542  1.00 0.00 ? 44  GLY A N    4  
ATOM 5738  C CA   . GLY A 1 44  ? 13.188  7.572   -8.837  1.00 0.00 ? 44  GLY A CA   4  
ATOM 5739  C C    . GLY A 1 44  ? 13.521  8.504   -9.985  1.00 0.00 ? 44  GLY A C    4  
ATOM 5740  O O    . GLY A 1 44  ? 13.713  9.703   -9.784  1.00 0.00 ? 44  GLY A O    4  
ATOM 5741  H H    . GLY A 1 44  ? 12.784  8.178   -6.849  1.00 0.00 ? 44  GLY A H    4  
ATOM 5742  H HA2  . GLY A 1 44  ? 13.765  6.665   -8.944  1.00 0.00 ? 44  GLY A HA2  4  
ATOM 5743  H HA3  . GLY A 1 44  ? 12.137  7.326   -8.882  1.00 0.00 ? 44  GLY A HA3  4  
ATOM 5744  N N    . ASN A 1 45  ? 13.592  7.953   -11.192 1.00 0.00 ? 45  ASN A N    4  
ATOM 5745  C CA   . ASN A 1 45  ? 13.907  8.743   -12.376 1.00 0.00 ? 45  ASN A CA   4  
ATOM 5746  C C    . ASN A 1 45  ? 12.649  9.384   -12.953 1.00 0.00 ? 45  ASN A C    4  
ATOM 5747  O O    . ASN A 1 45  ? 11.534  8.930   -12.696 1.00 0.00 ? 45  ASN A O    4  
ATOM 5748  C CB   . ASN A 1 45  ? 14.579  7.867   -13.436 1.00 0.00 ? 45  ASN A CB   4  
ATOM 5749  C CG   . ASN A 1 45  ? 13.576  7.225   -14.375 1.00 0.00 ? 45  ASN A CG   4  
ATOM 5750  O OD1  . ASN A 1 45  ? 13.258  6.042   -14.247 1.00 0.00 ? 45  ASN A OD1  4  
ATOM 5751  N ND2  . ASN A 1 45  ? 13.073  8.003   -15.326 1.00 0.00 ? 45  ASN A ND2  4  
ATOM 5752  H H    . ASN A 1 45  ? 13.429  6.991   -11.289 1.00 0.00 ? 45  ASN A H    4  
ATOM 5753  H HA   . ASN A 1 45  ? 14.592  9.524   -12.081 1.00 0.00 ? 45  ASN A HA   4  
ATOM 5754  H HB2  . ASN A 1 45  ? 15.253  8.475   -14.022 1.00 0.00 ? 45  ASN A HB2  4  
ATOM 5755  H HB3  . ASN A 1 45  ? 15.139  7.085   -12.946 1.00 0.00 ? 45  ASN A HB3  4  
ATOM 5756  H HD21 . ASN A 1 45  ? 13.373  8.936   -15.368 1.00 0.00 ? 45  ASN A HD21 4  
ATOM 5757  H HD22 . ASN A 1 45  ? 12.422  7.614   -15.946 1.00 0.00 ? 45  ASN A HD22 4  
ATOM 5758  N N    . GLY A 1 46  ? 12.835  10.442  -13.736 1.00 0.00 ? 46  GLY A N    4  
ATOM 5759  C CA   . GLY A 1 46  ? 11.707  11.128  -14.338 1.00 0.00 ? 46  GLY A CA   4  
ATOM 5760  C C    . GLY A 1 46  ? 10.495  11.159  -13.427 1.00 0.00 ? 46  GLY A C    4  
ATOM 5761  O O    . GLY A 1 46  ? 10.606  11.491  -12.248 1.00 0.00 ? 46  GLY A O    4  
ATOM 5762  H H    . GLY A 1 46  ? 13.747  10.760  -13.906 1.00 0.00 ? 46  GLY A H    4  
ATOM 5763  H HA2  . GLY A 1 46  ? 11.997  12.142  -14.568 1.00 0.00 ? 46  GLY A HA2  4  
ATOM 5764  H HA3  . GLY A 1 46  ? 11.440  10.623  -15.255 1.00 0.00 ? 46  GLY A HA3  4  
ATOM 5765  N N    . GLU A 1 47  ? 9.334   10.815  -13.977 1.00 0.00 ? 47  GLU A N    4  
ATOM 5766  C CA   . GLU A 1 47  ? 8.097   10.807  -13.206 1.00 0.00 ? 47  GLU A CA   4  
ATOM 5767  C C    . GLU A 1 47  ? 7.398   9.455   -13.312 1.00 0.00 ? 47  GLU A C    4  
ATOM 5768  O O    . GLU A 1 47  ? 7.418   8.815   -14.364 1.00 0.00 ? 47  GLU A O    4  
ATOM 5769  C CB   . GLU A 1 47  ? 7.161   11.916  -13.692 1.00 0.00 ? 47  GLU A CB   4  
ATOM 5770  C CG   . GLU A 1 47  ? 6.214   12.427  -12.619 1.00 0.00 ? 47  GLU A CG   4  
ATOM 5771  C CD   . GLU A 1 47  ? 5.085   13.265  -13.187 1.00 0.00 ? 47  GLU A CD   4  
ATOM 5772  O OE1  . GLU A 1 47  ? 5.318   13.969  -14.192 1.00 0.00 ? 47  GLU A OE1  4  
ATOM 5773  O OE2  . GLU A 1 47  ? 3.970   13.217  -12.628 1.00 0.00 ? 47  GLU A OE2  4  
ATOM 5774  H H    . GLU A 1 47  ? 9.310   10.560  -14.923 1.00 0.00 ? 47  GLU A H    4  
ATOM 5775  H HA   . GLU A 1 47  ? 8.349   10.989  -12.173 1.00 0.00 ? 47  GLU A HA   4  
ATOM 5776  H HB2  . GLU A 1 47  ? 7.757   12.746  -14.042 1.00 0.00 ? 47  GLU A HB2  4  
ATOM 5777  H HB3  . GLU A 1 47  ? 6.570   11.538  -14.513 1.00 0.00 ? 47  GLU A HB3  4  
ATOM 5778  H HG2  . GLU A 1 47  ? 5.787   11.581  -12.101 1.00 0.00 ? 47  GLU A HG2  4  
ATOM 5779  H HG3  . GLU A 1 47  ? 6.774   13.030  -11.919 1.00 0.00 ? 47  GLU A HG3  4  
ATOM 5780  N N    . ILE A 1 48  ? 6.782   9.027   -12.215 1.00 0.00 ? 48  ILE A N    4  
ATOM 5781  C CA   . ILE A 1 48  ? 6.077   7.751   -12.184 1.00 0.00 ? 48  ILE A CA   4  
ATOM 5782  C C    . ILE A 1 48  ? 4.846   7.782   -13.083 1.00 0.00 ? 48  ILE A C    4  
ATOM 5783  O O    . ILE A 1 48  ? 4.103   8.763   -13.101 1.00 0.00 ? 48  ILE A O    4  
ATOM 5784  C CB   . ILE A 1 48  ? 5.645   7.382   -10.753 1.00 0.00 ? 48  ILE A CB   4  
ATOM 5785  C CG1  . ILE A 1 48  ? 6.812   7.563   -9.781  1.00 0.00 ? 48  ILE A CG1  4  
ATOM 5786  C CG2  . ILE A 1 48  ? 5.129   5.951   -10.708 1.00 0.00 ? 48  ILE A CG2  4  
ATOM 5787  C CD1  . ILE A 1 48  ? 8.019   6.716   -10.120 1.00 0.00 ? 48  ILE A CD1  4  
ATOM 5788  H H    . ILE A 1 48  ? 6.802   9.582   -11.408 1.00 0.00 ? 48  ILE A H    4  
ATOM 5789  H HA   . ILE A 1 48  ? 6.753   6.988   -12.543 1.00 0.00 ? 48  ILE A HA   4  
ATOM 5790  H HB   . ILE A 1 48  ? 4.839   8.039   -10.463 1.00 0.00 ? 48  ILE A HB   4  
ATOM 5791  H HG12 . ILE A 1 48  ? 7.121   8.597   -9.788  1.00 0.00 ? 48  ILE A HG12 4  
ATOM 5792  H HG13 . ILE A 1 48  ? 6.487   7.296   -8.786  1.00 0.00 ? 48  ILE A HG13 4  
ATOM 5793  H HG21 . ILE A 1 48  ? 4.844   5.640   -11.703 1.00 0.00 ? 48  ILE A HG21 4  
ATOM 5794  H HG22 . ILE A 1 48  ? 5.906   5.300   -10.337 1.00 0.00 ? 48  ILE A HG22 4  
ATOM 5795  H HG23 . ILE A 1 48  ? 4.272   5.897   -10.055 1.00 0.00 ? 48  ILE A HG23 4  
ATOM 5796  H HD11 . ILE A 1 48  ? 7.731   5.941   -10.815 1.00 0.00 ? 48  ILE A HD11 4  
ATOM 5797  H HD12 . ILE A 1 48  ? 8.781   7.336   -10.567 1.00 0.00 ? 48  ILE A HD12 4  
ATOM 5798  H HD13 . ILE A 1 48  ? 8.406   6.264   -9.218  1.00 0.00 ? 48  ILE A HD13 4  
ATOM 5799  N N    . GLN A 1 49  ? 4.636   6.701   -13.827 1.00 0.00 ? 49  GLN A N    4  
ATOM 5800  C CA   . GLN A 1 49  ? 3.494   6.604   -14.728 1.00 0.00 ? 49  GLN A CA   4  
ATOM 5801  C C    . GLN A 1 49  ? 2.201   6.395   -13.947 1.00 0.00 ? 49  GLN A C    4  
ATOM 5802  O O    . GLN A 1 49  ? 1.276   7.202   -14.032 1.00 0.00 ? 49  GLN A O    4  
ATOM 5803  C CB   . GLN A 1 49  ? 3.695   5.456   -15.719 1.00 0.00 ? 49  GLN A CB   4  
ATOM 5804  C CG   . GLN A 1 49  ? 4.963   5.583   -16.548 1.00 0.00 ? 49  GLN A CG   4  
ATOM 5805  C CD   . GLN A 1 49  ? 4.863   6.662   -17.607 1.00 0.00 ? 49  GLN A CD   4  
ATOM 5806  O OE1  . GLN A 1 49  ? 4.067   7.594   -17.487 1.00 0.00 ? 49  GLN A OE1  4  
ATOM 5807  N NE2  . GLN A 1 49  ? 5.671   6.542   -18.654 1.00 0.00 ? 49  GLN A NE2  4  
ATOM 5808  H H    . GLN A 1 49  ? 5.264   5.951   -13.769 1.00 0.00 ? 49  GLN A H    4  
ATOM 5809  H HA   . GLN A 1 49  ? 3.424   7.531   -15.275 1.00 0.00 ? 49  GLN A HA   4  
ATOM 5810  H HB2  . GLN A 1 49  ? 3.739   4.527   -15.171 1.00 0.00 ? 49  GLN A HB2  4  
ATOM 5811  H HB3  . GLN A 1 49  ? 2.852   5.427   -16.394 1.00 0.00 ? 49  GLN A HB3  4  
ATOM 5812  H HG2  . GLN A 1 49  ? 5.785   5.822   -15.889 1.00 0.00 ? 49  GLN A HG2  4  
ATOM 5813  H HG3  . GLN A 1 49  ? 5.156   4.638   -17.033 1.00 0.00 ? 49  GLN A HG3  4  
ATOM 5814  H HE21 . GLN A 1 49  ? 6.279   5.772   -18.683 1.00 0.00 ? 49  GLN A HE21 4  
ATOM 5815  H HE22 . GLN A 1 49  ? 5.627   7.224   -19.354 1.00 0.00 ? 49  GLN A HE22 4  
ATOM 5816  N N    . ASN A 1 50  ? 2.143   5.307   -13.186 1.00 0.00 ? 50  ASN A N    4  
ATOM 5817  C CA   . ASN A 1 50  ? 0.963   4.993   -12.390 1.00 0.00 ? 50  ASN A CA   4  
ATOM 5818  C C    . ASN A 1 50  ? 1.358   4.518   -10.995 1.00 0.00 ? 50  ASN A C    4  
ATOM 5819  O O    . ASN A 1 50  ? 2.532   4.267   -10.722 1.00 0.00 ? 50  ASN A O    4  
ATOM 5820  C CB   . ASN A 1 50  ? 0.123   3.920   -13.087 1.00 0.00 ? 50  ASN A CB   4  
ATOM 5821  C CG   . ASN A 1 50  ? -1.251  3.765   -12.463 1.00 0.00 ? 50  ASN A CG   4  
ATOM 5822  O OD1  . ASN A 1 50  ? -1.901  4.751   -12.114 1.00 0.00 ? 50  ASN A OD1  4  
ATOM 5823  N ND2  . ASN A 1 50  ? -1.699  2.524   -12.320 1.00 0.00 ? 50  ASN A ND2  4  
ATOM 5824  H H    . ASN A 1 50  ? 2.913   4.701   -13.159 1.00 0.00 ? 50  ASN A H    4  
ATOM 5825  H HA   . ASN A 1 50  ? 0.375   5.894   -12.298 1.00 0.00 ? 50  ASN A HA   4  
ATOM 5826  H HB2  . ASN A 1 50  ? -0.004  4.190   -14.126 1.00 0.00 ? 50  ASN A HB2  4  
ATOM 5827  H HB3  . ASN A 1 50  ? 0.635   2.973   -13.025 1.00 0.00 ? 50  ASN A HB3  4  
ATOM 5828  H HD21 . ASN A 1 50  ? -1.126  1.787   -12.620 1.00 0.00 ? 50  ASN A HD21 4  
ATOM 5829  H HD22 . ASN A 1 50  ? -2.584  2.394   -11.920 1.00 0.00 ? 50  ASN A HD22 4  
ATOM 5830  N N    . TYR A 1 51  ? 0.369   4.395   -10.116 1.00 0.00 ? 51  TYR A N    4  
ATOM 5831  C CA   . TYR A 1 51  ? 0.613   3.951   -8.748  1.00 0.00 ? 51  TYR A CA   4  
ATOM 5832  C C    . TYR A 1 51  ? -0.272  2.760   -8.396  1.00 0.00 ? 51  TYR A C    4  
ATOM 5833  O O    . TYR A 1 51  ? -1.476  2.769   -8.650  1.00 0.00 ? 51  TYR A O    4  
ATOM 5834  C CB   . TYR A 1 51  ? 0.361   5.097   -7.766  1.00 0.00 ? 51  TYR A CB   4  
ATOM 5835  C CG   . TYR A 1 51  ? 1.454   6.141   -7.760  1.00 0.00 ? 51  TYR A CG   4  
ATOM 5836  C CD1  . TYR A 1 51  ? 2.721   5.846   -7.272  1.00 0.00 ? 51  TYR A CD1  4  
ATOM 5837  C CD2  . TYR A 1 51  ? 1.220   7.423   -8.243  1.00 0.00 ? 51  TYR A CD2  4  
ATOM 5838  C CE1  . TYR A 1 51  ? 3.723   6.798   -7.264  1.00 0.00 ? 51  TYR A CE1  4  
ATOM 5839  C CE2  . TYR A 1 51  ? 2.217   8.380   -8.240  1.00 0.00 ? 51  TYR A CE2  4  
ATOM 5840  C CZ   . TYR A 1 51  ? 3.466   8.063   -7.749  1.00 0.00 ? 51  TYR A CZ   4  
ATOM 5841  O OH   . TYR A 1 51  ? 4.461   9.014   -7.744  1.00 0.00 ? 51  TYR A OH   4  
ATOM 5842  H H    . TYR A 1 51  ? -0.546  4.609   -10.392 1.00 0.00 ? 51  TYR A H    4  
ATOM 5843  H HA   . TYR A 1 51  ? 1.648   3.650   -8.677  1.00 0.00 ? 51  TYR A HA   4  
ATOM 5844  H HB2  . TYR A 1 51  ? -0.564  5.587   -8.026  1.00 0.00 ? 51  TYR A HB2  4  
ATOM 5845  H HB3  . TYR A 1 51  ? 0.282   4.694   -6.767  1.00 0.00 ? 51  TYR A HB3  4  
ATOM 5846  H HD1  . TYR A 1 51  ? 2.920   4.855   -6.892  1.00 0.00 ? 51  TYR A HD1  4  
ATOM 5847  H HD2  . TYR A 1 51  ? 0.240   7.668   -8.626  1.00 0.00 ? 51  TYR A HD2  4  
ATOM 5848  H HE1  . TYR A 1 51  ? 4.702   6.550   -6.880  1.00 0.00 ? 51  TYR A HE1  4  
ATOM 5849  H HE2  . TYR A 1 51  ? 2.015   9.371   -8.620  1.00 0.00 ? 51  TYR A HE2  4  
ATOM 5850  H HH   . TYR A 1 51  ? 5.052   8.862   -8.484  1.00 0.00 ? 51  TYR A HH   4  
ATOM 5851  N N    . LYS A 1 52  ? 0.335   1.735   -7.807  1.00 0.00 ? 52  LYS A N    4  
ATOM 5852  C CA   . LYS A 1 52  ? -0.396  0.535   -7.417  1.00 0.00 ? 52  LYS A CA   4  
ATOM 5853  C C    . LYS A 1 52  ? -0.528  0.448   -5.899  1.00 0.00 ? 52  LYS A C    4  
ATOM 5854  O O    . LYS A 1 52  ? 0.465   0.529   -5.174  1.00 0.00 ? 52  LYS A O    4  
ATOM 5855  C CB   . LYS A 1 52  ? 0.310   -0.714  -7.950  1.00 0.00 ? 52  LYS A CB   4  
ATOM 5856  C CG   . LYS A 1 52  ? -0.629  -1.877  -8.216  1.00 0.00 ? 52  LYS A CG   4  
ATOM 5857  C CD   . LYS A 1 52  ? -0.021  -2.875  -9.187  1.00 0.00 ? 52  LYS A CD   4  
ATOM 5858  C CE   . LYS A 1 52  ? -1.094  -3.619  -9.968  1.00 0.00 ? 52  LYS A CE   4  
ATOM 5859  N NZ   . LYS A 1 52  ? -0.588  -4.909  -10.513 1.00 0.00 ? 52  LYS A NZ   4  
ATOM 5860  H H    . LYS A 1 52  ? 1.298   1.787   -7.630  1.00 0.00 ? 52  LYS A H    4  
ATOM 5861  H HA   . LYS A 1 52  ? -1.383  0.592   -7.849  1.00 0.00 ? 52  LYS A HA   4  
ATOM 5862  H HB2  . LYS A 1 52  ? 0.810   -0.463  -8.874  1.00 0.00 ? 52  LYS A HB2  4  
ATOM 5863  H HB3  . LYS A 1 52  ? 1.048   -1.032  -7.227  1.00 0.00 ? 52  LYS A HB3  4  
ATOM 5864  H HG2  . LYS A 1 52  ? -0.838  -2.380  -7.284  1.00 0.00 ? 52  LYS A HG2  4  
ATOM 5865  H HG3  . LYS A 1 52  ? -1.550  -1.496  -8.635  1.00 0.00 ? 52  LYS A HG3  4  
ATOM 5866  H HD2  . LYS A 1 52  ? 0.613   -2.346  -9.883  1.00 0.00 ? 52  LYS A HD2  4  
ATOM 5867  H HD3  . LYS A 1 52  ? 0.570   -3.590  -8.632  1.00 0.00 ? 52  LYS A HD3  4  
ATOM 5868  H HE2  . LYS A 1 52  ? -1.926  -3.817  -9.310  1.00 0.00 ? 52  LYS A HE2  4  
ATOM 5869  H HE3  . LYS A 1 52  ? -1.422  -2.995  -10.786 1.00 0.00 ? 52  LYS A HE3  4  
ATOM 5870  H HZ1  . LYS A 1 52  ? 0.445   -4.960  -10.410 1.00 0.00 ? 52  LYS A HZ1  4  
ATOM 5871  H HZ2  . LYS A 1 52  ? -0.829  -4.989  -11.522 1.00 0.00 ? 52  LYS A HZ2  4  
ATOM 5872  H HZ3  . LYS A 1 52  ? -1.017  -5.706  -10.001 1.00 0.00 ? 52  LYS A HZ3  4  
ATOM 5873  N N    . LEU A 1 53  ? -1.757  0.282   -5.425  1.00 0.00 ? 53  LEU A N    4  
ATOM 5874  C CA   . LEU A 1 53  ? -2.019  0.182   -3.994  1.00 0.00 ? 53  LEU A CA   4  
ATOM 5875  C C    . LEU A 1 53  ? -2.639  -1.167  -3.646  1.00 0.00 ? 53  LEU A C    4  
ATOM 5876  O O    . LEU A 1 53  ? -3.556  -1.633  -4.322  1.00 0.00 ? 53  LEU A O    4  
ATOM 5877  C CB   . LEU A 1 53  ? -2.946  1.313   -3.544  1.00 0.00 ? 53  LEU A CB   4  
ATOM 5878  C CG   . LEU A 1 53  ? -3.481  1.215   -2.116  1.00 0.00 ? 53  LEU A CG   4  
ATOM 5879  C CD1  . LEU A 1 53  ? -2.339  1.266   -1.113  1.00 0.00 ? 53  LEU A CD1  4  
ATOM 5880  C CD2  . LEU A 1 53  ? -4.482  2.328   -1.843  1.00 0.00 ? 53  LEU A CD2  4  
ATOM 5881  H H    . LEU A 1 53  ? -2.508  0.225   -6.052  1.00 0.00 ? 53  LEU A H    4  
ATOM 5882  H HA   . LEU A 1 53  ? -1.075  0.275   -3.478  1.00 0.00 ? 53  LEU A HA   4  
ATOM 5883  H HB2  . LEU A 1 53  ? -2.401  2.241   -3.630  1.00 0.00 ? 53  LEU A HB2  4  
ATOM 5884  H HB3  . LEU A 1 53  ? -3.793  1.331   -4.216  1.00 0.00 ? 53  LEU A HB3  4  
ATOM 5885  H HG   . LEU A 1 53  ? -3.990  0.268   -1.993  1.00 0.00 ? 53  LEU A HG   4  
ATOM 5886  H HD11 . LEU A 1 53  ? -2.298  0.336   -0.566  1.00 0.00 ? 53  LEU A HD11 4  
ATOM 5887  H HD12 . LEU A 1 53  ? -2.501  2.082   -0.424  1.00 0.00 ? 53  LEU A HD12 4  
ATOM 5888  H HD13 . LEU A 1 53  ? -1.406  1.417   -1.637  1.00 0.00 ? 53  LEU A HD13 4  
ATOM 5889  H HD21 . LEU A 1 53  ? -4.185  3.217   -2.378  1.00 0.00 ? 53  LEU A HD21 4  
ATOM 5890  H HD22 . LEU A 1 53  ? -4.508  2.537   -0.784  1.00 0.00 ? 53  LEU A HD22 4  
ATOM 5891  H HD23 . LEU A 1 53  ? -5.463  2.019   -2.174  1.00 0.00 ? 53  LEU A HD23 4  
ATOM 5892  N N    . TYR A 1 54  ? -2.133  -1.789  -2.587  1.00 0.00 ? 54  TYR A N    4  
ATOM 5893  C CA   . TYR A 1 54  ? -2.637  -3.086  -2.149  1.00 0.00 ? 54  TYR A CA   4  
ATOM 5894  C C    . TYR A 1 54  ? -3.371  -2.963  -0.817  1.00 0.00 ? 54  TYR A C    4  
ATOM 5895  O O    . TYR A 1 54  ? -3.201  -1.985  -0.089  1.00 0.00 ? 54  TYR A O    4  
ATOM 5896  C CB   . TYR A 1 54  ? -1.487  -4.086  -2.020  1.00 0.00 ? 54  TYR A CB   4  
ATOM 5897  C CG   . TYR A 1 54  ? -0.854  -4.454  -3.343  1.00 0.00 ? 54  TYR A CG   4  
ATOM 5898  C CD1  . TYR A 1 54  ? -0.117  -3.524  -4.066  1.00 0.00 ? 54  TYR A CD1  4  
ATOM 5899  C CD2  . TYR A 1 54  ? -0.991  -5.733  -3.868  1.00 0.00 ? 54  TYR A CD2  4  
ATOM 5900  C CE1  . TYR A 1 54  ? 0.462   -3.856  -5.275  1.00 0.00 ? 54  TYR A CE1  4  
ATOM 5901  C CE2  . TYR A 1 54  ? -0.413  -6.075  -5.076  1.00 0.00 ? 54  TYR A CE2  4  
ATOM 5902  C CZ   . TYR A 1 54  ? 0.312   -5.133  -5.776  1.00 0.00 ? 54  TYR A CZ   4  
ATOM 5903  O OH   . TYR A 1 54  ? 0.889   -5.468  -6.979  1.00 0.00 ? 54  TYR A OH   4  
ATOM 5904  H H    . TYR A 1 54  ? -1.402  -1.368  -2.088  1.00 0.00 ? 54  TYR A H    4  
ATOM 5905  H HA   . TYR A 1 54  ? -3.329  -3.442  -2.897  1.00 0.00 ? 54  TYR A HA   4  
ATOM 5906  H HB2  . TYR A 1 54  ? -0.719  -3.662  -1.392  1.00 0.00 ? 54  TYR A HB2  4  
ATOM 5907  H HB3  . TYR A 1 54  ? -1.857  -4.993  -1.565  1.00 0.00 ? 54  TYR A HB3  4  
ATOM 5908  H HD1  . TYR A 1 54  ? -0.001  -2.525  -3.670  1.00 0.00 ? 54  TYR A HD1  4  
ATOM 5909  H HD2  . TYR A 1 54  ? -1.559  -6.469  -3.318  1.00 0.00 ? 54  TYR A HD2  4  
ATOM 5910  H HE1  . TYR A 1 54  ? 1.030   -3.119  -5.823  1.00 0.00 ? 54  TYR A HE1  4  
ATOM 5911  H HE2  . TYR A 1 54  ? -0.531  -7.074  -5.469  1.00 0.00 ? 54  TYR A HE2  4  
ATOM 5912  H HH   . TYR A 1 54  ? 0.201   -5.634  -7.628  1.00 0.00 ? 54  TYR A HH   4  
ATOM 5913  N N    . TYR A 1 55  ? -4.188  -3.964  -0.506  1.00 0.00 ? 55  TYR A N    4  
ATOM 5914  C CA   . TYR A 1 55  ? -4.950  -3.969  0.737   1.00 0.00 ? 55  TYR A CA   4  
ATOM 5915  C C    . TYR A 1 55  ? -5.392  -5.383  1.099   1.00 0.00 ? 55  TYR A C    4  
ATOM 5916  O O    . TYR A 1 55  ? -6.009  -6.079  0.292   1.00 0.00 ? 55  TYR A O    4  
ATOM 5917  C CB   . TYR A 1 55  ? -6.172  -3.056  0.614   1.00 0.00 ? 55  TYR A CB   4  
ATOM 5918  C CG   . TYR A 1 55  ? -7.238  -3.593  -0.314  1.00 0.00 ? 55  TYR A CG   4  
ATOM 5919  C CD1  . TYR A 1 55  ? -7.093  -3.507  -1.693  1.00 0.00 ? 55  TYR A CD1  4  
ATOM 5920  C CD2  . TYR A 1 55  ? -8.390  -4.185  0.188   1.00 0.00 ? 55  TYR A CD2  4  
ATOM 5921  C CE1  . TYR A 1 55  ? -8.064  -3.995  -2.546  1.00 0.00 ? 55  TYR A CE1  4  
ATOM 5922  C CE2  . TYR A 1 55  ? -9.366  -4.678  -0.657  1.00 0.00 ? 55  TYR A CE2  4  
ATOM 5923  C CZ   . TYR A 1 55  ? -9.199  -4.580  -2.023  1.00 0.00 ? 55  TYR A CZ   4  
ATOM 5924  O OH   . TYR A 1 55  ? -10.169 -5.068  -2.867  1.00 0.00 ? 55  TYR A OH   4  
ATOM 5925  H H    . TYR A 1 55  ? -4.282  -4.716  -1.127  1.00 0.00 ? 55  TYR A H    4  
ATOM 5926  H HA   . TYR A 1 55  ? -4.310  -3.593  1.521   1.00 0.00 ? 55  TYR A HA   4  
ATOM 5927  H HB2  . TYR A 1 55  ? -6.616  -2.928  1.589   1.00 0.00 ? 55  TYR A HB2  4  
ATOM 5928  H HB3  . TYR A 1 55  ? -5.857  -2.094  0.238   1.00 0.00 ? 55  TYR A HB3  4  
ATOM 5929  H HD1  . TYR A 1 55  ? -6.203  -3.048  -2.100  1.00 0.00 ? 55  TYR A HD1  4  
ATOM 5930  H HD2  . TYR A 1 55  ? -8.518  -4.260  1.258   1.00 0.00 ? 55  TYR A HD2  4  
ATOM 5931  H HE1  . TYR A 1 55  ? -7.933  -3.920  -3.615  1.00 0.00 ? 55  TYR A HE1  4  
ATOM 5932  H HE2  . TYR A 1 55  ? -10.255 -5.135  -0.248  1.00 0.00 ? 55  TYR A HE2  4  
ATOM 5933  H HH   . TYR A 1 55  ? -10.911 -5.391  -2.350  1.00 0.00 ? 55  TYR A HH   4  
ATOM 5934  N N    . MET A 1 56  ? -5.073  -5.802  2.319   1.00 0.00 ? 56  MET A N    4  
ATOM 5935  C CA   . MET A 1 56  ? -5.439  -7.133  2.790   1.00 0.00 ? 56  MET A CA   4  
ATOM 5936  C C    . MET A 1 56  ? -5.642  -7.138  4.302   1.00 0.00 ? 56  MET A C    4  
ATOM 5937  O O    . MET A 1 56  ? -5.170  -6.244  5.003   1.00 0.00 ? 56  MET A O    4  
ATOM 5938  C CB   . MET A 1 56  ? -4.360  -8.148  2.405   1.00 0.00 ? 56  MET A CB   4  
ATOM 5939  C CG   . MET A 1 56  ? -3.274  -8.307  3.456   1.00 0.00 ? 56  MET A CG   4  
ATOM 5940  S SD   . MET A 1 56  ? -1.856  -9.243  2.852   1.00 0.00 ? 56  MET A SD   4  
ATOM 5941  C CE   . MET A 1 56  ? -1.665  -10.451 4.161   1.00 0.00 ? 56  MET A CE   4  
ATOM 5942  H H    . MET A 1 56  ? -4.581  -5.202  2.918   1.00 0.00 ? 56  MET A H    4  
ATOM 5943  H HA   . MET A 1 56  ? -6.367  -7.410  2.313   1.00 0.00 ? 56  MET A HA   4  
ATOM 5944  H HB2  . MET A 1 56  ? -4.826  -9.109  2.251   1.00 0.00 ? 56  MET A HB2  4  
ATOM 5945  H HB3  . MET A 1 56  ? -3.896  -7.830  1.484   1.00 0.00 ? 56  MET A HB3  4  
ATOM 5946  H HG2  . MET A 1 56  ? -2.937  -7.327  3.759   1.00 0.00 ? 56  MET A HG2  4  
ATOM 5947  H HG3  . MET A 1 56  ? -3.691  -8.822  4.309   1.00 0.00 ? 56  MET A HG3  4  
ATOM 5948  H HE1  . MET A 1 56  ? -0.708  -10.314 4.641   1.00 0.00 ? 56  MET A HE1  4  
ATOM 5949  H HE2  . MET A 1 56  ? -2.454  -10.322 4.887   1.00 0.00 ? 56  MET A HE2  4  
ATOM 5950  H HE3  . MET A 1 56  ? -1.719  -11.446 3.743   1.00 0.00 ? 56  MET A HE3  4  
ATOM 5951  N N    . GLU A 1 57  ? -6.347  -8.151  4.797   1.00 0.00 ? 57  GLU A N    4  
ATOM 5952  C CA   . GLU A 1 57  ? -6.612  -8.270  6.226   1.00 0.00 ? 57  GLU A CA   4  
ATOM 5953  C C    . GLU A 1 57  ? -5.487  -9.025  6.927   1.00 0.00 ? 57  GLU A C    4  
ATOM 5954  O O    . GLU A 1 57  ? -5.042  -10.075 6.461   1.00 0.00 ? 57  GLU A O    4  
ATOM 5955  C CB   . GLU A 1 57  ? -7.945  -8.984  6.461   1.00 0.00 ? 57  GLU A CB   4  
ATOM 5956  C CG   . GLU A 1 57  ? -8.250  -9.233  7.929   1.00 0.00 ? 57  GLU A CG   4  
ATOM 5957  C CD   . GLU A 1 57  ? -9.272  -10.335 8.133   1.00 0.00 ? 57  GLU A CD   4  
ATOM 5958  O OE1  . GLU A 1 57  ? -10.180 -10.465 7.286   1.00 0.00 ? 57  GLU A OE1  4  
ATOM 5959  O OE2  . GLU A 1 57  ? -9.164  -11.066 9.140   1.00 0.00 ? 57  GLU A OE2  4  
ATOM 5960  H H    . GLU A 1 57  ? -6.697  -8.833  4.187   1.00 0.00 ? 57  GLU A H    4  
ATOM 5961  H HA   . GLU A 1 57  ? -6.671  -7.273  6.636   1.00 0.00 ? 57  GLU A HA   4  
ATOM 5962  H HB2  . GLU A 1 57  ? -8.740  -8.383  6.046   1.00 0.00 ? 57  GLU A HB2  4  
ATOM 5963  H HB3  . GLU A 1 57  ? -7.923  -9.937  5.953   1.00 0.00 ? 57  GLU A HB3  4  
ATOM 5964  H HG2  . GLU A 1 57  ? -7.336  -9.513  8.431   1.00 0.00 ? 57  GLU A HG2  4  
ATOM 5965  H HG3  . GLU A 1 57  ? -8.633  -8.322  8.363   1.00 0.00 ? 57  GLU A HG3  4  
ATOM 5966  N N    . LYS A 1 58  ? -5.029  -8.483  8.050   1.00 0.00 ? 58  LYS A N    4  
ATOM 5967  C CA   . LYS A 1 58  ? -3.956  -9.104  8.818   1.00 0.00 ? 58  LYS A CA   4  
ATOM 5968  C C    . LYS A 1 58  ? -4.311  -10.541 9.185   1.00 0.00 ? 58  LYS A C    4  
ATOM 5969  O O    . LYS A 1 58  ? -5.042  -10.785 10.143  1.00 0.00 ? 58  LYS A O    4  
ATOM 5970  C CB   . LYS A 1 58  ? -3.677  -8.297  10.088  1.00 0.00 ? 58  LYS A CB   4  
ATOM 5971  C CG   . LYS A 1 58  ? -2.233  -8.375  10.553  1.00 0.00 ? 58  LYS A CG   4  
ATOM 5972  C CD   . LYS A 1 58  ? -1.344  -7.421  9.774   1.00 0.00 ? 58  LYS A CD   4  
ATOM 5973  C CE   . LYS A 1 58  ? 0.117   -7.841  9.840   1.00 0.00 ? 58  LYS A CE   4  
ATOM 5974  N NZ   . LYS A 1 58  ? 0.865   -7.442  8.616   1.00 0.00 ? 58  LYS A NZ   4  
ATOM 5975  H H    . LYS A 1 58  ? -5.424  -7.645  8.372   1.00 0.00 ? 58  LYS A H    4  
ATOM 5976  H HA   . LYS A 1 58  ? -3.069  -9.110  8.203   1.00 0.00 ? 58  LYS A HA   4  
ATOM 5977  H HB2  . LYS A 1 58  ? -3.918  -7.260  9.902   1.00 0.00 ? 58  LYS A HB2  4  
ATOM 5978  H HB3  . LYS A 1 58  ? -4.310  -8.667  10.882  1.00 0.00 ? 58  LYS A HB3  4  
ATOM 5979  H HG2  . LYS A 1 58  ? -2.188  -8.117  11.601  1.00 0.00 ? 58  LYS A HG2  4  
ATOM 5980  H HG3  . LYS A 1 58  ? -1.874  -9.384  10.413  1.00 0.00 ? 58  LYS A HG3  4  
ATOM 5981  H HD2  . LYS A 1 58  ? -1.657  -7.414  8.740   1.00 0.00 ? 58  LYS A HD2  4  
ATOM 5982  H HD3  . LYS A 1 58  ? -1.443  -6.429  10.189  1.00 0.00 ? 58  LYS A HD3  4  
ATOM 5983  H HE2  . LYS A 1 58  ? 0.573   -7.374  10.699  1.00 0.00 ? 58  LYS A HE2  4  
ATOM 5984  H HE3  . LYS A 1 58  ? 0.164   -8.915  9.946   1.00 0.00 ? 58  LYS A HE3  4  
ATOM 5985  H HZ1  . LYS A 1 58  ? 1.887   -7.437  8.809   1.00 0.00 ? 58  LYS A HZ1  4  
ATOM 5986  H HZ2  . LYS A 1 58  ? 0.576   -6.490  8.315   1.00 0.00 ? 58  LYS A HZ2  4  
ATOM 5987  H HZ3  . LYS A 1 58  ? 0.672   -8.112  7.844   1.00 0.00 ? 58  LYS A HZ3  4  
ATOM 5988  N N    . GLY A 1 59  ? -3.786  -11.491 8.416   1.00 0.00 ? 59  GLY A N    4  
ATOM 5989  C CA   . GLY A 1 59  ? -4.057  -12.892 8.677   1.00 0.00 ? 59  GLY A CA   4  
ATOM 5990  C C    . GLY A 1 59  ? -4.786  -13.565 7.531   1.00 0.00 ? 59  GLY A C    4  
ATOM 5991  O O    . GLY A 1 59  ? -5.558  -14.501 7.740   1.00 0.00 ? 59  GLY A O    4  
ATOM 5992  H H    . GLY A 1 59  ? -3.209  -11.237 7.665   1.00 0.00 ? 59  GLY A H    4  
ATOM 5993  H HA2  . GLY A 1 59  ? -3.121  -13.404 8.845   1.00 0.00 ? 59  GLY A HA2  4  
ATOM 5994  H HA3  . GLY A 1 59  ? -4.663  -12.969 9.568   1.00 0.00 ? 59  GLY A HA3  4  
ATOM 5995  N N    . THR A 1 60  ? -4.543  -13.086 6.315   1.00 0.00 ? 60  THR A N    4  
ATOM 5996  C CA   . THR A 1 60  ? -5.185  -13.645 5.131   1.00 0.00 ? 60  THR A CA   4  
ATOM 5997  C C    . THR A 1 60  ? -4.152  -14.203 4.158   1.00 0.00 ? 60  THR A C    4  
ATOM 5998  O O    . THR A 1 60  ? -4.419  -15.166 3.440   1.00 0.00 ? 60  THR A O    4  
ATOM 5999  C CB   . THR A 1 60  ? -6.040  -12.590 4.405   1.00 0.00 ? 60  THR A CB   4  
ATOM 6000  O OG1  . THR A 1 60  ? -6.559  -11.646 5.348   1.00 0.00 ? 60  THR A OG1  4  
ATOM 6001  C CG2  . THR A 1 60  ? -7.188  -13.248 3.654   1.00 0.00 ? 60  THR A CG2  4  
ATOM 6002  H H    . THR A 1 60  ? -3.918  -12.338 6.212   1.00 0.00 ? 60  THR A H    4  
ATOM 6003  H HA   . THR A 1 60  ? -5.834  -14.447 5.451   1.00 0.00 ? 60  THR A HA   4  
ATOM 6004  H HB   . THR A 1 60  ? -5.415  -12.070 3.693   1.00 0.00 ? 60  THR A HB   4  
ATOM 6005  H HG1  . THR A 1 60  ? -6.324  -10.756 5.074   1.00 0.00 ? 60  THR A HG1  4  
ATOM 6006  H HG21 . THR A 1 60  ? -7.558  -14.087 4.225   1.00 0.00 ? 60  THR A HG21 4  
ATOM 6007  H HG22 . THR A 1 60  ? -6.839  -13.593 2.692   1.00 0.00 ? 60  THR A HG22 4  
ATOM 6008  H HG23 . THR A 1 60  ? -7.983  -12.531 3.513   1.00 0.00 ? 60  THR A HG23 4  
ATOM 6009  N N    . ASP A 1 61  ? -2.972  -13.592 4.141   1.00 0.00 ? 61  ASP A N    4  
ATOM 6010  C CA   . ASP A 1 61  ? -1.898  -14.030 3.257   1.00 0.00 ? 61  ASP A CA   4  
ATOM 6011  C C    . ASP A 1 61  ? -2.299  -13.868 1.794   1.00 0.00 ? 61  ASP A C    4  
ATOM 6012  O O    . ASP A 1 61  ? -1.787  -14.566 0.918   1.00 0.00 ? 61  ASP A O    4  
ATOM 6013  C CB   . ASP A 1 61  ? -1.537  -15.488 3.541   1.00 0.00 ? 61  ASP A CB   4  
ATOM 6014  C CG   . ASP A 1 61  ? -1.020  -15.692 4.952   1.00 0.00 ? 61  ASP A CG   4  
ATOM 6015  O OD1  . ASP A 1 61  ? -1.564  -15.058 5.881   1.00 0.00 ? 61  ASP A OD1  4  
ATOM 6016  O OD2  . ASP A 1 61  ? -0.073  -16.486 5.128   1.00 0.00 ? 61  ASP A OD2  4  
ATOM 6017  H H    . ASP A 1 61  ? -2.820  -12.829 4.737   1.00 0.00 ? 61  ASP A H    4  
ATOM 6018  H HA   . ASP A 1 61  ? -1.036  -13.410 3.451   1.00 0.00 ? 61  ASP A HA   4  
ATOM 6019  H HB2  . ASP A 1 61  ? -2.415  -16.103 3.407   1.00 0.00 ? 61  ASP A HB2  4  
ATOM 6020  H HB3  . ASP A 1 61  ? -0.771  -15.804 2.848   1.00 0.00 ? 61  ASP A HB3  4  
ATOM 6021  N N    . LYS A 1 62  ? -3.218  -12.944 1.536   1.00 0.00 ? 62  LYS A N    4  
ATOM 6022  C CA   . LYS A 1 62  ? -3.689  -12.690 0.179   1.00 0.00 ? 62  LYS A CA   4  
ATOM 6023  C C    . LYS A 1 62  ? -4.108  -11.233 0.013   1.00 0.00 ? 62  LYS A C    4  
ATOM 6024  O O    . LYS A 1 62  ? -5.166  -10.824 0.490   1.00 0.00 ? 62  LYS A O    4  
ATOM 6025  C CB   . LYS A 1 62  ? -4.864  -13.611 -0.156  1.00 0.00 ? 62  LYS A CB   4  
ATOM 6026  C CG   . LYS A 1 62  ? -5.534  -13.285 -1.479  1.00 0.00 ? 62  LYS A CG   4  
ATOM 6027  C CD   . LYS A 1 62  ? -4.881  -14.026 -2.633  1.00 0.00 ? 62  LYS A CD   4  
ATOM 6028  C CE   . LYS A 1 62  ? -5.434  -15.435 -2.776  1.00 0.00 ? 62  LYS A CE   4  
ATOM 6029  N NZ   . LYS A 1 62  ? -6.790  -15.439 -3.392  1.00 0.00 ? 62  LYS A NZ   4  
ATOM 6030  H H    . LYS A 1 62  ? -3.589  -12.420 2.277   1.00 0.00 ? 62  LYS A H    4  
ATOM 6031  H HA   . LYS A 1 62  ? -2.875  -12.898 -0.499  1.00 0.00 ? 62  LYS A HA   4  
ATOM 6032  H HB2  . LYS A 1 62  ? -4.507  -14.629 -0.199  1.00 0.00 ? 62  LYS A HB2  4  
ATOM 6033  H HB3  . LYS A 1 62  ? -5.604  -13.531 0.628   1.00 0.00 ? 62  LYS A HB3  4  
ATOM 6034  H HG2  . LYS A 1 62  ? -6.575  -13.570 -1.426  1.00 0.00 ? 62  LYS A HG2  4  
ATOM 6035  H HG3  . LYS A 1 62  ? -5.459  -12.221 -1.658  1.00 0.00 ? 62  LYS A HG3  4  
ATOM 6036  H HD2  . LYS A 1 62  ? -5.066  -13.484 -3.549  1.00 0.00 ? 62  LYS A HD2  4  
ATOM 6037  H HD3  . LYS A 1 62  ? -3.816  -14.083 -2.456  1.00 0.00 ? 62  LYS A HD3  4  
ATOM 6038  H HE2  . LYS A 1 62  ? -4.764  -16.010 -3.396  1.00 0.00 ? 62  LYS A HE2  4  
ATOM 6039  H HE3  . LYS A 1 62  ? -5.493  -15.885 -1.795  1.00 0.00 ? 62  LYS A HE3  4  
ATOM 6040  H HZ1  . LYS A 1 62  ? -6.799  -16.055 -4.230  1.00 0.00 ? 62  LYS A HZ1  4  
ATOM 6041  H HZ2  . LYS A 1 62  ? -7.054  -14.476 -3.682  1.00 0.00 ? 62  LYS A HZ2  4  
ATOM 6042  H HZ3  . LYS A 1 62  ? -7.492  -15.789 -2.710  1.00 0.00 ? 62  LYS A HZ3  4  
ATOM 6043  N N    . GLU A 1 63  ? -3.272  -10.455 -0.667  1.00 0.00 ? 63  GLU A N    4  
ATOM 6044  C CA   . GLU A 1 63  ? -3.557  -9.044  -0.896  1.00 0.00 ? 63  GLU A CA   4  
ATOM 6045  C C    . GLU A 1 63  ? -4.007  -8.806  -2.335  1.00 0.00 ? 63  GLU A C    4  
ATOM 6046  O O    . GLU A 1 63  ? -3.714  -9.602  -3.226  1.00 0.00 ? 63  GLU A O    4  
ATOM 6047  C CB   . GLU A 1 63  ? -2.322  -8.194  -0.589  1.00 0.00 ? 63  GLU A CB   4  
ATOM 6048  C CG   . GLU A 1 63  ? -1.238  -8.291  -1.649  1.00 0.00 ? 63  GLU A CG   4  
ATOM 6049  C CD   . GLU A 1 63  ? -0.302  -9.462  -1.422  1.00 0.00 ? 63  GLU A CD   4  
ATOM 6050  O OE1  . GLU A 1 63  ? -0.068  -9.816  -0.247  1.00 0.00 ? 63  GLU A OE1  4  
ATOM 6051  O OE2  . GLU A 1 63  ? 0.195   -10.026 -2.419  1.00 0.00 ? 63  GLU A OE2  4  
ATOM 6052  H H    . GLU A 1 63  ? -2.443  -10.839 -1.023  1.00 0.00 ? 63  GLU A H    4  
ATOM 6053  H HA   . GLU A 1 63  ? -4.356  -8.754  -0.230  1.00 0.00 ? 63  GLU A HA   4  
ATOM 6054  H HB2  . GLU A 1 63  ? -2.623  -7.160  -0.505  1.00 0.00 ? 63  GLU A HB2  4  
ATOM 6055  H HB3  . GLU A 1 63  ? -1.904  -8.516  0.353   1.00 0.00 ? 63  GLU A HB3  4  
ATOM 6056  H HG2  . GLU A 1 63  ? -1.706  -8.407  -2.615  1.00 0.00 ? 63  GLU A HG2  4  
ATOM 6057  H HG3  . GLU A 1 63  ? -0.659  -7.379  -1.639  1.00 0.00 ? 63  GLU A HG3  4  
ATOM 6058  N N    . GLN A 1 64  ? -4.720  -7.705  -2.552  1.00 0.00 ? 64  GLN A N    4  
ATOM 6059  C CA   . GLN A 1 64  ? -5.211  -7.364  -3.881  1.00 0.00 ? 64  GLN A CA   4  
ATOM 6060  C C    . GLN A 1 64  ? -4.513  -6.118  -4.416  1.00 0.00 ? 64  GLN A C    4  
ATOM 6061  O O    . GLN A 1 64  ? -3.625  -5.565  -3.767  1.00 0.00 ? 64  GLN A O    4  
ATOM 6062  C CB   . GLN A 1 64  ? -6.724  -7.140  -3.847  1.00 0.00 ? 64  GLN A CB   4  
ATOM 6063  C CG   . GLN A 1 64  ? -7.526  -8.423  -3.710  1.00 0.00 ? 64  GLN A CG   4  
ATOM 6064  C CD   . GLN A 1 64  ? -8.874  -8.202  -3.051  1.00 0.00 ? 64  GLN A CD   4  
ATOM 6065  O OE1  . GLN A 1 64  ? -9.033  -7.305  -2.223  1.00 0.00 ? 64  GLN A OE1  4  
ATOM 6066  N NE2  . GLN A 1 64  ? -9.853  -9.021  -3.415  1.00 0.00 ? 64  GLN A NE2  4  
ATOM 6067  H H    . GLN A 1 64  ? -4.921  -7.110  -1.800  1.00 0.00 ? 64  GLN A H    4  
ATOM 6068  H HA   . GLN A 1 64  ? -4.994  -8.192  -4.538  1.00 0.00 ? 64  GLN A HA   4  
ATOM 6069  H HB2  . GLN A 1 64  ? -6.963  -6.500  -3.011  1.00 0.00 ? 64  GLN A HB2  4  
ATOM 6070  H HB3  . GLN A 1 64  ? -7.024  -6.650  -4.762  1.00 0.00 ? 64  GLN A HB3  4  
ATOM 6071  H HG2  . GLN A 1 64  ? -7.688  -8.839  -4.693  1.00 0.00 ? 64  GLN A HG2  4  
ATOM 6072  H HG3  . GLN A 1 64  ? -6.961  -9.124  -3.113  1.00 0.00 ? 64  GLN A HG3  4  
ATOM 6073  H HE21 . GLN A 1 64  ? -9.653  -9.714  -4.080  1.00 0.00 ? 64  GLN A HE21 4  
ATOM 6074  H HE22 . GLN A 1 64  ? -10.734 -8.901  -3.005  1.00 0.00 ? 64  GLN A HE22 4  
ATOM 6075  N N    . ASP A 1 65  ? -4.919  -5.681  -5.603  1.00 0.00 ? 65  ASP A N    4  
ATOM 6076  C CA   . ASP A 1 65  ? -4.333  -4.500  -6.225  1.00 0.00 ? 65  ASP A CA   4  
ATOM 6077  C C    . ASP A 1 65  ? -5.410  -3.635  -6.872  1.00 0.00 ? 65  ASP A C    4  
ATOM 6078  O O    . ASP A 1 65  ? -6.245  -4.128  -7.631  1.00 0.00 ? 65  ASP A O    4  
ATOM 6079  C CB   . ASP A 1 65  ? -3.295  -4.910  -7.271  1.00 0.00 ? 65  ASP A CB   4  
ATOM 6080  C CG   . ASP A 1 65  ? -3.925  -5.266  -8.603  1.00 0.00 ? 65  ASP A CG   4  
ATOM 6081  O OD1  . ASP A 1 65  ? -4.327  -4.337  -9.335  1.00 0.00 ? 65  ASP A OD1  4  
ATOM 6082  O OD2  . ASP A 1 65  ? -4.016  -6.472  -8.914  1.00 0.00 ? 65  ASP A OD2  4  
ATOM 6083  H H    . ASP A 1 65  ? -5.632  -6.165  -6.072  1.00 0.00 ? 65  ASP A H    4  
ATOM 6084  H HA   . ASP A 1 65  ? -3.844  -3.926  -5.452  1.00 0.00 ? 65  ASP A HA   4  
ATOM 6085  H HB2  . ASP A 1 65  ? -2.607  -4.092  -7.426  1.00 0.00 ? 65  ASP A HB2  4  
ATOM 6086  H HB3  . ASP A 1 65  ? -2.750  -5.770  -6.910  1.00 0.00 ? 65  ASP A HB3  4  
ATOM 6087  N N    . VAL A 1 66  ? -5.387  -2.342  -6.565  1.00 0.00 ? 66  VAL A N    4  
ATOM 6088  C CA   . VAL A 1 66  ? -6.361  -1.407  -7.116  1.00 0.00 ? 66  VAL A CA   4  
ATOM 6089  C C    . VAL A 1 66  ? -5.674  -0.289  -7.890  1.00 0.00 ? 66  VAL A C    4  
ATOM 6090  O O    . VAL A 1 66  ? -4.778  0.379   -7.373  1.00 0.00 ? 66  VAL A O    4  
ATOM 6091  C CB   . VAL A 1 66  ? -7.234  -0.788  -6.008  1.00 0.00 ? 66  VAL A CB   4  
ATOM 6092  C CG1  . VAL A 1 66  ? -8.053  -1.863  -5.309  1.00 0.00 ? 66  VAL A CG1  4  
ATOM 6093  C CG2  . VAL A 1 66  ? -6.370  -0.032  -5.010  1.00 0.00 ? 66  VAL A CG2  4  
ATOM 6094  H H    . VAL A 1 66  ? -4.697  -2.008  -5.954  1.00 0.00 ? 66  VAL A H    4  
ATOM 6095  H HA   . VAL A 1 66  ? -7.006  -1.955  -7.788  1.00 0.00 ? 66  VAL A HA   4  
ATOM 6096  H HB   . VAL A 1 66  ? -7.917  -0.087  -6.465  1.00 0.00 ? 66  VAL A HB   4  
ATOM 6097  H HG11 . VAL A 1 66  ? -8.259  -1.555  -4.295  1.00 0.00 ? 66  VAL A HG11 4  
ATOM 6098  H HG12 . VAL A 1 66  ? -8.983  -2.009  -5.839  1.00 0.00 ? 66  VAL A HG12 4  
ATOM 6099  H HG13 . VAL A 1 66  ? -7.496  -2.789  -5.298  1.00 0.00 ? 66  VAL A HG13 4  
ATOM 6100  H HG21 . VAL A 1 66  ? -6.917  0.100   -4.088  1.00 0.00 ? 66  VAL A HG21 4  
ATOM 6101  H HG22 . VAL A 1 66  ? -5.468  -0.594  -4.815  1.00 0.00 ? 66  VAL A HG22 4  
ATOM 6102  H HG23 . VAL A 1 66  ? -6.110  0.934   -5.417  1.00 0.00 ? 66  VAL A HG23 4  
ATOM 6103  N N    . ASP A 1 67  ? -6.098  -0.090  -9.133  1.00 0.00 ? 67  ASP A N    4  
ATOM 6104  C CA   . ASP A 1 67  ? -5.524  0.949   -9.980  1.00 0.00 ? 67  ASP A CA   4  
ATOM 6105  C C    . ASP A 1 67  ? -5.960  2.334   -9.512  1.00 0.00 ? 67  ASP A C    4  
ATOM 6106  O O    . ASP A 1 67  ? -7.150  2.646   -9.487  1.00 0.00 ? 67  ASP A O    4  
ATOM 6107  C CB   . ASP A 1 67  ? -5.938  0.736   -11.437 1.00 0.00 ? 67  ASP A CB   4  
ATOM 6108  C CG   . ASP A 1 67  ? -5.014  -0.218  -12.168 1.00 0.00 ? 67  ASP A CG   4  
ATOM 6109  O OD1  . ASP A 1 67  ? -3.810  -0.247  -11.839 1.00 0.00 ? 67  ASP A OD1  4  
ATOM 6110  O OD2  . ASP A 1 67  ? -5.495  -0.936  -13.071 1.00 0.00 ? 67  ASP A OD2  4  
ATOM 6111  H H    . ASP A 1 67  ? -6.815  -0.656  -9.490  1.00 0.00 ? 67  ASP A H    4  
ATOM 6112  H HA   . ASP A 1 67  ? -4.449  0.880   -9.908  1.00 0.00 ? 67  ASP A HA   4  
ATOM 6113  H HB2  . ASP A 1 67  ? -6.939  0.330   -11.464 1.00 0.00 ? 67  ASP A HB2  4  
ATOM 6114  H HB3  . ASP A 1 67  ? -5.926  1.686   -11.951 1.00 0.00 ? 67  ASP A HB3  4  
ATOM 6115  N N    . VAL A 1 68  ? -4.987  3.160   -9.140  1.00 0.00 ? 68  VAL A N    4  
ATOM 6116  C CA   . VAL A 1 68  ? -5.270  4.512   -8.672  1.00 0.00 ? 68  VAL A CA   4  
ATOM 6117  C C    . VAL A 1 68  ? -4.477  5.545   -9.465  1.00 0.00 ? 68  VAL A C    4  
ATOM 6118  O O    . VAL A 1 68  ? -3.394  5.255   -9.973  1.00 0.00 ? 68  VAL A O    4  
ATOM 6119  C CB   . VAL A 1 68  ? -4.942  4.668   -7.175  1.00 0.00 ? 68  VAL A CB   4  
ATOM 6120  C CG1  . VAL A 1 68  ? -5.278  6.072   -6.698  1.00 0.00 ? 68  VAL A CG1  4  
ATOM 6121  C CG2  . VAL A 1 68  ? -5.687  3.625   -6.356  1.00 0.00 ? 68  VAL A CG2  4  
ATOM 6122  H H    . VAL A 1 68  ? -4.057  2.854   -9.182  1.00 0.00 ? 68  VAL A H    4  
ATOM 6123  H HA   . VAL A 1 68  ? -6.325  4.699   -8.810  1.00 0.00 ? 68  VAL A HA   4  
ATOM 6124  H HB   . VAL A 1 68  ? -3.882  4.510   -7.041  1.00 0.00 ? 68  VAL A HB   4  
ATOM 6125  H HG11 . VAL A 1 68  ? -6.336  6.252   -6.825  1.00 0.00 ? 68  VAL A HG11 4  
ATOM 6126  H HG12 . VAL A 1 68  ? -5.018  6.171   -5.655  1.00 0.00 ? 68  VAL A HG12 4  
ATOM 6127  H HG13 . VAL A 1 68  ? -4.720  6.793   -7.278  1.00 0.00 ? 68  VAL A HG13 4  
ATOM 6128  H HG21 . VAL A 1 68  ? -5.606  2.663   -6.840  1.00 0.00 ? 68  VAL A HG21 4  
ATOM 6129  H HG22 . VAL A 1 68  ? -5.256  3.568   -5.367  1.00 0.00 ? 68  VAL A HG22 4  
ATOM 6130  H HG23 . VAL A 1 68  ? -6.728  3.903   -6.279  1.00 0.00 ? 68  VAL A HG23 4  
ATOM 6131  N N    . SER A 1 69  ? -5.024  6.752   -9.567  1.00 0.00 ? 69  SER A N    4  
ATOM 6132  C CA   . SER A 1 69  ? -4.369  7.829   -10.301 1.00 0.00 ? 69  SER A CA   4  
ATOM 6133  C C    . SER A 1 69  ? -3.894  8.923   -9.350  1.00 0.00 ? 69  SER A C    4  
ATOM 6134  O O    . SER A 1 69  ? -2.838  9.523   -9.555  1.00 0.00 ? 69  SER A O    4  
ATOM 6135  C CB   . SER A 1 69  ? -5.323  8.419   -11.341 1.00 0.00 ? 69  SER A CB   4  
ATOM 6136  O OG   . SER A 1 69  ? -6.465  8.986   -10.721 1.00 0.00 ? 69  SER A OG   4  
ATOM 6137  H H    . SER A 1 69  ? -5.890  6.922   -9.140  1.00 0.00 ? 69  SER A H    4  
ATOM 6138  H HA   . SER A 1 69  ? -3.512  7.411   -10.807 1.00 0.00 ? 69  SER A HA   4  
ATOM 6139  H HB2  . SER A 1 69  ? -4.812  9.189   -11.899 1.00 0.00 ? 69  SER A HB2  4  
ATOM 6140  H HB3  . SER A 1 69  ? -5.644  7.639   -12.015 1.00 0.00 ? 69  SER A HB3  4  
ATOM 6141  H HG   . SER A 1 69  ? -6.190  9.526   -9.976  1.00 0.00 ? 69  SER A HG   4  
ATOM 6142  N N    . SER A 1 70  ? -4.681  9.178   -8.310  1.00 0.00 ? 70  SER A N    4  
ATOM 6143  C CA   . SER A 1 70  ? -4.344  10.203  -7.329  1.00 0.00 ? 70  SER A CA   4  
ATOM 6144  C C    . SER A 1 70  ? -3.358  9.664   -6.297  1.00 0.00 ? 70  SER A C    4  
ATOM 6145  O O    . SER A 1 70  ? -3.042  8.474   -6.286  1.00 0.00 ? 70  SER A O    4  
ATOM 6146  C CB   . SER A 1 70  ? -5.608  10.705  -6.630  1.00 0.00 ? 70  SER A CB   4  
ATOM 6147  O OG   . SER A 1 70  ? -6.373  11.533  -7.489  1.00 0.00 ? 70  SER A OG   4  
ATOM 6148  H H    . SER A 1 70  ? -5.510  8.666   -8.202  1.00 0.00 ? 70  SER A H    4  
ATOM 6149  H HA   . SER A 1 70  ? -3.883  11.026  -7.855  1.00 0.00 ? 70  SER A HA   4  
ATOM 6150  H HB2  . SER A 1 70  ? -6.211  9.861   -6.332  1.00 0.00 ? 70  SER A HB2  4  
ATOM 6151  H HB3  . SER A 1 70  ? -5.330  11.275  -5.755  1.00 0.00 ? 70  SER A HB3  4  
ATOM 6152  H HG   . SER A 1 70  ? -5.859  12.308  -7.728  1.00 0.00 ? 70  SER A HG   4  
ATOM 6153  N N    . HIS A 1 71  ? -2.874  10.549  -5.431  1.00 0.00 ? 71  HIS A N    4  
ATOM 6154  C CA   . HIS A 1 71  ? -1.924  10.163  -4.394  1.00 0.00 ? 71  HIS A CA   4  
ATOM 6155  C C    . HIS A 1 71  ? -2.651  9.630   -3.163  1.00 0.00 ? 71  HIS A C    4  
ATOM 6156  O O    . HIS A 1 71  ? -2.101  8.834   -2.402  1.00 0.00 ? 71  HIS A O    4  
ATOM 6157  C CB   . HIS A 1 71  ? -1.048  11.355  -4.007  1.00 0.00 ? 71  HIS A CB   4  
ATOM 6158  C CG   . HIS A 1 71  ? -0.072  11.752  -5.072  1.00 0.00 ? 71  HIS A CG   4  
ATOM 6159  N ND1  . HIS A 1 71  ? -0.239  12.865  -5.868  1.00 0.00 ? 71  HIS A ND1  4  
ATOM 6160  C CD2  . HIS A 1 71  ? 1.088   11.178  -5.468  1.00 0.00 ? 71  HIS A CD2  4  
ATOM 6161  C CE1  . HIS A 1 71  ? 0.775   12.957  -6.710  1.00 0.00 ? 71  HIS A CE1  4  
ATOM 6162  N NE2  . HIS A 1 71  ? 1.595   11.946  -6.488  1.00 0.00 ? 71  HIS A NE2  4  
ATOM 6163  H H    . HIS A 1 71  ? -3.164  11.483  -5.491  1.00 0.00 ? 71  HIS A H    4  
ATOM 6164  H HA   . HIS A 1 71  ? -1.297  9.381   -4.793  1.00 0.00 ? 71  HIS A HA   4  
ATOM 6165  H HB2  . HIS A 1 71  ? -1.679  12.207  -3.803  1.00 0.00 ? 71  HIS A HB2  4  
ATOM 6166  H HB3  . HIS A 1 71  ? -0.487  11.107  -3.117  1.00 0.00 ? 71  HIS A HB3  4  
ATOM 6167  H HD1  . HIS A 1 71  ? -0.989  13.493  -5.824  1.00 0.00 ? 71  HIS A HD1  4  
ATOM 6168  H HD2  . HIS A 1 71  ? 1.533   10.281  -5.060  1.00 0.00 ? 71  HIS A HD2  4  
ATOM 6169  H HE1  . HIS A 1 71  ? 0.912   13.729  -7.453  1.00 0.00 ? 71  HIS A HE1  4  
ATOM 6170  H HE2  . HIS A 1 71  ? 2.382   11.727  -7.029  1.00 0.00 ? 71  HIS A HE2  4  
ATOM 6171  N N    . SER A 1 72  ? -3.889  10.075  -2.974  1.00 0.00 ? 72  SER A N    4  
ATOM 6172  C CA   . SER A 1 72  ? -4.689  9.646   -1.832  1.00 0.00 ? 72  SER A CA   4  
ATOM 6173  C C    . SER A 1 72  ? -5.943  8.911   -2.294  1.00 0.00 ? 72  SER A C    4  
ATOM 6174  O O    . SER A 1 72  ? -6.798  9.483   -2.972  1.00 0.00 ? 72  SER A O    4  
ATOM 6175  C CB   . SER A 1 72  ? -5.077  10.850  -0.973  1.00 0.00 ? 72  SER A CB   4  
ATOM 6176  O OG   . SER A 1 72  ? -5.841  11.783  -1.718  1.00 0.00 ? 72  SER A OG   4  
ATOM 6177  H H    . SER A 1 72  ? -4.272  10.709  -3.615  1.00 0.00 ? 72  SER A H    4  
ATOM 6178  H HA   . SER A 1 72  ? -4.088  8.971   -1.241  1.00 0.00 ? 72  SER A HA   4  
ATOM 6179  H HB2  . SER A 1 72  ? -5.663  10.515  -0.131  1.00 0.00 ? 72  SER A HB2  4  
ATOM 6180  H HB3  . SER A 1 72  ? -4.181  11.338  -0.617  1.00 0.00 ? 72  SER A HB3  4  
ATOM 6181  H HG   . SER A 1 72  ? -5.405  11.958  -2.555  1.00 0.00 ? 72  SER A HG   4  
ATOM 6182  N N    . TYR A 1 73  ? -6.047  7.639   -1.923  1.00 0.00 ? 73  TYR A N    4  
ATOM 6183  C CA   . TYR A 1 73  ? -7.195  6.824   -2.300  1.00 0.00 ? 73  TYR A CA   4  
ATOM 6184  C C    . TYR A 1 73  ? -8.050  6.490   -1.081  1.00 0.00 ? 73  TYR A C    4  
ATOM 6185  O O    . TYR A 1 73  ? -7.566  6.487   0.051   1.00 0.00 ? 73  TYR A O    4  
ATOM 6186  C CB   . TYR A 1 73  ? -6.730  5.535   -2.980  1.00 0.00 ? 73  TYR A CB   4  
ATOM 6187  C CG   . TYR A 1 73  ? -7.865  4.682   -3.500  1.00 0.00 ? 73  TYR A CG   4  
ATOM 6188  C CD1  . TYR A 1 73  ? -8.594  5.066   -4.618  1.00 0.00 ? 73  TYR A CD1  4  
ATOM 6189  C CD2  . TYR A 1 73  ? -8.208  3.490   -2.873  1.00 0.00 ? 73  TYR A CD2  4  
ATOM 6190  C CE1  . TYR A 1 73  ? -9.632  4.290   -5.096  1.00 0.00 ? 73  TYR A CE1  4  
ATOM 6191  C CE2  . TYR A 1 73  ? -9.243  2.706   -3.344  1.00 0.00 ? 73  TYR A CE2  4  
ATOM 6192  C CZ   . TYR A 1 73  ? -9.953  3.111   -4.456  1.00 0.00 ? 73  TYR A CZ   4  
ATOM 6193  O OH   . TYR A 1 73  ? -10.985 2.334   -4.930  1.00 0.00 ? 73  TYR A OH   4  
ATOM 6194  H H    . TYR A 1 73  ? -5.334  7.239   -1.383  1.00 0.00 ? 73  TYR A H    4  
ATOM 6195  H HA   . TYR A 1 73  ? -7.791  7.393   -2.998  1.00 0.00 ? 73  TYR A HA   4  
ATOM 6196  H HB2  . TYR A 1 73  ? -6.095  5.786   -3.816  1.00 0.00 ? 73  TYR A HB2  4  
ATOM 6197  H HB3  . TYR A 1 73  ? -6.169  4.945   -2.271  1.00 0.00 ? 73  TYR A HB3  4  
ATOM 6198  H HD1  . TYR A 1 73  ? -8.340  5.990   -5.118  1.00 0.00 ? 73  TYR A HD1  4  
ATOM 6199  H HD2  . TYR A 1 73  ? -7.650  3.176   -2.002  1.00 0.00 ? 73  TYR A HD2  4  
ATOM 6200  H HE1  . TYR A 1 73  ? -10.188 4.606   -5.967  1.00 0.00 ? 73  TYR A HE1  4  
ATOM 6201  H HE2  . TYR A 1 73  ? -9.495  1.783   -2.843  1.00 0.00 ? 73  TYR A HE2  4  
ATOM 6202  H HH   . TYR A 1 73  ? -10.823 1.415   -4.703  1.00 0.00 ? 73  TYR A HH   4  
ATOM 6203  N N    . THR A 1 74  ? -9.327  6.206   -1.322  1.00 0.00 ? 74  THR A N    4  
ATOM 6204  C CA   . THR A 1 74  ? -10.251 5.871   -0.246  1.00 0.00 ? 74  THR A CA   4  
ATOM 6205  C C    . THR A 1 74  ? -10.901 4.513   -0.483  1.00 0.00 ? 74  THR A C    4  
ATOM 6206  O O    . THR A 1 74  ? -11.730 4.359   -1.381  1.00 0.00 ? 74  THR A O    4  
ATOM 6207  C CB   . THR A 1 74  ? -11.353 6.936   -0.099  1.00 0.00 ? 74  THR A CB   4  
ATOM 6208  O OG1  . THR A 1 74  ? -10.772 8.199   0.245   1.00 0.00 ? 74  THR A OG1  4  
ATOM 6209  C CG2  . THR A 1 74  ? -12.361 6.529   0.965   1.00 0.00 ? 74  THR A CG2  4  
ATOM 6210  H H    . THR A 1 74  ? -9.653  6.225   -2.245  1.00 0.00 ? 74  THR A H    4  
ATOM 6211  H HA   . THR A 1 74  ? -9.689  5.834   0.677   1.00 0.00 ? 74  THR A HA   4  
ATOM 6212  H HB   . THR A 1 74  ? -11.868 7.032   -1.045  1.00 0.00 ? 74  THR A HB   4  
ATOM 6213  H HG1  . THR A 1 74  ? -9.860  8.224   -0.056  1.00 0.00 ? 74  THR A HG1  4  
ATOM 6214  H HG21 . THR A 1 74  ? -13.156 5.958   0.508   1.00 0.00 ? 74  THR A HG21 4  
ATOM 6215  H HG22 . THR A 1 74  ? -12.773 7.414   1.427   1.00 0.00 ? 74  THR A HG22 4  
ATOM 6216  H HG23 . THR A 1 74  ? -11.870 5.927   1.714   1.00 0.00 ? 74  THR A HG23 4  
ATOM 6217  N N    . ILE A 1 75  ? -10.520 3.530   0.326   1.00 0.00 ? 75  ILE A N    4  
ATOM 6218  C CA   . ILE A 1 75  ? -11.068 2.185   0.204   1.00 0.00 ? 75  ILE A CA   4  
ATOM 6219  C C    . ILE A 1 75  ? -12.322 2.023   1.057   1.00 0.00 ? 75  ILE A C    4  
ATOM 6220  O O    . ILE A 1 75  ? -12.312 2.312   2.253   1.00 0.00 ? 75  ILE A O    4  
ATOM 6221  C CB   . ILE A 1 75  ? -10.038 1.118   0.618   1.00 0.00 ? 75  ILE A CB   4  
ATOM 6222  C CG1  . ILE A 1 75  ? -8.785  1.222   -0.254  1.00 0.00 ? 75  ILE A CG1  4  
ATOM 6223  C CG2  . ILE A 1 75  ? -10.646 -0.273  0.516   1.00 0.00 ? 75  ILE A CG2  4  
ATOM 6224  C CD1  . ILE A 1 75  ? -7.558  0.596   0.372   1.00 0.00 ? 75  ILE A CD1  4  
ATOM 6225  H H    . ILE A 1 75  ? -9.855  3.714   1.022   1.00 0.00 ? 75  ILE A H    4  
ATOM 6226  H HA   . ILE A 1 75  ? -11.328 2.024   -0.832  1.00 0.00 ? 75  ILE A HA   4  
ATOM 6227  H HB   . ILE A 1 75  ? -9.766  1.291   1.648   1.00 0.00 ? 75  ILE A HB   4  
ATOM 6228  H HG12 . ILE A 1 75  ? -8.966  0.726   -1.195  1.00 0.00 ? 75  ILE A HG12 4  
ATOM 6229  H HG13 . ILE A 1 75  ? -8.569  2.265   -0.437  1.00 0.00 ? 75  ILE A HG13 4  
ATOM 6230  H HG21 . ILE A 1 75  ? -10.696 -0.717  1.499   1.00 0.00 ? 75  ILE A HG21 4  
ATOM 6231  H HG22 . ILE A 1 75  ? -11.641 -0.201  0.103   1.00 0.00 ? 75  ILE A HG22 4  
ATOM 6232  H HG23 . ILE A 1 75  ? -10.033 -0.888  -0.126  1.00 0.00 ? 75  ILE A HG23 4  
ATOM 6233  H HD11 . ILE A 1 75  ? -6.671  1.062   -0.030  1.00 0.00 ? 75  ILE A HD11 4  
ATOM 6234  H HD12 . ILE A 1 75  ? -7.588  0.739   1.442   1.00 0.00 ? 75  ILE A HD12 4  
ATOM 6235  H HD13 . ILE A 1 75  ? -7.541  -0.461  0.151   1.00 0.00 ? 75  ILE A HD13 4  
ATOM 6236  N N    . ASN A 1 76  ? -13.399 1.556   0.434   1.00 0.00 ? 76  ASN A N    4  
ATOM 6237  C CA   . ASN A 1 76  ? -14.661 1.354   1.137   1.00 0.00 ? 76  ASN A CA   4  
ATOM 6238  C C    . ASN A 1 76  ? -15.059 -0.119  1.127   1.00 0.00 ? 76  ASN A C    4  
ATOM 6239  O O    . ASN A 1 76  ? -14.721 -0.858  0.203   1.00 0.00 ? 76  ASN A O    4  
ATOM 6240  C CB   . ASN A 1 76  ? -15.766 2.197   0.497   1.00 0.00 ? 76  ASN A CB   4  
ATOM 6241  C CG   . ASN A 1 76  ? -15.290 3.588   0.126   1.00 0.00 ? 76  ASN A CG   4  
ATOM 6242  O OD1  . ASN A 1 76  ? -14.988 4.405   0.995   1.00 0.00 ? 76  ASN A OD1  4  
ATOM 6243  N ND2  . ASN A 1 76  ? -15.221 3.863   -1.172  1.00 0.00 ? 76  ASN A ND2  4  
ATOM 6244  H H    . ASN A 1 76  ? -13.344 1.343   -0.521  1.00 0.00 ? 76  ASN A H    4  
ATOM 6245  H HA   . ASN A 1 76  ? -14.525 1.671   2.160   1.00 0.00 ? 76  ASN A HA   4  
ATOM 6246  H HB2  . ASN A 1 76  ? -16.111 1.705   -0.401  1.00 0.00 ? 76  ASN A HB2  4  
ATOM 6247  H HB3  . ASN A 1 76  ? -16.587 2.290   1.191   1.00 0.00 ? 76  ASN A HB3  4  
ATOM 6248  H HD21 . ASN A 1 76  ? -15.478 3.163   -1.808  1.00 0.00 ? 76  ASN A HD21 4  
ATOM 6249  H HD22 . ASN A 1 76  ? -14.916 4.755   -1.440  1.00 0.00 ? 76  ASN A HD22 4  
ATOM 6250  N N    . GLY A 1 77  ? -15.780 -0.539  2.162   1.00 0.00 ? 77  GLY A N    4  
ATOM 6251  C CA   . GLY A 1 77  ? -16.213 -1.921  2.253   1.00 0.00 ? 77  GLY A CA   4  
ATOM 6252  C C    . GLY A 1 77  ? -15.304 -2.757  3.132   1.00 0.00 ? 77  GLY A C    4  
ATOM 6253  O O    . GLY A 1 77  ? -14.822 -3.811  2.716   1.00 0.00 ? 77  GLY A O    4  
ATOM 6254  H H    . GLY A 1 77  ? -16.019 0.095   2.870   1.00 0.00 ? 77  GLY A H    4  
ATOM 6255  H HA2  . GLY A 1 77  ? -17.213 -1.948  2.658   1.00 0.00 ? 77  GLY A HA2  4  
ATOM 6256  H HA3  . GLY A 1 77  ? -16.226 -2.348  1.261   1.00 0.00 ? 77  GLY A HA3  4  
ATOM 6257  N N    . LEU A 1 78  ? -15.066 -2.285  4.351   1.00 0.00 ? 78  LEU A N    4  
ATOM 6258  C CA   . LEU A 1 78  ? -14.207 -2.996  5.292   1.00 0.00 ? 78  LEU A CA   4  
ATOM 6259  C C    . LEU A 1 78  ? -14.921 -3.217  6.622   1.00 0.00 ? 78  LEU A C    4  
ATOM 6260  O O    . LEU A 1 78  ? -15.904 -2.542  6.931   1.00 0.00 ? 78  LEU A O    4  
ATOM 6261  C CB   . LEU A 1 78  ? -12.911 -2.215  5.520   1.00 0.00 ? 78  LEU A CB   4  
ATOM 6262  C CG   . LEU A 1 78  ? -12.202 -1.711  4.262   1.00 0.00 ? 78  LEU A CG   4  
ATOM 6263  C CD1  . LEU A 1 78  ? -11.055 -0.783  4.632   1.00 0.00 ? 78  LEU A CD1  4  
ATOM 6264  C CD2  . LEU A 1 78  ? -11.697 -2.881  3.430   1.00 0.00 ? 78  LEU A CD2  4  
ATOM 6265  H H    . LEU A 1 78  ? -15.478 -1.440  4.626   1.00 0.00 ? 78  LEU A H    4  
ATOM 6266  H HA   . LEU A 1 78  ? -13.968 -3.957  4.862   1.00 0.00 ? 78  LEU A HA   4  
ATOM 6267  H HB2  . LEU A 1 78  ? -13.145 -1.358  6.133   1.00 0.00 ? 78  LEU A HB2  4  
ATOM 6268  H HB3  . LEU A 1 78  ? -12.227 -2.860  6.051   1.00 0.00 ? 78  LEU A HB3  4  
ATOM 6269  H HG   . LEU A 1 78  ? -12.904 -1.150  3.661   1.00 0.00 ? 78  LEU A HG   4  
ATOM 6270  H HD11 . LEU A 1 78  ? -11.315 -0.226  5.519   1.00 0.00 ? 78  LEU A HD11 4  
ATOM 6271  H HD12 . LEU A 1 78  ? -10.869 -0.099  3.818   1.00 0.00 ? 78  LEU A HD12 4  
ATOM 6272  H HD13 . LEU A 1 78  ? -10.166 -1.368  4.821   1.00 0.00 ? 78  LEU A HD13 4  
ATOM 6273  H HD21 . LEU A 1 78  ? -11.153 -2.506  2.576   1.00 0.00 ? 78  LEU A HD21 4  
ATOM 6274  H HD22 . LEU A 1 78  ? -12.536 -3.471  3.092   1.00 0.00 ? 78  LEU A HD22 4  
ATOM 6275  H HD23 . LEU A 1 78  ? -11.043 -3.495  4.032   1.00 0.00 ? 78  LEU A HD23 4  
ATOM 6276  N N    . LYS A 1 79  ? -14.419 -4.165  7.406   1.00 0.00 ? 79  LYS A N    4  
ATOM 6277  C CA   . LYS A 1 79  ? -15.006 -4.473  8.705   1.00 0.00 ? 79  LYS A CA   4  
ATOM 6278  C C    . LYS A 1 79  ? -14.695 -3.376  9.717   1.00 0.00 ? 79  LYS A C    4  
ATOM 6279  O O    . LYS A 1 79  ? -13.923 -2.459  9.437   1.00 0.00 ? 79  LYS A O    4  
ATOM 6280  C CB   . LYS A 1 79  ? -14.484 -5.818  9.217   1.00 0.00 ? 79  LYS A CB   4  
ATOM 6281  C CG   . LYS A 1 79  ? -14.864 -6.994  8.334   1.00 0.00 ? 79  LYS A CG   4  
ATOM 6282  C CD   . LYS A 1 79  ? -13.876 -8.140  8.477   1.00 0.00 ? 79  LYS A CD   4  
ATOM 6283  C CE   . LYS A 1 79  ? -14.408 -9.416  7.844   1.00 0.00 ? 79  LYS A CE   4  
ATOM 6284  N NZ   . LYS A 1 79  ? -14.342 -9.367  6.357   1.00 0.00 ? 79  LYS A NZ   4  
ATOM 6285  H H    . LYS A 1 79  ? -13.634 -4.669  7.105   1.00 0.00 ? 79  LYS A H    4  
ATOM 6286  H HA   . LYS A 1 79  ? -16.076 -4.537  8.579   1.00 0.00 ? 79  LYS A HA   4  
ATOM 6287  H HB2  . LYS A 1 79  ? -13.406 -5.772  9.277   1.00 0.00 ? 79  LYS A HB2  4  
ATOM 6288  H HB3  . LYS A 1 79  ? -14.884 -5.993  10.205  1.00 0.00 ? 79  LYS A HB3  4  
ATOM 6289  H HG2  . LYS A 1 79  ? -15.846 -7.342  8.617   1.00 0.00 ? 79  LYS A HG2  4  
ATOM 6290  H HG3  . LYS A 1 79  ? -14.878 -6.669  7.303   1.00 0.00 ? 79  LYS A HG3  4  
ATOM 6291  H HD2  . LYS A 1 79  ? -12.951 -7.869  7.990   1.00 0.00 ? 79  LYS A HD2  4  
ATOM 6292  H HD3  . LYS A 1 79  ? -13.694 -8.318  9.527   1.00 0.00 ? 79  LYS A HD3  4  
ATOM 6293  H HE2  . LYS A 1 79  ? -13.819 -10.250 8.194   1.00 0.00 ? 79  LYS A HE2  4  
ATOM 6294  H HE3  . LYS A 1 79  ? -15.436 -9.551  8.146   1.00 0.00 ? 79  LYS A HE3  4  
ATOM 6295  H HZ1  . LYS A 1 79  ? -13.420 -9.720  6.029   1.00 0.00 ? 79  LYS A HZ1  4  
ATOM 6296  H HZ2  . LYS A 1 79  ? -14.464 -8.389  6.026   1.00 0.00 ? 79  LYS A HZ2  4  
ATOM 6297  H HZ3  . LYS A 1 79  ? -15.093 -9.958  5.946   1.00 0.00 ? 79  LYS A HZ3  4  
ATOM 6298  N N    . LYS A 1 80  ? -15.299 -3.476  10.897  1.00 0.00 ? 80  LYS A N    4  
ATOM 6299  C CA   . LYS A 1 80  ? -15.084 -2.495  11.953  1.00 0.00 ? 80  LYS A CA   4  
ATOM 6300  C C    . LYS A 1 80  ? -14.055 -2.996  12.961  1.00 0.00 ? 80  LYS A C    4  
ATOM 6301  O O    . LYS A 1 80  ? -14.074 -4.162  13.354  1.00 0.00 ? 80  LYS A O    4  
ATOM 6302  C CB   . LYS A 1 80  ? -16.403 -2.185  12.665  1.00 0.00 ? 80  LYS A CB   4  
ATOM 6303  C CG   . LYS A 1 80  ? -17.507 -1.728  11.729  1.00 0.00 ? 80  LYS A CG   4  
ATOM 6304  C CD   . LYS A 1 80  ? -18.365 -2.894  11.266  1.00 0.00 ? 80  LYS A CD   4  
ATOM 6305  C CE   . LYS A 1 80  ? -19.179 -2.533  10.034  1.00 0.00 ? 80  LYS A CE   4  
ATOM 6306  N NZ   . LYS A 1 80  ? -20.106 -3.630  9.640   1.00 0.00 ? 80  LYS A NZ   4  
ATOM 6307  H H    . LYS A 1 80  ? -15.903 -4.231  11.061  1.00 0.00 ? 80  LYS A H    4  
ATOM 6308  H HA   . LYS A 1 80  ? -14.711 -1.591  11.495  1.00 0.00 ? 80  LYS A HA   4  
ATOM 6309  H HB2  . LYS A 1 80  ? -16.739 -3.074  13.178  1.00 0.00 ? 80  LYS A HB2  4  
ATOM 6310  H HB3  . LYS A 1 80  ? -16.230 -1.405  13.393  1.00 0.00 ? 80  LYS A HB3  4  
ATOM 6311  H HG2  . LYS A 1 80  ? -18.135 -1.017  12.246  1.00 0.00 ? 80  LYS A HG2  4  
ATOM 6312  H HG3  . LYS A 1 80  ? -17.062 -1.256  10.865  1.00 0.00 ? 80  LYS A HG3  4  
ATOM 6313  H HD2  . LYS A 1 80  ? -17.723 -3.729  11.027  1.00 0.00 ? 80  LYS A HD2  4  
ATOM 6314  H HD3  . LYS A 1 80  ? -19.039 -3.173  12.064  1.00 0.00 ? 80  LYS A HD3  4  
ATOM 6315  H HE2  . LYS A 1 80  ? -19.756 -1.646  10.247  1.00 0.00 ? 80  LYS A HE2  4  
ATOM 6316  H HE3  . LYS A 1 80  ? -18.502 -2.335  9.216   1.00 0.00 ? 80  LYS A HE3  4  
ATOM 6317  H HZ1  . LYS A 1 80  ? -20.723 -3.880  10.440  1.00 0.00 ? 80  LYS A HZ1  4  
ATOM 6318  H HZ2  . LYS A 1 80  ? -19.565 -4.472  9.359   1.00 0.00 ? 80  LYS A HZ2  4  
ATOM 6319  H HZ3  . LYS A 1 80  ? -20.698 -3.329  8.840   1.00 0.00 ? 80  LYS A HZ3  4  
ATOM 6320  N N    . TYR A 1 81  ? -13.159 -2.107  13.376  1.00 0.00 ? 81  TYR A N    4  
ATOM 6321  C CA   . TYR A 1 81  ? -12.121 -2.460  14.337  1.00 0.00 ? 81  TYR A CA   4  
ATOM 6322  C C    . TYR A 1 81  ? -11.258 -3.604  13.813  1.00 0.00 ? 81  TYR A C    4  
ATOM 6323  O O    . TYR A 1 81  ? -10.825 -4.471  14.573  1.00 0.00 ? 81  TYR A O    4  
ATOM 6324  C CB   . TYR A 1 81  ? -12.749 -2.853  15.676  1.00 0.00 ? 81  TYR A CB   4  
ATOM 6325  C CG   . TYR A 1 81  ? -11.842 -2.617  16.863  1.00 0.00 ? 81  TYR A CG   4  
ATOM 6326  C CD1  . TYR A 1 81  ? -11.158 -1.417  17.011  1.00 0.00 ? 81  TYR A CD1  4  
ATOM 6327  C CD2  . TYR A 1 81  ? -11.671 -3.594  17.835  1.00 0.00 ? 81  TYR A CD2  4  
ATOM 6328  C CE1  . TYR A 1 81  ? -10.328 -1.198  18.094  1.00 0.00 ? 81  TYR A CE1  4  
ATOM 6329  C CE2  . TYR A 1 81  ? -10.844 -3.383  18.922  1.00 0.00 ? 81  TYR A CE2  4  
ATOM 6330  C CZ   . TYR A 1 81  ? -10.174 -2.184  19.046  1.00 0.00 ? 81  TYR A CZ   4  
ATOM 6331  O OH   . TYR A 1 81  ? -9.349  -1.969  20.126  1.00 0.00 ? 81  TYR A OH   4  
ATOM 6332  H H    . TYR A 1 81  ? -13.194 -1.193  13.026  1.00 0.00 ? 81  TYR A H    4  
ATOM 6333  H HA   . TYR A 1 81  ? -11.496 -1.592  14.485  1.00 0.00 ? 81  TYR A HA   4  
ATOM 6334  H HB2  . TYR A 1 81  ? -13.648 -2.276  15.827  1.00 0.00 ? 81  TYR A HB2  4  
ATOM 6335  H HB3  . TYR A 1 81  ? -13.000 -3.903  15.653  1.00 0.00 ? 81  TYR A HB3  4  
ATOM 6336  H HD1  . TYR A 1 81  ? -11.280 -0.647  16.264  1.00 0.00 ? 81  TYR A HD1  4  
ATOM 6337  H HD2  . TYR A 1 81  ? -12.197 -4.533  17.735  1.00 0.00 ? 81  TYR A HD2  4  
ATOM 6338  H HE1  . TYR A 1 81  ? -9.803  -0.259  18.191  1.00 0.00 ? 81  TYR A HE1  4  
ATOM 6339  H HE2  . TYR A 1 81  ? -10.723 -4.155  19.668  1.00 0.00 ? 81  TYR A HE2  4  
ATOM 6340  H HH   . TYR A 1 81  ? -9.235  -2.790  20.610  1.00 0.00 ? 81  TYR A HH   4  
ATOM 6341  N N    . THR A 1 82  ? -11.011 -3.599  12.507  1.00 0.00 ? 82  THR A N    4  
ATOM 6342  C CA   . THR A 1 82  ? -10.201 -4.635  11.878  1.00 0.00 ? 82  THR A CA   4  
ATOM 6343  C C    . THR A 1 82  ? -8.947  -4.043  11.245  1.00 0.00 ? 82  THR A C    4  
ATOM 6344  O O    . THR A 1 82  ? -8.999  -2.989  10.612  1.00 0.00 ? 82  THR A O    4  
ATOM 6345  C CB   . THR A 1 82  ? -10.997 -5.394  10.800  1.00 0.00 ? 82  THR A CB   4  
ATOM 6346  O OG1  . THR A 1 82  ? -12.253 -5.829  11.334  1.00 0.00 ? 82  THR A OG1  4  
ATOM 6347  C CG2  . THR A 1 82  ? -10.213 -6.595  10.293  1.00 0.00 ? 82  THR A CG2  4  
ATOM 6348  H H    . THR A 1 82  ? -11.384 -2.881  11.953  1.00 0.00 ? 82  THR A H    4  
ATOM 6349  H HA   . THR A 1 82  ? -9.908  -5.340  12.643  1.00 0.00 ? 82  THR A HA   4  
ATOM 6350  H HB   . THR A 1 82  ? -11.180 -4.725  9.971   1.00 0.00 ? 82  THR A HB   4  
ATOM 6351  H HG1  . THR A 1 82  ? -12.882 -5.105  11.304  1.00 0.00 ? 82  THR A HG1  4  
ATOM 6352  H HG21 . THR A 1 82  ? -10.820 -7.484  10.377  1.00 0.00 ? 82  THR A HG21 4  
ATOM 6353  H HG22 . THR A 1 82  ? -9.316  -6.714  10.882  1.00 0.00 ? 82  THR A HG22 4  
ATOM 6354  H HG23 . THR A 1 82  ? -9.945  -6.438  9.258   1.00 0.00 ? 82  THR A HG23 4  
ATOM 6355  N N    . GLU A 1 83  ? -7.821  -4.729  11.420  1.00 0.00 ? 83  GLU A N    4  
ATOM 6356  C CA   . GLU A 1 83  ? -6.554  -4.270  10.864  1.00 0.00 ? 83  GLU A CA   4  
ATOM 6357  C C    . GLU A 1 83  ? -6.424  -4.673  9.398   1.00 0.00 ? 83  GLU A C    4  
ATOM 6358  O O    . GLU A 1 83  ? -6.973  -5.689  8.972   1.00 0.00 ? 83  GLU A O    4  
ATOM 6359  C CB   . GLU A 1 83  ? -5.383  -4.841  11.667  1.00 0.00 ? 83  GLU A CB   4  
ATOM 6360  C CG   . GLU A 1 83  ? -4.151  -3.952  11.662  1.00 0.00 ? 83  GLU A CG   4  
ATOM 6361  C CD   . GLU A 1 83  ? -3.212  -4.249  12.816  1.00 0.00 ? 83  GLU A CD   4  
ATOM 6362  O OE1  . GLU A 1 83  ? -3.215  -5.399  13.303  1.00 0.00 ? 83  GLU A OE1  4  
ATOM 6363  O OE2  . GLU A 1 83  ? -2.474  -3.331  13.231  1.00 0.00 ? 83  GLU A OE2  4  
ATOM 6364  H H    . GLU A 1 83  ? -7.844  -5.563  11.934  1.00 0.00 ? 83  GLU A H    4  
ATOM 6365  H HA   . GLU A 1 83  ? -6.533  -3.193  10.932  1.00 0.00 ? 83  GLU A HA   4  
ATOM 6366  H HB2  . GLU A 1 83  ? -5.698  -4.980  12.691  1.00 0.00 ? 83  GLU A HB2  4  
ATOM 6367  H HB3  . GLU A 1 83  ? -5.111  -5.799  11.251  1.00 0.00 ? 83  GLU A HB3  4  
ATOM 6368  H HG2  . GLU A 1 83  ? -3.617  -4.103  10.736  1.00 0.00 ? 83  GLU A HG2  4  
ATOM 6369  H HG3  . GLU A 1 83  ? -4.466  -2.921  11.730  1.00 0.00 ? 83  GLU A HG3  4  
ATOM 6370  N N    . TYR A 1 84  ? -5.694  -3.869  8.632   1.00 0.00 ? 84  TYR A N    4  
ATOM 6371  C CA   . TYR A 1 84  ? -5.494  -4.140  7.214   1.00 0.00 ? 84  TYR A CA   4  
ATOM 6372  C C    . TYR A 1 84  ? -4.136  -3.625  6.747   1.00 0.00 ? 84  TYR A C    4  
ATOM 6373  O O    . TYR A 1 84  ? -3.755  -2.491  7.040   1.00 0.00 ? 84  TYR A O    4  
ATOM 6374  C CB   . TYR A 1 84  ? -6.608  -3.494  6.388   1.00 0.00 ? 84  TYR A CB   4  
ATOM 6375  C CG   . TYR A 1 84  ? -7.978  -4.071  6.663   1.00 0.00 ? 84  TYR A CG   4  
ATOM 6376  C CD1  . TYR A 1 84  ? -8.382  -5.265  6.079   1.00 0.00 ? 84  TYR A CD1  4  
ATOM 6377  C CD2  . TYR A 1 84  ? -8.869  -3.422  7.510   1.00 0.00 ? 84  TYR A CD2  4  
ATOM 6378  C CE1  . TYR A 1 84  ? -9.633  -5.795  6.327   1.00 0.00 ? 84  TYR A CE1  4  
ATOM 6379  C CE2  . TYR A 1 84  ? -10.122 -3.945  7.765   1.00 0.00 ? 84  TYR A CE2  4  
ATOM 6380  C CZ   . TYR A 1 84  ? -10.500 -5.131  7.171   1.00 0.00 ? 84  TYR A CZ   4  
ATOM 6381  O OH   . TYR A 1 84  ? -11.746 -5.657  7.422   1.00 0.00 ? 84  TYR A OH   4  
ATOM 6382  H H    . TYR A 1 84  ? -5.282  -3.074  9.030   1.00 0.00 ? 84  TYR A H    4  
ATOM 6383  H HA   . TYR A 1 84  ? -5.529  -5.210  7.072   1.00 0.00 ? 84  TYR A HA   4  
ATOM 6384  H HB2  . TYR A 1 84  ? -6.643  -2.438  6.607   1.00 0.00 ? 84  TYR A HB2  4  
ATOM 6385  H HB3  . TYR A 1 84  ? -6.395  -3.632  5.338   1.00 0.00 ? 84  TYR A HB3  4  
ATOM 6386  H HD1  . TYR A 1 84  ? -7.700  -5.782  5.418   1.00 0.00 ? 84  TYR A HD1  4  
ATOM 6387  H HD2  . TYR A 1 84  ? -8.571  -2.493  7.973   1.00 0.00 ? 84  TYR A HD2  4  
ATOM 6388  H HE1  . TYR A 1 84  ? -9.929  -6.724  5.862   1.00 0.00 ? 84  TYR A HE1  4  
ATOM 6389  H HE2  . TYR A 1 84  ? -10.801 -3.426  8.425   1.00 0.00 ? 84  TYR A HE2  4  
ATOM 6390  H HH   . TYR A 1 84  ? -11.685 -6.299  8.133   1.00 0.00 ? 84  TYR A HH   4  
ATOM 6391  N N    . SER A 1 85  ? -3.410  -4.467  6.019   1.00 0.00 ? 85  SER A N    4  
ATOM 6392  C CA   . SER A 1 85  ? -2.092  -4.100  5.514   1.00 0.00 ? 85  SER A CA   4  
ATOM 6393  C C    . SER A 1 85  ? -2.210  -3.302  4.218   1.00 0.00 ? 85  SER A C    4  
ATOM 6394  O O    . SER A 1 85  ? -3.019  -3.625  3.348   1.00 0.00 ? 85  SER A O    4  
ATOM 6395  C CB   . SER A 1 85  ? -1.245  -5.352  5.279   1.00 0.00 ? 85  SER A CB   4  
ATOM 6396  O OG   . SER A 1 85  ? 0.137   -5.039  5.269   1.00 0.00 ? 85  SER A OG   4  
ATOM 6397  H H    . SER A 1 85  ? -3.768  -5.357  5.819   1.00 0.00 ? 85  SER A H    4  
ATOM 6398  H HA   . SER A 1 85  ? -1.611  -3.484  6.259   1.00 0.00 ? 85  SER A HA   4  
ATOM 6399  H HB2  . SER A 1 85  ? -1.434  -6.064  6.068   1.00 0.00 ? 85  SER A HB2  4  
ATOM 6400  H HB3  . SER A 1 85  ? -1.511  -5.790  4.328   1.00 0.00 ? 85  SER A HB3  4  
ATOM 6401  H HG   . SER A 1 85  ? 0.619   -5.731  4.811   1.00 0.00 ? 85  SER A HG   4  
ATOM 6402  N N    . PHE A 1 86  ? -1.397  -2.258  4.097   1.00 0.00 ? 86  PHE A N    4  
ATOM 6403  C CA   . PHE A 1 86  ? -1.409  -1.413  2.909   1.00 0.00 ? 86  PHE A CA   4  
ATOM 6404  C C    . PHE A 1 86  ? 0.010   -1.136  2.424   1.00 0.00 ? 86  PHE A C    4  
ATOM 6405  O O    . PHE A 1 86  ? 0.908   -0.864  3.221   1.00 0.00 ? 86  PHE A O    4  
ATOM 6406  C CB   . PHE A 1 86  ? -2.126  -0.093  3.204   1.00 0.00 ? 86  PHE A CB   4  
ATOM 6407  C CG   . PHE A 1 86  ? -3.582  -0.262  3.533   1.00 0.00 ? 86  PHE A CG   4  
ATOM 6408  C CD1  . PHE A 1 86  ? -4.503  -0.542  2.536   1.00 0.00 ? 86  PHE A CD1  4  
ATOM 6409  C CD2  . PHE A 1 86  ? -4.029  -0.142  4.839   1.00 0.00 ? 86  PHE A CD2  4  
ATOM 6410  C CE1  . PHE A 1 86  ? -5.843  -0.697  2.836   1.00 0.00 ? 86  PHE A CE1  4  
ATOM 6411  C CE2  . PHE A 1 86  ? -5.368  -0.297  5.145   1.00 0.00 ? 86  PHE A CE2  4  
ATOM 6412  C CZ   . PHE A 1 86  ? -6.276  -0.576  4.142   1.00 0.00 ? 86  PHE A CZ   4  
ATOM 6413  H H    . PHE A 1 86  ? -0.773  -2.051  4.825   1.00 0.00 ? 86  PHE A H    4  
ATOM 6414  H HA   . PHE A 1 86  ? -1.946  -1.939  2.135   1.00 0.00 ? 86  PHE A HA   4  
ATOM 6415  H HB2  . PHE A 1 86  ? -1.650  0.387   4.046   1.00 0.00 ? 86  PHE A HB2  4  
ATOM 6416  H HB3  . PHE A 1 86  ? -2.052  0.549   2.339   1.00 0.00 ? 86  PHE A HB3  4  
ATOM 6417  H HD1  . PHE A 1 86  ? -4.166  -0.639  1.515   1.00 0.00 ? 86  PHE A HD1  4  
ATOM 6418  H HD2  . PHE A 1 86  ? -3.319  0.076   5.624   1.00 0.00 ? 86  PHE A HD2  4  
ATOM 6419  H HE1  . PHE A 1 86  ? -6.551  -0.916  2.051   1.00 0.00 ? 86  PHE A HE1  4  
ATOM 6420  H HE2  . PHE A 1 86  ? -5.703  -0.201  6.167   1.00 0.00 ? 86  PHE A HE2  4  
ATOM 6421  H HZ   . PHE A 1 86  ? -7.323  -0.696  4.379   1.00 0.00 ? 86  PHE A HZ   4  
ATOM 6422  N N    . ARG A 1 87  ? 0.205   -1.208  1.111   1.00 0.00 ? 87  ARG A N    4  
ATOM 6423  C CA   . ARG A 1 87  ? 1.515   -0.967  0.519   1.00 0.00 ? 87  ARG A CA   4  
ATOM 6424  C C    . ARG A 1 87  ? 1.381   -0.278  -0.836  1.00 0.00 ? 87  ARG A C    4  
ATOM 6425  O O    . ARG A 1 87  ? 0.452   -0.555  -1.596  1.00 0.00 ? 87  ARG A O    4  
ATOM 6426  C CB   . ARG A 1 87  ? 2.277   -2.284  0.360   1.00 0.00 ? 87  ARG A CB   4  
ATOM 6427  C CG   . ARG A 1 87  ? 1.607   -3.264  -0.590  1.00 0.00 ? 87  ARG A CG   4  
ATOM 6428  C CD   . ARG A 1 87  ? 2.589   -4.307  -1.098  1.00 0.00 ? 87  ARG A CD   4  
ATOM 6429  N NE   . ARG A 1 87  ? 2.688   -5.452  -0.197  1.00 0.00 ? 87  ARG A NE   4  
ATOM 6430  C CZ   . ARG A 1 87  ? 3.735   -6.269  -0.158  1.00 0.00 ? 87  ARG A CZ   4  
ATOM 6431  N NH1  . ARG A 1 87  ? 4.767   -6.068  -0.966  1.00 0.00 ? 87  ARG A NH1  4  
ATOM 6432  N NH2  . ARG A 1 87  ? 3.752   -7.289  0.690   1.00 0.00 ? 87  ARG A NH2  4  
ATOM 6433  H H    . ARG A 1 87  ? -0.550  -1.429  0.527   1.00 0.00 ? 87  ARG A H    4  
ATOM 6434  H HA   . ARG A 1 87  ? 2.067   -0.321  1.185   1.00 0.00 ? 87  ARG A HA   4  
ATOM 6435  H HB2  . ARG A 1 87  ? 3.266   -2.072  -0.018  1.00 0.00 ? 87  ARG A HB2  4  
ATOM 6436  H HB3  . ARG A 1 87  ? 2.362   -2.755  1.327   1.00 0.00 ? 87  ARG A HB3  4  
ATOM 6437  H HG2  . ARG A 1 87  ? 0.805   -3.766  -0.068  1.00 0.00 ? 87  ARG A HG2  4  
ATOM 6438  H HG3  . ARG A 1 87  ? 1.205   -2.719  -1.431  1.00 0.00 ? 87  ARG A HG3  4  
ATOM 6439  H HD2  . ARG A 1 87  ? 2.258   -4.652  -2.067  1.00 0.00 ? 87  ARG A HD2  4  
ATOM 6440  H HD3  . ARG A 1 87  ? 3.562   -3.849  -1.193  1.00 0.00 ? 87  ARG A HD3  4  
ATOM 6441  H HE   . ARG A 1 87  ? 1.937   -5.619  0.409   1.00 0.00 ? 87  ARG A HE   4  
ATOM 6442  H HH11 . ARG A 1 87  ? 4.758   -5.299  -1.606  1.00 0.00 ? 87  ARG A HH11 4  
ATOM 6443  H HH12 . ARG A 1 87  ? 5.555   -6.684  -0.935  1.00 0.00 ? 87  ARG A HH12 4  
ATOM 6444  H HH21 . ARG A 1 87  ? 2.976   -7.443  1.301   1.00 0.00 ? 87  ARG A HH21 4  
ATOM 6445  H HH22 . ARG A 1 87  ? 4.539   -7.903  0.718   1.00 0.00 ? 87  ARG A HH22 4  
ATOM 6446  N N    . VAL A 1 88  ? 2.314   0.621   -1.132  1.00 0.00 ? 88  VAL A N    4  
ATOM 6447  C CA   . VAL A 1 88  ? 2.301   1.349   -2.395  1.00 0.00 ? 88  VAL A CA   4  
ATOM 6448  C C    . VAL A 1 88  ? 3.464   0.927   -3.286  1.00 0.00 ? 88  VAL A C    4  
ATOM 6449  O O    . VAL A 1 88  ? 4.604   0.828   -2.832  1.00 0.00 ? 88  VAL A O    4  
ATOM 6450  C CB   . VAL A 1 88  ? 2.370   2.871   -2.167  1.00 0.00 ? 88  VAL A CB   4  
ATOM 6451  C CG1  . VAL A 1 88  ? 2.557   3.602   -3.487  1.00 0.00 ? 88  VAL A CG1  4  
ATOM 6452  C CG2  . VAL A 1 88  ? 1.120   3.359   -1.451  1.00 0.00 ? 88  VAL A CG2  4  
ATOM 6453  H H    . VAL A 1 88  ? 3.029   0.798   -0.486  1.00 0.00 ? 88  VAL A H    4  
ATOM 6454  H HA   . VAL A 1 88  ? 1.372   1.124   -2.901  1.00 0.00 ? 88  VAL A HA   4  
ATOM 6455  H HB   . VAL A 1 88  ? 3.224   3.082   -1.540  1.00 0.00 ? 88  VAL A HB   4  
ATOM 6456  H HG11 . VAL A 1 88  ? 2.403   4.660   -3.338  1.00 0.00 ? 88  VAL A HG11 4  
ATOM 6457  H HG12 . VAL A 1 88  ? 3.559   3.431   -3.855  1.00 0.00 ? 88  VAL A HG12 4  
ATOM 6458  H HG13 . VAL A 1 88  ? 1.842   3.233   -4.207  1.00 0.00 ? 88  VAL A HG13 4  
ATOM 6459  H HG21 . VAL A 1 88  ? 1.213   4.415   -1.246  1.00 0.00 ? 88  VAL A HG21 4  
ATOM 6460  H HG22 . VAL A 1 88  ? 0.256   3.189   -2.077  1.00 0.00 ? 88  VAL A HG22 4  
ATOM 6461  H HG23 . VAL A 1 88  ? 1.002   2.821   -0.522  1.00 0.00 ? 88  VAL A HG23 4  
ATOM 6462  N N    . VAL A 1 89  ? 3.168   0.678   -4.558  1.00 0.00 ? 89  VAL A N    4  
ATOM 6463  C CA   . VAL A 1 89  ? 4.189   0.267   -5.514  1.00 0.00 ? 89  VAL A CA   4  
ATOM 6464  C C    . VAL A 1 89  ? 4.263   1.236   -6.689  1.00 0.00 ? 89  VAL A C    4  
ATOM 6465  O O    . VAL A 1 89  ? 3.241   1.722   -7.172  1.00 0.00 ? 89  VAL A O    4  
ATOM 6466  C CB   . VAL A 1 89  ? 3.919   -1.151  -6.049  1.00 0.00 ? 89  VAL A CB   4  
ATOM 6467  C CG1  . VAL A 1 89  ? 4.964   -1.540  -7.084  1.00 0.00 ? 89  VAL A CG1  4  
ATOM 6468  C CG2  . VAL A 1 89  ? 3.890   -2.155  -4.906  1.00 0.00 ? 89  VAL A CG2  4  
ATOM 6469  H H    . VAL A 1 89  ? 2.241   0.774   -4.861  1.00 0.00 ? 89  VAL A H    4  
ATOM 6470  H HA   . VAL A 1 89  ? 5.141   0.262   -5.004  1.00 0.00 ? 89  VAL A HA   4  
ATOM 6471  H HB   . VAL A 1 89  ? 2.951   -1.155  -6.528  1.00 0.00 ? 89  VAL A HB   4  
ATOM 6472  H HG11 . VAL A 1 89  ? 5.064   -2.615  -7.108  1.00 0.00 ? 89  VAL A HG11 4  
ATOM 6473  H HG12 . VAL A 1 89  ? 4.657   -1.184  -8.057  1.00 0.00 ? 89  VAL A HG12 4  
ATOM 6474  H HG13 . VAL A 1 89  ? 5.913   -1.097  -6.821  1.00 0.00 ? 89  VAL A HG13 4  
ATOM 6475  H HG21 . VAL A 1 89  ? 4.761   -2.791  -4.964  1.00 0.00 ? 89  VAL A HG21 4  
ATOM 6476  H HG22 . VAL A 1 89  ? 3.892   -1.627  -3.963  1.00 0.00 ? 89  VAL A HG22 4  
ATOM 6477  H HG23 . VAL A 1 89  ? 2.997   -2.758  -4.978  1.00 0.00 ? 89  VAL A HG23 4  
ATOM 6478  N N    . ALA A 1 90  ? 5.481   1.513   -7.145  1.00 0.00 ? 90  ALA A N    4  
ATOM 6479  C CA   . ALA A 1 90  ? 5.689   2.422   -8.265  1.00 0.00 ? 90  ALA A CA   4  
ATOM 6480  C C    . ALA A 1 90  ? 5.845   1.654   -9.573  1.00 0.00 ? 90  ALA A C    4  
ATOM 6481  O O    . ALA A 1 90  ? 6.516   0.622   -9.623  1.00 0.00 ? 90  ALA A O    4  
ATOM 6482  C CB   . ALA A 1 90  ? 6.908   3.296   -8.015  1.00 0.00 ? 90  ALA A CB   4  
ATOM 6483  H H    . ALA A 1 90  ? 6.257   1.094   -6.718  1.00 0.00 ? 90  ALA A H    4  
ATOM 6484  H HA   . ALA A 1 90  ? 4.824   3.065   -8.338  1.00 0.00 ? 90  ALA A HA   4  
ATOM 6485  H HB1  . ALA A 1 90  ? 7.775   2.845   -8.477  1.00 0.00 ? 90  ALA A HB1  4  
ATOM 6486  H HB2  . ALA A 1 90  ? 6.742   4.275   -8.440  1.00 0.00 ? 90  ALA A HB2  4  
ATOM 6487  H HB3  . ALA A 1 90  ? 7.074   3.388   -6.952  1.00 0.00 ? 90  ALA A HB3  4  
ATOM 6488  N N    . TYR A 1 91  ? 5.222   2.162   -10.630 1.00 0.00 ? 91  TYR A N    4  
ATOM 6489  C CA   . TYR A 1 91  ? 5.289   1.522   -11.938 1.00 0.00 ? 91  TYR A CA   4  
ATOM 6490  C C    . TYR A 1 91  ? 5.682   2.527   -13.017 1.00 0.00 ? 91  TYR A C    4  
ATOM 6491  O O    . TYR A 1 91  ? 5.009   3.538   -13.214 1.00 0.00 ? 91  TYR A O    4  
ATOM 6492  C CB   . TYR A 1 91  ? 3.944   0.883   -12.287 1.00 0.00 ? 91  TYR A CB   4  
ATOM 6493  C CG   . TYR A 1 91  ? 3.764   -0.503  -11.710 1.00 0.00 ? 91  TYR A CG   4  
ATOM 6494  C CD1  . TYR A 1 91  ? 3.208   -0.686  -10.451 1.00 0.00 ? 91  TYR A CD1  4  
ATOM 6495  C CD2  . TYR A 1 91  ? 4.150   -1.630  -12.427 1.00 0.00 ? 91  TYR A CD2  4  
ATOM 6496  C CE1  . TYR A 1 91  ? 3.043   -1.951  -9.920  1.00 0.00 ? 91  TYR A CE1  4  
ATOM 6497  C CE2  . TYR A 1 91  ? 3.987   -2.898  -11.904 1.00 0.00 ? 91  TYR A CE2  4  
ATOM 6498  C CZ   . TYR A 1 91  ? 3.434   -3.054  -10.651 1.00 0.00 ? 91  TYR A CZ   4  
ATOM 6499  O OH   . TYR A 1 91  ? 3.270   -4.315  -10.126 1.00 0.00 ? 91  TYR A OH   4  
ATOM 6500  H H    . TYR A 1 91  ? 4.702   2.987   -10.528 1.00 0.00 ? 91  TYR A H    4  
ATOM 6501  H HA   . TYR A 1 91  ? 6.042   0.749   -11.891 1.00 0.00 ? 91  TYR A HA   4  
ATOM 6502  H HB2  . TYR A 1 91  ? 3.148   1.505   -11.907 1.00 0.00 ? 91  TYR A HB2  4  
ATOM 6503  H HB3  . TYR A 1 91  ? 3.855   0.810   -13.361 1.00 0.00 ? 91  TYR A HB3  4  
ATOM 6504  H HD1  . TYR A 1 91  ? 2.903   0.179   -9.881  1.00 0.00 ? 91  TYR A HD1  4  
ATOM 6505  H HD2  . TYR A 1 91  ? 4.583   -1.505  -13.408 1.00 0.00 ? 91  TYR A HD2  4  
ATOM 6506  H HE1  . TYR A 1 91  ? 2.609   -2.073  -8.938  1.00 0.00 ? 91  TYR A HE1  4  
ATOM 6507  H HE2  . TYR A 1 91  ? 4.294   -3.762  -12.476 1.00 0.00 ? 91  TYR A HE2  4  
ATOM 6508  H HH   . TYR A 1 91  ? 4.129   -4.728  -10.012 1.00 0.00 ? 91  TYR A HH   4  
ATOM 6509  N N    . ASN A 1 92  ? 6.778   2.240   -13.713 1.00 0.00 ? 92  ASN A N    4  
ATOM 6510  C CA   . ASN A 1 92  ? 7.262   3.117   -14.772 1.00 0.00 ? 92  ASN A CA   4  
ATOM 6511  C C    . ASN A 1 92  ? 7.548   2.327   -16.045 1.00 0.00 ? 92  ASN A C    4  
ATOM 6512  O O    . ASN A 1 92  ? 7.510   1.096   -16.047 1.00 0.00 ? 92  ASN A O    4  
ATOM 6513  C CB   . ASN A 1 92  ? 8.527   3.849   -14.318 1.00 0.00 ? 92  ASN A CB   4  
ATOM 6514  C CG   . ASN A 1 92  ? 8.261   4.805   -13.171 1.00 0.00 ? 92  ASN A CG   4  
ATOM 6515  O OD1  . ASN A 1 92  ? 7.160   4.841   -12.621 1.00 0.00 ? 92  ASN A OD1  4  
ATOM 6516  N ND2  . ASN A 1 92  ? 9.271   5.586   -12.806 1.00 0.00 ? 92  ASN A ND2  4  
ATOM 6517  H H    . ASN A 1 92  ? 7.272   1.419   -13.509 1.00 0.00 ? 92  ASN A H    4  
ATOM 6518  H HA   . ASN A 1 92  ? 6.491   3.844   -14.979 1.00 0.00 ? 92  ASN A HA   4  
ATOM 6519  H HB2  . ASN A 1 92  ? 9.259   3.124   -13.994 1.00 0.00 ? 92  ASN A HB2  4  
ATOM 6520  H HB3  . ASN A 1 92  ? 8.927   4.413   -15.147 1.00 0.00 ? 92  ASN A HB3  4  
ATOM 6521  H HD21 . ASN A 1 92  ? 10.119  5.504   -13.290 1.00 0.00 ? 92  ASN A HD21 4  
ATOM 6522  H HD22 . ASN A 1 92  ? 9.127   6.213   -12.067 1.00 0.00 ? 92  ASN A HD22 4  
ATOM 6523  N N    . LYS A 1 93  ? 7.836   3.042   -17.127 1.00 0.00 ? 93  LYS A N    4  
ATOM 6524  C CA   . LYS A 1 93  ? 8.131   2.409   -18.408 1.00 0.00 ? 93  LYS A CA   4  
ATOM 6525  C C    . LYS A 1 93  ? 9.173   1.308   -18.243 1.00 0.00 ? 93  LYS A C    4  
ATOM 6526  O O    . LYS A 1 93  ? 9.056   0.235   -18.836 1.00 0.00 ? 93  LYS A O    4  
ATOM 6527  C CB   . LYS A 1 93  ? 8.628   3.451   -19.412 1.00 0.00 ? 93  LYS A CB   4  
ATOM 6528  C CG   . LYS A 1 93  ? 9.953   4.085   -19.025 1.00 0.00 ? 93  LYS A CG   4  
ATOM 6529  C CD   . LYS A 1 93  ? 10.403  5.110   -20.053 1.00 0.00 ? 93  LYS A CD   4  
ATOM 6530  C CE   . LYS A 1 93  ? 9.870   6.497   -19.726 1.00 0.00 ? 93  LYS A CE   4  
ATOM 6531  N NZ   . LYS A 1 93  ? 8.479   6.687   -20.222 1.00 0.00 ? 93  LYS A NZ   4  
ATOM 6532  H H    . LYS A 1 93  ? 7.851   4.020   -17.063 1.00 0.00 ? 93  LYS A H    4  
ATOM 6533  H HA   . LYS A 1 93  ? 7.217   1.971   -18.779 1.00 0.00 ? 93  LYS A HA   4  
ATOM 6534  H HB2  . LYS A 1 93  ? 8.748   2.977   -20.375 1.00 0.00 ? 93  LYS A HB2  4  
ATOM 6535  H HB3  . LYS A 1 93  ? 7.889   4.235   -19.496 1.00 0.00 ? 93  LYS A HB3  4  
ATOM 6536  H HG2  . LYS A 1 93  ? 9.842   4.574   -18.069 1.00 0.00 ? 93  LYS A HG2  4  
ATOM 6537  H HG3  . LYS A 1 93  ? 10.704  3.310   -18.950 1.00 0.00 ? 93  LYS A HG3  4  
ATOM 6538  H HD2  . LYS A 1 93  ? 11.482  5.145   -20.065 1.00 0.00 ? 93  LYS A HD2  4  
ATOM 6539  H HD3  . LYS A 1 93  ? 10.039  4.814   -21.026 1.00 0.00 ? 93  LYS A HD3  4  
ATOM 6540  H HE2  . LYS A 1 93  ? 9.882   6.630   -18.655 1.00 0.00 ? 93  LYS A HE2  4  
ATOM 6541  H HE3  . LYS A 1 93  ? 10.512  7.232   -20.188 1.00 0.00 ? 93  LYS A HE3  4  
ATOM 6542  H HZ1  . LYS A 1 93  ? 8.291   7.698   -20.379 1.00 0.00 ? 93  LYS A HZ1  4  
ATOM 6543  H HZ2  . LYS A 1 93  ? 7.798   6.324   -19.525 1.00 0.00 ? 93  LYS A HZ2  4  
ATOM 6544  H HZ3  . LYS A 1 93  ? 8.346   6.178   -21.119 1.00 0.00 ? 93  LYS A HZ3  4  
ATOM 6545  N N    . HIS A 1 94  ? 10.191  1.579   -17.432 1.00 0.00 ? 94  HIS A N    4  
ATOM 6546  C CA   . HIS A 1 94  ? 11.253  0.610   -17.188 1.00 0.00 ? 94  HIS A CA   4  
ATOM 6547  C C    . HIS A 1 94  ? 10.698  -0.649  -16.527 1.00 0.00 ? 94  HIS A C    4  
ATOM 6548  O O    . HIS A 1 94  ? 10.808  -1.747  -17.070 1.00 0.00 ? 94  HIS A O    4  
ATOM 6549  C CB   . HIS A 1 94  ? 12.341  1.225   -16.307 1.00 0.00 ? 94  HIS A CB   4  
ATOM 6550  C CG   . HIS A 1 94  ? 12.707  2.624   -16.697 1.00 0.00 ? 94  HIS A CG   4  
ATOM 6551  N ND1  . HIS A 1 94  ? 13.539  2.918   -17.756 1.00 0.00 ? 94  HIS A ND1  4  
ATOM 6552  C CD2  . HIS A 1 94  ? 12.346  3.814   -16.163 1.00 0.00 ? 94  HIS A CD2  4  
ATOM 6553  C CE1  . HIS A 1 94  ? 13.677  4.228   -17.855 1.00 0.00 ? 94  HIS A CE1  4  
ATOM 6554  N NE2  . HIS A 1 94  ? 12.962  4.795   -16.900 1.00 0.00 ? 94  HIS A NE2  4  
ATOM 6555  H H    . HIS A 1 94  ? 10.228  2.452   -16.988 1.00 0.00 ? 94  HIS A H    4  
ATOM 6556  H HA   . HIS A 1 94  ? 11.682  0.341   -18.141 1.00 0.00 ? 94  HIS A HA   4  
ATOM 6557  H HB2  . HIS A 1 94  ? 11.998  1.245   -15.283 1.00 0.00 ? 94  HIS A HB2  4  
ATOM 6558  H HB3  . HIS A 1 94  ? 13.233  0.618   -16.371 1.00 0.00 ? 94  HIS A HB3  4  
ATOM 6559  H HD1  . HIS A 1 94  ? 13.968  2.263   -18.345 1.00 0.00 ? 94  HIS A HD1  4  
ATOM 6560  H HD2  . HIS A 1 94  ? 11.694  3.966   -15.313 1.00 0.00 ? 94  HIS A HD2  4  
ATOM 6561  H HE1  . HIS A 1 94  ? 14.271  4.747   -18.592 1.00 0.00 ? 94  HIS A HE1  4  
ATOM 6562  H HE2  . HIS A 1 94  ? 12.955  5.753   -16.694 1.00 0.00 ? 94  HIS A HE2  4  
ATOM 6563  N N    . GLY A 1 95  ? 10.103  -0.480  -15.350 1.00 0.00 ? 95  GLY A N    4  
ATOM 6564  C CA   . GLY A 1 95  ? 9.541   -1.611  -14.634 1.00 0.00 ? 95  GLY A CA   4  
ATOM 6565  C C    . GLY A 1 95  ? 9.229   -1.284  -13.187 1.00 0.00 ? 95  GLY A C    4  
ATOM 6566  O O    . GLY A 1 95  ? 9.599   -0.228  -12.673 1.00 0.00 ? 95  GLY A O    4  
ATOM 6567  H H    . GLY A 1 95  ? 10.044  0.419   -14.965 1.00 0.00 ? 95  GLY A H    4  
ATOM 6568  H HA2  . GLY A 1 95  ? 8.631   -1.918  -15.127 1.00 0.00 ? 95  GLY A HA2  4  
ATOM 6569  H HA3  . GLY A 1 95  ? 10.248  -2.427  -14.662 1.00 0.00 ? 95  GLY A HA3  4  
ATOM 6570  N N    . PRO A 1 96  ? 8.532   -2.204  -12.506 1.00 0.00 ? 96  PRO A N    4  
ATOM 6571  C CA   . PRO A 1 96  ? 8.154   -2.031  -11.100 1.00 0.00 ? 96  PRO A CA   4  
ATOM 6572  C C    . PRO A 1 96  ? 9.355   -2.105  -10.163 1.00 0.00 ? 96  PRO A C    4  
ATOM 6573  O O    . PRO A 1 96  ? 9.979   -3.156  -10.021 1.00 0.00 ? 96  PRO A O    4  
ATOM 6574  C CB   . PRO A 1 96  ? 7.201   -3.200  -10.841 1.00 0.00 ? 96  PRO A CB   4  
ATOM 6575  C CG   . PRO A 1 96  ? 7.594   -4.237  -11.837 1.00 0.00 ? 96  PRO A CG   4  
ATOM 6576  C CD   . PRO A 1 96  ? 8.058   -3.486  -13.054 1.00 0.00 ? 96  PRO A CD   4  
ATOM 6577  H HA   . PRO A 1 96  ? 7.633   -1.098  -10.941 1.00 0.00 ? 96  PRO A HA   4  
ATOM 6578  H HB2  . PRO A 1 96  ? 7.329   -3.555  -9.828  1.00 0.00 ? 96  PRO A HB2  4  
ATOM 6579  H HB3  . PRO A 1 96  ? 6.181   -2.878  -10.990 1.00 0.00 ? 96  PRO A HB3  4  
ATOM 6580  H HG2  . PRO A 1 96  ? 8.396   -4.841  -11.440 1.00 0.00 ? 96  PRO A HG2  4  
ATOM 6581  H HG3  . PRO A 1 96  ? 6.742   -4.854  -12.080 1.00 0.00 ? 96  PRO A HG3  4  
ATOM 6582  H HD2  . PRO A 1 96  ? 8.862   -4.018  -13.542 1.00 0.00 ? 96  PRO A HD2  4  
ATOM 6583  H HD3  . PRO A 1 96  ? 7.236   -3.332  -13.738 1.00 0.00 ? 96  PRO A HD3  4  
ATOM 6584  N N    . GLY A 1 97  ? 9.673   -0.983  -9.525  1.00 0.00 ? 97  GLY A N    4  
ATOM 6585  C CA   . GLY A 1 97  ? 10.799  -0.944  -8.610  1.00 0.00 ? 97  GLY A CA   4  
ATOM 6586  C C    . GLY A 1 97  ? 10.518  -1.679  -7.314  1.00 0.00 ? 97  GLY A C    4  
ATOM 6587  O O    . GLY A 1 97  ? 9.905   -2.747  -7.318  1.00 0.00 ? 97  GLY A O    4  
ATOM 6588  H H    . GLY A 1 97  ? 9.139   -0.175  -9.677  1.00 0.00 ? 97  GLY A H    4  
ATOM 6589  H HA2  . GLY A 1 97  ? 11.655  -1.394  -9.090  1.00 0.00 ? 97  GLY A HA2  4  
ATOM 6590  H HA3  . GLY A 1 97  ? 11.027  0.087   -8.383  1.00 0.00 ? 97  GLY A HA3  4  
ATOM 6591  N N    . VAL A 1 98  ? 10.970  -1.108  -6.202  1.00 0.00 ? 98  VAL A N    4  
ATOM 6592  C CA   . VAL A 1 98  ? 10.765  -1.717  -4.893  1.00 0.00 ? 98  VAL A CA   4  
ATOM 6593  C C    . VAL A 1 98  ? 9.351   -1.459  -4.382  1.00 0.00 ? 98  VAL A C    4  
ATOM 6594  O O    . VAL A 1 98  ? 8.548   -0.808  -5.050  1.00 0.00 ? 98  VAL A O    4  
ATOM 6595  C CB   . VAL A 1 98  ? 11.777  -1.183  -3.861  1.00 0.00 ? 98  VAL A CB   4  
ATOM 6596  C CG1  . VAL A 1 98  ? 13.164  -1.744  -4.135  1.00 0.00 ? 98  VAL A CG1  4  
ATOM 6597  C CG2  . VAL A 1 98  ? 11.796  0.338   -3.872  1.00 0.00 ? 98  VAL A CG2  4  
ATOM 6598  H H    . VAL A 1 98  ? 11.451  -0.257  -6.263  1.00 0.00 ? 98  VAL A H    4  
ATOM 6599  H HA   . VAL A 1 98  ? 10.912  -2.782  -4.993  1.00 0.00 ? 98  VAL A HA   4  
ATOM 6600  H HB   . VAL A 1 98  ? 11.467  -1.512  -2.880  1.00 0.00 ? 98  VAL A HB   4  
ATOM 6601  H HG11 . VAL A 1 98  ? 13.903  -0.975  -3.965  1.00 0.00 ? 98  VAL A HG11 4  
ATOM 6602  H HG12 . VAL A 1 98  ? 13.352  -2.578  -3.475  1.00 0.00 ? 98  VAL A HG12 4  
ATOM 6603  H HG13 . VAL A 1 98  ? 13.221  -2.077  -5.161  1.00 0.00 ? 98  VAL A HG13 4  
ATOM 6604  H HG21 . VAL A 1 98  ? 10.791  0.709   -4.006  1.00 0.00 ? 98  VAL A HG21 4  
ATOM 6605  H HG22 . VAL A 1 98  ? 12.191  0.699   -2.933  1.00 0.00 ? 98  VAL A HG22 4  
ATOM 6606  H HG23 . VAL A 1 98  ? 12.420  0.685   -4.682  1.00 0.00 ? 98  VAL A HG23 4  
ATOM 6607  N N    . SER A 1 99  ? 9.055   -1.973  -3.193  1.00 0.00 ? 99  SER A N    4  
ATOM 6608  C CA   . SER A 1 99  ? 7.737   -1.801  -2.593  1.00 0.00 ? 99  SER A CA   4  
ATOM 6609  C C    . SER A 1 99  ? 7.854   -1.270  -1.168  1.00 0.00 ? 99  SER A C    4  
ATOM 6610  O O    . SER A 1 99  ? 8.689   -1.729  -0.388  1.00 0.00 ? 99  SER A O    4  
ATOM 6611  C CB   . SER A 1 99  ? 6.976   -3.128  -2.594  1.00 0.00 ? 99  SER A CB   4  
ATOM 6612  O OG   . SER A 1 99  ? 5.806   -3.046  -1.800  1.00 0.00 ? 99  SER A OG   4  
ATOM 6613  H H    . SER A 1 99  ? 9.738   -2.482  -2.709  1.00 0.00 ? 99  SER A H    4  
ATOM 6614  H HA   . SER A 1 99  ? 7.193   -1.084  -3.189  1.00 0.00 ? 99  SER A HA   4  
ATOM 6615  H HB2  . SER A 1 99  ? 6.693   -3.377  -3.606  1.00 0.00 ? 99  SER A HB2  4  
ATOM 6616  H HB3  . SER A 1 99  ? 7.613   -3.906  -2.197  1.00 0.00 ? 99  SER A HB3  4  
ATOM 6617  H HG   . SER A 1 99  ? 5.171   -2.464  -2.224  1.00 0.00 ? 99  SER A HG   4  
ATOM 6618  N N    . THR A 1 100 ? 7.009   -0.299  -0.833  1.00 0.00 ? 100 THR A N    4  
ATOM 6619  C CA   . THR A 1 100 ? 7.018   0.296   0.497   1.00 0.00 ? 100 THR A CA   4  
ATOM 6620  C C    . THR A 1 100 ? 6.716   -0.746  1.567   1.00 0.00 ? 100 THR A C    4  
ATOM 6621  O O    . THR A 1 100 ? 6.136   -1.798  1.298   1.00 0.00 ? 100 THR A O    4  
ATOM 6622  C CB   . THR A 1 100 ? 5.991   1.440   0.606   1.00 0.00 ? 100 THR A CB   4  
ATOM 6623  O OG1  . THR A 1 100 ? 4.830   1.132   -0.173  1.00 0.00 ? 100 THR A OG1  4  
ATOM 6624  C CG2  . THR A 1 100 ? 6.593   2.754   0.133   1.00 0.00 ? 100 THR A CG2  4  
ATOM 6625  H H    . THR A 1 100 ? 6.367   0.024   -1.499  1.00 0.00 ? 100 THR A H    4  
ATOM 6626  H HA   . THR A 1 100 ? 8.002   0.706   0.673   1.00 0.00 ? 100 THR A HA   4  
ATOM 6627  H HB   . THR A 1 100 ? 5.703   1.546   1.643   1.00 0.00 ? 100 THR A HB   4  
ATOM 6628  H HG1  . THR A 1 100 ? 4.940   1.478   -1.062  1.00 0.00 ? 100 THR A HG1  4  
ATOM 6629  H HG21 . THR A 1 100 ? 6.679   2.743   -0.944  1.00 0.00 ? 100 THR A HG21 4  
ATOM 6630  H HG22 . THR A 1 100 ? 7.571   2.881   0.571   1.00 0.00 ? 100 THR A HG22 4  
ATOM 6631  H HG23 . THR A 1 100 ? 5.954   3.571   0.433   1.00 0.00 ? 100 THR A HG23 4  
ATOM 6632  N N    . PRO A 1 101 ? 7.119   -0.450  2.812   1.00 0.00 ? 101 PRO A N    4  
ATOM 6633  C CA   . PRO A 1 101 ? 6.902   -1.349  3.949   1.00 0.00 ? 101 PRO A CA   4  
ATOM 6634  C C    . PRO A 1 101 ? 5.431   -1.442  4.342   1.00 0.00 ? 101 PRO A C    4  
ATOM 6635  O O    . PRO A 1 101 ? 4.755   -0.425  4.498   1.00 0.00 ? 101 PRO A O    4  
ATOM 6636  C CB   . PRO A 1 101 ? 7.715   -0.703  5.073   1.00 0.00 ? 101 PRO A CB   4  
ATOM 6637  C CG   . PRO A 1 101 ? 7.786   0.740   4.708   1.00 0.00 ? 101 PRO A CG   4  
ATOM 6638  C CD   . PRO A 1 101 ? 7.817   0.785   3.205   1.00 0.00 ? 101 PRO A CD   4  
ATOM 6639  H HA   . PRO A 1 101 ? 7.283   -2.340  3.750   1.00 0.00 ? 101 PRO A HA   4  
ATOM 6640  H HB2  . PRO A 1 101 ? 7.209   -0.848  6.017   1.00 0.00 ? 101 PRO A HB2  4  
ATOM 6641  H HB3  . PRO A 1 101 ? 8.698   -1.149  5.114   1.00 0.00 ? 101 PRO A HB3  4  
ATOM 6642  H HG2  . PRO A 1 101 ? 6.915   1.256   5.081   1.00 0.00 ? 101 PRO A HG2  4  
ATOM 6643  H HG3  . PRO A 1 101 ? 8.686   1.177   5.115   1.00 0.00 ? 101 PRO A HG3  4  
ATOM 6644  H HD2  . PRO A 1 101 ? 7.292   1.657   2.844   1.00 0.00 ? 101 PRO A HD2  4  
ATOM 6645  H HD3  . PRO A 1 101 ? 8.836   0.782   2.849   1.00 0.00 ? 101 PRO A HD3  4  
ATOM 6646  N N    . ASP A 1 102 ? 4.942   -2.667  4.501   1.00 0.00 ? 102 ASP A N    4  
ATOM 6647  C CA   . ASP A 1 102 ? 3.552   -2.893  4.877   1.00 0.00 ? 102 ASP A CA   4  
ATOM 6648  C C    . ASP A 1 102 ? 3.092   -1.862  5.903   1.00 0.00 ? 102 ASP A C    4  
ATOM 6649  O O    . ASP A 1 102 ? 3.781   -1.603  6.890   1.00 0.00 ? 102 ASP A O    4  
ATOM 6650  C CB   . ASP A 1 102 ? 3.376   -4.304  5.440   1.00 0.00 ? 102 ASP A CB   4  
ATOM 6651  C CG   . ASP A 1 102 ? 4.281   -5.314  4.763   1.00 0.00 ? 102 ASP A CG   4  
ATOM 6652  O OD1  . ASP A 1 102 ? 5.508   -5.259  4.991   1.00 0.00 ? 102 ASP A OD1  4  
ATOM 6653  O OD2  . ASP A 1 102 ? 3.762   -6.161  4.005   1.00 0.00 ? 102 ASP A OD2  4  
ATOM 6654  H H    . ASP A 1 102 ? 5.532   -3.439  4.363   1.00 0.00 ? 102 ASP A H    4  
ATOM 6655  H HA   . ASP A 1 102 ? 2.947   -2.792  3.988   1.00 0.00 ? 102 ASP A HA   4  
ATOM 6656  H HB2  . ASP A 1 102 ? 3.605   -4.295  6.496   1.00 0.00 ? 102 ASP A HB2  4  
ATOM 6657  H HB3  . ASP A 1 102 ? 2.351   -4.615  5.301   1.00 0.00 ? 102 ASP A HB3  4  
ATOM 6658  N N    . VAL A 1 103 ? 1.924   -1.274  5.662   1.00 0.00 ? 103 VAL A N    4  
ATOM 6659  C CA   . VAL A 1 103 ? 1.372   -0.271  6.565   1.00 0.00 ? 103 VAL A CA   4  
ATOM 6660  C C    . VAL A 1 103 ? 0.044   -0.732  7.152   1.00 0.00 ? 103 VAL A C    4  
ATOM 6661  O O    . VAL A 1 103 ? -1.024  -0.323  6.697   1.00 0.00 ? 103 VAL A O    4  
ATOM 6662  C CB   . VAL A 1 103 ? 1.164   1.076   5.847   1.00 0.00 ? 103 VAL A CB   4  
ATOM 6663  C CG1  . VAL A 1 103 ? 0.448   2.061   6.758   1.00 0.00 ? 103 VAL A CG1  4  
ATOM 6664  C CG2  . VAL A 1 103 ? 2.496   1.641   5.378   1.00 0.00 ? 103 VAL A CG2  4  
ATOM 6665  H H    . VAL A 1 103 ? 1.422   -1.522  4.858   1.00 0.00 ? 103 VAL A H    4  
ATOM 6666  H HA   . VAL A 1 103 ? 2.078   -0.121  7.369   1.00 0.00 ? 103 VAL A HA   4  
ATOM 6667  H HB   . VAL A 1 103 ? 0.543   0.906   4.979   1.00 0.00 ? 103 VAL A HB   4  
ATOM 6668  H HG11 . VAL A 1 103 ? -0.506  2.324   6.325   1.00 0.00 ? 103 VAL A HG11 4  
ATOM 6669  H HG12 . VAL A 1 103 ? 0.294   1.610   7.727   1.00 0.00 ? 103 VAL A HG12 4  
ATOM 6670  H HG13 . VAL A 1 103 ? 1.050   2.952   6.868   1.00 0.00 ? 103 VAL A HG13 4  
ATOM 6671  H HG21 . VAL A 1 103 ? 3.180   1.687   6.212   1.00 0.00 ? 103 VAL A HG21 4  
ATOM 6672  H HG22 . VAL A 1 103 ? 2.908   1.002   4.610   1.00 0.00 ? 103 VAL A HG22 4  
ATOM 6673  H HG23 . VAL A 1 103 ? 2.347   2.633   4.979   1.00 0.00 ? 103 VAL A HG23 4  
ATOM 6674  N N    . ALA A 1 104 ? 0.117   -1.587  8.168   1.00 0.00 ? 104 ALA A N    4  
ATOM 6675  C CA   . ALA A 1 104 ? -1.080  -2.102  8.820   1.00 0.00 ? 104 ALA A CA   4  
ATOM 6676  C C    . ALA A 1 104 ? -1.759  -1.021  9.654   1.00 0.00 ? 104 ALA A C    4  
ATOM 6677  O O    . ALA A 1 104 ? -1.100  -0.277  10.380  1.00 0.00 ? 104 ALA A O    4  
ATOM 6678  C CB   . ALA A 1 104 ? -0.733  -3.302  9.689   1.00 0.00 ? 104 ALA A CB   4  
ATOM 6679  H H    . ALA A 1 104 ? 0.997   -1.877  8.486   1.00 0.00 ? 104 ALA A H    4  
ATOM 6680  H HA   . ALA A 1 104 ? -1.764  -2.432  8.051   1.00 0.00 ? 104 ALA A HA   4  
ATOM 6681  H HB1  . ALA A 1 104 ? 0.087   -3.046  10.344  1.00 0.00 ? 104 ALA A HB1  4  
ATOM 6682  H HB2  . ALA A 1 104 ? -1.593  -3.580  10.279  1.00 0.00 ? 104 ALA A HB2  4  
ATOM 6683  H HB3  . ALA A 1 104 ? -0.445  -4.131  9.059   1.00 0.00 ? 104 ALA A HB3  4  
ATOM 6684  N N    . VAL A 1 105 ? -3.082  -0.940  9.546   1.00 0.00 ? 105 VAL A N    4  
ATOM 6685  C CA   . VAL A 1 105 ? -3.850  0.050   10.291  1.00 0.00 ? 105 VAL A CA   4  
ATOM 6686  C C    . VAL A 1 105 ? -5.196  -0.516  10.732  1.00 0.00 ? 105 VAL A C    4  
ATOM 6687  O O    . VAL A 1 105 ? -5.800  -1.327  10.028  1.00 0.00 ? 105 VAL A O    4  
ATOM 6688  C CB   . VAL A 1 105 ? -4.090  1.320   9.455   1.00 0.00 ? 105 VAL A CB   4  
ATOM 6689  C CG1  . VAL A 1 105 ? -4.997  1.018   8.272   1.00 0.00 ? 105 VAL A CG1  4  
ATOM 6690  C CG2  . VAL A 1 105 ? -4.678  2.425   10.320  1.00 0.00 ? 105 VAL A CG2  4  
ATOM 6691  H H    . VAL A 1 105 ? -3.552  -1.562  8.952   1.00 0.00 ? 105 VAL A H    4  
ATOM 6692  H HA   . VAL A 1 105 ? -3.281  0.323   11.168  1.00 0.00 ? 105 VAL A HA   4  
ATOM 6693  H HB   . VAL A 1 105 ? -3.138  1.660   9.073   1.00 0.00 ? 105 VAL A HB   4  
ATOM 6694  H HG11 . VAL A 1 105 ? -5.774  0.335   8.580   1.00 0.00 ? 105 VAL A HG11 4  
ATOM 6695  H HG12 . VAL A 1 105 ? -5.442  1.935   7.916   1.00 0.00 ? 105 VAL A HG12 4  
ATOM 6696  H HG13 . VAL A 1 105 ? -4.417  0.568   7.479   1.00 0.00 ? 105 VAL A HG13 4  
ATOM 6697  H HG21 . VAL A 1 105 ? -5.728  2.537   10.094  1.00 0.00 ? 105 VAL A HG21 4  
ATOM 6698  H HG22 . VAL A 1 105 ? -4.560  2.168   11.362  1.00 0.00 ? 105 VAL A HG22 4  
ATOM 6699  H HG23 . VAL A 1 105 ? -4.165  3.353   10.118  1.00 0.00 ? 105 VAL A HG23 4  
ATOM 6700  N N    . ARG A 1 106 ? -5.660  -0.084  11.899  1.00 0.00 ? 106 ARG A N    4  
ATOM 6701  C CA   . ARG A 1 106 ? -6.934  -0.549  12.434  1.00 0.00 ? 106 ARG A CA   4  
ATOM 6702  C C    . ARG A 1 106 ? -8.023  0.501   12.232  1.00 0.00 ? 106 ARG A C    4  
ATOM 6703  O O    . ARG A 1 106 ? -7.863  1.660   12.614  1.00 0.00 ? 106 ARG A O    4  
ATOM 6704  C CB   . ARG A 1 106 ? -6.798  -0.877  13.922  1.00 0.00 ? 106 ARG A CB   4  
ATOM 6705  C CG   . ARG A 1 106 ? -7.746  -1.967  14.394  1.00 0.00 ? 106 ARG A CG   4  
ATOM 6706  C CD   . ARG A 1 106 ? -7.637  -2.189  15.895  1.00 0.00 ? 106 ARG A CD   4  
ATOM 6707  N NE   . ARG A 1 106 ? -6.316  -2.680  16.280  1.00 0.00 ? 106 ARG A NE   4  
ATOM 6708  C CZ   . ARG A 1 106 ? -6.036  -3.168  17.484  1.00 0.00 ? 106 ARG A CZ   4  
ATOM 6709  N NH1  . ARG A 1 106 ? -6.979  -3.229  18.414  1.00 0.00 ? 106 ARG A NH1  4  
ATOM 6710  N NH2  . ARG A 1 106 ? -4.811  -3.596  17.759  1.00 0.00 ? 106 ARG A NH2  4  
ATOM 6711  H H    . ARG A 1 106 ? -5.133  0.562   12.414  1.00 0.00 ? 106 ARG A H    4  
ATOM 6712  H HA   . ARG A 1 106 ? -7.211  -1.445  11.900  1.00 0.00 ? 106 ARG A HA   4  
ATOM 6713  H HB2  . ARG A 1 106 ? -5.786  -1.203  14.116  1.00 0.00 ? 106 ARG A HB2  4  
ATOM 6714  H HB3  . ARG A 1 106 ? -6.996  0.016   14.495  1.00 0.00 ? 106 ARG A HB3  4  
ATOM 6715  H HG2  . ARG A 1 106 ? -8.760  -1.677  14.158  1.00 0.00 ? 106 ARG A HG2  4  
ATOM 6716  H HG3  . ARG A 1 106 ? -7.505  -2.887  13.884  1.00 0.00 ? 106 ARG A HG3  4  
ATOM 6717  H HD2  . ARG A 1 106 ? -7.823  -1.252  16.398  1.00 0.00 ? 106 ARG A HD2  4  
ATOM 6718  H HD3  . ARG A 1 106 ? -8.381  -2.912  16.193  1.00 0.00 ? 106 ARG A HD3  4  
ATOM 6719  H HE   . ARG A 1 106 ? -5.605  -2.645  15.608  1.00 0.00 ? 106 ARG A HE   4  
ATOM 6720  H HH11 . ARG A 1 106 ? -7.904  -2.908  18.209  1.00 0.00 ? 106 ARG A HH11 4  
ATOM 6721  H HH12 . ARG A 1 106 ? -6.766  -3.597  19.319  1.00 0.00 ? 106 ARG A HH12 4  
ATOM 6722  H HH21 . ARG A 1 106 ? -4.097  -3.551  17.060  1.00 0.00 ? 106 ARG A HH21 4  
ATOM 6723  H HH22 . ARG A 1 106 ? -4.601  -3.962  18.665  1.00 0.00 ? 106 ARG A HH22 4  
ATOM 6724  N N    . THR A 1 107 ? -9.133  0.086   11.628  1.00 0.00 ? 107 THR A N    4  
ATOM 6725  C CA   . THR A 1 107 ? -10.248 0.989   11.374  1.00 0.00 ? 107 THR A CA   4  
ATOM 6726  C C    . THR A 1 107 ? -10.941 1.387   12.672  1.00 0.00 ? 107 THR A C    4  
ATOM 6727  O O    . THR A 1 107 ? -10.564 0.932   13.753  1.00 0.00 ? 107 THR A O    4  
ATOM 6728  C CB   . THR A 1 107 ? -11.282 0.352   10.427  1.00 0.00 ? 107 THR A CB   4  
ATOM 6729  O OG1  . THR A 1 107 ? -11.591 -0.977  10.861  1.00 0.00 ? 107 THR A OG1  4  
ATOM 6730  C CG2  . THR A 1 107 ? -10.758 0.316   8.999   1.00 0.00 ? 107 THR A CG2  4  
ATOM 6731  H H    . THR A 1 107 ? -9.201  -0.850  11.347  1.00 0.00 ? 107 THR A H    4  
ATOM 6732  H HA   . THR A 1 107 ? -9.856  1.878   10.900  1.00 0.00 ? 107 THR A HA   4  
ATOM 6733  H HB   . THR A 1 107 ? -12.183 0.948   10.449  1.00 0.00 ? 107 THR A HB   4  
ATOM 6734  H HG1  . THR A 1 107 ? -12.537 -1.054  11.008  1.00 0.00 ? 107 THR A HG1  4  
ATOM 6735  H HG21 . THR A 1 107 ? -9.763  0.734   8.970   1.00 0.00 ? 107 THR A HG21 4  
ATOM 6736  H HG22 . THR A 1 107 ? -11.411 0.893   8.361   1.00 0.00 ? 107 THR A HG22 4  
ATOM 6737  H HG23 . THR A 1 107 ? -10.729 -0.706  8.653   1.00 0.00 ? 107 THR A HG23 4  
ATOM 6738  N N    . LEU A 1 108 ? -11.956 2.236   12.559  1.00 0.00 ? 108 LEU A N    4  
ATOM 6739  C CA   . LEU A 1 108 ? -12.704 2.694   13.725  1.00 0.00 ? 108 LEU A CA   4  
ATOM 6740  C C    . LEU A 1 108 ? -13.701 1.635   14.183  1.00 0.00 ? 108 LEU A C    4  
ATOM 6741  O O    . LEU A 1 108 ? -14.137 0.796   13.395  1.00 0.00 ? 108 LEU A O    4  
ATOM 6742  C CB   . LEU A 1 108 ? -13.438 3.997   13.405  1.00 0.00 ? 108 LEU A CB   4  
ATOM 6743  C CG   . LEU A 1 108 ? -12.603 5.091   12.737  1.00 0.00 ? 108 LEU A CG   4  
ATOM 6744  C CD1  . LEU A 1 108 ? -13.493 6.237   12.281  1.00 0.00 ? 108 LEU A CD1  4  
ATOM 6745  C CD2  . LEU A 1 108 ? -11.527 5.595   13.687  1.00 0.00 ? 108 LEU A CD2  4  
ATOM 6746  H H    . LEU A 1 108 ? -12.210 2.563   11.671  1.00 0.00 ? 108 LEU A H    4  
ATOM 6747  H HA   . LEU A 1 108 ? -11.998 2.874   14.521  1.00 0.00 ? 108 LEU A HA   4  
ATOM 6748  H HB2  . LEU A 1 108 ? -14.260 3.761   12.746  1.00 0.00 ? 108 LEU A HB2  4  
ATOM 6749  H HB3  . LEU A 1 108 ? -13.825 4.395   14.332  1.00 0.00 ? 108 LEU A HB3  4  
ATOM 6750  H HG   . LEU A 1 108 ? -12.115 4.680   11.864  1.00 0.00 ? 108 LEU A HG   4  
ATOM 6751  H HD11 . LEU A 1 108 ? -13.674 6.904   13.110  1.00 0.00 ? 108 LEU A HD11 4  
ATOM 6752  H HD12 . LEU A 1 108 ? -14.432 5.843   11.923  1.00 0.00 ? 108 LEU A HD12 4  
ATOM 6753  H HD13 . LEU A 1 108 ? -13.003 6.777   11.484  1.00 0.00 ? 108 LEU A HD13 4  
ATOM 6754  H HD21 . LEU A 1 108 ? -10.593 5.098   13.469  1.00 0.00 ? 108 LEU A HD21 4  
ATOM 6755  H HD22 . LEU A 1 108 ? -11.818 5.383   14.706  1.00 0.00 ? 108 LEU A HD22 4  
ATOM 6756  H HD23 . LEU A 1 108 ? -11.405 6.660   13.561  1.00 0.00 ? 108 LEU A HD23 4  
ATOM 6757  N N    . SER A 1 109 ? -14.060 1.681   15.462  1.00 0.00 ? 109 SER A N    4  
ATOM 6758  C CA   . SER A 1 109 ? -15.006 0.725   16.026  1.00 0.00 ? 109 SER A CA   4  
ATOM 6759  C C    . SER A 1 109 ? -16.361 1.380   16.271  1.00 0.00 ? 109 SER A C    4  
ATOM 6760  O O    . SER A 1 109 ? -16.450 2.429   16.910  1.00 0.00 ? 109 SER A O    4  
ATOM 6761  C CB   . SER A 1 109 ? -14.461 0.148   17.334  1.00 0.00 ? 109 SER A CB   4  
ATOM 6762  O OG   . SER A 1 109 ? -15.455 -0.596  18.016  1.00 0.00 ? 109 SER A OG   4  
ATOM 6763  H H    . SER A 1 109 ? -13.678 2.374   16.040  1.00 0.00 ? 109 SER A H    4  
ATOM 6764  H HA   . SER A 1 109 ? -15.130 -0.077  15.313  1.00 0.00 ? 109 SER A HA   4  
ATOM 6765  H HB2  . SER A 1 109 ? -13.627 -0.501  17.119  1.00 0.00 ? 109 SER A HB2  4  
ATOM 6766  H HB3  . SER A 1 109 ? -14.133 0.957   17.971  1.00 0.00 ? 109 SER A HB3  4  
ATOM 6767  H HG   . SER A 1 109 ? -15.173 -1.510  18.095  1.00 0.00 ? 109 SER A HG   4  
ATOM 6768  N N    . ASP A 1 110 ? -17.415 0.755   15.757  1.00 0.00 ? 110 ASP A N    4  
ATOM 6769  C CA   . ASP A 1 110 ? -18.767 1.276   15.920  1.00 0.00 ? 110 ASP A CA   4  
ATOM 6770  C C    . ASP A 1 110 ? -19.302 0.971   17.316  1.00 0.00 ? 110 ASP A C    4  
ATOM 6771  O O    . ASP A 1 110 ? -20.026 -0.005  17.515  1.00 0.00 ? 110 ASP A O    4  
ATOM 6772  C CB   . ASP A 1 110 ? -19.697 0.680   14.863  1.00 0.00 ? 110 ASP A CB   4  
ATOM 6773  C CG   . ASP A 1 110 ? -21.066 1.330   14.862  1.00 0.00 ? 110 ASP A CG   4  
ATOM 6774  O OD1  . ASP A 1 110 ? -21.660 1.463   15.953  1.00 0.00 ? 110 ASP A OD1  4  
ATOM 6775  O OD2  . ASP A 1 110 ? -21.545 1.707   13.772  1.00 0.00 ? 110 ASP A OD2  4  
ATOM 6776  H H    . ASP A 1 110 ? -17.280 -0.077  15.257  1.00 0.00 ? 110 ASP A H    4  
ATOM 6777  H HA   . ASP A 1 110 ? -18.728 2.347   15.790  1.00 0.00 ? 110 ASP A HA   4  
ATOM 6778  H HB2  . ASP A 1 110 ? -19.255 0.815   13.886  1.00 0.00 ? 110 ASP A HB2  4  
ATOM 6779  H HB3  . ASP A 1 110 ? -19.820 -0.376  15.055  1.00 0.00 ? 110 ASP A HB3  4  
ATOM 6780  N N    . SER A 1 111 ? -18.940 1.812   18.280  1.00 0.00 ? 111 SER A N    4  
ATOM 6781  C CA   . SER A 1 111 ? -19.380 1.630   19.658  1.00 0.00 ? 111 SER A CA   4  
ATOM 6782  C C    . SER A 1 111 ? -20.545 2.559   19.984  1.00 0.00 ? 111 SER A C    4  
ATOM 6783  O O    . SER A 1 111 ? -20.855 3.475   19.223  1.00 0.00 ? 111 SER A O    4  
ATOM 6784  C CB   . SER A 1 111 ? -18.221 1.888   20.624  1.00 0.00 ? 111 SER A CB   4  
ATOM 6785  O OG   . SER A 1 111 ? -17.135 1.016   20.361  1.00 0.00 ? 111 SER A OG   4  
ATOM 6786  H H    . SER A 1 111 ? -18.361 2.571   18.059  1.00 0.00 ? 111 SER A H    4  
ATOM 6787  H HA   . SER A 1 111 ? -19.709 0.607   19.769  1.00 0.00 ? 111 SER A HA   4  
ATOM 6788  H HB2  . SER A 1 111 ? -17.884 2.907   20.513  1.00 0.00 ? 111 SER A HB2  4  
ATOM 6789  H HB3  . SER A 1 111 ? -18.559 1.728   21.637  1.00 0.00 ? 111 SER A HB3  4  
ATOM 6790  H HG   . SER A 1 111 ? -16.633 1.347   19.613  1.00 0.00 ? 111 SER A HG   4  
ATOM 6791  N N    . GLY A 1 112 ? -21.188 2.315   21.122  1.00 0.00 ? 112 GLY A N    4  
ATOM 6792  C CA   . GLY A 1 112 ? -22.312 3.138   21.530  1.00 0.00 ? 112 GLY A CA   4  
ATOM 6793  C C    . GLY A 1 112 ? -23.592 2.339   21.677  1.00 0.00 ? 112 GLY A C    4  
ATOM 6794  O O    . GLY A 1 112 ? -23.847 1.392   20.933  1.00 0.00 ? 112 GLY A O    4  
ATOM 6795  H H    . GLY A 1 112 ? -20.897 1.571   21.689  1.00 0.00 ? 112 GLY A H    4  
ATOM 6796  H HA2  . GLY A 1 112 ? -22.079 3.603   22.476  1.00 0.00 ? 112 GLY A HA2  4  
ATOM 6797  H HA3  . GLY A 1 112 ? -22.466 3.909   20.790  1.00 0.00 ? 112 GLY A HA3  4  
ATOM 6798  N N    . PRO A 1 113 ? -24.422 2.720   22.659  1.00 0.00 ? 113 PRO A N    4  
ATOM 6799  C CA   . PRO A 1 113 ? -25.696 2.045   22.925  1.00 0.00 ? 113 PRO A CA   4  
ATOM 6800  C C    . PRO A 1 113 ? -26.724 2.292   21.826  1.00 0.00 ? 113 PRO A C    4  
ATOM 6801  O O    . PRO A 1 113 ? -27.789 1.675   21.810  1.00 0.00 ? 113 PRO A O    4  
ATOM 6802  C CB   . PRO A 1 113 ? -26.161 2.671   24.242  1.00 0.00 ? 113 PRO A CB   4  
ATOM 6803  C CG   . PRO A 1 113 ? -25.506 4.009   24.278  1.00 0.00 ? 113 PRO A CG   4  
ATOM 6804  C CD   . PRO A 1 113 ? -24.182 3.840   23.584  1.00 0.00 ? 113 PRO A CD   4  
ATOM 6805  H HA   . PRO A 1 113 ? -25.561 0.981   23.058  1.00 0.00 ? 113 PRO A HA   4  
ATOM 6806  H HB2  . PRO A 1 113 ? -27.238 2.757   24.242  1.00 0.00 ? 113 PRO A HB2  4  
ATOM 6807  H HB3  . PRO A 1 113 ? -25.844 2.054   25.070  1.00 0.00 ? 113 PRO A HB3  4  
ATOM 6808  H HG2  . PRO A 1 113 ? -26.115 4.730   23.754  1.00 0.00 ? 113 PRO A HG2  4  
ATOM 6809  H HG3  . PRO A 1 113 ? -25.355 4.316   25.302  1.00 0.00 ? 113 PRO A HG3  4  
ATOM 6810  H HD2  . PRO A 1 113 ? -23.923 4.738   23.043  1.00 0.00 ? 113 PRO A HD2  4  
ATOM 6811  H HD3  . PRO A 1 113 ? -23.411 3.591   24.298  1.00 0.00 ? 113 PRO A HD3  4  
ATOM 6812  N N    . SER A 1 114 ? -26.397 3.197   20.909  1.00 0.00 ? 114 SER A N    4  
ATOM 6813  C CA   . SER A 1 114 ? -27.294 3.527   19.808  1.00 0.00 ? 114 SER A CA   4  
ATOM 6814  C C    . SER A 1 114 ? -26.505 3.953   18.573  1.00 0.00 ? 114 SER A C    4  
ATOM 6815  O O    . SER A 1 114 ? -25.391 4.465   18.681  1.00 0.00 ? 114 SER A O    4  
ATOM 6816  C CB   . SER A 1 114 ? -28.255 4.643   20.222  1.00 0.00 ? 114 SER A CB   4  
ATOM 6817  O OG   . SER A 1 114 ? -29.306 4.138   21.028  1.00 0.00 ? 114 SER A OG   4  
ATOM 6818  H H    . SER A 1 114 ? -25.533 3.655   20.976  1.00 0.00 ? 114 SER A H    4  
ATOM 6819  H HA   . SER A 1 114 ? -27.865 2.643   19.568  1.00 0.00 ? 114 SER A HA   4  
ATOM 6820  H HB2  . SER A 1 114 ? -27.715 5.390   20.784  1.00 0.00 ? 114 SER A HB2  4  
ATOM 6821  H HB3  . SER A 1 114 ? -28.680 5.095   19.338  1.00 0.00 ? 114 SER A HB3  4  
ATOM 6822  H HG   . SER A 1 114 ? -28.961 3.466   21.620  1.00 0.00 ? 114 SER A HG   4  
ATOM 6823  N N    . SER A 1 115 ? -27.091 3.736   17.400  1.00 0.00 ? 115 SER A N    4  
ATOM 6824  C CA   . SER A 1 115 ? -26.442 4.093   16.144  1.00 0.00 ? 115 SER A CA   4  
ATOM 6825  C C    . SER A 1 115 ? -25.734 5.439   16.262  1.00 0.00 ? 115 SER A C    4  
ATOM 6826  O O    . SER A 1 115 ? -26.128 6.293   17.055  1.00 0.00 ? 115 SER A O    4  
ATOM 6827  C CB   . SER A 1 115 ? -27.469 4.141   15.011  1.00 0.00 ? 115 SER A CB   4  
ATOM 6828  O OG   . SER A 1 115 ? -26.867 3.842   13.764  1.00 0.00 ? 115 SER A OG   4  
ATOM 6829  H H    . SER A 1 115 ? -27.980 3.324   17.379  1.00 0.00 ? 115 SER A H    4  
ATOM 6830  H HA   . SER A 1 115 ? -25.709 3.332   15.922  1.00 0.00 ? 115 SER A HA   4  
ATOM 6831  H HB2  . SER A 1 115 ? -28.248 3.419   15.203  1.00 0.00 ? 115 SER A HB2  4  
ATOM 6832  H HB3  . SER A 1 115 ? -27.900 5.131   14.962  1.00 0.00 ? 115 SER A HB3  4  
ATOM 6833  H HG   . SER A 1 115 ? -26.348 3.038   13.843  1.00 0.00 ? 115 SER A HG   4  
ATOM 6834  N N    . GLY A 1 116 ? -24.685 5.620   15.465  1.00 0.00 ? 116 GLY A N    4  
ATOM 6835  C CA   . GLY A 1 116 ? -23.938 6.864   15.494  1.00 0.00 ? 116 GLY A CA   4  
ATOM 6836  C C    . GLY A 1 116 ? -22.592 6.748   14.807  1.00 0.00 ? 116 GLY A C    4  
ATOM 6837  O O    . GLY A 1 116 ? -22.511 6.322   13.655  1.00 0.00 ? 116 GLY A O    4  
ATOM 6838  H H    . GLY A 1 116 ? -24.416 4.904   14.852  1.00 0.00 ? 116 GLY A H    4  
ATOM 6839  H HA2  . GLY A 1 116 ? -24.517 7.631   15.003  1.00 0.00 ? 116 GLY A HA2  4  
ATOM 6840  H HA3  . GLY A 1 116 ? -23.779 7.151   16.524  1.00 0.00 ? 116 GLY A HA3  4  
ATOM 6841  N N    . GLY A 1 1   ? 2.514   -22.988 6.783   1.00 0.00 ? 1   GLY A N    5  
ATOM 6842  C CA   . GLY A 1 1   ? 1.657   -23.557 5.759   1.00 0.00 ? 1   GLY A CA   5  
ATOM 6843  C C    . GLY A 1 1   ? 2.114   -23.202 4.358   1.00 0.00 ? 1   GLY A C    5  
ATOM 6844  O O    . GLY A 1 1   ? 2.749   -22.168 4.147   1.00 0.00 ? 1   GLY A O    5  
ATOM 6845  H H1   . GLY A 1 1   ? 2.888   -23.564 7.481   1.00 0.00 ? 1   GLY A H1   5  
ATOM 6846  H HA2  . GLY A 1 1   ? 1.654   -24.631 5.864   1.00 0.00 ? 1   GLY A HA2  5  
ATOM 6847  H HA3  . GLY A 1 1   ? 0.652   -23.188 5.901   1.00 0.00 ? 1   GLY A HA3  5  
ATOM 6848  N N    . SER A 1 2   ? 1.791   -24.061 3.396   1.00 0.00 ? 2   SER A N    5  
ATOM 6849  C CA   . SER A 1 2   ? 2.177   -23.836 2.008   1.00 0.00 ? 2   SER A CA   5  
ATOM 6850  C C    . SER A 1 2   ? 1.282   -24.628 1.060   1.00 0.00 ? 2   SER A C    5  
ATOM 6851  O O    . SER A 1 2   ? 0.951   -25.784 1.323   1.00 0.00 ? 2   SER A O    5  
ATOM 6852  C CB   . SER A 1 2   ? 3.640   -24.227 1.794   1.00 0.00 ? 2   SER A CB   5  
ATOM 6853  O OG   . SER A 1 2   ? 4.075   -23.883 0.490   1.00 0.00 ? 2   SER A OG   5  
ATOM 6854  H H    . SER A 1 2   ? 1.283   -24.867 3.627   1.00 0.00 ? 2   SER A H    5  
ATOM 6855  H HA   . SER A 1 2   ? 2.061   -22.783 1.799   1.00 0.00 ? 2   SER A HA   5  
ATOM 6856  H HB2  . SER A 1 2   ? 4.258   -23.711 2.513   1.00 0.00 ? 2   SER A HB2  5  
ATOM 6857  H HB3  . SER A 1 2   ? 3.748   -25.294 1.926   1.00 0.00 ? 2   SER A HB3  5  
ATOM 6858  H HG   . SER A 1 2   ? 4.335   -24.678 0.018   1.00 0.00 ? 2   SER A HG   5  
ATOM 6859  N N    . SER A 1 3   ? 0.895   -23.997 -0.044  1.00 0.00 ? 3   SER A N    5  
ATOM 6860  C CA   . SER A 1 3   ? 0.036   -24.641 -1.031  1.00 0.00 ? 3   SER A CA   5  
ATOM 6861  C C    . SER A 1 3   ? 0.487   -24.301 -2.448  1.00 0.00 ? 3   SER A C    5  
ATOM 6862  O O    . SER A 1 3   ? 0.310   -23.177 -2.915  1.00 0.00 ? 3   SER A O    5  
ATOM 6863  C CB   . SER A 1 3   ? -1.418  -24.210 -0.830  1.00 0.00 ? 3   SER A CB   5  
ATOM 6864  O OG   . SER A 1 3   ? -2.267  -24.818 -1.788  1.00 0.00 ? 3   SER A OG   5  
ATOM 6865  H H    . SER A 1 3   ? 1.193   -23.076 -0.197  1.00 0.00 ? 3   SER A H    5  
ATOM 6866  H HA   . SER A 1 3   ? 0.110   -25.709 -0.888  1.00 0.00 ? 3   SER A HA   5  
ATOM 6867  H HB2  . SER A 1 3   ? -1.744  -24.501 0.158   1.00 0.00 ? 3   SER A HB2  5  
ATOM 6868  H HB3  . SER A 1 3   ? -1.491  -23.137 -0.931  1.00 0.00 ? 3   SER A HB3  5  
ATOM 6869  H HG   . SER A 1 3   ? -3.176  -24.554 -1.625  1.00 0.00 ? 3   SER A HG   5  
ATOM 6870  N N    . GLY A 1 4   ? 1.072   -25.283 -3.128  1.00 0.00 ? 4   GLY A N    5  
ATOM 6871  C CA   . GLY A 1 4   ? 1.540   -25.069 -4.485  1.00 0.00 ? 4   GLY A CA   5  
ATOM 6872  C C    . GLY A 1 4   ? 2.799   -25.855 -4.794  1.00 0.00 ? 4   GLY A C    5  
ATOM 6873  O O    . GLY A 1 4   ? 3.269   -26.637 -3.969  1.00 0.00 ? 4   GLY A O    5  
ATOM 6874  H H    . GLY A 1 4   ? 1.186   -26.159 -2.704  1.00 0.00 ? 4   GLY A H    5  
ATOM 6875  H HA2  . GLY A 1 4   ? 0.763   -25.368 -5.173  1.00 0.00 ? 4   GLY A HA2  5  
ATOM 6876  H HA3  . GLY A 1 4   ? 1.743   -24.017 -4.622  1.00 0.00 ? 4   GLY A HA3  5  
ATOM 6877  N N    . SER A 1 5   ? 3.345   -25.648 -5.988  1.00 0.00 ? 5   SER A N    5  
ATOM 6878  C CA   . SER A 1 5   ? 4.554   -26.347 -6.407  1.00 0.00 ? 5   SER A CA   5  
ATOM 6879  C C    . SER A 1 5   ? 5.763   -25.418 -6.362  1.00 0.00 ? 5   SER A C    5  
ATOM 6880  O O    . SER A 1 5   ? 5.638   -24.209 -6.561  1.00 0.00 ? 5   SER A O    5  
ATOM 6881  C CB   . SER A 1 5   ? 4.380   -26.908 -7.820  1.00 0.00 ? 5   SER A CB   5  
ATOM 6882  O OG   . SER A 1 5   ? 3.262   -27.775 -7.891  1.00 0.00 ? 5   SER A OG   5  
ATOM 6883  H H    . SER A 1 5   ? 2.923   -25.012 -6.603  1.00 0.00 ? 5   SER A H    5  
ATOM 6884  H HA   . SER A 1 5   ? 4.718   -27.166 -5.722  1.00 0.00 ? 5   SER A HA   5  
ATOM 6885  H HB2  . SER A 1 5   ? 4.233   -26.093 -8.513  1.00 0.00 ? 5   SER A HB2  5  
ATOM 6886  H HB3  . SER A 1 5   ? 5.267   -27.460 -8.097  1.00 0.00 ? 5   SER A HB3  5  
ATOM 6887  H HG   . SER A 1 5   ? 3.327   -28.439 -7.200  1.00 0.00 ? 5   SER A HG   5  
ATOM 6888  N N    . SER A 1 6   ? 6.932   -25.991 -6.098  1.00 0.00 ? 6   SER A N    5  
ATOM 6889  C CA   . SER A 1 6   ? 8.164   -25.214 -6.022  1.00 0.00 ? 6   SER A CA   5  
ATOM 6890  C C    . SER A 1 6   ? 8.810   -25.084 -7.398  1.00 0.00 ? 6   SER A C    5  
ATOM 6891  O O    . SER A 1 6   ? 8.851   -26.041 -8.170  1.00 0.00 ? 6   SER A O    5  
ATOM 6892  C CB   . SER A 1 6   ? 9.144   -25.867 -5.045  1.00 0.00 ? 6   SER A CB   5  
ATOM 6893  O OG   . SER A 1 6   ? 10.294  -25.060 -4.860  1.00 0.00 ? 6   SER A OG   5  
ATOM 6894  H H    . SER A 1 6   ? 6.967   -26.959 -5.948  1.00 0.00 ? 6   SER A H    5  
ATOM 6895  H HA   . SER A 1 6   ? 7.913   -24.228 -5.660  1.00 0.00 ? 6   SER A HA   5  
ATOM 6896  H HB2  . SER A 1 6   ? 8.660   -26.006 -4.091  1.00 0.00 ? 6   SER A HB2  5  
ATOM 6897  H HB3  . SER A 1 6   ? 9.452   -26.827 -5.436  1.00 0.00 ? 6   SER A HB3  5  
ATOM 6898  H HG   . SER A 1 6   ? 10.435  -24.519 -5.641  1.00 0.00 ? 6   SER A HG   5  
ATOM 6899  N N    . GLY A 1 7   ? 9.314   -23.891 -7.698  1.00 0.00 ? 7   GLY A N    5  
ATOM 6900  C CA   . GLY A 1 7   ? 9.951   -23.656 -8.980  1.00 0.00 ? 7   GLY A CA   5  
ATOM 6901  C C    . GLY A 1 7   ? 9.812   -22.219 -9.442  1.00 0.00 ? 7   GLY A C    5  
ATOM 6902  O O    . GLY A 1 7   ? 8.778   -21.834 -9.990  1.00 0.00 ? 7   GLY A O    5  
ATOM 6903  H H    . GLY A 1 7   ? 9.253   -23.164 -7.043  1.00 0.00 ? 7   GLY A H    5  
ATOM 6904  H HA2  . GLY A 1 7   ? 11.001  -23.896 -8.898  1.00 0.00 ? 7   GLY A HA2  5  
ATOM 6905  H HA3  . GLY A 1 7   ? 9.501   -24.304 -9.717  1.00 0.00 ? 7   GLY A HA3  5  
ATOM 6906  N N    . ARG A 1 8   ? 10.853  -21.424 -9.220  1.00 0.00 ? 8   ARG A N    5  
ATOM 6907  C CA   . ARG A 1 8   ? 10.841  -20.020 -9.615  1.00 0.00 ? 8   ARG A CA   5  
ATOM 6908  C C    . ARG A 1 8   ? 12.191  -19.606 -10.194 1.00 0.00 ? 8   ARG A C    5  
ATOM 6909  O O    . ARG A 1 8   ? 13.220  -20.210 -9.890  1.00 0.00 ? 8   ARG A O    5  
ATOM 6910  C CB   . ARG A 1 8   ? 10.493  -19.134 -8.418  1.00 0.00 ? 8   ARG A CB   5  
ATOM 6911  C CG   . ARG A 1 8   ? 11.537  -19.167 -7.313  1.00 0.00 ? 8   ARG A CG   5  
ATOM 6912  C CD   . ARG A 1 8   ? 10.916  -18.901 -5.951  1.00 0.00 ? 8   ARG A CD   5  
ATOM 6913  N NE   . ARG A 1 8   ? 10.875  -17.475 -5.637  1.00 0.00 ? 8   ARG A NE   5  
ATOM 6914  C CZ   . ARG A 1 8   ? 10.182  -16.965 -4.625  1.00 0.00 ? 8   ARG A CZ   5  
ATOM 6915  N NH1  . ARG A 1 8   ? 9.475   -17.760 -3.834  1.00 0.00 ? 8   ARG A NH1  5  
ATOM 6916  N NH2  . ARG A 1 8   ? 10.194  -15.657 -4.403  1.00 0.00 ? 8   ARG A NH2  5  
ATOM 6917  H H    . ARG A 1 8   ? 11.649  -21.789 -8.780  1.00 0.00 ? 8   ARG A H    5  
ATOM 6918  H HA   . ARG A 1 8   ? 10.083  -19.896 -10.375 1.00 0.00 ? 8   ARG A HA   5  
ATOM 6919  H HB2  . ARG A 1 8   ? 10.392  -18.114 -8.757  1.00 0.00 ? 8   ARG A HB2  5  
ATOM 6920  H HB3  . ARG A 1 8   ? 9.552   -19.463 -8.003  1.00 0.00 ? 8   ARG A HB3  5  
ATOM 6921  H HG2  . ARG A 1 8   ? 12.004  -20.141 -7.300  1.00 0.00 ? 8   ARG A HG2  5  
ATOM 6922  H HG3  . ARG A 1 8   ? 12.282  -18.411 -7.513  1.00 0.00 ? 8   ARG A HG3  5  
ATOM 6923  H HD2  . ARG A 1 8   ? 9.908   -19.289 -5.948  1.00 0.00 ? 8   ARG A HD2  5  
ATOM 6924  H HD3  . ARG A 1 8   ? 11.499  -19.410 -5.199  1.00 0.00 ? 8   ARG A HD3  5  
ATOM 6925  H HE   . ARG A 1 8   ? 11.390  -16.869 -6.209  1.00 0.00 ? 8   ARG A HE   5  
ATOM 6926  H HH11 . ARG A 1 8   ? 9.464   -18.746 -3.998  1.00 0.00 ? 8   ARG A HH11 5  
ATOM 6927  H HH12 . ARG A 1 8   ? 8.954   -17.374 -3.072  1.00 0.00 ? 8   ARG A HH12 5  
ATOM 6928  H HH21 . ARG A 1 8   ? 10.726  -15.054 -4.997  1.00 0.00 ? 8   ARG A HH21 5  
ATOM 6929  H HH22 . ARG A 1 8   ? 9.672   -15.274 -3.642  1.00 0.00 ? 8   ARG A HH22 5  
ATOM 6930  N N    . VAL A 1 9   ? 12.179  -18.573 -11.030 1.00 0.00 ? 9   VAL A N    5  
ATOM 6931  C CA   . VAL A 1 9   ? 13.401  -18.077 -11.650 1.00 0.00 ? 9   VAL A CA   5  
ATOM 6932  C C    . VAL A 1 9   ? 13.944  -16.864 -10.903 1.00 0.00 ? 9   VAL A C    5  
ATOM 6933  O O    . VAL A 1 9   ? 13.278  -16.313 -10.028 1.00 0.00 ? 9   VAL A O    5  
ATOM 6934  C CB   . VAL A 1 9   ? 13.168  -17.697 -13.124 1.00 0.00 ? 9   VAL A CB   5  
ATOM 6935  C CG1  . VAL A 1 9   ? 12.715  -18.909 -13.924 1.00 0.00 ? 9   VAL A CG1  5  
ATOM 6936  C CG2  . VAL A 1 9   ? 12.153  -16.569 -13.229 1.00 0.00 ? 9   VAL A CG2  5  
ATOM 6937  H H    . VAL A 1 9   ? 11.327  -18.132 -11.233 1.00 0.00 ? 9   VAL A H    5  
ATOM 6938  H HA   . VAL A 1 9   ? 14.137  -18.868 -11.616 1.00 0.00 ? 9   VAL A HA   5  
ATOM 6939  H HB   . VAL A 1 9   ? 14.104  -17.350 -13.538 1.00 0.00 ? 9   VAL A HB   5  
ATOM 6940  H HG11 . VAL A 1 9   ? 11.637  -18.961 -13.918 1.00 0.00 ? 9   VAL A HG11 5  
ATOM 6941  H HG12 . VAL A 1 9   ? 13.067  -18.822 -14.941 1.00 0.00 ? 9   VAL A HG12 5  
ATOM 6942  H HG13 . VAL A 1 9   ? 13.121  -19.806 -13.478 1.00 0.00 ? 9   VAL A HG13 5  
ATOM 6943  H HG21 . VAL A 1 9   ? 11.783  -16.511 -14.242 1.00 0.00 ? 9   VAL A HG21 5  
ATOM 6944  H HG22 . VAL A 1 9   ? 11.329  -16.762 -12.556 1.00 0.00 ? 9   VAL A HG22 5  
ATOM 6945  H HG23 . VAL A 1 9   ? 12.623  -15.635 -12.963 1.00 0.00 ? 9   VAL A HG23 5  
ATOM 6946  N N    . GLU A 1 10  ? 15.158  -16.453 -11.256 1.00 0.00 ? 10  GLU A N    5  
ATOM 6947  C CA   . GLU A 1 10  ? 15.791  -15.305 -10.618 1.00 0.00 ? 10  GLU A CA   5  
ATOM 6948  C C    . GLU A 1 10  ? 15.973  -14.162 -11.613 1.00 0.00 ? 10  GLU A C    5  
ATOM 6949  O O    . GLU A 1 10  ? 16.884  -14.182 -12.440 1.00 0.00 ? 10  GLU A O    5  
ATOM 6950  C CB   . GLU A 1 10  ? 17.146  -15.703 -10.029 1.00 0.00 ? 10  GLU A CB   5  
ATOM 6951  C CG   . GLU A 1 10  ? 17.843  -16.811 -10.799 1.00 0.00 ? 10  GLU A CG   5  
ATOM 6952  C CD   . GLU A 1 10  ? 19.049  -17.363 -10.064 1.00 0.00 ? 10  GLU A CD   5  
ATOM 6953  O OE1  . GLU A 1 10  ? 19.898  -16.557 -9.629  1.00 0.00 ? 10  GLU A OE1  5  
ATOM 6954  O OE2  . GLU A 1 10  ? 19.144  -18.600 -9.924  1.00 0.00 ? 10  GLU A OE2  5  
ATOM 6955  H H    . GLU A 1 10  ? 15.640  -16.934 -11.961 1.00 0.00 ? 10  GLU A H    5  
ATOM 6956  H HA   . GLU A 1 10  ? 15.145  -14.972 -9.820  1.00 0.00 ? 10  GLU A HA   5  
ATOM 6957  H HB2  . GLU A 1 10  ? 17.790  -14.836 -10.022 1.00 0.00 ? 10  GLU A HB2  5  
ATOM 6958  H HB3  . GLU A 1 10  ? 16.998  -16.038 -9.013  1.00 0.00 ? 10  GLU A HB3  5  
ATOM 6959  H HG2  . GLU A 1 10  ? 17.141  -17.615 -10.962 1.00 0.00 ? 10  GLU A HG2  5  
ATOM 6960  H HG3  . GLU A 1 10  ? 18.168  -16.420 -11.752 1.00 0.00 ? 10  GLU A HG3  5  
ATOM 6961  N N    . THR A 1 11  ? 15.097  -13.165 -11.526 1.00 0.00 ? 11  THR A N    5  
ATOM 6962  C CA   . THR A 1 11  ? 15.158  -12.014 -12.418 1.00 0.00 ? 11  THR A CA   5  
ATOM 6963  C C    . THR A 1 11  ? 15.889  -10.849 -11.762 1.00 0.00 ? 11  THR A C    5  
ATOM 6964  O O    . THR A 1 11  ? 15.317  -10.125 -10.949 1.00 0.00 ? 11  THR A O    5  
ATOM 6965  C CB   . THR A 1 11  ? 13.750  -11.552 -12.837 1.00 0.00 ? 11  THR A CB   5  
ATOM 6966  O OG1  . THR A 1 11  ? 13.019  -12.650 -13.393 1.00 0.00 ? 11  THR A OG1  5  
ATOM 6967  C CG2  . THR A 1 11  ? 13.831  -10.423 -13.853 1.00 0.00 ? 11  THR A CG2  5  
ATOM 6968  H H    . THR A 1 11  ? 14.393  -13.207 -10.846 1.00 0.00 ? 11  THR A H    5  
ATOM 6969  H HA   . THR A 1 11  ? 15.696  -12.310 -13.307 1.00 0.00 ? 11  THR A HA   5  
ATOM 6970  H HB   . THR A 1 11  ? 13.231  -11.191 -11.960 1.00 0.00 ? 11  THR A HB   5  
ATOM 6971  H HG1  . THR A 1 11  ? 12.675  -12.402 -14.255 1.00 0.00 ? 11  THR A HG1  5  
ATOM 6972  H HG21 . THR A 1 11  ? 14.637  -10.618 -14.545 1.00 0.00 ? 11  THR A HG21 5  
ATOM 6973  H HG22 . THR A 1 11  ? 14.013  -9.490  -13.341 1.00 0.00 ? 11  THR A HG22 5  
ATOM 6974  H HG23 . THR A 1 11  ? 12.899  -10.360 -14.395 1.00 0.00 ? 11  THR A HG23 5  
ATOM 6975  N N    . GLN A 1 12  ? 17.157  -10.673 -12.123 1.00 0.00 ? 12  GLN A N    5  
ATOM 6976  C CA   . GLN A 1 12  ? 17.966  -9.594  -11.568 1.00 0.00 ? 12  GLN A CA   5  
ATOM 6977  C C    . GLN A 1 12  ? 17.254  -8.252  -11.709 1.00 0.00 ? 12  GLN A C    5  
ATOM 6978  O O    . GLN A 1 12  ? 16.684  -7.931  -12.752 1.00 0.00 ? 12  GLN A O    5  
ATOM 6979  C CB   . GLN A 1 12  ? 19.327  -9.539  -12.264 1.00 0.00 ? 12  GLN A CB   5  
ATOM 6980  C CG   . GLN A 1 12  ? 20.097  -10.848 -12.197 1.00 0.00 ? 12  GLN A CG   5  
ATOM 6981  C CD   . GLN A 1 12  ? 21.598  -10.645 -12.266 1.00 0.00 ? 12  GLN A CD   5  
ATOM 6982  O OE1  . GLN A 1 12  ? 22.129  -10.186 -13.278 1.00 0.00 ? 12  GLN A OE1  5  
ATOM 6983  N NE2  . GLN A 1 12  ? 22.292  -10.987 -11.187 1.00 0.00 ? 12  GLN A NE2  5  
ATOM 6984  H H    . GLN A 1 12  ? 17.557  -11.283 -12.776 1.00 0.00 ? 12  GLN A H    5  
ATOM 6985  H HA   . GLN A 1 12  ? 18.116  -9.798  -10.519 1.00 0.00 ? 12  GLN A HA   5  
ATOM 6986  H HB2  . GLN A 1 12  ? 19.177  -9.286  -13.303 1.00 0.00 ? 12  GLN A HB2  5  
ATOM 6987  H HB3  . GLN A 1 12  ? 19.925  -8.770  -11.797 1.00 0.00 ? 12  GLN A HB3  5  
ATOM 6988  H HG2  . GLN A 1 12  ? 19.859  -11.344 -11.269 1.00 0.00 ? 12  GLN A HG2  5  
ATOM 6989  H HG3  . GLN A 1 12  ? 19.794  -11.471 -13.026 1.00 0.00 ? 12  GLN A HG3  5  
ATOM 6990  H HE21 . GLN A 1 12  ? 21.802  -11.348 -10.417 1.00 0.00 ? 12  GLN A HE21 5  
ATOM 6991  H HE22 . GLN A 1 12  ? 23.263  -10.868 -11.204 1.00 0.00 ? 12  GLN A HE22 5  
ATOM 6992  N N    . PRO A 1 13  ? 17.286  -7.449  -10.636 1.00 0.00 ? 13  PRO A N    5  
ATOM 6993  C CA   . PRO A 1 13  ? 16.649  -6.129  -10.616 1.00 0.00 ? 13  PRO A CA   5  
ATOM 6994  C C    . PRO A 1 13  ? 17.368  -5.125  -11.511 1.00 0.00 ? 13  PRO A C    5  
ATOM 6995  O O    . PRO A 1 13  ? 18.310  -5.476  -12.220 1.00 0.00 ? 13  PRO A O    5  
ATOM 6996  C CB   . PRO A 1 13  ? 16.753  -5.707  -9.148  1.00 0.00 ? 13  PRO A CB   5  
ATOM 6997  C CG   . PRO A 1 13  ? 17.927  -6.457  -8.620  1.00 0.00 ? 13  PRO A CG   5  
ATOM 6998  C CD   . PRO A 1 13  ? 17.947  -7.767  -9.359  1.00 0.00 ? 13  PRO A CD   5  
ATOM 6999  H HA   . PRO A 1 13  ? 15.610  -6.185  -10.903 1.00 0.00 ? 13  PRO A HA   5  
ATOM 7000  H HB2  . PRO A 1 13  ? 16.907  -4.638  -9.088  1.00 0.00 ? 13  PRO A HB2  5  
ATOM 7001  H HB3  . PRO A 1 13  ? 15.847  -5.976  -8.627  1.00 0.00 ? 13  PRO A HB3  5  
ATOM 7002  H HG2  . PRO A 1 13  ? 18.834  -5.904  -8.813  1.00 0.00 ? 13  PRO A HG2  5  
ATOM 7003  H HG3  . PRO A 1 13  ? 17.807  -6.627  -7.560  1.00 0.00 ? 13  PRO A HG3  5  
ATOM 7004  H HD2  . PRO A 1 13  ? 18.964  -8.093  -9.522  1.00 0.00 ? 13  PRO A HD2  5  
ATOM 7005  H HD3  . PRO A 1 13  ? 17.392  -8.516  -8.814  1.00 0.00 ? 13  PRO A HD3  5  
ATOM 7006  N N    . GLU A 1 14  ? 16.918  -3.875  -11.471 1.00 0.00 ? 14  GLU A N    5  
ATOM 7007  C CA   . GLU A 1 14  ? 17.519  -2.820  -12.279 1.00 0.00 ? 14  GLU A CA   5  
ATOM 7008  C C    . GLU A 1 14  ? 17.951  -1.645  -11.407 1.00 0.00 ? 14  GLU A C    5  
ATOM 7009  O O    . GLU A 1 14  ? 17.804  -1.677  -10.185 1.00 0.00 ? 14  GLU A O    5  
ATOM 7010  C CB   . GLU A 1 14  ? 16.534  -2.342  -13.348 1.00 0.00 ? 14  GLU A CB   5  
ATOM 7011  C CG   . GLU A 1 14  ? 16.485  -3.237  -14.575 1.00 0.00 ? 14  GLU A CG   5  
ATOM 7012  C CD   . GLU A 1 14  ? 17.862  -3.679  -15.030 1.00 0.00 ? 14  GLU A CD   5  
ATOM 7013  O OE1  . GLU A 1 14  ? 18.492  -2.942  -15.816 1.00 0.00 ? 14  GLU A OE1  5  
ATOM 7014  O OE2  . GLU A 1 14  ? 18.309  -4.763  -14.600 1.00 0.00 ? 14  GLU A OE2  5  
ATOM 7015  H H    . GLU A 1 14  ? 16.163  -3.656  -10.885 1.00 0.00 ? 14  GLU A H    5  
ATOM 7016  H HA   . GLU A 1 14  ? 18.391  -3.232  -12.765 1.00 0.00 ? 14  GLU A HA   5  
ATOM 7017  H HB2  . GLU A 1 14  ? 15.545  -2.302  -12.916 1.00 0.00 ? 14  GLU A HB2  5  
ATOM 7018  H HB3  . GLU A 1 14  ? 16.819  -1.350  -13.664 1.00 0.00 ? 14  GLU A HB3  5  
ATOM 7019  H HG2  . GLU A 1 14  ? 15.901  -4.115  -14.341 1.00 0.00 ? 14  GLU A HG2  5  
ATOM 7020  H HG3  . GLU A 1 14  ? 16.011  -2.696  -15.381 1.00 0.00 ? 14  GLU A HG3  5  
ATOM 7021  N N    . VAL A 1 15  ? 18.485  -0.608  -12.044 1.00 0.00 ? 15  VAL A N    5  
ATOM 7022  C CA   . VAL A 1 15  ? 18.938  0.579   -11.328 1.00 0.00 ? 15  VAL A CA   5  
ATOM 7023  C C    . VAL A 1 15  ? 18.156  1.814   -11.760 1.00 0.00 ? 15  VAL A C    5  
ATOM 7024  O O    . VAL A 1 15  ? 18.139  2.825   -11.060 1.00 0.00 ? 15  VAL A O    5  
ATOM 7025  C CB   . VAL A 1 15  ? 20.440  0.831   -11.554 1.00 0.00 ? 15  VAL A CB   5  
ATOM 7026  C CG1  . VAL A 1 15  ? 20.726  1.071   -13.028 1.00 0.00 ? 15  VAL A CG1  5  
ATOM 7027  C CG2  . VAL A 1 15  ? 20.915  2.006   -10.712 1.00 0.00 ? 15  VAL A CG2  5  
ATOM 7028  H H    . VAL A 1 15  ? 18.576  -0.641  -13.019 1.00 0.00 ? 15  VAL A H    5  
ATOM 7029  H HA   . VAL A 1 15  ? 18.777  0.413   -10.272 1.00 0.00 ? 15  VAL A HA   5  
ATOM 7030  H HB   . VAL A 1 15  ? 20.984  -0.049  -11.243 1.00 0.00 ? 15  VAL A HB   5  
ATOM 7031  H HG11 . VAL A 1 15  ? 20.677  2.129   -13.237 1.00 0.00 ? 15  VAL A HG11 5  
ATOM 7032  H HG12 . VAL A 1 15  ? 21.712  0.700   -13.269 1.00 0.00 ? 15  VAL A HG12 5  
ATOM 7033  H HG13 . VAL A 1 15  ? 19.990  0.553   -13.626 1.00 0.00 ? 15  VAL A HG13 5  
ATOM 7034  H HG21 . VAL A 1 15  ? 21.216  2.815   -11.362 1.00 0.00 ? 15  VAL A HG21 5  
ATOM 7035  H HG22 . VAL A 1 15  ? 20.111  2.339   -10.072 1.00 0.00 ? 15  VAL A HG22 5  
ATOM 7036  H HG23 . VAL A 1 15  ? 21.755  1.700   -10.106 1.00 0.00 ? 15  VAL A HG23 5  
ATOM 7037  N N    . GLN A 1 16  ? 17.508  1.722   -12.917 1.00 0.00 ? 16  GLN A N    5  
ATOM 7038  C CA   . GLN A 1 16  ? 16.724  2.833   -13.443 1.00 0.00 ? 16  GLN A CA   5  
ATOM 7039  C C    . GLN A 1 16  ? 15.264  2.718   -13.016 1.00 0.00 ? 16  GLN A C    5  
ATOM 7040  O O    . GLN A 1 16  ? 14.358  3.099   -13.758 1.00 0.00 ? 16  GLN A O    5  
ATOM 7041  C CB   . GLN A 1 16  ? 16.820  2.876   -14.969 1.00 0.00 ? 16  GLN A CB   5  
ATOM 7042  C CG   . GLN A 1 16  ? 16.189  1.674   -15.652 1.00 0.00 ? 16  GLN A CG   5  
ATOM 7043  C CD   . GLN A 1 16  ? 17.149  0.509   -15.788 1.00 0.00 ? 16  GLN A CD   5  
ATOM 7044  O OE1  . GLN A 1 16  ? 18.349  0.647   -15.547 1.00 0.00 ? 16  GLN A OE1  5  
ATOM 7045  N NE2  . GLN A 1 16  ? 16.625  -0.649  -16.174 1.00 0.00 ? 16  GLN A NE2  5  
ATOM 7046  H H    . GLN A 1 16  ? 17.560  0.889   -13.429 1.00 0.00 ? 16  GLN A H    5  
ATOM 7047  H HA   . GLN A 1 16  ? 17.132  3.747   -13.040 1.00 0.00 ? 16  GLN A HA   5  
ATOM 7048  H HB2  . GLN A 1 16  ? 16.324  3.767   -15.324 1.00 0.00 ? 16  GLN A HB2  5  
ATOM 7049  H HB3  . GLN A 1 16  ? 17.862  2.917   -15.251 1.00 0.00 ? 16  GLN A HB3  5  
ATOM 7050  H HG2  . GLN A 1 16  ? 15.337  1.352   -15.072 1.00 0.00 ? 16  GLN A HG2  5  
ATOM 7051  H HG3  . GLN A 1 16  ? 15.861  1.968   -16.638 1.00 0.00 ? 16  GLN A HG3  5  
ATOM 7052  H HE21 . GLN A 1 16  ? 15.661  -0.684  -16.350 1.00 0.00 ? 16  GLN A HE21 5  
ATOM 7053  H HE22 . GLN A 1 16  ? 17.223  -1.418  -16.271 1.00 0.00 ? 16  GLN A HE22 5  
ATOM 7054  N N    . LEU A 1 17  ? 15.043  2.191   -11.817 1.00 0.00 ? 17  LEU A N    5  
ATOM 7055  C CA   . LEU A 1 17  ? 13.692  2.025   -11.292 1.00 0.00 ? 17  LEU A CA   5  
ATOM 7056  C C    . LEU A 1 17  ? 13.369  3.110   -10.269 1.00 0.00 ? 17  LEU A C    5  
ATOM 7057  O O    . LEU A 1 17  ? 14.256  3.761   -9.717  1.00 0.00 ? 17  LEU A O    5  
ATOM 7058  C CB   . LEU A 1 17  ? 13.538  0.644   -10.652 1.00 0.00 ? 17  LEU A CB   5  
ATOM 7059  C CG   . LEU A 1 17  ? 13.061  -0.475  -11.578 1.00 0.00 ? 17  LEU A CG   5  
ATOM 7060  C CD1  . LEU A 1 17  ? 13.684  -0.329  -12.957 1.00 0.00 ? 17  LEU A CD1  5  
ATOM 7061  C CD2  . LEU A 1 17  ? 13.389  -1.836  -10.983 1.00 0.00 ? 17  LEU A CD2  5  
ATOM 7062  H H    . LEU A 1 17  ? 15.805  1.906   -11.272 1.00 0.00 ? 17  LEU A H    5  
ATOM 7063  H HA   . LEU A 1 17  ? 13.002  2.109   -12.118 1.00 0.00 ? 17  LEU A HA   5  
ATOM 7064  H HB2  . LEU A 1 17  ? 14.499  0.356   -10.254 1.00 0.00 ? 17  LEU A HB2  5  
ATOM 7065  H HB3  . LEU A 1 17  ? 12.827  0.733   -9.843  1.00 0.00 ? 17  LEU A HB3  5  
ATOM 7066  H HG   . LEU A 1 17  ? 11.987  -0.408  -11.689 1.00 0.00 ? 17  LEU A HG   5  
ATOM 7067  H HD11 . LEU A 1 17  ? 14.759  -0.286  -12.864 1.00 0.00 ? 17  LEU A HD11 5  
ATOM 7068  H HD12 . LEU A 1 17  ? 13.327  0.579   -13.420 1.00 0.00 ? 17  LEU A HD12 5  
ATOM 7069  H HD13 . LEU A 1 17  ? 13.409  -1.176  -13.568 1.00 0.00 ? 17  LEU A HD13 5  
ATOM 7070  H HD21 . LEU A 1 17  ? 13.920  -2.429  -11.714 1.00 0.00 ? 17  LEU A HD21 5  
ATOM 7071  H HD22 . LEU A 1 17  ? 12.473  -2.339  -10.708 1.00 0.00 ? 17  LEU A HD22 5  
ATOM 7072  H HD23 . LEU A 1 17  ? 14.007  -1.706  -10.107 1.00 0.00 ? 17  LEU A HD23 5  
ATOM 7073  N N    . PRO A 1 18  ? 12.068  3.310   -10.009 1.00 0.00 ? 18  PRO A N    5  
ATOM 7074  C CA   . PRO A 1 18  ? 11.598  4.314   -9.050  1.00 0.00 ? 18  PRO A CA   5  
ATOM 7075  C C    . PRO A 1 18  ? 11.929  3.939   -7.610  1.00 0.00 ? 18  PRO A C    5  
ATOM 7076  O O    . PRO A 1 18  ? 12.425  2.846   -7.341  1.00 0.00 ? 18  PRO A O    5  
ATOM 7077  C CB   . PRO A 1 18  ? 10.082  4.326   -9.265  1.00 0.00 ? 18  PRO A CB   5  
ATOM 7078  C CG   . PRO A 1 18  ? 9.765   2.976   -9.808  1.00 0.00 ? 18  PRO A CG   5  
ATOM 7079  C CD   . PRO A 1 18  ? 10.957  2.571   -10.631 1.00 0.00 ? 18  PRO A CD   5  
ATOM 7080  H HA   . PRO A 1 18  ? 12.002  5.291   -9.269  1.00 0.00 ? 18  PRO A HA   5  
ATOM 7081  H HB2  . PRO A 1 18  ? 9.584   4.500   -8.321  1.00 0.00 ? 18  PRO A HB2  5  
ATOM 7082  H HB3  . PRO A 1 18  ? 9.820   5.105   -9.965  1.00 0.00 ? 18  PRO A HB3  5  
ATOM 7083  H HG2  . PRO A 1 18  ? 9.615   2.280   -8.997  1.00 0.00 ? 18  PRO A HG2  5  
ATOM 7084  H HG3  . PRO A 1 18  ? 8.882   3.028   -10.428 1.00 0.00 ? 18  PRO A HG3  5  
ATOM 7085  H HD2  . PRO A 1 18  ? 11.117  1.505   -10.564 1.00 0.00 ? 18  PRO A HD2  5  
ATOM 7086  H HD3  . PRO A 1 18  ? 10.824  2.870   -11.661 1.00 0.00 ? 18  PRO A HD3  5  
ATOM 7087  N N    . GLY A 1 19  ? 11.651  4.854   -6.686  1.00 0.00 ? 19  GLY A N    5  
ATOM 7088  C CA   . GLY A 1 19  ? 11.926  4.600   -5.284  1.00 0.00 ? 19  GLY A CA   5  
ATOM 7089  C C    . GLY A 1 19  ? 10.663  4.370   -4.478  1.00 0.00 ? 19  GLY A C    5  
ATOM 7090  O O    . GLY A 1 19  ? 9.547   4.543   -4.969  1.00 0.00 ? 19  GLY A O    5  
ATOM 7091  H H    . GLY A 1 19  ? 11.256  5.709   -6.959  1.00 0.00 ? 19  GLY A H    5  
ATOM 7092  H HA2  . GLY A 1 19  ? 12.556  3.727   -5.204  1.00 0.00 ? 19  GLY A HA2  5  
ATOM 7093  H HA3  . GLY A 1 19  ? 12.451  5.449   -4.872  1.00 0.00 ? 19  GLY A HA3  5  
ATOM 7094  N N    . PRO A 1 20  ? 10.831  3.967   -3.209  1.00 0.00 ? 20  PRO A N    5  
ATOM 7095  C CA   . PRO A 1 20  ? 9.706   3.703   -2.307  1.00 0.00 ? 20  PRO A CA   5  
ATOM 7096  C C    . PRO A 1 20  ? 8.971   4.977   -1.908  1.00 0.00 ? 20  PRO A C    5  
ATOM 7097  O O    . PRO A 1 20  ? 9.568   5.905   -1.364  1.00 0.00 ? 20  PRO A O    5  
ATOM 7098  C CB   . PRO A 1 20  ? 10.373  3.066   -1.086  1.00 0.00 ? 20  PRO A CB   5  
ATOM 7099  C CG   . PRO A 1 20  ? 11.772  3.580   -1.107  1.00 0.00 ? 20  PRO A CG   5  
ATOM 7100  C CD   . PRO A 1 20  ? 12.132  3.740   -2.558  1.00 0.00 ? 20  PRO A CD   5  
ATOM 7101  H HA   . PRO A 1 20  ? 9.005   3.005   -2.741  1.00 0.00 ? 20  PRO A HA   5  
ATOM 7102  H HB2  . PRO A 1 20  ? 9.853   3.371   -0.188  1.00 0.00 ? 20  PRO A HB2  5  
ATOM 7103  H HB3  . PRO A 1 20  ? 10.347  1.990   -1.176  1.00 0.00 ? 20  PRO A HB3  5  
ATOM 7104  H HG2  . PRO A 1 20  ? 11.821  4.532   -0.601  1.00 0.00 ? 20  PRO A HG2  5  
ATOM 7105  H HG3  . PRO A 1 20  ? 12.431  2.867   -0.634  1.00 0.00 ? 20  PRO A HG3  5  
ATOM 7106  H HD2  . PRO A 1 20  ? 12.784  4.589   -2.693  1.00 0.00 ? 20  PRO A HD2  5  
ATOM 7107  H HD3  . PRO A 1 20  ? 12.598  2.840   -2.933  1.00 0.00 ? 20  PRO A HD3  5  
ATOM 7108  N N    . ALA A 1 21  ? 7.671   5.015   -2.182  1.00 0.00 ? 21  ALA A N    5  
ATOM 7109  C CA   . ALA A 1 21  ? 6.853   6.176   -1.850  1.00 0.00 ? 21  ALA A CA   5  
ATOM 7110  C C    . ALA A 1 21  ? 7.048   6.585   -0.394  1.00 0.00 ? 21  ALA A C    5  
ATOM 7111  O O    . ALA A 1 21  ? 6.579   5.921   0.531   1.00 0.00 ? 21  ALA A O    5  
ATOM 7112  C CB   . ALA A 1 21  ? 5.386   5.884   -2.126  1.00 0.00 ? 21  ALA A CB   5  
ATOM 7113  H H    . ALA A 1 21  ? 7.251   4.244   -2.617  1.00 0.00 ? 21  ALA A H    5  
ATOM 7114  H HA   . ALA A 1 21  ? 7.159   6.993   -2.487  1.00 0.00 ? 21  ALA A HA   5  
ATOM 7115  H HB1  . ALA A 1 21  ? 4.909   6.775   -2.509  1.00 0.00 ? 21  ALA A HB1  5  
ATOM 7116  H HB2  . ALA A 1 21  ? 5.308   5.092   -2.856  1.00 0.00 ? 21  ALA A HB2  5  
ATOM 7117  H HB3  . ALA A 1 21  ? 4.901   5.581   -1.211  1.00 0.00 ? 21  ALA A HB3  5  
ATOM 7118  N N    . PRO A 1 22  ? 7.756   7.704   -0.182  1.00 0.00 ? 22  PRO A N    5  
ATOM 7119  C CA   . PRO A 1 22  ? 8.029   8.227   1.160   1.00 0.00 ? 22  PRO A CA   5  
ATOM 7120  C C    . PRO A 1 22  ? 6.777   8.775   1.834   1.00 0.00 ? 22  PRO A C    5  
ATOM 7121  O O    . PRO A 1 22  ? 5.677   8.685   1.289   1.00 0.00 ? 22  PRO A O    5  
ATOM 7122  C CB   . PRO A 1 22  ? 9.035   9.352   0.905   1.00 0.00 ? 22  PRO A CB   5  
ATOM 7123  C CG   . PRO A 1 22  ? 8.774   9.782   -0.497  1.00 0.00 ? 22  PRO A CG   5  
ATOM 7124  C CD   . PRO A 1 22  ? 8.345   8.546   -1.237  1.00 0.00 ? 22  PRO A CD   5  
ATOM 7125  H HA   . PRO A 1 22  ? 8.479   7.476   1.794   1.00 0.00 ? 22  PRO A HA   5  
ATOM 7126  H HB2  . PRO A 1 22  ? 8.864   10.157  1.605   1.00 0.00 ? 22  PRO A HB2  5  
ATOM 7127  H HB3  . PRO A 1 22  ? 10.040  8.974   1.021   1.00 0.00 ? 22  PRO A HB3  5  
ATOM 7128  H HG2  . PRO A 1 22  ? 7.988   10.522  -0.514  1.00 0.00 ? 22  PRO A HG2  5  
ATOM 7129  H HG3  . PRO A 1 22  ? 9.678   10.184  -0.932  1.00 0.00 ? 22  PRO A HG3  5  
ATOM 7130  H HD2  . PRO A 1 22  ? 7.610   8.792   -1.989  1.00 0.00 ? 22  PRO A HD2  5  
ATOM 7131  H HD3  . PRO A 1 22  ? 9.198   8.060   -1.687  1.00 0.00 ? 22  PRO A HD3  5  
ATOM 7132  N N    . ASN A 1 23  ? 6.951   9.344   3.023   1.00 0.00 ? 23  ASN A N    5  
ATOM 7133  C CA   . ASN A 1 23  ? 5.833   9.907   3.771   1.00 0.00 ? 23  ASN A CA   5  
ATOM 7134  C C    . ASN A 1 23  ? 4.593   9.027   3.643   1.00 0.00 ? 23  ASN A C    5  
ATOM 7135  O O    . ASN A 1 23  ? 3.486   9.523   3.428   1.00 0.00 ? 23  ASN A O    5  
ATOM 7136  C CB   . ASN A 1 23  ? 5.522   11.321  3.277   1.00 0.00 ? 23  ASN A CB   5  
ATOM 7137  C CG   . ASN A 1 23  ? 6.725   12.241  3.360   1.00 0.00 ? 23  ASN A CG   5  
ATOM 7138  O OD1  . ASN A 1 23  ? 7.092   12.892  2.382   1.00 0.00 ? 23  ASN A OD1  5  
ATOM 7139  N ND2  . ASN A 1 23  ? 7.347   12.297  4.532   1.00 0.00 ? 23  ASN A ND2  5  
ATOM 7140  H H    . ASN A 1 23  ? 7.852   9.386   3.406   1.00 0.00 ? 23  ASN A H    5  
ATOM 7141  H HA   . ASN A 1 23  ? 6.121   9.954   4.811   1.00 0.00 ? 23  ASN A HA   5  
ATOM 7142  H HB2  . ASN A 1 23  ? 5.201   11.273  2.247   1.00 0.00 ? 23  ASN A HB2  5  
ATOM 7143  H HB3  . ASN A 1 23  ? 4.729   11.741  3.878   1.00 0.00 ? 23  ASN A HB3  5  
ATOM 7144  H HD21 . ASN A 1 23  ? 6.999   11.751  5.268   1.00 0.00 ? 23  ASN A HD21 5  
ATOM 7145  H HD22 . ASN A 1 23  ? 8.127   12.884  4.614   1.00 0.00 ? 23  ASN A HD22 5  
ATOM 7146  N N    . LEU A 1 24  ? 4.787   7.720   3.776   1.00 0.00 ? 24  LEU A N    5  
ATOM 7147  C CA   . LEU A 1 24  ? 3.684   6.770   3.675   1.00 0.00 ? 24  LEU A CA   5  
ATOM 7148  C C    . LEU A 1 24  ? 2.855   6.759   4.956   1.00 0.00 ? 24  LEU A C    5  
ATOM 7149  O O    . LEU A 1 24  ? 3.265   6.190   5.967   1.00 0.00 ? 24  LEU A O    5  
ATOM 7150  C CB   . LEU A 1 24  ? 4.220   5.365   3.390   1.00 0.00 ? 24  LEU A CB   5  
ATOM 7151  C CG   . LEU A 1 24  ? 3.178   4.316   3.001   1.00 0.00 ? 24  LEU A CG   5  
ATOM 7152  C CD1  . LEU A 1 24  ? 2.335   4.807   1.835   1.00 0.00 ? 24  LEU A CD1  5  
ATOM 7153  C CD2  . LEU A 1 24  ? 3.854   2.996   2.656   1.00 0.00 ? 24  LEU A CD2  5  
ATOM 7154  H H    . LEU A 1 24  ? 5.691   7.384   3.945   1.00 0.00 ? 24  LEU A H    5  
ATOM 7155  H HA   . LEU A 1 24  ? 3.054   7.079   2.855   1.00 0.00 ? 24  LEU A HA   5  
ATOM 7156  H HB2  . LEU A 1 24  ? 4.931   5.441   2.581   1.00 0.00 ? 24  LEU A HB2  5  
ATOM 7157  H HB3  . LEU A 1 24  ? 4.725   5.018   4.280   1.00 0.00 ? 24  LEU A HB3  5  
ATOM 7158  H HG   . LEU A 1 24  ? 2.518   4.145   3.841   1.00 0.00 ? 24  LEU A HG   5  
ATOM 7159  H HD11 . LEU A 1 24  ? 1.945   3.960   1.291   1.00 0.00 ? 24  LEU A HD11 5  
ATOM 7160  H HD12 . LEU A 1 24  ? 2.946   5.407   1.177   1.00 0.00 ? 24  LEU A HD12 5  
ATOM 7161  H HD13 . LEU A 1 24  ? 1.516   5.404   2.209   1.00 0.00 ? 24  LEU A HD13 5  
ATOM 7162  H HD21 . LEU A 1 24  ? 4.434   3.116   1.753   1.00 0.00 ? 24  LEU A HD21 5  
ATOM 7163  H HD22 . LEU A 1 24  ? 3.101   2.236   2.502   1.00 0.00 ? 24  LEU A HD22 5  
ATOM 7164  H HD23 . LEU A 1 24  ? 4.504   2.702   3.466   1.00 0.00 ? 24  LEU A HD23 5  
ATOM 7165  N N    . ARG A 1 25  ? 1.687   7.391   4.903   1.00 0.00 ? 25  ARG A N    5  
ATOM 7166  C CA   . ARG A 1 25  ? 0.800   7.454   6.058   1.00 0.00 ? 25  ARG A CA   5  
ATOM 7167  C C    . ARG A 1 25  ? -0.630  7.097   5.665   1.00 0.00 ? 25  ARG A C    5  
ATOM 7168  O O    . ARG A 1 25  ? -1.121  7.521   4.620   1.00 0.00 ? 25  ARG A O    5  
ATOM 7169  C CB   . ARG A 1 25  ? 0.836   8.851   6.680   1.00 0.00 ? 25  ARG A CB   5  
ATOM 7170  C CG   . ARG A 1 25  ? 1.218   9.946   5.697   1.00 0.00 ? 25  ARG A CG   5  
ATOM 7171  C CD   . ARG A 1 25  ? 1.704   11.195  6.415   1.00 0.00 ? 25  ARG A CD   5  
ATOM 7172  N NE   . ARG A 1 25  ? 0.764   11.637  7.442   1.00 0.00 ? 25  ARG A NE   5  
ATOM 7173  C CZ   . ARG A 1 25  ? 0.760   12.861  7.957   1.00 0.00 ? 25  ARG A CZ   5  
ATOM 7174  N NH1  . ARG A 1 25  ? 1.641   13.761  7.543   1.00 0.00 ? 25  ARG A NH1  5  
ATOM 7175  N NH2  . ARG A 1 25  ? -0.127  13.188  8.888   1.00 0.00 ? 25  ARG A NH2  5  
ATOM 7176  H H    . ARG A 1 25  ? 1.416   7.826   4.068   1.00 0.00 ? 25  ARG A H    5  
ATOM 7177  H HA   . ARG A 1 25  ? 1.151   6.737   6.785   1.00 0.00 ? 25  ARG A HA   5  
ATOM 7178  H HB2  . ARG A 1 25  ? -0.141  9.081   7.079   1.00 0.00 ? 25  ARG A HB2  5  
ATOM 7179  H HB3  . ARG A 1 25  ? 1.555   8.855   7.486   1.00 0.00 ? 25  ARG A HB3  5  
ATOM 7180  H HG2  . ARG A 1 25  ? 2.008   9.582   5.057   1.00 0.00 ? 25  ARG A HG2  5  
ATOM 7181  H HG3  . ARG A 1 25  ? 0.354   10.197  5.100   1.00 0.00 ? 25  ARG A HG3  5  
ATOM 7182  H HD2  . ARG A 1 25  ? 2.654   10.980  6.880   1.00 0.00 ? 25  ARG A HD2  5  
ATOM 7183  H HD3  . ARG A 1 25  ? 1.828   11.985  5.690   1.00 0.00 ? 25  ARG A HD3  5  
ATOM 7184  H HE   . ARG A 1 25  ? 0.103   10.988  7.762   1.00 0.00 ? 25  ARG A HE   5  
ATOM 7185  H HH11 . ARG A 1 25  ? 2.310   13.518  6.841   1.00 0.00 ? 25  ARG A HH11 5  
ATOM 7186  H HH12 . ARG A 1 25  ? 1.636   14.682  7.932   1.00 0.00 ? 25  ARG A HH12 5  
ATOM 7187  H HH21 . ARG A 1 25  ? -0.794  12.512  9.203   1.00 0.00 ? 25  ARG A HH21 5  
ATOM 7188  H HH22 . ARG A 1 25  ? -0.129  14.109  9.275   1.00 0.00 ? 25  ARG A HH22 5  
ATOM 7189  N N    . ALA A 1 26  ? -1.293  6.314   6.511   1.00 0.00 ? 26  ALA A N    5  
ATOM 7190  C CA   . ALA A 1 26  ? -2.667  5.902   6.253   1.00 0.00 ? 26  ALA A CA   5  
ATOM 7191  C C    . ALA A 1 26  ? -3.540  6.100   7.487   1.00 0.00 ? 26  ALA A C    5  
ATOM 7192  O O    . ALA A 1 26  ? -3.157  5.729   8.597   1.00 0.00 ? 26  ALA A O    5  
ATOM 7193  C CB   . ALA A 1 26  ? -2.706  4.449   5.803   1.00 0.00 ? 26  ALA A CB   5  
ATOM 7194  H H    . ALA A 1 26  ? -0.847  6.008   7.328   1.00 0.00 ? 26  ALA A H    5  
ATOM 7195  H HA   . ALA A 1 26  ? -3.053  6.512   5.449   1.00 0.00 ? 26  ALA A HA   5  
ATOM 7196  H HB1  . ALA A 1 26  ? -3.055  4.398   4.782   1.00 0.00 ? 26  ALA A HB1  5  
ATOM 7197  H HB2  . ALA A 1 26  ? -1.715  4.026   5.867   1.00 0.00 ? 26  ALA A HB2  5  
ATOM 7198  H HB3  . ALA A 1 26  ? -3.377  3.893   6.441   1.00 0.00 ? 26  ALA A HB3  5  
ATOM 7199  N N    . TYR A 1 27  ? -4.715  6.686   7.286   1.00 0.00 ? 27  TYR A N    5  
ATOM 7200  C CA   . TYR A 1 27  ? -5.642  6.936   8.384   1.00 0.00 ? 27  TYR A CA   5  
ATOM 7201  C C    . TYR A 1 27  ? -7.053  6.487   8.018   1.00 0.00 ? 27  TYR A C    5  
ATOM 7202  O O    . TYR A 1 27  ? -7.555  6.796   6.938   1.00 0.00 ? 27  TYR A O    5  
ATOM 7203  C CB   . TYR A 1 27  ? -5.646  8.422   8.747   1.00 0.00 ? 27  TYR A CB   5  
ATOM 7204  C CG   . TYR A 1 27  ? -5.872  9.334   7.563   1.00 0.00 ? 27  TYR A CG   5  
ATOM 7205  C CD1  . TYR A 1 27  ? -7.158  9.657   7.146   1.00 0.00 ? 27  TYR A CD1  5  
ATOM 7206  C CD2  . TYR A 1 27  ? -4.802  9.873   6.861   1.00 0.00 ? 27  TYR A CD2  5  
ATOM 7207  C CE1  . TYR A 1 27  ? -7.370  10.489  6.064   1.00 0.00 ? 27  TYR A CE1  5  
ATOM 7208  C CE2  . TYR A 1 27  ? -5.004  10.708  5.779   1.00 0.00 ? 27  TYR A CE2  5  
ATOM 7209  C CZ   . TYR A 1 27  ? -6.290  11.013  5.384   1.00 0.00 ? 27  TYR A CZ   5  
ATOM 7210  O OH   . TYR A 1 27  ? -6.496  11.843  4.306   1.00 0.00 ? 27  TYR A OH   5  
ATOM 7211  H H    . TYR A 1 27  ? -4.965  6.959   6.379   1.00 0.00 ? 27  TYR A H    5  
ATOM 7212  H HA   . TYR A 1 27  ? -5.305  6.368   9.238   1.00 0.00 ? 27  TYR A HA   5  
ATOM 7213  H HB2  . TYR A 1 27  ? -6.431  8.608   9.464   1.00 0.00 ? 27  TYR A HB2  5  
ATOM 7214  H HB3  . TYR A 1 27  ? -4.694  8.680   9.188   1.00 0.00 ? 27  TYR A HB3  5  
ATOM 7215  H HD1  . TYR A 1 27  ? -8.002  9.245   7.680   1.00 0.00 ? 27  TYR A HD1  5  
ATOM 7216  H HD2  . TYR A 1 27  ? -3.796  9.632   7.173   1.00 0.00 ? 27  TYR A HD2  5  
ATOM 7217  H HE1  . TYR A 1 27  ? -8.377  10.729  5.754   1.00 0.00 ? 27  TYR A HE1  5  
ATOM 7218  H HE2  . TYR A 1 27  ? -4.158  11.118  5.247   1.00 0.00 ? 27  TYR A HE2  5  
ATOM 7219  H HH   . TYR A 1 27  ? -5.669  11.966  3.835   1.00 0.00 ? 27  TYR A HH   5  
ATOM 7220  N N    . ALA A 1 28  ? -7.688  5.755   8.928   1.00 0.00 ? 28  ALA A N    5  
ATOM 7221  C CA   . ALA A 1 28  ? -9.042  5.264   8.704   1.00 0.00 ? 28  ALA A CA   5  
ATOM 7222  C C    . ALA A 1 28  ? -10.066 6.382   8.873   1.00 0.00 ? 28  ALA A C    5  
ATOM 7223  O O    . ALA A 1 28  ? -10.250 6.907   9.971   1.00 0.00 ? 28  ALA A O    5  
ATOM 7224  C CB   . ALA A 1 28  ? -9.351  4.115   9.652   1.00 0.00 ? 28  ALA A CB   5  
ATOM 7225  H H    . ALA A 1 28  ? -7.235  5.541   9.770   1.00 0.00 ? 28  ALA A H    5  
ATOM 7226  H HA   . ALA A 1 28  ? -9.098  4.888   7.692   1.00 0.00 ? 28  ALA A HA   5  
ATOM 7227  H HB1  . ALA A 1 28  ? -10.263 3.627   9.340   1.00 0.00 ? 28  ALA A HB1  5  
ATOM 7228  H HB2  . ALA A 1 28  ? -8.538  3.405   9.634   1.00 0.00 ? 28  ALA A HB2  5  
ATOM 7229  H HB3  . ALA A 1 28  ? -9.473  4.498   10.654  1.00 0.00 ? 28  ALA A HB3  5  
ATOM 7230  N N    . ALA A 1 29  ? -10.729 6.741   7.779   1.00 0.00 ? 29  ALA A N    5  
ATOM 7231  C CA   . ALA A 1 29  ? -11.735 7.795   7.807   1.00 0.00 ? 29  ALA A CA   5  
ATOM 7232  C C    . ALA A 1 29  ? -13.068 7.269   8.330   1.00 0.00 ? 29  ALA A C    5  
ATOM 7233  O O    . ALA A 1 29  ? -13.860 8.018   8.901   1.00 0.00 ? 29  ALA A O    5  
ATOM 7234  C CB   . ALA A 1 29  ? -11.910 8.395   6.420   1.00 0.00 ? 29  ALA A CB   5  
ATOM 7235  H H    . ALA A 1 29  ? -10.538 6.285   6.933   1.00 0.00 ? 29  ALA A H    5  
ATOM 7236  H HA   . ALA A 1 29  ? -11.383 8.575   8.468   1.00 0.00 ? 29  ALA A HA   5  
ATOM 7237  H HB1  . ALA A 1 29  ? -10.939 8.575   5.981   1.00 0.00 ? 29  ALA A HB1  5  
ATOM 7238  H HB2  . ALA A 1 29  ? -12.464 7.708   5.798   1.00 0.00 ? 29  ALA A HB2  5  
ATOM 7239  H HB3  . ALA A 1 29  ? -12.449 9.327   6.496   1.00 0.00 ? 29  ALA A HB3  5  
ATOM 7240  N N    . SER A 1 30  ? -13.308 5.977   8.130   1.00 0.00 ? 30  SER A N    5  
ATOM 7241  C CA   . SER A 1 30  ? -14.547 5.352   8.578   1.00 0.00 ? 30  SER A CA   5  
ATOM 7242  C C    . SER A 1 30  ? -14.303 3.908   9.006   1.00 0.00 ? 30  SER A C    5  
ATOM 7243  O O    . SER A 1 30  ? -13.303 3.287   8.644   1.00 0.00 ? 30  SER A O    5  
ATOM 7244  C CB   . SER A 1 30  ? -15.596 5.396   7.465   1.00 0.00 ? 30  SER A CB   5  
ATOM 7245  O OG   . SER A 1 30  ? -16.344 6.598   7.516   1.00 0.00 ? 30  SER A OG   5  
ATOM 7246  H H    . SER A 1 30  ? -12.636 5.432   7.669   1.00 0.00 ? 30  SER A H    5  
ATOM 7247  H HA   . SER A 1 30  ? -14.912 5.910   9.427   1.00 0.00 ? 30  SER A HA   5  
ATOM 7248  H HB2  . SER A 1 30  ? -15.103 5.333   6.507   1.00 0.00 ? 30  SER A HB2  5  
ATOM 7249  H HB3  . SER A 1 30  ? -16.271 4.560   7.578   1.00 0.00 ? 30  SER A HB3  5  
ATOM 7250  H HG   . SER A 1 30  ? -15.745 7.348   7.505   1.00 0.00 ? 30  SER A HG   5  
ATOM 7251  N N    . PRO A 1 31  ? -15.237 3.360   9.797   1.00 0.00 ? 31  PRO A N    5  
ATOM 7252  C CA   . PRO A 1 31  ? -15.148 1.983   10.292  1.00 0.00 ? 31  PRO A CA   5  
ATOM 7253  C C    . PRO A 1 31  ? -15.343 0.955   9.183   1.00 0.00 ? 31  PRO A C    5  
ATOM 7254  O O    . PRO A 1 31  ? -15.144 -0.243  9.390   1.00 0.00 ? 31  PRO A O    5  
ATOM 7255  C CB   . PRO A 1 31  ? -16.289 1.897   11.308  1.00 0.00 ? 31  PRO A CB   5  
ATOM 7256  C CG   . PRO A 1 31  ? -17.268 2.929   10.867  1.00 0.00 ? 31  PRO A CG   5  
ATOM 7257  C CD   . PRO A 1 31  ? -16.454 4.043   10.268  1.00 0.00 ? 31  PRO A CD   5  
ATOM 7258  H HA   . PRO A 1 31  ? -14.206 1.801   10.789  1.00 0.00 ? 31  PRO A HA   5  
ATOM 7259  H HB2  . PRO A 1 31  ? -16.721 0.906   11.285  1.00 0.00 ? 31  PRO A HB2  5  
ATOM 7260  H HB3  . PRO A 1 31  ? -15.912 2.108   12.298  1.00 0.00 ? 31  PRO A HB3  5  
ATOM 7261  H HG2  . PRO A 1 31  ? -17.934 2.512   10.128  1.00 0.00 ? 31  PRO A HG2  5  
ATOM 7262  H HG3  . PRO A 1 31  ? -17.828 3.291   11.717  1.00 0.00 ? 31  PRO A HG3  5  
ATOM 7263  H HD2  . PRO A 1 31  ? -16.985 4.497   9.444   1.00 0.00 ? 31  PRO A HD2  5  
ATOM 7264  H HD3  . PRO A 1 31  ? -16.215 4.781   11.019  1.00 0.00 ? 31  PRO A HD3  5  
ATOM 7265  N N    . THR A 1 32  ? -15.733 1.429   8.004   1.00 0.00 ? 32  THR A N    5  
ATOM 7266  C CA   . THR A 1 32  ? -15.955 0.551   6.863   1.00 0.00 ? 32  THR A CA   5  
ATOM 7267  C C    . THR A 1 32  ? -15.140 1.000   5.656   1.00 0.00 ? 32  THR A C    5  
ATOM 7268  O O    . THR A 1 32  ? -15.207 0.392   4.588   1.00 0.00 ? 32  THR A O    5  
ATOM 7269  C CB   . THR A 1 32  ? -17.444 0.503   6.472   1.00 0.00 ? 32  THR A CB   5  
ATOM 7270  O OG1  . THR A 1 32  ? -17.823 1.727   5.834   1.00 0.00 ? 32  THR A OG1  5  
ATOM 7271  C CG2  . THR A 1 32  ? -18.317 0.271   7.697   1.00 0.00 ? 32  THR A CG2  5  
ATOM 7272  H H    . THR A 1 32  ? -15.874 2.393   7.901   1.00 0.00 ? 32  THR A H    5  
ATOM 7273  H HA   . THR A 1 32  ? -15.646 -0.446  7.143   1.00 0.00 ? 32  THR A HA   5  
ATOM 7274  H HB   . THR A 1 32  ? -17.594 -0.315  5.782   1.00 0.00 ? 32  THR A HB   5  
ATOM 7275  H HG1  . THR A 1 32  ? -18.776 1.835   5.888   1.00 0.00 ? 32  THR A HG1  5  
ATOM 7276  H HG21 . THR A 1 32  ? -18.811 1.193   7.966   1.00 0.00 ? 32  THR A HG21 5  
ATOM 7277  H HG22 . THR A 1 32  ? -17.702 -0.062  8.519   1.00 0.00 ? 32  THR A HG22 5  
ATOM 7278  H HG23 . THR A 1 32  ? -19.058 -0.481  7.473   1.00 0.00 ? 32  THR A HG23 5  
ATOM 7279  N N    . SER A 1 33  ? -14.369 2.069   5.833   1.00 0.00 ? 33  SER A N    5  
ATOM 7280  C CA   . SER A 1 33  ? -13.542 2.602   4.756   1.00 0.00 ? 33  SER A CA   5  
ATOM 7281  C C    . SER A 1 33  ? -12.255 3.207   5.308   1.00 0.00 ? 33  SER A C    5  
ATOM 7282  O O    . SER A 1 33  ? -12.229 3.721   6.427   1.00 0.00 ? 33  SER A O    5  
ATOM 7283  C CB   . SER A 1 33  ? -14.317 3.657   3.964   1.00 0.00 ? 33  SER A CB   5  
ATOM 7284  O OG   . SER A 1 33  ? -15.546 3.137   3.488   1.00 0.00 ? 33  SER A OG   5  
ATOM 7285  H H    . SER A 1 33  ? -14.358 2.510   6.708   1.00 0.00 ? 33  SER A H    5  
ATOM 7286  H HA   . SER A 1 33  ? -13.288 1.784   4.098   1.00 0.00 ? 33  SER A HA   5  
ATOM 7287  H HB2  . SER A 1 33  ? -14.521 4.504   4.601   1.00 0.00 ? 33  SER A HB2  5  
ATOM 7288  H HB3  . SER A 1 33  ? -13.723 3.976   3.119   1.00 0.00 ? 33  SER A HB3  5  
ATOM 7289  H HG   . SER A 1 33  ? -15.586 2.194   3.667   1.00 0.00 ? 33  SER A HG   5  
ATOM 7290  N N    . ILE A 1 34  ? -11.191 3.142   4.516   1.00 0.00 ? 34  ILE A N    5  
ATOM 7291  C CA   . ILE A 1 34  ? -9.901  3.685   4.924   1.00 0.00 ? 34  ILE A CA   5  
ATOM 7292  C C    . ILE A 1 34  ? -9.316  4.585   3.842   1.00 0.00 ? 34  ILE A C    5  
ATOM 7293  O O    . ILE A 1 34  ? -9.524  4.359   2.649   1.00 0.00 ? 34  ILE A O    5  
ATOM 7294  C CB   . ILE A 1 34  ? -8.894  2.563   5.243   1.00 0.00 ? 34  ILE A CB   5  
ATOM 7295  C CG1  . ILE A 1 34  ? -9.405  1.704   6.401   1.00 0.00 ? 34  ILE A CG1  5  
ATOM 7296  C CG2  . ILE A 1 34  ? -7.532  3.154   5.575   1.00 0.00 ? 34  ILE A CG2  5  
ATOM 7297  C CD1  . ILE A 1 34  ? -8.658  0.398   6.559   1.00 0.00 ? 34  ILE A CD1  5  
ATOM 7298  H H    . ILE A 1 34  ? -11.275 2.721   3.636   1.00 0.00 ? 34  ILE A H    5  
ATOM 7299  H HA   . ILE A 1 34  ? -10.054 4.269   5.820   1.00 0.00 ? 34  ILE A HA   5  
ATOM 7300  H HB   . ILE A 1 34  ? -8.788  1.945   4.364   1.00 0.00 ? 34  ILE A HB   5  
ATOM 7301  H HG12 . ILE A 1 34  ? -9.305  2.255   7.322   1.00 0.00 ? 34  ILE A HG12 5  
ATOM 7302  H HG13 . ILE A 1 34  ? -10.447 1.473   6.235   1.00 0.00 ? 34  ILE A HG13 5  
ATOM 7303  H HG21 . ILE A 1 34  ? -7.645  3.921   6.326   1.00 0.00 ? 34  ILE A HG21 5  
ATOM 7304  H HG22 . ILE A 1 34  ? -6.885  2.375   5.951   1.00 0.00 ? 34  ILE A HG22 5  
ATOM 7305  H HG23 . ILE A 1 34  ? -7.098  3.583   4.684   1.00 0.00 ? 34  ILE A HG23 5  
ATOM 7306  H HD11 . ILE A 1 34  ? -7.625  0.537   6.277   1.00 0.00 ? 34  ILE A HD11 5  
ATOM 7307  H HD12 . ILE A 1 34  ? -8.712  0.074   7.587   1.00 0.00 ? 34  ILE A HD12 5  
ATOM 7308  H HD13 . ILE A 1 34  ? -9.106  -0.352  5.922   1.00 0.00 ? 34  ILE A HD13 5  
ATOM 7309  N N    . THR A 1 35  ? -8.580  5.608   4.265   1.00 0.00 ? 35  THR A N    5  
ATOM 7310  C CA   . THR A 1 35  ? -7.963  6.544   3.332   1.00 0.00 ? 35  THR A CA   5  
ATOM 7311  C C    . THR A 1 35  ? -6.443  6.489   3.424   1.00 0.00 ? 35  THR A C    5  
ATOM 7312  O O    . THR A 1 35  ? -5.839  7.126   4.288   1.00 0.00 ? 35  THR A O    5  
ATOM 7313  C CB   . THR A 1 35  ? -8.431  7.988   3.594   1.00 0.00 ? 35  THR A CB   5  
ATOM 7314  O OG1  . THR A 1 35  ? -9.820  8.118   3.275   1.00 0.00 ? 35  THR A OG1  5  
ATOM 7315  C CG2  . THR A 1 35  ? -7.621  8.976   2.769   1.00 0.00 ? 35  THR A CG2  5  
ATOM 7316  H H    . THR A 1 35  ? -8.450  5.736   5.228   1.00 0.00 ? 35  THR A H    5  
ATOM 7317  H HA   . THR A 1 35  ? -8.264  6.265   2.333   1.00 0.00 ? 35  THR A HA   5  
ATOM 7318  H HB   . THR A 1 35  ? -8.287  8.213   4.641   1.00 0.00 ? 35  THR A HB   5  
ATOM 7319  H HG1  . THR A 1 35  ? -10.187 8.873   3.742   1.00 0.00 ? 35  THR A HG1  5  
ATOM 7320  H HG21 . THR A 1 35  ? -8.289  9.581   2.173   1.00 0.00 ? 35  THR A HG21 5  
ATOM 7321  H HG22 . THR A 1 35  ? -6.947  8.437   2.119   1.00 0.00 ? 35  THR A HG22 5  
ATOM 7322  H HG23 . THR A 1 35  ? -7.052  9.614   3.428   1.00 0.00 ? 35  THR A HG23 5  
ATOM 7323  N N    . VAL A 1 36  ? -5.827  5.725   2.528   1.00 0.00 ? 36  VAL A N    5  
ATOM 7324  C CA   . VAL A 1 36  ? -4.376  5.589   2.506   1.00 0.00 ? 36  VAL A CA   5  
ATOM 7325  C C    . VAL A 1 36  ? -3.728  6.732   1.732   1.00 0.00 ? 36  VAL A C    5  
ATOM 7326  O O    . VAL A 1 36  ? -4.211  7.132   0.673   1.00 0.00 ? 36  VAL A O    5  
ATOM 7327  C CB   . VAL A 1 36  ? -3.946  4.250   1.878   1.00 0.00 ? 36  VAL A CB   5  
ATOM 7328  C CG1  . VAL A 1 36  ? -2.451  4.033   2.053   1.00 0.00 ? 36  VAL A CG1  5  
ATOM 7329  C CG2  . VAL A 1 36  ? -4.735  3.100   2.486   1.00 0.00 ? 36  VAL A CG2  5  
ATOM 7330  H H    . VAL A 1 36  ? -6.362  5.241   1.864   1.00 0.00 ? 36  VAL A H    5  
ATOM 7331  H HA   . VAL A 1 36  ? -4.023  5.613   3.527   1.00 0.00 ? 36  VAL A HA   5  
ATOM 7332  H HB   . VAL A 1 36  ? -4.161  4.286   0.820   1.00 0.00 ? 36  VAL A HB   5  
ATOM 7333  H HG11 . VAL A 1 36  ? -2.252  2.977   2.165   1.00 0.00 ? 36  VAL A HG11 5  
ATOM 7334  H HG12 . VAL A 1 36  ? -1.928  4.409   1.186   1.00 0.00 ? 36  VAL A HG12 5  
ATOM 7335  H HG13 . VAL A 1 36  ? -2.112  4.558   2.934   1.00 0.00 ? 36  VAL A HG13 5  
ATOM 7336  H HG21 . VAL A 1 36  ? -5.792  3.294   2.380   1.00 0.00 ? 36  VAL A HG21 5  
ATOM 7337  H HG22 . VAL A 1 36  ? -4.485  2.181   1.974   1.00 0.00 ? 36  VAL A HG22 5  
ATOM 7338  H HG23 . VAL A 1 36  ? -4.488  3.007   3.533   1.00 0.00 ? 36  VAL A HG23 5  
ATOM 7339  N N    . THR A 1 37  ? -2.629  7.254   2.268   1.00 0.00 ? 37  THR A N    5  
ATOM 7340  C CA   . THR A 1 37  ? -1.914  8.351   1.629   1.00 0.00 ? 37  THR A CA   5  
ATOM 7341  C C    . THR A 1 37  ? -0.433  8.026   1.473   1.00 0.00 ? 37  THR A C    5  
ATOM 7342  O O    . THR A 1 37  ? 0.114   7.210   2.215   1.00 0.00 ? 37  THR A O    5  
ATOM 7343  C CB   . THR A 1 37  ? -2.060  9.659   2.430   1.00 0.00 ? 37  THR A CB   5  
ATOM 7344  O OG1  . THR A 1 37  ? -1.017  9.754   3.406   1.00 0.00 ? 37  THR A OG1  5  
ATOM 7345  C CG2  . THR A 1 37  ? -3.414  9.723   3.120   1.00 0.00 ? 37  THR A CG2  5  
ATOM 7346  H H    . THR A 1 37  ? -2.292  6.892   3.114   1.00 0.00 ? 37  THR A H    5  
ATOM 7347  H HA   . THR A 1 37  ? -2.344  8.504   0.649   1.00 0.00 ? 37  THR A HA   5  
ATOM 7348  H HB   . THR A 1 37  ? -1.980  10.493  1.747   1.00 0.00 ? 37  THR A HB   5  
ATOM 7349  H HG1  . THR A 1 37  ? -0.237  10.145  3.004   1.00 0.00 ? 37  THR A HG1  5  
ATOM 7350  H HG21 . THR A 1 37  ? -4.105  9.061   2.618   1.00 0.00 ? 37  THR A HG21 5  
ATOM 7351  H HG22 . THR A 1 37  ? -3.791  10.734  3.080   1.00 0.00 ? 37  THR A HG22 5  
ATOM 7352  H HG23 . THR A 1 37  ? -3.308  9.418   4.150   1.00 0.00 ? 37  THR A HG23 5  
ATOM 7353  N N    . TRP A 1 38  ? 0.210   8.670   0.506   1.00 0.00 ? 38  TRP A N    5  
ATOM 7354  C CA   . TRP A 1 38  ? 1.630   8.449   0.254   1.00 0.00 ? 38  TRP A CA   5  
ATOM 7355  C C    . TRP A 1 38  ? 2.219   9.586   -0.573  1.00 0.00 ? 38  TRP A C    5  
ATOM 7356  O O    . TRP A 1 38  ? 1.491   10.329  -1.230  1.00 0.00 ? 38  TRP A O    5  
ATOM 7357  C CB   . TRP A 1 38  ? 1.840   7.116   -0.466  1.00 0.00 ? 38  TRP A CB   5  
ATOM 7358  C CG   . TRP A 1 38  ? 1.128   7.033   -1.782  1.00 0.00 ? 38  TRP A CG   5  
ATOM 7359  C CD1  . TRP A 1 38  ? 1.615   7.406   -3.002  1.00 0.00 ? 38  TRP A CD1  5  
ATOM 7360  C CD2  . TRP A 1 38  ? -0.200  6.548   -2.009  1.00 0.00 ? 38  TRP A CD2  5  
ATOM 7361  N NE1  . TRP A 1 38  ? 0.669   7.182   -3.974  1.00 0.00 ? 38  TRP A NE1  5  
ATOM 7362  C CE2  . TRP A 1 38  ? -0.452  6.656   -3.391  1.00 0.00 ? 38  TRP A CE2  5  
ATOM 7363  C CE3  . TRP A 1 38  ? -1.200  6.032   -1.180  1.00 0.00 ? 38  TRP A CE3  5  
ATOM 7364  C CZ2  . TRP A 1 38  ? -1.663  6.267   -3.959  1.00 0.00 ? 38  TRP A CZ2  5  
ATOM 7365  C CZ3  . TRP A 1 38  ? -2.401  5.647   -1.745  1.00 0.00 ? 38  TRP A CZ3  5  
ATOM 7366  C CH2  . TRP A 1 38  ? -2.624  5.765   -3.123  1.00 0.00 ? 38  TRP A CH2  5  
ATOM 7367  H H    . TRP A 1 38  ? -0.280  9.309   -0.053  1.00 0.00 ? 38  TRP A H    5  
ATOM 7368  H HA   . TRP A 1 38  ? 2.134   8.415   1.209   1.00 0.00 ? 38  TRP A HA   5  
ATOM 7369  H HB2  . TRP A 1 38  ? 2.894   6.974   -0.648  1.00 0.00 ? 38  TRP A HB2  5  
ATOM 7370  H HB3  . TRP A 1 38  ? 1.476   6.315   0.162   1.00 0.00 ? 38  TRP A HB3  5  
ATOM 7371  H HD1  . TRP A 1 38  ? 2.599   7.817   -3.164  1.00 0.00 ? 38  TRP A HD1  5  
ATOM 7372  H HE1  . TRP A 1 38  ? 0.782   7.368   -4.930  1.00 0.00 ? 38  TRP A HE1  5  
ATOM 7373  H HE3  . TRP A 1 38  ? -1.047  5.933   -0.116  1.00 0.00 ? 38  TRP A HE3  5  
ATOM 7374  H HZ2  . TRP A 1 38  ? -1.850  6.351   -5.019  1.00 0.00 ? 38  TRP A HZ2  5  
ATOM 7375  H HZ3  . TRP A 1 38  ? -3.185  5.246   -1.120  1.00 0.00 ? 38  TRP A HZ3  5  
ATOM 7376  H HH2  . TRP A 1 38  ? -3.577  5.452   -3.521  1.00 0.00 ? 38  TRP A HH2  5  
ATOM 7377  N N    . GLU A 1 39  ? 3.542   9.714   -0.537  1.00 0.00 ? 39  GLU A N    5  
ATOM 7378  C CA   . GLU A 1 39  ? 4.228   10.762  -1.284  1.00 0.00 ? 39  GLU A CA   5  
ATOM 7379  C C    . GLU A 1 39  ? 4.975   10.178  -2.480  1.00 0.00 ? 39  GLU A C    5  
ATOM 7380  O O    . GLU A 1 39  ? 5.182   8.967   -2.567  1.00 0.00 ? 39  GLU A O    5  
ATOM 7381  C CB   . GLU A 1 39  ? 5.204   11.512  -0.375  1.00 0.00 ? 39  GLU A CB   5  
ATOM 7382  C CG   . GLU A 1 39  ? 4.568   12.668  0.379   1.00 0.00 ? 39  GLU A CG   5  
ATOM 7383  C CD   . GLU A 1 39  ? 3.876   13.654  -0.541  1.00 0.00 ? 39  GLU A CD   5  
ATOM 7384  O OE1  . GLU A 1 39  ? 4.228   13.698  -1.738  1.00 0.00 ? 39  GLU A OE1  5  
ATOM 7385  O OE2  . GLU A 1 39  ? 2.982   14.384  -0.063  1.00 0.00 ? 39  GLU A OE2  5  
ATOM 7386  H H    . GLU A 1 39  ? 4.069   9.090   0.005   1.00 0.00 ? 39  GLU A H    5  
ATOM 7387  H HA   . GLU A 1 39  ? 3.482   11.454  -1.645  1.00 0.00 ? 39  GLU A HA   5  
ATOM 7388  H HB2  . GLU A 1 39  ? 5.611   10.818  0.346   1.00 0.00 ? 39  GLU A HB2  5  
ATOM 7389  H HB3  . GLU A 1 39  ? 6.010   11.904  -0.979  1.00 0.00 ? 39  GLU A HB3  5  
ATOM 7390  H HG2  . GLU A 1 39  ? 3.839   12.272  1.070   1.00 0.00 ? 39  GLU A HG2  5  
ATOM 7391  H HG3  . GLU A 1 39  ? 5.338   13.189  0.928   1.00 0.00 ? 39  GLU A HG3  5  
ATOM 7392  N N    . THR A 1 40  ? 5.378   11.048  -3.401  1.00 0.00 ? 40  THR A N    5  
ATOM 7393  C CA   . THR A 1 40  ? 6.100   10.620  -4.592  1.00 0.00 ? 40  THR A CA   5  
ATOM 7394  C C    . THR A 1 40  ? 7.597   10.523  -4.322  1.00 0.00 ? 40  THR A C    5  
ATOM 7395  O O    . THR A 1 40  ? 8.208   11.421  -3.743  1.00 0.00 ? 40  THR A O    5  
ATOM 7396  C CB   . THR A 1 40  ? 5.864   11.584  -5.769  1.00 0.00 ? 40  THR A CB   5  
ATOM 7397  O OG1  . THR A 1 40  ? 4.479   11.585  -6.132  1.00 0.00 ? 40  THR A OG1  5  
ATOM 7398  C CG2  . THR A 1 40  ? 6.708   11.188  -6.972  1.00 0.00 ? 40  THR A CG2  5  
ATOM 7399  H H    . THR A 1 40  ? 5.183   12.000  -3.275  1.00 0.00 ? 40  THR A H    5  
ATOM 7400  H HA   . THR A 1 40  ? 5.731   9.644   -4.874  1.00 0.00 ? 40  THR A HA   5  
ATOM 7401  H HB   . THR A 1 40  ? 6.148   12.581  -5.461  1.00 0.00 ? 40  THR A HB   5  
ATOM 7402  H HG1  . THR A 1 40  ? 3.973   12.052  -5.463  1.00 0.00 ? 40  THR A HG1  5  
ATOM 7403  H HG21 . THR A 1 40  ? 7.125   12.074  -7.427  1.00 0.00 ? 40  THR A HG21 5  
ATOM 7404  H HG22 . THR A 1 40  ? 6.090   10.670  -7.690  1.00 0.00 ? 40  THR A HG22 5  
ATOM 7405  H HG23 . THR A 1 40  ? 7.508   10.539  -6.651  1.00 0.00 ? 40  THR A HG23 5  
ATOM 7406  N N    . PRO A 1 41  ? 8.206   9.407   -4.751  1.00 0.00 ? 41  PRO A N    5  
ATOM 7407  C CA   . PRO A 1 41  ? 9.640   9.167   -4.568  1.00 0.00 ? 41  PRO A CA   5  
ATOM 7408  C C    . PRO A 1 41  ? 10.497  10.084  -5.433  1.00 0.00 ? 41  PRO A C    5  
ATOM 7409  O O    . PRO A 1 41  ? 10.352  10.115  -6.655  1.00 0.00 ? 41  PRO A O    5  
ATOM 7410  C CB   . PRO A 1 41  ? 9.814   7.709   -4.999  1.00 0.00 ? 41  PRO A CB   5  
ATOM 7411  C CG   . PRO A 1 41  ? 8.688   7.456   -5.941  1.00 0.00 ? 41  PRO A CG   5  
ATOM 7412  C CD   . PRO A 1 41  ? 7.541   8.294   -5.449  1.00 0.00 ? 41  PRO A CD   5  
ATOM 7413  H HA   . PRO A 1 41  ? 9.931   9.275   -3.533  1.00 0.00 ? 41  PRO A HA   5  
ATOM 7414  H HB2  . PRO A 1 41  ? 10.772  7.586   -5.485  1.00 0.00 ? 41  PRO A HB2  5  
ATOM 7415  H HB3  . PRO A 1 41  ? 9.758   7.064   -4.135  1.00 0.00 ? 41  PRO A HB3  5  
ATOM 7416  H HG2  . PRO A 1 41  ? 8.970   7.754   -6.939  1.00 0.00 ? 41  PRO A HG2  5  
ATOM 7417  H HG3  . PRO A 1 41  ? 8.422   6.409   -5.922  1.00 0.00 ? 41  PRO A HG3  5  
ATOM 7418  H HD2  . PRO A 1 41  ? 6.954   8.656   -6.281  1.00 0.00 ? 41  PRO A HD2  5  
ATOM 7419  H HD3  . PRO A 1 41  ? 6.923   7.727   -4.768  1.00 0.00 ? 41  PRO A HD3  5  
ATOM 7420  N N    . VAL A 1 42  ? 11.391  10.830  -4.792  1.00 0.00 ? 42  VAL A N    5  
ATOM 7421  C CA   . VAL A 1 42  ? 12.273  11.748  -5.504  1.00 0.00 ? 42  VAL A CA   5  
ATOM 7422  C C    . VAL A 1 42  ? 13.371  10.992  -6.243  1.00 0.00 ? 42  VAL A C    5  
ATOM 7423  O O    . VAL A 1 42  ? 14.062  11.554  -7.093  1.00 0.00 ? 42  VAL A O    5  
ATOM 7424  C CB   . VAL A 1 42  ? 12.920  12.763  -4.543  1.00 0.00 ? 42  VAL A CB   5  
ATOM 7425  C CG1  . VAL A 1 42  ? 11.854  13.496  -3.743  1.00 0.00 ? 42  VAL A CG1  5  
ATOM 7426  C CG2  . VAL A 1 42  ? 13.908  12.067  -3.620  1.00 0.00 ? 42  VAL A CG2  5  
ATOM 7427  H H    . VAL A 1 42  ? 11.460  10.762  -3.817  1.00 0.00 ? 42  VAL A H    5  
ATOM 7428  H HA   . VAL A 1 42  ? 11.678  12.293  -6.223  1.00 0.00 ? 42  VAL A HA   5  
ATOM 7429  H HB   . VAL A 1 42  ? 13.461  13.490  -5.131  1.00 0.00 ? 42  VAL A HB   5  
ATOM 7430  H HG11 . VAL A 1 42  ? 11.160  13.971  -4.420  1.00 0.00 ? 42  VAL A HG11 5  
ATOM 7431  H HG12 . VAL A 1 42  ? 11.326  12.791  -3.118  1.00 0.00 ? 42  VAL A HG12 5  
ATOM 7432  H HG13 . VAL A 1 42  ? 12.323  14.246  -3.123  1.00 0.00 ? 42  VAL A HG13 5  
ATOM 7433  H HG21 . VAL A 1 42  ? 13.371  11.589  -2.814  1.00 0.00 ? 42  VAL A HG21 5  
ATOM 7434  H HG22 . VAL A 1 42  ? 14.459  11.322  -4.176  1.00 0.00 ? 42  VAL A HG22 5  
ATOM 7435  H HG23 . VAL A 1 42  ? 14.596  12.793  -3.214  1.00 0.00 ? 42  VAL A HG23 5  
ATOM 7436  N N    . SER A 1 43  ? 13.527  9.714   -5.913  1.00 0.00 ? 43  SER A N    5  
ATOM 7437  C CA   . SER A 1 43  ? 14.544  8.880   -6.544  1.00 0.00 ? 43  SER A CA   5  
ATOM 7438  C C    . SER A 1 43  ? 13.943  8.051   -7.674  1.00 0.00 ? 43  SER A C    5  
ATOM 7439  O O    . SER A 1 43  ? 13.244  7.067   -7.433  1.00 0.00 ? 43  SER A O    5  
ATOM 7440  C CB   . SER A 1 43  ? 15.192  7.959   -5.508  1.00 0.00 ? 43  SER A CB   5  
ATOM 7441  O OG   . SER A 1 43  ? 15.759  8.705   -4.445  1.00 0.00 ? 43  SER A OG   5  
ATOM 7442  H H    . SER A 1 43  ? 12.945  9.323   -5.228  1.00 0.00 ? 43  SER A H    5  
ATOM 7443  H HA   . SER A 1 43  ? 15.300  9.533   -6.955  1.00 0.00 ? 43  SER A HA   5  
ATOM 7444  H HB2  . SER A 1 43  ? 14.445  7.292   -5.106  1.00 0.00 ? 43  SER A HB2  5  
ATOM 7445  H HB3  . SER A 1 43  ? 15.972  7.381   -5.983  1.00 0.00 ? 43  SER A HB3  5  
ATOM 7446  H HG   . SER A 1 43  ? 15.061  9.013   -3.862  1.00 0.00 ? 43  SER A HG   5  
ATOM 7447  N N    . GLY A 1 44  ? 14.222  8.455   -8.910  1.00 0.00 ? 44  GLY A N    5  
ATOM 7448  C CA   . GLY A 1 44  ? 13.701  7.739   -10.060 1.00 0.00 ? 44  GLY A CA   5  
ATOM 7449  C C    . GLY A 1 44  ? 14.078  8.398   -11.372 1.00 0.00 ? 44  GLY A C    5  
ATOM 7450  O O    . GLY A 1 44  ? 14.403  9.584   -11.408 1.00 0.00 ? 44  GLY A O    5  
ATOM 7451  H H    . GLY A 1 44  ? 14.785  9.246   -9.041  1.00 0.00 ? 44  GLY A H    5  
ATOM 7452  H HA2  . GLY A 1 44  ? 14.090  6.732   -10.049 1.00 0.00 ? 44  GLY A HA2  5  
ATOM 7453  H HA3  . GLY A 1 44  ? 12.624  7.699   -9.987  1.00 0.00 ? 44  GLY A HA3  5  
ATOM 7454  N N    . ASN A 1 45  ? 14.035  7.626   -12.453 1.00 0.00 ? 45  ASN A N    5  
ATOM 7455  C CA   . ASN A 1 45  ? 14.377  8.142   -13.774 1.00 0.00 ? 45  ASN A CA   5  
ATOM 7456  C C    . ASN A 1 45  ? 13.160  8.133   -14.693 1.00 0.00 ? 45  ASN A C    5  
ATOM 7457  O O    . ASN A 1 45  ? 12.952  9.060   -15.474 1.00 0.00 ? 45  ASN A O    5  
ATOM 7458  C CB   . ASN A 1 45  ? 15.503  7.311   -14.393 1.00 0.00 ? 45  ASN A CB   5  
ATOM 7459  C CG   . ASN A 1 45  ? 15.657  7.562   -15.880 1.00 0.00 ? 45  ASN A CG   5  
ATOM 7460  O OD1  . ASN A 1 45  ? 15.617  8.705   -16.335 1.00 0.00 ? 45  ASN A OD1  5  
ATOM 7461  N ND2  . ASN A 1 45  ? 15.834  6.491   -16.646 1.00 0.00 ? 45  ASN A ND2  5  
ATOM 7462  H H    . ASN A 1 45  ? 13.768  6.688   -12.361 1.00 0.00 ? 45  ASN A H    5  
ATOM 7463  H HA   . ASN A 1 45  ? 14.717  9.159   -13.655 1.00 0.00 ? 45  ASN A HA   5  
ATOM 7464  H HB2  . ASN A 1 45  ? 16.435  7.561   -13.907 1.00 0.00 ? 45  ASN A HB2  5  
ATOM 7465  H HB3  . ASN A 1 45  ? 15.294  6.262   -14.242 1.00 0.00 ? 45  ASN A HB3  5  
ATOM 7466  H HD21 . ASN A 1 45  ? 15.855  5.611   -16.214 1.00 0.00 ? 45  ASN A HD21 5  
ATOM 7467  H HD22 . ASN A 1 45  ? 15.937  6.625   -17.611 1.00 0.00 ? 45  ASN A HD22 5  
ATOM 7468  N N    . GLY A 1 46  ? 12.357  7.077   -14.594 1.00 0.00 ? 46  GLY A N    5  
ATOM 7469  C CA   . GLY A 1 46  ? 11.170  6.967   -15.422 1.00 0.00 ? 46  GLY A CA   5  
ATOM 7470  C C    . GLY A 1 46  ? 9.947   7.574   -14.764 1.00 0.00 ? 46  GLY A C    5  
ATOM 7471  O O    . GLY A 1 46  ? 9.901   7.725   -13.544 1.00 0.00 ? 46  GLY A O    5  
ATOM 7472  H H    . GLY A 1 46  ? 12.573  6.367   -13.954 1.00 0.00 ? 46  GLY A H    5  
ATOM 7473  H HA2  . GLY A 1 46  ? 11.350  7.472   -16.359 1.00 0.00 ? 46  GLY A HA2  5  
ATOM 7474  H HA3  . GLY A 1 46  ? 10.978  5.923   -15.618 1.00 0.00 ? 46  GLY A HA3  5  
ATOM 7475  N N    . GLU A 1 47  ? 8.954   7.926   -15.575 1.00 0.00 ? 47  GLU A N    5  
ATOM 7476  C CA   . GLU A 1 47  ? 7.726   8.522   -15.064 1.00 0.00 ? 47  GLU A CA   5  
ATOM 7477  C C    . GLU A 1 47  ? 6.736   7.444   -14.631 1.00 0.00 ? 47  GLU A C    5  
ATOM 7478  O O    . GLU A 1 47  ? 6.385   6.560   -15.413 1.00 0.00 ? 47  GLU A O    5  
ATOM 7479  C CB   . GLU A 1 47  ? 7.087   9.419   -16.127 1.00 0.00 ? 47  GLU A CB   5  
ATOM 7480  C CG   . GLU A 1 47  ? 6.071   10.399  -15.565 1.00 0.00 ? 47  GLU A CG   5  
ATOM 7481  C CD   . GLU A 1 47  ? 4.730   9.751   -15.281 1.00 0.00 ? 47  GLU A CD   5  
ATOM 7482  O OE1  . GLU A 1 47  ? 4.323   8.864   -16.061 1.00 0.00 ? 47  GLU A OE1  5  
ATOM 7483  O OE2  . GLU A 1 47  ? 4.088   10.129  -14.279 1.00 0.00 ? 47  GLU A OE2  5  
ATOM 7484  H H    . GLU A 1 47  ? 9.050   7.781   -16.540 1.00 0.00 ? 47  GLU A H    5  
ATOM 7485  H HA   . GLU A 1 47  ? 7.982   9.124   -14.205 1.00 0.00 ? 47  GLU A HA   5  
ATOM 7486  H HB2  . GLU A 1 47  ? 7.865   9.982   -16.620 1.00 0.00 ? 47  GLU A HB2  5  
ATOM 7487  H HB3  . GLU A 1 47  ? 6.590   8.795   -16.855 1.00 0.00 ? 47  GLU A HB3  5  
ATOM 7488  H HG2  . GLU A 1 47  ? 6.457   10.811  -14.644 1.00 0.00 ? 47  GLU A HG2  5  
ATOM 7489  H HG3  . GLU A 1 47  ? 5.925   11.196  -16.280 1.00 0.00 ? 47  GLU A HG3  5  
ATOM 7490  N N    . ILE A 1 48  ? 6.291   7.525   -13.382 1.00 0.00 ? 48  ILE A N    5  
ATOM 7491  C CA   . ILE A 1 48  ? 5.343   6.557   -12.845 1.00 0.00 ? 48  ILE A CA   5  
ATOM 7492  C C    . ILE A 1 48  ? 4.107   6.448   -13.732 1.00 0.00 ? 48  ILE A C    5  
ATOM 7493  O O    . ILE A 1 48  ? 3.257   7.338   -13.739 1.00 0.00 ? 48  ILE A O    5  
ATOM 7494  C CB   . ILE A 1 48  ? 4.904   6.931   -11.417 1.00 0.00 ? 48  ILE A CB   5  
ATOM 7495  C CG1  . ILE A 1 48  ? 6.122   7.294   -10.564 1.00 0.00 ? 48  ILE A CG1  5  
ATOM 7496  C CG2  . ILE A 1 48  ? 4.130   5.785   -10.783 1.00 0.00 ? 48  ILE A CG2  5  
ATOM 7497  C CD1  . ILE A 1 48  ? 7.226   6.262   -10.618 1.00 0.00 ? 48  ILE A CD1  5  
ATOM 7498  H H    . ILE A 1 48  ? 6.608   8.253   -12.807 1.00 0.00 ? 48  ILE A H    5  
ATOM 7499  H HA   . ILE A 1 48  ? 5.833   5.595   -12.809 1.00 0.00 ? 48  ILE A HA   5  
ATOM 7500  H HB   . ILE A 1 48  ? 4.248   7.786   -11.478 1.00 0.00 ? 48  ILE A HB   5  
ATOM 7501  H HG12 . ILE A 1 48  ? 6.528   8.232   -10.909 1.00 0.00 ? 48  ILE A HG12 5  
ATOM 7502  H HG13 . ILE A 1 48  ? 5.813   7.397   -9.534  1.00 0.00 ? 48  ILE A HG13 5  
ATOM 7503  H HG21 . ILE A 1 48  ? 3.229   5.602   -11.350 1.00 0.00 ? 48  ILE A HG21 5  
ATOM 7504  H HG22 . ILE A 1 48  ? 4.741   4.895   -10.783 1.00 0.00 ? 48  ILE A HG22 5  
ATOM 7505  H HG23 . ILE A 1 48  ? 3.870   6.043   -9.768  1.00 0.00 ? 48  ILE A HG23 5  
ATOM 7506  H HD11 . ILE A 1 48  ? 7.920   6.518   -11.406 1.00 0.00 ? 48  ILE A HD11 5  
ATOM 7507  H HD12 . ILE A 1 48  ? 7.746   6.241   -9.673  1.00 0.00 ? 48  ILE A HD12 5  
ATOM 7508  H HD13 . ILE A 1 48  ? 6.800   5.289   -10.817 1.00 0.00 ? 48  ILE A HD13 5  
ATOM 7509  N N    . GLN A 1 49  ? 4.015   5.352   -14.477 1.00 0.00 ? 49  GLN A N    5  
ATOM 7510  C CA   . GLN A 1 49  ? 2.882   5.127   -15.367 1.00 0.00 ? 49  GLN A CA   5  
ATOM 7511  C C    . GLN A 1 49  ? 1.574   5.085   -14.584 1.00 0.00 ? 49  GLN A C    5  
ATOM 7512  O O    . GLN A 1 49  ? 0.550   5.590   -15.041 1.00 0.00 ? 49  GLN A O    5  
ATOM 7513  C CB   . GLN A 1 49  ? 3.068   3.821   -16.143 1.00 0.00 ? 49  GLN A CB   5  
ATOM 7514  C CG   . GLN A 1 49  ? 4.184   3.879   -17.173 1.00 0.00 ? 49  GLN A CG   5  
ATOM 7515  C CD   . GLN A 1 49  ? 3.888   4.848   -18.301 1.00 0.00 ? 49  GLN A CD   5  
ATOM 7516  O OE1  . GLN A 1 49  ? 3.919   6.065   -18.114 1.00 0.00 ? 49  GLN A OE1  5  
ATOM 7517  N NE2  . GLN A 1 49  ? 3.598   4.312   -19.481 1.00 0.00 ? 49  GLN A NE2  5  
ATOM 7518  H H    . GLN A 1 49  ? 4.725   4.679   -14.428 1.00 0.00 ? 49  GLN A H    5  
ATOM 7519  H HA   . GLN A 1 49  ? 2.842   5.948   -16.067 1.00 0.00 ? 49  GLN A HA   5  
ATOM 7520  H HB2  . GLN A 1 49  ? 3.293   3.030   -15.444 1.00 0.00 ? 49  GLN A HB2  5  
ATOM 7521  H HB3  . GLN A 1 49  ? 2.147   3.587   -16.656 1.00 0.00 ? 49  GLN A HB3  5  
ATOM 7522  H HG2  . GLN A 1 49  ? 5.094   4.191   -16.682 1.00 0.00 ? 49  GLN A HG2  5  
ATOM 7523  H HG3  . GLN A 1 49  ? 4.322   2.893   -17.592 1.00 0.00 ? 49  GLN A HG3  5  
ATOM 7524  H HE21 . GLN A 1 49  ? 3.591   3.334   -19.556 1.00 0.00 ? 49  GLN A HE21 5  
ATOM 7525  H HE22 . GLN A 1 49  ? 3.402   4.915   -20.227 1.00 0.00 ? 49  GLN A HE22 5  
ATOM 7526  N N    . ASN A 1 50  ? 1.617   4.479   -13.402 1.00 0.00 ? 50  ASN A N    5  
ATOM 7527  C CA   . ASN A 1 50  ? 0.435   4.371   -12.556 1.00 0.00 ? 50  ASN A CA   5  
ATOM 7528  C C    . ASN A 1 50  ? 0.819   3.981   -11.131 1.00 0.00 ? 50  ASN A C    5  
ATOM 7529  O O    . ASN A 1 50  ? 1.851   3.348   -10.907 1.00 0.00 ? 50  ASN A O    5  
ATOM 7530  C CB   . ASN A 1 50  ? -0.538  3.341   -13.133 1.00 0.00 ? 50  ASN A CB   5  
ATOM 7531  C CG   . ASN A 1 50  ? -1.538  2.850   -12.103 1.00 0.00 ? 50  ASN A CG   5  
ATOM 7532  O OD1  . ASN A 1 50  ? -1.380  1.771   -11.533 1.00 0.00 ? 50  ASN A OD1  5  
ATOM 7533  N ND2  . ASN A 1 50  ? -2.575  3.644   -11.861 1.00 0.00 ? 50  ASN A ND2  5  
ATOM 7534  H H    . ASN A 1 50  ? 2.464   4.095   -13.092 1.00 0.00 ? 50  ASN A H    5  
ATOM 7535  H HA   . ASN A 1 50  ? -0.047  5.336   -12.535 1.00 0.00 ? 50  ASN A HA   5  
ATOM 7536  H HB2  . ASN A 1 50  ? -1.084  3.789   -13.951 1.00 0.00 ? 50  ASN A HB2  5  
ATOM 7537  H HB3  . ASN A 1 50  ? 0.020   2.492   -13.499 1.00 0.00 ? 50  ASN A HB3  5  
ATOM 7538  H HD21 . ASN A 1 50  ? -2.636  4.490   -12.353 1.00 0.00 ? 50  ASN A HD21 5  
ATOM 7539  H HD22 . ASN A 1 50  ? -3.237  3.352   -11.200 1.00 0.00 ? 50  ASN A HD22 5  
ATOM 7540  N N    . TYR A 1 51  ? -0.018  4.364   -10.173 1.00 0.00 ? 51  TYR A N    5  
ATOM 7541  C CA   . TYR A 1 51  ? 0.235   4.057   -8.770  1.00 0.00 ? 51  TYR A CA   5  
ATOM 7542  C C    . TYR A 1 51  ? -0.574  2.843   -8.324  1.00 0.00 ? 51  TYR A C    5  
ATOM 7543  O O    . TYR A 1 51  ? -1.805  2.858   -8.349  1.00 0.00 ? 51  TYR A O    5  
ATOM 7544  C CB   . TYR A 1 51  ? -0.107  5.262   -7.893  1.00 0.00 ? 51  TYR A CB   5  
ATOM 7545  C CG   . TYR A 1 51  ? 0.899   6.386   -7.989  1.00 0.00 ? 51  TYR A CG   5  
ATOM 7546  C CD1  . TYR A 1 51  ? 2.129   6.301   -7.348  1.00 0.00 ? 51  TYR A CD1  5  
ATOM 7547  C CD2  . TYR A 1 51  ? 0.620   7.534   -8.721  1.00 0.00 ? 51  TYR A CD2  5  
ATOM 7548  C CE1  . TYR A 1 51  ? 3.051   7.326   -7.432  1.00 0.00 ? 51  TYR A CE1  5  
ATOM 7549  C CE2  . TYR A 1 51  ? 1.537   8.563   -8.812  1.00 0.00 ? 51  TYR A CE2  5  
ATOM 7550  C CZ   . TYR A 1 51  ? 2.751   8.455   -8.166  1.00 0.00 ? 51  TYR A CZ   5  
ATOM 7551  O OH   . TYR A 1 51  ? 3.666   9.478   -8.253  1.00 0.00 ? 51  TYR A OH   5  
ATOM 7552  H H    . TYR A 1 51  ? -0.824  4.866   -10.414 1.00 0.00 ? 51  TYR A H    5  
ATOM 7553  H HA   . TYR A 1 51  ? 1.287   3.834   -8.664  1.00 0.00 ? 51  TYR A HA   5  
ATOM 7554  H HB2  . TYR A 1 51  ? -1.069  5.652   -8.189  1.00 0.00 ? 51  TYR A HB2  5  
ATOM 7555  H HB3  . TYR A 1 51  ? -0.154  4.946   -6.861  1.00 0.00 ? 51  TYR A HB3  5  
ATOM 7556  H HD1  . TYR A 1 51  ? 2.361   5.415   -6.774  1.00 0.00 ? 51  TYR A HD1  5  
ATOM 7557  H HD2  . TYR A 1 51  ? -0.332  7.616   -9.225  1.00 0.00 ? 51  TYR A HD2  5  
ATOM 7558  H HE1  . TYR A 1 51  ? 4.002   7.241   -6.927  1.00 0.00 ? 51  TYR A HE1  5  
ATOM 7559  H HE2  . TYR A 1 51  ? 1.302   9.448   -9.386  1.00 0.00 ? 51  TYR A HE2  5  
ATOM 7560  H HH   . TYR A 1 51  ? 4.276   9.426   -7.513  1.00 0.00 ? 51  TYR A HH   5  
ATOM 7561  N N    . LYS A 1 52  ? 0.127   1.790   -7.916  1.00 0.00 ? 52  LYS A N    5  
ATOM 7562  C CA   . LYS A 1 52  ? -0.523  0.567   -7.461  1.00 0.00 ? 52  LYS A CA   5  
ATOM 7563  C C    . LYS A 1 52  ? -0.750  0.599   -5.954  1.00 0.00 ? 52  LYS A C    5  
ATOM 7564  O O    . LYS A 1 52  ? 0.171   0.873   -5.182  1.00 0.00 ? 52  LYS A O    5  
ATOM 7565  C CB   . LYS A 1 52  ? 0.323   -0.653  -7.835  1.00 0.00 ? 52  LYS A CB   5  
ATOM 7566  C CG   . LYS A 1 52  ? -0.491  -1.922  -8.024  1.00 0.00 ? 52  LYS A CG   5  
ATOM 7567  C CD   . LYS A 1 52  ? -0.938  -2.087  -9.467  1.00 0.00 ? 52  LYS A CD   5  
ATOM 7568  C CE   . LYS A 1 52  ? -2.230  -1.332  -9.739  1.00 0.00 ? 52  LYS A CE   5  
ATOM 7569  N NZ   . LYS A 1 52  ? -3.278  -1.641  -8.727  1.00 0.00 ? 52  LYS A NZ   5  
ATOM 7570  H H    . LYS A 1 52  ? 1.107   1.838   -7.919  1.00 0.00 ? 52  LYS A H    5  
ATOM 7571  H HA   . LYS A 1 52  ? -1.480  0.496   -7.956  1.00 0.00 ? 52  LYS A HA   5  
ATOM 7572  H HB2  . LYS A 1 52  ? 0.846   -0.445  -8.756  1.00 0.00 ? 52  LYS A HB2  5  
ATOM 7573  H HB3  . LYS A 1 52  ? 1.046   -0.828  -7.051  1.00 0.00 ? 52  LYS A HB3  5  
ATOM 7574  H HG2  . LYS A 1 52  ? 0.115   -2.772  -7.747  1.00 0.00 ? 52  LYS A HG2  5  
ATOM 7575  H HG3  . LYS A 1 52  ? -1.364  -1.877  -7.388  1.00 0.00 ? 52  LYS A HG3  5  
ATOM 7576  H HD2  . LYS A 1 52  ? -0.167  -1.706  -10.120 1.00 0.00 ? 52  LYS A HD2  5  
ATOM 7577  H HD3  . LYS A 1 52  ? -1.096  -3.137  -9.667  1.00 0.00 ? 52  LYS A HD3  5  
ATOM 7578  H HE2  . LYS A 1 52  ? -2.023  -0.273  -9.719  1.00 0.00 ? 52  LYS A HE2  5  
ATOM 7579  H HE3  . LYS A 1 52  ? -2.593  -1.609  -10.718 1.00 0.00 ? 52  LYS A HE3  5  
ATOM 7580  H HZ1  . LYS A 1 52  ? -3.062  -2.541  -8.254  1.00 0.00 ? 52  LYS A HZ1  5  
ATOM 7581  H HZ2  . LYS A 1 52  ? -4.207  -1.718  -9.187  1.00 0.00 ? 52  LYS A HZ2  5  
ATOM 7582  H HZ3  . LYS A 1 52  ? -3.318  -0.886  -8.013  1.00 0.00 ? 52  LYS A HZ3  5  
ATOM 7583  N N    . LEU A 1 53  ? -1.980  0.317   -5.539  1.00 0.00 ? 53  LEU A N    5  
ATOM 7584  C CA   . LEU A 1 53  ? -2.328  0.312   -4.122  1.00 0.00 ? 53  LEU A CA   5  
ATOM 7585  C C    . LEU A 1 53  ? -2.893  -1.042  -3.705  1.00 0.00 ? 53  LEU A C    5  
ATOM 7586  O O    . LEU A 1 53  ? -3.919  -1.485  -4.224  1.00 0.00 ? 53  LEU A O    5  
ATOM 7587  C CB   . LEU A 1 53  ? -3.343  1.416   -3.822  1.00 0.00 ? 53  LEU A CB   5  
ATOM 7588  C CG   . LEU A 1 53  ? -4.059  1.321   -2.474  1.00 0.00 ? 53  LEU A CG   5  
ATOM 7589  C CD1  . LEU A 1 53  ? -3.089  1.592   -1.335  1.00 0.00 ? 53  LEU A CD1  5  
ATOM 7590  C CD2  . LEU A 1 53  ? -5.229  2.292   -2.423  1.00 0.00 ? 53  LEU A CD2  5  
ATOM 7591  H H    . LEU A 1 53  ? -2.671  0.106   -6.200  1.00 0.00 ? 53  LEU A H    5  
ATOM 7592  H HA   . LEU A 1 53  ? -1.426  0.500   -3.559  1.00 0.00 ? 53  LEU A HA   5  
ATOM 7593  H HB2  . LEU A 1 53  ? -2.823  2.361   -3.855  1.00 0.00 ? 53  LEU A HB2  5  
ATOM 7594  H HB3  . LEU A 1 53  ? -4.094  1.393   -4.599  1.00 0.00 ? 53  LEU A HB3  5  
ATOM 7595  H HG   . LEU A 1 53  ? -4.448  0.320   -2.350  1.00 0.00 ? 53  LEU A HG   5  
ATOM 7596  H HD11 . LEU A 1 53  ? -3.462  2.404   -0.730  1.00 0.00 ? 53  LEU A HD11 5  
ATOM 7597  H HD12 . LEU A 1 53  ? -2.123  1.858   -1.740  1.00 0.00 ? 53  LEU A HD12 5  
ATOM 7598  H HD13 . LEU A 1 53  ? -2.991  0.704   -0.727  1.00 0.00 ? 53  LEU A HD13 5  
ATOM 7599  H HD21 . LEU A 1 53  ? -4.879  3.289   -2.646  1.00 0.00 ? 53  LEU A HD21 5  
ATOM 7600  H HD22 . LEU A 1 53  ? -5.666  2.278   -1.434  1.00 0.00 ? 53  LEU A HD22 5  
ATOM 7601  H HD23 . LEU A 1 53  ? -5.972  2.000   -3.149  1.00 0.00 ? 53  LEU A HD23 5  
ATOM 7602  N N    . TYR A 1 54  ? -2.220  -1.694  -2.764  1.00 0.00 ? 54  TYR A N    5  
ATOM 7603  C CA   . TYR A 1 54  ? -2.655  -2.998  -2.277  1.00 0.00 ? 54  TYR A CA   5  
ATOM 7604  C C    . TYR A 1 54  ? -3.389  -2.865  -0.946  1.00 0.00 ? 54  TYR A C    5  
ATOM 7605  O O    . TYR A 1 54  ? -3.215  -1.883  -0.223  1.00 0.00 ? 54  TYR A O    5  
ATOM 7606  C CB   . TYR A 1 54  ? -1.455  -3.933  -2.119  1.00 0.00 ? 54  TYR A CB   5  
ATOM 7607  C CG   . TYR A 1 54  ? -0.695  -4.165  -3.406  1.00 0.00 ? 54  TYR A CG   5  
ATOM 7608  C CD1  . TYR A 1 54  ? -0.099  -3.109  -4.084  1.00 0.00 ? 54  TYR A CD1  5  
ATOM 7609  C CD2  . TYR A 1 54  ? -0.571  -5.441  -3.942  1.00 0.00 ? 54  TYR A CD2  5  
ATOM 7610  C CE1  . TYR A 1 54  ? 0.595   -3.316  -5.260  1.00 0.00 ? 54  TYR A CE1  5  
ATOM 7611  C CE2  . TYR A 1 54  ? 0.123   -5.657  -5.117  1.00 0.00 ? 54  TYR A CE2  5  
ATOM 7612  C CZ   . TYR A 1 54  ? 0.704   -4.592  -5.772  1.00 0.00 ? 54  TYR A CZ   5  
ATOM 7613  O OH   . TYR A 1 54  ? 1.397   -4.802  -6.942  1.00 0.00 ? 54  TYR A OH   5  
ATOM 7614  H H    . TYR A 1 54  ? -1.410  -1.290  -2.389  1.00 0.00 ? 54  TYR A H    5  
ATOM 7615  H HA   . TYR A 1 54  ? -3.331  -3.416  -3.008  1.00 0.00 ? 54  TYR A HA   5  
ATOM 7616  H HB2  . TYR A 1 54  ? -0.769  -3.510  -1.401  1.00 0.00 ? 54  TYR A HB2  5  
ATOM 7617  H HB3  . TYR A 1 54  ? -1.799  -4.892  -1.760  1.00 0.00 ? 54  TYR A HB3  5  
ATOM 7618  H HD1  . TYR A 1 54  ? -0.186  -2.110  -3.680  1.00 0.00 ? 54  TYR A HD1  5  
ATOM 7619  H HD2  . TYR A 1 54  ? -1.027  -6.273  -3.426  1.00 0.00 ? 54  TYR A HD2  5  
ATOM 7620  H HE1  . TYR A 1 54  ? 1.051   -2.481  -5.773  1.00 0.00 ? 54  TYR A HE1  5  
ATOM 7621  H HE2  . TYR A 1 54  ? 0.209   -6.656  -5.518  1.00 0.00 ? 54  TYR A HE2  5  
ATOM 7622  H HH   . TYR A 1 54  ? 2.340   -4.781  -6.764  1.00 0.00 ? 54  TYR A HH   5  
ATOM 7623  N N    . TYR A 1 55  ? -4.209  -3.860  -0.629  1.00 0.00 ? 55  TYR A N    5  
ATOM 7624  C CA   . TYR A 1 55  ? -4.972  -3.855  0.614   1.00 0.00 ? 55  TYR A CA   5  
ATOM 7625  C C    . TYR A 1 55  ? -5.453  -5.260  0.964   1.00 0.00 ? 55  TYR A C    5  
ATOM 7626  O O    . TYR A 1 55  ? -6.055  -5.945  0.138   1.00 0.00 ? 55  TYR A O    5  
ATOM 7627  C CB   . TYR A 1 55  ? -6.168  -2.909  0.500   1.00 0.00 ? 55  TYR A CB   5  
ATOM 7628  C CG   . TYR A 1 55  ? -7.291  -3.452  -0.354  1.00 0.00 ? 55  TYR A CG   5  
ATOM 7629  C CD1  . TYR A 1 55  ? -7.142  -3.586  -1.729  1.00 0.00 ? 55  TYR A CD1  5  
ATOM 7630  C CD2  . TYR A 1 55  ? -8.501  -3.832  0.213   1.00 0.00 ? 55  TYR A CD2  5  
ATOM 7631  C CE1  . TYR A 1 55  ? -8.166  -4.081  -2.514  1.00 0.00 ? 55  TYR A CE1  5  
ATOM 7632  C CE2  . TYR A 1 55  ? -9.529  -4.330  -0.563  1.00 0.00 ? 55  TYR A CE2  5  
ATOM 7633  C CZ   . TYR A 1 55  ? -9.357  -4.452  -1.926  1.00 0.00 ? 55  TYR A CZ   5  
ATOM 7634  O OH   . TYR A 1 55  ? -10.379 -4.947  -2.703  1.00 0.00 ? 55  TYR A OH   5  
ATOM 7635  H H    . TYR A 1 55  ? -4.306  -4.615  -1.245  1.00 0.00 ? 55  TYR A H    5  
ATOM 7636  H HA   . TYR A 1 55  ? -4.321  -3.504  1.401   1.00 0.00 ? 55  TYR A HA   5  
ATOM 7637  H HB2  . TYR A 1 55  ? -6.564  -2.719  1.485   1.00 0.00 ? 55  TYR A HB2  5  
ATOM 7638  H HB3  . TYR A 1 55  ? -5.840  -1.977  0.063   1.00 0.00 ? 55  TYR A HB3  5  
ATOM 7639  H HD1  . TYR A 1 55  ? -6.208  -3.294  -2.187  1.00 0.00 ? 55  TYR A HD1  5  
ATOM 7640  H HD2  . TYR A 1 55  ? -8.632  -3.734  1.281   1.00 0.00 ? 55  TYR A HD2  5  
ATOM 7641  H HE1  . TYR A 1 55  ? -8.031  -4.178  -3.581  1.00 0.00 ? 55  TYR A HE1  5  
ATOM 7642  H HE2  . TYR A 1 55  ? -10.462 -4.620  -0.103  1.00 0.00 ? 55  TYR A HE2  5  
ATOM 7643  H HH   . TYR A 1 55  ? -10.501 -4.381  -3.469  1.00 0.00 ? 55  TYR A HH   5  
ATOM 7644  N N    . MET A 1 56  ? -5.182  -5.682  2.194   1.00 0.00 ? 56  MET A N    5  
ATOM 7645  C CA   . MET A 1 56  ? -5.588  -7.005  2.655   1.00 0.00 ? 56  MET A CA   5  
ATOM 7646  C C    . MET A 1 56  ? -5.870  -6.995  4.154   1.00 0.00 ? 56  MET A C    5  
ATOM 7647  O O    . MET A 1 56  ? -5.442  -6.090  4.869   1.00 0.00 ? 56  MET A O    5  
ATOM 7648  C CB   . MET A 1 56  ? -4.504  -8.036  2.335   1.00 0.00 ? 56  MET A CB   5  
ATOM 7649  C CG   . MET A 1 56  ? -3.474  -8.199  3.441   1.00 0.00 ? 56  MET A CG   5  
ATOM 7650  S SD   . MET A 1 56  ? -1.914  -8.878  2.844   1.00 0.00 ? 56  MET A SD   5  
ATOM 7651  C CE   . MET A 1 56  ? -1.585  -10.119 4.093   1.00 0.00 ? 56  MET A CE   5  
ATOM 7652  H H    . MET A 1 56  ? -4.698  -5.091  2.808   1.00 0.00 ? 56  MET A H    5  
ATOM 7653  H HA   . MET A 1 56  ? -6.493  -7.274  2.132   1.00 0.00 ? 56  MET A HA   5  
ATOM 7654  H HB2  . MET A 1 56  ? -4.973  -8.993  2.165   1.00 0.00 ? 56  MET A HB2  5  
ATOM 7655  H HB3  . MET A 1 56  ? -3.989  -7.731  1.436   1.00 0.00 ? 56  MET A HB3  5  
ATOM 7656  H HG2  . MET A 1 56  ? -3.283  -7.232  3.882   1.00 0.00 ? 56  MET A HG2  5  
ATOM 7657  H HG3  . MET A 1 56  ? -3.876  -8.862  4.193   1.00 0.00 ? 56  MET A HG3  5  
ATOM 7658  H HE1  . MET A 1 56  ? -2.352  -10.077 4.853   1.00 0.00 ? 56  MET A HE1  5  
ATOM 7659  H HE2  . MET A 1 56  ? -1.583  -11.097 3.636   1.00 0.00 ? 56  MET A HE2  5  
ATOM 7660  H HE3  . MET A 1 56  ? -0.622  -9.929  4.543   1.00 0.00 ? 56  MET A HE3  5  
ATOM 7661  N N    . GLU A 1 57  ? -6.592  -8.008  4.623   1.00 0.00 ? 57  GLU A N    5  
ATOM 7662  C CA   . GLU A 1 57  ? -6.931  -8.114  6.037   1.00 0.00 ? 57  GLU A CA   5  
ATOM 7663  C C    . GLU A 1 57  ? -5.866  -8.904  6.794   1.00 0.00 ? 57  GLU A C    5  
ATOM 7664  O O    . GLU A 1 57  ? -5.490  -10.005 6.392   1.00 0.00 ? 57  GLU A O    5  
ATOM 7665  C CB   . GLU A 1 57  ? -8.296  -8.784  6.208   1.00 0.00 ? 57  GLU A CB   5  
ATOM 7666  C CG   . GLU A 1 57  ? -8.824  -8.734  7.632   1.00 0.00 ? 57  GLU A CG   5  
ATOM 7667  C CD   . GLU A 1 57  ? -10.292 -9.102  7.723   1.00 0.00 ? 57  GLU A CD   5  
ATOM 7668  O OE1  . GLU A 1 57  ? -11.043 -8.783  6.778   1.00 0.00 ? 57  GLU A OE1  5  
ATOM 7669  O OE2  . GLU A 1 57  ? -10.690 -9.710  8.739   1.00 0.00 ? 57  GLU A OE2  5  
ATOM 7670  H H    . GLU A 1 57  ? -6.905  -8.700  4.003   1.00 0.00 ? 57  GLU A H    5  
ATOM 7671  H HA   . GLU A 1 57  ? -6.977  -7.115  6.443   1.00 0.00 ? 57  GLU A HA   5  
ATOM 7672  H HB2  . GLU A 1 57  ? -9.009  -8.291  5.564   1.00 0.00 ? 57  GLU A HB2  5  
ATOM 7673  H HB3  . GLU A 1 57  ? -8.214  -9.820  5.914   1.00 0.00 ? 57  GLU A HB3  5  
ATOM 7674  H HG2  . GLU A 1 57  ? -8.257  -9.425  8.238   1.00 0.00 ? 57  GLU A HG2  5  
ATOM 7675  H HG3  . GLU A 1 57  ? -8.695  -7.732  8.015   1.00 0.00 ? 57  GLU A HG3  5  
ATOM 7676  N N    . LYS A 1 58  ? -5.384  -8.332  7.892   1.00 0.00 ? 58  LYS A N    5  
ATOM 7677  C CA   . LYS A 1 58  ? -4.364  -8.980  8.707   1.00 0.00 ? 58  LYS A CA   5  
ATOM 7678  C C    . LYS A 1 58  ? -4.796  -10.389 9.102   1.00 0.00 ? 58  LYS A C    5  
ATOM 7679  O O    . LYS A 1 58  ? -5.584  -10.570 10.029  1.00 0.00 ? 58  LYS A O    5  
ATOM 7680  C CB   . LYS A 1 58  ? -4.082  -8.151  9.963   1.00 0.00 ? 58  LYS A CB   5  
ATOM 7681  C CG   . LYS A 1 58  ? -2.660  -8.291  10.478  1.00 0.00 ? 58  LYS A CG   5  
ATOM 7682  C CD   . LYS A 1 58  ? -1.738  -7.254  9.859   1.00 0.00 ? 58  LYS A CD   5  
ATOM 7683  C CE   . LYS A 1 58  ? -0.317  -7.385  10.386  1.00 0.00 ? 58  LYS A CE   5  
ATOM 7684  N NZ   . LYS A 1 58  ? -0.203  -6.921  11.796  1.00 0.00 ? 58  LYS A NZ   5  
ATOM 7685  H H    . LYS A 1 58  ? -5.724  -7.453  8.162   1.00 0.00 ? 58  LYS A H    5  
ATOM 7686  H HA   . LYS A 1 58  ? -3.461  -9.045  8.119   1.00 0.00 ? 58  LYS A HA   5  
ATOM 7687  H HB2  . LYS A 1 58  ? -4.261  -7.110  9.739   1.00 0.00 ? 58  LYS A HB2  5  
ATOM 7688  H HB3  . LYS A 1 58  ? -4.758  -8.464  10.745  1.00 0.00 ? 58  LYS A HB3  5  
ATOM 7689  H HG2  . LYS A 1 58  ? -2.660  -8.162  11.550  1.00 0.00 ? 58  LYS A HG2  5  
ATOM 7690  H HG3  . LYS A 1 58  ? -2.293  -9.278  10.232  1.00 0.00 ? 58  LYS A HG3  5  
ATOM 7691  H HD2  . LYS A 1 58  ? -1.726  -7.388  8.787   1.00 0.00 ? 58  LYS A HD2  5  
ATOM 7692  H HD3  . LYS A 1 58  ? -2.111  -6.267  10.095  1.00 0.00 ? 58  LYS A HD3  5  
ATOM 7693  H HE2  . LYS A 1 58  ? -0.022  -8.422  10.332  1.00 0.00 ? 58  LYS A HE2  5  
ATOM 7694  H HE3  . LYS A 1 58  ? 0.339   -6.792  9.766   1.00 0.00 ? 58  LYS A HE3  5  
ATOM 7695  H HZ1  . LYS A 1 58  ? -0.821  -7.490  12.410  1.00 0.00 ? 58  LYS A HZ1  5  
ATOM 7696  H HZ2  . LYS A 1 58  ? -0.487  -5.923  11.867  1.00 0.00 ? 58  LYS A HZ2  5  
ATOM 7697  H HZ3  . LYS A 1 58  ? 0.778   -7.016  12.125  1.00 0.00 ? 58  LYS A HZ3  5  
ATOM 7698  N N    . GLY A 1 59  ? -4.273  -11.384 8.393   1.00 0.00 ? 59  GLY A N    5  
ATOM 7699  C CA   . GLY A 1 59  ? -4.616  -12.764 8.685   1.00 0.00 ? 59  GLY A CA   5  
ATOM 7700  C C    . GLY A 1 59  ? -5.365  -13.429 7.548   1.00 0.00 ? 59  GLY A C    5  
ATOM 7701  O O    . GLY A 1 59  ? -6.243  -14.262 7.775   1.00 0.00 ? 59  GLY A O    5  
ATOM 7702  H H    . GLY A 1 59  ? -3.649  -11.180 7.664   1.00 0.00 ? 59  GLY A H    5  
ATOM 7703  H HA2  . GLY A 1 59  ? -3.708  -13.316 8.876   1.00 0.00 ? 59  GLY A HA2  5  
ATOM 7704  H HA3  . GLY A 1 59  ? -5.234  -12.789 9.571   1.00 0.00 ? 59  GLY A HA3  5  
ATOM 7705  N N    . THR A 1 60  ? -5.020  -13.060 6.318   1.00 0.00 ? 60  THR A N    5  
ATOM 7706  C CA   . THR A 1 60  ? -5.667  -13.624 5.141   1.00 0.00 ? 60  THR A CA   5  
ATOM 7707  C C    . THR A 1 60  ? -4.653  -14.298 4.225   1.00 0.00 ? 60  THR A C    5  
ATOM 7708  O O    . THR A 1 60  ? -4.984  -15.236 3.499   1.00 0.00 ? 60  THR A O    5  
ATOM 7709  C CB   . THR A 1 60  ? -6.423  -12.544 4.344   1.00 0.00 ? 60  THR A CB   5  
ATOM 7710  O OG1  . THR A 1 60  ? -6.983  -11.577 5.239   1.00 0.00 ? 60  THR A OG1  5  
ATOM 7711  C CG2  . THR A 1 60  ? -7.529  -13.166 3.504   1.00 0.00 ? 60  THR A CG2  5  
ATOM 7712  H H    . THR A 1 60  ? -4.312  -12.392 6.201   1.00 0.00 ? 60  THR A H    5  
ATOM 7713  H HA   . THR A 1 60  ? -6.383  -14.362 5.475   1.00 0.00 ? 60  THR A HA   5  
ATOM 7714  H HB   . THR A 1 60  ? -5.724  -12.051 3.683   1.00 0.00 ? 60  THR A HB   5  
ATOM 7715  H HG1  . THR A 1 60  ? -6.605  -10.713 5.054   1.00 0.00 ? 60  THR A HG1  5  
ATOM 7716  H HG21 . THR A 1 60  ? -7.138  -13.432 2.533   1.00 0.00 ? 60  THR A HG21 5  
ATOM 7717  H HG22 . THR A 1 60  ? -8.334  -12.455 3.386   1.00 0.00 ? 60  THR A HG22 5  
ATOM 7718  H HG23 . THR A 1 60  ? -7.900  -14.051 3.997   1.00 0.00 ? 60  THR A HG23 5  
ATOM 7719  N N    . ASP A 1 61  ? -3.415  -13.816 4.264   1.00 0.00 ? 61  ASP A N    5  
ATOM 7720  C CA   . ASP A 1 61  ? -2.351  -14.374 3.438   1.00 0.00 ? 61  ASP A CA   5  
ATOM 7721  C C    . ASP A 1 61  ? -2.649  -14.169 1.956   1.00 0.00 ? 61  ASP A C    5  
ATOM 7722  O O    . ASP A 1 61  ? -2.229  -14.960 1.111   1.00 0.00 ? 61  ASP A O    5  
ATOM 7723  C CB   . ASP A 1 61  ? -2.175  -15.864 3.734   1.00 0.00 ? 61  ASP A CB   5  
ATOM 7724  C CG   . ASP A 1 61  ? -1.965  -16.141 5.210   1.00 0.00 ? 61  ASP A CG   5  
ATOM 7725  O OD1  . ASP A 1 61  ? -2.220  -15.231 6.026   1.00 0.00 ? 61  ASP A OD1  5  
ATOM 7726  O OD2  . ASP A 1 61  ? -1.546  -17.267 5.548   1.00 0.00 ? 61  ASP A OD2  5  
ATOM 7727  H H    . ASP A 1 61  ? -3.213  -13.067 4.863   1.00 0.00 ? 61  ASP A H    5  
ATOM 7728  H HA   . ASP A 1 61  ? -1.435  -13.857 3.683   1.00 0.00 ? 61  ASP A HA   5  
ATOM 7729  H HB2  . ASP A 1 61  ? -3.057  -16.396 3.409   1.00 0.00 ? 61  ASP A HB2  5  
ATOM 7730  H HB3  . ASP A 1 61  ? -1.317  -16.234 3.191   1.00 0.00 ? 61  ASP A HB3  5  
ATOM 7731  N N    . LYS A 1 62  ? -3.377  -13.102 1.646   1.00 0.00 ? 62  LYS A N    5  
ATOM 7732  C CA   . LYS A 1 62  ? -3.732  -12.791 0.267   1.00 0.00 ? 62  LYS A CA   5  
ATOM 7733  C C    . LYS A 1 62  ? -3.811  -11.283 0.052   1.00 0.00 ? 62  LYS A C    5  
ATOM 7734  O O    . LYS A 1 62  ? -4.752  -10.632 0.502   1.00 0.00 ? 62  LYS A O    5  
ATOM 7735  C CB   . LYS A 1 62  ? -5.070  -13.439 -0.096  1.00 0.00 ? 62  LYS A CB   5  
ATOM 7736  C CG   . LYS A 1 62  ? -5.617  -12.993 -1.441  1.00 0.00 ? 62  LYS A CG   5  
ATOM 7737  C CD   . LYS A 1 62  ? -5.012  -13.794 -2.582  1.00 0.00 ? 62  LYS A CD   5  
ATOM 7738  C CE   . LYS A 1 62  ? -5.722  -15.127 -2.765  1.00 0.00 ? 62  LYS A CE   5  
ATOM 7739  N NZ   . LYS A 1 62  ? -6.963  -14.988 -3.577  1.00 0.00 ? 62  LYS A NZ   5  
ATOM 7740  H H    . LYS A 1 62  ? -3.683  -12.507 2.364   1.00 0.00 ? 62  LYS A H    5  
ATOM 7741  H HA   . LYS A 1 62  ? -2.961  -13.194 -0.373  1.00 0.00 ? 62  LYS A HA   5  
ATOM 7742  H HB2  . LYS A 1 62  ? -4.942  -14.511 -0.120  1.00 0.00 ? 62  LYS A HB2  5  
ATOM 7743  H HB3  . LYS A 1 62  ? -5.795  -13.189 0.665   1.00 0.00 ? 62  LYS A HB3  5  
ATOM 7744  H HG2  . LYS A 1 62  ? -6.688  -13.130 -1.447  1.00 0.00 ? 62  LYS A HG2  5  
ATOM 7745  H HG3  . LYS A 1 62  ? -5.385  -11.947 -1.585  1.00 0.00 ? 62  LYS A HG3  5  
ATOM 7746  H HD2  . LYS A 1 62  ? -5.099  -13.225 -3.496  1.00 0.00 ? 62  LYS A HD2  5  
ATOM 7747  H HD3  . LYS A 1 62  ? -3.969  -13.978 -2.368  1.00 0.00 ? 62  LYS A HD3  5  
ATOM 7748  H HE2  . LYS A 1 62  ? -5.052  -15.811 -3.262  1.00 0.00 ? 62  LYS A HE2  5  
ATOM 7749  H HE3  . LYS A 1 62  ? -5.980  -15.518 -1.792  1.00 0.00 ? 62  LYS A HE3  5  
ATOM 7750  H HZ1  . LYS A 1 62  ? -7.789  -15.289 -3.021  1.00 0.00 ? 62  LYS A HZ1  5  
ATOM 7751  H HZ2  . LYS A 1 62  ? -6.899  -15.578 -4.430  1.00 0.00 ? 62  LYS A HZ2  5  
ATOM 7752  H HZ3  . LYS A 1 62  ? -7.094  -13.996 -3.863  1.00 0.00 ? 62  LYS A HZ3  5  
ATOM 7753  N N    . GLU A 1 63  ? -2.816  -10.735 -0.640  1.00 0.00 ? 63  GLU A N    5  
ATOM 7754  C CA   . GLU A 1 63  ? -2.775  -9.304  -0.915  1.00 0.00 ? 63  GLU A CA   5  
ATOM 7755  C C    . GLU A 1 63  ? -3.507  -8.978  -2.214  1.00 0.00 ? 63  GLU A C    5  
ATOM 7756  O O    . GLU A 1 63  ? -3.496  -9.766  -3.158  1.00 0.00 ? 63  GLU A O    5  
ATOM 7757  C CB   . GLU A 1 63  ? -1.326  -8.819  -0.998  1.00 0.00 ? 63  GLU A CB   5  
ATOM 7758  C CG   . GLU A 1 63  ? -1.192  -7.306  -1.044  1.00 0.00 ? 63  GLU A CG   5  
ATOM 7759  C CD   . GLU A 1 63  ? -1.100  -6.686  0.336   1.00 0.00 ? 63  GLU A CD   5  
ATOM 7760  O OE1  . GLU A 1 63  ? -0.007  -6.742  0.940   1.00 0.00 ? 63  GLU A OE1  5  
ATOM 7761  O OE2  . GLU A 1 63  ? -2.119  -6.145  0.814   1.00 0.00 ? 63  GLU A OE2  5  
ATOM 7762  H H    . GLU A 1 63  ? -2.093  -11.307 -0.973  1.00 0.00 ? 63  GLU A H    5  
ATOM 7763  H HA   . GLU A 1 63  ? -3.269  -8.796  -0.100  1.00 0.00 ? 63  GLU A HA   5  
ATOM 7764  H HB2  . GLU A 1 63  ? -0.788  -9.182  -0.134  1.00 0.00 ? 63  GLU A HB2  5  
ATOM 7765  H HB3  . GLU A 1 63  ? -0.874  -9.227  -1.889  1.00 0.00 ? 63  GLU A HB3  5  
ATOM 7766  H HG2  . GLU A 1 63  ? -0.299  -7.054  -1.596  1.00 0.00 ? 63  GLU A HG2  5  
ATOM 7767  H HG3  . GLU A 1 63  ? -2.054  -6.897  -1.550  1.00 0.00 ? 63  GLU A HG3  5  
ATOM 7768  N N    . GLN A 1 64  ? -4.142  -7.811  -2.251  1.00 0.00 ? 64  GLN A N    5  
ATOM 7769  C CA   . GLN A 1 64  ? -4.880  -7.381  -3.432  1.00 0.00 ? 64  GLN A CA   5  
ATOM 7770  C C    . GLN A 1 64  ? -4.222  -6.163  -4.073  1.00 0.00 ? 64  GLN A C    5  
ATOM 7771  O O    . GLN A 1 64  ? -3.210  -5.662  -3.581  1.00 0.00 ? 64  GLN A O    5  
ATOM 7772  C CB   . GLN A 1 64  ? -6.330  -7.058  -3.065  1.00 0.00 ? 64  GLN A CB   5  
ATOM 7773  C CG   . GLN A 1 64  ? -7.102  -8.251  -2.527  1.00 0.00 ? 64  GLN A CG   5  
ATOM 7774  C CD   . GLN A 1 64  ? -8.481  -7.876  -2.023  1.00 0.00 ? 64  GLN A CD   5  
ATOM 7775  O OE1  . GLN A 1 64  ? -9.333  -7.423  -2.788  1.00 0.00 ? 64  GLN A OE1  5  
ATOM 7776  N NE2  . GLN A 1 64  ? -8.709  -8.061  -0.728  1.00 0.00 ? 64  GLN A NE2  5  
ATOM 7777  H H    . GLN A 1 64  ? -4.114  -7.226  -1.466  1.00 0.00 ? 64  GLN A H    5  
ATOM 7778  H HA   . GLN A 1 64  ? -4.872  -8.194  -4.142  1.00 0.00 ? 64  GLN A HA   5  
ATOM 7779  H HB2  . GLN A 1 64  ? -6.333  -6.284  -2.311  1.00 0.00 ? 64  GLN A HB2  5  
ATOM 7780  H HB3  . GLN A 1 64  ? -6.839  -6.694  -3.945  1.00 0.00 ? 64  GLN A HB3  5  
ATOM 7781  H HG2  . GLN A 1 64  ? -7.211  -8.979  -3.318  1.00 0.00 ? 64  GLN A HG2  5  
ATOM 7782  H HG3  . GLN A 1 64  ? -6.543  -8.688  -1.713  1.00 0.00 ? 64  GLN A HG3  5  
ATOM 7783  H HE21 . GLN A 1 64  ? -7.983  -8.425  -0.178  1.00 0.00 ? 64  GLN A HE21 5  
ATOM 7784  H HE22 . GLN A 1 64  ? -9.592  -7.826  -0.375  1.00 0.00 ? 64  GLN A HE22 5  
ATOM 7785  N N    . ASP A 1 65  ? -4.802  -5.692  -5.171  1.00 0.00 ? 65  ASP A N    5  
ATOM 7786  C CA   . ASP A 1 65  ? -4.272  -4.533  -5.878  1.00 0.00 ? 65  ASP A CA   5  
ATOM 7787  C C    . ASP A 1 65  ? -5.393  -3.750  -6.555  1.00 0.00 ? 65  ASP A C    5  
ATOM 7788  O O    . ASP A 1 65  ? -6.256  -4.327  -7.216  1.00 0.00 ? 65  ASP A O    5  
ATOM 7789  C CB   . ASP A 1 65  ? -3.239  -4.971  -6.918  1.00 0.00 ? 65  ASP A CB   5  
ATOM 7790  C CG   . ASP A 1 65  ? -3.880  -5.574  -8.152  1.00 0.00 ? 65  ASP A CG   5  
ATOM 7791  O OD1  . ASP A 1 65  ? -4.891  -6.292  -8.005  1.00 0.00 ? 65  ASP A OD1  5  
ATOM 7792  O OD2  . ASP A 1 65  ? -3.370  -5.328  -9.265  1.00 0.00 ? 65  ASP A OD2  5  
ATOM 7793  H H    . ASP A 1 65  ? -5.606  -6.135  -5.514  1.00 0.00 ? 65  ASP A H    5  
ATOM 7794  H HA   . ASP A 1 65  ? -3.791  -3.893  -5.154  1.00 0.00 ? 65  ASP A HA   5  
ATOM 7795  H HB2  . ASP A 1 65  ? -2.656  -4.113  -7.221  1.00 0.00 ? 65  ASP A HB2  5  
ATOM 7796  H HB3  . ASP A 1 65  ? -2.584  -5.708  -6.477  1.00 0.00 ? 65  ASP A HB3  5  
ATOM 7797  N N    . VAL A 1 66  ? -5.374  -2.432  -6.385  1.00 0.00 ? 66  VAL A N    5  
ATOM 7798  C CA   . VAL A 1 66  ? -6.388  -1.569  -6.979  1.00 0.00 ? 66  VAL A CA   5  
ATOM 7799  C C    . VAL A 1 66  ? -5.751  -0.385  -7.697  1.00 0.00 ? 66  VAL A C    5  
ATOM 7800  O O    . VAL A 1 66  ? -4.817  0.234   -7.186  1.00 0.00 ? 66  VAL A O    5  
ATOM 7801  C CB   . VAL A 1 66  ? -7.370  -1.043  -5.916  1.00 0.00 ? 66  VAL A CB   5  
ATOM 7802  C CG1  . VAL A 1 66  ? -8.230  -2.176  -5.377  1.00 0.00 ? 66  VAL A CG1  5  
ATOM 7803  C CG2  . VAL A 1 66  ? -6.616  -0.352  -4.790  1.00 0.00 ? 66  VAL A CG2  5  
ATOM 7804  H H    . VAL A 1 66  ? -4.660  -2.029  -5.848  1.00 0.00 ? 66  VAL A H    5  
ATOM 7805  H HA   . VAL A 1 66  ? -6.946  -2.155  -7.696  1.00 0.00 ? 66  VAL A HA   5  
ATOM 7806  H HB   . VAL A 1 66  ? -8.021  -0.318  -6.383  1.00 0.00 ? 66  VAL A HB   5  
ATOM 7807  H HG11 . VAL A 1 66  ? -9.274  -1.928  -5.506  1.00 0.00 ? 66  VAL A HG11 5  
ATOM 7808  H HG12 . VAL A 1 66  ? -8.006  -3.086  -5.913  1.00 0.00 ? 66  VAL A HG12 5  
ATOM 7809  H HG13 . VAL A 1 66  ? -8.022  -2.316  -4.326  1.00 0.00 ? 66  VAL A HG13 5  
ATOM 7810  H HG21 . VAL A 1 66  ? -7.218  0.454   -4.397  1.00 0.00 ? 66  VAL A HG21 5  
ATOM 7811  H HG22 . VAL A 1 66  ? -6.410  -1.064  -4.004  1.00 0.00 ? 66  VAL A HG22 5  
ATOM 7812  H HG23 . VAL A 1 66  ? -5.686  0.044   -5.169  1.00 0.00 ? 66  VAL A HG23 5  
ATOM 7813  N N    . ASP A 1 67  ? -6.261  -0.075  -8.883  1.00 0.00 ? 67  ASP A N    5  
ATOM 7814  C CA   . ASP A 1 67  ? -5.743  1.037   -9.672  1.00 0.00 ? 67  ASP A CA   5  
ATOM 7815  C C    . ASP A 1 67  ? -6.107  2.373   -9.031  1.00 0.00 ? 67  ASP A C    5  
ATOM 7816  O O    . ASP A 1 67  ? -7.273  2.635   -8.736  1.00 0.00 ? 67  ASP A O    5  
ATOM 7817  C CB   . ASP A 1 67  ? -6.289  0.977   -11.099 1.00 0.00 ? 67  ASP A CB   5  
ATOM 7818  C CG   . ASP A 1 67  ? -5.993  2.238   -11.886 1.00 0.00 ? 67  ASP A CG   5  
ATOM 7819  O OD1  . ASP A 1 67  ? -4.904  2.319   -12.492 1.00 0.00 ? 67  ASP A OD1  5  
ATOM 7820  O OD2  . ASP A 1 67  ? -6.852  3.145   -11.897 1.00 0.00 ? 67  ASP A OD2  5  
ATOM 7821  H H    . ASP A 1 67  ? -7.005  -0.606  -9.237  1.00 0.00 ? 67  ASP A H    5  
ATOM 7822  H HA   . ASP A 1 67  ? -4.668  0.949   -9.703  1.00 0.00 ? 67  ASP A HA   5  
ATOM 7823  H HB2  . ASP A 1 67  ? -5.839  0.140   -11.614 1.00 0.00 ? 67  ASP A HB2  5  
ATOM 7824  H HB3  . ASP A 1 67  ? -7.359  0.838   -11.063 1.00 0.00 ? 67  ASP A HB3  5  
ATOM 7825  N N    . VAL A 1 68  ? -5.100  3.215   -8.819  1.00 0.00 ? 68  VAL A N    5  
ATOM 7826  C CA   . VAL A 1 68  ? -5.314  4.525   -8.213  1.00 0.00 ? 68  VAL A CA   5  
ATOM 7827  C C    . VAL A 1 68  ? -4.627  5.621   -9.019  1.00 0.00 ? 68  VAL A C    5  
ATOM 7828  O O    . VAL A 1 68  ? -3.430  5.544   -9.297  1.00 0.00 ? 68  VAL A O    5  
ATOM 7829  C CB   . VAL A 1 68  ? -4.794  4.564   -6.764  1.00 0.00 ? 68  VAL A CB   5  
ATOM 7830  C CG1  . VAL A 1 68  ? -4.931  5.965   -6.186  1.00 0.00 ? 68  VAL A CG1  5  
ATOM 7831  C CG2  . VAL A 1 68  ? -5.533  3.549   -5.905  1.00 0.00 ? 68  VAL A CG2  5  
ATOM 7832  H H    . VAL A 1 68  ? -4.193  2.950   -9.076  1.00 0.00 ? 68  VAL A H    5  
ATOM 7833  H HA   . VAL A 1 68  ? -6.377  4.716   -8.197  1.00 0.00 ? 68  VAL A HA   5  
ATOM 7834  H HB   . VAL A 1 68  ? -3.746  4.303   -6.772  1.00 0.00 ? 68  VAL A HB   5  
ATOM 7835  H HG11 . VAL A 1 68  ? -5.966  6.154   -5.943  1.00 0.00 ? 68  VAL A HG11 5  
ATOM 7836  H HG12 . VAL A 1 68  ? -4.329  6.046   -5.292  1.00 0.00 ? 68  VAL A HG12 5  
ATOM 7837  H HG13 . VAL A 1 68  ? -4.595  6.689   -6.913  1.00 0.00 ? 68  VAL A HG13 5  
ATOM 7838  H HG21 . VAL A 1 68  ? -5.353  3.763   -4.862  1.00 0.00 ? 68  VAL A HG21 5  
ATOM 7839  H HG22 . VAL A 1 68  ? -6.592  3.609   -6.108  1.00 0.00 ? 68  VAL A HG22 5  
ATOM 7840  H HG23 . VAL A 1 68  ? -5.178  2.556   -6.135  1.00 0.00 ? 68  VAL A HG23 5  
ATOM 7841  N N    . SER A 1 69  ? -5.392  6.643   -9.390  1.00 0.00 ? 69  SER A N    5  
ATOM 7842  C CA   . SER A 1 69  ? -4.857  7.755   -10.167 1.00 0.00 ? 69  SER A CA   5  
ATOM 7843  C C    . SER A 1 69  ? -4.683  8.994   -9.293  1.00 0.00 ? 69  SER A C    5  
ATOM 7844  O O    . SER A 1 69  ? -5.180  10.072  -9.619  1.00 0.00 ? 69  SER A O    5  
ATOM 7845  C CB   . SER A 1 69  ? -5.781  8.073   -11.344 1.00 0.00 ? 69  SER A CB   5  
ATOM 7846  O OG   . SER A 1 69  ? -5.578  7.165   -12.412 1.00 0.00 ? 69  SER A OG   5  
ATOM 7847  H H    . SER A 1 69  ? -6.339  6.647   -9.137  1.00 0.00 ? 69  SER A H    5  
ATOM 7848  H HA   . SER A 1 69  ? -3.891  7.459   -10.549 1.00 0.00 ? 69  SER A HA   5  
ATOM 7849  H HB2  . SER A 1 69  ? -6.809  8.006   -11.020 1.00 0.00 ? 69  SER A HB2  5  
ATOM 7850  H HB3  . SER A 1 69  ? -5.580  9.075   -11.696 1.00 0.00 ? 69  SER A HB3  5  
ATOM 7851  H HG   . SER A 1 69  ? -5.222  6.342   -12.069 1.00 0.00 ? 69  SER A HG   5  
ATOM 7852  N N    . SER A 1 70  ? -3.972  8.831   -8.182  1.00 0.00 ? 70  SER A N    5  
ATOM 7853  C CA   . SER A 1 70  ? -3.734  9.934   -7.258  1.00 0.00 ? 70  SER A CA   5  
ATOM 7854  C C    . SER A 1 70  ? -2.768  9.518   -6.153  1.00 0.00 ? 70  SER A C    5  
ATOM 7855  O O    . SER A 1 70  ? -2.310  8.376   -6.110  1.00 0.00 ? 70  SER A O    5  
ATOM 7856  C CB   . SER A 1 70  ? -5.053  10.409  -6.647  1.00 0.00 ? 70  SER A CB   5  
ATOM 7857  O OG   . SER A 1 70  ? -5.707  11.333  -7.500  1.00 0.00 ? 70  SER A OG   5  
ATOM 7858  H H    . SER A 1 70  ? -3.601  7.947   -7.978  1.00 0.00 ? 70  SER A H    5  
ATOM 7859  H HA   . SER A 1 70  ? -3.293  10.746  -7.818  1.00 0.00 ? 70  SER A HA   5  
ATOM 7860  H HB2  . SER A 1 70  ? -5.701  9.560   -6.492  1.00 0.00 ? 70  SER A HB2  5  
ATOM 7861  H HB3  . SER A 1 70  ? -4.856  10.889  -5.700  1.00 0.00 ? 70  SER A HB3  5  
ATOM 7862  H HG   . SER A 1 70  ? -5.059  11.765  -8.061  1.00 0.00 ? 70  SER A HG   5  
ATOM 7863  N N    . HIS A 1 71  ? -2.464  10.453  -5.259  1.00 0.00 ? 71  HIS A N    5  
ATOM 7864  C CA   . HIS A 1 71  ? -1.554  10.185  -4.151  1.00 0.00 ? 71  HIS A CA   5  
ATOM 7865  C C    . HIS A 1 71  ? -2.318  9.691   -2.926  1.00 0.00 ? 71  HIS A C    5  
ATOM 7866  O O    . HIS A 1 71  ? -1.760  9.011   -2.066  1.00 0.00 ? 71  HIS A O    5  
ATOM 7867  C CB   . HIS A 1 71  ? -0.760  11.443  -3.799  1.00 0.00 ? 71  HIS A CB   5  
ATOM 7868  C CG   . HIS A 1 71  ? 0.216   11.852  -4.858  1.00 0.00 ? 71  HIS A CG   5  
ATOM 7869  N ND1  . HIS A 1 71  ? 0.176   13.079  -5.486  1.00 0.00 ? 71  HIS A ND1  5  
ATOM 7870  C CD2  . HIS A 1 71  ? 1.265   11.189  -5.399  1.00 0.00 ? 71  HIS A CD2  5  
ATOM 7871  C CE1  . HIS A 1 71  ? 1.156   13.153  -6.368  1.00 0.00 ? 71  HIS A CE1  5  
ATOM 7872  N NE2  . HIS A 1 71  ? 1.833   12.019  -6.334  1.00 0.00 ? 71  HIS A NE2  5  
ATOM 7873  H H    . HIS A 1 71  ? -2.861  11.345  -5.346  1.00 0.00 ? 71  HIS A H    5  
ATOM 7874  H HA   . HIS A 1 71  ? -0.867  9.414   -4.466  1.00 0.00 ? 71  HIS A HA   5  
ATOM 7875  H HB2  . HIS A 1 71  ? -1.447  12.263  -3.647  1.00 0.00 ? 71  HIS A HB2  5  
ATOM 7876  H HB3  . HIS A 1 71  ? -0.208  11.270  -2.886  1.00 0.00 ? 71  HIS A HB3  5  
ATOM 7877  H HD1  . HIS A 1 71  ? -0.476  13.790  -5.312  1.00 0.00 ? 71  HIS A HD1  5  
ATOM 7878  H HD2  . HIS A 1 71  ? 1.595   10.192  -5.142  1.00 0.00 ? 71  HIS A HD2  5  
ATOM 7879  H HE1  . HIS A 1 71  ? 1.370   13.996  -7.007  1.00 0.00 ? 71  HIS A HE1  5  
ATOM 7880  H HE2  . HIS A 1 71  ? 2.557   11.776  -6.947  1.00 0.00 ? 71  HIS A HE2  5  
ATOM 7881  N N    . SER A 1 72  ? -3.599  10.040  -2.854  1.00 0.00 ? 72  SER A N    5  
ATOM 7882  C CA   . SER A 1 72  ? -4.439  9.637   -1.733  1.00 0.00 ? 72  SER A CA   5  
ATOM 7883  C C    . SER A 1 72  ? -5.724  8.979   -2.226  1.00 0.00 ? 72  SER A C    5  
ATOM 7884  O O    . SER A 1 72  ? -6.527  9.602   -2.922  1.00 0.00 ? 72  SER A O    5  
ATOM 7885  C CB   . SER A 1 72  ? -4.775  10.847  -0.859  1.00 0.00 ? 72  SER A CB   5  
ATOM 7886  O OG   . SER A 1 72  ? -5.620  11.754  -1.546  1.00 0.00 ? 72  SER A OG   5  
ATOM 7887  H H    . SER A 1 72  ? -3.987  10.584  -3.572  1.00 0.00 ? 72  SER A H    5  
ATOM 7888  H HA   . SER A 1 72  ? -3.885  8.921   -1.144  1.00 0.00 ? 72  SER A HA   5  
ATOM 7889  H HB2  . SER A 1 72  ? -5.278  10.513  0.036   1.00 0.00 ? 72  SER A HB2  5  
ATOM 7890  H HB3  . SER A 1 72  ? -3.862  11.357  -0.589  1.00 0.00 ? 72  SER A HB3  5  
ATOM 7891  H HG   . SER A 1 72  ? -6.498  11.375  -1.628  1.00 0.00 ? 72  SER A HG   5  
ATOM 7892  N N    . TYR A 1 73  ? -5.912  7.716   -1.860  1.00 0.00 ? 73  TYR A N    5  
ATOM 7893  C CA   . TYR A 1 73  ? -7.098  6.971   -2.267  1.00 0.00 ? 73  TYR A CA   5  
ATOM 7894  C C    . TYR A 1 73  ? -7.926  6.561   -1.053  1.00 0.00 ? 73  TYR A C    5  
ATOM 7895  O O    . TYR A 1 73  ? -7.445  6.587   0.081   1.00 0.00 ? 73  TYR A O    5  
ATOM 7896  C CB   . TYR A 1 73  ? -6.698  5.731   -3.068  1.00 0.00 ? 73  TYR A CB   5  
ATOM 7897  C CG   . TYR A 1 73  ? -7.876  4.960   -3.619  1.00 0.00 ? 73  TYR A CG   5  
ATOM 7898  C CD1  . TYR A 1 73  ? -8.474  5.330   -4.817  1.00 0.00 ? 73  TYR A CD1  5  
ATOM 7899  C CD2  . TYR A 1 73  ? -8.390  3.861   -2.942  1.00 0.00 ? 73  TYR A CD2  5  
ATOM 7900  C CE1  . TYR A 1 73  ? -9.551  4.629   -5.324  1.00 0.00 ? 73  TYR A CE1  5  
ATOM 7901  C CE2  . TYR A 1 73  ? -9.465  3.153   -3.443  1.00 0.00 ? 73  TYR A CE2  5  
ATOM 7902  C CZ   . TYR A 1 73  ? -10.043 3.541   -4.634  1.00 0.00 ? 73  TYR A CZ   5  
ATOM 7903  O OH   . TYR A 1 73  ? -11.114 2.839   -5.136  1.00 0.00 ? 73  TYR A OH   5  
ATOM 7904  H H    . TYR A 1 73  ? -5.237  7.273   -1.305  1.00 0.00 ? 73  TYR A H    5  
ATOM 7905  H HA   . TYR A 1 73  ? -7.696  7.616   -2.894  1.00 0.00 ? 73  TYR A HA   5  
ATOM 7906  H HB2  . TYR A 1 73  ? -6.080  6.032   -3.900  1.00 0.00 ? 73  TYR A HB2  5  
ATOM 7907  H HB3  . TYR A 1 73  ? -6.134  5.066   -2.430  1.00 0.00 ? 73  TYR A HB3  5  
ATOM 7908  H HD1  . TYR A 1 73  ? -8.086  6.182   -5.356  1.00 0.00 ? 73  TYR A HD1  5  
ATOM 7909  H HD2  . TYR A 1 73  ? -7.935  3.559   -2.009  1.00 0.00 ? 73  TYR A HD2  5  
ATOM 7910  H HE1  . TYR A 1 73  ? -10.003 4.932   -6.257  1.00 0.00 ? 73  TYR A HE1  5  
ATOM 7911  H HE2  . TYR A 1 73  ? -9.851  2.301   -2.902  1.00 0.00 ? 73  TYR A HE2  5  
ATOM 7912  H HH   . TYR A 1 73  ? -11.860 3.433   -5.251  1.00 0.00 ? 73  TYR A HH   5  
ATOM 7913  N N    . THR A 1 74  ? -9.176  6.180   -1.298  1.00 0.00 ? 74  THR A N    5  
ATOM 7914  C CA   . THR A 1 74  ? -10.073 5.765   -0.227  1.00 0.00 ? 74  THR A CA   5  
ATOM 7915  C C    . THR A 1 74  ? -10.721 4.421   -0.543  1.00 0.00 ? 74  THR A C    5  
ATOM 7916  O O    . THR A 1 74  ? -11.453 4.290   -1.524  1.00 0.00 ? 74  THR A O    5  
ATOM 7917  C CB   . THR A 1 74  ? -11.178 6.809   0.017   1.00 0.00 ? 74  THR A CB   5  
ATOM 7918  O OG1  . THR A 1 74  ? -10.592 8.083   0.308   1.00 0.00 ? 74  THR A OG1  5  
ATOM 7919  C CG2  . THR A 1 74  ? -12.078 6.385   1.168   1.00 0.00 ? 74  THR A CG2  5  
ATOM 7920  H H    . THR A 1 74  ? -9.502  6.181   -2.223  1.00 0.00 ? 74  THR A H    5  
ATOM 7921  H HA   . THR A 1 74  ? -9.490  5.669   0.677   1.00 0.00 ? 74  THR A HA   5  
ATOM 7922  H HB   . THR A 1 74  ? -11.778 6.893   -0.878  1.00 0.00 ? 74  THR A HB   5  
ATOM 7923  H HG1  . THR A 1 74  ? -10.336 8.114   1.233   1.00 0.00 ? 74  THR A HG1  5  
ATOM 7924  H HG21 . THR A 1 74  ? -12.992 5.964   0.774   1.00 0.00 ? 74  THR A HG21 5  
ATOM 7925  H HG22 . THR A 1 74  ? -12.312 7.245   1.778   1.00 0.00 ? 74  THR A HG22 5  
ATOM 7926  H HG23 . THR A 1 74  ? -11.571 5.645   1.768   1.00 0.00 ? 74  THR A HG23 5  
ATOM 7927  N N    . ILE A 1 75  ? -10.447 3.426   0.294   1.00 0.00 ? 75  ILE A N    5  
ATOM 7928  C CA   . ILE A 1 75  ? -11.005 2.093   0.104   1.00 0.00 ? 75  ILE A CA   5  
ATOM 7929  C C    . ILE A 1 75  ? -12.215 1.870   1.005   1.00 0.00 ? 75  ILE A C    5  
ATOM 7930  O O    . ILE A 1 75  ? -12.121 1.984   2.227   1.00 0.00 ? 75  ILE A O    5  
ATOM 7931  C CB   . ILE A 1 75  ? -9.959  0.999   0.388   1.00 0.00 ? 75  ILE A CB   5  
ATOM 7932  C CG1  . ILE A 1 75  ? -8.853  1.034   -0.669  1.00 0.00 ? 75  ILE A CG1  5  
ATOM 7933  C CG2  . ILE A 1 75  ? -10.621 -0.370  0.425   1.00 0.00 ? 75  ILE A CG2  5  
ATOM 7934  C CD1  . ILE A 1 75  ? -7.650  0.190   -0.312  1.00 0.00 ? 75  ILE A CD1  5  
ATOM 7935  H H    . ILE A 1 75  ? -9.856  3.593   1.058   1.00 0.00 ? 75  ILE A H    5  
ATOM 7936  H HA   . ILE A 1 75  ? -11.317 2.007   -0.927  1.00 0.00 ? 75  ILE A HA   5  
ATOM 7937  H HB   . ILE A 1 75  ? -9.526  1.189   1.358   1.00 0.00 ? 75  ILE A HB   5  
ATOM 7938  H HG12 . ILE A 1 75  ? -9.247  0.671   -1.605  1.00 0.00 ? 75  ILE A HG12 5  
ATOM 7939  H HG13 . ILE A 1 75  ? -8.518  2.054   -0.795  1.00 0.00 ? 75  ILE A HG13 5  
ATOM 7940  H HG21 . ILE A 1 75  ? -11.559 -0.330  -0.109  1.00 0.00 ? 75  ILE A HG21 5  
ATOM 7941  H HG22 . ILE A 1 75  ? -9.973  -1.096  -0.043  1.00 0.00 ? 75  ILE A HG22 5  
ATOM 7942  H HG23 . ILE A 1 75  ? -10.801 -0.656  1.450   1.00 0.00 ? 75  ILE A HG23 5  
ATOM 7943  H HD11 . ILE A 1 75  ? -7.980  -0.745  0.116   1.00 0.00 ? 75  ILE A HD11 5  
ATOM 7944  H HD12 . ILE A 1 75  ? -7.070  -0.005  -1.202  1.00 0.00 ? 75  ILE A HD12 5  
ATOM 7945  H HD13 . ILE A 1 75  ? -7.039  0.718   0.406   1.00 0.00 ? 75  ILE A HD13 5  
ATOM 7946  N N    . ASN A 1 76  ? -13.351 1.551   0.394   1.00 0.00 ? 76  ASN A N    5  
ATOM 7947  C CA   . ASN A 1 76  ? -14.580 1.310   1.141   1.00 0.00 ? 76  ASN A CA   5  
ATOM 7948  C C    . ASN A 1 76  ? -14.977 -0.162  1.076   1.00 0.00 ? 76  ASN A C    5  
ATOM 7949  O O    . ASN A 1 76  ? -14.557 -0.889  0.177   1.00 0.00 ? 76  ASN A O    5  
ATOM 7950  C CB   . ASN A 1 76  ? -15.713 2.180   0.593   1.00 0.00 ? 76  ASN A CB   5  
ATOM 7951  C CG   . ASN A 1 76  ? -15.266 3.602   0.312   1.00 0.00 ? 76  ASN A CG   5  
ATOM 7952  O OD1  . ASN A 1 76  ? -15.464 4.500   1.131   1.00 0.00 ? 76  ASN A OD1  5  
ATOM 7953  N ND2  . ASN A 1 76  ? -14.659 3.812   -0.850  1.00 0.00 ? 76  ASN A ND2  5  
ATOM 7954  H H    . ASN A 1 76  ? -13.363 1.475   -0.583  1.00 0.00 ? 76  ASN A H    5  
ATOM 7955  H HA   . ASN A 1 76  ? -14.399 1.577   2.171   1.00 0.00 ? 76  ASN A HA   5  
ATOM 7956  H HB2  . ASN A 1 76  ? -16.076 1.749   -0.328  1.00 0.00 ? 76  ASN A HB2  5  
ATOM 7957  H HB3  . ASN A 1 76  ? -16.516 2.210   1.314   1.00 0.00 ? 76  ASN A HB3  5  
ATOM 7958  H HD21 . ASN A 1 76  ? -14.535 3.049   -1.453  1.00 0.00 ? 76  ASN A HD21 5  
ATOM 7959  H HD22 . ASN A 1 76  ? -14.359 4.722   -1.057  1.00 0.00 ? 76  ASN A HD22 5  
ATOM 7960  N N    . GLY A 1 77  ? -15.789 -0.593  2.036   1.00 0.00 ? 77  GLY A N    5  
ATOM 7961  C CA   . GLY A 1 77  ? -16.230 -1.975  2.069   1.00 0.00 ? 77  GLY A CA   5  
ATOM 7962  C C    . GLY A 1 77  ? -15.346 -2.844  2.942   1.00 0.00 ? 77  GLY A C    5  
ATOM 7963  O O    . GLY A 1 77  ? -14.921 -3.924  2.527   1.00 0.00 ? 77  GLY A O    5  
ATOM 7964  H H    . GLY A 1 77  ? -16.092 0.033   2.727   1.00 0.00 ? 77  GLY A H    5  
ATOM 7965  H HA2  . GLY A 1 77  ? -17.240 -2.011  2.450   1.00 0.00 ? 77  GLY A HA2  5  
ATOM 7966  H HA3  . GLY A 1 77  ? -16.221 -2.368  1.063   1.00 0.00 ? 77  GLY A HA3  5  
ATOM 7967  N N    . LEU A 1 78  ? -15.067 -2.375  4.153   1.00 0.00 ? 78  LEU A N    5  
ATOM 7968  C CA   . LEU A 1 78  ? -14.226 -3.116  5.086   1.00 0.00 ? 78  LEU A CA   5  
ATOM 7969  C C    . LEU A 1 78  ? -14.952 -3.346  6.408   1.00 0.00 ? 78  LEU A C    5  
ATOM 7970  O O    . LEU A 1 78  ? -16.016 -2.778  6.652   1.00 0.00 ? 78  LEU A O    5  
ATOM 7971  C CB   . LEU A 1 78  ? -12.918 -2.363  5.334   1.00 0.00 ? 78  LEU A CB   5  
ATOM 7972  C CG   . LEU A 1 78  ? -12.154 -1.918  4.086   1.00 0.00 ? 78  LEU A CG   5  
ATOM 7973  C CD1  . LEU A 1 78  ? -10.916 -1.124  4.474   1.00 0.00 ? 78  LEU A CD1  5  
ATOM 7974  C CD2  . LEU A 1 78  ? -11.773 -3.121  3.237   1.00 0.00 ? 78  LEU A CD2  5  
ATOM 7975  H H    . LEU A 1 78  ? -15.435 -1.509  4.427   1.00 0.00 ? 78  LEU A H    5  
ATOM 7976  H HA   . LEU A 1 78  ? -14.002 -4.074  4.641   1.00 0.00 ? 78  LEU A HA   5  
ATOM 7977  H HB2  . LEU A 1 78  ? -13.149 -1.481  5.912   1.00 0.00 ? 78  LEU A HB2  5  
ATOM 7978  H HB3  . LEU A 1 78  ? -12.269 -3.009  5.908   1.00 0.00 ? 78  LEU A HB3  5  
ATOM 7979  H HG   . LEU A 1 78  ? -12.789 -1.275  3.493   1.00 0.00 ? 78  LEU A HG   5  
ATOM 7980  H HD11 . LEU A 1 78  ? -10.415 -0.779  3.582   1.00 0.00 ? 78  LEU A HD11 5  
ATOM 7981  H HD12 . LEU A 1 78  ? -10.247 -1.754  5.041   1.00 0.00 ? 78  LEU A HD12 5  
ATOM 7982  H HD13 . LEU A 1 78  ? -11.207 -0.275  5.076   1.00 0.00 ? 78  LEU A HD13 5  
ATOM 7983  H HD21 . LEU A 1 78  ? -11.094 -2.810  2.456   1.00 0.00 ? 78  LEU A HD21 5  
ATOM 7984  H HD22 . LEU A 1 78  ? -12.662 -3.544  2.792   1.00 0.00 ? 78  LEU A HD22 5  
ATOM 7985  H HD23 . LEU A 1 78  ? -11.292 -3.863  3.857   1.00 0.00 ? 78  LEU A HD23 5  
ATOM 7986  N N    . LYS A 1 79  ? -14.368 -4.182  7.260   1.00 0.00 ? 79  LYS A N    5  
ATOM 7987  C CA   . LYS A 1 79  ? -14.956 -4.486  8.559   1.00 0.00 ? 79  LYS A CA   5  
ATOM 7988  C C    . LYS A 1 79  ? -14.610 -3.405  9.578   1.00 0.00 ? 79  LYS A C    5  
ATOM 7989  O O    . LYS A 1 79  ? -13.851 -2.481  9.286   1.00 0.00 ? 79  LYS A O    5  
ATOM 7990  C CB   . LYS A 1 79  ? -14.466 -5.847  9.058   1.00 0.00 ? 79  LYS A CB   5  
ATOM 7991  C CG   . LYS A 1 79  ? -15.188 -7.023  8.423   1.00 0.00 ? 79  LYS A CG   5  
ATOM 7992  C CD   . LYS A 1 79  ? -16.418 -7.419  9.223   1.00 0.00 ? 79  LYS A CD   5  
ATOM 7993  C CE   . LYS A 1 79  ? -16.061 -8.355  10.368  1.00 0.00 ? 79  LYS A CE   5  
ATOM 7994  N NZ   . LYS A 1 79  ? -17.231 -8.625  11.249  1.00 0.00 ? 79  LYS A NZ   5  
ATOM 7995  H H    . LYS A 1 79  ? -13.519 -4.605  7.008   1.00 0.00 ? 79  LYS A H    5  
ATOM 7996  H HA   . LYS A 1 79  ? -16.028 -4.520  8.438   1.00 0.00 ? 79  LYS A HA   5  
ATOM 7997  H HB2  . LYS A 1 79  ? -13.412 -5.939  8.840   1.00 0.00 ? 79  LYS A HB2  5  
ATOM 7998  H HB3  . LYS A 1 79  ? -14.610 -5.898  10.128  1.00 0.00 ? 79  LYS A HB3  5  
ATOM 7999  H HG2  . LYS A 1 79  ? -15.494 -6.750  7.425   1.00 0.00 ? 79  LYS A HG2  5  
ATOM 8000  H HG3  . LYS A 1 79  ? -14.513 -7.866  8.377   1.00 0.00 ? 79  LYS A HG3  5  
ATOM 8001  H HD2  . LYS A 1 79  ? -16.875 -6.529  9.630   1.00 0.00 ? 79  LYS A HD2  5  
ATOM 8002  H HD3  . LYS A 1 79  ? -17.118 -7.917  8.567   1.00 0.00 ? 79  LYS A HD3  5  
ATOM 8003  H HE2  . LYS A 1 79  ? -15.709 -9.288  9.956   1.00 0.00 ? 79  LYS A HE2  5  
ATOM 8004  H HE3  . LYS A 1 79  ? -15.276 -7.901  10.955  1.00 0.00 ? 79  LYS A HE3  5  
ATOM 8005  H HZ1  . LYS A 1 79  ? -18.025 -8.004  10.989  1.00 0.00 ? 79  LYS A HZ1  5  
ATOM 8006  H HZ2  . LYS A 1 79  ? -16.979 -8.448  12.242  1.00 0.00 ? 79  LYS A HZ2  5  
ATOM 8007  H HZ3  . LYS A 1 79  ? -17.532 -9.615  11.150  1.00 0.00 ? 79  LYS A HZ3  5  
ATOM 8008  N N    . LYS A 1 80  ? -15.171 -3.527  10.777  1.00 0.00 ? 80  LYS A N    5  
ATOM 8009  C CA   . LYS A 1 80  ? -14.920 -2.563  11.841  1.00 0.00 ? 80  LYS A CA   5  
ATOM 8010  C C    . LYS A 1 80  ? -13.935 -3.123  12.862  1.00 0.00 ? 80  LYS A C    5  
ATOM 8011  O O    . LYS A 1 80  ? -13.968 -4.311  13.184  1.00 0.00 ? 80  LYS A O    5  
ATOM 8012  C CB   . LYS A 1 80  ? -16.232 -2.186  12.535  1.00 0.00 ? 80  LYS A CB   5  
ATOM 8013  C CG   . LYS A 1 80  ? -17.318 -1.731  11.576  1.00 0.00 ? 80  LYS A CG   5  
ATOM 8014  C CD   . LYS A 1 80  ? -18.199 -2.890  11.141  1.00 0.00 ? 80  LYS A CD   5  
ATOM 8015  C CE   . LYS A 1 80  ? -18.978 -2.555  9.878   1.00 0.00 ? 80  LYS A CE   5  
ATOM 8016  N NZ   . LYS A 1 80  ? -18.224 -2.920  8.647   1.00 0.00 ? 80  LYS A NZ   5  
ATOM 8017  H H    . LYS A 1 80  ? -15.767 -4.286  10.950  1.00 0.00 ? 80  LYS A H    5  
ATOM 8018  H HA   . LYS A 1 80  ? -14.493 -1.678  11.394  1.00 0.00 ? 80  LYS A HA   5  
ATOM 8019  H HB2  . LYS A 1 80  ? -16.597 -3.045  13.079  1.00 0.00 ? 80  LYS A HB2  5  
ATOM 8020  H HB3  . LYS A 1 80  ? -16.038 -1.385  13.233  1.00 0.00 ? 80  LYS A HB3  5  
ATOM 8021  H HG2  . LYS A 1 80  ? -17.933 -0.992  12.068  1.00 0.00 ? 80  LYS A HG2  5  
ATOM 8022  H HG3  . LYS A 1 80  ? -16.855 -1.295  10.703  1.00 0.00 ? 80  LYS A HG3  5  
ATOM 8023  H HD2  . LYS A 1 80  ? -17.576 -3.751  10.947  1.00 0.00 ? 80  LYS A HD2  5  
ATOM 8024  H HD3  . LYS A 1 80  ? -18.896 -3.119  11.934  1.00 0.00 ? 80  LYS A HD3  5  
ATOM 8025  H HE2  . LYS A 1 80  ? -19.911 -3.096  9.892   1.00 0.00 ? 80  LYS A HE2  5  
ATOM 8026  H HE3  . LYS A 1 80  ? -19.178 -1.493  9.866   1.00 0.00 ? 80  LYS A HE3  5  
ATOM 8027  H HZ1  . LYS A 1 80  ? -18.864 -2.931  7.827   1.00 0.00 ? 80  LYS A HZ1  5  
ATOM 8028  H HZ2  . LYS A 1 80  ? -17.800 -3.863  8.754   1.00 0.00 ? 80  LYS A HZ2  5  
ATOM 8029  H HZ3  . LYS A 1 80  ? -17.467 -2.229  8.474   1.00 0.00 ? 80  LYS A HZ3  5  
ATOM 8030  N N    . TYR A 1 81  ? -13.062 -2.260  13.369  1.00 0.00 ? 81  TYR A N    5  
ATOM 8031  C CA   . TYR A 1 81  ? -12.067 -2.670  14.354  1.00 0.00 ? 81  TYR A CA   5  
ATOM 8032  C C    . TYR A 1 81  ? -11.173 -3.774  13.798  1.00 0.00 ? 81  TYR A C    5  
ATOM 8033  O O    . TYR A 1 81  ? -10.648 -4.600  14.545  1.00 0.00 ? 81  TYR A O    5  
ATOM 8034  C CB   . TYR A 1 81  ? -12.753 -3.149  15.634  1.00 0.00 ? 81  TYR A CB   5  
ATOM 8035  C CG   . TYR A 1 81  ? -11.930 -2.924  16.883  1.00 0.00 ? 81  TYR A CG   5  
ATOM 8036  C CD1  . TYR A 1 81  ? -11.496 -1.651  17.232  1.00 0.00 ? 81  TYR A CD1  5  
ATOM 8037  C CD2  . TYR A 1 81  ? -11.588 -3.983  17.714  1.00 0.00 ? 81  TYR A CD2  5  
ATOM 8038  C CE1  . TYR A 1 81  ? -10.744 -1.440  18.371  1.00 0.00 ? 81  TYR A CE1  5  
ATOM 8039  C CE2  . TYR A 1 81  ? -10.837 -3.782  18.856  1.00 0.00 ? 81  TYR A CE2  5  
ATOM 8040  C CZ   . TYR A 1 81  ? -10.417 -2.509  19.180  1.00 0.00 ? 81  TYR A CZ   5  
ATOM 8041  O OH   . TYR A 1 81  ? -9.669  -2.303  20.316  1.00 0.00 ? 81  TYR A OH   5  
ATOM 8042  H H    . TYR A 1 81  ? -13.085 -1.326  13.074  1.00 0.00 ? 81  TYR A H    5  
ATOM 8043  H HA   . TYR A 1 81  ? -11.456 -1.809  14.585  1.00 0.00 ? 81  TYR A HA   5  
ATOM 8044  H HB2  . TYR A 1 81  ? -13.687 -2.622  15.753  1.00 0.00 ? 81  TYR A HB2  5  
ATOM 8045  H HB3  . TYR A 1 81  ? -12.950 -4.208  15.553  1.00 0.00 ? 81  TYR A HB3  5  
ATOM 8046  H HD1  . TYR A 1 81  ? -11.754 -0.816  16.596  1.00 0.00 ? 81  TYR A HD1  5  
ATOM 8047  H HD2  . TYR A 1 81  ? -11.919 -4.979  17.457  1.00 0.00 ? 81  TYR A HD2  5  
ATOM 8048  H HE1  . TYR A 1 81  ? -10.415 -0.443  18.625  1.00 0.00 ? 81  TYR A HE1  5  
ATOM 8049  H HE2  . TYR A 1 81  ? -10.581 -4.618  19.489  1.00 0.00 ? 81  TYR A HE2  5  
ATOM 8050  H HH   . TYR A 1 81  ? -9.994  -2.870  21.020  1.00 0.00 ? 81  TYR A HH   5  
ATOM 8051  N N    . THR A 1 82  ? -11.004 -3.782  12.479  1.00 0.00 ? 82  THR A N    5  
ATOM 8052  C CA   . THR A 1 82  ? -10.175 -4.784  11.821  1.00 0.00 ? 82  THR A CA   5  
ATOM 8053  C C    . THR A 1 82  ? -8.935  -4.149  11.200  1.00 0.00 ? 82  THR A C    5  
ATOM 8054  O O    . THR A 1 82  ? -9.013  -3.085  10.588  1.00 0.00 ? 82  THR A O    5  
ATOM 8055  C CB   . THR A 1 82  ? -10.959 -5.531  10.726  1.00 0.00 ? 82  THR A CB   5  
ATOM 8056  O OG1  . THR A 1 82  ? -12.140 -6.118  11.283  1.00 0.00 ? 82  THR A OG1  5  
ATOM 8057  C CG2  . THR A 1 82  ? -10.100 -6.612  10.088  1.00 0.00 ? 82  THR A CG2  5  
ATOM 8058  H H    . THR A 1 82  ? -11.449 -3.097  11.937  1.00 0.00 ? 82  THR A H    5  
ATOM 8059  H HA   . THR A 1 82  ? -9.865  -5.502  12.566  1.00 0.00 ? 82  THR A HA   5  
ATOM 8060  H HB   . THR A 1 82  ? -11.245 -4.822  9.962   1.00 0.00 ? 82  THR A HB   5  
ATOM 8061  H HG1  . THR A 1 82  ? -12.463 -5.568  12.001  1.00 0.00 ? 82  THR A HG1  5  
ATOM 8062  H HG21 . THR A 1 82  ? -9.065  -6.450  10.347  1.00 0.00 ? 82  THR A HG21 5  
ATOM 8063  H HG22 . THR A 1 82  ? -10.214 -6.576  9.015   1.00 0.00 ? 82  THR A HG22 5  
ATOM 8064  H HG23 . THR A 1 82  ? -10.414 -7.580  10.450  1.00 0.00 ? 82  THR A HG23 5  
ATOM 8065  N N    . GLU A 1 83  ? -7.794  -4.811  11.361  1.00 0.00 ? 83  GLU A N    5  
ATOM 8066  C CA   . GLU A 1 83  ? -6.538  -4.310  10.815  1.00 0.00 ? 83  GLU A CA   5  
ATOM 8067  C C    . GLU A 1 83  ? -6.426  -4.628  9.326   1.00 0.00 ? 83  GLU A C    5  
ATOM 8068  O O    . GLU A 1 83  ? -6.955  -5.635  8.854   1.00 0.00 ? 83  GLU A O    5  
ATOM 8069  C CB   . GLU A 1 83  ? -5.351  -4.917  11.567  1.00 0.00 ? 83  GLU A CB   5  
ATOM 8070  C CG   . GLU A 1 83  ? -4.081  -4.088  11.470  1.00 0.00 ? 83  GLU A CG   5  
ATOM 8071  C CD   . GLU A 1 83  ? -3.075  -4.433  12.550  1.00 0.00 ? 83  GLU A CD   5  
ATOM 8072  O OE1  . GLU A 1 83  ? -2.496  -5.538  12.492  1.00 0.00 ? 83  GLU A OE1  5  
ATOM 8073  O OE2  . GLU A 1 83  ? -2.867  -3.598  13.455  1.00 0.00 ? 83  GLU A OE2  5  
ATOM 8074  H H    . GLU A 1 83  ? -7.796  -5.655  11.858  1.00 0.00 ? 83  GLU A H    5  
ATOM 8075  H HA   . GLU A 1 83  ? -6.524  -3.239  10.944  1.00 0.00 ? 83  GLU A HA   5  
ATOM 8076  H HB2  . GLU A 1 83  ? -5.614  -5.015  12.610  1.00 0.00 ? 83  GLU A HB2  5  
ATOM 8077  H HB3  . GLU A 1 83  ? -5.148  -5.897  11.163  1.00 0.00 ? 83  GLU A HB3  5  
ATOM 8078  H HG2  . GLU A 1 83  ? -3.626  -4.263  10.507  1.00 0.00 ? 83  GLU A HG2  5  
ATOM 8079  H HG3  . GLU A 1 83  ? -4.340  -3.043  11.560  1.00 0.00 ? 83  GLU A HG3  5  
ATOM 8080  N N    . TYR A 1 84  ? -5.736  -3.762  8.593   1.00 0.00 ? 84  TYR A N    5  
ATOM 8081  C CA   . TYR A 1 84  ? -5.557  -3.948  7.158   1.00 0.00 ? 84  TYR A CA   5  
ATOM 8082  C C    . TYR A 1 84  ? -4.184  -3.455  6.712   1.00 0.00 ? 84  TYR A C    5  
ATOM 8083  O O    . TYR A 1 84  ? -3.751  -2.365  7.088   1.00 0.00 ? 84  TYR A O    5  
ATOM 8084  C CB   . TYR A 1 84  ? -6.652  -3.209  6.387   1.00 0.00 ? 84  TYR A CB   5  
ATOM 8085  C CG   . TYR A 1 84  ? -8.021  -3.835  6.531   1.00 0.00 ? 84  TYR A CG   5  
ATOM 8086  C CD1  . TYR A 1 84  ? -8.428  -4.865  5.692   1.00 0.00 ? 84  TYR A CD1  5  
ATOM 8087  C CD2  . TYR A 1 84  ? -8.908  -3.396  7.507   1.00 0.00 ? 84  TYR A CD2  5  
ATOM 8088  C CE1  . TYR A 1 84  ? -9.678  -5.439  5.820   1.00 0.00 ? 84  TYR A CE1  5  
ATOM 8089  C CE2  . TYR A 1 84  ? -10.159 -3.965  7.643   1.00 0.00 ? 84  TYR A CE2  5  
ATOM 8090  C CZ   . TYR A 1 84  ? -10.540 -4.985  6.797   1.00 0.00 ? 84  TYR A CZ   5  
ATOM 8091  O OH   . TYR A 1 84  ? -11.786 -5.555  6.928   1.00 0.00 ? 84  TYR A OH   5  
ATOM 8092  H H    . TYR A 1 84  ? -5.338  -2.979  9.026   1.00 0.00 ? 84  TYR A H    5  
ATOM 8093  H HA   . TYR A 1 84  ? -5.633  -5.005  6.948   1.00 0.00 ? 84  TYR A HA   5  
ATOM 8094  H HB2  . TYR A 1 84  ? -6.713  -2.194  6.745   1.00 0.00 ? 84  TYR A HB2  5  
ATOM 8095  H HB3  . TYR A 1 84  ? -6.400  -3.201  5.336   1.00 0.00 ? 84  TYR A HB3  5  
ATOM 8096  H HD1  . TYR A 1 84  ? -7.750  -5.218  4.928   1.00 0.00 ? 84  TYR A HD1  5  
ATOM 8097  H HD2  . TYR A 1 84  ? -8.606  -2.596  8.168   1.00 0.00 ? 84  TYR A HD2  5  
ATOM 8098  H HE1  . TYR A 1 84  ? -9.976  -6.238  5.158   1.00 0.00 ? 84  TYR A HE1  5  
ATOM 8099  H HE2  . TYR A 1 84  ? -10.835 -3.610  8.407   1.00 0.00 ? 84  TYR A HE2  5  
ATOM 8100  H HH   . TYR A 1 84  ? -11.695 -6.444  7.279   1.00 0.00 ? 84  TYR A HH   5  
ATOM 8101  N N    . SER A 1 85  ? -3.504  -4.265  5.906   1.00 0.00 ? 85  SER A N    5  
ATOM 8102  C CA   . SER A 1 85  ? -2.179  -3.914  5.410   1.00 0.00 ? 85  SER A CA   5  
ATOM 8103  C C    . SER A 1 85  ? -2.277  -3.154  4.090   1.00 0.00 ? 85  SER A C    5  
ATOM 8104  O O    . SER A 1 85  ? -3.077  -3.497  3.221   1.00 0.00 ? 85  SER A O    5  
ATOM 8105  C CB   . SER A 1 85  ? -1.331  -5.173  5.224   1.00 0.00 ? 85  SER A CB   5  
ATOM 8106  O OG   . SER A 1 85  ? 0.051   -4.876  5.325   1.00 0.00 ? 85  SER A OG   5  
ATOM 8107  H H    . SER A 1 85  ? -3.903  -5.120  5.641   1.00 0.00 ? 85  SER A H    5  
ATOM 8108  H HA   . SER A 1 85  ? -1.708  -3.277  6.144   1.00 0.00 ? 85  SER A HA   5  
ATOM 8109  H HB2  . SER A 1 85  ? -1.588  -5.893  5.986   1.00 0.00 ? 85  SER A HB2  5  
ATOM 8110  H HB3  . SER A 1 85  ? -1.526  -5.595  4.249   1.00 0.00 ? 85  SER A HB3  5  
ATOM 8111  H HG   . SER A 1 85  ? 0.501   -5.168  4.528   1.00 0.00 ? 85  SER A HG   5  
ATOM 8112  N N    . PHE A 1 86  ? -1.456  -2.118  3.949   1.00 0.00 ? 86  PHE A N    5  
ATOM 8113  C CA   . PHE A 1 86  ? -1.449  -1.308  2.737   1.00 0.00 ? 86  PHE A CA   5  
ATOM 8114  C C    . PHE A 1 86  ? -0.022  -1.050  2.263   1.00 0.00 ? 86  PHE A C    5  
ATOM 8115  O O    . PHE A 1 86  ? 0.861   -0.735  3.060   1.00 0.00 ? 86  PHE A O    5  
ATOM 8116  C CB   . PHE A 1 86  ? -2.164  0.022   2.984   1.00 0.00 ? 86  PHE A CB   5  
ATOM 8117  C CG   . PHE A 1 86  ? -3.625  -0.132  3.298   1.00 0.00 ? 86  PHE A CG   5  
ATOM 8118  C CD1  . PHE A 1 86  ? -4.542  -0.378  2.290   1.00 0.00 ? 86  PHE A CD1  5  
ATOM 8119  C CD2  . PHE A 1 86  ? -4.080  -0.030  4.603   1.00 0.00 ? 86  PHE A CD2  5  
ATOM 8120  C CE1  . PHE A 1 86  ? -5.887  -0.520  2.577   1.00 0.00 ? 86  PHE A CE1  5  
ATOM 8121  C CE2  . PHE A 1 86  ? -5.424  -0.171  4.896   1.00 0.00 ? 86  PHE A CE2  5  
ATOM 8122  C CZ   . PHE A 1 86  ? -6.328  -0.417  3.882   1.00 0.00 ? 86  PHE A CZ   5  
ATOM 8123  H H    . PHE A 1 86  ? -0.840  -1.893  4.678   1.00 0.00 ? 86  PHE A H    5  
ATOM 8124  H HA   . PHE A 1 86  ? -1.977  -1.854  1.971   1.00 0.00 ? 86  PHE A HA   5  
ATOM 8125  H HB2  . PHE A 1 86  ? -1.697  0.525   3.817   1.00 0.00 ? 86  PHE A HB2  5  
ATOM 8126  H HB3  . PHE A 1 86  ? -2.077  0.639   2.102   1.00 0.00 ? 86  PHE A HB3  5  
ATOM 8127  H HD1  . PHE A 1 86  ? -4.199  -0.460  1.269   1.00 0.00 ? 86  PHE A HD1  5  
ATOM 8128  H HD2  . PHE A 1 86  ? -3.373  0.162   5.398   1.00 0.00 ? 86  PHE A HD2  5  
ATOM 8129  H HE1  . PHE A 1 86  ? -6.592  -0.713  1.782   1.00 0.00 ? 86  PHE A HE1  5  
ATOM 8130  H HE2  . PHE A 1 86  ? -5.765  -0.090  5.918   1.00 0.00 ? 86  PHE A HE2  5  
ATOM 8131  H HZ   . PHE A 1 86  ? -7.378  -0.527  4.108   1.00 0.00 ? 86  PHE A HZ   5  
ATOM 8132  N N    . ARG A 1 87  ? 0.196   -1.187  0.959   1.00 0.00 ? 87  ARG A N    5  
ATOM 8133  C CA   . ARG A 1 87  ? 1.515   -0.972  0.378   1.00 0.00 ? 87  ARG A CA   5  
ATOM 8134  C C    . ARG A 1 87  ? 1.404   -0.316  -0.995  1.00 0.00 ? 87  ARG A C    5  
ATOM 8135  O O    . ARG A 1 87  ? 0.549   -0.681  -1.802  1.00 0.00 ? 87  ARG A O    5  
ATOM 8136  C CB   . ARG A 1 87  ? 2.268   -2.299  0.261   1.00 0.00 ? 87  ARG A CB   5  
ATOM 8137  C CG   . ARG A 1 87  ? 1.580   -3.312  -0.639  1.00 0.00 ? 87  ARG A CG   5  
ATOM 8138  C CD   . ARG A 1 87  ? 2.534   -4.416  -1.067  1.00 0.00 ? 87  ARG A CD   5  
ATOM 8139  N NE   . ARG A 1 87  ? 2.594   -5.497  -0.087  1.00 0.00 ? 87  ARG A NE   5  
ATOM 8140  C CZ   . ARG A 1 87  ? 3.538   -6.432  -0.081  1.00 0.00 ? 87  ARG A CZ   5  
ATOM 8141  N NH1  . ARG A 1 87  ? 4.497   -6.417  -0.997  1.00 0.00 ? 87  ARG A NH1  5  
ATOM 8142  N NH2  . ARG A 1 87  ? 3.525   -7.384  0.844   1.00 0.00 ? 87  ARG A NH2  5  
ATOM 8143  H H    . ARG A 1 87  ? -0.549  -1.441  0.374   1.00 0.00 ? 87  ARG A H    5  
ATOM 8144  H HA   . ARG A 1 87  ? 2.064   -0.314  1.035   1.00 0.00 ? 87  ARG A HA   5  
ATOM 8145  H HB2  . ARG A 1 87  ? 3.253   -2.107  -0.138  1.00 0.00 ? 87  ARG A HB2  5  
ATOM 8146  H HB3  . ARG A 1 87  ? 2.364   -2.731  1.245   1.00 0.00 ? 87  ARG A HB3  5  
ATOM 8147  H HG2  . ARG A 1 87  ? 0.753   -3.754  -0.103  1.00 0.00 ? 87  ARG A HG2  5  
ATOM 8148  H HG3  . ARG A 1 87  ? 1.211   -2.806  -1.519  1.00 0.00 ? 87  ARG A HG3  5  
ATOM 8149  H HD2  . ARG A 1 87  ? 2.199   -4.817  -2.012  1.00 0.00 ? 87  ARG A HD2  5  
ATOM 8150  H HD3  . ARG A 1 87  ? 3.521   -3.994  -1.185  1.00 0.00 ? 87  ARG A HD3  5  
ATOM 8151  H HE   . ARG A 1 87  ? 1.896   -5.527  0.599   1.00 0.00 ? 87  ARG A HE   5  
ATOM 8152  H HH11 . ARG A 1 87  ? 4.509   -5.700  -1.694  1.00 0.00 ? 87  ARG A HH11 5  
ATOM 8153  H HH12 . ARG A 1 87  ? 5.207   -7.121  -0.989  1.00 0.00 ? 87  ARG A HH12 5  
ATOM 8154  H HH21 . ARG A 1 87  ? 2.805   -7.398  1.536   1.00 0.00 ? 87  ARG A HH21 5  
ATOM 8155  H HH22 . ARG A 1 87  ? 4.236   -8.086  0.847   1.00 0.00 ? 87  ARG A HH22 5  
ATOM 8156  N N    . VAL A 1 88  ? 2.274   0.655   -1.254  1.00 0.00 ? 88  VAL A N    5  
ATOM 8157  C CA   . VAL A 1 88  ? 2.274   1.362   -2.529  1.00 0.00 ? 88  VAL A CA   5  
ATOM 8158  C C    . VAL A 1 88  ? 3.515   1.021   -3.347  1.00 0.00 ? 88  VAL A C    5  
ATOM 8159  O O    . VAL A 1 88  ? 4.640   1.110   -2.855  1.00 0.00 ? 88  VAL A O    5  
ATOM 8160  C CB   . VAL A 1 88  ? 2.211   2.888   -2.325  1.00 0.00 ? 88  VAL A CB   5  
ATOM 8161  C CG1  . VAL A 1 88  ? 2.195   3.606   -3.666  1.00 0.00 ? 88  VAL A CG1  5  
ATOM 8162  C CG2  . VAL A 1 88  ? 0.993   3.264   -1.495  1.00 0.00 ? 88  VAL A CG2  5  
ATOM 8163  H H    . VAL A 1 88  ? 2.932   0.902   -0.571  1.00 0.00 ? 88  VAL A H    5  
ATOM 8164  H HA   . VAL A 1 88  ? 1.396   1.058   -3.080  1.00 0.00 ? 88  VAL A HA   5  
ATOM 8165  H HB   . VAL A 1 88  ? 3.096   3.196   -1.788  1.00 0.00 ? 88  VAL A HB   5  
ATOM 8166  H HG11 . VAL A 1 88  ? 1.187   3.921   -3.893  1.00 0.00 ? 88  VAL A HG11 5  
ATOM 8167  H HG12 . VAL A 1 88  ? 2.842   4.470   -3.620  1.00 0.00 ? 88  VAL A HG12 5  
ATOM 8168  H HG13 . VAL A 1 88  ? 2.544   2.935   -4.437  1.00 0.00 ? 88  VAL A HG13 5  
ATOM 8169  H HG21 . VAL A 1 88  ? 0.485   2.366   -1.176  1.00 0.00 ? 88  VAL A HG21 5  
ATOM 8170  H HG22 . VAL A 1 88  ? 1.308   3.826   -0.627  1.00 0.00 ? 88  VAL A HG22 5  
ATOM 8171  H HG23 . VAL A 1 88  ? 0.324   3.867   -2.090  1.00 0.00 ? 88  VAL A HG23 5  
ATOM 8172  N N    . VAL A 1 89  ? 3.302   0.630   -4.599  1.00 0.00 ? 89  VAL A N    5  
ATOM 8173  C CA   . VAL A 1 89  ? 4.403   0.276   -5.487  1.00 0.00 ? 89  VAL A CA   5  
ATOM 8174  C C    . VAL A 1 89  ? 4.402   1.147   -6.738  1.00 0.00 ? 89  VAL A C    5  
ATOM 8175  O O    . VAL A 1 89  ? 3.364   1.341   -7.370  1.00 0.00 ? 89  VAL A O    5  
ATOM 8176  C CB   . VAL A 1 89  ? 4.334   -1.205  -5.905  1.00 0.00 ? 89  VAL A CB   5  
ATOM 8177  C CG1  . VAL A 1 89  ? 5.455   -1.539  -6.877  1.00 0.00 ? 89  VAL A CG1  5  
ATOM 8178  C CG2  . VAL A 1 89  ? 4.391   -2.107  -4.682  1.00 0.00 ? 89  VAL A CG2  5  
ATOM 8179  H H    . VAL A 1 89  ? 2.383   0.579   -4.934  1.00 0.00 ? 89  VAL A H    5  
ATOM 8180  H HA   . VAL A 1 89  ? 5.328   0.434   -4.951  1.00 0.00 ? 89  VAL A HA   5  
ATOM 8181  H HB   . VAL A 1 89  ? 3.392   -1.372  -6.406  1.00 0.00 ? 89  VAL A HB   5  
ATOM 8182  H HG11 . VAL A 1 89  ? 5.033   -1.818  -7.831  1.00 0.00 ? 89  VAL A HG11 5  
ATOM 8183  H HG12 . VAL A 1 89  ? 6.092   -0.675  -7.002  1.00 0.00 ? 89  VAL A HG12 5  
ATOM 8184  H HG13 . VAL A 1 89  ? 6.036   -2.361  -6.486  1.00 0.00 ? 89  VAL A HG13 5  
ATOM 8185  H HG21 . VAL A 1 89  ? 5.378   -2.536  -4.598  1.00 0.00 ? 89  VAL A HG21 5  
ATOM 8186  H HG22 . VAL A 1 89  ? 4.174   -1.527  -3.796  1.00 0.00 ? 89  VAL A HG22 5  
ATOM 8187  H HG23 . VAL A 1 89  ? 3.661   -2.896  -4.782  1.00 0.00 ? 89  VAL A HG23 5  
ATOM 8188  N N    . ALA A 1 90  ? 5.572   1.669   -7.091  1.00 0.00 ? 90  ALA A N    5  
ATOM 8189  C CA   . ALA A 1 90  ? 5.707   2.517   -8.269  1.00 0.00 ? 90  ALA A CA   5  
ATOM 8190  C C    . ALA A 1 90  ? 5.964   1.683   -9.519  1.00 0.00 ? 90  ALA A C    5  
ATOM 8191  O O    . ALA A 1 90  ? 6.756   0.742   -9.497  1.00 0.00 ? 90  ALA A O    5  
ATOM 8192  C CB   . ALA A 1 90  ? 6.826   3.527   -8.066  1.00 0.00 ? 90  ALA A CB   5  
ATOM 8193  H H    . ALA A 1 90  ? 6.364   1.477   -6.547  1.00 0.00 ? 90  ALA A H    5  
ATOM 8194  H HA   . ALA A 1 90  ? 4.782   3.062   -8.395  1.00 0.00 ? 90  ALA A HA   5  
ATOM 8195  H HB1  . ALA A 1 90  ? 7.178   3.473   -7.046  1.00 0.00 ? 90  ALA A HB1  5  
ATOM 8196  H HB2  . ALA A 1 90  ? 7.639   3.304   -8.741  1.00 0.00 ? 90  ALA A HB2  5  
ATOM 8197  H HB3  . ALA A 1 90  ? 6.454   4.521   -8.266  1.00 0.00 ? 90  ALA A HB3  5  
ATOM 8198  N N    . TYR A 1 91  ? 5.289   2.035   -10.608 1.00 0.00 ? 91  TYR A N    5  
ATOM 8199  C CA   . TYR A 1 91  ? 5.442   1.317   -11.868 1.00 0.00 ? 91  TYR A CA   5  
ATOM 8200  C C    . TYR A 1 91  ? 5.855   2.265   -12.989 1.00 0.00 ? 91  TYR A C    5  
ATOM 8201  O O    . TYR A 1 91  ? 5.061   3.085   -13.448 1.00 0.00 ? 91  TYR A O    5  
ATOM 8202  C CB   . TYR A 1 91  ? 4.137   0.610   -12.238 1.00 0.00 ? 91  TYR A CB   5  
ATOM 8203  C CG   . TYR A 1 91  ? 3.903   -0.671  -11.469 1.00 0.00 ? 91  TYR A CG   5  
ATOM 8204  C CD1  . TYR A 1 91  ? 4.380   -1.886  -11.944 1.00 0.00 ? 91  TYR A CD1  5  
ATOM 8205  C CD2  . TYR A 1 91  ? 3.204   -0.666  -10.268 1.00 0.00 ? 91  TYR A CD2  5  
ATOM 8206  C CE1  . TYR A 1 91  ? 4.168   -3.059  -11.245 1.00 0.00 ? 91  TYR A CE1  5  
ATOM 8207  C CE2  . TYR A 1 91  ? 2.989   -1.833  -9.562  1.00 0.00 ? 91  TYR A CE2  5  
ATOM 8208  C CZ   . TYR A 1 91  ? 3.472   -3.027  -10.054 1.00 0.00 ? 91  TYR A CZ   5  
ATOM 8209  O OH   . TYR A 1 91  ? 3.259   -4.193  -9.355  1.00 0.00 ? 91  TYR A OH   5  
ATOM 8210  H H    . TYR A 1 91  ? 4.671   2.795   -10.563 1.00 0.00 ? 91  TYR A H    5  
ATOM 8211  H HA   . TYR A 1 91  ? 6.216   0.576   -11.735 1.00 0.00 ? 91  TYR A HA   5  
ATOM 8212  H HB2  . TYR A 1 91  ? 3.308   1.271   -12.039 1.00 0.00 ? 91  TYR A HB2  5  
ATOM 8213  H HB3  . TYR A 1 91  ? 4.153   0.367   -13.290 1.00 0.00 ? 91  TYR A HB3  5  
ATOM 8214  H HD1  . TYR A 1 91  ? 4.925   -1.908  -12.876 1.00 0.00 ? 91  TYR A HD1  5  
ATOM 8215  H HD2  . TYR A 1 91  ? 2.826   0.271   -9.885  1.00 0.00 ? 91  TYR A HD2  5  
ATOM 8216  H HE1  . TYR A 1 91  ? 4.547   -3.994  -11.630 1.00 0.00 ? 91  TYR A HE1  5  
ATOM 8217  H HE2  . TYR A 1 91  ? 2.443   -1.809  -8.630  1.00 0.00 ? 91  TYR A HE2  5  
ATOM 8218  H HH   . TYR A 1 91  ? 3.548   -4.078  -8.446  1.00 0.00 ? 91  TYR A HH   5  
ATOM 8219  N N    . ASN A 1 92  ? 7.105   2.147   -13.424 1.00 0.00 ? 92  ASN A N    5  
ATOM 8220  C CA   . ASN A 1 92  ? 7.626   2.993   -14.492 1.00 0.00 ? 92  ASN A CA   5  
ATOM 8221  C C    . ASN A 1 92  ? 7.704   2.223   -15.807 1.00 0.00 ? 92  ASN A C    5  
ATOM 8222  O O    . ASN A 1 92  ? 7.743   0.993   -15.818 1.00 0.00 ? 92  ASN A O    5  
ATOM 8223  C CB   . ASN A 1 92  ? 9.010   3.528   -14.118 1.00 0.00 ? 92  ASN A CB   5  
ATOM 8224  C CG   . ASN A 1 92  ? 8.938   4.833   -13.351 1.00 0.00 ? 92  ASN A CG   5  
ATOM 8225  O OD1  . ASN A 1 92  ? 7.943   5.555   -13.425 1.00 0.00 ? 92  ASN A OD1  5  
ATOM 8226  N ND2  . ASN A 1 92  ? 9.994   5.143   -12.609 1.00 0.00 ? 92  ASN A ND2  5  
ATOM 8227  H H    . ASN A 1 92  ? 7.692   1.475   -13.019 1.00 0.00 ? 92  ASN A H    5  
ATOM 8228  H HA   . ASN A 1 92  ? 6.950   3.825   -14.615 1.00 0.00 ? 92  ASN A HA   5  
ATOM 8229  H HB2  . ASN A 1 92  ? 9.517   2.798   -13.503 1.00 0.00 ? 92  ASN A HB2  5  
ATOM 8230  H HB3  . ASN A 1 92  ? 9.582   3.691   -15.019 1.00 0.00 ? 92  ASN A HB3  5  
ATOM 8231  H HD21 . ASN A 1 92  ? 10.751  4.520   -12.598 1.00 0.00 ? 92  ASN A HD21 5  
ATOM 8232  H HD22 . ASN A 1 92  ? 9.974   5.981   -12.102 1.00 0.00 ? 92  ASN A HD22 5  
ATOM 8233  N N    . LYS A 1 93  ? 7.727   2.957   -16.915 1.00 0.00 ? 93  LYS A N    5  
ATOM 8234  C CA   . LYS A 1 93  ? 7.802   2.345   -18.236 1.00 0.00 ? 93  LYS A CA   5  
ATOM 8235  C C    . LYS A 1 93  ? 8.808   1.199   -18.249 1.00 0.00 ? 93  LYS A C    5  
ATOM 8236  O O    . LYS A 1 93  ? 8.661   0.239   -19.006 1.00 0.00 ? 93  LYS A O    5  
ATOM 8237  C CB   . LYS A 1 93  ? 8.192   3.391   -19.283 1.00 0.00 ? 93  LYS A CB   5  
ATOM 8238  C CG   . LYS A 1 93  ? 9.606   3.921   -19.117 1.00 0.00 ? 93  LYS A CG   5  
ATOM 8239  C CD   . LYS A 1 93  ? 9.782   5.265   -19.804 1.00 0.00 ? 93  LYS A CD   5  
ATOM 8240  C CE   . LYS A 1 93  ? 9.868   5.112   -21.315 1.00 0.00 ? 93  LYS A CE   5  
ATOM 8241  N NZ   . LYS A 1 93  ? 10.679  6.196   -21.936 1.00 0.00 ? 93  LYS A NZ   5  
ATOM 8242  H H    . LYS A 1 93  ? 7.693   3.934   -16.842 1.00 0.00 ? 93  LYS A H    5  
ATOM 8243  H HA   . LYS A 1 93  ? 6.825   1.954   -18.477 1.00 0.00 ? 93  LYS A HA   5  
ATOM 8244  H HB2  . LYS A 1 93  ? 8.108   2.949   -20.265 1.00 0.00 ? 93  LYS A HB2  5  
ATOM 8245  H HB3  . LYS A 1 93  ? 7.507   4.224   -19.214 1.00 0.00 ? 93  LYS A HB3  5  
ATOM 8246  H HG2  . LYS A 1 93  ? 9.816   4.036   -18.065 1.00 0.00 ? 93  LYS A HG2  5  
ATOM 8247  H HG3  . LYS A 1 93  ? 10.299  3.212   -19.549 1.00 0.00 ? 93  LYS A HG3  5  
ATOM 8248  H HD2  . LYS A 1 93  ? 8.938   5.895   -19.565 1.00 0.00 ? 93  LYS A HD2  5  
ATOM 8249  H HD3  . LYS A 1 93  ? 10.691  5.726   -19.445 1.00 0.00 ? 93  LYS A HD3  5  
ATOM 8250  H HE2  . LYS A 1 93  ? 10.322  4.159   -21.542 1.00 0.00 ? 93  LYS A HE2  5  
ATOM 8251  H HE3  . LYS A 1 93  ? 8.869   5.141   -21.724 1.00 0.00 ? 93  LYS A HE3  5  
ATOM 8252  H HZ1  . LYS A 1 93  ? 11.308  6.623   -21.227 1.00 0.00 ? 93  LYS A HZ1  5  
ATOM 8253  H HZ2  . LYS A 1 93  ? 10.055  6.934   -22.319 1.00 0.00 ? 93  LYS A HZ2  5  
ATOM 8254  H HZ3  . LYS A 1 93  ? 11.257  5.810   -22.710 1.00 0.00 ? 93  LYS A HZ3  5  
ATOM 8255  N N    . HIS A 1 94  ? 9.830   1.305   -17.405 1.00 0.00 ? 94  HIS A N    5  
ATOM 8256  C CA   . HIS A 1 94  ? 10.859  0.275   -17.318 1.00 0.00 ? 94  HIS A CA   5  
ATOM 8257  C C    . HIS A 1 94  ? 10.350  -0.939  -16.547 1.00 0.00 ? 94  HIS A C    5  
ATOM 8258  O O    . HIS A 1 94  ? 10.241  -2.035  -17.096 1.00 0.00 ? 94  HIS A O    5  
ATOM 8259  C CB   . HIS A 1 94  ? 12.113  0.833   -16.643 1.00 0.00 ? 94  HIS A CB   5  
ATOM 8260  C CG   . HIS A 1 94  ? 12.491  2.201   -17.121 1.00 0.00 ? 94  HIS A CG   5  
ATOM 8261  N ND1  . HIS A 1 94  ? 13.171  2.426   -18.299 1.00 0.00 ? 94  HIS A ND1  5  
ATOM 8262  C CD2  . HIS A 1 94  ? 12.279  3.420   -16.572 1.00 0.00 ? 94  HIS A CD2  5  
ATOM 8263  C CE1  . HIS A 1 94  ? 13.363  3.724   -18.453 1.00 0.00 ? 94  HIS A CE1  5  
ATOM 8264  N NE2  . HIS A 1 94  ? 12.831  4.350   -17.419 1.00 0.00 ? 94  HIS A NE2  5  
ATOM 8265  H H    . HIS A 1 94  ? 9.892   2.093   -16.827 1.00 0.00 ? 94  HIS A H    5  
ATOM 8266  H HA   . HIS A 1 94  ? 11.108  -0.031  -18.323 1.00 0.00 ? 94  HIS A HA   5  
ATOM 8267  H HB2  . HIS A 1 94  ? 11.945  0.889   -15.578 1.00 0.00 ? 94  HIS A HB2  5  
ATOM 8268  H HB3  . HIS A 1 94  ? 12.944  0.171   -16.838 1.00 0.00 ? 94  HIS A HB3  5  
ATOM 8269  H HD1  . HIS A 1 94  ? 13.471  1.736   -18.927 1.00 0.00 ? 94  HIS A HD1  5  
ATOM 8270  H HD2  . HIS A 1 94  ? 11.771  3.625   -15.640 1.00 0.00 ? 94  HIS A HD2  5  
ATOM 8271  H HE1  . HIS A 1 94  ? 13.868  4.194   -19.284 1.00 0.00 ? 94  HIS A HE1  5  
ATOM 8272  H HE2  . HIS A 1 94  ? 12.906  5.310   -17.241 1.00 0.00 ? 94  HIS A HE2  5  
ATOM 8273  N N    . GLY A 1 95  ? 10.039  -0.736  -15.270 1.00 0.00 ? 95  GLY A N    5  
ATOM 8274  C CA   . GLY A 1 95  ? 9.546   -1.822  -14.445 1.00 0.00 ? 95  GLY A CA   5  
ATOM 8275  C C    . GLY A 1 95  ? 9.294   -1.394  -13.012 1.00 0.00 ? 95  GLY A C    5  
ATOM 8276  O O    . GLY A 1 95  ? 9.637   -0.285  -12.604 1.00 0.00 ? 95  GLY A O    5  
ATOM 8277  H H    . GLY A 1 95  ? 10.145  0.160   -14.886 1.00 0.00 ? 95  GLY A H    5  
ATOM 8278  H HA2  . GLY A 1 95  ? 8.622   -2.190  -14.867 1.00 0.00 ? 95  GLY A HA2  5  
ATOM 8279  H HA3  . GLY A 1 95  ? 10.274  -2.620  -14.447 1.00 0.00 ? 95  GLY A HA3  5  
ATOM 8280  N N    . PRO A 1 96  ? 8.679   -2.288  -12.223 1.00 0.00 ? 96  PRO A N    5  
ATOM 8281  C CA   . PRO A 1 96  ? 8.367   -2.019  -10.816 1.00 0.00 ? 96  PRO A CA   5  
ATOM 8282  C C    . PRO A 1 96  ? 9.618   -1.963  -9.945  1.00 0.00 ? 96  PRO A C    5  
ATOM 8283  O O    . PRO A 1 96  ? 10.302  -2.968  -9.760  1.00 0.00 ? 96  PRO A O    5  
ATOM 8284  C CB   . PRO A 1 96  ? 7.488   -3.205  -10.414 1.00 0.00 ? 96  PRO A CB   5  
ATOM 8285  C CG   . PRO A 1 96  ? 7.880   -4.300  -11.346 1.00 0.00 ? 96  PRO A CG   5  
ATOM 8286  C CD   . PRO A 1 96  ? 8.242   -3.630  -12.643 1.00 0.00 ? 96  PRO A CD   5  
ATOM 8287  H HA   . PRO A 1 96  ? 7.809   -1.100  -10.702 1.00 0.00 ? 96  PRO A HA   5  
ATOM 8288  H HB2  . PRO A 1 96  ? 7.686   -3.471  -9.386  1.00 0.00 ? 96  PRO A HB2  5  
ATOM 8289  H HB3  . PRO A 1 96  ? 6.447   -2.943  -10.530 1.00 0.00 ? 96  PRO A HB3  5  
ATOM 8290  H HG2  . PRO A 1 96  ? 8.731   -4.833  -10.949 1.00 0.00 ? 96  PRO A HG2  5  
ATOM 8291  H HG3  . PRO A 1 96  ? 7.048   -4.973  -11.492 1.00 0.00 ? 96  PRO A HG3  5  
ATOM 8292  H HD2  . PRO A 1 96  ? 9.045   -4.162  -13.131 1.00 0.00 ? 96  PRO A HD2  5  
ATOM 8293  H HD3  . PRO A 1 96  ? 7.379   -3.569  -13.290 1.00 0.00 ? 96  PRO A HD3  5  
ATOM 8294  N N    . GLY A 1 97  ? 9.910   -0.780  -9.412  1.00 0.00 ? 97  GLY A N    5  
ATOM 8295  C CA   . GLY A 1 97  ? 11.078  -0.616  -8.567  1.00 0.00 ? 97  GLY A CA   5  
ATOM 8296  C C    . GLY A 1 97  ? 10.973  -1.401  -7.274  1.00 0.00 ? 97  GLY A C    5  
ATOM 8297  O O    . GLY A 1 97  ? 10.941  -2.632  -7.287  1.00 0.00 ? 97  GLY A O    5  
ATOM 8298  H H    . GLY A 1 97  ? 9.328   -0.013  -9.595  1.00 0.00 ? 97  GLY A H    5  
ATOM 8299  H HA2  . GLY A 1 97  ? 11.951  -0.950  -9.108  1.00 0.00 ? 97  GLY A HA2  5  
ATOM 8300  H HA3  . GLY A 1 97  ? 11.193  0.431   -8.330  1.00 0.00 ? 97  GLY A HA3  5  
ATOM 8301  N N    . VAL A 1 98  ? 10.922  -0.688  -6.154  1.00 0.00 ? 98  VAL A N    5  
ATOM 8302  C CA   . VAL A 1 98  ? 10.820  -1.325  -4.846  1.00 0.00 ? 98  VAL A CA   5  
ATOM 8303  C C    . VAL A 1 98  ? 9.379   -1.334  -4.349  1.00 0.00 ? 98  VAL A C    5  
ATOM 8304  O O    . VAL A 1 98  ? 8.465   -0.911  -5.057  1.00 0.00 ? 98  VAL A O    5  
ATOM 8305  C CB   . VAL A 1 98  ? 11.706  -0.615  -3.805  1.00 0.00 ? 98  VAL A CB   5  
ATOM 8306  C CG1  . VAL A 1 98  ? 13.150  -0.558  -4.282  1.00 0.00 ? 98  VAL A CG1  5  
ATOM 8307  C CG2  . VAL A 1 98  ? 11.175  0.781   -3.519  1.00 0.00 ? 98  VAL A CG2  5  
ATOM 8308  H H    . VAL A 1 98  ? 10.952  0.290   -6.207  1.00 0.00 ? 98  VAL A H    5  
ATOM 8309  H HA   . VAL A 1 98  ? 11.164  -2.345  -4.944  1.00 0.00 ? 98  VAL A HA   5  
ATOM 8310  H HB   . VAL A 1 98  ? 11.676  -1.184  -2.888  1.00 0.00 ? 98  VAL A HB   5  
ATOM 8311  H HG11 . VAL A 1 98  ? 13.343  0.407   -4.727  1.00 0.00 ? 98  VAL A HG11 5  
ATOM 8312  H HG12 . VAL A 1 98  ? 13.813  -0.709  -3.443  1.00 0.00 ? 98  VAL A HG12 5  
ATOM 8313  H HG13 . VAL A 1 98  ? 13.316  -1.332  -5.017  1.00 0.00 ? 98  VAL A HG13 5  
ATOM 8314  H HG21 . VAL A 1 98  ? 10.096  0.768   -3.546  1.00 0.00 ? 98  VAL A HG21 5  
ATOM 8315  H HG22 . VAL A 1 98  ? 11.506  1.099   -2.540  1.00 0.00 ? 98  VAL A HG22 5  
ATOM 8316  H HG23 . VAL A 1 98  ? 11.547  1.468   -4.264  1.00 0.00 ? 98  VAL A HG23 5  
ATOM 8317  N N    . SER A 1 99  ? 9.183   -1.818  -3.127  1.00 0.00 ? 99  SER A N    5  
ATOM 8318  C CA   . SER A 1 99  ? 7.852   -1.886  -2.535  1.00 0.00 ? 99  SER A CA   5  
ATOM 8319  C C    . SER A 1 99  ? 7.863   -1.341  -1.110  1.00 0.00 ? 99  SER A C    5  
ATOM 8320  O O    . SER A 1 99  ? 8.610   -1.818  -0.256  1.00 0.00 ? 99  SER A O    5  
ATOM 8321  C CB   . SER A 1 99  ? 7.342   -3.328  -2.539  1.00 0.00 ? 99  SER A CB   5  
ATOM 8322  O OG   . SER A 1 99  ? 6.147   -3.448  -1.787  1.00 0.00 ? 99  SER A OG   5  
ATOM 8323  H H    . SER A 1 99  ? 9.953   -2.141  -2.612  1.00 0.00 ? 99  SER A H    5  
ATOM 8324  H HA   . SER A 1 99  ? 7.192   -1.278  -3.136  1.00 0.00 ? 99  SER A HA   5  
ATOM 8325  H HB2  . SER A 1 99  ? 7.146   -3.635  -3.555  1.00 0.00 ? 99  SER A HB2  5  
ATOM 8326  H HB3  . SER A 1 99  ? 8.092   -3.973  -2.105  1.00 0.00 ? 99  SER A HB3  5  
ATOM 8327  H HG   . SER A 1 99  ? 5.694   -2.601  -1.768  1.00 0.00 ? 99  SER A HG   5  
ATOM 8328  N N    . THR A 1 100 ? 7.027   -0.338  -0.860  1.00 0.00 ? 100 THR A N    5  
ATOM 8329  C CA   . THR A 1 100 ? 6.940   0.274   0.460   1.00 0.00 ? 100 THR A CA   5  
ATOM 8330  C C    . THR A 1 100 ? 6.648   -0.771  1.531   1.00 0.00 ? 100 THR A C    5  
ATOM 8331  O O    . THR A 1 100 ? 6.098   -1.838  1.258   1.00 0.00 ? 100 THR A O    5  
ATOM 8332  C CB   . THR A 1 100 ? 5.848   1.359   0.505   1.00 0.00 ? 100 THR A CB   5  
ATOM 8333  O OG1  . THR A 1 100 ? 4.778   1.015   -0.383  1.00 0.00 ? 100 THR A OG1  5  
ATOM 8334  C CG2  . THR A 1 100 ? 6.418   2.716   0.120   1.00 0.00 ? 100 THR A CG2  5  
ATOM 8335  H H    . THR A 1 100 ? 6.457   -0.001  -1.583  1.00 0.00 ? 100 THR A H    5  
ATOM 8336  H HA   . THR A 1 100 ? 7.891   0.740   0.675   1.00 0.00 ? 100 THR A HA   5  
ATOM 8337  H HB   . THR A 1 100 ? 5.464   1.420   1.513   1.00 0.00 ? 100 THR A HB   5  
ATOM 8338  H HG1  . THR A 1 100 ? 4.680   0.060   -0.411  1.00 0.00 ? 100 THR A HG1  5  
ATOM 8339  H HG21 . THR A 1 100 ? 7.470   2.615   -0.100  1.00 0.00 ? 100 THR A HG21 5  
ATOM 8340  H HG22 . THR A 1 100 ? 6.285   3.408   0.938   1.00 0.00 ? 100 THR A HG22 5  
ATOM 8341  H HG23 . THR A 1 100 ? 5.902   3.087   -0.753  1.00 0.00 ? 100 THR A HG23 5  
ATOM 8342  N N    . PRO A 1 101 ? 7.022   -0.459  2.781   1.00 0.00 ? 101 PRO A N    5  
ATOM 8343  C CA   . PRO A 1 101 ? 6.808   -1.357  3.919   1.00 0.00 ? 101 PRO A CA   5  
ATOM 8344  C C    . PRO A 1 101 ? 5.334   -1.485  4.288   1.00 0.00 ? 101 PRO A C    5  
ATOM 8345  O O    . PRO A 1 101 ? 4.617   -0.488  4.372   1.00 0.00 ? 101 PRO A O    5  
ATOM 8346  C CB   . PRO A 1 101 ? 7.587   -0.685  5.053   1.00 0.00 ? 101 PRO A CB   5  
ATOM 8347  C CG   . PRO A 1 101 ? 7.628   0.757   4.681   1.00 0.00 ? 101 PRO A CG   5  
ATOM 8348  C CD   . PRO A 1 101 ? 7.682   0.796   3.179   1.00 0.00 ? 101 PRO A CD   5  
ATOM 8349  H HA   . PRO A 1 101 ? 7.218   -2.339  3.731   1.00 0.00 ? 101 PRO A HA   5  
ATOM 8350  H HB2  . PRO A 1 101 ? 7.068   -0.838  5.989   1.00 0.00 ? 101 PRO A HB2  5  
ATOM 8351  H HB3  . PRO A 1 101 ? 8.579   -1.106  5.111   1.00 0.00 ? 101 PRO A HB3  5  
ATOM 8352  H HG2  . PRO A 1 101 ? 6.738   1.253   5.037   1.00 0.00 ? 101 PRO A HG2  5  
ATOM 8353  H HG3  . PRO A 1 101 ? 8.510   1.219   5.100   1.00 0.00 ? 101 PRO A HG3  5  
ATOM 8354  H HD2  . PRO A 1 101 ? 7.141   1.652   2.804   1.00 0.00 ? 101 PRO A HD2  5  
ATOM 8355  H HD3  . PRO A 1 101 ? 8.707   0.816   2.839   1.00 0.00 ? 101 PRO A HD3  5  
ATOM 8356  N N    . ASP A 1 102 ? 4.889   -2.717  4.507   1.00 0.00 ? 102 ASP A N    5  
ATOM 8357  C CA   . ASP A 1 102 ? 3.500   -2.975  4.869   1.00 0.00 ? 102 ASP A CA   5  
ATOM 8358  C C    . ASP A 1 102 ? 3.008   -1.959  5.895   1.00 0.00 ? 102 ASP A C    5  
ATOM 8359  O O    . ASP A 1 102 ? 3.675   -1.700  6.896   1.00 0.00 ? 102 ASP A O    5  
ATOM 8360  C CB   . ASP A 1 102 ? 3.350   -4.393  5.423   1.00 0.00 ? 102 ASP A CB   5  
ATOM 8361  C CG   . ASP A 1 102 ? 3.941   -5.441  4.501   1.00 0.00 ? 102 ASP A CG   5  
ATOM 8362  O OD1  . ASP A 1 102 ? 3.530   -5.494  3.323   1.00 0.00 ? 102 ASP A OD1  5  
ATOM 8363  O OD2  . ASP A 1 102 ? 4.813   -6.209  4.958   1.00 0.00 ? 102 ASP A OD2  5  
ATOM 8364  H H    . ASP A 1 102 ? 5.509   -3.472  4.424   1.00 0.00 ? 102 ASP A H    5  
ATOM 8365  H HA   . ASP A 1 102 ? 2.902   -2.883  3.974   1.00 0.00 ? 102 ASP A HA   5  
ATOM 8366  H HB2  . ASP A 1 102 ? 3.853   -4.454  6.377   1.00 0.00 ? 102 ASP A HB2  5  
ATOM 8367  H HB3  . ASP A 1 102 ? 2.300   -4.609  5.560   1.00 0.00 ? 102 ASP A HB3  5  
ATOM 8368  N N    . VAL A 1 103 ? 1.836   -1.386  5.638   1.00 0.00 ? 103 VAL A N    5  
ATOM 8369  C CA   . VAL A 1 103 ? 1.254   -0.398  6.539   1.00 0.00 ? 103 VAL A CA   5  
ATOM 8370  C C    . VAL A 1 103 ? -0.049  -0.908  7.145   1.00 0.00 ? 103 VAL A C    5  
ATOM 8371  O O    . VAL A 1 103 ? -1.135  -0.586  6.666   1.00 0.00 ? 103 VAL A O    5  
ATOM 8372  C CB   . VAL A 1 103 ? 0.984   0.933   5.813   1.00 0.00 ? 103 VAL A CB   5  
ATOM 8373  C CG1  . VAL A 1 103 ? 0.359   1.942   6.764   1.00 0.00 ? 103 VAL A CG1  5  
ATOM 8374  C CG2  . VAL A 1 103 ? 2.269   1.481   5.210   1.00 0.00 ? 103 VAL A CG2  5  
ATOM 8375  H H    . VAL A 1 103 ? 1.351   -1.634  4.823   1.00 0.00 ? 103 VAL A H    5  
ATOM 8376  H HA   . VAL A 1 103 ? 1.962   -0.214  7.334   1.00 0.00 ? 103 VAL A HA   5  
ATOM 8377  H HB   . VAL A 1 103 ? 0.286   0.747   5.010   1.00 0.00 ? 103 VAL A HB   5  
ATOM 8378  H HG11 . VAL A 1 103 ? 1.107   2.659   7.069   1.00 0.00 ? 103 VAL A HG11 5  
ATOM 8379  H HG12 . VAL A 1 103 ? -0.450  2.455   6.264   1.00 0.00 ? 103 VAL A HG12 5  
ATOM 8380  H HG13 . VAL A 1 103 ? -0.023  1.428   7.634   1.00 0.00 ? 103 VAL A HG13 5  
ATOM 8381  H HG21 . VAL A 1 103 ? 2.465   2.463   5.614   1.00 0.00 ? 103 VAL A HG21 5  
ATOM 8382  H HG22 . VAL A 1 103 ? 3.091   0.822   5.452   1.00 0.00 ? 103 VAL A HG22 5  
ATOM 8383  H HG23 . VAL A 1 103 ? 2.165   1.547   4.138   1.00 0.00 ? 103 VAL A HG23 5  
ATOM 8384  N N    . ALA A 1 104 ? 0.068   -1.704  8.202   1.00 0.00 ? 104 ALA A N    5  
ATOM 8385  C CA   . ALA A 1 104 ? -1.100  -2.256  8.876   1.00 0.00 ? 104 ALA A CA   5  
ATOM 8386  C C    . ALA A 1 104 ? -1.798  -1.197  9.722   1.00 0.00 ? 104 ALA A C    5  
ATOM 8387  O O    . ALA A 1 104 ? -1.192  -0.601  10.613  1.00 0.00 ? 104 ALA A O    5  
ATOM 8388  C CB   . ALA A 1 104 ? -0.700  -3.444  9.739   1.00 0.00 ? 104 ALA A CB   5  
ATOM 8389  H H    . ALA A 1 104 ? 0.962   -1.925  8.538   1.00 0.00 ? 104 ALA A H    5  
ATOM 8390  H HA   . ALA A 1 104 ? -1.787  -2.608  8.119   1.00 0.00 ? 104 ALA A HA   5  
ATOM 8391  H HB1  . ALA A 1 104 ? 0.241   -3.233  10.226  1.00 0.00 ? 104 ALA A HB1  5  
ATOM 8392  H HB2  . ALA A 1 104 ? -1.461  -3.619  10.485  1.00 0.00 ? 104 ALA A HB2  5  
ATOM 8393  H HB3  . ALA A 1 104 ? -0.596  -4.321  9.117   1.00 0.00 ? 104 ALA A HB3  5  
ATOM 8394  N N    . VAL A 1 105 ? -3.075  -0.965  9.436   1.00 0.00 ? 105 VAL A N    5  
ATOM 8395  C CA   . VAL A 1 105 ? -3.855  0.024   10.172  1.00 0.00 ? 105 VAL A CA   5  
ATOM 8396  C C    . VAL A 1 105 ? -5.194  -0.554  10.617  1.00 0.00 ? 105 VAL A C    5  
ATOM 8397  O O    . VAL A 1 105 ? -5.798  -1.363  9.913   1.00 0.00 ? 105 VAL A O    5  
ATOM 8398  C CB   . VAL A 1 105 ? -4.109  1.283   9.322   1.00 0.00 ? 105 VAL A CB   5  
ATOM 8399  C CG1  . VAL A 1 105 ? -5.069  0.975   8.183   1.00 0.00 ? 105 VAL A CG1  5  
ATOM 8400  C CG2  . VAL A 1 105 ? -4.644  2.412   10.190  1.00 0.00 ? 105 VAL A CG2  5  
ATOM 8401  H H    . VAL A 1 105 ? -3.503  -1.471  8.715   1.00 0.00 ? 105 VAL A H    5  
ATOM 8402  H HA   . VAL A 1 105 ? -3.290  0.313   11.046  1.00 0.00 ? 105 VAL A HA   5  
ATOM 8403  H HB   . VAL A 1 105 ? -3.169  1.600   8.895   1.00 0.00 ? 105 VAL A HB   5  
ATOM 8404  H HG11 . VAL A 1 105 ? -5.898  0.392   8.559   1.00 0.00 ? 105 VAL A HG11 5  
ATOM 8405  H HG12 . VAL A 1 105 ? -5.439  1.899   7.763   1.00 0.00 ? 105 VAL A HG12 5  
ATOM 8406  H HG13 . VAL A 1 105 ? -4.552  0.413   7.419   1.00 0.00 ? 105 VAL A HG13 5  
ATOM 8407  H HG21 . VAL A 1 105 ? -5.720  2.338   10.253  1.00 0.00 ? 105 VAL A HG21 5  
ATOM 8408  H HG22 . VAL A 1 105 ? -4.220  2.337   11.181  1.00 0.00 ? 105 VAL A HG22 5  
ATOM 8409  H HG23 . VAL A 1 105 ? -4.373  3.362   9.755   1.00 0.00 ? 105 VAL A HG23 5  
ATOM 8410  N N    . ARG A 1 106 ? -5.653  -0.132  11.791  1.00 0.00 ? 106 ARG A N    5  
ATOM 8411  C CA   . ARG A 1 106 ? -6.921  -0.608  12.331  1.00 0.00 ? 106 ARG A CA   5  
ATOM 8412  C C    . ARG A 1 106 ? -8.019  0.433   12.138  1.00 0.00 ? 106 ARG A C    5  
ATOM 8413  O O    . ARG A 1 106 ? -7.834  1.612   12.445  1.00 0.00 ? 106 ARG A O    5  
ATOM 8414  C CB   . ARG A 1 106 ? -6.773  -0.940  13.817  1.00 0.00 ? 106 ARG A CB   5  
ATOM 8415  C CG   . ARG A 1 106 ? -7.801  -1.940  14.323  1.00 0.00 ? 106 ARG A CG   5  
ATOM 8416  C CD   . ARG A 1 106 ? -8.035  -1.791  15.818  1.00 0.00 ? 106 ARG A CD   5  
ATOM 8417  N NE   . ARG A 1 106 ? -6.858  -2.167  16.596  1.00 0.00 ? 106 ARG A NE   5  
ATOM 8418  C CZ   . ARG A 1 106 ? -6.410  -3.413  16.696  1.00 0.00 ? 106 ARG A CZ   5  
ATOM 8419  N NH1  . ARG A 1 106 ? -7.037  -4.399  16.068  1.00 0.00 ? 106 ARG A NH1  5  
ATOM 8420  N NH2  . ARG A 1 106 ? -5.332  -3.676  17.423  1.00 0.00 ? 106 ARG A NH2  5  
ATOM 8421  H H    . ARG A 1 106 ? -5.126  0.514   12.306  1.00 0.00 ? 106 ARG A H    5  
ATOM 8422  H HA   . ARG A 1 106 ? -7.194  -1.505  11.796  1.00 0.00 ? 106 ARG A HA   5  
ATOM 8423  H HB2  . ARG A 1 106 ? -5.789  -1.352  13.987  1.00 0.00 ? 106 ARG A HB2  5  
ATOM 8424  H HB3  . ARG A 1 106 ? -6.877  -0.030  14.389  1.00 0.00 ? 106 ARG A HB3  5  
ATOM 8425  H HG2  . ARG A 1 106 ? -8.734  -1.775  13.805  1.00 0.00 ? 106 ARG A HG2  5  
ATOM 8426  H HG3  . ARG A 1 106 ? -7.446  -2.940  14.120  1.00 0.00 ? 106 ARG A HG3  5  
ATOM 8427  H HD2  . ARG A 1 106 ? -8.280  -0.761  16.029  1.00 0.00 ? 106 ARG A HD2  5  
ATOM 8428  H HD3  . ARG A 1 106 ? -8.862  -2.423  16.104  1.00 0.00 ? 106 ARG A HD3  5  
ATOM 8429  H HE   . ARG A 1 106 ? -6.379  -1.454  17.068  1.00 0.00 ? 106 ARG A HE   5  
ATOM 8430  H HH11 . ARG A 1 106 ? -7.849  -4.203  15.518  1.00 0.00 ? 106 ARG A HH11 5  
ATOM 8431  H HH12 . ARG A 1 106 ? -6.697  -5.336  16.143  1.00 0.00 ? 106 ARG A HH12 5  
ATOM 8432  H HH21 . ARG A 1 106 ? -4.856  -2.936  17.897  1.00 0.00 ? 106 ARG A HH21 5  
ATOM 8433  H HH22 . ARG A 1 106 ? -4.995  -4.614  17.497  1.00 0.00 ? 106 ARG A HH22 5  
ATOM 8434  N N    . THR A 1 107 ? -9.164  -0.009  11.628  1.00 0.00 ? 107 THR A N    5  
ATOM 8435  C CA   . THR A 1 107 ? -10.292 0.884   11.392  1.00 0.00 ? 107 THR A CA   5  
ATOM 8436  C C    . THR A 1 107 ? -10.951 1.294   12.704  1.00 0.00 ? 107 THR A C    5  
ATOM 8437  O O    . THR A 1 107 ? -10.524 0.879   13.782  1.00 0.00 ? 107 THR A O    5  
ATOM 8438  C CB   . THR A 1 107 ? -11.348 0.227   10.483  1.00 0.00 ? 107 THR A CB   5  
ATOM 8439  O OG1  . THR A 1 107 ? -11.579 -1.124  10.897  1.00 0.00 ? 107 THR A OG1  5  
ATOM 8440  C CG2  . THR A 1 107 ? -10.899 0.248   9.030   1.00 0.00 ? 107 THR A CG2  5  
ATOM 8441  H H    . THR A 1 107 ? -9.251  -0.959  11.404  1.00 0.00 ? 107 THR A H    5  
ATOM 8442  H HA   . THR A 1 107 ? -9.919  1.768   10.895  1.00 0.00 ? 107 THR A HA   5  
ATOM 8443  H HB   . THR A 1 107 ? -12.270 0.784   10.568  1.00 0.00 ? 107 THR A HB   5  
ATOM 8444  H HG1  . THR A 1 107 ? -11.418 -1.202  11.841  1.00 0.00 ? 107 THR A HG1  5  
ATOM 8445  H HG21 . THR A 1 107 ? -9.994  0.831   8.941   1.00 0.00 ? 107 THR A HG21 5  
ATOM 8446  H HG22 . THR A 1 107 ? -11.673 0.689   8.420   1.00 0.00 ? 107 THR A HG22 5  
ATOM 8447  H HG23 . THR A 1 107 ? -10.710 -0.762  8.697   1.00 0.00 ? 107 THR A HG23 5  
ATOM 8448  N N    . LEU A 1 108 ? -11.994 2.111   12.606  1.00 0.00 ? 108 LEU A N    5  
ATOM 8449  C CA   . LEU A 1 108 ? -12.714 2.578   13.785  1.00 0.00 ? 108 LEU A CA   5  
ATOM 8450  C C    . LEU A 1 108 ? -13.685 1.514   14.287  1.00 0.00 ? 108 LEU A C    5  
ATOM 8451  O O    . LEU A 1 108 ? -14.108 0.639   13.531  1.00 0.00 ? 108 LEU A O    5  
ATOM 8452  C CB   . LEU A 1 108 ? -13.473 3.867   13.467  1.00 0.00 ? 108 LEU A CB   5  
ATOM 8453  C CG   . LEU A 1 108 ? -12.690 4.936   12.704  1.00 0.00 ? 108 LEU A CG   5  
ATOM 8454  C CD1  . LEU A 1 108 ? -13.627 6.014   12.182  1.00 0.00 ? 108 LEU A CD1  5  
ATOM 8455  C CD2  . LEU A 1 108 ? -11.616 5.546   13.593  1.00 0.00 ? 108 LEU A CD2  5  
ATOM 8456  H H    . LEU A 1 108 ? -12.288 2.408   11.719  1.00 0.00 ? 108 LEU A H    5  
ATOM 8457  H HA   . LEU A 1 108 ? -11.988 2.779   14.559  1.00 0.00 ? 108 LEU A HA   5  
ATOM 8458  H HB2  . LEU A 1 108 ? -14.337 3.605   12.875  1.00 0.00 ? 108 LEU A HB2  5  
ATOM 8459  H HB3  . LEU A 1 108 ? -13.798 4.298   14.403  1.00 0.00 ? 108 LEU A HB3  5  
ATOM 8460  H HG   . LEU A 1 108 ? -12.202 4.479   11.855  1.00 0.00 ? 108 LEU A HG   5  
ATOM 8461  H HD11 . LEU A 1 108 ? -13.425 6.191   11.137  1.00 0.00 ? 108 LEU A HD11 5  
ATOM 8462  H HD12 . LEU A 1 108 ? -13.473 6.926   12.739  1.00 0.00 ? 108 LEU A HD12 5  
ATOM 8463  H HD13 . LEU A 1 108 ? -14.651 5.689   12.301  1.00 0.00 ? 108 LEU A HD13 5  
ATOM 8464  H HD21 . LEU A 1 108 ? -11.384 4.864   14.397  1.00 0.00 ? 108 LEU A HD21 5  
ATOM 8465  H HD22 . LEU A 1 108 ? -11.976 6.478   14.005  1.00 0.00 ? 108 LEU A HD22 5  
ATOM 8466  H HD23 . LEU A 1 108 ? -10.727 5.730   13.009  1.00 0.00 ? 108 LEU A HD23 5  
ATOM 8467  N N    . SER A 1 109 ? -14.035 1.596   15.567  1.00 0.00 ? 109 SER A N    5  
ATOM 8468  C CA   . SER A 1 109 ? -14.954 0.639   16.171  1.00 0.00 ? 109 SER A CA   5  
ATOM 8469  C C    . SER A 1 109 ? -16.355 1.231   16.288  1.00 0.00 ? 109 SER A C    5  
ATOM 8470  O O    . SER A 1 109 ? -16.559 2.244   16.958  1.00 0.00 ? 109 SER A O    5  
ATOM 8471  C CB   . SER A 1 109 ? -14.450 0.216   17.552  1.00 0.00 ? 109 SER A CB   5  
ATOM 8472  O OG   . SER A 1 109 ? -14.610 1.261   18.495  1.00 0.00 ? 109 SER A OG   5  
ATOM 8473  H H    . SER A 1 109 ? -13.663 2.316   16.119  1.00 0.00 ? 109 SER A H    5  
ATOM 8474  H HA   . SER A 1 109 ? -14.996 -0.230  15.531  1.00 0.00 ? 109 SER A HA   5  
ATOM 8475  H HB2  . SER A 1 109 ? -15.008 -0.644  17.888  1.00 0.00 ? 109 SER A HB2  5  
ATOM 8476  H HB3  . SER A 1 109 ? -13.402 -0.038  17.487  1.00 0.00 ? 109 SER A HB3  5  
ATOM 8477  H HG   . SER A 1 109 ? -15.542 1.373   18.695  1.00 0.00 ? 109 SER A HG   5  
ATOM 8478  N N    . ASP A 1 110 ? -17.317 0.592   15.632  1.00 0.00 ? 110 ASP A N    5  
ATOM 8479  C CA   . ASP A 1 110 ? -18.700 1.054   15.662  1.00 0.00 ? 110 ASP A CA   5  
ATOM 8480  C C    . ASP A 1 110 ? -19.289 0.917   17.062  1.00 0.00 ? 110 ASP A C    5  
ATOM 8481  O O    . ASP A 1 110 ? -18.804 0.131   17.876  1.00 0.00 ? 110 ASP A O    5  
ATOM 8482  C CB   . ASP A 1 110 ? -19.546 0.266   14.660  1.00 0.00 ? 110 ASP A CB   5  
ATOM 8483  C CG   . ASP A 1 110 ? -19.728 -1.182  15.070  1.00 0.00 ? 110 ASP A CG   5  
ATOM 8484  O OD1  . ASP A 1 110 ? -20.140 -1.425  16.225  1.00 0.00 ? 110 ASP A OD1  5  
ATOM 8485  O OD2  . ASP A 1 110 ? -19.461 -2.073  14.237  1.00 0.00 ? 110 ASP A OD2  5  
ATOM 8486  H H    . ASP A 1 110 ? -17.092 -0.210  15.115  1.00 0.00 ? 110 ASP A H    5  
ATOM 8487  H HA   . ASP A 1 110 ? -18.708 2.097   15.383  1.00 0.00 ? 110 ASP A HA   5  
ATOM 8488  H HB2  . ASP A 1 110 ? -20.521 0.724   14.583  1.00 0.00 ? 110 ASP A HB2  5  
ATOM 8489  H HB3  . ASP A 1 110 ? -19.064 0.290   13.694  1.00 0.00 ? 110 ASP A HB3  5  
ATOM 8490  N N    . SER A 1 111 ? -20.336 1.688   17.337  1.00 0.00 ? 111 SER A N    5  
ATOM 8491  C CA   . SER A 1 111 ? -20.987 1.656   18.641  1.00 0.00 ? 111 SER A CA   5  
ATOM 8492  C C    . SER A 1 111 ? -22.456 1.265   18.506  1.00 0.00 ? 111 SER A C    5  
ATOM 8493  O O    . SER A 1 111 ? -22.920 0.320   19.142  1.00 0.00 ? 111 SER A O    5  
ATOM 8494  C CB   . SER A 1 111 ? -20.872 3.019   19.326  1.00 0.00 ? 111 SER A CB   5  
ATOM 8495  O OG   . SER A 1 111 ? -19.516 3.371   19.537  1.00 0.00 ? 111 SER A OG   5  
ATOM 8496  H H    . SER A 1 111 ? -20.677 2.295   16.647  1.00 0.00 ? 111 SER A H    5  
ATOM 8497  H HA   . SER A 1 111 ? -20.484 0.916   19.245  1.00 0.00 ? 111 SER A HA   5  
ATOM 8498  H HB2  . SER A 1 111 ? -21.334 3.772   18.705  1.00 0.00 ? 111 SER A HB2  5  
ATOM 8499  H HB3  . SER A 1 111 ? -21.375 2.983   20.282  1.00 0.00 ? 111 SER A HB3  5  
ATOM 8500  H HG   . SER A 1 111 ? -19.064 2.652   19.986  1.00 0.00 ? 111 SER A HG   5  
ATOM 8501  N N    . GLY A 1 112 ? -23.183 2.001   17.670  1.00 0.00 ? 112 GLY A N    5  
ATOM 8502  C CA   . GLY A 1 112 ? -24.591 1.717   17.465  1.00 0.00 ? 112 GLY A CA   5  
ATOM 8503  C C    . GLY A 1 112 ? -25.263 2.733   16.563  1.00 0.00 ? 112 GLY A C    5  
ATOM 8504  O O    . GLY A 1 112 ? -24.616 3.613   15.994  1.00 0.00 ? 112 GLY A O    5  
ATOM 8505  H H    . GLY A 1 112 ? -22.760 2.743   17.189  1.00 0.00 ? 112 GLY A H    5  
ATOM 8506  H HA2  . GLY A 1 112 ? -24.689 0.737   17.022  1.00 0.00 ? 112 GLY A HA2  5  
ATOM 8507  H HA3  . GLY A 1 112 ? -25.090 1.719   18.423  1.00 0.00 ? 112 GLY A HA3  5  
ATOM 8508  N N    . PRO A 1 113 ? -26.591 2.618   16.421  1.00 0.00 ? 113 PRO A N    5  
ATOM 8509  C CA   . PRO A 1 113 ? -27.379 3.526   15.581  1.00 0.00 ? 113 PRO A CA   5  
ATOM 8510  C C    . PRO A 1 113 ? -27.465 4.931   16.168  1.00 0.00 ? 113 PRO A C    5  
ATOM 8511  O O    . PRO A 1 113 ? -27.654 5.906   15.442  1.00 0.00 ? 113 PRO A O    5  
ATOM 8512  C CB   . PRO A 1 113 ? -28.763 2.872   15.555  1.00 0.00 ? 113 PRO A CB   5  
ATOM 8513  C CG   . PRO A 1 113 ? -28.829 2.072   16.810  1.00 0.00 ? 113 PRO A CG   5  
ATOM 8514  C CD   . PRO A 1 113 ? -27.427 1.594   17.070  1.00 0.00 ? 113 PRO A CD   5  
ATOM 8515  H HA   . PRO A 1 113 ? -26.985 3.579   14.577  1.00 0.00 ? 113 PRO A HA   5  
ATOM 8516  H HB2  . PRO A 1 113 ? -29.526 3.638   15.533  1.00 0.00 ? 113 PRO A HB2  5  
ATOM 8517  H HB3  . PRO A 1 113 ? -28.852 2.244   14.681  1.00 0.00 ? 113 PRO A HB3  5  
ATOM 8518  H HG2  . PRO A 1 113 ? -29.170 2.693   17.624  1.00 0.00 ? 113 PRO A HG2  5  
ATOM 8519  H HG3  . PRO A 1 113 ? -29.492 1.231   16.674  1.00 0.00 ? 113 PRO A HG3  5  
ATOM 8520  H HD2  . PRO A 1 113 ? -27.233 1.554   18.131  1.00 0.00 ? 113 PRO A HD2  5  
ATOM 8521  H HD3  . PRO A 1 113 ? -27.269 0.626   16.618  1.00 0.00 ? 113 PRO A HD3  5  
ATOM 8522  N N    . SER A 1 114 ? -27.324 5.026   17.486  1.00 0.00 ? 114 SER A N    5  
ATOM 8523  C CA   . SER A 1 114 ? -27.389 6.312   18.170  1.00 0.00 ? 114 SER A CA   5  
ATOM 8524  C C    . SER A 1 114 ? -26.775 7.415   17.313  1.00 0.00 ? 114 SER A C    5  
ATOM 8525  O O    . SER A 1 114 ? -27.453 8.368   16.929  1.00 0.00 ? 114 SER A O    5  
ATOM 8526  C CB   . SER A 1 114 ? -26.666 6.235   19.516  1.00 0.00 ? 114 SER A CB   5  
ATOM 8527  O OG   . SER A 1 114 ? -27.227 5.227   20.340  1.00 0.00 ? 114 SER A OG   5  
ATOM 8528  H H    . SER A 1 114 ? -27.175 4.212   18.011  1.00 0.00 ? 114 SER A H    5  
ATOM 8529  H HA   . SER A 1 114 ? -28.429 6.544   18.343  1.00 0.00 ? 114 SER A HA   5  
ATOM 8530  H HB2  . SER A 1 114 ? -25.624 6.007   19.350  1.00 0.00 ? 114 SER A HB2  5  
ATOM 8531  H HB3  . SER A 1 114 ? -26.750 7.186   20.023  1.00 0.00 ? 114 SER A HB3  5  
ATOM 8532  H HG   . SER A 1 114 ? -28.127 5.048   20.057  1.00 0.00 ? 114 SER A HG   5  
ATOM 8533  N N    . SER A 1 115 ? -25.486 7.278   17.018  1.00 0.00 ? 115 SER A N    5  
ATOM 8534  C CA   . SER A 1 115 ? -24.778 8.264   16.210  1.00 0.00 ? 115 SER A CA   5  
ATOM 8535  C C    . SER A 1 115 ? -25.399 8.375   14.821  1.00 0.00 ? 115 SER A C    5  
ATOM 8536  O O    . SER A 1 115 ? -25.648 7.368   14.158  1.00 0.00 ? 115 SER A O    5  
ATOM 8537  C CB   . SER A 1 115 ? -23.299 7.891   16.092  1.00 0.00 ? 115 SER A CB   5  
ATOM 8538  O OG   . SER A 1 115 ? -23.105 6.876   15.123  1.00 0.00 ? 115 SER A OG   5  
ATOM 8539  H H    . SER A 1 115 ? -24.999 6.497   17.354  1.00 0.00 ? 115 SER A H    5  
ATOM 8540  H HA   . SER A 1 115 ? -24.861 9.220   16.705  1.00 0.00 ? 115 SER A HA   5  
ATOM 8541  H HB2  . SER A 1 115 ? -22.733 8.763   15.801  1.00 0.00 ? 115 SER A HB2  5  
ATOM 8542  H HB3  . SER A 1 115 ? -22.944 7.533   17.048  1.00 0.00 ? 115 SER A HB3  5  
ATOM 8543  H HG   . SER A 1 115 ? -22.658 6.129   15.527  1.00 0.00 ? 115 SER A HG   5  
ATOM 8544  N N    . GLY A 1 116 ? -25.647 9.607   14.386  1.00 0.00 ? 116 GLY A N    5  
ATOM 8545  C CA   . GLY A 1 116 ? -26.237 9.827   13.078  1.00 0.00 ? 116 GLY A CA   5  
ATOM 8546  C C    . GLY A 1 116 ? -26.166 11.279  12.648  1.00 0.00 ? 116 GLY A C    5  
ATOM 8547  O O    . GLY A 1 116 ? -27.068 12.064  12.940  1.00 0.00 ? 116 GLY A O    5  
ATOM 8548  H H    . GLY A 1 116 ? -25.428 10.372  14.958  1.00 0.00 ? 116 GLY A H    5  
ATOM 8549  H HA2  . GLY A 1 116 ? -25.714 9.222   12.353  1.00 0.00 ? 116 GLY A HA2  5  
ATOM 8550  H HA3  . GLY A 1 116 ? -27.273 9.523   13.107  1.00 0.00 ? 116 GLY A HA3  5  
ATOM 8551  N N    . GLY A 1 1   ? -9.943  -37.486 -4.494  1.00 0.00 ? 1   GLY A N    6  
ATOM 8552  C CA   . GLY A 1 1   ? -9.346  -36.953 -3.284  1.00 0.00 ? 1   GLY A CA   6  
ATOM 8553  C C    . GLY A 1 1   ? -8.195  -36.010 -3.572  1.00 0.00 ? 1   GLY A C    6  
ATOM 8554  O O    . GLY A 1 1   ? -7.264  -36.359 -4.298  1.00 0.00 ? 1   GLY A O    6  
ATOM 8555  H H1   . GLY A 1 1   ? -9.942  -36.952 -5.316  1.00 0.00 ? 1   GLY A H1   6  
ATOM 8556  H HA2  . GLY A 1 1   ? -10.103 -36.421 -2.727  1.00 0.00 ? 1   GLY A HA2  6  
ATOM 8557  H HA3  . GLY A 1 1   ? -8.982  -37.774 -2.684  1.00 0.00 ? 1   GLY A HA3  6  
ATOM 8558  N N    . SER A 1 2   ? -8.258  -34.810 -3.003  1.00 0.00 ? 2   SER A N    6  
ATOM 8559  C CA   . SER A 1 2   ? -7.215  -33.812 -3.207  1.00 0.00 ? 2   SER A CA   6  
ATOM 8560  C C    . SER A 1 2   ? -7.132  -32.862 -2.016  1.00 0.00 ? 2   SER A C    6  
ATOM 8561  O O    . SER A 1 2   ? -8.016  -32.843 -1.160  1.00 0.00 ? 2   SER A O    6  
ATOM 8562  C CB   . SER A 1 2   ? -7.481  -33.020 -4.488  1.00 0.00 ? 2   SER A CB   6  
ATOM 8563  O OG   . SER A 1 2   ? -7.233  -33.811 -5.638  1.00 0.00 ? 2   SER A OG   6  
ATOM 8564  H H    . SER A 1 2   ? -9.025  -34.591 -2.434  1.00 0.00 ? 2   SER A H    6  
ATOM 8565  H HA   . SER A 1 2   ? -6.273  -34.331 -3.304  1.00 0.00 ? 2   SER A HA   6  
ATOM 8566  H HB2  . SER A 1 2   ? -8.512  -32.699 -4.503  1.00 0.00 ? 2   SER A HB2  6  
ATOM 8567  H HB3  . SER A 1 2   ? -6.835  -32.154 -4.514  1.00 0.00 ? 2   SER A HB3  6  
ATOM 8568  H HG   . SER A 1 2   ? -7.142  -33.241 -6.405  1.00 0.00 ? 2   SER A HG   6  
ATOM 8569  N N    . SER A 1 3   ? -6.062  -32.074 -1.969  1.00 0.00 ? 3   SER A N    6  
ATOM 8570  C CA   . SER A 1 3   ? -5.860  -31.123 -0.882  1.00 0.00 ? 3   SER A CA   6  
ATOM 8571  C C    . SER A 1 3   ? -5.003  -29.947 -1.341  1.00 0.00 ? 3   SER A C    6  
ATOM 8572  O O    . SER A 1 3   ? -4.483  -29.941 -2.455  1.00 0.00 ? 3   SER A O    6  
ATOM 8573  C CB   . SER A 1 3   ? -5.200  -31.815 0.313   1.00 0.00 ? 3   SER A CB   6  
ATOM 8574  O OG   . SER A 1 3   ? -5.925  -32.971 0.697   1.00 0.00 ? 3   SER A OG   6  
ATOM 8575  H H    . SER A 1 3   ? -5.392  -32.136 -2.681  1.00 0.00 ? 3   SER A H    6  
ATOM 8576  H HA   . SER A 1 3   ? -6.829  -30.752 -0.582  1.00 0.00 ? 3   SER A HA   6  
ATOM 8577  H HB2  . SER A 1 3   ? -4.196  -32.106 0.047   1.00 0.00 ? 3   SER A HB2  6  
ATOM 8578  H HB3  . SER A 1 3   ? -5.168  -31.130 1.148   1.00 0.00 ? 3   SER A HB3  6  
ATOM 8579  H HG   . SER A 1 3   ? -6.832  -32.729 0.896   1.00 0.00 ? 3   SER A HG   6  
ATOM 8580  N N    . GLY A 1 4   ? -4.861  -28.952 -0.471  1.00 0.00 ? 4   GLY A N    6  
ATOM 8581  C CA   . GLY A 1 4   ? -4.067  -27.784 -0.804  1.00 0.00 ? 4   GLY A CA   6  
ATOM 8582  C C    . GLY A 1 4   ? -2.603  -27.958 -0.450  1.00 0.00 ? 4   GLY A C    6  
ATOM 8583  O O    . GLY A 1 4   ? -2.269  -28.633 0.523   1.00 0.00 ? 4   GLY A O    6  
ATOM 8584  H H    . GLY A 1 4   ? -5.299  -29.011 0.404   1.00 0.00 ? 4   GLY A H    6  
ATOM 8585  H HA2  . GLY A 1 4   ? -4.151  -27.595 -1.864  1.00 0.00 ? 4   GLY A HA2  6  
ATOM 8586  H HA3  . GLY A 1 4   ? -4.456  -26.932 -0.265  1.00 0.00 ? 4   GLY A HA3  6  
ATOM 8587  N N    . SER A 1 5   ? -1.728  -27.349 -1.243  1.00 0.00 ? 5   SER A N    6  
ATOM 8588  C CA   . SER A 1 5   ? -0.291  -27.444 -1.012  1.00 0.00 ? 5   SER A CA   6  
ATOM 8589  C C    . SER A 1 5   ? 0.424   -26.194 -1.516  1.00 0.00 ? 5   SER A C    6  
ATOM 8590  O O    . SER A 1 5   ? 0.011   -25.584 -2.502  1.00 0.00 ? 5   SER A O    6  
ATOM 8591  C CB   . SER A 1 5   ? 0.277   -28.685 -1.705  1.00 0.00 ? 5   SER A CB   6  
ATOM 8592  O OG   . SER A 1 5   ? 1.563   -29.005 -1.202  1.00 0.00 ? 5   SER A OG   6  
ATOM 8593  H H    . SER A 1 5   ? -2.056  -26.825 -2.004  1.00 0.00 ? 5   SER A H    6  
ATOM 8594  H HA   . SER A 1 5   ? -0.132  -27.532 0.052   1.00 0.00 ? 5   SER A HA   6  
ATOM 8595  H HB2  . SER A 1 5   ? -0.382  -29.522 -1.534  1.00 0.00 ? 5   SER A HB2  6  
ATOM 8596  H HB3  . SER A 1 5   ? 0.354   -28.497 -2.766  1.00 0.00 ? 5   SER A HB3  6  
ATOM 8597  H HG   . SER A 1 5   ? 1.543   -28.995 -0.243  1.00 0.00 ? 5   SER A HG   6  
ATOM 8598  N N    . SER A 1 6   ? 1.500   -25.820 -0.831  1.00 0.00 ? 6   SER A N    6  
ATOM 8599  C CA   . SER A 1 6   ? 2.272   -24.640 -1.205  1.00 0.00 ? 6   SER A CA   6  
ATOM 8600  C C    . SER A 1 6   ? 3.628   -25.039 -1.780  1.00 0.00 ? 6   SER A C    6  
ATOM 8601  O O    . SER A 1 6   ? 4.128   -26.133 -1.521  1.00 0.00 ? 6   SER A O    6  
ATOM 8602  C CB   . SER A 1 6   ? 2.468   -23.727 0.007   1.00 0.00 ? 6   SER A CB   6  
ATOM 8603  O OG   . SER A 1 6   ? 3.110   -24.416 1.066   1.00 0.00 ? 6   SER A OG   6  
ATOM 8604  H H    . SER A 1 6   ? 1.779   -26.347 -0.054  1.00 0.00 ? 6   SER A H    6  
ATOM 8605  H HA   . SER A 1 6   ? 1.716   -24.107 -1.961  1.00 0.00 ? 6   SER A HA   6  
ATOM 8606  H HB2  . SER A 1 6   ? 3.075   -22.881 -0.278  1.00 0.00 ? 6   SER A HB2  6  
ATOM 8607  H HB3  . SER A 1 6   ? 1.504   -23.379 0.351   1.00 0.00 ? 6   SER A HB3  6  
ATOM 8608  H HG   . SER A 1 6   ? 4.049   -24.489 0.877   1.00 0.00 ? 6   SER A HG   6  
ATOM 8609  N N    . GLY A 1 7   ? 4.218   -24.141 -2.564  1.00 0.00 ? 7   GLY A N    6  
ATOM 8610  C CA   . GLY A 1 7   ? 5.510   -24.417 -3.164  1.00 0.00 ? 7   GLY A CA   6  
ATOM 8611  C C    . GLY A 1 7   ? 6.459   -23.239 -3.064  1.00 0.00 ? 7   GLY A C    6  
ATOM 8612  O O    . GLY A 1 7   ? 6.776   -22.780 -1.966  1.00 0.00 ? 7   GLY A O    6  
ATOM 8613  H H    . GLY A 1 7   ? 3.772   -23.286 -2.736  1.00 0.00 ? 7   GLY A H    6  
ATOM 8614  H HA2  . GLY A 1 7   ? 5.953   -25.266 -2.666  1.00 0.00 ? 7   GLY A HA2  6  
ATOM 8615  H HA3  . GLY A 1 7   ? 5.366   -24.659 -4.207  1.00 0.00 ? 7   GLY A HA3  6  
ATOM 8616  N N    . ARG A 1 8   ? 6.915   -22.749 -4.212  1.00 0.00 ? 8   ARG A N    6  
ATOM 8617  C CA   . ARG A 1 8   ? 7.836   -21.619 -4.249  1.00 0.00 ? 8   ARG A CA   6  
ATOM 8618  C C    . ARG A 1 8   ? 7.303   -20.513 -5.155  1.00 0.00 ? 8   ARG A C    6  
ATOM 8619  O O    . ARG A 1 8   ? 6.790   -20.780 -6.242  1.00 0.00 ? 8   ARG A O    6  
ATOM 8620  C CB   . ARG A 1 8   ? 9.214   -22.072 -4.735  1.00 0.00 ? 8   ARG A CB   6  
ATOM 8621  C CG   . ARG A 1 8   ? 10.329  -21.096 -4.398  1.00 0.00 ? 8   ARG A CG   6  
ATOM 8622  C CD   . ARG A 1 8   ? 11.510  -21.251 -5.345  1.00 0.00 ? 8   ARG A CD   6  
ATOM 8623  N NE   . ARG A 1 8   ? 12.737  -20.690 -4.786  1.00 0.00 ? 8   ARG A NE   6  
ATOM 8624  C CZ   . ARG A 1 8   ? 13.441  -21.276 -3.824  1.00 0.00 ? 8   ARG A CZ   6  
ATOM 8625  N NH1  . ARG A 1 8   ? 13.042  -22.435 -3.317  1.00 0.00 ? 8   ARG A NH1  6  
ATOM 8626  N NH2  . ARG A 1 8   ? 14.548  -20.703 -3.368  1.00 0.00 ? 8   ARG A NH2  6  
ATOM 8627  H H    . ARG A 1 8   ? 6.626   -23.157 -5.055  1.00 0.00 ? 8   ARG A H    6  
ATOM 8628  H HA   . ARG A 1 8   ? 7.927   -21.233 -3.245  1.00 0.00 ? 8   ARG A HA   6  
ATOM 8629  H HB2  . ARG A 1 8   ? 9.449   -23.023 -4.280  1.00 0.00 ? 8   ARG A HB2  6  
ATOM 8630  H HB3  . ARG A 1 8   ? 9.182   -22.193 -5.807  1.00 0.00 ? 8   ARG A HB3  6  
ATOM 8631  H HG2  . ARG A 1 8   ? 9.949   -20.088 -4.477  1.00 0.00 ? 8   ARG A HG2  6  
ATOM 8632  H HG3  . ARG A 1 8   ? 10.663  -21.279 -3.388  1.00 0.00 ? 8   ARG A HG3  6  
ATOM 8633  H HD2  . ARG A 1 8   ? 11.662  -22.303 -5.539  1.00 0.00 ? 8   ARG A HD2  6  
ATOM 8634  H HD3  . ARG A 1 8   ? 11.281  -20.744 -6.270  1.00 0.00 ? 8   ARG A HD3  6  
ATOM 8635  H HE   . ARG A 1 8   ? 13.050  -19.835 -5.146  1.00 0.00 ? 8   ARG A HE   6  
ATOM 8636  H HH11 . ARG A 1 8   ? 12.210  -22.869 -3.660  1.00 0.00 ? 8   ARG A HH11 6  
ATOM 8637  H HH12 . ARG A 1 8   ? 13.575  -22.874 -2.594  1.00 0.00 ? 8   ARG A HH12 6  
ATOM 8638  H HH21 . ARG A 1 8   ? 14.852  -19.830 -3.748  1.00 0.00 ? 8   ARG A HH21 6  
ATOM 8639  H HH22 . ARG A 1 8   ? 15.077  -21.145 -2.644  1.00 0.00 ? 8   ARG A HH22 6  
ATOM 8640  N N    . VAL A 1 9   ? 7.429   -19.270 -4.701  1.00 0.00 ? 9   VAL A N    6  
ATOM 8641  C CA   . VAL A 1 9   ? 6.962   -18.124 -5.470  1.00 0.00 ? 9   VAL A CA   6  
ATOM 8642  C C    . VAL A 1 9   ? 8.049   -17.611 -6.408  1.00 0.00 ? 9   VAL A C    6  
ATOM 8643  O O    . VAL A 1 9   ? 9.219   -17.536 -6.035  1.00 0.00 ? 9   VAL A O    6  
ATOM 8644  C CB   . VAL A 1 9   ? 6.511   -16.975 -4.548  1.00 0.00 ? 9   VAL A CB   6  
ATOM 8645  C CG1  . VAL A 1 9   ? 6.044   -15.783 -5.369  1.00 0.00 ? 9   VAL A CG1  6  
ATOM 8646  C CG2  . VAL A 1 9   ? 5.413   -17.448 -3.607  1.00 0.00 ? 9   VAL A CG2  6  
ATOM 8647  H H    . VAL A 1 9   ? 7.848   -19.121 -3.827  1.00 0.00 ? 9   VAL A H    6  
ATOM 8648  H HA   . VAL A 1 9   ? 6.112   -18.440 -6.058  1.00 0.00 ? 9   VAL A HA   6  
ATOM 8649  H HB   . VAL A 1 9   ? 7.357   -16.665 -3.953  1.00 0.00 ? 9   VAL A HB   6  
ATOM 8650  H HG11 . VAL A 1 9   ? 4.975   -15.843 -5.515  1.00 0.00 ? 9   VAL A HG11 6  
ATOM 8651  H HG12 . VAL A 1 9   ? 6.287   -14.869 -4.848  1.00 0.00 ? 9   VAL A HG12 6  
ATOM 8652  H HG13 . VAL A 1 9   ? 6.538   -15.792 -6.330  1.00 0.00 ? 9   VAL A HG13 6  
ATOM 8653  H HG21 . VAL A 1 9   ? 4.991   -18.369 -3.981  1.00 0.00 ? 9   VAL A HG21 6  
ATOM 8654  H HG22 . VAL A 1 9   ? 5.829   -17.615 -2.624  1.00 0.00 ? 9   VAL A HG22 6  
ATOM 8655  H HG23 . VAL A 1 9   ? 4.641   -16.696 -3.547  1.00 0.00 ? 9   VAL A HG23 6  
ATOM 8656  N N    . GLU A 1 10  ? 7.653   -17.258 -7.627  1.00 0.00 ? 10  GLU A N    6  
ATOM 8657  C CA   . GLU A 1 10  ? 8.595   -16.752 -8.619  1.00 0.00 ? 10  GLU A CA   6  
ATOM 8658  C C    . GLU A 1 10  ? 9.010   -15.320 -8.294  1.00 0.00 ? 10  GLU A C    6  
ATOM 8659  O O    . GLU A 1 10  ? 8.176   -14.416 -8.242  1.00 0.00 ? 10  GLU A O    6  
ATOM 8660  C CB   . GLU A 1 10  ? 7.978   -16.811 -10.017 1.00 0.00 ? 10  GLU A CB   6  
ATOM 8661  C CG   . GLU A 1 10  ? 7.746   -18.225 -10.521 1.00 0.00 ? 10  GLU A CG   6  
ATOM 8662  C CD   . GLU A 1 10  ? 9.008   -19.066 -10.503 1.00 0.00 ? 10  GLU A CD   6  
ATOM 8663  O OE1  . GLU A 1 10  ? 9.817   -18.939 -11.445 1.00 0.00 ? 10  GLU A OE1  6  
ATOM 8664  O OE2  . GLU A 1 10  ? 9.186   -19.849 -9.547  1.00 0.00 ? 10  GLU A OE2  6  
ATOM 8665  H H    . GLU A 1 10  ? 6.706   -17.340 -7.865  1.00 0.00 ? 10  GLU A H    6  
ATOM 8666  H HA   . GLU A 1 10  ? 9.471   -17.382 -8.595  1.00 0.00 ? 10  GLU A HA   6  
ATOM 8667  H HB2  . GLU A 1 10  ? 7.028   -16.296 -10.001 1.00 0.00 ? 10  GLU A HB2  6  
ATOM 8668  H HB3  . GLU A 1 10  ? 8.637   -16.309 -10.710 1.00 0.00 ? 10  GLU A HB3  6  
ATOM 8669  H HG2  . GLU A 1 10  ? 7.006   -18.701 -9.894  1.00 0.00 ? 10  GLU A HG2  6  
ATOM 8670  H HG3  . GLU A 1 10  ? 7.378   -18.177 -11.536 1.00 0.00 ? 10  GLU A HG3  6  
ATOM 8671  N N    . THR A 1 11  ? 10.306  -15.121 -8.074  1.00 0.00 ? 11  THR A N    6  
ATOM 8672  C CA   . THR A 1 11  ? 10.833  -13.801 -7.753  1.00 0.00 ? 11  THR A CA   6  
ATOM 8673  C C    . THR A 1 11  ? 11.696  -13.262 -8.888  1.00 0.00 ? 11  THR A C    6  
ATOM 8674  O O    . THR A 1 11  ? 12.515  -13.985 -9.454  1.00 0.00 ? 11  THR A O    6  
ATOM 8675  C CB   . THR A 1 11  ? 11.668  -13.829 -6.458  1.00 0.00 ? 11  THR A CB   6  
ATOM 8676  O OG1  . THR A 1 11  ? 12.035  -12.497 -6.083  1.00 0.00 ? 11  THR A OG1  6  
ATOM 8677  C CG2  . THR A 1 11  ? 12.919  -14.674 -6.639  1.00 0.00 ? 11  THR A CG2  6  
ATOM 8678  H H    . THR A 1 11  ? 10.922  -15.882 -8.130  1.00 0.00 ? 11  THR A H    6  
ATOM 8679  H HA   . THR A 1 11  ? 9.996   -13.135 -7.602  1.00 0.00 ? 11  THR A HA   6  
ATOM 8680  H HB   . THR A 1 11  ? 11.068  -14.264 -5.671  1.00 0.00 ? 11  THR A HB   6  
ATOM 8681  H HG1  . THR A 1 11  ? 12.469  -12.514 -5.227  1.00 0.00 ? 11  THR A HG1  6  
ATOM 8682  H HG21 . THR A 1 11  ? 12.696  -15.518 -7.276  1.00 0.00 ? 11  THR A HG21 6  
ATOM 8683  H HG22 . THR A 1 11  ? 13.257  -15.029 -5.677  1.00 0.00 ? 11  THR A HG22 6  
ATOM 8684  H HG23 . THR A 1 11  ? 13.694  -14.076 -7.094  1.00 0.00 ? 11  THR A HG23 6  
ATOM 8685  N N    . GLN A 1 12  ? 11.507  -11.988 -9.215  1.00 0.00 ? 12  GLN A N    6  
ATOM 8686  C CA   . GLN A 1 12  ? 12.269  -11.352 -10.283 1.00 0.00 ? 12  GLN A CA   6  
ATOM 8687  C C    . GLN A 1 12  ? 13.037  -10.144 -9.760  1.00 0.00 ? 12  GLN A C    6  
ATOM 8688  O O    . GLN A 1 12  ? 12.577  -9.420  -8.876  1.00 0.00 ? 12  GLN A O    6  
ATOM 8689  C CB   . GLN A 1 12  ? 11.337  -10.926 -11.419 1.00 0.00 ? 12  GLN A CB   6  
ATOM 8690  C CG   . GLN A 1 12  ? 11.006  -12.049 -12.389 1.00 0.00 ? 12  GLN A CG   6  
ATOM 8691  C CD   . GLN A 1 12  ? 12.213  -12.509 -13.183 1.00 0.00 ? 12  GLN A CD   6  
ATOM 8692  O OE1  . GLN A 1 12  ? 13.143  -13.100 -12.634 1.00 0.00 ? 12  GLN A OE1  6  
ATOM 8693  N NE2  . GLN A 1 12  ? 12.203  -12.240 -14.483 1.00 0.00 ? 12  GLN A NE2  6  
ATOM 8694  H H    . GLN A 1 12  ? 10.839  -11.463 -8.727  1.00 0.00 ? 12  GLN A H    6  
ATOM 8695  H HA   . GLN A 1 12  ? 12.975  -12.076 -10.662 1.00 0.00 ? 12  GLN A HA   6  
ATOM 8696  H HB2  . GLN A 1 12  ? 10.414  -10.563 -10.994 1.00 0.00 ? 12  GLN A HB2  6  
ATOM 8697  H HB3  . GLN A 1 12  ? 11.807  -10.128 -11.974 1.00 0.00 ? 12  GLN A HB3  6  
ATOM 8698  H HG2  . GLN A 1 12  ? 10.622  -12.889 -11.829 1.00 0.00 ? 12  GLN A HG2  6  
ATOM 8699  H HG3  . GLN A 1 12  ? 10.251  -11.701 -13.078 1.00 0.00 ? 12  GLN A HG3  6  
ATOM 8700  H HE21 . GLN A 1 12  ? 11.428  -11.765 -14.852 1.00 0.00 ? 12  GLN A HE21 6  
ATOM 8701  H HE22 . GLN A 1 12  ? 12.971  -12.525 -15.021 1.00 0.00 ? 12  GLN A HE22 6  
ATOM 8702  N N    . PRO A 1 13  ? 14.237  -9.918  -10.316 1.00 0.00 ? 13  PRO A N    6  
ATOM 8703  C CA   . PRO A 1 13  ? 15.095  -8.798  -9.920  1.00 0.00 ? 13  PRO A CA   6  
ATOM 8704  C C    . PRO A 1 13  ? 14.529  -7.451  -10.359 1.00 0.00 ? 13  PRO A C    6  
ATOM 8705  O O    . PRO A 1 13  ? 13.452  -7.384  -10.950 1.00 0.00 ? 13  PRO A O    6  
ATOM 8706  C CB   . PRO A 1 13  ? 16.412  -9.086  -10.644 1.00 0.00 ? 13  PRO A CB   6  
ATOM 8707  C CG   . PRO A 1 13  ? 16.024  -9.916  -11.819 1.00 0.00 ? 13  PRO A CG   6  
ATOM 8708  C CD   . PRO A 1 13  ? 14.848  -10.740 -11.374 1.00 0.00 ? 13  PRO A CD   6  
ATOM 8709  H HA   . PRO A 1 13  ? 15.264  -8.785  -8.853  1.00 0.00 ? 13  PRO A HA   6  
ATOM 8710  H HB2  . PRO A 1 13  ? 16.869  -8.155  -10.950 1.00 0.00 ? 13  PRO A HB2  6  
ATOM 8711  H HB3  . PRO A 1 13  ? 17.079  -9.622  -9.986  1.00 0.00 ? 13  PRO A HB3  6  
ATOM 8712  H HG2  . PRO A 1 13  ? 15.745  -9.278  -12.643 1.00 0.00 ? 13  PRO A HG2  6  
ATOM 8713  H HG3  . PRO A 1 13  ? 16.846  -10.558 -12.102 1.00 0.00 ? 13  PRO A HG3  6  
ATOM 8714  H HD2  . PRO A 1 13  ? 14.160  -10.888 -12.193 1.00 0.00 ? 13  PRO A HD2  6  
ATOM 8715  H HD3  . PRO A 1 13  ? 15.180  -11.690 -10.981 1.00 0.00 ? 13  PRO A HD3  6  
ATOM 8716  N N    . GLU A 1 14  ? 15.263  -6.382  -10.067 1.00 0.00 ? 14  GLU A N    6  
ATOM 8717  C CA   . GLU A 1 14  ? 14.833  -5.038  -10.432 1.00 0.00 ? 14  GLU A CA   6  
ATOM 8718  C C    . GLU A 1 14  ? 16.015  -4.199  -10.911 1.00 0.00 ? 14  GLU A C    6  
ATOM 8719  O O    . GLU A 1 14  ? 17.034  -4.095  -10.228 1.00 0.00 ? 14  GLU A O    6  
ATOM 8720  C CB   . GLU A 1 14  ? 14.157  -4.354  -9.242  1.00 0.00 ? 14  GLU A CB   6  
ATOM 8721  C CG   . GLU A 1 14  ? 15.114  -4.014  -8.111  1.00 0.00 ? 14  GLU A CG   6  
ATOM 8722  C CD   . GLU A 1 14  ? 14.414  -3.894  -6.771  1.00 0.00 ? 14  GLU A CD   6  
ATOM 8723  O OE1  . GLU A 1 14  ? 13.425  -4.624  -6.552  1.00 0.00 ? 14  GLU A OE1  6  
ATOM 8724  O OE2  . GLU A 1 14  ? 14.856  -3.070  -5.943  1.00 0.00 ? 14  GLU A OE2  6  
ATOM 8725  H H    . GLU A 1 14  ? 16.113  -6.500  -9.594  1.00 0.00 ? 14  GLU A H    6  
ATOM 8726  H HA   . GLU A 1 14  ? 14.119  -5.125  -11.237 1.00 0.00 ? 14  GLU A HA   6  
ATOM 8727  H HB2  . GLU A 1 14  ? 13.695  -3.439  -9.582  1.00 0.00 ? 14  GLU A HB2  6  
ATOM 8728  H HB3  . GLU A 1 14  ? 13.392  -5.009  -8.853  1.00 0.00 ? 14  GLU A HB3  6  
ATOM 8729  H HG2  . GLU A 1 14  ? 15.860  -4.792  -8.042  1.00 0.00 ? 14  GLU A HG2  6  
ATOM 8730  H HG3  . GLU A 1 14  ? 15.596  -3.074  -8.335  1.00 0.00 ? 14  GLU A HG3  6  
ATOM 8731  N N    . VAL A 1 15  ? 15.870  -3.603  -12.090 1.00 0.00 ? 15  VAL A N    6  
ATOM 8732  C CA   . VAL A 1 15  ? 16.925  -2.774  -12.661 1.00 0.00 ? 15  VAL A CA   6  
ATOM 8733  C C    . VAL A 1 15  ? 16.373  -1.435  -13.137 1.00 0.00 ? 15  VAL A C    6  
ATOM 8734  O O    . VAL A 1 15  ? 15.377  -1.384  -13.859 1.00 0.00 ? 15  VAL A O    6  
ATOM 8735  C CB   . VAL A 1 15  ? 17.617  -3.480  -13.842 1.00 0.00 ? 15  VAL A CB   6  
ATOM 8736  C CG1  . VAL A 1 15  ? 16.661  -3.619  -15.017 1.00 0.00 ? 15  VAL A CG1  6  
ATOM 8737  C CG2  . VAL A 1 15  ? 18.872  -2.725  -14.252 1.00 0.00 ? 15  VAL A CG2  6  
ATOM 8738  H H    . VAL A 1 15  ? 15.035  -3.724  -12.588 1.00 0.00 ? 15  VAL A H    6  
ATOM 8739  H HA   . VAL A 1 15  ? 17.663  -2.595  -11.893 1.00 0.00 ? 15  VAL A HA   6  
ATOM 8740  H HB   . VAL A 1 15  ? 17.907  -4.471  -13.523 1.00 0.00 ? 15  VAL A HB   6  
ATOM 8741  H HG11 . VAL A 1 15  ? 16.774  -2.770  -15.675 1.00 0.00 ? 15  VAL A HG11 6  
ATOM 8742  H HG12 . VAL A 1 15  ? 16.884  -4.527  -15.557 1.00 0.00 ? 15  VAL A HG12 6  
ATOM 8743  H HG13 . VAL A 1 15  ? 15.645  -3.658  -14.651 1.00 0.00 ? 15  VAL A HG13 6  
ATOM 8744  H HG21 . VAL A 1 15  ? 18.656  -2.111  -15.114 1.00 0.00 ? 15  VAL A HG21 6  
ATOM 8745  H HG22 . VAL A 1 15  ? 19.198  -2.096  -13.436 1.00 0.00 ? 15  VAL A HG22 6  
ATOM 8746  H HG23 . VAL A 1 15  ? 19.653  -3.429  -14.497 1.00 0.00 ? 15  VAL A HG23 6  
ATOM 8747  N N    . GLN A 1 16  ? 17.027  -0.352  -12.729 1.00 0.00 ? 16  GLN A N    6  
ATOM 8748  C CA   . GLN A 1 16  ? 16.601  0.988   -13.114 1.00 0.00 ? 16  GLN A CA   6  
ATOM 8749  C C    . GLN A 1 16  ? 15.138  1.219   -12.752 1.00 0.00 ? 16  GLN A C    6  
ATOM 8750  O O    . GLN A 1 16  ? 14.341  1.649   -13.587 1.00 0.00 ? 16  GLN A O    6  
ATOM 8751  C CB   . GLN A 1 16  ? 16.807  1.200   -14.615 1.00 0.00 ? 16  GLN A CB   6  
ATOM 8752  C CG   . GLN A 1 16  ? 18.257  1.440   -15.002 1.00 0.00 ? 16  GLN A CG   6  
ATOM 8753  C CD   . GLN A 1 16  ? 18.410  1.895   -16.440 1.00 0.00 ? 16  GLN A CD   6  
ATOM 8754  O OE1  . GLN A 1 16  ? 18.425  1.080   -17.363 1.00 0.00 ? 16  GLN A OE1  6  
ATOM 8755  N NE2  . GLN A 1 16  ? 18.524  3.203   -16.638 1.00 0.00 ? 16  GLN A NE2  6  
ATOM 8756  H H    . GLN A 1 16  ? 17.814  -0.458  -12.155 1.00 0.00 ? 16  GLN A H    6  
ATOM 8757  H HA   . GLN A 1 16  ? 17.209  1.697   -12.573 1.00 0.00 ? 16  GLN A HA   6  
ATOM 8758  H HB2  . GLN A 1 16  ? 16.456  0.325   -15.141 1.00 0.00 ? 16  GLN A HB2  6  
ATOM 8759  H HB3  . GLN A 1 16  ? 16.227  2.055   -14.928 1.00 0.00 ? 16  GLN A HB3  6  
ATOM 8760  H HG2  . GLN A 1 16  ? 18.668  2.201   -14.355 1.00 0.00 ? 16  GLN A HG2  6  
ATOM 8761  H HG3  . GLN A 1 16  ? 18.809  0.521   -14.870 1.00 0.00 ? 16  GLN A HG3  6  
ATOM 8762  H HE21 . GLN A 1 16  ? 18.505  3.793   -15.855 1.00 0.00 ? 16  GLN A HE21 6  
ATOM 8763  H HE22 . GLN A 1 16  ? 18.625  3.525   -17.558 1.00 0.00 ? 16  GLN A HE22 6  
ATOM 8764  N N    . LEU A 1 17  ? 14.790  0.931   -11.502 1.00 0.00 ? 17  LEU A N    6  
ATOM 8765  C CA   . LEU A 1 17  ? 13.422  1.107   -11.029 1.00 0.00 ? 17  LEU A CA   6  
ATOM 8766  C C    . LEU A 1 17  ? 13.314  2.322   -10.113 1.00 0.00 ? 17  LEU A C    6  
ATOM 8767  O O    . LEU A 1 17  ? 14.306  2.811   -9.571  1.00 0.00 ? 17  LEU A O    6  
ATOM 8768  C CB   . LEU A 1 17  ? 12.951  -0.146  -10.290 1.00 0.00 ? 17  LEU A CB   6  
ATOM 8769  C CG   . LEU A 1 17  ? 12.301  -1.230  -11.151 1.00 0.00 ? 17  LEU A CG   6  
ATOM 8770  C CD1  . LEU A 1 17  ? 10.992  -0.729  -11.741 1.00 0.00 ? 17  LEU A CD1  6  
ATOM 8771  C CD2  . LEU A 1 17  ? 13.250  -1.674  -12.254 1.00 0.00 ? 17  LEU A CD2  6  
ATOM 8772  H H    . LEU A 1 17  ? 15.469  0.592   -10.883 1.00 0.00 ? 17  LEU A H    6  
ATOM 8773  H HA   . LEU A 1 17  ? 12.791  1.265   -11.891 1.00 0.00 ? 17  LEU A HA   6  
ATOM 8774  H HB2  . LEU A 1 17  ? 13.809  -0.583  -9.801  1.00 0.00 ? 17  LEU A HB2  6  
ATOM 8775  H HB3  . LEU A 1 17  ? 12.232  0.161   -9.544  1.00 0.00 ? 17  LEU A HB3  6  
ATOM 8776  H HG   . LEU A 1 17  ? 12.081  -2.089  -10.532 1.00 0.00 ? 17  LEU A HG   6  
ATOM 8777  H HD11 . LEU A 1 17  ? 11.160  0.213   -12.241 1.00 0.00 ? 17  LEU A HD11 6  
ATOM 8778  H HD12 . LEU A 1 17  ? 10.270  -0.592  -10.950 1.00 0.00 ? 17  LEU A HD12 6  
ATOM 8779  H HD13 . LEU A 1 17  ? 10.617  -1.452  -12.450 1.00 0.00 ? 17  LEU A HD13 6  
ATOM 8780  H HD21 . LEU A 1 17  ? 13.449  -0.843  -12.914 1.00 0.00 ? 17  LEU A HD21 6  
ATOM 8781  H HD22 . LEU A 1 17  ? 12.797  -2.479  -12.816 1.00 0.00 ? 17  LEU A HD22 6  
ATOM 8782  H HD23 . LEU A 1 17  ? 14.176  -2.017  -11.817 1.00 0.00 ? 17  LEU A HD23 6  
ATOM 8783  N N    . PRO A 1 18  ? 12.082  2.821   -9.933  1.00 0.00 ? 18  PRO A N    6  
ATOM 8784  C CA   . PRO A 1 18  ? 11.816  3.984   -9.081  1.00 0.00 ? 18  PRO A CA   6  
ATOM 8785  C C    . PRO A 1 18  ? 12.013  3.674   -7.601  1.00 0.00 ? 18  PRO A C    6  
ATOM 8786  O O    . PRO A 1 18  ? 12.154  2.515   -7.212  1.00 0.00 ? 18  PRO A O    6  
ATOM 8787  C CB   . PRO A 1 18  ? 10.347  4.306   -9.369  1.00 0.00 ? 18  PRO A CB   6  
ATOM 8788  C CG   . PRO A 1 18  ? 9.757   3.014   -9.819  1.00 0.00 ? 18  PRO A CG   6  
ATOM 8789  C CD   . PRO A 1 18  ? 10.855  2.289   -10.548 1.00 0.00 ? 18  PRO A CD   6  
ATOM 8790  H HA   . PRO A 1 18  ? 12.432  4.827   -9.356  1.00 0.00 ? 18  PRO A HA   6  
ATOM 8791  H HB2  . PRO A 1 18  ? 9.871   4.666   -8.468  1.00 0.00 ? 18  PRO A HB2  6  
ATOM 8792  H HB3  . PRO A 1 18  ? 10.285  5.058   -10.141 1.00 0.00 ? 18  PRO A HB3  6  
ATOM 8793  H HG2  . PRO A 1 18  ? 9.433   2.440   -8.964  1.00 0.00 ? 18  PRO A HG2  6  
ATOM 8794  H HG3  . PRO A 1 18  ? 8.927   3.201   -10.483 1.00 0.00 ? 18  PRO A HG3  6  
ATOM 8795  H HD2  . PRO A 1 18  ? 10.774  1.224   -10.389 1.00 0.00 ? 18  PRO A HD2  6  
ATOM 8796  H HD3  . PRO A 1 18  ? 10.822  2.519   -11.603 1.00 0.00 ? 18  PRO A HD3  6  
ATOM 8797  N N    . GLY A 1 19  ? 12.020  4.719   -6.778  1.00 0.00 ? 19  GLY A N    6  
ATOM 8798  C CA   . GLY A 1 19  ? 12.199  4.536   -5.349  1.00 0.00 ? 19  GLY A CA   6  
ATOM 8799  C C    . GLY A 1 19  ? 10.882  4.392   -4.613  1.00 0.00 ? 19  GLY A C    6  
ATOM 8800  O O    . GLY A 1 19  ? 9.806   4.588   -5.178  1.00 0.00 ? 19  GLY A O    6  
ATOM 8801  H H    . GLY A 1 19  ? 11.902  5.620   -7.144  1.00 0.00 ? 19  GLY A H    6  
ATOM 8802  H HA2  . GLY A 1 19  ? 12.792  3.650   -5.182  1.00 0.00 ? 19  GLY A HA2  6  
ATOM 8803  H HA3  . GLY A 1 19  ? 12.728  5.391   -4.953  1.00 0.00 ? 19  GLY A HA3  6  
ATOM 8804  N N    . PRO A 1 20  ? 10.958  4.041   -3.321  1.00 0.00 ? 20  PRO A N    6  
ATOM 8805  C CA   . PRO A 1 20  ? 9.771   3.861   -2.479  1.00 0.00 ? 20  PRO A CA   6  
ATOM 8806  C C    . PRO A 1 20  ? 9.068   5.181   -2.180  1.00 0.00 ? 20  PRO A C    6  
ATOM 8807  O O    . PRO A 1 20  ? 9.715   6.205   -1.965  1.00 0.00 ? 20  PRO A O    6  
ATOM 8808  C CB   . PRO A 1 20  ? 10.338  3.254   -1.193  1.00 0.00 ? 20  PRO A CB   6  
ATOM 8809  C CG   . PRO A 1 20  ? 11.755  3.711   -1.150  1.00 0.00 ? 20  PRO A CG   6  
ATOM 8810  C CD   . PRO A 1 20  ? 12.207  3.792   -2.582  1.00 0.00 ? 20  PRO A CD   6  
ATOM 8811  H HA   . PRO A 1 20  ? 9.068   3.173   -2.925  1.00 0.00 ? 20  PRO A HA   6  
ATOM 8812  H HB2  . PRO A 1 20  ? 9.778   3.619   -0.343  1.00 0.00 ? 20  PRO A HB2  6  
ATOM 8813  H HB3  . PRO A 1 20  ? 10.271  2.178   -1.239  1.00 0.00 ? 20  PRO A HB3  6  
ATOM 8814  H HG2  . PRO A 1 20  ? 11.814  4.682   -0.683  1.00 0.00 ? 20  PRO A HG2  6  
ATOM 8815  H HG3  . PRO A 1 20  ? 12.355  2.995   -0.608  1.00 0.00 ? 20  PRO A HG3  6  
ATOM 8816  H HD2  . PRO A 1 20  ? 12.902  4.608   -2.713  1.00 0.00 ? 20  PRO A HD2  6  
ATOM 8817  H HD3  . PRO A 1 20  ? 12.656  2.858   -2.889  1.00 0.00 ? 20  PRO A HD3  6  
ATOM 8818  N N    . ALA A 1 21  ? 7.739   5.148   -2.167  1.00 0.00 ? 21  ALA A N    6  
ATOM 8819  C CA   . ALA A 1 21  ? 6.948   6.341   -1.892  1.00 0.00 ? 21  ALA A CA   6  
ATOM 8820  C C    . ALA A 1 21  ? 7.126   6.797   -0.448  1.00 0.00 ? 21  ALA A C    6  
ATOM 8821  O O    . ALA A 1 21  ? 6.695   6.133   0.496   1.00 0.00 ? 21  ALA A O    6  
ATOM 8822  C CB   . ALA A 1 21  ? 5.479   6.080   -2.188  1.00 0.00 ? 21  ALA A CB   6  
ATOM 8823  H H    . ALA A 1 21  ? 7.280   4.301   -2.346  1.00 0.00 ? 21  ALA A H    6  
ATOM 8824  H HA   . ALA A 1 21  ? 7.289   7.127   -2.551  1.00 0.00 ? 21  ALA A HA   6  
ATOM 8825  H HB1  . ALA A 1 21  ? 5.241   6.444   -3.177  1.00 0.00 ? 21  ALA A HB1  6  
ATOM 8826  H HB2  . ALA A 1 21  ? 5.285   5.019   -2.138  1.00 0.00 ? 21  ALA A HB2  6  
ATOM 8827  H HB3  . ALA A 1 21  ? 4.869   6.592   -1.459  1.00 0.00 ? 21  ALA A HB3  6  
ATOM 8828  N N    . PRO A 1 22  ? 7.777   7.956   -0.268  1.00 0.00 ? 22  PRO A N    6  
ATOM 8829  C CA   . PRO A 1 22  ? 8.027   8.525   1.059   1.00 0.00 ? 22  PRO A CA   6  
ATOM 8830  C C    . PRO A 1 22  ? 6.750   9.027   1.725   1.00 0.00 ? 22  PRO A C    6  
ATOM 8831  O O    . PRO A 1 22  ? 5.658   8.886   1.178   1.00 0.00 ? 22  PRO A O    6  
ATOM 8832  C CB   . PRO A 1 22  ? 8.974   9.693   0.772   1.00 0.00 ? 22  PRO A CB   6  
ATOM 8833  C CG   . PRO A 1 22  ? 8.687   10.074  -0.640  1.00 0.00 ? 22  PRO A CG   6  
ATOM 8834  C CD   . PRO A 1 22  ? 8.319   8.799   -1.346  1.00 0.00 ? 22  PRO A CD   6  
ATOM 8835  H HA   . PRO A 1 22  ? 8.516   7.815   1.710   1.00 0.00 ? 22  PRO A HA   6  
ATOM 8836  H HB2  . PRO A 1 22  ? 8.764   10.506  1.452   1.00 0.00 ? 22  PRO A HB2  6  
ATOM 8837  H HB3  . PRO A 1 22  ? 9.997   9.370   0.893   1.00 0.00 ? 22  PRO A HB3  6  
ATOM 8838  H HG2  . PRO A 1 22  ? 7.864   10.772  -0.672  1.00 0.00 ? 22  PRO A HG2  6  
ATOM 8839  H HG3  . PRO A 1 22  ? 9.568   10.510  -1.088  1.00 0.00 ? 22  PRO A HG3  6  
ATOM 8840  H HD2  . PRO A 1 22  ? 7.570   8.988   -2.101  1.00 0.00 ? 22  PRO A HD2  6  
ATOM 8841  H HD3  . PRO A 1 22  ? 9.195   8.345   -1.787  1.00 0.00 ? 22  PRO A HD3  6  
ATOM 8842  N N    . ASN A 1 23  ? 6.896   9.612   2.909   1.00 0.00 ? 23  ASN A N    6  
ATOM 8843  C CA   . ASN A 1 23  ? 5.754   10.135  3.650   1.00 0.00 ? 23  ASN A CA   6  
ATOM 8844  C C    . ASN A 1 23  ? 4.524   9.255   3.444   1.00 0.00 ? 23  ASN A C    6  
ATOM 8845  O O    . ASN A 1 23  ? 3.454   9.742   3.077   1.00 0.00 ? 23  ASN A O    6  
ATOM 8846  C CB   . ASN A 1 23  ? 5.448   11.569  3.212   1.00 0.00 ? 23  ASN A CB   6  
ATOM 8847  C CG   . ASN A 1 23  ? 6.201   12.597  4.034   1.00 0.00 ? 23  ASN A CG   6  
ATOM 8848  O OD1  . ASN A 1 23  ? 5.670   13.661  4.354   1.00 0.00 ? 23  ASN A OD1  6  
ATOM 8849  N ND2  . ASN A 1 23  ? 7.444   12.283  4.379   1.00 0.00 ? 23  ASN A ND2  6  
ATOM 8850  H H    . ASN A 1 23  ? 7.794   9.695   3.295   1.00 0.00 ? 23  ASN A H    6  
ATOM 8851  H HA   . ASN A 1 23  ? 6.010   10.135  4.698   1.00 0.00 ? 23  ASN A HA   6  
ATOM 8852  H HB2  . ASN A 1 23  ? 5.729   11.690  2.175   1.00 0.00 ? 23  ASN A HB2  6  
ATOM 8853  H HB3  . ASN A 1 23  ? 4.390   11.754  3.318   1.00 0.00 ? 23  ASN A HB3  6  
ATOM 8854  H HD21 . ASN A 1 23  ? 7.802   11.418  4.088   1.00 0.00 ? 23  ASN A HD21 6  
ATOM 8855  H HD22 . ASN A 1 23  ? 7.953   12.930  4.911   1.00 0.00 ? 23  ASN A HD22 6  
ATOM 8856  N N    . LEU A 1 24  ? 4.684   7.959   3.683   1.00 0.00 ? 24  LEU A N    6  
ATOM 8857  C CA   . LEU A 1 24  ? 3.587   7.010   3.525   1.00 0.00 ? 24  LEU A CA   6  
ATOM 8858  C C    . LEU A 1 24  ? 2.724   6.961   4.781   1.00 0.00 ? 24  LEU A C    6  
ATOM 8859  O O    . LEU A 1 24  ? 3.119   6.386   5.795   1.00 0.00 ? 24  LEU A O    6  
ATOM 8860  C CB   . LEU A 1 24  ? 4.134   5.616   3.213   1.00 0.00 ? 24  LEU A CB   6  
ATOM 8861  C CG   . LEU A 1 24  ? 3.090   4.520   2.991   1.00 0.00 ? 24  LEU A CG   6  
ATOM 8862  C CD1  . LEU A 1 24  ? 2.250   4.825   1.761   1.00 0.00 ? 24  LEU A CD1  6  
ATOM 8863  C CD2  . LEU A 1 24  ? 3.763   3.162   2.856   1.00 0.00 ? 24  LEU A CD2  6  
ATOM 8864  H H    . LEU A 1 24  ? 5.561   7.630   3.973   1.00 0.00 ? 24  LEU A H    6  
ATOM 8865  H HA   . LEU A 1 24  ? 2.979   7.343   2.697   1.00 0.00 ? 24  LEU A HA   6  
ATOM 8866  H HB2  . LEU A 1 24  ? 4.733   5.688   2.318   1.00 0.00 ? 24  LEU A HB2  6  
ATOM 8867  H HB3  . LEU A 1 24  ? 4.761   5.314   4.040   1.00 0.00 ? 24  LEU A HB3  6  
ATOM 8868  H HG   . LEU A 1 24  ? 2.429   4.483   3.846   1.00 0.00 ? 24  LEU A HG   6  
ATOM 8869  H HD11 . LEU A 1 24  ? 1.612   5.673   1.962   1.00 0.00 ? 24  LEU A HD11 6  
ATOM 8870  H HD12 . LEU A 1 24  ? 1.641   3.966   1.519   1.00 0.00 ? 24  LEU A HD12 6  
ATOM 8871  H HD13 . LEU A 1 24  ? 2.899   5.052   0.928   1.00 0.00 ? 24  LEU A HD13 6  
ATOM 8872  H HD21 . LEU A 1 24  ? 4.376   3.152   1.966   1.00 0.00 ? 24  LEU A HD21 6  
ATOM 8873  H HD22 . LEU A 1 24  ? 3.009   2.392   2.782   1.00 0.00 ? 24  LEU A HD22 6  
ATOM 8874  H HD23 . LEU A 1 24  ? 4.382   2.979   3.721   1.00 0.00 ? 24  LEU A HD23 6  
ATOM 8875  N N    . ARG A 1 25  ? 1.544   7.567   4.706   1.00 0.00 ? 25  ARG A N    6  
ATOM 8876  C CA   . ARG A 1 25  ? 0.624   7.592   5.837   1.00 0.00 ? 25  ARG A CA   6  
ATOM 8877  C C    . ARG A 1 25  ? -0.668  6.852   5.503   1.00 0.00 ? 25  ARG A C    6  
ATOM 8878  O O    . ARG A 1 25  ? -1.008  6.673   4.334   1.00 0.00 ? 25  ARG A O    6  
ATOM 8879  C CB   . ARG A 1 25  ? 0.310   9.035   6.235   1.00 0.00 ? 25  ARG A CB   6  
ATOM 8880  C CG   . ARG A 1 25  ? 1.444   10.006  5.950   1.00 0.00 ? 25  ARG A CG   6  
ATOM 8881  C CD   . ARG A 1 25  ? 2.551   9.890   6.987   1.00 0.00 ? 25  ARG A CD   6  
ATOM 8882  N NE   . ARG A 1 25  ? 2.163   10.473  8.268   1.00 0.00 ? 25  ARG A NE   6  
ATOM 8883  C CZ   . ARG A 1 25  ? 2.234   11.772  8.537   1.00 0.00 ? 25  ARG A CZ   6  
ATOM 8884  N NH1  . ARG A 1 25  ? 2.677   12.619  7.618   1.00 0.00 ? 25  ARG A NH1  6  
ATOM 8885  N NH2  . ARG A 1 25  ? 1.863   12.226  9.727   1.00 0.00 ? 25  ARG A NH2  6  
ATOM 8886  H H    . ARG A 1 25  ? 1.285   8.009   3.870   1.00 0.00 ? 25  ARG A H    6  
ATOM 8887  H HA   . ARG A 1 25  ? 1.105   7.095   6.666   1.00 0.00 ? 25  ARG A HA   6  
ATOM 8888  H HB2  . ARG A 1 25  ? -0.562  9.365   5.690   1.00 0.00 ? 25  ARG A HB2  6  
ATOM 8889  H HB3  . ARG A 1 25  ? 0.097   9.065   7.293   1.00 0.00 ? 25  ARG A HB3  6  
ATOM 8890  H HG2  . ARG A 1 25  ? 1.856   9.788   4.975   1.00 0.00 ? 25  ARG A HG2  6  
ATOM 8891  H HG3  . ARG A 1 25  ? 1.055   11.013  5.962   1.00 0.00 ? 25  ARG A HG3  6  
ATOM 8892  H HD2  . ARG A 1 25  ? 2.782   8.845   7.132   1.00 0.00 ? 25  ARG A HD2  6  
ATOM 8893  H HD3  . ARG A 1 25  ? 3.426   10.404  6.618   1.00 0.00 ? 25  ARG A HD3  6  
ATOM 8894  H HE   . ARG A 1 25  ? 1.833   9.865   8.962   1.00 0.00 ? 25  ARG A HE   6  
ATOM 8895  H HH11 . ARG A 1 25  ? 2.957   12.279  6.720   1.00 0.00 ? 25  ARG A HH11 6  
ATOM 8896  H HH12 . ARG A 1 25  ? 2.729   13.596  7.823   1.00 0.00 ? 25  ARG A HH12 6  
ATOM 8897  H HH21 . ARG A 1 25  ? 1.528   11.590  10.422  1.00 0.00 ? 25  ARG A HH21 6  
ATOM 8898  H HH22 . ARG A 1 25  ? 1.917   13.203  9.928   1.00 0.00 ? 25  ARG A HH22 6  
ATOM 8899  N N    . ALA A 1 26  ? -1.384  6.425   6.538   1.00 0.00 ? 26  ALA A N    6  
ATOM 8900  C CA   . ALA A 1 26  ? -2.639  5.707   6.355   1.00 0.00 ? 26  ALA A CA   6  
ATOM 8901  C C    . ALA A 1 26  ? -3.502  5.780   7.610   1.00 0.00 ? 26  ALA A C    6  
ATOM 8902  O O    . ALA A 1 26  ? -3.048  5.455   8.707   1.00 0.00 ? 26  ALA A O    6  
ATOM 8903  C CB   . ALA A 1 26  ? -2.367  4.257   5.983   1.00 0.00 ? 26  ALA A CB   6  
ATOM 8904  H H    . ALA A 1 26  ? -1.061  6.599   7.447   1.00 0.00 ? 26  ALA A H    6  
ATOM 8905  H HA   . ALA A 1 26  ? -3.172  6.169   5.536   1.00 0.00 ? 26  ALA A HA   6  
ATOM 8906  H HB1  . ALA A 1 26  ? -1.314  4.130   5.779   1.00 0.00 ? 26  ALA A HB1  6  
ATOM 8907  H HB2  . ALA A 1 26  ? -2.656  3.615   6.802   1.00 0.00 ? 26  ALA A HB2  6  
ATOM 8908  H HB3  . ALA A 1 26  ? -2.939  3.998   5.104   1.00 0.00 ? 26  ALA A HB3  6  
ATOM 8909  N N    . TYR A 1 27  ? -4.747  6.211   7.442   1.00 0.00 ? 27  TYR A N    6  
ATOM 8910  C CA   . TYR A 1 27  ? -5.673  6.330   8.562   1.00 0.00 ? 27  TYR A CA   6  
ATOM 8911  C C    . TYR A 1 27  ? -7.075  5.884   8.160   1.00 0.00 ? 27  TYR A C    6  
ATOM 8912  O O    . TYR A 1 27  ? -7.472  6.015   7.002   1.00 0.00 ? 27  TYR A O    6  
ATOM 8913  C CB   . TYR A 1 27  ? -5.710  7.773   9.068   1.00 0.00 ? 27  TYR A CB   6  
ATOM 8914  C CG   . TYR A 1 27  ? -5.923  8.794   7.974   1.00 0.00 ? 27  TYR A CG   6  
ATOM 8915  C CD1  . TYR A 1 27  ? -4.861  9.246   7.202   1.00 0.00 ? 27  TYR A CD1  6  
ATOM 8916  C CD2  . TYR A 1 27  ? -7.188  9.305   7.711   1.00 0.00 ? 27  TYR A CD2  6  
ATOM 8917  C CE1  . TYR A 1 27  ? -5.051  10.179  6.201   1.00 0.00 ? 27  TYR A CE1  6  
ATOM 8918  C CE2  . TYR A 1 27  ? -7.388  10.237  6.711   1.00 0.00 ? 27  TYR A CE2  6  
ATOM 8919  C CZ   . TYR A 1 27  ? -6.316  10.672  5.959   1.00 0.00 ? 27  TYR A CZ   6  
ATOM 8920  O OH   . TYR A 1 27  ? -6.511  11.600  4.962   1.00 0.00 ? 27  TYR A OH   6  
ATOM 8921  H H    . TYR A 1 27  ? -5.051  6.456   6.543   1.00 0.00 ? 27  TYR A H    6  
ATOM 8922  H HA   . TYR A 1 27  ? -5.317  5.689   9.355   1.00 0.00 ? 27  TYR A HA   6  
ATOM 8923  H HB2  . TYR A 1 27  ? -6.515  7.877   9.779   1.00 0.00 ? 27  TYR A HB2  6  
ATOM 8924  H HB3  . TYR A 1 27  ? -4.773  8.000   9.556   1.00 0.00 ? 27  TYR A HB3  6  
ATOM 8925  H HD1  . TYR A 1 27  ? -3.871  8.858   7.393   1.00 0.00 ? 27  TYR A HD1  6  
ATOM 8926  H HD2  . TYR A 1 27  ? -8.026  8.963   8.301   1.00 0.00 ? 27  TYR A HD2  6  
ATOM 8927  H HE1  . TYR A 1 27  ? -4.212  10.519  5.612   1.00 0.00 ? 27  TYR A HE1  6  
ATOM 8928  H HE2  . TYR A 1 27  ? -8.379  10.624  6.522   1.00 0.00 ? 27  TYR A HE2  6  
ATOM 8929  H HH   . TYR A 1 27  ? -5.823  11.505  4.299   1.00 0.00 ? 27  TYR A HH   6  
ATOM 8930  N N    . ALA A 1 28  ? -7.821  5.358   9.125   1.00 0.00 ? 28  ALA A N    6  
ATOM 8931  C CA   . ALA A 1 28  ? -9.180  4.895   8.874   1.00 0.00 ? 28  ALA A CA   6  
ATOM 8932  C C    . ALA A 1 28  ? -10.179 6.043   8.974   1.00 0.00 ? 28  ALA A C    6  
ATOM 8933  O O    . ALA A 1 28  ? -10.458 6.542   10.063  1.00 0.00 ? 28  ALA A O    6  
ATOM 8934  C CB   . ALA A 1 28  ? -9.549  3.786   9.849   1.00 0.00 ? 28  ALA A CB   6  
ATOM 8935  H H    . ALA A 1 28  ? -7.449  5.280   10.028  1.00 0.00 ? 28  ALA A H    6  
ATOM 8936  H HA   . ALA A 1 28  ? -9.215  4.487   7.874   1.00 0.00 ? 28  ALA A HA   6  
ATOM 8937  H HB1  . ALA A 1 28  ? -10.295 4.150   10.541  1.00 0.00 ? 28  ALA A HB1  6  
ATOM 8938  H HB2  . ALA A 1 28  ? -9.945  2.943   9.303   1.00 0.00 ? 28  ALA A HB2  6  
ATOM 8939  H HB3  . ALA A 1 28  ? -8.669  3.481   10.396  1.00 0.00 ? 28  ALA A HB3  6  
ATOM 8940  N N    . ALA A 1 29  ? -10.713 6.457   7.829   1.00 0.00 ? 29  ALA A N    6  
ATOM 8941  C CA   . ALA A 1 29  ? -11.681 7.546   7.788   1.00 0.00 ? 29  ALA A CA   6  
ATOM 8942  C C    . ALA A 1 29  ? -13.050 7.082   8.275   1.00 0.00 ? 29  ALA A C    6  
ATOM 8943  O O    . ALA A 1 29  ? -13.859 7.884   8.741   1.00 0.00 ? 29  ALA A O    6  
ATOM 8944  C CB   . ALA A 1 29  ? -11.783 8.109   6.379   1.00 0.00 ? 29  ALA A CB   6  
ATOM 8945  H H    . ALA A 1 29  ? -10.451 6.019   6.993   1.00 0.00 ? 29  ALA A H    6  
ATOM 8946  H HA   . ALA A 1 29  ? -11.327 8.332   8.439   1.00 0.00 ? 29  ALA A HA   6  
ATOM 8947  H HB1  . ALA A 1 29  ? -12.353 9.026   6.399   1.00 0.00 ? 29  ALA A HB1  6  
ATOM 8948  H HB2  . ALA A 1 29  ? -10.792 8.308   5.998   1.00 0.00 ? 29  ALA A HB2  6  
ATOM 8949  H HB3  . ALA A 1 29  ? -12.277 7.392   5.740   1.00 0.00 ? 29  ALA A HB3  6  
ATOM 8950  N N    . SER A 1 30  ? -13.303 5.782   8.163   1.00 0.00 ? 30  SER A N    6  
ATOM 8951  C CA   . SER A 1 30  ? -14.577 5.212   8.587   1.00 0.00 ? 30  SER A CA   6  
ATOM 8952  C C    . SER A 1 30  ? -14.418 3.739   8.952   1.00 0.00 ? 30  SER A C    6  
ATOM 8953  O O    . SER A 1 30  ? -13.463 3.073   8.551   1.00 0.00 ? 30  SER A O    6  
ATOM 8954  C CB   . SER A 1 30  ? -15.622 5.365   7.481   1.00 0.00 ? 30  SER A CB   6  
ATOM 8955  O OG   . SER A 1 30  ? -16.273 6.621   7.566   1.00 0.00 ? 30  SER A OG   6  
ATOM 8956  H H    . SER A 1 30  ? -12.618 5.192   7.783   1.00 0.00 ? 30  SER A H    6  
ATOM 8957  H HA   . SER A 1 30  ? -14.907 5.753   9.461   1.00 0.00 ? 30  SER A HA   6  
ATOM 8958  H HB2  . SER A 1 30  ? -15.139 5.288   6.519   1.00 0.00 ? 30  SER A HB2  6  
ATOM 8959  H HB3  . SER A 1 30  ? -16.361 4.582   7.577   1.00 0.00 ? 30  SER A HB3  6  
ATOM 8960  H HG   . SER A 1 30  ? -15.898 7.221   6.917   1.00 0.00 ? 30  SER A HG   6  
ATOM 8961  N N    . PRO A 1 31  ? -15.376 3.216   9.731   1.00 0.00 ? 31  PRO A N    6  
ATOM 8962  C CA   . PRO A 1 31  ? -15.367 1.817   10.167  1.00 0.00 ? 31  PRO A CA   6  
ATOM 8963  C C    . PRO A 1 31  ? -15.636 0.850   9.019   1.00 0.00 ? 31  PRO A C    6  
ATOM 8964  O O    . PRO A 1 31  ? -15.691 -0.365  9.216   1.00 0.00 ? 31  PRO A O    6  
ATOM 8965  C CB   . PRO A 1 31  ? -16.500 1.757   11.194  1.00 0.00 ? 31  PRO A CB   6  
ATOM 8966  C CG   . PRO A 1 31  ? -17.419 2.865   10.809  1.00 0.00 ? 31  PRO A CG   6  
ATOM 8967  C CD   . PRO A 1 31  ? -16.544 3.951   10.246  1.00 0.00 ? 31  PRO A CD   6  
ATOM 8968  H HA   . PRO A 1 31  ? -14.433 1.556   10.644  1.00 0.00 ? 31  PRO A HA   6  
ATOM 8969  H HB2  . PRO A 1 31  ? -16.993 0.796   11.135  1.00 0.00 ? 31  PRO A HB2  6  
ATOM 8970  H HB3  . PRO A 1 31  ? -16.101 1.903   12.186  1.00 0.00 ? 31  PRO A HB3  6  
ATOM 8971  H HG2  . PRO A 1 31  ? -18.117 2.521   10.061  1.00 0.00 ? 31  PRO A HG2  6  
ATOM 8972  H HG3  . PRO A 1 31  ? -17.946 3.224   11.680  1.00 0.00 ? 31  PRO A HG3  6  
ATOM 8973  H HD2  . PRO A 1 31  ? -17.054 4.472   9.449   1.00 0.00 ? 31  PRO A HD2  6  
ATOM 8974  H HD3  . PRO A 1 31  ? -16.252 4.641   11.024  1.00 0.00 ? 31  PRO A HD3  6  
ATOM 8975  N N    . THR A 1 32  ? -15.803 1.396   7.819   1.00 0.00 ? 32  THR A N    6  
ATOM 8976  C CA   . THR A 1 32  ? -16.068 0.582   6.639   1.00 0.00 ? 32  THR A CA   6  
ATOM 8977  C C    . THR A 1 32  ? -15.153 0.973   5.485   1.00 0.00 ? 32  THR A C    6  
ATOM 8978  O O    . THR A 1 32  ? -15.241 0.412   4.392   1.00 0.00 ? 32  THR A O    6  
ATOM 8979  C CB   . THR A 1 32  ? -17.534 0.711   6.184   1.00 0.00 ? 32  THR A CB   6  
ATOM 8980  O OG1  . THR A 1 32  ? -17.803 2.058   5.779   1.00 0.00 ? 32  THR A OG1  6  
ATOM 8981  C CG2  . THR A 1 32  ? -18.485 0.313   7.303   1.00 0.00 ? 32  THR A CG2  6  
ATOM 8982  H H    . THR A 1 32  ? -15.748 2.370   7.726   1.00 0.00 ? 32  THR A H    6  
ATOM 8983  H HA   . THR A 1 32  ? -15.883 -0.451  6.898   1.00 0.00 ? 32  THR A HA   6  
ATOM 8984  H HB   . THR A 1 32  ? -17.693 0.051   5.343   1.00 0.00 ? 32  THR A HB   6  
ATOM 8985  H HG1  . THR A 1 32  ? -17.084 2.376   5.227   1.00 0.00 ? 32  THR A HG1  6  
ATOM 8986  H HG21 . THR A 1 32  ? -19.162 1.129   7.507   1.00 0.00 ? 32  THR A HG21 6  
ATOM 8987  H HG22 . THR A 1 32  ? -17.918 0.083   8.192   1.00 0.00 ? 32  THR A HG22 6  
ATOM 8988  H HG23 . THR A 1 32  ? -19.050 -0.556  7.001   1.00 0.00 ? 32  THR A HG23 6  
ATOM 8989  N N    . SER A 1 33  ? -14.273 1.938   5.734   1.00 0.00 ? 33  SER A N    6  
ATOM 8990  C CA   . SER A 1 33  ? -13.343 2.407   4.713   1.00 0.00 ? 33  SER A CA   6  
ATOM 8991  C C    . SER A 1 33  ? -12.005 2.794   5.334   1.00 0.00 ? 33  SER A C    6  
ATOM 8992  O O    . SER A 1 33  ? -11.861 2.821   6.557   1.00 0.00 ? 33  SER A O    6  
ATOM 8993  C CB   . SER A 1 33  ? -13.935 3.602   3.963   1.00 0.00 ? 33  SER A CB   6  
ATOM 8994  O OG   . SER A 1 33  ? -13.582 4.823   4.589   1.00 0.00 ? 33  SER A OG   6  
ATOM 8995  H H    . SER A 1 33  ? -14.251 2.346   6.624   1.00 0.00 ? 33  SER A H    6  
ATOM 8996  H HA   . SER A 1 33  ? -13.182 1.599   4.015   1.00 0.00 ? 33  SER A HA   6  
ATOM 8997  H HB2  . SER A 1 33  ? -13.561 3.609   2.951   1.00 0.00 ? 33  SER A HB2  6  
ATOM 8998  H HB3  . SER A 1 33  ? -15.012 3.516   3.949   1.00 0.00 ? 33  SER A HB3  6  
ATOM 8999  H HG   . SER A 1 33  ? -13.504 4.686   5.537   1.00 0.00 ? 33  SER A HG   6  
ATOM 9000  N N    . ILE A 1 34  ? -11.029 3.093   4.483   1.00 0.00 ? 34  ILE A N    6  
ATOM 9001  C CA   . ILE A 1 34  ? -9.703  3.479   4.948   1.00 0.00 ? 34  ILE A CA   6  
ATOM 9002  C C    . ILE A 1 34  ? -9.013  4.395   3.942   1.00 0.00 ? 34  ILE A C    6  
ATOM 9003  O O    . ILE A 1 34  ? -8.916  4.074   2.757   1.00 0.00 ? 34  ILE A O    6  
ATOM 9004  C CB   . ILE A 1 34  ? -8.812  2.248   5.198   1.00 0.00 ? 34  ILE A CB   6  
ATOM 9005  C CG1  . ILE A 1 34  ? -9.375  1.409   6.347   1.00 0.00 ? 34  ILE A CG1  6  
ATOM 9006  C CG2  . ILE A 1 34  ? -7.385  2.679   5.500   1.00 0.00 ? 34  ILE A CG2  6  
ATOM 9007  C CD1  . ILE A 1 34  ? -8.638  0.106   6.561   1.00 0.00 ? 34  ILE A CD1  6  
ATOM 9008  H H    . ILE A 1 34  ? -11.205 3.052   3.521   1.00 0.00 ? 34  ILE A H    6  
ATOM 9009  H HA   . ILE A 1 34  ? -9.819  4.010   5.882   1.00 0.00 ? 34  ILE A HA   6  
ATOM 9010  H HB   . ILE A 1 34  ? -8.800  1.652   4.298   1.00 0.00 ? 34  ILE A HB   6  
ATOM 9011  H HG12 . ILE A 1 34  ? -9.317  1.977   7.261   1.00 0.00 ? 34  ILE A HG12 6  
ATOM 9012  H HG13 . ILE A 1 34  ? -10.410 1.175   6.138   1.00 0.00 ? 34  ILE A HG13 6  
ATOM 9013  H HG21 . ILE A 1 34  ? -6.835  2.776   4.575   1.00 0.00 ? 34  ILE A HG21 6  
ATOM 9014  H HG22 . ILE A 1 34  ? -7.397  3.629   6.011   1.00 0.00 ? 34  ILE A HG22 6  
ATOM 9015  H HG23 . ILE A 1 34  ? -6.910  1.939   6.126   1.00 0.00 ? 34  ILE A HG23 6  
ATOM 9016  H HD11 . ILE A 1 34  ? -7.755  0.085   5.940   1.00 0.00 ? 34  ILE A HD11 6  
ATOM 9017  H HD12 . ILE A 1 34  ? -8.351  0.020   7.598   1.00 0.00 ? 34  ILE A HD12 6  
ATOM 9018  H HD13 . ILE A 1 34  ? -9.282  -0.721  6.297   1.00 0.00 ? 34  ILE A HD13 6  
ATOM 9019  N N    . THR A 1 35  ? -8.534  5.538   4.423   1.00 0.00 ? 35  THR A N    6  
ATOM 9020  C CA   . THR A 1 35  ? -7.852  6.501   3.567   1.00 0.00 ? 35  THR A CA   6  
ATOM 9021  C C    . THR A 1 35  ? -6.338  6.360   3.677   1.00 0.00 ? 35  THR A C    6  
ATOM 9022  O O    . THR A 1 35  ? -5.791  6.278   4.777   1.00 0.00 ? 35  THR A O    6  
ATOM 9023  C CB   . THR A 1 35  ? -8.249  7.947   3.921   1.00 0.00 ? 35  THR A CB   6  
ATOM 9024  O OG1  . THR A 1 35  ? -9.644  8.148   3.671   1.00 0.00 ? 35  THR A OG1  6  
ATOM 9025  C CG2  . THR A 1 35  ? -7.435  8.945   3.113   1.00 0.00 ? 35  THR A CG2  6  
ATOM 9026  H H    . THR A 1 35  ? -8.642  5.738   5.376   1.00 0.00 ? 35  THR A H    6  
ATOM 9027  H HA   . THR A 1 35  ? -8.149  6.309   2.546   1.00 0.00 ? 35  THR A HA   6  
ATOM 9028  H HB   . THR A 1 35  ? -8.052  8.111   4.971   1.00 0.00 ? 35  THR A HB   6  
ATOM 9029  H HG1  . THR A 1 35  ? -9.942  8.936   4.131   1.00 0.00 ? 35  THR A HG1  6  
ATOM 9030  H HG21 . THR A 1 35  ? -7.510  9.923   3.566   1.00 0.00 ? 35  THR A HG21 6  
ATOM 9031  H HG22 . THR A 1 35  ? -7.815  8.986   2.103   1.00 0.00 ? 35  THR A HG22 6  
ATOM 9032  H HG23 . THR A 1 35  ? -6.401  8.636   3.095   1.00 0.00 ? 35  THR A HG23 6  
ATOM 9033  N N    . VAL A 1 36  ? -5.666  6.334   2.531   1.00 0.00 ? 36  VAL A N    6  
ATOM 9034  C CA   . VAL A 1 36  ? -4.214  6.205   2.499   1.00 0.00 ? 36  VAL A CA   6  
ATOM 9035  C C    . VAL A 1 36  ? -3.583  7.309   1.657   1.00 0.00 ? 36  VAL A C    6  
ATOM 9036  O O    . VAL A 1 36  ? -3.971  7.530   0.510   1.00 0.00 ? 36  VAL A O    6  
ATOM 9037  C CB   . VAL A 1 36  ? -3.785  4.837   1.937   1.00 0.00 ? 36  VAL A CB   6  
ATOM 9038  C CG1  . VAL A 1 36  ? -2.302  4.601   2.181   1.00 0.00 ? 36  VAL A CG1  6  
ATOM 9039  C CG2  . VAL A 1 36  ? -4.618  3.723   2.552   1.00 0.00 ? 36  VAL A CG2  6  
ATOM 9040  H H    . VAL A 1 36  ? -6.158  6.404   1.686   1.00 0.00 ? 36  VAL A H    6  
ATOM 9041  H HA   . VAL A 1 36  ? -3.849  6.285   3.513   1.00 0.00 ? 36  VAL A HA   6  
ATOM 9042  H HB   . VAL A 1 36  ? -3.956  4.839   0.870   1.00 0.00 ? 36  VAL A HB   6  
ATOM 9043  H HG11 . VAL A 1 36  ? -2.085  3.547   2.084   1.00 0.00 ? 36  VAL A HG11 6  
ATOM 9044  H HG12 . VAL A 1 36  ? -1.725  5.157   1.457   1.00 0.00 ? 36  VAL A HG12 6  
ATOM 9045  H HG13 . VAL A 1 36  ? -2.044  4.931   3.177   1.00 0.00 ? 36  VAL A HG13 6  
ATOM 9046  H HG21 . VAL A 1 36  ? -4.005  3.148   3.230   1.00 0.00 ? 36  VAL A HG21 6  
ATOM 9047  H HG22 . VAL A 1 36  ? -5.449  4.152   3.094   1.00 0.00 ? 36  VAL A HG22 6  
ATOM 9048  H HG23 . VAL A 1 36  ? -4.993  3.079   1.771   1.00 0.00 ? 36  VAL A HG23 6  
ATOM 9049  N N    . THR A 1 37  ? -2.606  8.000   2.235   1.00 0.00 ? 37  THR A N    6  
ATOM 9050  C CA   . THR A 1 37  ? -1.920  9.082   1.539   1.00 0.00 ? 37  THR A CA   6  
ATOM 9051  C C    . THR A 1 37  ? -0.414  8.848   1.508   1.00 0.00 ? 37  THR A C    6  
ATOM 9052  O O    . THR A 1 37  ? 0.198   8.546   2.533   1.00 0.00 ? 37  THR A O    6  
ATOM 9053  C CB   . THR A 1 37  ? -2.203  10.444  2.201   1.00 0.00 ? 37  THR A CB   6  
ATOM 9054  O OG1  . THR A 1 37  ? -1.615  10.486  3.506   1.00 0.00 ? 37  THR A OG1  6  
ATOM 9055  C CG2  . THR A 1 37  ? -3.700  10.694  2.305   1.00 0.00 ? 37  THR A CG2  6  
ATOM 9056  H H    . THR A 1 37  ? -2.341  7.777   3.152   1.00 0.00 ? 37  THR A H    6  
ATOM 9057  H HA   . THR A 1 37  ? -2.290  9.114   0.525   1.00 0.00 ? 37  THR A HA   6  
ATOM 9058  H HB   . THR A 1 37  ? -1.764  11.221  1.591   1.00 0.00 ? 37  THR A HB   6  
ATOM 9059  H HG1  . THR A 1 37  ? -0.734  10.105  3.473   1.00 0.00 ? 37  THR A HG1  6  
ATOM 9060  H HG21 . THR A 1 37  ? -4.081  10.228  3.201   1.00 0.00 ? 37  THR A HG21 6  
ATOM 9061  H HG22 . THR A 1 37  ? -4.195  10.276  1.442   1.00 0.00 ? 37  THR A HG22 6  
ATOM 9062  H HG23 . THR A 1 37  ? -3.884  11.757  2.346   1.00 0.00 ? 37  THR A HG23 6  
ATOM 9063  N N    . TRP A 1 38  ? 0.178   8.989   0.328   1.00 0.00 ? 38  TRP A N    6  
ATOM 9064  C CA   . TRP A 1 38  ? 1.614   8.794   0.165   1.00 0.00 ? 38  TRP A CA   6  
ATOM 9065  C C    . TRP A 1 38  ? 2.224   9.913   -0.672  1.00 0.00 ? 38  TRP A C    6  
ATOM 9066  O O    . TRP A 1 38  ? 1.506   10.703  -1.285  1.00 0.00 ? 38  TRP A O    6  
ATOM 9067  C CB   . TRP A 1 38  ? 1.894   7.440   -0.490  1.00 0.00 ? 38  TRP A CB   6  
ATOM 9068  C CG   . TRP A 1 38  ? 1.208   7.266   -1.811  1.00 0.00 ? 38  TRP A CG   6  
ATOM 9069  C CD1  . TRP A 1 38  ? 1.711   7.574   -3.043  1.00 0.00 ? 38  TRP A CD1  6  
ATOM 9070  C CD2  . TRP A 1 38  ? -0.108  6.745   -2.031  1.00 0.00 ? 38  TRP A CD2  6  
ATOM 9071  N NE1  . TRP A 1 38  ? 0.787   7.276   -4.016  1.00 0.00 ? 38  TRP A NE1  6  
ATOM 9072  C CE2  . TRP A 1 38  ? -0.336  6.765   -3.421  1.00 0.00 ? 38  TRP A CE2  6  
ATOM 9073  C CE3  . TRP A 1 38  ? -1.114  6.263   -1.190  1.00 0.00 ? 38  TRP A CE3  6  
ATOM 9074  C CZ2  . TRP A 1 38  ? -1.530  6.322   -3.985  1.00 0.00 ? 38  TRP A CZ2  6  
ATOM 9075  C CZ3  . TRP A 1 38  ? -2.298  5.823   -1.752  1.00 0.00 ? 38  TRP A CZ3  6  
ATOM 9076  C CH2  . TRP A 1 38  ? -2.497  5.855   -3.138  1.00 0.00 ? 38  TRP A CH2  6  
ATOM 9077  H H    . TRP A 1 38  ? -0.364  9.231   -0.453  1.00 0.00 ? 38  TRP A H    6  
ATOM 9078  H HA   . TRP A 1 38  ? 2.063   8.808   1.147   1.00 0.00 ? 38  TRP A HA   6  
ATOM 9079  H HB2  . TRP A 1 38  ? 2.957   7.338   -0.651  1.00 0.00 ? 38  TRP A HB2  6  
ATOM 9080  H HB3  . TRP A 1 38  ? 1.555   6.653   0.169   1.00 0.00 ? 38  TRP A HB3  6  
ATOM 9081  H HD1  . TRP A 1 38  ? 2.691   7.991   -3.212  1.00 0.00 ? 38  TRP A HD1  6  
ATOM 9082  H HE1  . TRP A 1 38  ? 0.914   7.406   -4.979  1.00 0.00 ? 38  TRP A HE1  6  
ATOM 9083  H HE3  . TRP A 1 38  ? -0.979  6.230   -0.119  1.00 0.00 ? 38  TRP A HE3  6  
ATOM 9084  H HZ2  . TRP A 1 38  ? -1.699  6.339   -5.052  1.00 0.00 ? 38  TRP A HZ2  6  
ATOM 9085  H HZ3  . TRP A 1 38  ? -3.087  5.447   -1.117  1.00 0.00 ? 38  TRP A HZ3  6  
ATOM 9086  H HH2  . TRP A 1 38  ? -3.438  5.502   -3.533  1.00 0.00 ? 38  TRP A HH2  6  
ATOM 9087  N N    . GLU A 1 39  ? 3.552   9.974   -0.693  1.00 0.00 ? 39  GLU A N    6  
ATOM 9088  C CA   . GLU A 1 39  ? 4.257   10.998  -1.455  1.00 0.00 ? 39  GLU A CA   6  
ATOM 9089  C C    . GLU A 1 39  ? 5.056   10.374  -2.596  1.00 0.00 ? 39  GLU A C    6  
ATOM 9090  O O    . GLU A 1 39  ? 5.282   9.164   -2.622  1.00 0.00 ? 39  GLU A O    6  
ATOM 9091  C CB   . GLU A 1 39  ? 5.190   11.795  -0.540  1.00 0.00 ? 39  GLU A CB   6  
ATOM 9092  C CG   . GLU A 1 39  ? 4.510   12.964  0.153   1.00 0.00 ? 39  GLU A CG   6  
ATOM 9093  C CD   . GLU A 1 39  ? 4.444   14.201  -0.721  1.00 0.00 ? 39  GLU A CD   6  
ATOM 9094  O OE1  . GLU A 1 39  ? 5.509   14.791  -0.998  1.00 0.00 ? 39  GLU A OE1  6  
ATOM 9095  O OE2  . GLU A 1 39  ? 3.325   14.579  -1.129  1.00 0.00 ? 39  GLU A OE2  6  
ATOM 9096  H H    . GLU A 1 39  ? 4.069   9.316   -0.184  1.00 0.00 ? 39  GLU A H    6  
ATOM 9097  H HA   . GLU A 1 39  ? 3.520   11.668  -1.872  1.00 0.00 ? 39  GLU A HA   6  
ATOM 9098  H HB2  . GLU A 1 39  ? 5.583   11.133  0.217   1.00 0.00 ? 39  GLU A HB2  6  
ATOM 9099  H HB3  . GLU A 1 39  ? 6.009   12.179  -1.129  1.00 0.00 ? 39  GLU A HB3  6  
ATOM 9100  H HG2  . GLU A 1 39  ? 3.505   12.674  0.417   1.00 0.00 ? 39  GLU A HG2  6  
ATOM 9101  H HG3  . GLU A 1 39  ? 5.062   13.204  1.050   1.00 0.00 ? 39  GLU A HG3  6  
ATOM 9102  N N    . THR A 1 40  ? 5.481   11.210  -3.539  1.00 0.00 ? 40  THR A N    6  
ATOM 9103  C CA   . THR A 1 40  ? 6.252   10.741  -4.683  1.00 0.00 ? 40  THR A CA   6  
ATOM 9104  C C    . THR A 1 40  ? 7.740   10.685  -4.357  1.00 0.00 ? 40  THR A C    6  
ATOM 9105  O O    . THR A 1 40  ? 8.307   11.608  -3.770  1.00 0.00 ? 40  THR A O    6  
ATOM 9106  C CB   . THR A 1 40  ? 6.041   11.647  -5.911  1.00 0.00 ? 40  THR A CB   6  
ATOM 9107  O OG1  . THR A 1 40  ? 4.683   11.562  -6.354  1.00 0.00 ? 40  THR A OG1  6  
ATOM 9108  C CG2  . THR A 1 40  ? 6.975   11.248  -7.044  1.00 0.00 ? 40  THR A CG2  6  
ATOM 9109  H H    . THR A 1 40  ? 5.268   12.163  -3.462  1.00 0.00 ? 40  THR A H    6  
ATOM 9110  H HA   . THR A 1 40  ? 5.910   9.747   -4.932  1.00 0.00 ? 40  THR A HA   6  
ATOM 9111  H HB   . THR A 1 40  ? 6.257   12.667  -5.628  1.00 0.00 ? 40  THR A HB   6  
ATOM 9112  H HG1  . THR A 1 40  ? 4.607   10.882  -7.029  1.00 0.00 ? 40  THR A HG1  6  
ATOM 9113  H HG21 . THR A 1 40  ? 6.975   12.020  -7.799  1.00 0.00 ? 40  THR A HG21 6  
ATOM 9114  H HG22 . THR A 1 40  ? 6.638   10.319  -7.478  1.00 0.00 ? 40  THR A HG22 6  
ATOM 9115  H HG23 . THR A 1 40  ? 7.976   11.123  -6.658  1.00 0.00 ? 40  THR A HG23 6  
ATOM 9116  N N    . PRO A 1 41  ? 8.391   9.578   -4.745  1.00 0.00 ? 41  PRO A N    6  
ATOM 9117  C CA   . PRO A 1 41  ? 9.823   9.376   -4.505  1.00 0.00 ? 41  PRO A CA   6  
ATOM 9118  C C    . PRO A 1 41  ? 10.689  10.301  -5.353  1.00 0.00 ? 41  PRO A C    6  
ATOM 9119  O O    . PRO A 1 41  ? 10.749  10.164  -6.575  1.00 0.00 ? 41  PRO A O    6  
ATOM 9120  C CB   . PRO A 1 41  ? 10.047  7.916   -4.906  1.00 0.00 ? 41  PRO A CB   6  
ATOM 9121  C CG   . PRO A 1 41  ? 8.963   7.621   -5.884  1.00 0.00 ? 41  PRO A CG   6  
ATOM 9122  C CD   . PRO A 1 41  ? 7.778   8.439   -5.449  1.00 0.00 ? 41  PRO A CD   6  
ATOM 9123  H HA   . PRO A 1 41  ? 10.073  9.507   -3.462  1.00 0.00 ? 41  PRO A HA   6  
ATOM 9124  H HB2  . PRO A 1 41  ? 11.025  7.810   -5.355  1.00 0.00 ? 41  PRO A HB2  6  
ATOM 9125  H HB3  . PRO A 1 41  ? 9.974   7.284   -4.034  1.00 0.00 ? 41  PRO A HB3  6  
ATOM 9126  H HG2  . PRO A 1 41  ? 9.274   7.911   -6.876  1.00 0.00 ? 41  PRO A HG2  6  
ATOM 9127  H HG3  . PRO A 1 41  ? 8.721   6.569   -5.858  1.00 0.00 ? 41  PRO A HG3  6  
ATOM 9128  H HD2  . PRO A 1 41  ? 7.215   8.773   -6.307  1.00 0.00 ? 41  PRO A HD2  6  
ATOM 9129  H HD3  . PRO A 1 41  ? 7.150   7.867   -4.782  1.00 0.00 ? 41  PRO A HD3  6  
ATOM 9130  N N    . VAL A 1 42  ? 11.359  11.244  -4.698  1.00 0.00 ? 42  VAL A N    6  
ATOM 9131  C CA   . VAL A 1 42  ? 12.223  12.191  -5.392  1.00 0.00 ? 42  VAL A CA   6  
ATOM 9132  C C    . VAL A 1 42  ? 13.129  11.478  -6.390  1.00 0.00 ? 42  VAL A C    6  
ATOM 9133  O O    . VAL A 1 42  ? 13.272  11.911  -7.533  1.00 0.00 ? 42  VAL A O    6  
ATOM 9134  C CB   . VAL A 1 42  ? 13.094  12.986  -4.402  1.00 0.00 ? 42  VAL A CB   6  
ATOM 9135  C CG1  . VAL A 1 42  ? 12.222  13.780  -3.442  1.00 0.00 ? 42  VAL A CG1  6  
ATOM 9136  C CG2  . VAL A 1 42  ? 14.024  12.052  -3.642  1.00 0.00 ? 42  VAL A CG2  6  
ATOM 9137  H H    . VAL A 1 42  ? 11.270  11.303  -3.724  1.00 0.00 ? 42  VAL A H    6  
ATOM 9138  H HA   . VAL A 1 42  ? 11.594  12.888  -5.926  1.00 0.00 ? 42  VAL A HA   6  
ATOM 9139  H HB   . VAL A 1 42  ? 13.699  13.682  -4.964  1.00 0.00 ? 42  VAL A HB   6  
ATOM 9140  H HG11 . VAL A 1 42  ? 11.706  14.558  -3.985  1.00 0.00 ? 42  VAL A HG11 6  
ATOM 9141  H HG12 . VAL A 1 42  ? 11.501  13.121  -2.981  1.00 0.00 ? 42  VAL A HG12 6  
ATOM 9142  H HG13 . VAL A 1 42  ? 12.842  14.227  -2.678  1.00 0.00 ? 42  VAL A HG13 6  
ATOM 9143  H HG21 . VAL A 1 42  ? 14.437  12.571  -2.790  1.00 0.00 ? 42  VAL A HG21 6  
ATOM 9144  H HG22 . VAL A 1 42  ? 13.470  11.189  -3.303  1.00 0.00 ? 42  VAL A HG22 6  
ATOM 9145  H HG23 . VAL A 1 42  ? 14.824  11.732  -4.292  1.00 0.00 ? 42  VAL A HG23 6  
ATOM 9146  N N    . SER A 1 43  ? 13.738  10.382  -5.950  1.00 0.00 ? 43  SER A N    6  
ATOM 9147  C CA   . SER A 1 43  ? 14.634  9.610   -6.804  1.00 0.00 ? 43  SER A CA   6  
ATOM 9148  C C    . SER A 1 43  ? 13.843  8.779   -7.809  1.00 0.00 ? 43  SER A C    6  
ATOM 9149  O O    . SER A 1 43  ? 12.616  8.709   -7.746  1.00 0.00 ? 43  SER A O    6  
ATOM 9150  C CB   . SER A 1 43  ? 15.520  8.696   -5.955  1.00 0.00 ? 43  SER A CB   6  
ATOM 9151  O OG   . SER A 1 43  ? 16.764  8.459   -6.591  1.00 0.00 ? 43  SER A OG   6  
ATOM 9152  H H    . SER A 1 43  ? 13.584  10.087  -5.028  1.00 0.00 ? 43  SER A H    6  
ATOM 9153  H HA   . SER A 1 43  ? 15.260  10.306  -7.342  1.00 0.00 ? 43  SER A HA   6  
ATOM 9154  H HB2  . SER A 1 43  ? 15.702  9.162   -4.999  1.00 0.00 ? 43  SER A HB2  6  
ATOM 9155  H HB3  . SER A 1 43  ? 15.019  7.751   -5.805  1.00 0.00 ? 43  SER A HB3  6  
ATOM 9156  H HG   . SER A 1 43  ? 16.817  8.979   -7.396  1.00 0.00 ? 43  SER A HG   6  
ATOM 9157  N N    . GLY A 1 44  ? 14.556  8.150   -8.739  1.00 0.00 ? 44  GLY A N    6  
ATOM 9158  C CA   . GLY A 1 44  ? 13.906  7.332   -9.746  1.00 0.00 ? 44  GLY A CA   6  
ATOM 9159  C C    . GLY A 1 44  ? 14.486  7.545   -11.130 1.00 0.00 ? 44  GLY A C    6  
ATOM 9160  O O    . GLY A 1 44  ? 15.095  8.579   -11.402 1.00 0.00 ? 44  GLY A O    6  
ATOM 9161  H H    . GLY A 1 44  ? 15.532  8.242   -8.741  1.00 0.00 ? 44  GLY A H    6  
ATOM 9162  H HA2  . GLY A 1 44  ? 14.017  6.292   -9.476  1.00 0.00 ? 44  GLY A HA2  6  
ATOM 9163  H HA3  . GLY A 1 44  ? 12.854  7.577   -9.767  1.00 0.00 ? 44  GLY A HA3  6  
ATOM 9164  N N    . ASN A 1 45  ? 14.298  6.564   -12.006 1.00 0.00 ? 45  ASN A N    6  
ATOM 9165  C CA   . ASN A 1 45  ? 14.810  6.649   -13.369 1.00 0.00 ? 45  ASN A CA   6  
ATOM 9166  C C    . ASN A 1 45  ? 13.717  7.099   -14.334 1.00 0.00 ? 45  ASN A C    6  
ATOM 9167  O O    . ASN A 1 45  ? 13.071  6.277   -14.983 1.00 0.00 ? 45  ASN A O    6  
ATOM 9168  C CB   . ASN A 1 45  ? 15.370  5.295   -13.811 1.00 0.00 ? 45  ASN A CB   6  
ATOM 9169  C CG   . ASN A 1 45  ? 16.457  5.433   -14.859 1.00 0.00 ? 45  ASN A CG   6  
ATOM 9170  O OD1  . ASN A 1 45  ? 17.475  6.087   -14.632 1.00 0.00 ? 45  ASN A OD1  6  
ATOM 9171  N ND2  . ASN A 1 45  ? 16.244  4.816   -16.016 1.00 0.00 ? 45  ASN A ND2  6  
ATOM 9172  H H    . ASN A 1 45  ? 13.804  5.764   -11.730 1.00 0.00 ? 45  ASN A H    6  
ATOM 9173  H HA   . ASN A 1 45  ? 15.606  7.378   -13.380 1.00 0.00 ? 45  ASN A HA   6  
ATOM 9174  H HB2  . ASN A 1 45  ? 15.786  4.787   -12.953 1.00 0.00 ? 45  ASN A HB2  6  
ATOM 9175  H HB3  . ASN A 1 45  ? 14.570  4.698   -14.223 1.00 0.00 ? 45  ASN A HB3  6  
ATOM 9176  H HD21 . ASN A 1 45  ? 15.410  4.313   -16.127 1.00 0.00 ? 45  ASN A HD21 6  
ATOM 9177  H HD22 . ASN A 1 45  ? 16.931  4.888   -16.711 1.00 0.00 ? 45  ASN A HD22 6  
ATOM 9178  N N    . GLY A 1 46  ? 13.516  8.410   -14.422 1.00 0.00 ? 46  GLY A N    6  
ATOM 9179  C CA   . GLY A 1 46  ? 12.501  8.947   -15.309 1.00 0.00 ? 46  GLY A CA   6  
ATOM 9180  C C    . GLY A 1 46  ? 11.238  9.347   -14.571 1.00 0.00 ? 46  GLY A C    6  
ATOM 9181  O O    . GLY A 1 46  ? 11.295  9.767   -13.416 1.00 0.00 ? 46  GLY A O    6  
ATOM 9182  H H    . GLY A 1 46  ? 14.061  9.018   -13.879 1.00 0.00 ? 46  GLY A H    6  
ATOM 9183  H HA2  . GLY A 1 46  ? 12.901  9.814   -15.813 1.00 0.00 ? 46  GLY A HA2  6  
ATOM 9184  H HA3  . GLY A 1 46  ? 12.250  8.198   -16.046 1.00 0.00 ? 46  GLY A HA3  6  
ATOM 9185  N N    . GLU A 1 47  ? 10.097  9.218   -15.241 1.00 0.00 ? 47  GLU A N    6  
ATOM 9186  C CA   . GLU A 1 47  ? 8.816   9.573   -14.641 1.00 0.00 ? 47  GLU A CA   6  
ATOM 9187  C C    . GLU A 1 47  ? 8.021   8.322   -14.278 1.00 0.00 ? 47  GLU A C    6  
ATOM 9188  O O    . GLU A 1 47  ? 8.384   7.210   -14.662 1.00 0.00 ? 47  GLU A O    6  
ATOM 9189  C CB   . GLU A 1 47  ? 8.004   10.447  -15.599 1.00 0.00 ? 47  GLU A CB   6  
ATOM 9190  C CG   . GLU A 1 47  ? 7.445   9.688   -16.791 1.00 0.00 ? 47  GLU A CG   6  
ATOM 9191  C CD   . GLU A 1 47  ? 6.793   10.602  -17.810 1.00 0.00 ? 47  GLU A CD   6  
ATOM 9192  O OE1  . GLU A 1 47  ? 5.607   10.947  -17.623 1.00 0.00 ? 47  GLU A OE1  6  
ATOM 9193  O OE2  . GLU A 1 47  ? 7.466   10.971  -18.794 1.00 0.00 ? 47  GLU A OE2  6  
ATOM 9194  H H    . GLU A 1 47  ? 10.117  8.878   -16.159 1.00 0.00 ? 47  GLU A H    6  
ATOM 9195  H HA   . GLU A 1 47  ? 9.016   10.132  -13.740 1.00 0.00 ? 47  GLU A HA   6  
ATOM 9196  H HB2  . GLU A 1 47  ? 7.178   10.884  -15.056 1.00 0.00 ? 47  GLU A HB2  6  
ATOM 9197  H HB3  . GLU A 1 47  ? 8.638   11.239  -15.969 1.00 0.00 ? 47  GLU A HB3  6  
ATOM 9198  H HG2  . GLU A 1 47  ? 8.252   9.155   -17.272 1.00 0.00 ? 47  GLU A HG2  6  
ATOM 9199  H HG3  . GLU A 1 47  ? 6.709   8.982   -16.438 1.00 0.00 ? 47  GLU A HG3  6  
ATOM 9200  N N    . ILE A 1 48  ? 6.935   8.514   -13.536 1.00 0.00 ? 48  ILE A N    6  
ATOM 9201  C CA   . ILE A 1 48  ? 6.088   7.402   -13.122 1.00 0.00 ? 48  ILE A CA   6  
ATOM 9202  C C    . ILE A 1 48  ? 4.868   7.273   -14.028 1.00 0.00 ? 48  ILE A C    6  
ATOM 9203  O O    . ILE A 1 48  ? 4.305   8.274   -14.472 1.00 0.00 ? 48  ILE A O    6  
ATOM 9204  C CB   . ILE A 1 48  ? 5.617   7.566   -11.665 1.00 0.00 ? 48  ILE A CB   6  
ATOM 9205  C CG1  . ILE A 1 48  ? 6.811   7.843   -10.749 1.00 0.00 ? 48  ILE A CG1  6  
ATOM 9206  C CG2  . ILE A 1 48  ? 4.869   6.322   -11.207 1.00 0.00 ? 48  ILE A CG2  6  
ATOM 9207  C CD1  . ILE A 1 48  ? 7.800   6.702   -10.683 1.00 0.00 ? 48  ILE A CD1  6  
ATOM 9208  H H    . ILE A 1 48  ? 6.698   9.424   -13.262 1.00 0.00 ? 48  ILE A H    6  
ATOM 9209  H HA   . ILE A 1 48  ? 6.671   6.495   -13.191 1.00 0.00 ? 48  ILE A HA   6  
ATOM 9210  H HB   . ILE A 1 48  ? 4.937   8.402   -11.622 1.00 0.00 ? 48  ILE A HB   6  
ATOM 9211  H HG12 . ILE A 1 48  ? 7.335   8.716   -11.105 1.00 0.00 ? 48  ILE A HG12 6  
ATOM 9212  H HG13 . ILE A 1 48  ? 6.450   8.029   -9.747  1.00 0.00 ? 48  ILE A HG13 6  
ATOM 9213  H HG21 . ILE A 1 48  ? 3.833   6.571   -11.028 1.00 0.00 ? 48  ILE A HG21 6  
ATOM 9214  H HG22 . ILE A 1 48  ? 4.929   5.564   -11.974 1.00 0.00 ? 48  ILE A HG22 6  
ATOM 9215  H HG23 . ILE A 1 48  ? 5.313   5.950   -10.297 1.00 0.00 ? 48  ILE A HG23 6  
ATOM 9216  H HD11 . ILE A 1 48  ? 7.408   5.921   -10.048 1.00 0.00 ? 48  ILE A HD11 6  
ATOM 9217  H HD12 . ILE A 1 48  ? 7.967   6.311   -11.675 1.00 0.00 ? 48  ILE A HD12 6  
ATOM 9218  H HD13 . ILE A 1 48  ? 8.735   7.059   -10.275 1.00 0.00 ? 48  ILE A HD13 6  
ATOM 9219  N N    . GLN A 1 49  ? 4.463   6.036   -14.294 1.00 0.00 ? 49  GLN A N    6  
ATOM 9220  C CA   . GLN A 1 49  ? 3.309   5.777   -15.146 1.00 0.00 ? 49  GLN A CA   6  
ATOM 9221  C C    . GLN A 1 49  ? 2.024   5.739   -14.325 1.00 0.00 ? 49  GLN A C    6  
ATOM 9222  O O    . GLN A 1 49  ? 1.084   6.487   -14.590 1.00 0.00 ? 49  GLN A O    6  
ATOM 9223  C CB   . GLN A 1 49  ? 3.488   4.456   -15.897 1.00 0.00 ? 49  GLN A CB   6  
ATOM 9224  C CG   . GLN A 1 49  ? 4.603   4.489   -16.928 1.00 0.00 ? 49  GLN A CG   6  
ATOM 9225  C CD   . GLN A 1 49  ? 4.280   5.382   -18.110 1.00 0.00 ? 49  GLN A CD   6  
ATOM 9226  O OE1  . GLN A 1 49  ? 3.318   6.151   -18.077 1.00 0.00 ? 49  GLN A OE1  6  
ATOM 9227  N NE2  . GLN A 1 49  ? 5.083   5.285   -19.163 1.00 0.00 ? 49  GLN A NE2  6  
ATOM 9228  H H    . GLN A 1 49  ? 4.953   5.280   -13.910 1.00 0.00 ? 49  GLN A H    6  
ATOM 9229  H HA   . GLN A 1 49  ? 3.239   6.581   -15.863 1.00 0.00 ? 49  GLN A HA   6  
ATOM 9230  H HB2  . GLN A 1 49  ? 3.709   3.677   -15.182 1.00 0.00 ? 49  GLN A HB2  6  
ATOM 9231  H HB3  . GLN A 1 49  ? 2.565   4.216   -16.404 1.00 0.00 ? 49  GLN A HB3  6  
ATOM 9232  H HG2  . GLN A 1 49  ? 5.503   4.856   -16.456 1.00 0.00 ? 49  GLN A HG2  6  
ATOM 9233  H HG3  . GLN A 1 49  ? 4.772   3.485   -17.290 1.00 0.00 ? 49  GLN A HG3  6  
ATOM 9234  H HE21 . GLN A 1 49  ? 5.829   4.650   -19.119 1.00 0.00 ? 49  GLN A HE21 6  
ATOM 9235  H HE22 . GLN A 1 49  ? 4.897   5.850   -19.940 1.00 0.00 ? 49  GLN A HE22 6  
ATOM 9236  N N    . ASN A 1 50  ? 1.992   4.862   -13.327 1.00 0.00 ? 50  ASN A N    6  
ATOM 9237  C CA   . ASN A 1 50  ? 0.822   4.725   -12.466 1.00 0.00 ? 50  ASN A CA   6  
ATOM 9238  C C    . ASN A 1 50  ? 1.229   4.315   -11.055 1.00 0.00 ? 50  ASN A C    6  
ATOM 9239  O O    . ASN A 1 50  ? 2.368   3.909   -10.819 1.00 0.00 ? 50  ASN A O    6  
ATOM 9240  C CB   . ASN A 1 50  ? -0.148  3.695   -13.049 1.00 0.00 ? 50  ASN A CB   6  
ATOM 9241  C CG   . ASN A 1 50  ? 0.134   2.290   -12.554 1.00 0.00 ? 50  ASN A CG   6  
ATOM 9242  O OD1  . ASN A 1 50  ? 1.069   1.634   -13.014 1.00 0.00 ? 50  ASN A OD1  6  
ATOM 9243  N ND2  . ASN A 1 50  ? -0.675  1.822   -11.611 1.00 0.00 ? 50  ASN A ND2  6  
ATOM 9244  H H    . ASN A 1 50  ? 2.773   4.293   -13.164 1.00 0.00 ? 50  ASN A H    6  
ATOM 9245  H HA   . ASN A 1 50  ? 0.330   5.685   -12.422 1.00 0.00 ? 50  ASN A HA   6  
ATOM 9246  H HB2  . ASN A 1 50  ? -1.157  3.960   -12.767 1.00 0.00 ? 50  ASN A HB2  6  
ATOM 9247  H HB3  . ASN A 1 50  ? -0.067  3.701   -14.126 1.00 0.00 ? 50  ASN A HB3  6  
ATOM 9248  H HD21 . ASN A 1 50  ? -1.399  2.401   -11.292 1.00 0.00 ? 50  ASN A HD21 6  
ATOM 9249  H HD22 . ASN A 1 50  ? -0.515  0.916   -11.272 1.00 0.00 ? 50  ASN A HD22 6  
ATOM 9250  N N    . TYR A 1 51  ? 0.292   4.423   -10.120 1.00 0.00 ? 51  TYR A N    6  
ATOM 9251  C CA   . TYR A 1 51  ? 0.554   4.065   -8.731  1.00 0.00 ? 51  TYR A CA   6  
ATOM 9252  C C    . TYR A 1 51  ? -0.278  2.855   -8.314  1.00 0.00 ? 51  TYR A C    6  
ATOM 9253  O O    . TYR A 1 51  ? -1.502  2.851   -8.451  1.00 0.00 ? 51  TYR A O    6  
ATOM 9254  C CB   . TYR A 1 51  ? 0.249   5.248   -7.811  1.00 0.00 ? 51  TYR A CB   6  
ATOM 9255  C CG   . TYR A 1 51  ? 1.328   6.308   -7.810  1.00 0.00 ? 51  TYR A CG   6  
ATOM 9256  C CD1  . TYR A 1 51  ? 2.538   6.094   -7.161  1.00 0.00 ? 51  TYR A CD1  6  
ATOM 9257  C CD2  . TYR A 1 51  ? 1.137   7.522   -8.458  1.00 0.00 ? 51  TYR A CD2  6  
ATOM 9258  C CE1  . TYR A 1 51  ? 3.526   7.059   -7.157  1.00 0.00 ? 51  TYR A CE1  6  
ATOM 9259  C CE2  . TYR A 1 51  ? 2.121   8.492   -8.460  1.00 0.00 ? 51  TYR A CE2  6  
ATOM 9260  C CZ   . TYR A 1 51  ? 3.313   8.256   -7.808  1.00 0.00 ? 51  TYR A CZ   6  
ATOM 9261  O OH   . TYR A 1 51  ? 4.295   9.221   -7.807  1.00 0.00 ? 51  TYR A OH   6  
ATOM 9262  H H    . TYR A 1 51  ? -0.596  4.753   -10.369 1.00 0.00 ? 51  TYR A H    6  
ATOM 9263  H HA   . TYR A 1 51  ? 1.601   3.814   -8.644  1.00 0.00 ? 51  TYR A HA   6  
ATOM 9264  H HB2  . TYR A 1 51  ? -0.671  5.714   -8.127  1.00 0.00 ? 51  TYR A HB2  6  
ATOM 9265  H HB3  . TYR A 1 51  ? 0.136   4.889   -6.798  1.00 0.00 ? 51  TYR A HB3  6  
ATOM 9266  H HD1  . TYR A 1 51  ? 2.702   5.156   -6.652  1.00 0.00 ? 51  TYR A HD1  6  
ATOM 9267  H HD2  . TYR A 1 51  ? 0.202   7.704   -8.967  1.00 0.00 ? 51  TYR A HD2  6  
ATOM 9268  H HE1  . TYR A 1 51  ? 4.461   6.875   -6.647  1.00 0.00 ? 51  TYR A HE1  6  
ATOM 9269  H HE2  . TYR A 1 51  ? 1.954   9.430   -8.969  1.00 0.00 ? 51  TYR A HE2  6  
ATOM 9270  H HH   . TYR A 1 51  ? 4.963   8.998   -8.460  1.00 0.00 ? 51  TYR A HH   6  
ATOM 9271  N N    . LYS A 1 52  ? 0.395   1.830   -7.803  1.00 0.00 ? 52  LYS A N    6  
ATOM 9272  C CA   . LYS A 1 52  ? -0.279  0.614   -7.364  1.00 0.00 ? 52  LYS A CA   6  
ATOM 9273  C C    . LYS A 1 52  ? -0.460  0.610   -5.849  1.00 0.00 ? 52  LYS A C    6  
ATOM 9274  O O    . LYS A 1 52  ? 0.481   0.873   -5.100  1.00 0.00 ? 52  LYS A O    6  
ATOM 9275  C CB   . LYS A 1 52  ? 0.517   -0.619  -7.796  1.00 0.00 ? 52  LYS A CB   6  
ATOM 9276  C CG   . LYS A 1 52  ? -0.314  -1.890  -7.853  1.00 0.00 ? 52  LYS A CG   6  
ATOM 9277  C CD   . LYS A 1 52  ? -1.281  -1.871  -9.024  1.00 0.00 ? 52  LYS A CD   6  
ATOM 9278  C CE   . LYS A 1 52  ? -0.576  -2.183  -10.335 1.00 0.00 ? 52  LYS A CE   6  
ATOM 9279  N NZ   . LYS A 1 52  ? -0.133  -3.603  -10.403 1.00 0.00 ? 52  LYS A NZ   6  
ATOM 9280  H H    . LYS A 1 52  ? 1.370   1.893   -7.719  1.00 0.00 ? 52  LYS A H    6  
ATOM 9281  H HA   . LYS A 1 52  ? -1.251  0.587   -7.831  1.00 0.00 ? 52  LYS A HA   6  
ATOM 9282  H HB2  . LYS A 1 52  ? 0.931   -0.440  -8.777  1.00 0.00 ? 52  LYS A HB2  6  
ATOM 9283  H HB3  . LYS A 1 52  ? 1.326   -0.774  -7.096  1.00 0.00 ? 52  LYS A HB3  6  
ATOM 9284  H HG2  . LYS A 1 52  ? 0.347   -2.737  -7.960  1.00 0.00 ? 52  LYS A HG2  6  
ATOM 9285  H HG3  . LYS A 1 52  ? -0.876  -1.983  -6.935  1.00 0.00 ? 52  LYS A HG3  6  
ATOM 9286  H HD2  . LYS A 1 52  ? -2.049  -2.612  -8.857  1.00 0.00 ? 52  LYS A HD2  6  
ATOM 9287  H HD3  . LYS A 1 52  ? -1.732  -0.891  -9.092  1.00 0.00 ? 52  LYS A HD3  6  
ATOM 9288  H HE2  . LYS A 1 52  ? -1.256  -1.987  -11.150 1.00 0.00 ? 52  LYS A HE2  6  
ATOM 9289  H HE3  . LYS A 1 52  ? 0.288   -1.540  -10.425 1.00 0.00 ? 52  LYS A HE3  6  
ATOM 9290  H HZ1  . LYS A 1 52  ? -0.602  -4.159  -9.660  1.00 0.00 ? 52  LYS A HZ1  6  
ATOM 9291  H HZ2  . LYS A 1 52  ? 0.896   -3.663  -10.267 1.00 0.00 ? 52  LYS A HZ2  6  
ATOM 9292  H HZ3  . LYS A 1 52  ? -0.374  -4.009  -11.329 1.00 0.00 ? 52  LYS A HZ3  6  
ATOM 9293  N N    . LEU A 1 53  ? -1.675  0.309   -5.405  1.00 0.00 ? 53  LEU A N    6  
ATOM 9294  C CA   . LEU A 1 53  ? -1.980  0.268   -3.978  1.00 0.00 ? 53  LEU A CA   6  
ATOM 9295  C C    . LEU A 1 53  ? -2.619  -1.062  -3.595  1.00 0.00 ? 53  LEU A C    6  
ATOM 9296  O O    . LEU A 1 53  ? -3.708  -1.397  -4.062  1.00 0.00 ? 53  LEU A O    6  
ATOM 9297  C CB   . LEU A 1 53  ? -2.912  1.422   -3.603  1.00 0.00 ? 53  LEU A CB   6  
ATOM 9298  C CG   . LEU A 1 53  ? -3.554  1.342   -2.218  1.00 0.00 ? 53  LEU A CG   6  
ATOM 9299  C CD1  . LEU A 1 53  ? -2.496  1.464   -1.132  1.00 0.00 ? 53  LEU A CD1  6  
ATOM 9300  C CD2  . LEU A 1 53  ? -4.612  2.424   -2.057  1.00 0.00 ? 53  LEU A CD2  6  
ATOM 9301  H H    . LEU A 1 53  ? -2.385  0.108   -6.049  1.00 0.00 ? 53  LEU A H    6  
ATOM 9302  H HA   . LEU A 1 53  ? -1.051  0.377   -3.438  1.00 0.00 ? 53  LEU A HA   6  
ATOM 9303  H HB2  . LEU A 1 53  ? -2.342  2.337   -3.652  1.00 0.00 ? 53  LEU A HB2  6  
ATOM 9304  H HB3  . LEU A 1 53  ? -3.706  1.455   -4.336  1.00 0.00 ? 53  LEU A HB3  6  
ATOM 9305  H HG   . LEU A 1 53  ? -4.037  0.381   -2.106  1.00 0.00 ? 53  LEU A HG   6  
ATOM 9306  H HD11 . LEU A 1 53  ? -2.064  0.494   -0.941  1.00 0.00 ? 53  LEU A HD11 6  
ATOM 9307  H HD12 . LEU A 1 53  ? -2.951  1.840   -0.227  1.00 0.00 ? 53  LEU A HD12 6  
ATOM 9308  H HD13 . LEU A 1 53  ? -1.724  2.146   -1.456  1.00 0.00 ? 53  LEU A HD13 6  
ATOM 9309  H HD21 . LEU A 1 53  ? -5.053  2.641   -3.019  1.00 0.00 ? 53  LEU A HD21 6  
ATOM 9310  H HD22 . LEU A 1 53  ? -4.155  3.319   -1.661  1.00 0.00 ? 53  LEU A HD22 6  
ATOM 9311  H HD23 . LEU A 1 53  ? -5.379  2.080   -1.379  1.00 0.00 ? 53  LEU A HD23 6  
ATOM 9312  N N    . TYR A 1 54  ? -1.936  -1.817  -2.742  1.00 0.00 ? 54  TYR A N    6  
ATOM 9313  C CA   . TYR A 1 54  ? -2.437  -3.112  -2.296  1.00 0.00 ? 54  TYR A CA   6  
ATOM 9314  C C    . TYR A 1 54  ? -3.094  -2.998  -0.924  1.00 0.00 ? 54  TYR A C    6  
ATOM 9315  O O    . TYR A 1 54  ? -2.813  -2.072  -0.163  1.00 0.00 ? 54  TYR A O    6  
ATOM 9316  C CB   . TYR A 1 54  ? -1.299  -4.133  -2.246  1.00 0.00 ? 54  TYR A CB   6  
ATOM 9317  C CG   . TYR A 1 54  ? -0.661  -4.394  -3.592  1.00 0.00 ? 54  TYR A CG   6  
ATOM 9318  C CD1  . TYR A 1 54  ? -0.025  -3.376  -4.291  1.00 0.00 ? 54  TYR A CD1  6  
ATOM 9319  C CD2  . TYR A 1 54  ? -0.694  -5.661  -4.164  1.00 0.00 ? 54  TYR A CD2  6  
ATOM 9320  C CE1  . TYR A 1 54  ? 0.558   -3.611  -5.521  1.00 0.00 ? 54  TYR A CE1  6  
ATOM 9321  C CE2  . TYR A 1 54  ? -0.112  -5.905  -5.392  1.00 0.00 ? 54  TYR A CE2  6  
ATOM 9322  C CZ   . TYR A 1 54  ? 0.512   -4.877  -6.068  1.00 0.00 ? 54  TYR A CZ   6  
ATOM 9323  O OH   . TYR A 1 54  ? 1.094   -5.115  -7.292  1.00 0.00 ? 54  TYR A OH   6  
ATOM 9324  H H    . TYR A 1 54  ? -1.074  -1.497  -2.405  1.00 0.00 ? 54  TYR A H    6  
ATOM 9325  H HA   . TYR A 1 54  ? -3.176  -3.445  -3.010  1.00 0.00 ? 54  TYR A HA   6  
ATOM 9326  H HB2  . TYR A 1 54  ? -0.530  -3.773  -1.580  1.00 0.00 ? 54  TYR A HB2  6  
ATOM 9327  H HB3  . TYR A 1 54  ? -1.682  -5.071  -1.872  1.00 0.00 ? 54  TYR A HB3  6  
ATOM 9328  H HD1  . TYR A 1 54  ? 0.009   -2.386  -3.860  1.00 0.00 ? 54  TYR A HD1  6  
ATOM 9329  H HD2  . TYR A 1 54  ? -1.184  -6.464  -3.632  1.00 0.00 ? 54  TYR A HD2  6  
ATOM 9330  H HE1  . TYR A 1 54  ? 1.047   -2.806  -6.050  1.00 0.00 ? 54  TYR A HE1  6  
ATOM 9331  H HE2  . TYR A 1 54  ? -0.148  -6.896  -5.821  1.00 0.00 ? 54  TYR A HE2  6  
ATOM 9332  H HH   . TYR A 1 54  ? 1.560   -4.328  -7.583  1.00 0.00 ? 54  TYR A HH   6  
ATOM 9333  N N    . TYR A 1 55  ? -3.970  -3.948  -0.614  1.00 0.00 ? 55  TYR A N    6  
ATOM 9334  C CA   . TYR A 1 55  ? -4.669  -3.955  0.665   1.00 0.00 ? 55  TYR A CA   6  
ATOM 9335  C C    . TYR A 1 55  ? -5.118  -5.367  1.032   1.00 0.00 ? 55  TYR A C    6  
ATOM 9336  O O    . TYR A 1 55  ? -5.611  -6.112  0.187   1.00 0.00 ? 55  TYR A O    6  
ATOM 9337  C CB   . TYR A 1 55  ? -5.878  -3.020  0.614   1.00 0.00 ? 55  TYR A CB   6  
ATOM 9338  C CG   . TYR A 1 55  ? -6.933  -3.448  -0.381  1.00 0.00 ? 55  TYR A CG   6  
ATOM 9339  C CD1  . TYR A 1 55  ? -6.699  -3.367  -1.748  1.00 0.00 ? 55  TYR A CD1  6  
ATOM 9340  C CD2  . TYR A 1 55  ? -8.164  -3.932  0.045   1.00 0.00 ? 55  TYR A CD2  6  
ATOM 9341  C CE1  . TYR A 1 55  ? -7.660  -3.756  -2.662  1.00 0.00 ? 55  TYR A CE1  6  
ATOM 9342  C CE2  . TYR A 1 55  ? -9.130  -4.324  -0.861  1.00 0.00 ? 55  TYR A CE2  6  
ATOM 9343  C CZ   . TYR A 1 55  ? -8.873  -4.234  -2.213  1.00 0.00 ? 55  TYR A CZ   6  
ATOM 9344  O OH   . TYR A 1 55  ? -9.834  -4.623  -3.119  1.00 0.00 ? 55  TYR A OH   6  
ATOM 9345  H H    . TYR A 1 55  ? -4.152  -4.660  -1.262  1.00 0.00 ? 55  TYR A H    6  
ATOM 9346  H HA   . TYR A 1 55  ? -3.983  -3.600  1.420   1.00 0.00 ? 55  TYR A HA   6  
ATOM 9347  H HB2  . TYR A 1 55  ? -6.339  -2.985  1.590   1.00 0.00 ? 55  TYR A HB2  6  
ATOM 9348  H HB3  . TYR A 1 55  ? -5.547  -2.029  0.342   1.00 0.00 ? 55  TYR A HB3  6  
ATOM 9349  H HD1  . TYR A 1 55  ? -5.748  -2.992  -2.097  1.00 0.00 ? 55  TYR A HD1  6  
ATOM 9350  H HD2  . TYR A 1 55  ? -8.361  -4.001  1.105   1.00 0.00 ? 55  TYR A HD2  6  
ATOM 9351  H HE1  . TYR A 1 55  ? -7.459  -3.686  -3.721  1.00 0.00 ? 55  TYR A HE1  6  
ATOM 9352  H HE2  . TYR A 1 55  ? -10.080 -4.698  -0.510  1.00 0.00 ? 55  TYR A HE2  6  
ATOM 9353  H HH   . TYR A 1 55  ? -9.410  -5.013  -3.887  1.00 0.00 ? 55  TYR A HH   6  
ATOM 9354  N N    . MET A 1 56  ? -4.943  -5.725  2.300   1.00 0.00 ? 56  MET A N    6  
ATOM 9355  C CA   . MET A 1 56  ? -5.331  -7.046  2.781   1.00 0.00 ? 56  MET A CA   6  
ATOM 9356  C C    . MET A 1 56  ? -5.597  -7.021  4.283   1.00 0.00 ? 56  MET A C    6  
ATOM 9357  O O    . MET A 1 56  ? -5.165  -6.105  4.983   1.00 0.00 ? 56  MET A O    6  
ATOM 9358  C CB   . MET A 1 56  ? -4.241  -8.070  2.461   1.00 0.00 ? 56  MET A CB   6  
ATOM 9359  C CG   . MET A 1 56  ? -3.200  -8.213  3.560   1.00 0.00 ? 56  MET A CG   6  
ATOM 9360  S SD   . MET A 1 56  ? -1.655  -8.927  2.965   1.00 0.00 ? 56  MET A SD   6  
ATOM 9361  C CE   . MET A 1 56  ? -1.305  -10.107 4.266   1.00 0.00 ? 56  MET A CE   6  
ATOM 9362  H H    . MET A 1 56  ? -4.544  -5.086  2.928   1.00 0.00 ? 56  MET A H    6  
ATOM 9363  H HA   . MET A 1 56  ? -6.240  -7.330  2.271   1.00 0.00 ? 56  MET A HA   6  
ATOM 9364  H HB2  . MET A 1 56  ? -4.703  -9.033  2.305   1.00 0.00 ? 56  MET A HB2  6  
ATOM 9365  H HB3  . MET A 1 56  ? -3.736  -7.770  1.555   1.00 0.00 ? 56  MET A HB3  6  
ATOM 9366  H HG2  . MET A 1 56  ? -2.994  -7.236  3.972   1.00 0.00 ? 56  MET A HG2  6  
ATOM 9367  H HG3  . MET A 1 56  ? -3.601  -8.850  4.335   1.00 0.00 ? 56  MET A HG3  6  
ATOM 9368  H HE1  . MET A 1 56  ? -0.351  -9.875  4.715   1.00 0.00 ? 56  MET A HE1  6  
ATOM 9369  H HE2  . MET A 1 56  ? -2.079  -10.056 5.016   1.00 0.00 ? 56  MET A HE2  6  
ATOM 9370  H HE3  . MET A 1 56  ? -1.273  -11.103 3.848   1.00 0.00 ? 56  MET A HE3  6  
ATOM 9371  N N    . GLU A 1 57  ? -6.310  -8.032  4.770   1.00 0.00 ? 57  GLU A N    6  
ATOM 9372  C CA   . GLU A 1 57  ? -6.633  -8.123  6.189   1.00 0.00 ? 57  GLU A CA   6  
ATOM 9373  C C    . GLU A 1 57  ? -5.518  -8.828  6.957   1.00 0.00 ? 57  GLU A C    6  
ATOM 9374  O O    . GLU A 1 57  ? -5.068  -9.907  6.571   1.00 0.00 ? 57  GLU A O    6  
ATOM 9375  C CB   . GLU A 1 57  ? -7.954  -8.870  6.387   1.00 0.00 ? 57  GLU A CB   6  
ATOM 9376  C CG   . GLU A 1 57  ? -8.295  -9.127  7.845   1.00 0.00 ? 57  GLU A CG   6  
ATOM 9377  C CD   . GLU A 1 57  ? -9.109  -10.392 8.040   1.00 0.00 ? 57  GLU A CD   6  
ATOM 9378  O OE1  . GLU A 1 57  ? -10.102 -10.577 7.305   1.00 0.00 ? 57  GLU A OE1  6  
ATOM 9379  O OE2  . GLU A 1 57  ? -8.754  -11.196 8.926   1.00 0.00 ? 57  GLU A OE2  6  
ATOM 9380  H H    . GLU A 1 57  ? -6.626  -8.731  4.162   1.00 0.00 ? 57  GLU A H    6  
ATOM 9381  H HA   . GLU A 1 57  ? -6.737  -7.119  6.571   1.00 0.00 ? 57  GLU A HA   6  
ATOM 9382  H HB2  . GLU A 1 57  ? -8.751  -8.289  5.949   1.00 0.00 ? 57  GLU A HB2  6  
ATOM 9383  H HB3  . GLU A 1 57  ? -7.894  -9.822  5.880   1.00 0.00 ? 57  GLU A HB3  6  
ATOM 9384  H HG2  . GLU A 1 57  ? -7.377  -9.219  8.406   1.00 0.00 ? 57  GLU A HG2  6  
ATOM 9385  H HG3  . GLU A 1 57  ? -8.864  -8.289  8.222   1.00 0.00 ? 57  GLU A HG3  6  
ATOM 9386  N N    . LYS A 1 58  ? -5.075  -8.209  8.046   1.00 0.00 ? 58  LYS A N    6  
ATOM 9387  C CA   . LYS A 1 58  ? -4.014  -8.775  8.870   1.00 0.00 ? 58  LYS A CA   6  
ATOM 9388  C C    . LYS A 1 58  ? -4.354  -10.200 9.292   1.00 0.00 ? 58  LYS A C    6  
ATOM 9389  O O    . LYS A 1 58  ? -4.998  -10.417 10.318  1.00 0.00 ? 58  LYS A O    6  
ATOM 9390  C CB   . LYS A 1 58  ? -3.783  -7.906  10.109  1.00 0.00 ? 58  LYS A CB   6  
ATOM 9391  C CG   . LYS A 1 58  ? -2.352  -7.939  10.617  1.00 0.00 ? 58  LYS A CG   6  
ATOM 9392  C CD   . LYS A 1 58  ? -1.425  -7.128  9.727   1.00 0.00 ? 58  LYS A CD   6  
ATOM 9393  C CE   . LYS A 1 58  ? 0.013   -7.611  9.833   1.00 0.00 ? 58  LYS A CE   6  
ATOM 9394  N NZ   . LYS A 1 58  ? 0.987   -6.515  9.570   1.00 0.00 ? 58  LYS A NZ   6  
ATOM 9395  H H    . LYS A 1 58  ? -5.474  -7.350  8.303   1.00 0.00 ? 58  LYS A H    6  
ATOM 9396  H HA   . LYS A 1 58  ? -3.110  -8.793  8.280   1.00 0.00 ? 58  LYS A HA   6  
ATOM 9397  H HB2  . LYS A 1 58  ? -4.034  -6.883  9.868   1.00 0.00 ? 58  LYS A HB2  6  
ATOM 9398  H HB3  . LYS A 1 58  ? -4.432  -8.250  10.901  1.00 0.00 ? 58  LYS A HB3  6  
ATOM 9399  H HG2  . LYS A 1 58  ? -2.325  -7.528  11.615  1.00 0.00 ? 58  LYS A HG2  6  
ATOM 9400  H HG3  . LYS A 1 58  ? -2.011  -8.964  10.638  1.00 0.00 ? 58  LYS A HG3  6  
ATOM 9401  H HD2  . LYS A 1 58  ? -1.750  -7.223  8.701   1.00 0.00 ? 58  LYS A HD2  6  
ATOM 9402  H HD3  . LYS A 1 58  ? -1.471  -6.090  10.025  1.00 0.00 ? 58  LYS A HD3  6  
ATOM 9403  H HE2  . LYS A 1 58  ? 0.177   -7.996  10.827  1.00 0.00 ? 58  LYS A HE2  6  
ATOM 9404  H HE3  . LYS A 1 58  ? 0.168   -8.399  9.111   1.00 0.00 ? 58  LYS A HE3  6  
ATOM 9405  H HZ1  . LYS A 1 58  ? 1.847   -6.900  9.131   1.00 0.00 ? 58  LYS A HZ1  6  
ATOM 9406  H HZ2  . LYS A 1 58  ? 1.246   -6.047  10.462  1.00 0.00 ? 58  LYS A HZ2  6  
ATOM 9407  H HZ3  . LYS A 1 58  ? 0.568   -5.811  8.930   1.00 0.00 ? 58  LYS A HZ3  6  
ATOM 9408  N N    . GLY A 1 59  ? -3.915  -11.170 8.495   1.00 0.00 ? 59  GLY A N    6  
ATOM 9409  C CA   . GLY A 1 59  ? -4.182  -12.562 8.804   1.00 0.00 ? 59  GLY A CA   6  
ATOM 9410  C C    . GLY A 1 59  ? -4.913  -13.275 7.684   1.00 0.00 ? 59  GLY A C    6  
ATOM 9411  O O    . GLY A 1 59  ? -5.814  -14.077 7.932   1.00 0.00 ? 59  GLY A O    6  
ATOM 9412  H H    . GLY A 1 59  ? -3.406  -10.937 7.690   1.00 0.00 ? 59  GLY A H    6  
ATOM 9413  H HA2  . GLY A 1 59  ? -3.244  -13.066 8.985   1.00 0.00 ? 59  GLY A HA2  6  
ATOM 9414  H HA3  . GLY A 1 59  ? -4.784  -12.611 9.700   1.00 0.00 ? 59  GLY A HA3  6  
ATOM 9415  N N    . THR A 1 60  ? -4.527  -12.982 6.446   1.00 0.00 ? 60  THR A N    6  
ATOM 9416  C CA   . THR A 1 60  ? -5.154  -13.598 5.284   1.00 0.00 ? 60  THR A CA   6  
ATOM 9417  C C    . THR A 1 60  ? -4.113  -14.232 4.369   1.00 0.00 ? 60  THR A C    6  
ATOM 9418  O O    . THR A 1 60  ? -4.361  -15.271 3.757   1.00 0.00 ? 60  THR A O    6  
ATOM 9419  C CB   . THR A 1 60  ? -5.972  -12.572 4.477   1.00 0.00 ? 60  THR A CB   6  
ATOM 9420  O OG1  . THR A 1 60  ? -6.485  -11.559 5.350   1.00 0.00 ? 60  THR A OG1  6  
ATOM 9421  C CG2  . THR A 1 60  ? -7.122  -13.250 3.748   1.00 0.00 ? 60  THR A CG2  6  
ATOM 9422  H H    . THR A 1 60  ? -3.804  -12.334 6.313   1.00 0.00 ? 60  THR A H    6  
ATOM 9423  H HA   . THR A 1 60  ? -5.826  -14.367 5.636   1.00 0.00 ? 60  THR A HA   6  
ATOM 9424  H HB   . THR A 1 60  ? -5.324  -12.112 3.746   1.00 0.00 ? 60  THR A HB   6  
ATOM 9425  H HG1  . THR A 1 60  ? -5.987  -10.748 5.227   1.00 0.00 ? 60  THR A HG1  6  
ATOM 9426  H HG21 . THR A 1 60  ? -6.983  -13.148 2.682   1.00 0.00 ? 60  THR A HG21 6  
ATOM 9427  H HG22 . THR A 1 60  ? -8.054  -12.787 4.036   1.00 0.00 ? 60  THR A HG22 6  
ATOM 9428  H HG23 . THR A 1 60  ? -7.145  -14.298 4.009   1.00 0.00 ? 60  THR A HG23 6  
ATOM 9429  N N    . ASP A 1 61  ? -2.947  -13.602 4.281   1.00 0.00 ? 61  ASP A N    6  
ATOM 9430  C CA   . ASP A 1 61  ? -1.866  -14.106 3.442   1.00 0.00 ? 61  ASP A CA   6  
ATOM 9431  C C    . ASP A 1 61  ? -2.189  -13.910 1.964   1.00 0.00 ? 61  ASP A C    6  
ATOM 9432  O O    . ASP A 1 61  ? -1.686  -14.635 1.105   1.00 0.00 ? 61  ASP A O    6  
ATOM 9433  C CB   . ASP A 1 61  ? -1.617  -15.587 3.730   1.00 0.00 ? 61  ASP A CB   6  
ATOM 9434  C CG   . ASP A 1 61  ? -0.221  -16.027 3.335   1.00 0.00 ? 61  ASP A CG   6  
ATOM 9435  O OD1  . ASP A 1 61  ? 0.749   -15.568 3.975   1.00 0.00 ? 61  ASP A OD1  6  
ATOM 9436  O OD2  . ASP A 1 61  ? -0.098  -16.830 2.387   1.00 0.00 ? 61  ASP A OD2  6  
ATOM 9437  H H    . ASP A 1 61  ? -2.809  -12.777 4.793   1.00 0.00 ? 61  ASP A H    6  
ATOM 9438  H HA   . ASP A 1 61  ? -0.973  -13.547 3.679   1.00 0.00 ? 61  ASP A HA   6  
ATOM 9439  H HB2  . ASP A 1 61  ? -1.746  -15.768 4.787   1.00 0.00 ? 61  ASP A HB2  6  
ATOM 9440  H HB3  . ASP A 1 61  ? -2.332  -16.180 3.177   1.00 0.00 ? 61  ASP A HB3  6  
ATOM 9441  N N    . LYS A 1 62  ? -3.033  -12.925 1.673   1.00 0.00 ? 62  LYS A N    6  
ATOM 9442  C CA   . LYS A 1 62  ? -3.424  -12.632 0.300   1.00 0.00 ? 62  LYS A CA   6  
ATOM 9443  C C    . LYS A 1 62  ? -3.818  -11.166 0.147   1.00 0.00 ? 62  LYS A C    6  
ATOM 9444  O O    . LYS A 1 62  ? -4.792  -10.711 0.746   1.00 0.00 ? 62  LYS A O    6  
ATOM 9445  C CB   . LYS A 1 62  ? -4.587  -13.531 -0.124  1.00 0.00 ? 62  LYS A CB   6  
ATOM 9446  C CG   . LYS A 1 62  ? -5.199  -13.145 -1.460  1.00 0.00 ? 62  LYS A CG   6  
ATOM 9447  C CD   . LYS A 1 62  ? -4.493  -13.833 -2.616  1.00 0.00 ? 62  LYS A CD   6  
ATOM 9448  C CE   . LYS A 1 62  ? -5.114  -15.186 -2.923  1.00 0.00 ? 62  LYS A CE   6  
ATOM 9449  N NZ   . LYS A 1 62  ? -4.523  -16.270 -2.090  1.00 0.00 ? 62  LYS A NZ   6  
ATOM 9450  H H    . LYS A 1 62  ? -3.401  -12.381 2.402   1.00 0.00 ? 62  LYS A H    6  
ATOM 9451  H HA   . LYS A 1 62  ? -2.575  -12.832 -0.337  1.00 0.00 ? 62  LYS A HA   6  
ATOM 9452  H HB2  . LYS A 1 62  ? -4.233  -14.549 -0.194  1.00 0.00 ? 62  LYS A HB2  6  
ATOM 9453  H HB3  . LYS A 1 62  ? -5.359  -13.479 0.630   1.00 0.00 ? 62  LYS A HB3  6  
ATOM 9454  H HG2  . LYS A 1 62  ? -6.240  -13.433 -1.465  1.00 0.00 ? 62  LYS A HG2  6  
ATOM 9455  H HG3  . LYS A 1 62  ? -5.119  -12.075 -1.586  1.00 0.00 ? 62  LYS A HG3  6  
ATOM 9456  H HD2  . LYS A 1 62  ? -4.566  -13.208 -3.494  1.00 0.00 ? 62  LYS A HD2  6  
ATOM 9457  H HD3  . LYS A 1 62  ? -3.452  -13.974 -2.358  1.00 0.00 ? 62  LYS A HD3  6  
ATOM 9458  H HE2  . LYS A 1 62  ? -6.175  -15.133 -2.730  1.00 0.00 ? 62  LYS A HE2  6  
ATOM 9459  H HE3  . LYS A 1 62  ? -4.949  -15.415 -3.966  1.00 0.00 ? 62  LYS A HE3  6  
ATOM 9460  H HZ1  . LYS A 1 62  ? -5.234  -16.636 -1.424  1.00 0.00 ? 62  LYS A HZ1  6  
ATOM 9461  H HZ2  . LYS A 1 62  ? -3.714  -15.904 -1.549  1.00 0.00 ? 62  LYS A HZ2  6  
ATOM 9462  H HZ3  . LYS A 1 62  ? -4.198  -17.050 -2.696  1.00 0.00 ? 62  LYS A HZ3  6  
ATOM 9463  N N    . GLU A 1 63  ? -3.057  -10.434 -0.660  1.00 0.00 ? 63  GLU A N    6  
ATOM 9464  C CA   . GLU A 1 63  ? -3.329  -9.020  -0.890  1.00 0.00 ? 63  GLU A CA   6  
ATOM 9465  C C    . GLU A 1 63  ? -3.823  -8.787  -2.315  1.00 0.00 ? 63  GLU A C    6  
ATOM 9466  O O    . GLU A 1 63  ? -3.594  -9.606  -3.204  1.00 0.00 ? 63  GLU A O    6  
ATOM 9467  C CB   . GLU A 1 63  ? -2.071  -8.187  -0.632  1.00 0.00 ? 63  GLU A CB   6  
ATOM 9468  C CG   . GLU A 1 63  ? -1.038  -8.284  -1.742  1.00 0.00 ? 63  GLU A CG   6  
ATOM 9469  C CD   . GLU A 1 63  ? -0.186  -9.534  -1.638  1.00 0.00 ? 63  GLU A CD   6  
ATOM 9470  O OE1  . GLU A 1 63  ? 0.003   -10.032 -0.509  1.00 0.00 ? 63  GLU A OE1  6  
ATOM 9471  O OE2  . GLU A 1 63  ? 0.293   -10.014 -2.687  1.00 0.00 ? 63  GLU A OE2  6  
ATOM 9472  H H    . GLU A 1 63  ? -2.294  -10.854 -1.109  1.00 0.00 ? 63  GLU A H    6  
ATOM 9473  H HA   . GLU A 1 63  ? -4.100  -8.714  -0.200  1.00 0.00 ? 63  GLU A HA   6  
ATOM 9474  H HB2  . GLU A 1 63  ? -2.356  -7.151  -0.523  1.00 0.00 ? 63  GLU A HB2  6  
ATOM 9475  H HB3  . GLU A 1 63  ? -1.614  -8.524  0.286   1.00 0.00 ? 63  GLU A HB3  6  
ATOM 9476  H HG2  . GLU A 1 63  ? -1.550  -8.295  -2.693  1.00 0.00 ? 63  GLU A HG2  6  
ATOM 9477  H HG3  . GLU A 1 63  ? -0.392  -7.420  -1.692  1.00 0.00 ? 63  GLU A HG3  6  
ATOM 9478  N N    . GLN A 1 64  ? -4.503  -7.663  -2.523  1.00 0.00 ? 64  GLN A N    6  
ATOM 9479  C CA   . GLN A 1 64  ? -5.031  -7.323  -3.838  1.00 0.00 ? 64  GLN A CA   6  
ATOM 9480  C C    . GLN A 1 64  ? -4.338  -6.085  -4.399  1.00 0.00 ? 64  GLN A C    6  
ATOM 9481  O O    . GLN A 1 64  ? -3.427  -5.537  -3.779  1.00 0.00 ? 64  GLN A O    6  
ATOM 9482  C CB   . GLN A 1 64  ? -6.540  -7.086  -3.760  1.00 0.00 ? 64  GLN A CB   6  
ATOM 9483  C CG   . GLN A 1 64  ? -7.360  -8.365  -3.815  1.00 0.00 ? 64  GLN A CG   6  
ATOM 9484  C CD   . GLN A 1 64  ? -7.732  -8.760  -5.230  1.00 0.00 ? 64  GLN A CD   6  
ATOM 9485  O OE1  . GLN A 1 64  ? -6.954  -9.410  -5.930  1.00 0.00 ? 64  GLN A OE1  6  
ATOM 9486  N NE2  . GLN A 1 64  ? -8.926  -8.368  -5.660  1.00 0.00 ? 64  GLN A NE2  6  
ATOM 9487  H H    . GLN A 1 64  ? -4.653  -7.050  -1.774  1.00 0.00 ? 64  GLN A H    6  
ATOM 9488  H HA   . GLN A 1 64  ? -4.840  -8.156  -4.498  1.00 0.00 ? 64  GLN A HA   6  
ATOM 9489  H HB2  . GLN A 1 64  ? -6.765  -6.578  -2.834  1.00 0.00 ? 64  GLN A HB2  6  
ATOM 9490  H HB3  . GLN A 1 64  ? -6.837  -6.458  -4.587  1.00 0.00 ? 64  GLN A HB3  6  
ATOM 9491  H HG2  . GLN A 1 64  ? -6.785  -9.165  -3.373  1.00 0.00 ? 64  GLN A HG2  6  
ATOM 9492  H HG3  . GLN A 1 64  ? -8.267  -8.219  -3.247  1.00 0.00 ? 64  GLN A HG3  6  
ATOM 9493  H HE21 . GLN A 1 64  ? -9.491  -7.852  -5.048  1.00 0.00 ? 64  GLN A HE21 6  
ATOM 9494  H HE22 . GLN A 1 64  ? -9.191  -8.609  -6.571  1.00 0.00 ? 64  GLN A HE22 6  
ATOM 9495  N N    . ASP A 1 65  ? -4.776  -5.650  -5.575  1.00 0.00 ? 65  ASP A N    6  
ATOM 9496  C CA   . ASP A 1 65  ? -4.199  -4.476  -6.220  1.00 0.00 ? 65  ASP A CA   6  
ATOM 9497  C C    . ASP A 1 65  ? -5.288  -3.605  -6.838  1.00 0.00 ? 65  ASP A C    6  
ATOM 9498  O O    . ASP A 1 65  ? -6.146  -4.093  -7.573  1.00 0.00 ? 65  ASP A O    6  
ATOM 9499  C CB   . ASP A 1 65  ? -3.196  -4.899  -7.294  1.00 0.00 ? 65  ASP A CB   6  
ATOM 9500  C CG   . ASP A 1 65  ? -3.854  -5.138  -8.639  1.00 0.00 ? 65  ASP A CG   6  
ATOM 9501  O OD1  . ASP A 1 65  ? -4.584  -6.142  -8.773  1.00 0.00 ? 65  ASP A OD1  6  
ATOM 9502  O OD2  . ASP A 1 65  ? -3.640  -4.319  -9.557  1.00 0.00 ? 65  ASP A OD2  6  
ATOM 9503  H H    . ASP A 1 65  ? -5.506  -6.130  -6.021  1.00 0.00 ? 65  ASP A H    6  
ATOM 9504  H HA   . ASP A 1 65  ? -3.683  -3.903  -5.464  1.00 0.00 ? 65  ASP A HA   6  
ATOM 9505  H HB2  . ASP A 1 65  ? -2.454  -4.123  -7.410  1.00 0.00 ? 65  ASP A HB2  6  
ATOM 9506  H HB3  . ASP A 1 65  ? -2.710  -5.812  -6.984  1.00 0.00 ? 65  ASP A HB3  6  
ATOM 9507  N N    . VAL A 1 66  ? -5.248  -2.311  -6.533  1.00 0.00 ? 66  VAL A N    6  
ATOM 9508  C CA   . VAL A 1 66  ? -6.231  -1.372  -7.059  1.00 0.00 ? 66  VAL A CA   6  
ATOM 9509  C C    . VAL A 1 66  ? -5.557  -0.258  -7.852  1.00 0.00 ? 66  VAL A C    6  
ATOM 9510  O O    . VAL A 1 66  ? -4.665  0.426   -7.348  1.00 0.00 ? 66  VAL A O    6  
ATOM 9511  C CB   . VAL A 1 66  ? -7.070  -0.747  -5.928  1.00 0.00 ? 66  VAL A CB   6  
ATOM 9512  C CG1  . VAL A 1 66  ? -8.053  -1.764  -5.368  1.00 0.00 ? 66  VAL A CG1  6  
ATOM 9513  C CG2  . VAL A 1 66  ? -6.166  -0.206  -4.831  1.00 0.00 ? 66  VAL A CG2  6  
ATOM 9514  H H    . VAL A 1 66  ? -4.540  -1.982  -5.942  1.00 0.00 ? 66  VAL A H    6  
ATOM 9515  H HA   . VAL A 1 66  ? -6.896  -1.915  -7.714  1.00 0.00 ? 66  VAL A HA   6  
ATOM 9516  H HB   . VAL A 1 66  ? -7.634  0.077   -6.340  1.00 0.00 ? 66  VAL A HB   6  
ATOM 9517  H HG11 . VAL A 1 66  ? -9.062  -1.451  -5.593  1.00 0.00 ? 66  VAL A HG11 6  
ATOM 9518  H HG12 . VAL A 1 66  ? -7.866  -2.729  -5.814  1.00 0.00 ? 66  VAL A HG12 6  
ATOM 9519  H HG13 . VAL A 1 66  ? -7.929  -1.831  -4.297  1.00 0.00 ? 66  VAL A HG13 6  
ATOM 9520  H HG21 . VAL A 1 66  ? -6.047  -0.955  -4.062  1.00 0.00 ? 66  VAL A HG21 6  
ATOM 9521  H HG22 . VAL A 1 66  ? -5.199  0.038   -5.248  1.00 0.00 ? 66  VAL A HG22 6  
ATOM 9522  H HG23 . VAL A 1 66  ? -6.608  0.682   -4.404  1.00 0.00 ? 66  VAL A HG23 6  
ATOM 9523  N N    . ASP A 1 67  ? -5.989  -0.079  -9.095  1.00 0.00 ? 67  ASP A N    6  
ATOM 9524  C CA   . ASP A 1 67  ? -5.429  0.953   -9.959  1.00 0.00 ? 67  ASP A CA   6  
ATOM 9525  C C    . ASP A 1 67  ? -5.886  2.340   -9.515  1.00 0.00 ? 67  ASP A C    6  
ATOM 9526  O O    . ASP A 1 67  ? -7.079  2.642   -9.519  1.00 0.00 ? 67  ASP A O    6  
ATOM 9527  C CB   . ASP A 1 67  ? -5.837  0.709   -11.413 1.00 0.00 ? 67  ASP A CB   6  
ATOM 9528  C CG   . ASP A 1 67  ? -7.215  1.259   -11.727 1.00 0.00 ? 67  ASP A CG   6  
ATOM 9529  O OD1  . ASP A 1 67  ? -7.307  2.438   -12.128 1.00 0.00 ? 67  ASP A OD1  6  
ATOM 9530  O OD2  . ASP A 1 67  ? -8.201  0.509   -11.573 1.00 0.00 ? 67  ASP A OD2  6  
ATOM 9531  H H    . ASP A 1 67  ? -6.703  -0.656  -9.440  1.00 0.00 ? 67  ASP A H    6  
ATOM 9532  H HA   . ASP A 1 67  ? -4.353  0.901   -9.883  1.00 0.00 ? 67  ASP A HA   6  
ATOM 9533  H HB2  . ASP A 1 67  ? -5.122  1.188   -12.066 1.00 0.00 ? 67  ASP A HB2  6  
ATOM 9534  H HB3  . ASP A 1 67  ? -5.840  -0.353  -11.605 1.00 0.00 ? 67  ASP A HB3  6  
ATOM 9535  N N    . VAL A 1 68  ? -4.928  3.178   -9.131  1.00 0.00 ? 68  VAL A N    6  
ATOM 9536  C CA   . VAL A 1 68  ? -5.232  4.532   -8.685  1.00 0.00 ? 68  VAL A CA   6  
ATOM 9537  C C    . VAL A 1 68  ? -4.487  5.567   -9.521  1.00 0.00 ? 68  VAL A C    6  
ATOM 9538  O O    . VAL A 1 68  ? -3.451  5.270   -10.115 1.00 0.00 ? 68  VAL A O    6  
ATOM 9539  C CB   . VAL A 1 68  ? -4.868  4.729   -7.201  1.00 0.00 ? 68  VAL A CB   6  
ATOM 9540  C CG1  . VAL A 1 68  ? -5.141  6.161   -6.769  1.00 0.00 ? 68  VAL A CG1  6  
ATOM 9541  C CG2  . VAL A 1 68  ? -5.634  3.745   -6.330  1.00 0.00 ? 68  VAL A CG2  6  
ATOM 9542  H H    . VAL A 1 68  ? -3.995  2.879   -9.150  1.00 0.00 ? 68  VAL A H    6  
ATOM 9543  H HA   . VAL A 1 68  ? -6.295  4.691   -8.797  1.00 0.00 ? 68  VAL A HA   6  
ATOM 9544  H HB   . VAL A 1 68  ? -3.812  4.536   -7.082  1.00 0.00 ? 68  VAL A HB   6  
ATOM 9545  H HG11 . VAL A 1 68  ? -6.180  6.399   -6.949  1.00 0.00 ? 68  VAL A HG11 6  
ATOM 9546  H HG12 . VAL A 1 68  ? -4.923  6.268   -5.716  1.00 0.00 ? 68  VAL A HG12 6  
ATOM 9547  H HG13 . VAL A 1 68  ? -4.515  6.834   -7.337  1.00 0.00 ? 68  VAL A HG13 6  
ATOM 9548  H HG21 . VAL A 1 68  ? -5.809  4.185   -5.359  1.00 0.00 ? 68  VAL A HG21 6  
ATOM 9549  H HG22 . VAL A 1 68  ? -6.581  3.513   -6.795  1.00 0.00 ? 68  VAL A HG22 6  
ATOM 9550  H HG23 . VAL A 1 68  ? -5.058  2.839   -6.217  1.00 0.00 ? 68  VAL A HG23 6  
ATOM 9551  N N    . SER A 1 69  ? -5.022  6.783   -9.561  1.00 0.00 ? 69  SER A N    6  
ATOM 9552  C CA   . SER A 1 69  ? -4.410  7.862   -10.328 1.00 0.00 ? 69  SER A CA   6  
ATOM 9553  C C    . SER A 1 69  ? -3.894  8.960   -9.403  1.00 0.00 ? 69  SER A C    6  
ATOM 9554  O O    . SER A 1 69  ? -2.846  9.556   -9.652  1.00 0.00 ? 69  SER A O    6  
ATOM 9555  C CB   . SER A 1 69  ? -5.417  8.447   -11.320 1.00 0.00 ? 69  SER A CB   6  
ATOM 9556  O OG   . SER A 1 69  ? -6.534  9.000   -10.647 1.00 0.00 ? 69  SER A OG   6  
ATOM 9557  H H    . SER A 1 69  ? -5.850  6.958   -9.066  1.00 0.00 ? 69  SER A H    6  
ATOM 9558  H HA   . SER A 1 69  ? -3.576  7.448   -10.875 1.00 0.00 ? 69  SER A HA   6  
ATOM 9559  H HB2  . SER A 1 69  ? -4.940  9.223   -11.898 1.00 0.00 ? 69  SER A HB2  6  
ATOM 9560  H HB3  . SER A 1 69  ? -5.761  7.665   -11.982 1.00 0.00 ? 69  SER A HB3  6  
ATOM 9561  H HG   . SER A 1 69  ? -6.881  8.359   -10.021 1.00 0.00 ? 69  SER A HG   6  
ATOM 9562  N N    . SER A 1 70  ? -4.639  9.223   -8.334  1.00 0.00 ? 70  SER A N    6  
ATOM 9563  C CA   . SER A 1 70  ? -4.261  10.252  -7.372  1.00 0.00 ? 70  SER A CA   6  
ATOM 9564  C C    . SER A 1 70  ? -3.359  9.675   -6.285  1.00 0.00 ? 70  SER A C    6  
ATOM 9565  O O    . SER A 1 70  ? -3.311  8.461   -6.082  1.00 0.00 ? 70  SER A O    6  
ATOM 9566  C CB   . SER A 1 70  ? -5.508  10.873  -6.740  1.00 0.00 ? 70  SER A CB   6  
ATOM 9567  O OG   . SER A 1 70  ? -6.122  11.796  -7.624  1.00 0.00 ? 70  SER A OG   6  
ATOM 9568  H H    . SER A 1 70  ? -5.464  8.714   -8.189  1.00 0.00 ? 70  SER A H    6  
ATOM 9569  H HA   . SER A 1 70  ? -3.717  11.019  -7.904  1.00 0.00 ? 70  SER A HA   6  
ATOM 9570  H HB2  . SER A 1 70  ? -6.216  10.093  -6.505  1.00 0.00 ? 70  SER A HB2  6  
ATOM 9571  H HB3  . SER A 1 70  ? -5.229  11.391  -5.834  1.00 0.00 ? 70  SER A HB3  6  
ATOM 9572  H HG   . SER A 1 70  ? -6.995  12.021  -7.295  1.00 0.00 ? 70  SER A HG   6  
ATOM 9573  N N    . HIS A 1 71  ? -2.647  10.554  -5.588  1.00 0.00 ? 71  HIS A N    6  
ATOM 9574  C CA   . HIS A 1 71  ? -1.747  10.133  -4.520  1.00 0.00 ? 71  HIS A CA   6  
ATOM 9575  C C    . HIS A 1 71  ? -2.531  9.574   -3.336  1.00 0.00 ? 71  HIS A C    6  
ATOM 9576  O O    . HIS A 1 71  ? -2.071  8.664   -2.647  1.00 0.00 ? 71  HIS A O    6  
ATOM 9577  C CB   . HIS A 1 71  ? -0.879  11.306  -4.063  1.00 0.00 ? 71  HIS A CB   6  
ATOM 9578  C CG   . HIS A 1 71  ? 0.188   11.680  -5.046  1.00 0.00 ? 71  HIS A CG   6  
ATOM 9579  N ND1  . HIS A 1 71  ? -0.019  12.571  -6.077  1.00 0.00 ? 71  HIS A ND1  6  
ATOM 9580  C CD2  . HIS A 1 71  ? 1.476   11.278  -5.150  1.00 0.00 ? 71  HIS A CD2  6  
ATOM 9581  C CE1  . HIS A 1 71  ? 1.097   12.701  -6.774  1.00 0.00 ? 71  HIS A CE1  6  
ATOM 9582  N NE2  . HIS A 1 71  ? 2.019   11.927  -6.231  1.00 0.00 ? 71  HIS A NE2  6  
ATOM 9583  H H    . HIS A 1 71  ? -2.728  11.508  -5.796  1.00 0.00 ? 71  HIS A H    6  
ATOM 9584  H HA   . HIS A 1 71  ? -1.108  9.355   -4.911  1.00 0.00 ? 71  HIS A HA   6  
ATOM 9585  H HB2  . HIS A 1 71  ? -1.506  12.171  -3.910  1.00 0.00 ? 71  HIS A HB2  6  
ATOM 9586  H HB3  . HIS A 1 71  ? -0.396  11.047  -3.131  1.00 0.00 ? 71  HIS A HB3  6  
ATOM 9587  H HD1  . HIS A 1 71  ? -0.858  13.038  -6.271  1.00 0.00 ? 71  HIS A HD1  6  
ATOM 9588  H HD2  . HIS A 1 71  ? 1.984   10.577  -4.502  1.00 0.00 ? 71  HIS A HD2  6  
ATOM 9589  H HE1  . HIS A 1 71  ? 1.232   13.333  -7.639  1.00 0.00 ? 71  HIS A HE1  6  
ATOM 9590  H HE2  . HIS A 1 71  ? 2.912   11.770  -6.602  1.00 0.00 ? 71  HIS A HE2  6  
ATOM 9591  N N    . SER A 1 72  ? -3.718  10.127  -3.106  1.00 0.00 ? 72  SER A N    6  
ATOM 9592  C CA   . SER A 1 72  ? -4.565  9.687   -2.003  1.00 0.00 ? 72  SER A CA   6  
ATOM 9593  C C    . SER A 1 72  ? -5.819  8.991   -2.525  1.00 0.00 ? 72  SER A C    6  
ATOM 9594  O O    . SER A 1 72  ? -6.548  9.540   -3.351  1.00 0.00 ? 72  SER A O    6  
ATOM 9595  C CB   . SER A 1 72  ? -4.956  10.878  -1.127  1.00 0.00 ? 72  SER A CB   6  
ATOM 9596  O OG   . SER A 1 72  ? -5.747  11.806  -1.850  1.00 0.00 ? 72  SER A OG   6  
ATOM 9597  H H    . SER A 1 72  ? -4.031  10.849  -3.691  1.00 0.00 ? 72  SER A H    6  
ATOM 9598  H HA   . SER A 1 72  ? -3.998  8.985   -1.410  1.00 0.00 ? 72  SER A HA   6  
ATOM 9599  H HB2  . SER A 1 72  ? -5.522  10.527  -0.278  1.00 0.00 ? 72  SER A HB2  6  
ATOM 9600  H HB3  . SER A 1 72  ? -4.062  11.377  -0.782  1.00 0.00 ? 72  SER A HB3  6  
ATOM 9601  H HG   . SER A 1 72  ? -5.504  12.700  -1.596  1.00 0.00 ? 72  SER A HG   6  
ATOM 9602  N N    . TYR A 1 73  ? -6.062  7.781   -2.036  1.00 0.00 ? 73  TYR A N    6  
ATOM 9603  C CA   . TYR A 1 73  ? -7.226  7.008   -2.453  1.00 0.00 ? 73  TYR A CA   6  
ATOM 9604  C C    . TYR A 1 73  ? -8.058  6.581   -1.248  1.00 0.00 ? 73  TYR A C    6  
ATOM 9605  O O    . TYR A 1 73  ? -7.585  6.606   -0.111  1.00 0.00 ? 73  TYR A O    6  
ATOM 9606  C CB   . TYR A 1 73  ? -6.788  5.776   -3.247  1.00 0.00 ? 73  TYR A CB   6  
ATOM 9607  C CG   . TYR A 1 73  ? -7.942  4.953   -3.773  1.00 0.00 ? 73  TYR A CG   6  
ATOM 9608  C CD1  . TYR A 1 73  ? -8.647  5.350   -4.903  1.00 0.00 ? 73  TYR A CD1  6  
ATOM 9609  C CD2  . TYR A 1 73  ? -8.327  3.777   -3.141  1.00 0.00 ? 73  TYR A CD2  6  
ATOM 9610  C CE1  . TYR A 1 73  ? -9.702  4.602   -5.386  1.00 0.00 ? 73  TYR A CE1  6  
ATOM 9611  C CE2  . TYR A 1 73  ? -9.381  3.021   -3.619  1.00 0.00 ? 73  TYR A CE2  6  
ATOM 9612  C CZ   . TYR A 1 73  ? -10.065 3.438   -4.741  1.00 0.00 ? 73  TYR A CZ   6  
ATOM 9613  O OH   . TYR A 1 73  ? -11.115 2.689   -5.220  1.00 0.00 ? 73  TYR A OH   6  
ATOM 9614  H H    . TYR A 1 73  ? -5.444  7.397   -1.379  1.00 0.00 ? 73  TYR A H    6  
ATOM 9615  H HA   . TYR A 1 73  ? -7.832  7.637   -3.089  1.00 0.00 ? 73  TYR A HA   6  
ATOM 9616  H HB2  . TYR A 1 73  ? -6.195  6.092   -4.091  1.00 0.00 ? 73  TYR A HB2  6  
ATOM 9617  H HB3  . TYR A 1 73  ? -6.190  5.140   -2.611  1.00 0.00 ? 73  TYR A HB3  6  
ATOM 9618  H HD1  . TYR A 1 73  ? -8.360  6.262   -5.406  1.00 0.00 ? 73  TYR A HD1  6  
ATOM 9619  H HD2  . TYR A 1 73  ? -7.789  3.453   -2.262  1.00 0.00 ? 73  TYR A HD2  6  
ATOM 9620  H HE1  . TYR A 1 73  ? -10.238 4.928   -6.265  1.00 0.00 ? 73  TYR A HE1  6  
ATOM 9621  H HE2  . TYR A 1 73  ? -9.665  2.110   -3.114  1.00 0.00 ? 73  TYR A HE2  6  
ATOM 9622  H HH   . TYR A 1 73  ? -11.676 2.419   -4.489  1.00 0.00 ? 73  TYR A HH   6  
ATOM 9623  N N    . THR A 1 74  ? -9.301  6.187   -1.504  1.00 0.00 ? 74  THR A N    6  
ATOM 9624  C CA   . THR A 1 74  ? -10.201 5.754   -0.442  1.00 0.00 ? 74  THR A CA   6  
ATOM 9625  C C    . THR A 1 74  ? -10.771 4.371   -0.734  1.00 0.00 ? 74  THR A C    6  
ATOM 9626  O O    . THR A 1 74  ? -11.438 4.166   -1.749  1.00 0.00 ? 74  THR A O    6  
ATOM 9627  C CB   . THR A 1 74  ? -11.363 6.747   -0.251  1.00 0.00 ? 74  THR A CB   6  
ATOM 9628  O OG1  . THR A 1 74  ? -10.850 8.058   0.011   1.00 0.00 ? 74  THR A OG1  6  
ATOM 9629  C CG2  . THR A 1 74  ? -12.264 6.311   0.895   1.00 0.00 ? 74  THR A CG2  6  
ATOM 9630  H H    . THR A 1 74  ? -9.620  6.189   -2.431  1.00 0.00 ? 74  THR A H    6  
ATOM 9631  H HA   . THR A 1 74  ? -9.635  5.714   0.478   1.00 0.00 ? 74  THR A HA   6  
ATOM 9632  H HB   . THR A 1 74  ? -11.948 6.772   -1.160  1.00 0.00 ? 74  THR A HB   6  
ATOM 9633  H HG1  . THR A 1 74  ? -10.654 8.144   0.947   1.00 0.00 ? 74  THR A HG1  6  
ATOM 9634  H HG21 . THR A 1 74  ? -13.239 6.054   0.508   1.00 0.00 ? 74  THR A HG21 6  
ATOM 9635  H HG22 . THR A 1 74  ? -12.359 7.119   1.605   1.00 0.00 ? 74  THR A HG22 6  
ATOM 9636  H HG23 . THR A 1 74  ? -11.833 5.451   1.384   1.00 0.00 ? 74  THR A HG23 6  
ATOM 9637  N N    . ILE A 1 75  ? -10.506 3.426   0.162   1.00 0.00 ? 75  ILE A N    6  
ATOM 9638  C CA   . ILE A 1 75  ? -10.995 2.063   0.000   1.00 0.00 ? 75  ILE A CA   6  
ATOM 9639  C C    . ILE A 1 75  ? -12.203 1.802   0.894   1.00 0.00 ? 75  ILE A C    6  
ATOM 9640  O O    . ILE A 1 75  ? -12.083 1.751   2.117   1.00 0.00 ? 75  ILE A O    6  
ATOM 9641  C CB   . ILE A 1 75  ? -9.899  1.030   0.323   1.00 0.00 ? 75  ILE A CB   6  
ATOM 9642  C CG1  . ILE A 1 75  ? -8.736  1.163   -0.662  1.00 0.00 ? 75  ILE A CG1  6  
ATOM 9643  C CG2  . ILE A 1 75  ? -10.473 -0.379  0.286   1.00 0.00 ? 75  ILE A CG2  6  
ATOM 9644  C CD1  . ILE A 1 75  ? -7.547  0.295   -0.314  1.00 0.00 ? 75  ILE A CD1  6  
ATOM 9645  H H    . ILE A 1 75  ? -9.969  3.651   0.950   1.00 0.00 ? 75  ILE A H    6  
ATOM 9646  H HA   . ILE A 1 75  ? -11.290 1.935   -1.032  1.00 0.00 ? 75  ILE A HA   6  
ATOM 9647  H HB   . ILE A 1 75  ? -9.539  1.220   1.322   1.00 0.00 ? 75  ILE A HB   6  
ATOM 9648  H HG12 . ILE A 1 75  ? -9.073  0.882   -1.648  1.00 0.00 ? 75  ILE A HG12 6  
ATOM 9649  H HG13 . ILE A 1 75  ? -8.405  2.191   -0.679  1.00 0.00 ? 75  ILE A HG13 6  
ATOM 9650  H HG21 . ILE A 1 75  ? -11.544 -0.329  0.158   1.00 0.00 ? 75  ILE A HG21 6  
ATOM 9651  H HG22 . ILE A 1 75  ? -10.037 -0.923  -0.538  1.00 0.00 ? 75  ILE A HG22 6  
ATOM 9652  H HG23 . ILE A 1 75  ? -10.245 -0.885  1.212   1.00 0.00 ? 75  ILE A HG23 6  
ATOM 9653  H HD11 . ILE A 1 75  ? -6.791  0.897   0.168   1.00 0.00 ? 75  ILE A HD11 6  
ATOM 9654  H HD12 . ILE A 1 75  ? -7.859  -0.494  0.352   1.00 0.00 ? 75  ILE A HD12 6  
ATOM 9655  H HD13 . ILE A 1 75  ? -7.140  -0.136  -1.217  1.00 0.00 ? 75  ILE A HD13 6  
ATOM 9656  N N    . ASN A 1 76  ? -13.367 1.637   0.274   1.00 0.00 ? 76  ASN A N    6  
ATOM 9657  C CA   . ASN A 1 76  ? -14.597 1.380   1.013   1.00 0.00 ? 76  ASN A CA   6  
ATOM 9658  C C    . ASN A 1 76  ? -15.000 -0.087  0.906   1.00 0.00 ? 76  ASN A C    6  
ATOM 9659  O O    . ASN A 1 76  ? -14.618 -0.780  -0.037  1.00 0.00 ? 76  ASN A O    6  
ATOM 9660  C CB   . ASN A 1 76  ? -15.726 2.270   0.491   1.00 0.00 ? 76  ASN A CB   6  
ATOM 9661  C CG   . ASN A 1 76  ? -15.641 2.493   -1.007  1.00 0.00 ? 76  ASN A CG   6  
ATOM 9662  O OD1  . ASN A 1 76  ? -15.855 1.572   -1.796  1.00 0.00 ? 76  ASN A OD1  6  
ATOM 9663  N ND2  . ASN A 1 76  ? -15.325 3.720   -1.406  1.00 0.00 ? 76  ASN A ND2  6  
ATOM 9664  H H    . ASN A 1 76  ? -13.399 1.689   -0.704  1.00 0.00 ? 76  ASN A H    6  
ATOM 9665  H HA   . ASN A 1 76  ? -14.415 1.616   2.051   1.00 0.00 ? 76  ASN A HA   6  
ATOM 9666  H HB2  . ASN A 1 76  ? -16.675 1.805   0.712   1.00 0.00 ? 76  ASN A HB2  6  
ATOM 9667  H HB3  . ASN A 1 76  ? -15.677 3.230   0.982   1.00 0.00 ? 76  ASN A HB3  6  
ATOM 9668  H HD21 . ASN A 1 76  ? -15.168 4.403   -0.721  1.00 0.00 ? 76  ASN A HD21 6  
ATOM 9669  H HD22 . ASN A 1 76  ? -15.264 3.892   -2.368  1.00 0.00 ? 76  ASN A HD22 6  
ATOM 9670  N N    . GLY A 1 77  ? -15.776 -0.555  1.879   1.00 0.00 ? 77  GLY A N    6  
ATOM 9671  C CA   . GLY A 1 77  ? -16.219 -1.937  1.875   1.00 0.00 ? 77  GLY A CA   6  
ATOM 9672  C C    . GLY A 1 77  ? -15.356 -2.826  2.749   1.00 0.00 ? 77  GLY A C    6  
ATOM 9673  O O    . GLY A 1 77  ? -14.974 -3.925  2.345   1.00 0.00 ? 77  GLY A O    6  
ATOM 9674  H H    . GLY A 1 77  ? -16.050 0.043   2.605   1.00 0.00 ? 77  GLY A H    6  
ATOM 9675  H HA2  . GLY A 1 77  ? -17.237 -1.979  2.232   1.00 0.00 ? 77  GLY A HA2  6  
ATOM 9676  H HA3  . GLY A 1 77  ? -16.188 -2.310  0.861   1.00 0.00 ? 77  GLY A HA3  6  
ATOM 9677  N N    . LEU A 1 78  ? -15.045 -2.349  3.949   1.00 0.00 ? 78  LEU A N    6  
ATOM 9678  C CA   . LEU A 1 78  ? -14.219 -3.107  4.883   1.00 0.00 ? 78  LEU A CA   6  
ATOM 9679  C C    . LEU A 1 78  ? -14.969 -3.369  6.184   1.00 0.00 ? 78  LEU A C    6  
ATOM 9680  O O    . LEU A 1 78  ? -16.042 -2.813  6.418   1.00 0.00 ? 78  LEU A O    6  
ATOM 9681  C CB   . LEU A 1 78  ? -12.920 -2.353  5.173   1.00 0.00 ? 78  LEU A CB   6  
ATOM 9682  C CG   . LEU A 1 78  ? -12.167 -1.819  3.954   1.00 0.00 ? 78  LEU A CG   6  
ATOM 9683  C CD1  . LEU A 1 78  ? -11.028 -0.909  4.386   1.00 0.00 ? 78  LEU A CD1  6  
ATOM 9684  C CD2  . LEU A 1 78  ? -11.641 -2.968  3.106   1.00 0.00 ? 78  LEU A CD2  6  
ATOM 9685  H H    . LEU A 1 78  ? -15.378 -1.467  4.215   1.00 0.00 ? 78  LEU A H    6  
ATOM 9686  H HA   . LEU A 1 78  ? -13.981 -4.054  4.421   1.00 0.00 ? 78  LEU A HA   6  
ATOM 9687  H HB2  . LEU A 1 78  ? -13.159 -1.514  5.807   1.00 0.00 ? 78  LEU A HB2  6  
ATOM 9688  H HB3  . LEU A 1 78  ? -12.260 -3.025  5.702   1.00 0.00 ? 78  LEU A HB3  6  
ATOM 9689  H HG   . LEU A 1 78  ? -12.846 -1.237  3.345   1.00 0.00 ? 78  LEU A HG   6  
ATOM 9690  H HD11 . LEU A 1 78  ? -11.284 -0.431  5.320   1.00 0.00 ? 78  LEU A HD11 6  
ATOM 9691  H HD12 . LEU A 1 78  ? -10.863 -0.155  3.630   1.00 0.00 ? 78  LEU A HD12 6  
ATOM 9692  H HD13 . LEU A 1 78  ? -10.129 -1.493  4.514   1.00 0.00 ? 78  LEU A HD13 6  
ATOM 9693  H HD21 . LEU A 1 78  ? -11.186 -2.575  2.209   1.00 0.00 ? 78  LEU A HD21 6  
ATOM 9694  H HD22 . LEU A 1 78  ? -12.459 -3.621  2.838   1.00 0.00 ? 78  LEU A HD22 6  
ATOM 9695  H HD23 . LEU A 1 78  ? -10.906 -3.524  3.669   1.00 0.00 ? 78  LEU A HD23 6  
ATOM 9696  N N    . LYS A 1 79  ? -14.397 -4.219  7.030   1.00 0.00 ? 79  LYS A N    6  
ATOM 9697  C CA   . LYS A 1 79  ? -15.009 -4.554  8.311   1.00 0.00 ? 79  LYS A CA   6  
ATOM 9698  C C    . LYS A 1 79  ? -14.721 -3.475  9.350   1.00 0.00 ? 79  LYS A C    6  
ATOM 9699  O O    . LYS A 1 79  ? -13.884 -2.597  9.134   1.00 0.00 ? 79  LYS A O    6  
ATOM 9700  C CB   . LYS A 1 79  ? -14.493 -5.906  8.808   1.00 0.00 ? 79  LYS A CB   6  
ATOM 9701  C CG   . LYS A 1 79  ? -15.204 -7.095  8.184   1.00 0.00 ? 79  LYS A CG   6  
ATOM 9702  C CD   . LYS A 1 79  ? -15.125 -8.323  9.075   1.00 0.00 ? 79  LYS A CD   6  
ATOM 9703  C CE   . LYS A 1 79  ? -13.841 -9.103  8.836   1.00 0.00 ? 79  LYS A CE   6  
ATOM 9704  N NZ   . LYS A 1 79  ? -13.899 -9.892  7.574   1.00 0.00 ? 79  LYS A NZ   6  
ATOM 9705  H H    . LYS A 1 79  ? -13.541 -4.631  6.787   1.00 0.00 ? 79  LYS A H    6  
ATOM 9706  H HA   . LYS A 1 79  ? -16.076 -4.617  8.162   1.00 0.00 ? 79  LYS A HA   6  
ATOM 9707  H HB2  . LYS A 1 79  ? -13.440 -5.982  8.580   1.00 0.00 ? 79  LYS A HB2  6  
ATOM 9708  H HB3  . LYS A 1 79  ? -14.625 -5.956  9.879   1.00 0.00 ? 79  LYS A HB3  6  
ATOM 9709  H HG2  . LYS A 1 79  ? -16.243 -6.841  8.030   1.00 0.00 ? 79  LYS A HG2  6  
ATOM 9710  H HG3  . LYS A 1 79  ? -14.742 -7.320  7.233   1.00 0.00 ? 79  LYS A HG3  6  
ATOM 9711  H HD2  . LYS A 1 79  ? -15.155 -8.010  10.108  1.00 0.00 ? 79  LYS A HD2  6  
ATOM 9712  H HD3  . LYS A 1 79  ? -15.970 -8.963  8.867   1.00 0.00 ? 79  LYS A HD3  6  
ATOM 9713  H HE2  . LYS A 1 79  ? -13.018 -8.408  8.778   1.00 0.00 ? 79  LYS A HE2  6  
ATOM 9714  H HE3  . LYS A 1 79  ? -13.685 -9.777  9.665   1.00 0.00 ? 79  LYS A HE3  6  
ATOM 9715  H HZ1  . LYS A 1 79  ? -14.886 -9.998  7.264   1.00 0.00 ? 79  LYS A HZ1  6  
ATOM 9716  H HZ2  . LYS A 1 79  ? -13.492 -10.837 7.725   1.00 0.00 ? 79  LYS A HZ2  6  
ATOM 9717  H HZ3  . LYS A 1 79  ? -13.362 -9.410  6.826   1.00 0.00 ? 79  LYS A HZ3  6  
ATOM 9718  N N    . LYS A 1 80  ? -15.417 -3.546  10.479  1.00 0.00 ? 80  LYS A N    6  
ATOM 9719  C CA   . LYS A 1 80  ? -15.235 -2.578  11.554  1.00 0.00 ? 80  LYS A CA   6  
ATOM 9720  C C    . LYS A 1 80  ? -14.193 -3.066  12.555  1.00 0.00 ? 80  LYS A C    6  
ATOM 9721  O O    . LYS A 1 80  ? -14.061 -4.267  12.792  1.00 0.00 ? 80  LYS A O    6  
ATOM 9722  C CB   . LYS A 1 80  ? -16.564 -2.322  12.268  1.00 0.00 ? 80  LYS A CB   6  
ATOM 9723  C CG   . LYS A 1 80  ? -17.662 -1.820  11.348  1.00 0.00 ? 80  LYS A CG   6  
ATOM 9724  C CD   . LYS A 1 80  ? -18.492 -2.966  10.793  1.00 0.00 ? 80  LYS A CD   6  
ATOM 9725  C CE   . LYS A 1 80  ? -19.529 -2.473  9.796   1.00 0.00 ? 80  LYS A CE   6  
ATOM 9726  N NZ   . LYS A 1 80  ? -20.145 -3.595  9.035   1.00 0.00 ? 80  LYS A NZ   6  
ATOM 9727  H H    . LYS A 1 80  ? -16.070 -4.269  10.593  1.00 0.00 ? 80  LYS A H    6  
ATOM 9728  H HA   . LYS A 1 80  ? -14.889 -1.655  11.113  1.00 0.00 ? 80  LYS A HA   6  
ATOM 9729  H HB2  . LYS A 1 80  ? -16.897 -3.242  12.724  1.00 0.00 ? 80  LYS A HB2  6  
ATOM 9730  H HB3  . LYS A 1 80  ? -16.406 -1.584  13.042  1.00 0.00 ? 80  LYS A HB3  6  
ATOM 9731  H HG2  . LYS A 1 80  ? -18.310 -1.157  11.902  1.00 0.00 ? 80  LYS A HG2  6  
ATOM 9732  H HG3  . LYS A 1 80  ? -17.213 -1.283  10.525  1.00 0.00 ? 80  LYS A HG3  6  
ATOM 9733  H HD2  . LYS A 1 80  ? -17.837 -3.667  10.297  1.00 0.00 ? 80  LYS A HD2  6  
ATOM 9734  H HD3  . LYS A 1 80  ? -18.998 -3.461  11.610  1.00 0.00 ? 80  LYS A HD3  6  
ATOM 9735  H HE2  . LYS A 1 80  ? -20.303 -1.945  10.332  1.00 0.00 ? 80  LYS A HE2  6  
ATOM 9736  H HE3  . LYS A 1 80  ? -19.048 -1.799  9.102   1.00 0.00 ? 80  LYS A HE3  6  
ATOM 9737  H HZ1  . LYS A 1 80  ? -19.606 -4.471  9.191   1.00 0.00 ? 80  LYS A HZ1  6  
ATOM 9738  H HZ2  . LYS A 1 80  ? -20.145 -3.379  8.018   1.00 0.00 ? 80  LYS A HZ2  6  
ATOM 9739  H HZ3  . LYS A 1 80  ? -21.125 -3.743  9.347   1.00 0.00 ? 80  LYS A HZ3  6  
ATOM 9740  N N    . TYR A 1 81  ? -13.456 -2.128  13.140  1.00 0.00 ? 81  TYR A N    6  
ATOM 9741  C CA   . TYR A 1 81  ? -12.425 -2.463  14.115  1.00 0.00 ? 81  TYR A CA   6  
ATOM 9742  C C    . TYR A 1 81  ? -11.603 -3.661  13.649  1.00 0.00 ? 81  TYR A C    6  
ATOM 9743  O O    . TYR A 1 81  ? -11.439 -4.640  14.377  1.00 0.00 ? 81  TYR A O    6  
ATOM 9744  C CB   . TYR A 1 81  ? -13.058 -2.764  15.475  1.00 0.00 ? 81  TYR A CB   6  
ATOM 9745  C CG   . TYR A 1 81  ? -12.150 -2.463  16.645  1.00 0.00 ? 81  TYR A CG   6  
ATOM 9746  C CD1  . TYR A 1 81  ? -11.815 -1.155  16.972  1.00 0.00 ? 81  TYR A CD1  6  
ATOM 9747  C CD2  . TYR A 1 81  ? -11.628 -3.487  17.426  1.00 0.00 ? 81  TYR A CD2  6  
ATOM 9748  C CE1  . TYR A 1 81  ? -10.985 -0.875  18.040  1.00 0.00 ? 81  TYR A CE1  6  
ATOM 9749  C CE2  . TYR A 1 81  ? -10.798 -3.217  18.497  1.00 0.00 ? 81  TYR A CE2  6  
ATOM 9750  C CZ   . TYR A 1 81  ? -10.479 -1.910  18.800  1.00 0.00 ? 81  TYR A CZ   6  
ATOM 9751  O OH   . TYR A 1 81  ? -9.653  -1.635  19.865  1.00 0.00 ? 81  TYR A OH   6  
ATOM 9752  H H    . TYR A 1 81  ? -13.608 -1.188  12.909  1.00 0.00 ? 81  TYR A H    6  
ATOM 9753  H HA   . TYR A 1 81  ? -11.772 -1.609  14.214  1.00 0.00 ? 81  TYR A HA   6  
ATOM 9754  H HB2  . TYR A 1 81  ? -13.952 -2.170  15.587  1.00 0.00 ? 81  TYR A HB2  6  
ATOM 9755  H HB3  . TYR A 1 81  ? -13.321 -3.811  15.518  1.00 0.00 ? 81  TYR A HB3  6  
ATOM 9756  H HD1  . TYR A 1 81  ? -12.214 -0.347  16.375  1.00 0.00 ? 81  TYR A HD1  6  
ATOM 9757  H HD2  . TYR A 1 81  ? -11.879 -4.510  17.186  1.00 0.00 ? 81  TYR A HD2  6  
ATOM 9758  H HE1  . TYR A 1 81  ? -10.736 0.148   18.278  1.00 0.00 ? 81  TYR A HE1  6  
ATOM 9759  H HE2  . TYR A 1 81  ? -10.401 -4.027  19.092  1.00 0.00 ? 81  TYR A HE2  6  
ATOM 9760  H HH   . TYR A 1 81  ? -9.048  -2.369  19.998  1.00 0.00 ? 81  TYR A HH   6  
ATOM 9761  N N    . THR A 1 82  ? -11.086 -3.575  12.427  1.00 0.00 ? 82  THR A N    6  
ATOM 9762  C CA   . THR A 1 82  ? -10.280 -4.650  11.861  1.00 0.00 ? 82  THR A CA   6  
ATOM 9763  C C    . THR A 1 82  ? -9.011  -4.105  11.215  1.00 0.00 ? 82  THR A C    6  
ATOM 9764  O O    . THR A 1 82  ? -9.057  -3.136  10.458  1.00 0.00 ? 82  THR A O    6  
ATOM 9765  C CB   . THR A 1 82  ? -11.072 -5.453  10.811  1.00 0.00 ? 82  THR A CB   6  
ATOM 9766  O OG1  . THR A 1 82  ? -12.226 -6.046  11.417  1.00 0.00 ? 82  THR A OG1  6  
ATOM 9767  C CG2  . THR A 1 82  ? -10.204 -6.537  10.191  1.00 0.00 ? 82  THR A CG2  6  
ATOM 9768  H H    . THR A 1 82  ? -11.251 -2.769  11.894  1.00 0.00 ? 82  THR A H    6  
ATOM 9769  H HA   . THR A 1 82  ? -10.006 -5.319  12.663  1.00 0.00 ? 82  THR A HA   6  
ATOM 9770  H HB   . THR A 1 82  ? -11.392 -4.778  10.030  1.00 0.00 ? 82  THR A HB   6  
ATOM 9771  H HG1  . THR A 1 82  ? -12.515 -5.503  12.155  1.00 0.00 ? 82  THR A HG1  6  
ATOM 9772  H HG21 . THR A 1 82  ? -10.182 -6.411  9.119   1.00 0.00 ? 82  THR A HG21 6  
ATOM 9773  H HG22 . THR A 1 82  ? -10.614 -7.507  10.432  1.00 0.00 ? 82  THR A HG22 6  
ATOM 9774  H HG23 . THR A 1 82  ? -9.201  -6.463  10.583  1.00 0.00 ? 82  THR A HG23 6  
ATOM 9775  N N    . GLU A 1 83  ? -7.881  -4.734  11.520  1.00 0.00 ? 83  GLU A N    6  
ATOM 9776  C CA   . GLU A 1 83  ? -6.599  -4.310  10.969  1.00 0.00 ? 83  GLU A CA   6  
ATOM 9777  C C    . GLU A 1 83  ? -6.528  -4.599  9.472   1.00 0.00 ? 83  GLU A C    6  
ATOM 9778  O O    . GLU A 1 83  ? -7.166  -5.530  8.978   1.00 0.00 ? 83  GLU A O    6  
ATOM 9779  C CB   . GLU A 1 83  ? -5.450  -5.016  11.690  1.00 0.00 ? 83  GLU A CB   6  
ATOM 9780  C CG   . GLU A 1 83  ? -4.165  -4.206  11.727  1.00 0.00 ? 83  GLU A CG   6  
ATOM 9781  C CD   . GLU A 1 83  ? -3.150  -4.766  12.705  1.00 0.00 ? 83  GLU A CD   6  
ATOM 9782  O OE1  . GLU A 1 83  ? -3.561  -5.217  13.795  1.00 0.00 ? 83  GLU A OE1  6  
ATOM 9783  O OE2  . GLU A 1 83  ? -1.944  -4.752  12.381  1.00 0.00 ? 83  GLU A OE2  6  
ATOM 9784  H H    . GLU A 1 83  ? -7.909  -5.500  12.131  1.00 0.00 ? 83  GLU A H    6  
ATOM 9785  H HA   . GLU A 1 83  ? -6.508  -3.245  11.122  1.00 0.00 ? 83  GLU A HA   6  
ATOM 9786  H HB2  . GLU A 1 83  ? -5.751  -5.222  12.707  1.00 0.00 ? 83  GLU A HB2  6  
ATOM 9787  H HB3  . GLU A 1 83  ? -5.246  -5.951  11.189  1.00 0.00 ? 83  GLU A HB3  6  
ATOM 9788  H HG2  . GLU A 1 83  ? -3.727  -4.204  10.740  1.00 0.00 ? 83  GLU A HG2  6  
ATOM 9789  H HG3  . GLU A 1 83  ? -4.401  -3.193  12.017  1.00 0.00 ? 83  GLU A HG3  6  
ATOM 9790  N N    . TYR A 1 84  ? -5.750  -3.795  8.756   1.00 0.00 ? 84  TYR A N    6  
ATOM 9791  C CA   . TYR A 1 84  ? -5.598  -3.962  7.316   1.00 0.00 ? 84  TYR A CA   6  
ATOM 9792  C C    . TYR A 1 84  ? -4.240  -3.446  6.848   1.00 0.00 ? 84  TYR A C    6  
ATOM 9793  O O    . TYR A 1 84  ? -3.855  -2.317  7.150   1.00 0.00 ? 84  TYR A O    6  
ATOM 9794  C CB   . TYR A 1 84  ? -6.717  -3.228  6.575   1.00 0.00 ? 84  TYR A CB   6  
ATOM 9795  C CG   . TYR A 1 84  ? -8.036  -3.967  6.585   1.00 0.00 ? 84  TYR A CG   6  
ATOM 9796  C CD1  . TYR A 1 84  ? -8.257  -5.046  5.738   1.00 0.00 ? 84  TYR A CD1  6  
ATOM 9797  C CD2  . TYR A 1 84  ? -9.061  -3.588  7.443   1.00 0.00 ? 84  TYR A CD2  6  
ATOM 9798  C CE1  . TYR A 1 84  ? -9.461  -5.724  5.743   1.00 0.00 ? 84  TYR A CE1  6  
ATOM 9799  C CE2  . TYR A 1 84  ? -10.268 -4.261  7.456   1.00 0.00 ? 84  TYR A CE2  6  
ATOM 9800  C CZ   . TYR A 1 84  ? -10.463 -5.328  6.604   1.00 0.00 ? 84  TYR A CZ   6  
ATOM 9801  O OH   . TYR A 1 84  ? -11.663 -6.001  6.614   1.00 0.00 ? 84  TYR A OH   6  
ATOM 9802  H H    . TYR A 1 84  ? -5.267  -3.071  9.207   1.00 0.00 ? 84  TYR A H    6  
ATOM 9803  H HA   . TYR A 1 84  ? -5.665  -5.017  7.095   1.00 0.00 ? 84  TYR A HA   6  
ATOM 9804  H HB2  . TYR A 1 84  ? -6.874  -2.265  7.037   1.00 0.00 ? 84  TYR A HB2  6  
ATOM 9805  H HB3  . TYR A 1 84  ? -6.425  -3.085  5.546   1.00 0.00 ? 84  TYR A HB3  6  
ATOM 9806  H HD1  . TYR A 1 84  ? -7.470  -5.354  5.065   1.00 0.00 ? 84  TYR A HD1  6  
ATOM 9807  H HD2  . TYR A 1 84  ? -8.905  -2.752  8.110   1.00 0.00 ? 84  TYR A HD2  6  
ATOM 9808  H HE1  . TYR A 1 84  ? -9.613  -6.560  5.076   1.00 0.00 ? 84  TYR A HE1  6  
ATOM 9809  H HE2  . TYR A 1 84  ? -11.053 -3.951  8.130   1.00 0.00 ? 84  TYR A HE2  6  
ATOM 9810  H HH   . TYR A 1 84  ? -11.578 -6.799  7.141   1.00 0.00 ? 84  TYR A HH   6  
ATOM 9811  N N    . SER A 1 85  ? -3.520  -4.283  6.109   1.00 0.00 ? 85  SER A N    6  
ATOM 9812  C CA   . SER A 1 85  ? -2.203  -3.915  5.601   1.00 0.00 ? 85  SER A CA   6  
ATOM 9813  C C    . SER A 1 85  ? -2.325  -3.105  4.314   1.00 0.00 ? 85  SER A C    6  
ATOM 9814  O O    . SER A 1 85  ? -3.291  -3.248  3.565   1.00 0.00 ? 85  SER A O    6  
ATOM 9815  C CB   . SER A 1 85  ? -1.361  -5.168  5.350   1.00 0.00 ? 85  SER A CB   6  
ATOM 9816  O OG   . SER A 1 85  ? 0.021   -4.888  5.485   1.00 0.00 ? 85  SER A OG   6  
ATOM 9817  H H    . SER A 1 85  ? -3.881  -5.171  5.902   1.00 0.00 ? 85  SER A H    6  
ATOM 9818  H HA   . SER A 1 85  ? -1.717  -3.309  6.350   1.00 0.00 ? 85  SER A HA   6  
ATOM 9819  H HB2  . SER A 1 85  ? -1.633  -5.930  6.064   1.00 0.00 ? 85  SER A HB2  6  
ATOM 9820  H HB3  . SER A 1 85  ? -1.548  -5.529  4.349   1.00 0.00 ? 85  SER A HB3  6  
ATOM 9821  H HG   . SER A 1 85  ? 0.406   -5.482  6.134   1.00 0.00 ? 85  SER A HG   6  
ATOM 9822  N N    . PHE A 1 86  ? -1.337  -2.252  4.064   1.00 0.00 ? 86  PHE A N    6  
ATOM 9823  C CA   . PHE A 1 86  ? -1.332  -1.416  2.869   1.00 0.00 ? 86  PHE A CA   6  
ATOM 9824  C C    . PHE A 1 86  ? 0.091   -1.193  2.367   1.00 0.00 ? 86  PHE A C    6  
ATOM 9825  O O    . PHE A 1 86  ? 1.003   -0.927  3.150   1.00 0.00 ? 86  PHE A O    6  
ATOM 9826  C CB   . PHE A 1 86  ? -1.999  -0.070  3.159   1.00 0.00 ? 86  PHE A CB   6  
ATOM 9827  C CG   . PHE A 1 86  ? -3.478  -0.174  3.399   1.00 0.00 ? 86  PHE A CG   6  
ATOM 9828  C CD1  . PHE A 1 86  ? -4.354  -0.362  2.341   1.00 0.00 ? 86  PHE A CD1  6  
ATOM 9829  C CD2  . PHE A 1 86  ? -3.993  -0.083  4.682   1.00 0.00 ? 86  PHE A CD2  6  
ATOM 9830  C CE1  . PHE A 1 86  ? -5.715  -0.456  2.560   1.00 0.00 ? 86  PHE A CE1  6  
ATOM 9831  C CE2  . PHE A 1 86  ? -5.354  -0.178  4.907   1.00 0.00 ? 86  PHE A CE2  6  
ATOM 9832  C CZ   . PHE A 1 86  ? -6.216  -0.365  3.844   1.00 0.00 ? 86  PHE A CZ   6  
ATOM 9833  H H    . PHE A 1 86  ? -0.593  -2.182  4.699   1.00 0.00 ? 86  PHE A H    6  
ATOM 9834  H HA   . PHE A 1 86  ? -1.894  -1.930  2.104   1.00 0.00 ? 86  PHE A HA   6  
ATOM 9835  H HB2  . PHE A 1 86  ? -1.550  0.364   4.040   1.00 0.00 ? 86  PHE A HB2  6  
ATOM 9836  H HB3  . PHE A 1 86  ? -1.843  0.589   2.318   1.00 0.00 ? 86  PHE A HB3  6  
ATOM 9837  H HD1  . PHE A 1 86  ? -3.964  -0.434  1.337   1.00 0.00 ? 86  PHE A HD1  6  
ATOM 9838  H HD2  . PHE A 1 86  ? -3.319  0.063   5.515   1.00 0.00 ? 86  PHE A HD2  6  
ATOM 9839  H HE1  . PHE A 1 86  ? -6.387  -0.603  1.727   1.00 0.00 ? 86  PHE A HE1  6  
ATOM 9840  H HE2  . PHE A 1 86  ? -5.742  -0.106  5.912   1.00 0.00 ? 86  PHE A HE2  6  
ATOM 9841  H HZ   . PHE A 1 86  ? -7.279  -0.439  4.017   1.00 0.00 ? 86  PHE A HZ   6  
ATOM 9842  N N    . ARG A 1 87  ? 0.274   -1.305  1.055   1.00 0.00 ? 87  ARG A N    6  
ATOM 9843  C CA   . ARG A 1 87  ? 1.586   -1.118  0.448   1.00 0.00 ? 87  ARG A CA   6  
ATOM 9844  C C    . ARG A 1 87  ? 1.459   -0.507  -0.945  1.00 0.00 ? 87  ARG A C    6  
ATOM 9845  O O    . ARG A 1 87  ? 0.640   -0.944  -1.753  1.00 0.00 ? 87  ARG A O    6  
ATOM 9846  C CB   . ARG A 1 87  ? 2.329   -2.453  0.365   1.00 0.00 ? 87  ARG A CB   6  
ATOM 9847  C CG   . ARG A 1 87  ? 1.619   -3.493  -0.486  1.00 0.00 ? 87  ARG A CG   6  
ATOM 9848  C CD   . ARG A 1 87  ? 2.472   -4.738  -0.671  1.00 0.00 ? 87  ARG A CD   6  
ATOM 9849  N NE   . ARG A 1 87  ? 1.932   -5.623  -1.700  1.00 0.00 ? 87  ARG A NE   6  
ATOM 9850  C CZ   . ARG A 1 87  ? 2.629   -6.602  -2.267  1.00 0.00 ? 87  ARG A CZ   6  
ATOM 9851  N NH1  . ARG A 1 87  ? 3.886   -6.819  -1.907  1.00 0.00 ? 87  ARG A NH1  6  
ATOM 9852  N NH2  . ARG A 1 87  ? 2.068   -7.365  -3.196  1.00 0.00 ? 87  ARG A NH2  6  
ATOM 9853  H H    . ARG A 1 87  ? -0.491  -1.519  0.482   1.00 0.00 ? 87  ARG A H    6  
ATOM 9854  H HA   . ARG A 1 87  ? 2.149   -0.441  1.074   1.00 0.00 ? 87  ARG A HA   6  
ATOM 9855  H HB2  . ARG A 1 87  ? 3.308   -2.281  -0.058  1.00 0.00 ? 87  ARG A HB2  6  
ATOM 9856  H HB3  . ARG A 1 87  ? 2.441   -2.851  1.362   1.00 0.00 ? 87  ARG A HB3  6  
ATOM 9857  H HG2  . ARG A 1 87  ? 0.695   -3.772  0.000   1.00 0.00 ? 87  ARG A HG2  6  
ATOM 9858  H HG3  . ARG A 1 87  ? 1.404   -3.066  -1.454  1.00 0.00 ? 87  ARG A HG3  6  
ATOM 9859  H HD2  . ARG A 1 87  ? 3.468   -4.436  -0.957  1.00 0.00 ? 87  ARG A HD2  6  
ATOM 9860  H HD3  . ARG A 1 87  ? 2.513   -5.272  0.266   1.00 0.00 ? 87  ARG A HD3  6  
ATOM 9861  H HE   . ARG A 1 87  ? 1.005   -5.480  -1.981  1.00 0.00 ? 87  ARG A HE   6  
ATOM 9862  H HH11 . ARG A 1 87  ? 4.311   -6.246  -1.206  1.00 0.00 ? 87  ARG A HH11 6  
ATOM 9863  H HH12 . ARG A 1 87  ? 4.409   -7.557  -2.334  1.00 0.00 ? 87  ARG A HH12 6  
ATOM 9864  H HH21 . ARG A 1 87  ? 1.120   -7.204  -3.469  1.00 0.00 ? 87  ARG A HH21 6  
ATOM 9865  H HH22 . ARG A 1 87  ? 2.593   -8.101  -3.622  1.00 0.00 ? 87  ARG A HH22 6  
ATOM 9866  N N    . VAL A 1 88  ? 2.274   0.506   -1.218  1.00 0.00 ? 88  VAL A N    6  
ATOM 9867  C CA   . VAL A 1 88  ? 2.253   1.177   -2.512  1.00 0.00 ? 88  VAL A CA   6  
ATOM 9868  C C    . VAL A 1 88  ? 3.481   0.813   -3.340  1.00 0.00 ? 88  VAL A C    6  
ATOM 9869  O O    . VAL A 1 88  ? 4.578   0.651   -2.804  1.00 0.00 ? 88  VAL A O    6  
ATOM 9870  C CB   . VAL A 1 88  ? 2.191   2.707   -2.351  1.00 0.00 ? 88  VAL A CB   6  
ATOM 9871  C CG1  . VAL A 1 88  ? 2.292   3.392   -3.705  1.00 0.00 ? 88  VAL A CG1  6  
ATOM 9872  C CG2  . VAL A 1 88  ? 0.915   3.116   -1.631  1.00 0.00 ? 88  VAL A CG2  6  
ATOM 9873  H H    . VAL A 1 88  ? 2.906   0.810   -0.533  1.00 0.00 ? 88  VAL A H    6  
ATOM 9874  H HA   . VAL A 1 88  ? 1.367   0.856   -3.041  1.00 0.00 ? 88  VAL A HA   6  
ATOM 9875  H HB   . VAL A 1 88  ? 3.034   3.020   -1.751  1.00 0.00 ? 88  VAL A HB   6  
ATOM 9876  H HG11 . VAL A 1 88  ? 1.653   4.263   -3.716  1.00 0.00 ? 88  VAL A HG11 6  
ATOM 9877  H HG12 . VAL A 1 88  ? 3.314   3.692   -3.883  1.00 0.00 ? 88  VAL A HG12 6  
ATOM 9878  H HG13 . VAL A 1 88  ? 1.978   2.707   -4.479  1.00 0.00 ? 88  VAL A HG13 6  
ATOM 9879  H HG21 . VAL A 1 88  ? 0.275   2.253   -1.518  1.00 0.00 ? 88  VAL A HG21 6  
ATOM 9880  H HG22 . VAL A 1 88  ? 1.161   3.512   -0.657  1.00 0.00 ? 88  VAL A HG22 6  
ATOM 9881  H HG23 . VAL A 1 88  ? 0.402   3.871   -2.207  1.00 0.00 ? 88  VAL A HG23 6  
ATOM 9882  N N    . VAL A 1 89  ? 3.290   0.688   -4.649  1.00 0.00 ? 89  VAL A N    6  
ATOM 9883  C CA   . VAL A 1 89  ? 4.383   0.345   -5.552  1.00 0.00 ? 89  VAL A CA   6  
ATOM 9884  C C    . VAL A 1 89  ? 4.401   1.266   -6.767  1.00 0.00 ? 89  VAL A C    6  
ATOM 9885  O O    . VAL A 1 89  ? 3.356   1.574   -7.340  1.00 0.00 ? 89  VAL A O    6  
ATOM 9886  C CB   . VAL A 1 89  ? 4.279   -1.115  -6.029  1.00 0.00 ? 89  VAL A CB   6  
ATOM 9887  C CG1  . VAL A 1 89  ? 5.388   -1.433  -7.020  1.00 0.00 ? 89  VAL A CG1  6  
ATOM 9888  C CG2  . VAL A 1 89  ? 4.323   -2.067  -4.843  1.00 0.00 ? 89  VAL A CG2  6  
ATOM 9889  H H    . VAL A 1 89  ? 2.393   0.830   -5.017  1.00 0.00 ? 89  VAL A H    6  
ATOM 9890  H HA   . VAL A 1 89  ? 5.311   0.460   -5.011  1.00 0.00 ? 89  VAL A HA   6  
ATOM 9891  H HB   . VAL A 1 89  ? 3.331   -1.243  -6.531  1.00 0.00 ? 89  VAL A HB   6  
ATOM 9892  H HG11 . VAL A 1 89  ? 6.334   -1.474  -6.500  1.00 0.00 ? 89  VAL A HG11 6  
ATOM 9893  H HG12 . VAL A 1 89  ? 5.191   -2.387  -7.488  1.00 0.00 ? 89  VAL A HG12 6  
ATOM 9894  H HG13 . VAL A 1 89  ? 5.427   -0.663  -7.776  1.00 0.00 ? 89  VAL A HG13 6  
ATOM 9895  H HG21 . VAL A 1 89  ? 3.965   -1.559  -3.961  1.00 0.00 ? 89  VAL A HG21 6  
ATOM 9896  H HG22 . VAL A 1 89  ? 3.696   -2.924  -5.045  1.00 0.00 ? 89  VAL A HG22 6  
ATOM 9897  H HG23 . VAL A 1 89  ? 5.339   -2.395  -4.682  1.00 0.00 ? 89  VAL A HG23 6  
ATOM 9898  N N    . ALA A 1 90  ? 5.595   1.701   -7.155  1.00 0.00 ? 90  ALA A N    6  
ATOM 9899  C CA   . ALA A 1 90  ? 5.749   2.584   -8.304  1.00 0.00 ? 90  ALA A CA   6  
ATOM 9900  C C    . ALA A 1 90  ? 5.932   1.785   -9.590  1.00 0.00 ? 90  ALA A C    6  
ATOM 9901  O O    . ALA A 1 90  ? 6.819   0.937   -9.685  1.00 0.00 ? 90  ALA A O    6  
ATOM 9902  C CB   . ALA A 1 90  ? 6.927   3.524   -8.093  1.00 0.00 ? 90  ALA A CB   6  
ATOM 9903  H H    . ALA A 1 90  ? 6.391   1.420   -6.657  1.00 0.00 ? 90  ALA A H    6  
ATOM 9904  H HA   . ALA A 1 90  ? 4.854   3.183   -8.388  1.00 0.00 ? 90  ALA A HA   6  
ATOM 9905  H HB1  . ALA A 1 90  ? 7.780   2.958   -7.746  1.00 0.00 ? 90  ALA A HB1  6  
ATOM 9906  H HB2  . ALA A 1 90  ? 7.173   4.009   -9.026  1.00 0.00 ? 90  ALA A HB2  6  
ATOM 9907  H HB3  . ALA A 1 90  ? 6.666   4.269   -7.357  1.00 0.00 ? 90  ALA A HB3  6  
ATOM 9908  N N    . TYR A 1 91  ? 5.086   2.060   -10.577 1.00 0.00 ? 91  TYR A N    6  
ATOM 9909  C CA   . TYR A 1 91  ? 5.152   1.364   -11.857 1.00 0.00 ? 91  TYR A CA   6  
ATOM 9910  C C    . TYR A 1 91  ? 5.573   2.316   -12.973 1.00 0.00 ? 91  TYR A C    6  
ATOM 9911  O O    . TYR A 1 91  ? 4.908   3.317   -13.233 1.00 0.00 ? 91  TYR A O    6  
ATOM 9912  C CB   . TYR A 1 91  ? 3.798   0.737   -12.190 1.00 0.00 ? 91  TYR A CB   6  
ATOM 9913  C CG   . TYR A 1 91  ? 3.594   -0.627  -11.570 1.00 0.00 ? 91  TYR A CG   6  
ATOM 9914  C CD1  . TYR A 1 91  ? 3.189   -0.757  -10.247 1.00 0.00 ? 91  TYR A CD1  6  
ATOM 9915  C CD2  . TYR A 1 91  ? 3.804   -1.786  -12.307 1.00 0.00 ? 91  TYR A CD2  6  
ATOM 9916  C CE1  . TYR A 1 91  ? 3.002   -2.001  -9.676  1.00 0.00 ? 91  TYR A CE1  6  
ATOM 9917  C CE2  . TYR A 1 91  ? 3.618   -3.034  -11.745 1.00 0.00 ? 91  TYR A CE2  6  
ATOM 9918  C CZ   . TYR A 1 91  ? 3.218   -3.137  -10.429 1.00 0.00 ? 91  TYR A CZ   6  
ATOM 9919  O OH   . TYR A 1 91  ? 3.031   -4.378  -9.865  1.00 0.00 ? 91  TYR A OH   6  
ATOM 9920  H H    . TYR A 1 91  ? 4.400   2.747   -10.441 1.00 0.00 ? 91  TYR A H    6  
ATOM 9921  H HA   . TYR A 1 91  ? 5.890   0.580   -11.770 1.00 0.00 ? 91  TYR A HA   6  
ATOM 9922  H HB2  . TYR A 1 91  ? 3.011   1.383   -11.833 1.00 0.00 ? 91  TYR A HB2  6  
ATOM 9923  H HB3  . TYR A 1 91  ? 3.712   0.630   -13.262 1.00 0.00 ? 91  TYR A HB3  6  
ATOM 9924  H HD1  . TYR A 1 91  ? 3.021   0.134   -9.660  1.00 0.00 ? 91  TYR A HD1  6  
ATOM 9925  H HD2  . TYR A 1 91  ? 4.118   -1.702  -13.338 1.00 0.00 ? 91  TYR A HD2  6  
ATOM 9926  H HE1  . TYR A 1 91  ? 2.688   -2.082  -8.646  1.00 0.00 ? 91  TYR A HE1  6  
ATOM 9927  H HE2  . TYR A 1 91  ? 3.787   -3.923  -12.335 1.00 0.00 ? 91  TYR A HE2  6  
ATOM 9928  H HH   . TYR A 1 91  ? 3.386   -4.380  -8.973  1.00 0.00 ? 91  TYR A HH   6  
ATOM 9929  N N    . ASN A 1 92  ? 6.683   1.993   -13.629 1.00 0.00 ? 92  ASN A N    6  
ATOM 9930  C CA   . ASN A 1 92  ? 7.194   2.817   -14.718 1.00 0.00 ? 92  ASN A CA   6  
ATOM 9931  C C    . ASN A 1 92  ? 7.294   2.012   -16.010 1.00 0.00 ? 92  ASN A C    6  
ATOM 9932  O O    . ASN A 1 92  ? 7.191   0.785   -15.999 1.00 0.00 ? 92  ASN A O    6  
ATOM 9933  C CB   . ASN A 1 92  ? 8.565   3.389   -14.352 1.00 0.00 ? 92  ASN A CB   6  
ATOM 9934  C CG   . ASN A 1 92  ? 8.529   4.209   -13.078 1.00 0.00 ? 92  ASN A CG   6  
ATOM 9935  O OD1  . ASN A 1 92  ? 7.499   4.289   -12.407 1.00 0.00 ? 92  ASN A OD1  6  
ATOM 9936  N ND2  . ASN A 1 92  ? 9.655   4.824   -12.737 1.00 0.00 ? 92  ASN A ND2  6  
ATOM 9937  H H    . ASN A 1 92  ? 7.170   1.181   -13.375 1.00 0.00 ? 92  ASN A H    6  
ATOM 9938  H HA   . ASN A 1 92  ? 6.503   3.633   -14.869 1.00 0.00 ? 92  ASN A HA   6  
ATOM 9939  H HB2  . ASN A 1 92  ? 9.262   2.575   -14.213 1.00 0.00 ? 92  ASN A HB2  6  
ATOM 9940  H HB3  . ASN A 1 92  ? 8.912   4.021   -15.156 1.00 0.00 ? 92  ASN A HB3  6  
ATOM 9941  H HD21 . ASN A 1 92  ? 10.437  4.716   -13.320 1.00 0.00 ? 92  ASN A HD21 6  
ATOM 9942  H HD22 . ASN A 1 92  ? 9.660   5.361   -11.918 1.00 0.00 ? 92  ASN A HD22 6  
ATOM 9943  N N    . LYS A 1 93  ? 7.497   2.710   -17.122 1.00 0.00 ? 93  LYS A N    6  
ATOM 9944  C CA   . LYS A 1 93  ? 7.614   2.061   -18.423 1.00 0.00 ? 93  LYS A CA   6  
ATOM 9945  C C    . LYS A 1 93  ? 8.505   0.826   -18.337 1.00 0.00 ? 93  LYS A C    6  
ATOM 9946  O O    . LYS A 1 93  ? 8.285   -0.160  -19.041 1.00 0.00 ? 93  LYS A O    6  
ATOM 9947  C CB   . LYS A 1 93  ? 8.179   3.040   -19.455 1.00 0.00 ? 93  LYS A CB   6  
ATOM 9948  C CG   . LYS A 1 93  ? 9.594   3.499   -19.147 1.00 0.00 ? 93  LYS A CG   6  
ATOM 9949  C CD   . LYS A 1 93  ? 10.245  4.146   -20.358 1.00 0.00 ? 93  LYS A CD   6  
ATOM 9950  C CE   . LYS A 1 93  ? 9.949   5.637   -20.419 1.00 0.00 ? 93  LYS A CE   6  
ATOM 9951  N NZ   . LYS A 1 93  ? 10.921  6.429   -19.615 1.00 0.00 ? 93  LYS A NZ   6  
ATOM 9952  H H    . LYS A 1 93  ? 7.571   3.686   -17.066 1.00 0.00 ? 93  LYS A H    6  
ATOM 9953  H HA   . LYS A 1 93  ? 6.625   1.757   -18.731 1.00 0.00 ? 93  LYS A HA   6  
ATOM 9954  H HB2  . LYS A 1 93  ? 8.180   2.562   -20.423 1.00 0.00 ? 93  LYS A HB2  6  
ATOM 9955  H HB3  . LYS A 1 93  ? 7.541   3.911   -19.493 1.00 0.00 ? 93  LYS A HB3  6  
ATOM 9956  H HG2  . LYS A 1 93  ? 9.563   4.217   -18.341 1.00 0.00 ? 93  LYS A HG2  6  
ATOM 9957  H HG3  . LYS A 1 93  ? 10.182  2.643   -18.847 1.00 0.00 ? 93  LYS A HG3  6  
ATOM 9958  H HD2  . LYS A 1 93  ? 11.314  4.005   -20.299 1.00 0.00 ? 93  LYS A HD2  6  
ATOM 9959  H HD3  . LYS A 1 93  ? 9.867   3.676   -21.254 1.00 0.00 ? 93  LYS A HD3  6  
ATOM 9960  H HE2  . LYS A 1 93  ? 10.000  5.959   -21.448 1.00 0.00 ? 93  LYS A HE2  6  
ATOM 9961  H HE3  . LYS A 1 93  ? 8.954   5.809   -20.036 1.00 0.00 ? 93  LYS A HE3  6  
ATOM 9962  H HZ1  . LYS A 1 93  ? 10.414  7.087   -18.990 1.00 0.00 ? 93  LYS A HZ1  6  
ATOM 9963  H HZ2  . LYS A 1 93  ? 11.543  6.975   -20.244 1.00 0.00 ? 93  LYS A HZ2  6  
ATOM 9964  H HZ3  . LYS A 1 93  ? 11.505  5.794   -19.033 1.00 0.00 ? 93  LYS A HZ3  6  
ATOM 9965  N N    . HIS A 1 94  ? 9.510   0.886   -17.469 1.00 0.00 ? 94  HIS A N    6  
ATOM 9966  C CA   . HIS A 1 94  ? 10.433  -0.229  -17.290 1.00 0.00 ? 94  HIS A CA   6  
ATOM 9967  C C    . HIS A 1 94  ? 9.762   -1.374  -16.537 1.00 0.00 ? 94  HIS A C    6  
ATOM 9968  O O    . HIS A 1 94  ? 9.689   -2.498  -17.032 1.00 0.00 ? 94  HIS A O    6  
ATOM 9969  C CB   . HIS A 1 94  ? 11.681  0.231   -16.536 1.00 0.00 ? 94  HIS A CB   6  
ATOM 9970  C CG   . HIS A 1 94  ? 12.161  1.589   -16.944 1.00 0.00 ? 94  HIS A CG   6  
ATOM 9971  N ND1  . HIS A 1 94  ? 12.733  1.847   -18.172 1.00 0.00 ? 94  HIS A ND1  6  
ATOM 9972  C CD2  . HIS A 1 94  ? 12.150  2.769   -16.280 1.00 0.00 ? 94  HIS A CD2  6  
ATOM 9973  C CE1  . HIS A 1 94  ? 13.055  3.127   -18.245 1.00 0.00 ? 94  HIS A CE1  6  
ATOM 9974  N NE2  . HIS A 1 94  ? 12.711  3.708   -17.110 1.00 0.00 ? 94  HIS A NE2  6  
ATOM 9975  H H    . HIS A 1 94  ? 9.633   1.699   -16.936 1.00 0.00 ? 94  HIS A H    6  
ATOM 9976  H HA   . HIS A 1 94  ? 10.723  -0.580  -18.268 1.00 0.00 ? 94  HIS A HA   6  
ATOM 9977  H HB2  . HIS A 1 94  ? 11.464  0.260   -15.478 1.00 0.00 ? 94  HIS A HB2  6  
ATOM 9978  H HB3  . HIS A 1 94  ? 12.481  -0.473  -16.715 1.00 0.00 ? 94  HIS A HB3  6  
ATOM 9979  H HD1  . HIS A 1 94  ? 12.883  1.190   -18.883 1.00 0.00 ? 94  HIS A HD1  6  
ATOM 9980  H HD2  . HIS A 1 94  ? 11.771  2.940   -15.282 1.00 0.00 ? 94  HIS A HD2  6  
ATOM 9981  H HE1  . HIS A 1 94  ? 13.520  3.615   -19.089 1.00 0.00 ? 94  HIS A HE1  6  
ATOM 9982  H HE2  . HIS A 1 94  ? 12.916  4.635   -16.866 1.00 0.00 ? 94  HIS A HE2  6  
ATOM 9983  N N    . GLY A 1 95  ? 9.274   -1.080  -15.335 1.00 0.00 ? 95  GLY A N    6  
ATOM 9984  C CA   . GLY A 1 95  ? 8.616   -2.095  -14.533 1.00 0.00 ? 95  GLY A CA   6  
ATOM 9985  C C    . GLY A 1 95  ? 8.359   -1.635  -13.112 1.00 0.00 ? 95  GLY A C    6  
ATOM 9986  O O    . GLY A 1 95  ? 8.648   -0.496  -12.744 1.00 0.00 ? 95  GLY A O    6  
ATOM 9987  H H    . GLY A 1 95  ? 9.361   -0.167  -14.991 1.00 0.00 ? 95  GLY A H    6  
ATOM 9988  H HA2  . GLY A 1 95  ? 7.674   -2.349  -14.995 1.00 0.00 ? 95  GLY A HA2  6  
ATOM 9989  H HA3  . GLY A 1 95  ? 9.241   -2.976  -14.506 1.00 0.00 ? 95  GLY A HA3  6  
ATOM 9990  N N    . PRO A 1 96  ? 7.801   -2.533  -12.287 1.00 0.00 ? 96  PRO A N    6  
ATOM 9991  C CA   . PRO A 1 96  ? 7.491   -2.235  -10.886 1.00 0.00 ? 96  PRO A CA   6  
ATOM 9992  C C    . PRO A 1 96  ? 8.746   -2.086  -10.033 1.00 0.00 ? 96  PRO A C    6  
ATOM 9993  O O    . PRO A 1 96  ? 9.621   -2.951  -10.043 1.00 0.00 ? 96  PRO A O    6  
ATOM 9994  C CB   . PRO A 1 96  ? 6.679   -3.452  -10.435 1.00 0.00 ? 96  PRO A CB   6  
ATOM 9995  C CG   . PRO A 1 96  ? 7.117   -4.554  -11.336 1.00 0.00 ? 96  PRO A CG   6  
ATOM 9996  C CD   . PRO A 1 96  ? 7.429   -3.909  -12.658 1.00 0.00 ? 96  PRO A CD   6  
ATOM 9997  H HA   . PRO A 1 96  ? 6.887   -1.343  -10.794 1.00 0.00 ? 96  PRO A HA   6  
ATOM 9998  H HB2  . PRO A 1 96  ? 6.902   -3.674  -9.401  1.00 0.00 ? 96  PRO A HB2  6  
ATOM 9999  H HB3  . PRO A 1 96  ? 5.625   -3.247  -10.546 1.00 0.00 ? 96  PRO A HB3  6  
ATOM 10000 H HG2  . PRO A 1 96  ? 7.999   -5.029  -10.934 1.00 0.00 ? 96  PRO A HG2  6  
ATOM 10001 H HG3  . PRO A 1 96  ? 6.320   -5.273  -11.450 1.00 0.00 ? 96  PRO A HG3  6  
ATOM 10002 H HD2  . PRO A 1 96  ? 8.253   -4.414  -13.140 1.00 0.00 ? 96  PRO A HD2  6  
ATOM 10003 H HD3  . PRO A 1 96  ? 6.557   -3.913  -13.296 1.00 0.00 ? 96  PRO A HD3  6  
ATOM 10004 N N    . GLY A 1 97  ? 8.828   -0.983  -9.295  1.00 0.00 ? 97  GLY A N    6  
ATOM 10005 C CA   . GLY A 1 97  ? 9.981   -0.742  -8.447  1.00 0.00 ? 97  GLY A CA   6  
ATOM 10006 C C    . GLY A 1 97  ? 9.834   -1.374  -7.077  1.00 0.00 ? 97  GLY A C    6  
ATOM 10007 O O    . GLY A 1 97  ? 9.113   -2.358  -6.913  1.00 0.00 ? 97  GLY A O    6  
ATOM 10008 H H    . GLY A 1 97  ? 8.100   -0.327  -9.327  1.00 0.00 ? 97  GLY A H    6  
ATOM 10009 H HA2  . GLY A 1 97  ? 10.859  -1.148  -8.927  1.00 0.00 ? 97  GLY A HA2  6  
ATOM 10010 H HA3  . GLY A 1 97  ? 10.108  0.324   -8.327  1.00 0.00 ? 97  GLY A HA3  6  
ATOM 10011 N N    . VAL A 1 98  ? 10.522  -0.809  -6.090  1.00 0.00 ? 98  VAL A N    6  
ATOM 10012 C CA   . VAL A 1 98  ? 10.466  -1.323  -4.727  1.00 0.00 ? 98  VAL A CA   6  
ATOM 10013 C C    . VAL A 1 98  ? 9.029   -1.387  -4.222  1.00 0.00 ? 98  VAL A C    6  
ATOM 10014 O O    . VAL A 1 98  ? 8.087   -1.109  -4.964  1.00 0.00 ? 98  VAL A O    6  
ATOM 10015 C CB   . VAL A 1 98  ? 11.299  -0.455  -3.764  1.00 0.00 ? 98  VAL A CB   6  
ATOM 10016 C CG1  . VAL A 1 98  ? 12.722  -0.303  -4.278  1.00 0.00 ? 98  VAL A CG1  6  
ATOM 10017 C CG2  . VAL A 1 98  ? 10.644  0.904   -3.572  1.00 0.00 ? 98  VAL A CG2  6  
ATOM 10018 H H    . VAL A 1 98  ? 11.080  -0.027  -6.283  1.00 0.00 ? 98  VAL A H    6  
ATOM 10019 H HA   . VAL A 1 98  ? 10.881  -2.321  -4.729  1.00 0.00 ? 98  VAL A HA   6  
ATOM 10020 H HB   . VAL A 1 98  ? 11.337  -0.952  -2.806  1.00 0.00 ? 98  VAL A HB   6  
ATOM 10021 H HG11 . VAL A 1 98  ? 13.253  0.407   -3.661  1.00 0.00 ? 98  VAL A HG11 6  
ATOM 10022 H HG12 . VAL A 1 98  ? 13.223  -1.259  -4.242  1.00 0.00 ? 98  VAL A HG12 6  
ATOM 10023 H HG13 . VAL A 1 98  ? 12.700  0.054   -5.298  1.00 0.00 ? 98  VAL A HG13 6  
ATOM 10024 H HG21 . VAL A 1 98  ? 11.213  1.479   -2.857  1.00 0.00 ? 98  VAL A HG21 6  
ATOM 10025 H HG22 . VAL A 1 98  ? 10.617  1.428   -4.516  1.00 0.00 ? 98  VAL A HG22 6  
ATOM 10026 H HG23 . VAL A 1 98  ? 9.637   0.771   -3.206  1.00 0.00 ? 98  VAL A HG23 6  
ATOM 10027 N N    . SER A 1 99  ? 8.868   -1.755  -2.955  1.00 0.00 ? 99  SER A N    6  
ATOM 10028 C CA   . SER A 1 99  ? 7.545   -1.858  -2.351  1.00 0.00 ? 99  SER A CA   6  
ATOM 10029 C C    . SER A 1 99  ? 7.576   -1.406  -0.894  1.00 0.00 ? 99  SER A C    6  
ATOM 10030 O O    . SER A 1 99  ? 8.096   -2.106  -0.024  1.00 0.00 ? 99  SER A O    6  
ATOM 10031 C CB   . SER A 1 99  ? 7.032   -3.297  -2.439  1.00 0.00 ? 99  SER A CB   6  
ATOM 10032 O OG   . SER A 1 99  ? 5.758   -3.422  -1.832  1.00 0.00 ? 99  SER A OG   6  
ATOM 10033 H H    . SER A 1 99  ? 9.659   -1.964  -2.414  1.00 0.00 ? 99  SER A H    6  
ATOM 10034 H HA   . SER A 1 99  ? 6.878   -1.213  -2.902  1.00 0.00 ? 99  SER A HA   6  
ATOM 10035 H HB2  . SER A 1 99  ? 6.953   -3.585  -3.476  1.00 0.00 ? 99  SER A HB2  6  
ATOM 10036 H HB3  . SER A 1 99  ? 7.725   -3.955  -1.934  1.00 0.00 ? 99  SER A HB3  6  
ATOM 10037 H HG   . SER A 1 99  ? 5.735   -2.904  -1.024  1.00 0.00 ? 99  SER A HG   6  
ATOM 10038 N N    . THR A 1 100 ? 7.015   -0.229  -0.635  1.00 0.00 ? 100 THR A N    6  
ATOM 10039 C CA   . THR A 1 100 ? 6.978   0.319   0.715   1.00 0.00 ? 100 THR A CA   6  
ATOM 10040 C C    . THR A 1 100 ? 6.664   -0.764  1.740   1.00 0.00 ? 100 THR A C    6  
ATOM 10041 O O    . THR A 1 100 ? 6.041   -1.781  1.433   1.00 0.00 ? 100 THR A O    6  
ATOM 10042 C CB   . THR A 1 100 ? 5.933   1.444   0.837   1.00 0.00 ? 100 THR A CB   6  
ATOM 10043 O OG1  . THR A 1 100 ? 4.686   1.017   0.278   1.00 0.00 ? 100 THR A OG1  6  
ATOM 10044 C CG2  . THR A 1 100 ? 6.408   2.703   0.127   1.00 0.00 ? 100 THR A CG2  6  
ATOM 10045 H H    . THR A 1 100 ? 6.617   0.282   -1.370  1.00 0.00 ? 100 THR A H    6  
ATOM 10046 H HA   . THR A 1 100 ? 7.951   0.736   0.933   1.00 0.00 ? 100 THR A HA   6  
ATOM 10047 H HB   . THR A 1 100 ? 5.791   1.671   1.884   1.00 0.00 ? 100 THR A HB   6  
ATOM 10048 H HG1  . THR A 1 100 ? 4.054   0.863   0.984   1.00 0.00 ? 100 THR A HG1  6  
ATOM 10049 H HG21 . THR A 1 100 ? 5.886   2.805   -0.813  1.00 0.00 ? 100 THR A HG21 6  
ATOM 10050 H HG22 . THR A 1 100 ? 7.470   2.634   -0.057  1.00 0.00 ? 100 THR A HG22 6  
ATOM 10051 H HG23 . THR A 1 100 ? 6.205   3.564   0.746   1.00 0.00 ? 100 THR A HG23 6  
ATOM 10052 N N    . PRO A 1 101 ? 7.102   -0.544  2.989   1.00 0.00 ? 101 PRO A N    6  
ATOM 10053 C CA   . PRO A 1 101 ? 6.877   -1.491  4.085   1.00 0.00 ? 101 PRO A CA   6  
ATOM 10054 C C    . PRO A 1 101 ? 5.412   -1.553  4.505   1.00 0.00 ? 101 PRO A C    6  
ATOM 10055 O O    . PRO A 1 101 ? 4.778   -0.524  4.736   1.00 0.00 ? 101 PRO A O    6  
ATOM 10056 C CB   . PRO A 1 101 ? 7.735   -0.928  5.221   1.00 0.00 ? 101 PRO A CB   6  
ATOM 10057 C CG   . PRO A 1 101 ? 7.849   0.527   4.925   1.00 0.00 ? 101 PRO A CG   6  
ATOM 10058 C CD   . PRO A 1 101 ? 7.850   0.647   3.426   1.00 0.00 ? 101 PRO A CD   6  
ATOM 10059 H HA   . PRO A 1 101 ? 7.220   -2.482  3.830   1.00 0.00 ? 101 PRO A HA   6  
ATOM 10060 H HB2  . PRO A 1 101 ? 7.244   -1.103  6.168   1.00 0.00 ? 101 PRO A HB2  6  
ATOM 10061 H HB3  . PRO A 1 101 ? 8.702   -1.408  5.217   1.00 0.00 ? 101 PRO A HB3  6  
ATOM 10062 H HG2  . PRO A 1 101 ? 7.004   1.054   5.343   1.00 0.00 ? 101 PRO A HG2  6  
ATOM 10063 H HG3  . PRO A 1 101 ? 8.772   0.913   5.332   1.00 0.00 ? 101 PRO A HG3  6  
ATOM 10064 H HD2  . PRO A 1 101 ? 7.348   1.552   3.119   1.00 0.00 ? 101 PRO A HD2  6  
ATOM 10065 H HD3  . PRO A 1 101 ? 8.861   0.626   3.047   1.00 0.00 ? 101 PRO A HD3  6  
ATOM 10066 N N    . ASP A 1 102 ? 4.881   -2.767  4.603   1.00 0.00 ? 102 ASP A N    6  
ATOM 10067 C CA   . ASP A 1 102 ? 3.491   -2.964  4.998   1.00 0.00 ? 102 ASP A CA   6  
ATOM 10068 C C    . ASP A 1 102 ? 3.061   -1.913  6.016   1.00 0.00 ? 102 ASP A C    6  
ATOM 10069 O O    . ASP A 1 102 ? 3.811   -1.580  6.934   1.00 0.00 ? 102 ASP A O    6  
ATOM 10070 C CB   . ASP A 1 102 ? 3.298   -4.365  5.580   1.00 0.00 ? 102 ASP A CB   6  
ATOM 10071 C CG   . ASP A 1 102 ? 4.116   -5.413  4.851   1.00 0.00 ? 102 ASP A CG   6  
ATOM 10072 O OD1  . ASP A 1 102 ? 5.278   -5.641  5.249   1.00 0.00 ? 102 ASP A OD1  6  
ATOM 10073 O OD2  . ASP A 1 102 ? 3.595   -6.005  3.884   1.00 0.00 ? 102 ASP A OD2  6  
ATOM 10074 H H    . ASP A 1 102 ? 5.438   -3.550  4.406   1.00 0.00 ? 102 ASP A H    6  
ATOM 10075 H HA   . ASP A 1 102 ? 2.879   -2.863  4.115   1.00 0.00 ? 102 ASP A HA   6  
ATOM 10076 H HB2  . ASP A 1 102 ? 3.595   -4.361  6.618   1.00 0.00 ? 102 ASP A HB2  6  
ATOM 10077 H HB3  . ASP A 1 102 ? 2.254   -4.636  5.509   1.00 0.00 ? 102 ASP A HB3  6  
ATOM 10078 N N    . VAL A 1 103 ? 1.850   -1.393  5.847   1.00 0.00 ? 103 VAL A N    6  
ATOM 10079 C CA   . VAL A 1 103 ? 1.319   -0.380  6.751   1.00 0.00 ? 103 VAL A CA   6  
ATOM 10080 C C    . VAL A 1 103 ? -0.025  -0.808  7.329   1.00 0.00 ? 103 VAL A C    6  
ATOM 10081 O O    . VAL A 1 103 ? -1.077  -0.344  6.891   1.00 0.00 ? 103 VAL A O    6  
ATOM 10082 C CB   . VAL A 1 103 ? 1.151   0.976   6.038   1.00 0.00 ? 103 VAL A CB   6  
ATOM 10083 C CG1  . VAL A 1 103 ? 0.518   1.995   6.973   1.00 0.00 ? 103 VAL A CG1  6  
ATOM 10084 C CG2  . VAL A 1 103 ? 2.491   1.474   5.520   1.00 0.00 ? 103 VAL A CG2  6  
ATOM 10085 H H    . VAL A 1 103 ? 1.299   -1.699  5.096   1.00 0.00 ? 103 VAL A H    6  
ATOM 10086 H HA   . VAL A 1 103 ? 2.024   -0.252  7.560   1.00 0.00 ? 103 VAL A HA   6  
ATOM 10087 H HB   . VAL A 1 103 ? 0.491   0.836   5.195   1.00 0.00 ? 103 VAL A HB   6  
ATOM 10088 H HG11 . VAL A 1 103 ? -0.324  2.460   6.481   1.00 0.00 ? 103 VAL A HG11 6  
ATOM 10089 H HG12 . VAL A 1 103 ? 0.183   1.501   7.873   1.00 0.00 ? 103 VAL A HG12 6  
ATOM 10090 H HG13 . VAL A 1 103 ? 1.247   2.751   7.227   1.00 0.00 ? 103 VAL A HG13 6  
ATOM 10091 H HG21 . VAL A 1 103 ? 3.285   0.877   5.943   1.00 0.00 ? 103 VAL A HG21 6  
ATOM 10092 H HG22 . VAL A 1 103 ? 2.514   1.393   4.443   1.00 0.00 ? 103 VAL A HG22 6  
ATOM 10093 H HG23 . VAL A 1 103 ? 2.626   2.507   5.805   1.00 0.00 ? 103 VAL A HG23 6  
ATOM 10094 N N    . ALA A 1 104 ? 0.018   -1.696  8.317   1.00 0.00 ? 104 ALA A N    6  
ATOM 10095 C CA   . ALA A 1 104 ? -1.196  -2.186  8.957   1.00 0.00 ? 104 ALA A CA   6  
ATOM 10096 C C    . ALA A 1 104 ? -1.887  -1.077  9.744   1.00 0.00 ? 104 ALA A C    6  
ATOM 10097 O O    . ALA A 1 104 ? -1.239  -0.309  10.455  1.00 0.00 ? 104 ALA A O    6  
ATOM 10098 C CB   . ALA A 1 104 ? -0.875  -3.361  9.869   1.00 0.00 ? 104 ALA A CB   6  
ATOM 10099 H H    . ALA A 1 104 ? 0.887   -2.029  8.623   1.00 0.00 ? 104 ALA A H    6  
ATOM 10100 H HA   . ALA A 1 104 ? -1.865  -2.534  8.183   1.00 0.00 ? 104 ALA A HA   6  
ATOM 10101 H HB1  . ALA A 1 104 ? 0.093   -3.208  10.324  1.00 0.00 ? 104 ALA A HB1  6  
ATOM 10102 H HB2  . ALA A 1 104 ? -1.628  -3.434  10.639  1.00 0.00 ? 104 ALA A HB2  6  
ATOM 10103 H HB3  . ALA A 1 104 ? -0.862  -4.272  9.290   1.00 0.00 ? 104 ALA A HB3  6  
ATOM 10104 N N    . VAL A 1 105 ? -3.207  -0.998  9.611   1.00 0.00 ? 105 VAL A N    6  
ATOM 10105 C CA   . VAL A 1 105 ? -3.987  0.017   10.309  1.00 0.00 ? 105 VAL A CA   6  
ATOM 10106 C C    . VAL A 1 105 ? -5.345  -0.529  10.735  1.00 0.00 ? 105 VAL A C    6  
ATOM 10107 O O    . VAL A 1 105 ? -6.006  -1.237  9.975   1.00 0.00 ? 105 VAL A O    6  
ATOM 10108 C CB   . VAL A 1 105 ? -4.199  1.265   9.431   1.00 0.00 ? 105 VAL A CB   6  
ATOM 10109 C CG1  . VAL A 1 105 ? -5.261  1.000   8.375   1.00 0.00 ? 105 VAL A CG1  6  
ATOM 10110 C CG2  . VAL A 1 105 ? -4.577  2.462   10.290  1.00 0.00 ? 105 VAL A CG2  6  
ATOM 10111 H H    . VAL A 1 105 ? -3.669  -1.638  9.030   1.00 0.00 ? 105 VAL A H    6  
ATOM 10112 H HA   . VAL A 1 105 ? -3.436  0.313   11.191  1.00 0.00 ? 105 VAL A HA   6  
ATOM 10113 H HB   . VAL A 1 105 ? -3.270  1.488   8.928   1.00 0.00 ? 105 VAL A HB   6  
ATOM 10114 H HG11 . VAL A 1 105 ? -5.019  1.548   7.476   1.00 0.00 ? 105 VAL A HG11 6  
ATOM 10115 H HG12 . VAL A 1 105 ? -5.295  -0.057  8.155   1.00 0.00 ? 105 VAL A HG12 6  
ATOM 10116 H HG13 . VAL A 1 105 ? -6.224  1.322   8.743   1.00 0.00 ? 105 VAL A HG13 6  
ATOM 10117 H HG21 . VAL A 1 105 ? -3.719  2.778   10.864  1.00 0.00 ? 105 VAL A HG21 6  
ATOM 10118 H HG22 . VAL A 1 105 ? -4.903  3.273   9.655   1.00 0.00 ? 105 VAL A HG22 6  
ATOM 10119 H HG23 . VAL A 1 105 ? -5.378  2.187   10.961  1.00 0.00 ? 105 VAL A HG23 6  
ATOM 10120 N N    . ARG A 1 106 ? -5.756  -0.195  11.954  1.00 0.00 ? 106 ARG A N    6  
ATOM 10121 C CA   . ARG A 1 106 ? -7.036  -0.652  12.481  1.00 0.00 ? 106 ARG A CA   6  
ATOM 10122 C C    . ARG A 1 106 ? -8.136  0.365   12.195  1.00 0.00 ? 106 ARG A C    6  
ATOM 10123 O O    . ARG A 1 106 ? -7.983  1.556   12.470  1.00 0.00 ? 106 ARG A O    6  
ATOM 10124 C CB   . ARG A 1 106 ? -6.933  -0.898  13.987  1.00 0.00 ? 106 ARG A CB   6  
ATOM 10125 C CG   . ARG A 1 106 ? -8.003  -1.833  14.526  1.00 0.00 ? 106 ARG A CG   6  
ATOM 10126 C CD   . ARG A 1 106 ? -8.043  -1.816  16.046  1.00 0.00 ? 106 ARG A CD   6  
ATOM 10127 N NE   . ARG A 1 106 ? -6.835  -2.392  16.632  1.00 0.00 ? 106 ARG A NE   6  
ATOM 10128 C CZ   . ARG A 1 106 ? -6.486  -2.231  17.903  1.00 0.00 ? 106 ARG A CZ   6  
ATOM 10129 N NH1  . ARG A 1 106 ? -7.249  -1.515  18.718  1.00 0.00 ? 106 ARG A NH1  6  
ATOM 10130 N NH2  . ARG A 1 106 ? -5.372  -2.786  18.362  1.00 0.00 ? 106 ARG A NH2  6  
ATOM 10131 H H    . ARG A 1 106 ? -5.184  0.372   12.512  1.00 0.00 ? 106 ARG A H    6  
ATOM 10132 H HA   . ARG A 1 106 ? -7.284  -1.581  11.990  1.00 0.00 ? 106 ARG A HA   6  
ATOM 10133 H HB2  . ARG A 1 106 ? -5.967  -1.330  14.205  1.00 0.00 ? 106 ARG A HB2  6  
ATOM 10134 H HB3  . ARG A 1 106 ? -7.019  0.047   14.501  1.00 0.00 ? 106 ARG A HB3  6  
ATOM 10135 H HG2  . ARG A 1 106 ? -8.965  -1.519  14.149  1.00 0.00 ? 106 ARG A HG2  6  
ATOM 10136 H HG3  . ARG A 1 106 ? -7.793  -2.837  14.191  1.00 0.00 ? 106 ARG A HG3  6  
ATOM 10137 H HD2  . ARG A 1 106 ? -8.140  -0.794  16.380  1.00 0.00 ? 106 ARG A HD2  6  
ATOM 10138 H HD3  . ARG A 1 106 ? -8.899  -2.385  16.377  1.00 0.00 ? 106 ARG A HD3  6  
ATOM 10139 H HE   . ARG A 1 106 ? -6.257  -2.925  16.048  1.00 0.00 ? 106 ARG A HE   6  
ATOM 10140 H HH11 . ARG A 1 106 ? -8.089  -1.096  18.375  1.00 0.00 ? 106 ARG A HH11 6  
ATOM 10141 H HH12 . ARG A 1 106 ? -6.984  -1.396  19.675  1.00 0.00 ? 106 ARG A HH12 6  
ATOM 10142 H HH21 . ARG A 1 106 ? -4.794  -3.326  17.751  1.00 0.00 ? 106 ARG A HH21 6  
ATOM 10143 H HH22 . ARG A 1 106 ? -5.110  -2.664  19.319  1.00 0.00 ? 106 ARG A HH22 6  
ATOM 10144 N N    . THR A 1 107 ? -9.247  -0.112  11.641  1.00 0.00 ? 107 THR A N    6  
ATOM 10145 C CA   . THR A 1 107 ? -10.372 0.756   11.316  1.00 0.00 ? 107 THR A CA   6  
ATOM 10146 C C    . THR A 1 107 ? -11.126 1.173   12.574  1.00 0.00 ? 107 THR A C    6  
ATOM 10147 O O    . THR A 1 107 ? -10.735 0.824   13.689  1.00 0.00 ? 107 THR A O    6  
ATOM 10148 C CB   . THR A 1 107 ? -11.353 0.065   10.349  1.00 0.00 ? 107 THR A CB   6  
ATOM 10149 O OG1  . THR A 1 107 ? -11.609 -1.274  10.785  1.00 0.00 ? 107 THR A OG1  6  
ATOM 10150 C CG2  . THR A 1 107 ? -10.794 0.046   8.935   1.00 0.00 ? 107 THR A CG2  6  
ATOM 10151 H H    . THR A 1 107 ? -9.309  -1.070  11.446  1.00 0.00 ? 107 THR A H    6  
ATOM 10152 H HA   . THR A 1 107 ? -9.983  1.639   10.831  1.00 0.00 ? 107 THR A HA   6  
ATOM 10153 H HB   . THR A 1 107 ? -12.281 0.619   10.346  1.00 0.00 ? 107 THR A HB   6  
ATOM 10154 H HG1  . THR A 1 107 ? -12.395 -1.287  11.337  1.00 0.00 ? 107 THR A HG1  6  
ATOM 10155 H HG21 . THR A 1 107 ? -11.395 0.681   8.301   1.00 0.00 ? 107 THR A HG21 6  
ATOM 10156 H HG22 . THR A 1 107 ? -10.813 -0.965  8.554   1.00 0.00 ? 107 THR A HG22 6  
ATOM 10157 H HG23 . THR A 1 107 ? -9.777  0.407   8.945   1.00 0.00 ? 107 THR A HG23 6  
ATOM 10158 N N    . LEU A 1 108 ? -12.208 1.921   12.389  1.00 0.00 ? 108 LEU A N    6  
ATOM 10159 C CA   . LEU A 1 108 ? -13.018 2.385   13.510  1.00 0.00 ? 108 LEU A CA   6  
ATOM 10160 C C    . LEU A 1 108 ? -14.104 1.371   13.854  1.00 0.00 ? 108 LEU A C    6  
ATOM 10161 O O    . LEU A 1 108 ? -14.404 0.476   13.064  1.00 0.00 ? 108 LEU A O    6  
ATOM 10162 C CB   . LEU A 1 108 ? -13.653 3.737   13.180  1.00 0.00 ? 108 LEU A CB   6  
ATOM 10163 C CG   . LEU A 1 108 ? -12.735 4.767   12.520  1.00 0.00 ? 108 LEU A CG   6  
ATOM 10164 C CD1  . LEU A 1 108 ? -13.519 6.011   12.134  1.00 0.00 ? 108 LEU A CD1  6  
ATOM 10165 C CD2  . LEU A 1 108 ? -11.583 5.126   13.447  1.00 0.00 ? 108 LEU A CD2  6  
ATOM 10166 H H    . LEU A 1 108 ? -12.470 2.167   11.478  1.00 0.00 ? 108 LEU A H    6  
ATOM 10167 H HA   . LEU A 1 108 ? -12.367 2.501   14.363  1.00 0.00 ? 108 LEU A HA   6  
ATOM 10168 H HB2  . LEU A 1 108 ? -14.483 3.559   12.513  1.00 0.00 ? 108 LEU A HB2  6  
ATOM 10169 H HB3  . LEU A 1 108 ? -14.020 4.163   14.103  1.00 0.00 ? 108 LEU A HB3  6  
ATOM 10170 H HG   . LEU A 1 108 ? -12.319 4.342   11.617  1.00 0.00 ? 108 LEU A HG   6  
ATOM 10171 H HD11 . LEU A 1 108 ? -13.362 6.225   11.088  1.00 0.00 ? 108 LEU A HD11 6  
ATOM 10172 H HD12 . LEU A 1 108 ? -13.182 6.848   12.728  1.00 0.00 ? 108 LEU A HD12 6  
ATOM 10173 H HD13 . LEU A 1 108 ? -14.571 5.844   12.314  1.00 0.00 ? 108 LEU A HD13 6  
ATOM 10174 H HD21 . LEU A 1 108 ? -10.734 4.496   13.226  1.00 0.00 ? 108 LEU A HD21 6  
ATOM 10175 H HD22 . LEU A 1 108 ? -11.886 4.975   14.473  1.00 0.00 ? 108 LEU A HD22 6  
ATOM 10176 H HD23 . LEU A 1 108 ? -11.312 6.161   13.300  1.00 0.00 ? 108 LEU A HD23 6  
ATOM 10177 N N    . SER A 1 109 ? -14.691 1.519   15.037  1.00 0.00 ? 109 SER A N    6  
ATOM 10178 C CA   . SER A 1 109 ? -15.743 0.615   15.487  1.00 0.00 ? 109 SER A CA   6  
ATOM 10179 C C    . SER A 1 109 ? -17.096 1.320   15.500  1.00 0.00 ? 109 SER A C    6  
ATOM 10180 O O    . SER A 1 109 ? -17.289 2.304   16.214  1.00 0.00 ? 109 SER A O    6  
ATOM 10181 C CB   . SER A 1 109 ? -15.421 0.078   16.883  1.00 0.00 ? 109 SER A CB   6  
ATOM 10182 O OG   . SER A 1 109 ? -16.607 -0.198  17.609  1.00 0.00 ? 109 SER A OG   6  
ATOM 10183 H H    . SER A 1 109 ? -14.408 2.252   15.623  1.00 0.00 ? 109 SER A H    6  
ATOM 10184 H HA   . SER A 1 109 ? -15.788 -0.212  14.794  1.00 0.00 ? 109 SER A HA   6  
ATOM 10185 H HB2  . SER A 1 109 ? -14.849 -0.832  16.793  1.00 0.00 ? 109 SER A HB2  6  
ATOM 10186 H HB3  . SER A 1 109 ? -14.845 0.814   17.424  1.00 0.00 ? 109 SER A HB3  6  
ATOM 10187 H HG   . SER A 1 109 ? -17.260 -0.584  17.021  1.00 0.00 ? 109 SER A HG   6  
ATOM 10188 N N    . ASP A 1 110 ? -18.030 0.808   14.706  1.00 0.00 ? 110 ASP A N    6  
ATOM 10189 C CA   . ASP A 1 110 ? -19.366 1.387   14.625  1.00 0.00 ? 110 ASP A CA   6  
ATOM 10190 C C    . ASP A 1 110 ? -20.315 0.701   15.604  1.00 0.00 ? 110 ASP A C    6  
ATOM 10191 O O    . ASP A 1 110 ? -20.995 -0.263  15.253  1.00 0.00 ? 110 ASP A O    6  
ATOM 10192 C CB   . ASP A 1 110 ? -19.911 1.270   13.201  1.00 0.00 ? 110 ASP A CB   6  
ATOM 10193 C CG   . ASP A 1 110 ? -21.229 1.998   13.024  1.00 0.00 ? 110 ASP A CG   6  
ATOM 10194 O OD1  . ASP A 1 110 ? -21.978 2.119   14.016  1.00 0.00 ? 110 ASP A OD1  6  
ATOM 10195 O OD2  . ASP A 1 110 ? -21.513 2.445   11.893  1.00 0.00 ? 110 ASP A OD2  6  
ATOM 10196 H H    . ASP A 1 110 ? -17.816 0.022   14.160  1.00 0.00 ? 110 ASP A H    6  
ATOM 10197 H HA   . ASP A 1 110 ? -19.292 2.431   14.888  1.00 0.00 ? 110 ASP A HA   6  
ATOM 10198 H HB2  . ASP A 1 110 ? -19.193 1.691   12.512  1.00 0.00 ? 110 ASP A HB2  6  
ATOM 10199 H HB3  . ASP A 1 110 ? -20.062 0.227   12.965  1.00 0.00 ? 110 ASP A HB3  6  
ATOM 10200 N N    . SER A 1 111 ? -20.354 1.206   16.833  1.00 0.00 ? 111 SER A N    6  
ATOM 10201 C CA   . SER A 1 111 ? -21.216 0.639   17.864  1.00 0.00 ? 111 SER A CA   6  
ATOM 10202 C C    . SER A 1 111 ? -22.573 1.336   17.882  1.00 0.00 ? 111 SER A C    6  
ATOM 10203 O O    . SER A 1 111 ? -23.110 1.646   18.944  1.00 0.00 ? 111 SER A O    6  
ATOM 10204 C CB   . SER A 1 111 ? -20.551 0.758   19.237  1.00 0.00 ? 111 SER A CB   6  
ATOM 10205 O OG   . SER A 1 111 ? -20.241 2.108   19.538  1.00 0.00 ? 111 SER A OG   6  
ATOM 10206 H H    . SER A 1 111 ? -19.789 1.976   17.052  1.00 0.00 ? 111 SER A H    6  
ATOM 10207 H HA   . SER A 1 111 ? -21.364 -0.406  17.635  1.00 0.00 ? 111 SER A HA   6  
ATOM 10208 H HB2  . SER A 1 111 ? -21.220 0.378   19.993  1.00 0.00 ? 111 SER A HB2  6  
ATOM 10209 H HB3  . SER A 1 111 ? -19.637 0.182   19.242  1.00 0.00 ? 111 SER A HB3  6  
ATOM 10210 H HG   . SER A 1 111 ? -20.458 2.290   20.455  1.00 0.00 ? 111 SER A HG   6  
ATOM 10211 N N    . GLY A 1 112 ? -23.121 1.580   16.696  1.00 0.00 ? 112 GLY A N    6  
ATOM 10212 C CA   . GLY A 1 112 ? -24.411 2.239   16.596  1.00 0.00 ? 112 GLY A CA   6  
ATOM 10213 C C    . GLY A 1 112 ? -24.316 3.602   15.938  1.00 0.00 ? 112 GLY A C    6  
ATOM 10214 O O    . GLY A 1 112 ? -23.236 4.062   15.568  1.00 0.00 ? 112 GLY A O    6  
ATOM 10215 H H    . GLY A 1 112 ? -22.647 1.310   15.881  1.00 0.00 ? 112 GLY A H    6  
ATOM 10216 H HA2  . GLY A 1 112 ? -25.077 1.617   16.017  1.00 0.00 ? 112 GLY A HA2  6  
ATOM 10217 H HA3  . GLY A 1 112 ? -24.818 2.359   17.589  1.00 0.00 ? 112 GLY A HA3  6  
ATOM 10218 N N    . PRO A 1 113 ? -25.469 4.269   15.783  1.00 0.00 ? 113 PRO A N    6  
ATOM 10219 C CA   . PRO A 1 113 ? -25.538 5.596   15.164  1.00 0.00 ? 113 PRO A CA   6  
ATOM 10220 C C    . PRO A 1 113 ? -24.916 6.678   16.040  1.00 0.00 ? 113 PRO A C    6  
ATOM 10221 O O    . PRO A 1 113 ? -24.509 7.731   15.549  1.00 0.00 ? 113 PRO A O    6  
ATOM 10222 C CB   . PRO A 1 113 ? -27.041 5.836   15.005  1.00 0.00 ? 113 PRO A CB   6  
ATOM 10223 C CG   . PRO A 1 113 ? -27.673 4.992   16.058  1.00 0.00 ? 113 PRO A CG   6  
ATOM 10224 C CD   . PRO A 1 113 ? -26.794 3.781   16.201  1.00 0.00 ? 113 PRO A CD   6  
ATOM 10225 H HA   . PRO A 1 113 ? -25.066 5.606   14.192  1.00 0.00 ? 113 PRO A HA   6  
ATOM 10226 H HB2  . PRO A 1 113 ? -27.259 6.884   15.154  1.00 0.00 ? 113 PRO A HB2  6  
ATOM 10227 H HB3  . PRO A 1 113 ? -27.355 5.534   14.017  1.00 0.00 ? 113 PRO A HB3  6  
ATOM 10228 H HG2  . PRO A 1 113 ? -27.714 5.537   16.989  1.00 0.00 ? 113 PRO A HG2  6  
ATOM 10229 H HG3  . PRO A 1 113 ? -28.665 4.701   15.748  1.00 0.00 ? 113 PRO A HG3  6  
ATOM 10230 H HD2  . PRO A 1 113 ? -26.775 3.446   17.227  1.00 0.00 ? 113 PRO A HD2  6  
ATOM 10231 H HD3  . PRO A 1 113 ? -27.134 2.989   15.550  1.00 0.00 ? 113 PRO A HD3  6  
ATOM 10232 N N    . SER A 1 114 ? -24.845 6.411   17.340  1.00 0.00 ? 114 SER A N    6  
ATOM 10233 C CA   . SER A 1 114 ? -24.275 7.364   18.286  1.00 0.00 ? 114 SER A CA   6  
ATOM 10234 C C    . SER A 1 114 ? -23.279 6.677   19.216  1.00 0.00 ? 114 SER A C    6  
ATOM 10235 O O    . SER A 1 114 ? -23.229 5.450   19.291  1.00 0.00 ? 114 SER A O    6  
ATOM 10236 C CB   . SER A 1 114 ? -25.384 8.026   19.106  1.00 0.00 ? 114 SER A CB   6  
ATOM 10237 O OG   . SER A 1 114 ? -26.083 7.070   19.884  1.00 0.00 ? 114 SER A OG   6  
ATOM 10238 H H    . SER A 1 114 ? -25.186 5.554   17.672  1.00 0.00 ? 114 SER A H    6  
ATOM 10239 H HA   . SER A 1 114 ? -23.756 8.123   17.720  1.00 0.00 ? 114 SER A HA   6  
ATOM 10240 H HB2  . SER A 1 114 ? -24.949 8.761   19.767  1.00 0.00 ? 114 SER A HB2  6  
ATOM 10241 H HB3  . SER A 1 114 ? -26.082 8.510   18.439  1.00 0.00 ? 114 SER A HB3  6  
ATOM 10242 H HG   . SER A 1 114 ? -26.594 7.519   20.561  1.00 0.00 ? 114 SER A HG   6  
ATOM 10243 N N    . SER A 1 115 ? -22.489 7.479   19.923  1.00 0.00 ? 115 SER A N    6  
ATOM 10244 C CA   . SER A 1 115 ? -21.492 6.950   20.846  1.00 0.00 ? 115 SER A CA   6  
ATOM 10245 C C    . SER A 1 115 ? -21.145 7.977   21.919  1.00 0.00 ? 115 SER A C    6  
ATOM 10246 O O    . SER A 1 115 ? -21.019 9.168   21.636  1.00 0.00 ? 115 SER A O    6  
ATOM 10247 C CB   . SER A 1 115 ? -20.228 6.543   20.085  1.00 0.00 ? 115 SER A CB   6  
ATOM 10248 O OG   . SER A 1 115 ? -19.456 5.621   20.836  1.00 0.00 ? 115 SER A OG   6  
ATOM 10249 H H    . SER A 1 115 ? -22.578 8.450   19.819  1.00 0.00 ? 115 SER A H    6  
ATOM 10250 H HA   . SER A 1 115 ? -21.912 6.076   21.322  1.00 0.00 ? 115 SER A HA   6  
ATOM 10251 H HB2  . SER A 1 115 ? -20.506 6.083   19.150  1.00 0.00 ? 115 SER A HB2  6  
ATOM 10252 H HB3  . SER A 1 115 ? -19.630 7.421   19.891  1.00 0.00 ? 115 SER A HB3  6  
ATOM 10253 H HG   . SER A 1 115 ? -18.663 6.055   21.158  1.00 0.00 ? 115 SER A HG   6  
ATOM 10254 N N    . GLY A 1 116 ? -20.992 7.507   23.153  1.00 0.00 ? 116 GLY A N    6  
ATOM 10255 C CA   . GLY A 1 116 ? -20.661 8.397   24.250  1.00 0.00 ? 116 GLY A CA   6  
ATOM 10256 C C    . GLY A 1 116 ? -21.893 8.959   24.932  1.00 0.00 ? 116 GLY A C    6  
ATOM 10257 O O    . GLY A 1 116 ? -21.907 9.144   26.149  1.00 0.00 ? 116 GLY A O    6  
ATOM 10258 H H    . GLY A 1 116 ? -21.105 6.547   23.319  1.00 0.00 ? 116 GLY A H    6  
ATOM 10259 H HA2  . GLY A 1 116 ? -20.077 7.852   24.977  1.00 0.00 ? 116 GLY A HA2  6  
ATOM 10260 H HA3  . GLY A 1 116 ? -20.070 9.216   23.869  1.00 0.00 ? 116 GLY A HA3  6  
ATOM 10261 N N    . GLY A 1 1   ? -6.793  -28.033 4.202   1.00 0.00 ? 1   GLY A N    7  
ATOM 10262 C CA   . GLY A 1 1   ? -6.378  -26.698 3.811   1.00 0.00 ? 1   GLY A CA   7  
ATOM 10263 C C    . GLY A 1 1   ? -5.008  -26.335 4.350   1.00 0.00 ? 1   GLY A C    7  
ATOM 10264 O O    . GLY A 1 1   ? -4.817  -26.237 5.562   1.00 0.00 ? 1   GLY A O    7  
ATOM 10265 H H1   . GLY A 1 1   ? -6.180  -28.788 4.084   1.00 0.00 ? 1   GLY A H1   7  
ATOM 10266 H HA2  . GLY A 1 1   ? -6.355  -26.641 2.733   1.00 0.00 ? 1   GLY A HA2  7  
ATOM 10267 H HA3  . GLY A 1 1   ? -7.099  -25.986 4.184   1.00 0.00 ? 1   GLY A HA3  7  
ATOM 10268 N N    . SER A 1 2   ? -4.052  -26.138 3.449   1.00 0.00 ? 2   SER A N    7  
ATOM 10269 C CA   . SER A 1 2   ? -2.691  -25.790 3.841   1.00 0.00 ? 2   SER A CA   7  
ATOM 10270 C C    . SER A 1 2   ? -1.996  -24.995 2.740   1.00 0.00 ? 2   SER A C    7  
ATOM 10271 O O    . SER A 1 2   ? -2.548  -24.796 1.658   1.00 0.00 ? 2   SER A O    7  
ATOM 10272 C CB   . SER A 1 2   ? -1.890  -27.054 4.157   1.00 0.00 ? 2   SER A CB   7  
ATOM 10273 O OG   . SER A 1 2   ? -2.245  -27.580 5.424   1.00 0.00 ? 2   SER A OG   7  
ATOM 10274 H H    . SER A 1 2   ? -4.267  -26.232 2.497   1.00 0.00 ? 2   SER A H    7  
ATOM 10275 H HA   . SER A 1 2   ? -2.749  -25.179 4.729   1.00 0.00 ? 2   SER A HA   7  
ATOM 10276 H HB2  . SER A 1 2   ? -2.087  -27.800 3.403   1.00 0.00 ? 2   SER A HB2  7  
ATOM 10277 H HB3  . SER A 1 2   ? -0.836  -26.817 4.161   1.00 0.00 ? 2   SER A HB3  7  
ATOM 10278 H HG   . SER A 1 2   ? -1.459  -27.659 5.970   1.00 0.00 ? 2   SER A HG   7  
ATOM 10279 N N    . SER A 1 3   ? -0.779  -24.541 3.026   1.00 0.00 ? 3   SER A N    7  
ATOM 10280 C CA   . SER A 1 3   ? -0.008  -23.764 2.063   1.00 0.00 ? 3   SER A CA   7  
ATOM 10281 C C    . SER A 1 3   ? 1.214   -24.545 1.589   1.00 0.00 ? 3   SER A C    7  
ATOM 10282 O O    . SER A 1 3   ? 1.678   -25.463 2.263   1.00 0.00 ? 3   SER A O    7  
ATOM 10283 C CB   . SER A 1 3   ? 0.430   -22.435 2.682   1.00 0.00 ? 3   SER A CB   7  
ATOM 10284 O OG   . SER A 1 3   ? 1.363   -22.643 3.728   1.00 0.00 ? 3   SER A OG   7  
ATOM 10285 H H    . SER A 1 3   ? -0.392  -24.732 3.906   1.00 0.00 ? 3   SER A H    7  
ATOM 10286 H HA   . SER A 1 3   ? -0.644  -23.563 1.213   1.00 0.00 ? 3   SER A HA   7  
ATOM 10287 H HB2  . SER A 1 3   ? 0.890   -21.821 1.923   1.00 0.00 ? 3   SER A HB2  7  
ATOM 10288 H HB3  . SER A 1 3   ? -0.434  -21.925 3.082   1.00 0.00 ? 3   SER A HB3  7  
ATOM 10289 H HG   . SER A 1 3   ? 1.988   -21.914 3.750   1.00 0.00 ? 3   SER A HG   7  
ATOM 10290 N N    . GLY A 1 4   ? 1.731   -24.171 0.422   1.00 0.00 ? 4   GLY A N    7  
ATOM 10291 C CA   . GLY A 1 4   ? 2.895   -24.846 -0.124  1.00 0.00 ? 4   GLY A CA   7  
ATOM 10292 C C    . GLY A 1 4   ? 4.038   -23.892 -0.407  1.00 0.00 ? 4   GLY A C    7  
ATOM 10293 O O    . GLY A 1 4   ? 4.109   -23.300 -1.484  1.00 0.00 ? 4   GLY A O    7  
ATOM 10294 H H    . GLY A 1 4   ? 1.320   -23.431 -0.072  1.00 0.00 ? 4   GLY A H    7  
ATOM 10295 H HA2  . GLY A 1 4   ? 3.229   -25.592 0.582   1.00 0.00 ? 4   GLY A HA2  7  
ATOM 10296 H HA3  . GLY A 1 4   ? 2.613   -25.336 -1.044  1.00 0.00 ? 4   GLY A HA3  7  
ATOM 10297 N N    . SER A 1 5   ? 4.935   -23.741 0.562   1.00 0.00 ? 5   SER A N    7  
ATOM 10298 C CA   . SER A 1 5   ? 6.078   -22.847 0.413   1.00 0.00 ? 5   SER A CA   7  
ATOM 10299 C C    . SER A 1 5   ? 6.758   -23.056 -0.936  1.00 0.00 ? 5   SER A C    7  
ATOM 10300 O O    . SER A 1 5   ? 7.508   -24.014 -1.124  1.00 0.00 ? 5   SER A O    7  
ATOM 10301 C CB   . SER A 1 5   ? 7.082   -23.077 1.544   1.00 0.00 ? 5   SER A CB   7  
ATOM 10302 O OG   . SER A 1 5   ? 7.581   -24.403 1.522   1.00 0.00 ? 5   SER A OG   7  
ATOM 10303 H H    . SER A 1 5   ? 4.824   -24.240 1.398   1.00 0.00 ? 5   SER A H    7  
ATOM 10304 H HA   . SER A 1 5   ? 5.714   -21.832 0.467   1.00 0.00 ? 5   SER A HA   7  
ATOM 10305 H HB2  . SER A 1 5   ? 7.909   -22.392 1.433   1.00 0.00 ? 5   SER A HB2  7  
ATOM 10306 H HB3  . SER A 1 5   ? 6.596   -22.904 2.494   1.00 0.00 ? 5   SER A HB3  7  
ATOM 10307 H HG   . SER A 1 5   ? 7.865   -24.623 0.632   1.00 0.00 ? 5   SER A HG   7  
ATOM 10308 N N    . SER A 1 6   ? 6.491   -22.151 -1.873  1.00 0.00 ? 6   SER A N    7  
ATOM 10309 C CA   . SER A 1 6   ? 7.073   -22.237 -3.207  1.00 0.00 ? 6   SER A CA   7  
ATOM 10310 C C    . SER A 1 6   ? 8.597   -22.200 -3.138  1.00 0.00 ? 6   SER A C    7  
ATOM 10311 O O    . SER A 1 6   ? 9.274   -23.103 -3.625  1.00 0.00 ? 6   SER A O    7  
ATOM 10312 C CB   . SER A 1 6   ? 6.563   -21.092 -4.084  1.00 0.00 ? 6   SER A CB   7  
ATOM 10313 O OG   . SER A 1 6   ? 5.168   -21.202 -4.305  1.00 0.00 ? 6   SER A OG   7  
ATOM 10314 H H    . SER A 1 6   ? 5.885   -21.410 -1.662  1.00 0.00 ? 6   SER A H    7  
ATOM 10315 H HA   . SER A 1 6   ? 6.767   -23.177 -3.643  1.00 0.00 ? 6   SER A HA   7  
ATOM 10316 H HB2  . SER A 1 6   ? 6.764   -20.151 -3.595  1.00 0.00 ? 6   SER A HB2  7  
ATOM 10317 H HB3  . SER A 1 6   ? 7.070   -21.119 -5.037  1.00 0.00 ? 6   SER A HB3  7  
ATOM 10318 H HG   . SER A 1 6   ? 5.008   -21.744 -5.082  1.00 0.00 ? 6   SER A HG   7  
ATOM 10319 N N    . GLY A 1 7   ? 9.130   -21.145 -2.527  1.00 0.00 ? 7   GLY A N    7  
ATOM 10320 C CA   . GLY A 1 7   ? 10.569  -21.008 -2.405  1.00 0.00 ? 7   GLY A CA   7  
ATOM 10321 C C    . GLY A 1 7   ? 11.000  -19.568 -2.214  1.00 0.00 ? 7   GLY A C    7  
ATOM 10322 O O    . GLY A 1 7   ? 10.542  -18.676 -2.928  1.00 0.00 ? 7   GLY A O    7  
ATOM 10323 H H    . GLY A 1 7   ? 8.540   -20.455 -2.157  1.00 0.00 ? 7   GLY A H    7  
ATOM 10324 H HA2  . GLY A 1 7   ? 10.905  -21.589 -1.558  1.00 0.00 ? 7   GLY A HA2  7  
ATOM 10325 H HA3  . GLY A 1 7   ? 11.034  -21.395 -3.300  1.00 0.00 ? 7   GLY A HA3  7  
ATOM 10326 N N    . ARG A 1 8   ? 11.883  -19.339 -1.247  1.00 0.00 ? 8   ARG A N    7  
ATOM 10327 C CA   . ARG A 1 8   ? 12.374  -17.996 -0.963  1.00 0.00 ? 8   ARG A CA   7  
ATOM 10328 C C    . ARG A 1 8   ? 13.470  -17.598 -1.946  1.00 0.00 ? 8   ARG A C    7  
ATOM 10329 O O    . ARG A 1 8   ? 14.644  -17.910 -1.743  1.00 0.00 ? 8   ARG A O    7  
ATOM 10330 C CB   . ARG A 1 8   ? 12.905  -17.916 0.470   1.00 0.00 ? 8   ARG A CB   7  
ATOM 10331 C CG   . ARG A 1 8   ? 11.836  -17.584 1.498   1.00 0.00 ? 8   ARG A CG   7  
ATOM 10332 C CD   . ARG A 1 8   ? 12.317  -17.868 2.913   1.00 0.00 ? 8   ARG A CD   7  
ATOM 10333 N NE   . ARG A 1 8   ? 12.252  -19.290 3.238   1.00 0.00 ? 8   ARG A NE   7  
ATOM 10334 C CZ   . ARG A 1 8   ? 11.154  -19.895 3.678   1.00 0.00 ? 8   ARG A CZ   7  
ATOM 10335 N NH1  . ARG A 1 8   ? 10.035  -19.204 3.846   1.00 0.00 ? 8   ARG A NH1  7  
ATOM 10336 N NH2  . ARG A 1 8   ? 11.174  -21.193 3.952   1.00 0.00 ? 8   ARG A NH2  7  
ATOM 10337 H H    . ARG A 1 8   ? 12.212  -20.091 -0.712  1.00 0.00 ? 8   ARG A H    7  
ATOM 10338 H HA   . ARG A 1 8   ? 11.546  -17.311 -1.068  1.00 0.00 ? 8   ARG A HA   7  
ATOM 10339 H HB2  . ARG A 1 8   ? 13.342  -18.869 0.733   1.00 0.00 ? 8   ARG A HB2  7  
ATOM 10340 H HB3  . ARG A 1 8   ? 13.668  -17.154 0.516   1.00 0.00 ? 8   ARG A HB3  7  
ATOM 10341 H HG2  . ARG A 1 8   ? 11.586  -16.536 1.419   1.00 0.00 ? 8   ARG A HG2  7  
ATOM 10342 H HG3  . ARG A 1 8   ? 10.959  -18.181 1.298   1.00 0.00 ? 8   ARG A HG3  7  
ATOM 10343 H HD2  . ARG A 1 8   ? 13.339  -17.534 3.005   1.00 0.00 ? 8   ARG A HD2  7  
ATOM 10344 H HD3  . ARG A 1 8   ? 11.695  -17.321 3.606   1.00 0.00 ? 8   ARG A HD3  7  
ATOM 10345 H HE   . ARG A 1 8   ? 13.068  -19.820 3.121   1.00 0.00 ? 8   ARG A HE   7  
ATOM 10346 H HH11 . ARG A 1 8   ? 10.017  -18.226 3.639   1.00 0.00 ? 8   ARG A HH11 7  
ATOM 10347 H HH12 . ARG A 1 8   ? 9.209   -19.661 4.176   1.00 0.00 ? 8   ARG A HH12 7  
ATOM 10348 H HH21 . ARG A 1 8   ? 12.016  -21.717 3.827   1.00 0.00 ? 8   ARG A HH21 7  
ATOM 10349 H HH22 . ARG A 1 8   ? 10.348  -21.646 4.284   1.00 0.00 ? 8   ARG A HH22 7  
ATOM 10350 N N    . VAL A 1 9   ? 13.080  -16.907 -3.012  1.00 0.00 ? 9   VAL A N    7  
ATOM 10351 C CA   . VAL A 1 9   ? 14.029  -16.465 -4.027  1.00 0.00 ? 9   VAL A CA   7  
ATOM 10352 C C    . VAL A 1 9   ? 14.730  -15.180 -3.602  1.00 0.00 ? 9   VAL A C    7  
ATOM 10353 O O    . VAL A 1 9   ? 14.080  -14.186 -3.278  1.00 0.00 ? 9   VAL A O    7  
ATOM 10354 C CB   . VAL A 1 9   ? 13.335  -16.235 -5.383  1.00 0.00 ? 9   VAL A CB   7  
ATOM 10355 C CG1  . VAL A 1 9   ? 12.796  -17.546 -5.936  1.00 0.00 ? 9   VAL A CG1  7  
ATOM 10356 C CG2  . VAL A 1 9   ? 12.223  -15.207 -5.243  1.00 0.00 ? 9   VAL A CG2  7  
ATOM 10357 H H    . VAL A 1 9   ? 12.131  -16.688 -3.118  1.00 0.00 ? 9   VAL A H    7  
ATOM 10358 H HA   . VAL A 1 9   ? 14.769  -17.243 -4.152  1.00 0.00 ? 9   VAL A HA   7  
ATOM 10359 H HB   . VAL A 1 9   ? 14.067  -15.851 -6.078  1.00 0.00 ? 9   VAL A HB   7  
ATOM 10360 H HG11 . VAL A 1 9   ? 12.899  -17.552 -7.011  1.00 0.00 ? 9   VAL A HG11 7  
ATOM 10361 H HG12 . VAL A 1 9   ? 13.351  -18.371 -5.514  1.00 0.00 ? 9   VAL A HG12 7  
ATOM 10362 H HG13 . VAL A 1 9   ? 11.752  -17.643 -5.675  1.00 0.00 ? 9   VAL A HG13 7  
ATOM 10363 H HG21 . VAL A 1 9   ? 11.284  -15.653 -5.536  1.00 0.00 ? 9   VAL A HG21 7  
ATOM 10364 H HG22 . VAL A 1 9   ? 12.161  -14.880 -4.215  1.00 0.00 ? 9   VAL A HG22 7  
ATOM 10365 H HG23 . VAL A 1 9   ? 12.433  -14.360 -5.878  1.00 0.00 ? 9   VAL A HG23 7  
ATOM 10366 N N    . GLU A 1 10  ? 16.059  -15.207 -3.607  1.00 0.00 ? 10  GLU A N    7  
ATOM 10367 C CA   . GLU A 1 10  ? 16.847  -14.043 -3.221  1.00 0.00 ? 10  GLU A CA   7  
ATOM 10368 C C    . GLU A 1 10  ? 17.241  -13.222 -4.446  1.00 0.00 ? 10  GLU A C    7  
ATOM 10369 O O    . GLU A 1 10  ? 18.292  -13.447 -5.048  1.00 0.00 ? 10  GLU A O    7  
ATOM 10370 C CB   . GLU A 1 10  ? 18.102  -14.477 -2.460  1.00 0.00 ? 10  GLU A CB   7  
ATOM 10371 C CG   . GLU A 1 10  ? 17.834  -14.865 -1.016  1.00 0.00 ? 10  GLU A CG   7  
ATOM 10372 C CD   . GLU A 1 10  ? 17.305  -13.708 -0.190  1.00 0.00 ? 10  GLU A CD   7  
ATOM 10373 O OE1  . GLU A 1 10  ? 17.979  -12.657 -0.144  1.00 0.00 ? 10  GLU A OE1  7  
ATOM 10374 O OE2  . GLU A 1 10  ? 16.220  -13.853 0.410   1.00 0.00 ? 10  GLU A OE2  7  
ATOM 10375 H H    . GLU A 1 10  ? 16.520  -16.029 -3.875  1.00 0.00 ? 10  GLU A H    7  
ATOM 10376 H HA   . GLU A 1 10  ? 16.239  -13.430 -2.573  1.00 0.00 ? 10  GLU A HA   7  
ATOM 10377 H HB2  . GLU A 1 10  ? 18.538  -15.327 -2.965  1.00 0.00 ? 10  GLU A HB2  7  
ATOM 10378 H HB3  . GLU A 1 10  ? 18.812  -13.664 -2.467  1.00 0.00 ? 10  GLU A HB3  7  
ATOM 10379 H HG2  . GLU A 1 10  ? 17.105  -15.661 -0.999  1.00 0.00 ? 10  GLU A HG2  7  
ATOM 10380 H HG3  . GLU A 1 10  ? 18.755  -15.213 -0.573  1.00 0.00 ? 10  GLU A HG3  7  
ATOM 10381 N N    . THR A 1 11  ? 16.389  -12.269 -4.812  1.00 0.00 ? 11  THR A N    7  
ATOM 10382 C CA   . THR A 1 11  ? 16.646  -11.416 -5.965  1.00 0.00 ? 11  THR A CA   7  
ATOM 10383 C C    . THR A 1 11  ? 16.230  -9.976  -5.687  1.00 0.00 ? 11  THR A C    7  
ATOM 10384 O O    . THR A 1 11  ? 15.264  -9.728  -4.966  1.00 0.00 ? 11  THR A O    7  
ATOM 10385 C CB   . THR A 1 11  ? 15.901  -11.922 -7.215  1.00 0.00 ? 11  THR A CB   7  
ATOM 10386 O OG1  . THR A 1 11  ? 16.218  -11.097 -8.341  1.00 0.00 ? 11  THR A OG1  7  
ATOM 10387 C CG2  . THR A 1 11  ? 14.397  -11.920 -6.986  1.00 0.00 ? 11  THR A CG2  7  
ATOM 10388 H H    . THR A 1 11  ? 15.569  -12.138 -4.292  1.00 0.00 ? 11  THR A H    7  
ATOM 10389 H HA   . THR A 1 11  ? 17.707  -11.441 -6.169  1.00 0.00 ? 11  THR A HA   7  
ATOM 10390 H HB   . THR A 1 11  ? 16.218  -12.935 -7.419  1.00 0.00 ? 11  THR A HB   7  
ATOM 10391 H HG1  . THR A 1 11  ? 16.166  -10.173 -8.086  1.00 0.00 ? 11  THR A HG1  7  
ATOM 10392 H HG21 . THR A 1 11  ? 14.151  -11.209 -6.211  1.00 0.00 ? 11  THR A HG21 7  
ATOM 10393 H HG22 . THR A 1 11  ? 14.078  -12.907 -6.684  1.00 0.00 ? 11  THR A HG22 7  
ATOM 10394 H HG23 . THR A 1 11  ? 13.894  -11.643 -7.900  1.00 0.00 ? 11  THR A HG23 7  
ATOM 10395 N N    . GLN A 1 12  ? 16.964  -9.031  -6.265  1.00 0.00 ? 12  GLN A N    7  
ATOM 10396 C CA   . GLN A 1 12  ? 16.670  -7.615  -6.079  1.00 0.00 ? 12  GLN A CA   7  
ATOM 10397 C C    . GLN A 1 12  ? 16.241  -6.971  -7.393  1.00 0.00 ? 12  GLN A C    7  
ATOM 10398 O O    . GLN A 1 12  ? 16.577  -7.439  -8.481  1.00 0.00 ? 12  GLN A O    7  
ATOM 10399 C CB   . GLN A 1 12  ? 17.892  -6.888  -5.516  1.00 0.00 ? 12  GLN A CB   7  
ATOM 10400 C CG   . GLN A 1 12  ? 18.147  -7.176  -4.045  1.00 0.00 ? 12  GLN A CG   7  
ATOM 10401 C CD   . GLN A 1 12  ? 19.052  -8.373  -3.833  1.00 0.00 ? 12  GLN A CD   7  
ATOM 10402 O OE1  . GLN A 1 12  ? 18.612  -9.422  -3.360  1.00 0.00 ? 12  GLN A OE1  7  
ATOM 10403 N NE2  . GLN A 1 12  ? 20.324  -8.223  -4.182  1.00 0.00 ? 12  GLN A NE2  7  
ATOM 10404 H H    . GLN A 1 12  ? 17.721  -9.292  -6.829  1.00 0.00 ? 12  GLN A H    7  
ATOM 10405 H HA   . GLN A 1 12  ? 15.858  -7.535  -5.372  1.00 0.00 ? 12  GLN A HA   7  
ATOM 10406 H HB2  . GLN A 1 12  ? 18.765  -7.189  -6.076  1.00 0.00 ? 12  GLN A HB2  7  
ATOM 10407 H HB3  . GLN A 1 12  ? 17.749  -5.824  -5.632  1.00 0.00 ? 12  GLN A HB3  7  
ATOM 10408 H HG2  . GLN A 1 12  ? 18.611  -6.310  -3.597  1.00 0.00 ? 12  GLN A HG2  7  
ATOM 10409 H HG3  . GLN A 1 12  ? 17.201  -7.367  -3.560  1.00 0.00 ? 12  GLN A HG3  7  
ATOM 10410 H HE21 . GLN A 1 12  ? 20.603  -7.359  -4.551  1.00 0.00 ? 12  GLN A HE21 7  
ATOM 10411 H HE22 . GLN A 1 12  ? 20.931  -8.981  -4.055  1.00 0.00 ? 12  GLN A HE22 7  
ATOM 10412 N N    . PRO A 1 13  ? 15.481  -5.870  -7.293  1.00 0.00 ? 13  PRO A N    7  
ATOM 10413 C CA   . PRO A 1 13  ? 14.990  -5.138  -8.464  1.00 0.00 ? 13  PRO A CA   7  
ATOM 10414 C C    . PRO A 1 13  ? 16.109  -4.416  -9.207  1.00 0.00 ? 13  PRO A C    7  
ATOM 10415 O O    . PRO A 1 13  ? 17.216  -4.272  -8.691  1.00 0.00 ? 13  PRO A O    7  
ATOM 10416 C CB   . PRO A 1 13  ? 14.008  -4.128  -7.865  1.00 0.00 ? 13  PRO A CB   7  
ATOM 10417 C CG   . PRO A 1 13  ? 14.473  -3.934  -6.463  1.00 0.00 ? 13  PRO A CG   7  
ATOM 10418 C CD   . PRO A 1 13  ? 15.042  -5.256  -6.029  1.00 0.00 ? 13  PRO A CD   7  
ATOM 10419 H HA   . PRO A 1 13  ? 14.466  -5.789  -9.149  1.00 0.00 ? 13  PRO A HA   7  
ATOM 10420 H HB2  . PRO A 1 13  ? 14.049  -3.205  -8.427  1.00 0.00 ? 13  PRO A HB2  7  
ATOM 10421 H HB3  . PRO A 1 13  ? 13.007  -4.531  -7.896  1.00 0.00 ? 13  PRO A HB3  7  
ATOM 10422 H HG2  . PRO A 1 13  ? 15.233  -3.168  -6.431  1.00 0.00 ? 13  PRO A HG2  7  
ATOM 10423 H HG3  . PRO A 1 13  ? 13.638  -3.661  -5.834  1.00 0.00 ? 13  PRO A HG3  7  
ATOM 10424 H HD2  . PRO A 1 13  ? 15.879  -5.105  -5.362  1.00 0.00 ? 13  PRO A HD2  7  
ATOM 10425 H HD3  . PRO A 1 13  ? 14.282  -5.856  -5.552  1.00 0.00 ? 13  PRO A HD3  7  
ATOM 10426 N N    . GLU A 1 14  ? 15.811  -3.964  -10.422 1.00 0.00 ? 14  GLU A N    7  
ATOM 10427 C CA   . GLU A 1 14  ? 16.794  -3.258  -11.235 1.00 0.00 ? 14  GLU A CA   7  
ATOM 10428 C C    . GLU A 1 14  ? 17.191  -1.937  -10.583 1.00 0.00 ? 14  GLU A C    7  
ATOM 10429 O O    . GLU A 1 14  ? 16.572  -1.499  -9.613  1.00 0.00 ? 14  GLU A O    7  
ATOM 10430 C CB   . GLU A 1 14  ? 16.237  -3.000  -12.637 1.00 0.00 ? 14  GLU A CB   7  
ATOM 10431 C CG   . GLU A 1 14  ? 16.430  -4.166  -13.592 1.00 0.00 ? 14  GLU A CG   7  
ATOM 10432 C CD   . GLU A 1 14  ? 17.878  -4.349  -14.005 1.00 0.00 ? 14  GLU A CD   7  
ATOM 10433 O OE1  . GLU A 1 14  ? 18.467  -3.390  -14.545 1.00 0.00 ? 14  GLU A OE1  7  
ATOM 10434 O OE2  . GLU A 1 14  ? 18.421  -5.452  -13.787 1.00 0.00 ? 14  GLU A OE2  7  
ATOM 10435 H H    . GLU A 1 14  ? 14.910  -4.110  -10.779 1.00 0.00 ? 14  GLU A H    7  
ATOM 10436 H HA   . GLU A 1 14  ? 17.670  -3.884  -11.315 1.00 0.00 ? 14  GLU A HA   7  
ATOM 10437 H HB2  . GLU A 1 14  ? 15.180  -2.795  -12.560 1.00 0.00 ? 14  GLU A HB2  7  
ATOM 10438 H HB3  . GLU A 1 14  ? 16.732  -2.135  -13.054 1.00 0.00 ? 14  GLU A HB3  7  
ATOM 10439 H HG2  . GLU A 1 14  ? 16.093  -5.071  -13.109 1.00 0.00 ? 14  GLU A HG2  7  
ATOM 10440 H HG3  . GLU A 1 14  ? 15.838  -3.991  -14.478 1.00 0.00 ? 14  GLU A HG3  7  
ATOM 10441 N N    . VAL A 1 15  ? 18.229  -1.305  -11.123 1.00 0.00 ? 15  VAL A N    7  
ATOM 10442 C CA   . VAL A 1 15  ? 18.709  -0.034  -10.595 1.00 0.00 ? 15  VAL A CA   7  
ATOM 10443 C C    . VAL A 1 15  ? 17.978  1.139   -11.238 1.00 0.00 ? 15  VAL A C    7  
ATOM 10444 O O    . VAL A 1 15  ? 17.745  2.164   -10.596 1.00 0.00 ? 15  VAL A O    7  
ATOM 10445 C CB   . VAL A 1 15  ? 20.224  0.132   -10.823 1.00 0.00 ? 15  VAL A CB   7  
ATOM 10446 C CG1  . VAL A 1 15  ? 20.694  1.488   -10.320 1.00 0.00 ? 15  VAL A CG1  7  
ATOM 10447 C CG2  . VAL A 1 15  ? 20.990  -0.993  -10.145 1.00 0.00 ? 15  VAL A CG2  7  
ATOM 10448 H H    . VAL A 1 15  ? 18.681  -1.704  -11.896 1.00 0.00 ? 15  VAL A H    7  
ATOM 10449 H HA   . VAL A 1 15  ? 18.523  -0.023  -9.531  1.00 0.00 ? 15  VAL A HA   7  
ATOM 10450 H HB   . VAL A 1 15  ? 20.415  0.081   -11.885 1.00 0.00 ? 15  VAL A HB   7  
ATOM 10451 H HG11 . VAL A 1 15  ? 20.773  1.464   -9.243  1.00 0.00 ? 15  VAL A HG11 7  
ATOM 10452 H HG12 . VAL A 1 15  ? 21.659  1.716   -10.748 1.00 0.00 ? 15  VAL A HG12 7  
ATOM 10453 H HG13 . VAL A 1 15  ? 19.982  2.246   -10.610 1.00 0.00 ? 15  VAL A HG13 7  
ATOM 10454 H HG21 . VAL A 1 15  ? 20.441  -1.332  -9.279  1.00 0.00 ? 15  VAL A HG21 7  
ATOM 10455 H HG22 . VAL A 1 15  ? 21.112  -1.815  -10.837 1.00 0.00 ? 15  VAL A HG22 7  
ATOM 10456 H HG23 . VAL A 1 15  ? 21.961  -0.634  -9.839  1.00 0.00 ? 15  VAL A HG23 7  
ATOM 10457 N N    . GLN A 1 16  ? 17.619  0.982   -12.508 1.00 0.00 ? 16  GLN A N    7  
ATOM 10458 C CA   . GLN A 1 16  ? 16.914  2.029   -13.237 1.00 0.00 ? 16  GLN A CA   7  
ATOM 10459 C C    . GLN A 1 16  ? 15.420  1.995   -12.930 1.00 0.00 ? 16  GLN A C    7  
ATOM 10460 O O    . GLN A 1 16  ? 14.589  2.182   -13.820 1.00 0.00 ? 16  GLN A O    7  
ATOM 10461 C CB   . GLN A 1 16  ? 17.141  1.874   -14.742 1.00 0.00 ? 16  GLN A CB   7  
ATOM 10462 C CG   . GLN A 1 16  ? 16.698  0.526   -15.288 1.00 0.00 ? 16  GLN A CG   7  
ATOM 10463 C CD   . GLN A 1 16  ? 15.265  0.540   -15.783 1.00 0.00 ? 16  GLN A CD   7  
ATOM 10464 O OE1  . GLN A 1 16  ? 14.808  1.521   -16.370 1.00 0.00 ? 16  GLN A OE1  7  
ATOM 10465 N NE2  . GLN A 1 16  ? 14.547  -0.552  -15.547 1.00 0.00 ? 16  GLN A NE2  7  
ATOM 10466 H H    . GLN A 1 16  ? 17.833  0.143   -12.964 1.00 0.00 ? 16  GLN A H    7  
ATOM 10467 H HA   . GLN A 1 16  ? 17.312  2.981   -12.918 1.00 0.00 ? 16  GLN A HA   7  
ATOM 10468 H HB2  . GLN A 1 16  ? 16.592  2.646   -15.258 1.00 0.00 ? 16  GLN A HB2  7  
ATOM 10469 H HB3  . GLN A 1 16  ? 18.195  1.993   -14.948 1.00 0.00 ? 16  GLN A HB3  7  
ATOM 10470 H HG2  . GLN A 1 16  ? 17.344  0.256   -16.110 1.00 0.00 ? 16  GLN A HG2  7  
ATOM 10471 H HG3  . GLN A 1 16  ? 16.786  -0.212  -14.504 1.00 0.00 ? 16  GLN A HG3  7  
ATOM 10472 H HE21 . GLN A 1 16  ? 14.977  -1.295  -15.072 1.00 0.00 ? 16  GLN A HE21 7  
ATOM 10473 H HE22 . GLN A 1 16  ? 13.618  -0.571  -15.855 1.00 0.00 ? 16  GLN A HE22 7  
ATOM 10474 N N    . LEU A 1 17  ? 15.086  1.756   -11.667 1.00 0.00 ? 17  LEU A N    7  
ATOM 10475 C CA   . LEU A 1 17  ? 13.692  1.697   -11.242 1.00 0.00 ? 17  LEU A CA   7  
ATOM 10476 C C    . LEU A 1 17  ? 13.385  2.793   -10.226 1.00 0.00 ? 17  LEU A C    7  
ATOM 10477 O O    . LEU A 1 17  ? 14.282  3.381   -9.622  1.00 0.00 ? 17  LEU A O    7  
ATOM 10478 C CB   . LEU A 1 17  ? 13.378  0.326   -10.641 1.00 0.00 ? 17  LEU A CB   7  
ATOM 10479 C CG   . LEU A 1 17  ? 12.817  -0.718  -11.607 1.00 0.00 ? 17  LEU A CG   7  
ATOM 10480 C CD1  . LEU A 1 17  ? 13.422  -0.544  -12.992 1.00 0.00 ? 17  LEU A CD1  7  
ATOM 10481 C CD2  . LEU A 1 17  ? 13.074  -2.123  -11.083 1.00 0.00 ? 17  LEU A CD2  7  
ATOM 10482 H H    . LEU A 1 17  ? 15.793  1.616   -11.003 1.00 0.00 ? 17  LEU A H    7  
ATOM 10483 H HA   . LEU A 1 17  ? 13.073  1.849   -12.114 1.00 0.00 ? 17  LEU A HA   7  
ATOM 10484 H HB2  . LEU A 1 17  ? 14.292  -0.068  -10.224 1.00 0.00 ? 17  LEU A HB2  7  
ATOM 10485 H HB3  . LEU A 1 17  ? 12.656  0.470   -9.851  1.00 0.00 ? 17  LEU A HB3  7  
ATOM 10486 H HG   . LEU A 1 17  ? 11.747  -0.582  -11.692 1.00 0.00 ? 17  LEU A HG   7  
ATOM 10487 H HD11 . LEU A 1 17  ? 13.013  0.341   -13.455 1.00 0.00 ? 17  LEU A HD11 7  
ATOM 10488 H HD12 . LEU A 1 17  ? 13.189  -1.407  -13.597 1.00 0.00 ? 17  LEU A HD12 7  
ATOM 10489 H HD13 . LEU A 1 17  ? 14.494  -0.444  -12.906 1.00 0.00 ? 17  LEU A HD13 7  
ATOM 10490 H HD21 . LEU A 1 17  ? 12.284  -2.403  -10.402 1.00 0.00 ? 17  LEU A HD21 7  
ATOM 10491 H HD22 . LEU A 1 17  ? 14.021  -2.145  -10.564 1.00 0.00 ? 17  LEU A HD22 7  
ATOM 10492 H HD23 . LEU A 1 17  ? 13.100  -2.817  -11.910 1.00 0.00 ? 17  LEU A HD23 7  
ATOM 10493 N N    . PRO A 1 18  ? 12.088  3.072   -10.030 1.00 0.00 ? 18  PRO A N    7  
ATOM 10494 C CA   . PRO A 1 18  ? 11.633  4.096   -9.085  1.00 0.00 ? 18  PRO A CA   7  
ATOM 10495 C C    . PRO A 1 18  ? 11.866  3.690   -7.634  1.00 0.00 ? 18  PRO A C    7  
ATOM 10496 O O    . PRO A 1 18  ? 12.106  2.520   -7.337  1.00 0.00 ? 18  PRO A O    7  
ATOM 10497 C CB   . PRO A 1 18  ? 10.134  4.207   -9.376  1.00 0.00 ? 18  PRO A CB   7  
ATOM 10498 C CG   . PRO A 1 18  ? 9.761   2.883   -9.950  1.00 0.00 ? 18  PRO A CG   7  
ATOM 10499 C CD   . PRO A 1 18  ? 10.966  2.410   -10.716 1.00 0.00 ? 18  PRO A CD   7  
ATOM 10500 H HA   . PRO A 1 18  ? 12.109  5.048   -9.271  1.00 0.00 ? 18  PRO A HA   7  
ATOM 10501 H HB2  . PRO A 1 18  ? 9.600   4.404   -8.457  1.00 0.00 ? 18  PRO A HB2  7  
ATOM 10502 H HB3  . PRO A 1 18  ? 9.959   5.006   -10.080 1.00 0.00 ? 18  PRO A HB3  7  
ATOM 10503 H HG2  . PRO A 1 18  ? 9.527   2.191   -9.155  1.00 0.00 ? 18  PRO A HG2  7  
ATOM 10504 H HG3  . PRO A 1 18  ? 8.917   2.996   -10.613 1.00 0.00 ? 18  PRO A HG3  7  
ATOM 10505 H HD2  . PRO A 1 18  ? 11.055  1.336   -10.653 1.00 0.00 ? 18  PRO A HD2  7  
ATOM 10506 H HD3  . PRO A 1 18  ? 10.905  2.726   -11.747 1.00 0.00 ? 18  PRO A HD3  7  
ATOM 10507 N N    . GLY A 1 19  ? 11.792  4.664   -6.732  1.00 0.00 ? 19  GLY A N    7  
ATOM 10508 C CA   . GLY A 1 19  ? 11.997  4.387   -5.322  1.00 0.00 ? 19  GLY A CA   7  
ATOM 10509 C C    . GLY A 1 19  ? 10.692  4.273   -4.558  1.00 0.00 ? 19  GLY A C    7  
ATOM 10510 O O    . GLY A 1 19  ? 9.608   4.466   -5.108  1.00 0.00 ? 19  GLY A O    7  
ATOM 10511 H H    . GLY A 1 19  ? 11.597  5.578   -7.026  1.00 0.00 ? 19  GLY A H    7  
ATOM 10512 H HA2  . GLY A 1 19  ? 12.541  3.460   -5.224  1.00 0.00 ? 19  GLY A HA2  7  
ATOM 10513 H HA3  . GLY A 1 19  ? 12.584  5.185   -4.891  1.00 0.00 ? 19  GLY A HA3  7  
ATOM 10514 N N    . PRO A 1 20  ? 10.789  3.951   -3.260  1.00 0.00 ? 20  PRO A N    7  
ATOM 10515 C CA   . PRO A 1 20  ? 9.617   3.804   -2.392  1.00 0.00 ? 20  PRO A CA   7  
ATOM 10516 C C    . PRO A 1 20  ? 8.931   5.137   -2.111  1.00 0.00 ? 20  PRO A C    7  
ATOM 10517 O O    . PRO A 1 20  ? 9.548   6.064   -1.588  1.00 0.00 ? 20  PRO A O    7  
ATOM 10518 C CB   . PRO A 1 20  ? 10.201  3.221   -1.102  1.00 0.00 ? 20  PRO A CB   7  
ATOM 10519 C CG   . PRO A 1 20  ? 11.623  3.665   -1.097  1.00 0.00 ? 20  PRO A CG   7  
ATOM 10520 C CD   . PRO A 1 20  ? 12.049  3.707   -2.538  1.00 0.00 ? 20  PRO A CD   7  
ATOM 10521 H HA   . PRO A 1 20  ? 8.899   3.112   -2.808  1.00 0.00 ? 20  PRO A HA   7  
ATOM 10522 H HB2  . PRO A 1 20  ? 9.661   3.612   -0.251  1.00 0.00 ? 20  PRO A HB2  7  
ATOM 10523 H HB3  . PRO A 1 20  ? 10.124  2.145   -1.122  1.00 0.00 ? 20  PRO A HB3  7  
ATOM 10524 H HG2  . PRO A 1 20  ? 11.700  4.646   -0.654  1.00 0.00 ? 20  PRO A HG2  7  
ATOM 10525 H HG3  . PRO A 1 20  ? 12.226  2.956   -0.549  1.00 0.00 ? 20  PRO A HG3  7  
ATOM 10526 H HD2  . PRO A 1 20  ? 12.749  4.513   -2.702  1.00 0.00 ? 20  PRO A HD2  7  
ATOM 10527 H HD3  . PRO A 1 20  ? 12.484  2.763   -2.832  1.00 0.00 ? 20  PRO A HD3  7  
ATOM 10528 N N    . ALA A 1 21  ? 7.653   5.225   -2.463  1.00 0.00 ? 21  ALA A N    7  
ATOM 10529 C CA   . ALA A 1 21  ? 6.883   6.444   -2.246  1.00 0.00 ? 21  ALA A CA   7  
ATOM 10530 C C    . ALA A 1 21  ? 7.033   6.940   -0.812  1.00 0.00 ? 21  ALA A C    7  
ATOM 10531 O O    . ALA A 1 21  ? 6.555   6.319   0.138   1.00 0.00 ? 21  ALA A O    7  
ATOM 10532 C CB   . ALA A 1 21  ? 5.417   6.208   -2.575  1.00 0.00 ? 21  ALA A CB   7  
ATOM 10533 H H    . ALA A 1 21  ? 7.216   4.451   -2.876  1.00 0.00 ? 21  ALA A H    7  
ATOM 10534 H HA   . ALA A 1 21  ? 7.260   7.201   -2.920  1.00 0.00 ? 21  ALA A HA   7  
ATOM 10535 H HB1  . ALA A 1 21  ? 5.296   6.136   -3.647  1.00 0.00 ? 21  ALA A HB1  7  
ATOM 10536 H HB2  . ALA A 1 21  ? 5.088   5.289   -2.113  1.00 0.00 ? 21  ALA A HB2  7  
ATOM 10537 H HB3  . ALA A 1 21  ? 4.827   7.031   -2.201  1.00 0.00 ? 21  ALA A HB3  7  
ATOM 10538 N N    . PRO A 1 22  ? 7.712   8.085   -0.649  1.00 0.00 ? 22  PRO A N    7  
ATOM 10539 C CA   . PRO A 1 22  ? 7.940   8.689   0.667   1.00 0.00 ? 22  PRO A CA   7  
ATOM 10540 C C    . PRO A 1 22  ? 6.659   9.248   1.278   1.00 0.00 ? 22  PRO A C    7  
ATOM 10541 O O    . PRO A 1 22  ? 5.594   9.194   0.666   1.00 0.00 ? 22  PRO A O    7  
ATOM 10542 C CB   . PRO A 1 22  ? 8.929   9.820   0.371   1.00 0.00 ? 22  PRO A CB   7  
ATOM 10543 C CG   . PRO A 1 22  ? 8.694   10.164  -1.059  1.00 0.00 ? 22  PRO A CG   7  
ATOM 10544 C CD   . PRO A 1 22  ? 8.309   8.878   -1.737  1.00 0.00 ? 22  PRO A CD   7  
ATOM 10545 H HA   . PRO A 1 22  ? 8.389   7.987   1.354   1.00 0.00 ? 22  PRO A HA   7  
ATOM 10546 H HB2  . PRO A 1 22  ? 8.723   10.660  1.020   1.00 0.00 ? 22  PRO A HB2  7  
ATOM 10547 H HB3  . PRO A 1 22  ? 9.938   9.472   0.533   1.00 0.00 ? 22  PRO A HB3  7  
ATOM 10548 H HG2  . PRO A 1 22  ? 7.893   10.883  -1.137  1.00 0.00 ? 22  PRO A HG2  7  
ATOM 10549 H HG3  . PRO A 1 22  ? 9.600   10.560  -1.494  1.00 0.00 ? 22  PRO A HG3  7  
ATOM 10550 H HD2  . PRO A 1 22  ? 7.588   9.065   -2.519  1.00 0.00 ? 22  PRO A HD2  7  
ATOM 10551 H HD3  . PRO A 1 22  ? 9.184   8.386   -2.136  1.00 0.00 ? 22  PRO A HD3  7  
ATOM 10552 N N    . ASN A 1 23  ? 6.772   9.784   2.489   1.00 0.00 ? 23  ASN A N    7  
ATOM 10553 C CA   . ASN A 1 23  ? 5.622   10.353  3.183   1.00 0.00 ? 23  ASN A CA   7  
ATOM 10554 C C    . ASN A 1 23  ? 4.425   9.409   3.117   1.00 0.00 ? 23  ASN A C    7  
ATOM 10555 O O    . ASN A 1 23  ? 3.288   9.843   2.932   1.00 0.00 ? 23  ASN A O    7  
ATOM 10556 C CB   . ASN A 1 23  ? 5.252   11.707  2.575   1.00 0.00 ? 23  ASN A CB   7  
ATOM 10557 C CG   . ASN A 1 23  ? 6.423   12.670  2.552   1.00 0.00 ? 23  ASN A CG   7  
ATOM 10558 O OD1  . ASN A 1 23  ? 6.792   13.191  1.500   1.00 0.00 ? 23  ASN A OD1  7  
ATOM 10559 N ND2  . ASN A 1 23  ? 7.014   12.910  3.717   1.00 0.00 ? 23  ASN A ND2  7  
ATOM 10560 H H    . ASN A 1 23  ? 7.649   9.798   2.926   1.00 0.00 ? 23  ASN A H    7  
ATOM 10561 H HA   . ASN A 1 23  ? 5.897   10.495  4.217   1.00 0.00 ? 23  ASN A HA   7  
ATOM 10562 H HB2  . ASN A 1 23  ? 4.913   11.559  1.560   1.00 0.00 ? 23  ASN A HB2  7  
ATOM 10563 H HB3  . ASN A 1 23  ? 4.456   12.150  3.155   1.00 0.00 ? 23  ASN A HB3  7  
ATOM 10564 H HD21 . ASN A 1 23  ? 6.666   12.460  4.515   1.00 0.00 ? 23  ASN A HD21 7  
ATOM 10565 H HD22 . ASN A 1 23  ? 7.774   13.530  3.731   1.00 0.00 ? 23  ASN A HD22 7  
ATOM 10566 N N    . LEU A 1 24  ? 4.690   8.116   3.268   1.00 0.00 ? 24  LEU A N    7  
ATOM 10567 C CA   . LEU A 1 24  ? 3.635   7.109   3.226   1.00 0.00 ? 24  LEU A CA   7  
ATOM 10568 C C    . LEU A 1 24  ? 2.825   7.114   4.519   1.00 0.00 ? 24  LEU A C    7  
ATOM 10569 O O    . LEU A 1 24  ? 3.283   6.625   5.552   1.00 0.00 ? 24  LEU A O    7  
ATOM 10570 C CB   . LEU A 1 24  ? 4.236   5.722   2.993   1.00 0.00 ? 24  LEU A CB   7  
ATOM 10571 C CG   . LEU A 1 24  ? 3.239   4.567   2.891   1.00 0.00 ? 24  LEU A CG   7  
ATOM 10572 C CD1  . LEU A 1 24  ? 2.257   4.809   1.754   1.00 0.00 ? 24  LEU A CD1  7  
ATOM 10573 C CD2  . LEU A 1 24  ? 3.970   3.247   2.695   1.00 0.00 ? 24  LEU A CD2  7  
ATOM 10574 H H    . LEU A 1 24  ? 5.616   7.830   3.412   1.00 0.00 ? 24  LEU A H    7  
ATOM 10575 H HA   . LEU A 1 24  ? 2.979   7.351   2.404   1.00 0.00 ? 24  LEU A HA   7  
ATOM 10576 H HB2  . LEU A 1 24  ? 4.798   5.755   2.073   1.00 0.00 ? 24  LEU A HB2  7  
ATOM 10577 H HB3  . LEU A 1 24  ? 4.905   5.510   3.815   1.00 0.00 ? 24  LEU A HB3  7  
ATOM 10578 H HG   . LEU A 1 24  ? 2.674   4.504   3.811   1.00 0.00 ? 24  LEU A HG   7  
ATOM 10579 H HD11 . LEU A 1 24  ? 1.861   3.864   1.414   1.00 0.00 ? 24  LEU A HD11 7  
ATOM 10580 H HD12 . LEU A 1 24  ? 2.765   5.301   0.938   1.00 0.00 ? 24  LEU A HD12 7  
ATOM 10581 H HD13 . LEU A 1 24  ? 1.449   5.434   2.104   1.00 0.00 ? 24  LEU A HD13 7  
ATOM 10582 H HD21 . LEU A 1 24  ? 3.575   2.512   3.381   1.00 0.00 ? 24  LEU A HD21 7  
ATOM 10583 H HD22 . LEU A 1 24  ? 5.024   3.387   2.885   1.00 0.00 ? 24  LEU A HD22 7  
ATOM 10584 H HD23 . LEU A 1 24  ? 3.829   2.905   1.680   1.00 0.00 ? 24  LEU A HD23 7  
ATOM 10585 N N    . ARG A 1 25  ? 1.620   7.670   4.454   1.00 0.00 ? 25  ARG A N    7  
ATOM 10586 C CA   . ARG A 1 25  ? 0.746   7.738   5.619   1.00 0.00 ? 25  ARG A CA   7  
ATOM 10587 C C    . ARG A 1 25  ? -0.525  6.925   5.393   1.00 0.00 ? 25  ARG A C    7  
ATOM 10588 O O    . ARG A 1 25  ? -0.899  6.641   4.255   1.00 0.00 ? 25  ARG A O    7  
ATOM 10589 C CB   . ARG A 1 25  ? 0.386   9.192   5.928   1.00 0.00 ? 25  ARG A CB   7  
ATOM 10590 C CG   . ARG A 1 25  ? 1.568   10.143  5.844   1.00 0.00 ? 25  ARG A CG   7  
ATOM 10591 C CD   . ARG A 1 25  ? 2.463   10.030  7.068   1.00 0.00 ? 25  ARG A CD   7  
ATOM 10592 N NE   . ARG A 1 25  ? 1.854   10.635  8.249   1.00 0.00 ? 25  ARG A NE   7  
ATOM 10593 C CZ   . ARG A 1 25  ? 1.928   11.931  8.532   1.00 0.00 ? 25  ARG A CZ   7  
ATOM 10594 N NH1  . ARG A 1 25  ? 2.582   12.753  7.723   1.00 0.00 ? 25  ARG A NH1  7  
ATOM 10595 N NH2  . ARG A 1 25  ? 1.348   12.406  9.627   1.00 0.00 ? 25  ARG A NH2  7  
ATOM 10596 H H    . ARG A 1 25  ? 1.311   8.043   3.602   1.00 0.00 ? 25  ARG A H    7  
ATOM 10597 H HA   . ARG A 1 25  ? 1.280   7.322   6.459   1.00 0.00 ? 25  ARG A HA   7  
ATOM 10598 H HB2  . ARG A 1 25  ? -0.365  9.522   5.226   1.00 0.00 ? 25  ARG A HB2  7  
ATOM 10599 H HB3  . ARG A 1 25  ? -0.020  9.244   6.927   1.00 0.00 ? 25  ARG A HB3  7  
ATOM 10600 H HG2  . ARG A 1 25  ? 2.148   9.905   4.965   1.00 0.00 ? 25  ARG A HG2  7  
ATOM 10601 H HG3  . ARG A 1 25  ? 1.199   11.155  5.771   1.00 0.00 ? 25  ARG A HG3  7  
ATOM 10602 H HD2  . ARG A 1 25  ? 2.649   8.985   7.266   1.00 0.00 ? 25  ARG A HD2  7  
ATOM 10603 H HD3  . ARG A 1 25  ? 3.398   10.528  6.861   1.00 0.00 ? 25  ARG A HD3  7  
ATOM 10604 H HE   . ARG A 1 25  ? 1.367   10.045  8.861   1.00 0.00 ? 25  ARG A HE   7  
ATOM 10605 H HH11 . ARG A 1 25  ? 3.019   12.397  6.897   1.00 0.00 ? 25  ARG A HH11 7  
ATOM 10606 H HH12 . ARG A 1 25  ? 2.635   13.729  7.938   1.00 0.00 ? 25  ARG A HH12 7  
ATOM 10607 H HH21 . ARG A 1 25  ? 0.854   11.790  10.239  1.00 0.00 ? 25  ARG A HH21 7  
ATOM 10608 H HH22 . ARG A 1 25  ? 1.404   13.382  9.839   1.00 0.00 ? 25  ARG A HH22 7  
ATOM 10609 N N    . ALA A 1 26  ? -1.186  6.553   6.485   1.00 0.00 ? 26  ALA A N    7  
ATOM 10610 C CA   . ALA A 1 26  ? -2.415  5.774   6.406   1.00 0.00 ? 26  ALA A CA   7  
ATOM 10611 C C    . ALA A 1 26  ? -3.278  5.983   7.646   1.00 0.00 ? 26  ALA A C    7  
ATOM 10612 O O    . ALA A 1 26  ? -2.812  5.817   8.774   1.00 0.00 ? 26  ALA A O    7  
ATOM 10613 C CB   . ALA A 1 26  ? -2.094  4.298   6.227   1.00 0.00 ? 26  ALA A CB   7  
ATOM 10614 H H    . ALA A 1 26  ? -0.838  6.810   7.364   1.00 0.00 ? 26  ALA A H    7  
ATOM 10615 H HA   . ALA A 1 26  ? -2.965  6.106   5.537   1.00 0.00 ? 26  ALA A HA   7  
ATOM 10616 H HB1  . ALA A 1 26  ? -2.706  3.713   6.899   1.00 0.00 ? 26  ALA A HB1  7  
ATOM 10617 H HB2  . ALA A 1 26  ? -2.299  4.006   5.208   1.00 0.00 ? 26  ALA A HB2  7  
ATOM 10618 H HB3  . ALA A 1 26  ? -1.052  4.127   6.448   1.00 0.00 ? 26  ALA A HB3  7  
ATOM 10619 N N    . TYR A 1 27  ? -4.536  6.350   7.430   1.00 0.00 ? 27  TYR A N    7  
ATOM 10620 C CA   . TYR A 1 27  ? -5.463  6.585   8.531   1.00 0.00 ? 27  TYR A CA   7  
ATOM 10621 C C    . TYR A 1 27  ? -6.870  6.117   8.168   1.00 0.00 ? 27  TYR A C    7  
ATOM 10622 O O    . TYR A 1 27  ? -7.337  6.329   7.050   1.00 0.00 ? 27  TYR A O    7  
ATOM 10623 C CB   . TYR A 1 27  ? -5.486  8.070   8.898   1.00 0.00 ? 27  TYR A CB   7  
ATOM 10624 C CG   . TYR A 1 27  ? -5.783  8.978   7.726   1.00 0.00 ? 27  TYR A CG   7  
ATOM 10625 C CD1  . TYR A 1 27  ? -7.089  9.324   7.404   1.00 0.00 ? 27  TYR A CD1  7  
ATOM 10626 C CD2  . TYR A 1 27  ? -4.757  9.490   6.941   1.00 0.00 ? 27  TYR A CD2  7  
ATOM 10627 C CE1  . TYR A 1 27  ? -7.365  10.154  6.334   1.00 0.00 ? 27  TYR A CE1  7  
ATOM 10628 C CE2  . TYR A 1 27  ? -5.023  10.321  5.871   1.00 0.00 ? 27  TYR A CE2  7  
ATOM 10629 C CZ   . TYR A 1 27  ? -6.329  10.650  5.571   1.00 0.00 ? 27  TYR A CZ   7  
ATOM 10630 O OH   . TYR A 1 27  ? -6.598  11.476  4.504   1.00 0.00 ? 27  TYR A OH   7  
ATOM 10631 H H    . TYR A 1 27  ? -4.850  6.467   6.509   1.00 0.00 ? 27  TYR A H    7  
ATOM 10632 H HA   . TYR A 1 27  ? -5.117  6.019   9.383   1.00 0.00 ? 27  TYR A HA   7  
ATOM 10633 H HB2  . TYR A 1 27  ? -6.245  8.237   9.647   1.00 0.00 ? 27  TYR A HB2  7  
ATOM 10634 H HB3  . TYR A 1 27  ? -4.523  8.349   9.299   1.00 0.00 ? 27  TYR A HB3  7  
ATOM 10635 H HD1  . TYR A 1 27  ? -7.899  8.934   8.003   1.00 0.00 ? 27  TYR A HD1  7  
ATOM 10636 H HD2  . TYR A 1 27  ? -3.735  9.230   7.179   1.00 0.00 ? 27  TYR A HD2  7  
ATOM 10637 H HE1  . TYR A 1 27  ? -8.387  10.412  6.099   1.00 0.00 ? 27  TYR A HE1  7  
ATOM 10638 H HE2  . TYR A 1 27  ? -4.212  10.709  5.273   1.00 0.00 ? 27  TYR A HE2  7  
ATOM 10639 H HH   . TYR A 1 27  ? -5.826  11.528  3.936   1.00 0.00 ? 27  TYR A HH   7  
ATOM 10640 N N    . ALA A 1 28  ? -7.539  5.481   9.124   1.00 0.00 ? 28  ALA A N    7  
ATOM 10641 C CA   . ALA A 1 28  ? -8.893  4.986   8.908   1.00 0.00 ? 28  ALA A CA   7  
ATOM 10642 C C    . ALA A 1 28  ? -9.916  6.110   9.034   1.00 0.00 ? 28  ALA A C    7  
ATOM 10643 O O    . ALA A 1 28  ? -10.217 6.567   10.136  1.00 0.00 ? 28  ALA A O    7  
ATOM 10644 C CB   . ALA A 1 28  ? -9.210  3.869   9.891   1.00 0.00 ? 28  ALA A CB   7  
ATOM 10645 H H    . ALA A 1 28  ? -7.113  5.343   9.995   1.00 0.00 ? 28  ALA A H    7  
ATOM 10646 H HA   . ALA A 1 28  ? -8.943  4.577   7.908   1.00 0.00 ? 28  ALA A HA   7  
ATOM 10647 H HB1  . ALA A 1 28  ? -10.127 4.100   10.413  1.00 0.00 ? 28  ALA A HB1  7  
ATOM 10648 H HB2  . ALA A 1 28  ? -9.325  2.939   9.355   1.00 0.00 ? 28  ALA A HB2  7  
ATOM 10649 H HB3  . ALA A 1 28  ? -8.403  3.777   10.603  1.00 0.00 ? 28  ALA A HB3  7  
ATOM 10650 N N    . ALA A 1 29  ? -10.445 6.552   7.898   1.00 0.00 ? 29  ALA A N    7  
ATOM 10651 C CA   . ALA A 1 29  ? -11.435 7.622   7.882   1.00 0.00 ? 29  ALA A CA   7  
ATOM 10652 C C    . ALA A 1 29  ? -12.743 7.169   8.522   1.00 0.00 ? 29  ALA A C    7  
ATOM 10653 O O    . ALA A 1 29  ? -13.393 7.934   9.235   1.00 0.00 ? 29  ALA A O    7  
ATOM 10654 C CB   . ALA A 1 29  ? -11.679 8.094   6.456   1.00 0.00 ? 29  ALA A CB   7  
ATOM 10655 H H    . ALA A 1 29  ? -10.165 6.148   7.050   1.00 0.00 ? 29  ALA A H    7  
ATOM 10656 H HA   . ALA A 1 29  ? -11.038 8.453   8.447   1.00 0.00 ? 29  ALA A HA   7  
ATOM 10657 H HB1  . ALA A 1 29  ? -12.279 7.362   5.933   1.00 0.00 ? 29  ALA A HB1  7  
ATOM 10658 H HB2  . ALA A 1 29  ? -12.200 9.039   6.474   1.00 0.00 ? 29  ALA A HB2  7  
ATOM 10659 H HB3  . ALA A 1 29  ? -10.733 8.213   5.950   1.00 0.00 ? 29  ALA A HB3  7  
ATOM 10660 N N    . SER A 1 30  ? -13.123 5.922   8.264   1.00 0.00 ? 30  SER A N    7  
ATOM 10661 C CA   . SER A 1 30  ? -14.356 5.369   8.812   1.00 0.00 ? 30  SER A CA   7  
ATOM 10662 C C    . SER A 1 30  ? -14.161 3.915   9.229   1.00 0.00 ? 30  SER A C    7  
ATOM 10663 O O    . SER A 1 30  ? -13.202 3.252   8.833   1.00 0.00 ? 30  SER A O    7  
ATOM 10664 C CB   . SER A 1 30  ? -15.486 5.471   7.785   1.00 0.00 ? 30  SER A CB   7  
ATOM 10665 O OG   . SER A 1 30  ? -16.234 6.661   7.966   1.00 0.00 ? 30  SER A OG   7  
ATOM 10666 H H    . SER A 1 30  ? -12.562 5.361   7.688   1.00 0.00 ? 30  SER A H    7  
ATOM 10667 H HA   . SER A 1 30  ? -14.620 5.949   9.684   1.00 0.00 ? 30  SER A HA   7  
ATOM 10668 H HB2  . SER A 1 30  ? -15.066 5.471   6.791   1.00 0.00 ? 30  SER A HB2  7  
ATOM 10669 H HB3  . SER A 1 30  ? -16.147 4.623   7.897   1.00 0.00 ? 30  SER A HB3  7  
ATOM 10670 H HG   . SER A 1 30  ? -15.748 7.261   8.535   1.00 0.00 ? 30  SER A HG   7  
ATOM 10671 N N    . PRO A 1 31  ? -15.093 3.405   10.047  1.00 0.00 ? 31  PRO A N    7  
ATOM 10672 C CA   . PRO A 1 31  ? -15.048 2.023   10.536  1.00 0.00 ? 31  PRO A CA   7  
ATOM 10673 C C    . PRO A 1 31  ? -15.322 1.008   9.432   1.00 0.00 ? 31  PRO A C    7  
ATOM 10674 O O    . PRO A 1 31  ? -15.356 -0.198  9.677   1.00 0.00 ? 31  PRO A O    7  
ATOM 10675 C CB   . PRO A 1 31  ? -16.159 1.982   11.588  1.00 0.00 ? 31  PRO A CB   7  
ATOM 10676 C CG   . PRO A 1 31  ? -17.106 3.058   11.181  1.00 0.00 ? 31  PRO A CG   7  
ATOM 10677 C CD   . PRO A 1 31  ? -16.264 4.137   10.558  1.00 0.00 ? 31  PRO A CD   7  
ATOM 10678 H HA   . PRO A 1 31  ? -14.100 1.799   11.003  1.00 0.00 ? 31  PRO A HA   7  
ATOM 10679 H HB2  . PRO A 1 31  ? -16.634 1.011   11.576  1.00 0.00 ? 31  PRO A HB2  7  
ATOM 10680 H HB3  . PRO A 1 31  ? -15.742 2.173   12.565  1.00 0.00 ? 31  PRO A HB3  7  
ATOM 10681 H HG2  . PRO A 1 31  ? -17.813 2.672   10.462  1.00 0.00 ? 31  PRO A HG2  7  
ATOM 10682 H HG3  . PRO A 1 31  ? -17.623 3.440   12.049  1.00 0.00 ? 31  PRO A HG3  7  
ATOM 10683 H HD2  . PRO A 1 31  ? -16.801 4.617   9.753   1.00 0.00 ? 31  PRO A HD2  7  
ATOM 10684 H HD3  . PRO A 1 31  ? -15.970 4.862   11.303  1.00 0.00 ? 31  PRO A HD3  7  
ATOM 10685 N N    . THR A 1 32  ? -15.516 1.504   8.213   1.00 0.00 ? 32  THR A N    7  
ATOM 10686 C CA   . THR A 1 32  ? -15.788 0.640   7.071   1.00 0.00 ? 32  THR A CA   7  
ATOM 10687 C C    . THR A 1 32  ? -14.836 0.938   5.918   1.00 0.00 ? 32  THR A C    7  
ATOM 10688 O O    . THR A 1 32  ? -14.662 0.117   5.018   1.00 0.00 ? 32  THR A O    7  
ATOM 10689 C CB   . THR A 1 32  ? -17.238 0.800   6.578   1.00 0.00 ? 32  THR A CB   7  
ATOM 10690 O OG1  . THR A 1 32  ? -17.472 2.154   6.174   1.00 0.00 ? 32  THR A OG1  7  
ATOM 10691 C CG2  . THR A 1 32  ? -18.226 0.414   7.669   1.00 0.00 ? 32  THR A CG2  7  
ATOM 10692 H H    . THR A 1 32  ? -15.476 2.474   8.081   1.00 0.00 ? 32  THR A H    7  
ATOM 10693 H HA   . THR A 1 32  ? -15.648 -0.383  7.387   1.00 0.00 ? 32  THR A HA   7  
ATOM 10694 H HB   . THR A 1 32  ? -17.388 0.148   5.730   1.00 0.00 ? 32  THR A HB   7  
ATOM 10695 H HG1  . THR A 1 32  ? -18.152 2.173   5.497   1.00 0.00 ? 32  THR A HG1  7  
ATOM 10696 H HG21 . THR A 1 32  ? -17.780 0.588   8.637   1.00 0.00 ? 32  THR A HG21 7  
ATOM 10697 H HG22 . THR A 1 32  ? -18.479 -0.632  7.572   1.00 0.00 ? 32  THR A HG22 7  
ATOM 10698 H HG23 . THR A 1 32  ? -19.120 1.011   7.572   1.00 0.00 ? 32  THR A HG23 7  
ATOM 10699 N N    . SER A 1 33  ? -14.221 2.116   5.953   1.00 0.00 ? 33  SER A N    7  
ATOM 10700 C CA   . SER A 1 33  ? -13.288 2.522   4.909   1.00 0.00 ? 33  SER A CA   7  
ATOM 10701 C C    . SER A 1 33  ? -11.965 2.985   5.512   1.00 0.00 ? 33  SER A C    7  
ATOM 10702 O O    . SER A 1 33  ? -11.860 3.190   6.722   1.00 0.00 ? 33  SER A O    7  
ATOM 10703 C CB   . SER A 1 33  ? -13.895 3.642   4.062   1.00 0.00 ? 33  SER A CB   7  
ATOM 10704 O OG   . SER A 1 33  ? -13.677 4.909   4.659   1.00 0.00 ? 33  SER A OG   7  
ATOM 10705 H H    . SER A 1 33  ? -14.402 2.727   6.698   1.00 0.00 ? 33  SER A H    7  
ATOM 10706 H HA   . SER A 1 33  ? -13.103 1.666   4.278   1.00 0.00 ? 33  SER A HA   7  
ATOM 10707 H HB2  . SER A 1 33  ? -13.440 3.637   3.083   1.00 0.00 ? 33  SER A HB2  7  
ATOM 10708 H HB3  . SER A 1 33  ? -14.959 3.481   3.965   1.00 0.00 ? 33  SER A HB3  7  
ATOM 10709 H HG   . SER A 1 33  ? -13.731 5.593   3.988   1.00 0.00 ? 33  SER A HG   7  
ATOM 10710 N N    . ILE A 1 34  ? -10.959 3.147   4.660   1.00 0.00 ? 34  ILE A N    7  
ATOM 10711 C CA   . ILE A 1 34  ? -9.643  3.586   5.108   1.00 0.00 ? 34  ILE A CA   7  
ATOM 10712 C C    . ILE A 1 34  ? -8.997  4.516   4.087   1.00 0.00 ? 34  ILE A C    7  
ATOM 10713 O O    . ILE A 1 34  ? -9.054  4.269   2.881   1.00 0.00 ? 34  ILE A O    7  
ATOM 10714 C CB   . ILE A 1 34  ? -8.706  2.390   5.362   1.00 0.00 ? 34  ILE A CB   7  
ATOM 10715 C CG1  . ILE A 1 34  ? -9.243  1.527   6.506   1.00 0.00 ? 34  ILE A CG1  7  
ATOM 10716 C CG2  . ILE A 1 34  ? -7.299  2.876   5.673   1.00 0.00 ? 34  ILE A CG2  7  
ATOM 10717 C CD1  . ILE A 1 34  ? -8.578  0.173   6.605   1.00 0.00 ? 34  ILE A CD1  7  
ATOM 10718 H H    . ILE A 1 34  ? -11.104 2.968   3.708   1.00 0.00 ? 34  ILE A H    7  
ATOM 10719 H HA   . ILE A 1 34  ? -9.769  4.122   6.038   1.00 0.00 ? 34  ILE A HA   7  
ATOM 10720 H HB   . ILE A 1 34  ? -8.665  1.796   4.461   1.00 0.00 ? 34  ILE A HB   7  
ATOM 10721 H HG12 . ILE A 1 34  ? -9.086  2.042   7.440   1.00 0.00 ? 34  ILE A HG12 7  
ATOM 10722 H HG13 . ILE A 1 34  ? -10.302 1.368   6.360   1.00 0.00 ? 34  ILE A HG13 7  
ATOM 10723 H HG21 . ILE A 1 34  ? -6.840  3.253   4.770   1.00 0.00 ? 34  ILE A HG21 7  
ATOM 10724 H HG22 . ILE A 1 34  ? -7.345  3.665   6.408   1.00 0.00 ? 34  ILE A HG22 7  
ATOM 10725 H HG23 . ILE A 1 34  ? -6.712  2.057   6.060   1.00 0.00 ? 34  ILE A HG23 7  
ATOM 10726 H HD11 . ILE A 1 34  ? -9.036  -0.506  5.901   1.00 0.00 ? 34  ILE A HD11 7  
ATOM 10727 H HD12 . ILE A 1 34  ? -7.526  0.270   6.380   1.00 0.00 ? 34  ILE A HD12 7  
ATOM 10728 H HD13 . ILE A 1 34  ? -8.697  -0.214  7.607   1.00 0.00 ? 34  ILE A HD13 7  
ATOM 10729 N N    . THR A 1 35  ? -8.380  5.587   4.576   1.00 0.00 ? 35  THR A N    7  
ATOM 10730 C CA   . THR A 1 35  ? -7.722  6.554   3.707   1.00 0.00 ? 35  THR A CA   7  
ATOM 10731 C C    . THR A 1 35  ? -6.208  6.376   3.733   1.00 0.00 ? 35  THR A C    7  
ATOM 10732 O O    . THR A 1 35  ? -5.614  6.178   4.794   1.00 0.00 ? 35  THR A O    7  
ATOM 10733 C CB   . THR A 1 35  ? -8.064  7.999   4.114   1.00 0.00 ? 35  THR A CB   7  
ATOM 10734 O OG1  . THR A 1 35  ? -9.480  8.203   4.053   1.00 0.00 ? 35  THR A OG1  7  
ATOM 10735 C CG2  . THR A 1 35  ? -7.363  8.998   3.206   1.00 0.00 ? 35  THR A CG2  7  
ATOM 10736 H H    . THR A 1 35  ? -8.369  5.729   5.546   1.00 0.00 ? 35  THR A H    7  
ATOM 10737 H HA   . THR A 1 35  ? -8.076  6.392   2.700   1.00 0.00 ? 35  THR A HA   7  
ATOM 10738 H HB   . THR A 1 35  ? -7.728  8.161   5.129   1.00 0.00 ? 35  THR A HB   7  
ATOM 10739 H HG1  . THR A 1 35  ? -9.662  9.119   3.828   1.00 0.00 ? 35  THR A HG1  7  
ATOM 10740 H HG21 . THR A 1 35  ? -7.832  9.966   3.305   1.00 0.00 ? 35  THR A HG21 7  
ATOM 10741 H HG22 . THR A 1 35  ? -7.436  8.665   2.181   1.00 0.00 ? 35  THR A HG22 7  
ATOM 10742 H HG23 . THR A 1 35  ? -6.323  9.072   3.487   1.00 0.00 ? 35  THR A HG23 7  
ATOM 10743 N N    . VAL A 1 36  ? -5.588  6.448   2.560   1.00 0.00 ? 36  VAL A N    7  
ATOM 10744 C CA   . VAL A 1 36  ? -4.142  6.296   2.449   1.00 0.00 ? 36  VAL A CA   7  
ATOM 10745 C C    . VAL A 1 36  ? -3.543  7.377   1.556   1.00 0.00 ? 36  VAL A C    7  
ATOM 10746 O O    . VAL A 1 36  ? -3.980  7.575   0.422   1.00 0.00 ? 36  VAL A O    7  
ATOM 10747 C CB   . VAL A 1 36  ? -3.764  4.913   1.885   1.00 0.00 ? 36  VAL A CB   7  
ATOM 10748 C CG1  . VAL A 1 36  ? -2.254  4.729   1.889   1.00 0.00 ? 36  VAL A CG1  7  
ATOM 10749 C CG2  . VAL A 1 36  ? -4.447  3.810   2.680   1.00 0.00 ? 36  VAL A CG2  7  
ATOM 10750 H H    . VAL A 1 36  ? -6.115  6.607   1.750   1.00 0.00 ? 36  VAL A H    7  
ATOM 10751 H HA   . VAL A 1 36  ? -3.720  6.386   3.439   1.00 0.00 ? 36  VAL A HA   7  
ATOM 10752 H HB   . VAL A 1 36  ? -4.108  4.857   0.863   1.00 0.00 ? 36  VAL A HB   7  
ATOM 10753 H HG11 . VAL A 1 36  ? -2.003  3.806   1.387   1.00 0.00 ? 36  VAL A HG11 7  
ATOM 10754 H HG12 . VAL A 1 36  ? -1.789  5.558   1.377   1.00 0.00 ? 36  VAL A HG12 7  
ATOM 10755 H HG13 . VAL A 1 36  ? -1.900  4.691   2.909   1.00 0.00 ? 36  VAL A HG13 7  
ATOM 10756 H HG21 . VAL A 1 36  ? -5.091  4.251   3.425   1.00 0.00 ? 36  VAL A HG21 7  
ATOM 10757 H HG22 . VAL A 1 36  ? -5.035  3.196   2.013   1.00 0.00 ? 36  VAL A HG22 7  
ATOM 10758 H HG23 . VAL A 1 36  ? -3.699  3.200   3.164   1.00 0.00 ? 36  VAL A HG23 7  
ATOM 10759 N N    . THR A 1 37  ? -2.538  8.076   2.075   1.00 0.00 ? 37  THR A N    7  
ATOM 10760 C CA   . THR A 1 37  ? -1.878  9.138   1.326   1.00 0.00 ? 37  THR A CA   7  
ATOM 10761 C C    . THR A 1 37  ? -0.375  8.899   1.241   1.00 0.00 ? 37  THR A C    7  
ATOM 10762 O O    . THR A 1 37  ? 0.276   8.619   2.247   1.00 0.00 ? 37  THR A O    7  
ATOM 10763 C CB   . THR A 1 37  ? -2.132  10.517  1.965   1.00 0.00 ? 37  THR A CB   7  
ATOM 10764 O OG1  . THR A 1 37  ? -1.517  10.579  3.257   1.00 0.00 ? 37  THR A OG1  7  
ATOM 10765 C CG2  . THR A 1 37  ? -3.623  10.787  2.095   1.00 0.00 ? 37  THR A CG2  7  
ATOM 10766 H H    . THR A 1 37  ? -2.234  7.871   2.984   1.00 0.00 ? 37  THR A H    7  
ATOM 10767 H HA   . THR A 1 37  ? -2.289  9.147   0.327   1.00 0.00 ? 37  THR A HA   7  
ATOM 10768 H HB   . THR A 1 37  ? -1.697  11.276  1.331   1.00 0.00 ? 37  THR A HB   7  
ATOM 10769 H HG1  . THR A 1 37  ? -0.766  9.981   3.283   1.00 0.00 ? 37  THR A HG1  7  
ATOM 10770 H HG21 . THR A 1 37  ? -4.009  11.139  1.149   1.00 0.00 ? 37  THR A HG21 7  
ATOM 10771 H HG22 . THR A 1 37  ? -3.788  11.538  2.853   1.00 0.00 ? 37  THR A HG22 7  
ATOM 10772 H HG23 . THR A 1 37  ? -4.131  9.876   2.373   1.00 0.00 ? 37  THR A HG23 7  
ATOM 10773 N N    . TRP A 1 38  ? 0.169   9.012   0.035   1.00 0.00 ? 38  TRP A N    7  
ATOM 10774 C CA   . TRP A 1 38  ? 1.597   8.809   -0.181  1.00 0.00 ? 38  TRP A CA   7  
ATOM 10775 C C    . TRP A 1 38  ? 2.175   9.906   -1.068  1.00 0.00 ? 38  TRP A C    7  
ATOM 10776 O O    . TRP A 1 38  ? 1.435   10.674  -1.682  1.00 0.00 ? 38  TRP A O    7  
ATOM 10777 C CB   . TRP A 1 38  ? 1.848   7.439   -0.815  1.00 0.00 ? 38  TRP A CB   7  
ATOM 10778 C CG   . TRP A 1 38  ? 1.157   7.259   -2.132  1.00 0.00 ? 38  TRP A CG   7  
ATOM 10779 C CD1  . TRP A 1 38  ? 1.625   7.629   -3.361  1.00 0.00 ? 38  TRP A CD1  7  
ATOM 10780 C CD2  . TRP A 1 38  ? -0.127  6.665   -2.352  1.00 0.00 ? 38  TRP A CD2  7  
ATOM 10781 N NE1  . TRP A 1 38  ? 0.709   7.301   -4.331  1.00 0.00 ? 38  TRP A NE1  7  
ATOM 10782 C CE2  . TRP A 1 38  ? -0.374  6.708   -3.738  1.00 0.00 ? 38  TRP A CE2  7  
ATOM 10783 C CE3  . TRP A 1 38  ? -1.092  6.100   -1.513  1.00 0.00 ? 38  TRP A CE3  7  
ATOM 10784 C CZ2  . TRP A 1 38  ? -1.545  6.208   -4.301  1.00 0.00 ? 38  TRP A CZ2  7  
ATOM 10785 C CZ3  . TRP A 1 38  ? -2.254  5.605   -2.074  1.00 0.00 ? 38  TRP A CZ3  7  
ATOM 10786 C CH2  . TRP A 1 38  ? -2.472  5.660   -3.457  1.00 0.00 ? 38  TRP A CH2  7  
ATOM 10787 H H    . TRP A 1 38  ? -0.403  9.238   -0.729  1.00 0.00 ? 38  TRP A H    7  
ATOM 10788 H HA   . TRP A 1 38  ? 2.085   8.845   0.781   1.00 0.00 ? 38  TRP A HA   7  
ATOM 10789 H HB2  . TRP A 1 38  ? 2.908   7.312   -0.974  1.00 0.00 ? 38  TRP A HB2  7  
ATOM 10790 H HB3  . TRP A 1 38  ? 1.494   6.670   -0.143  1.00 0.00 ? 38  TRP A HB3  7  
ATOM 10791 H HD1  . TRP A 1 38  ? 2.576   8.109   -3.529  1.00 0.00 ? 38  TRP A HD1  7  
ATOM 10792 H HE1  . TRP A 1 38  ? 0.816   7.464   -5.292  1.00 0.00 ? 38  TRP A HE1  7  
ATOM 10793 H HE3  . TRP A 1 38  ? -0.941  6.048   -0.445  1.00 0.00 ? 38  TRP A HE3  7  
ATOM 10794 H HZ2  . TRP A 1 38  ? -1.728  6.243   -5.365  1.00 0.00 ? 38  TRP A HZ2  7  
ATOM 10795 H HZ3  . TRP A 1 38  ? -3.011  5.164   -1.441  1.00 0.00 ? 38  TRP A HZ3  7  
ATOM 10796 H HH2  . TRP A 1 38  ? -3.394  5.261   -3.850  1.00 0.00 ? 38  TRP A HH2  7  
ATOM 10797 N N    . GLU A 1 39  ? 3.502   9.974   -1.130  1.00 0.00 ? 39  GLU A N    7  
ATOM 10798 C CA   . GLU A 1 39  ? 4.178   10.979  -1.942  1.00 0.00 ? 39  GLU A CA   7  
ATOM 10799 C C    . GLU A 1 39  ? 5.036   10.321  -3.019  1.00 0.00 ? 39  GLU A C    7  
ATOM 10800 O O    . GLU A 1 39  ? 5.312   9.122   -2.963  1.00 0.00 ? 39  GLU A O    7  
ATOM 10801 C CB   . GLU A 1 39  ? 5.047   11.878  -1.060  1.00 0.00 ? 39  GLU A CB   7  
ATOM 10802 C CG   . GLU A 1 39  ? 4.266   12.969  -0.347  1.00 0.00 ? 39  GLU A CG   7  
ATOM 10803 C CD   . GLU A 1 39  ? 3.768   14.044  -1.294  1.00 0.00 ? 39  GLU A CD   7  
ATOM 10804 O OE1  . GLU A 1 39  ? 4.561   14.504  -2.141  1.00 0.00 ? 39  GLU A OE1  7  
ATOM 10805 O OE2  . GLU A 1 39  ? 2.583   14.424  -1.187  1.00 0.00 ? 39  GLU A OE2  7  
ATOM 10806 H H    . GLU A 1 39  ? 4.038   9.333   -0.617  1.00 0.00 ? 39  GLU A H    7  
ATOM 10807 H HA   . GLU A 1 39  ? 3.421   11.582  -2.420  1.00 0.00 ? 39  GLU A HA   7  
ATOM 10808 H HB2  . GLU A 1 39  ? 5.536   11.268  -0.316  1.00 0.00 ? 39  GLU A HB2  7  
ATOM 10809 H HB3  . GLU A 1 39  ? 5.799   12.348  -1.678  1.00 0.00 ? 39  GLU A HB3  7  
ATOM 10810 H HG2  . GLU A 1 39  ? 3.416   12.523  0.145   1.00 0.00 ? 39  GLU A HG2  7  
ATOM 10811 H HG3  . GLU A 1 39  ? 4.907   13.429  0.391   1.00 0.00 ? 39  GLU A HG3  7  
ATOM 10812 N N    . THR A 1 40  ? 5.454   11.114  -4.000  1.00 0.00 ? 40  THR A N    7  
ATOM 10813 C CA   . THR A 1 40  ? 6.279   10.611  -5.091  1.00 0.00 ? 40  THR A CA   7  
ATOM 10814 C C    . THR A 1 40  ? 7.756   10.628  -4.717  1.00 0.00 ? 40  THR A C    7  
ATOM 10815 O O    . THR A 1 40  ? 8.278   11.614  -4.197  1.00 0.00 ? 40  THR A O    7  
ATOM 10816 C CB   . THR A 1 40  ? 6.077   11.436  -6.375  1.00 0.00 ? 40  THR A CB   7  
ATOM 10817 O OG1  . THR A 1 40  ? 4.715   11.343  -6.809  1.00 0.00 ? 40  THR A OG1  7  
ATOM 10818 C CG2  . THR A 1 40  ? 7.001   10.951  -7.482  1.00 0.00 ? 40  THR A CG2  7  
ATOM 10819 H H    . THR A 1 40  ? 5.201   12.061  -3.989  1.00 0.00 ? 40  THR A H    7  
ATOM 10820 H HA   . THR A 1 40  ? 5.980   9.592   -5.292  1.00 0.00 ? 40  THR A HA   7  
ATOM 10821 H HB   . THR A 1 40  ? 6.308   12.470  -6.161  1.00 0.00 ? 40  THR A HB   7  
ATOM 10822 H HG1  . THR A 1 40  ? 4.627   10.620  -7.434  1.00 0.00 ? 40  THR A HG1  7  
ATOM 10823 H HG21 . THR A 1 40  ? 7.376   11.799  -8.035  1.00 0.00 ? 40  THR A HG21 7  
ATOM 10824 H HG22 . THR A 1 40  ? 6.454   10.300  -8.148  1.00 0.00 ? 40  THR A HG22 7  
ATOM 10825 H HG23 . THR A 1 40  ? 7.828   10.409  -7.048  1.00 0.00 ? 40  THR A HG23 7  
ATOM 10826 N N    . PRO A 1 41  ? 8.449   9.512   -4.987  1.00 0.00 ? 41  PRO A N    7  
ATOM 10827 C CA   . PRO A 1 41  ? 9.878   9.374   -4.687  1.00 0.00 ? 41  PRO A CA   7  
ATOM 10828 C C    . PRO A 1 41  ? 10.745  10.248  -5.587  1.00 0.00 ? 41  PRO A C    7  
ATOM 10829 O O    . PRO A 1 41  ? 10.832  10.019  -6.794  1.00 0.00 ? 41  PRO A O    7  
ATOM 10830 C CB   . PRO A 1 41  ? 10.155  7.892   -4.952  1.00 0.00 ? 41  PRO A CB   7  
ATOM 10831 C CG   . PRO A 1 41  ? 9.111   7.481   -5.932  1.00 0.00 ? 41  PRO A CG   7  
ATOM 10832 C CD   . PRO A 1 41  ? 7.891   8.297   -5.605  1.00 0.00 ? 41  PRO A CD   7  
ATOM 10833 H HA   . PRO A 1 41  ? 10.090  9.603   -3.653  1.00 0.00 ? 41  PRO A HA   7  
ATOM 10834 H HB2  . PRO A 1 41  ? 11.149  7.777   -5.360  1.00 0.00 ? 41  PRO A HB2  7  
ATOM 10835 H HB3  . PRO A 1 41  ? 10.071  7.337   -4.030  1.00 0.00 ? 41  PRO A HB3  7  
ATOM 10836 H HG2  . PRO A 1 41  ? 9.446   7.693   -6.936  1.00 0.00 ? 41  PRO A HG2  7  
ATOM 10837 H HG3  . PRO A 1 41  ? 8.898   6.428   -5.820  1.00 0.00 ? 41  PRO A HG3  7  
ATOM 10838 H HD2  . PRO A 1 41  ? 7.347   8.539   -6.506  1.00 0.00 ? 41  PRO A HD2  7  
ATOM 10839 H HD3  . PRO A 1 41  ? 7.258   7.767   -4.910  1.00 0.00 ? 41  PRO A HD3  7  
ATOM 10840 N N    . VAL A 1 42  ? 11.387  11.248  -4.993  1.00 0.00 ? 42  VAL A N    7  
ATOM 10841 C CA   . VAL A 1 42  ? 12.249  12.155  -5.741  1.00 0.00 ? 42  VAL A CA   7  
ATOM 10842 C C    . VAL A 1 42  ? 13.339  11.390  -6.484  1.00 0.00 ? 42  VAL A C    7  
ATOM 10843 O O    . VAL A 1 42  ? 13.845  11.848  -7.508  1.00 0.00 ? 42  VAL A O    7  
ATOM 10844 C CB   . VAL A 1 42  ? 12.908  13.195  -4.815  1.00 0.00 ? 42  VAL A CB   7  
ATOM 10845 C CG1  . VAL A 1 42  ? 11.851  13.954  -4.027  1.00 0.00 ? 42  VAL A CG1  7  
ATOM 10846 C CG2  . VAL A 1 42  ? 13.901  12.522  -3.880  1.00 0.00 ? 42  VAL A CG2  7  
ATOM 10847 H H    . VAL A 1 42  ? 11.278  11.380  -4.028  1.00 0.00 ? 42  VAL A H    7  
ATOM 10848 H HA   . VAL A 1 42  ? 11.638  12.681  -6.460  1.00 0.00 ? 42  VAL A HA   7  
ATOM 10849 H HB   . VAL A 1 42  ? 13.445  13.904  -5.428  1.00 0.00 ? 42  VAL A HB   7  
ATOM 10850 H HG11 . VAL A 1 42  ? 11.326  14.629  -4.686  1.00 0.00 ? 42  VAL A HG11 7  
ATOM 10851 H HG12 . VAL A 1 42  ? 11.151  13.253  -3.595  1.00 0.00 ? 42  VAL A HG12 7  
ATOM 10852 H HG13 . VAL A 1 42  ? 12.327  14.519  -3.239  1.00 0.00 ? 42  VAL A HG13 7  
ATOM 10853 H HG21 . VAL A 1 42  ? 13.724  12.854  -2.868  1.00 0.00 ? 42  VAL A HG21 7  
ATOM 10854 H HG22 . VAL A 1 42  ? 13.778  11.450  -3.934  1.00 0.00 ? 42  VAL A HG22 7  
ATOM 10855 H HG23 . VAL A 1 42  ? 14.907  12.783  -4.175  1.00 0.00 ? 42  VAL A HG23 7  
ATOM 10856 N N    . SER A 1 43  ? 13.694  10.221  -5.961  1.00 0.00 ? 43  SER A N    7  
ATOM 10857 C CA   . SER A 1 43  ? 14.727  9.392   -6.572  1.00 0.00 ? 43  SER A CA   7  
ATOM 10858 C C    . SER A 1 43  ? 14.128  8.472   -7.631  1.00 0.00 ? 43  SER A C    7  
ATOM 10859 O O    . SER A 1 43  ? 13.627  7.392   -7.320  1.00 0.00 ? 43  SER A O    7  
ATOM 10860 C CB   . SER A 1 43  ? 15.443  8.562   -5.505  1.00 0.00 ? 43  SER A CB   7  
ATOM 10861 O OG   . SER A 1 43  ? 16.715  8.134   -5.961  1.00 0.00 ? 43  SER A OG   7  
ATOM 10862 H H    . SER A 1 43  ? 13.254  9.910   -5.142  1.00 0.00 ? 43  SER A H    7  
ATOM 10863 H HA   . SER A 1 43  ? 15.441  10.049  -7.046  1.00 0.00 ? 43  SER A HA   7  
ATOM 10864 H HB2  . SER A 1 43  ? 15.575  9.160   -4.616  1.00 0.00 ? 43  SER A HB2  7  
ATOM 10865 H HB3  . SER A 1 43  ? 14.847  7.693   -5.269  1.00 0.00 ? 43  SER A HB3  7  
ATOM 10866 H HG   . SER A 1 43  ? 17.329  8.872   -5.935  1.00 0.00 ? 43  SER A HG   7  
ATOM 10867 N N    . GLY A 1 44  ? 14.183  8.908   -8.886  1.00 0.00 ? 44  GLY A N    7  
ATOM 10868 C CA   . GLY A 1 44  ? 13.642  8.113   -9.973  1.00 0.00 ? 44  GLY A CA   7  
ATOM 10869 C C    . GLY A 1 44  ? 14.329  8.394   -11.294 1.00 0.00 ? 44  GLY A C    7  
ATOM 10870 O O    . GLY A 1 44  ? 15.198  9.261   -11.378 1.00 0.00 ? 44  GLY A O    7  
ATOM 10871 H H    . GLY A 1 44  ? 14.593  9.778   -9.075  1.00 0.00 ? 44  GLY A H    7  
ATOM 10872 H HA2  . GLY A 1 44  ? 13.761  7.067   -9.733  1.00 0.00 ? 44  GLY A HA2  7  
ATOM 10873 H HA3  . GLY A 1 44  ? 12.589  8.331   -10.074 1.00 0.00 ? 44  GLY A HA3  7  
ATOM 10874 N N    . ASN A 1 45  ? 13.940  7.658   -12.330 1.00 0.00 ? 45  ASN A N    7  
ATOM 10875 C CA   . ASN A 1 45  ? 14.526  7.832   -13.655 1.00 0.00 ? 45  ASN A CA   7  
ATOM 10876 C C    . ASN A 1 45  ? 13.494  8.374   -14.639 1.00 0.00 ? 45  ASN A C    7  
ATOM 10877 O O    . ASN A 1 45  ? 13.697  9.420   -15.254 1.00 0.00 ? 45  ASN A O    7  
ATOM 10878 C CB   . ASN A 1 45  ? 15.086  6.503   -14.165 1.00 0.00 ? 45  ASN A CB   7  
ATOM 10879 C CG   . ASN A 1 45  ? 16.321  6.065   -13.402 1.00 0.00 ? 45  ASN A CG   7  
ATOM 10880 O OD1  . ASN A 1 45  ? 17.428  6.533   -13.669 1.00 0.00 ? 45  ASN A OD1  7  
ATOM 10881 N ND2  . ASN A 1 45  ? 16.136  5.161   -12.447 1.00 0.00 ? 45  ASN A ND2  7  
ATOM 10882 H H    . ASN A 1 45  ? 13.242  6.982   -12.202 1.00 0.00 ? 45  ASN A H    7  
ATOM 10883 H HA   . ASN A 1 45  ? 15.333  8.544   -13.569 1.00 0.00 ? 45  ASN A HA   7  
ATOM 10884 H HB2  . ASN A 1 45  ? 14.331  5.737   -14.061 1.00 0.00 ? 45  ASN A HB2  7  
ATOM 10885 H HB3  . ASN A 1 45  ? 15.347  6.606   -15.208 1.00 0.00 ? 45  ASN A HB3  7  
ATOM 10886 H HD21 . ASN A 1 45  ? 15.226  4.832   -12.290 1.00 0.00 ? 45  ASN A HD21 7  
ATOM 10887 H HD22 . ASN A 1 45  ? 16.917  4.861   -11.937 1.00 0.00 ? 45  ASN A HD22 7  
ATOM 10888 N N    . GLY A 1 46  ? 12.385  7.654   -14.783 1.00 0.00 ? 46  GLY A N    7  
ATOM 10889 C CA   . GLY A 1 46  ? 11.338  8.078   -15.693 1.00 0.00 ? 46  GLY A CA   7  
ATOM 10890 C C    . GLY A 1 46  ? 10.128  8.632   -14.968 1.00 0.00 ? 46  GLY A C    7  
ATOM 10891 O O    . GLY A 1 46  ? 10.089  8.651   -13.738 1.00 0.00 ? 46  GLY A O    7  
ATOM 10892 H H    . GLY A 1 46  ? 12.278  6.828   -14.266 1.00 0.00 ? 46  GLY A H    7  
ATOM 10893 H HA2  . GLY A 1 46  ? 11.732  8.840   -16.349 1.00 0.00 ? 46  GLY A HA2  7  
ATOM 10894 H HA3  . GLY A 1 46  ? 11.029  7.230   -16.288 1.00 0.00 ? 46  GLY A HA3  7  
ATOM 10895 N N    . GLU A 1 47  ? 9.139   9.087   -15.731 1.00 0.00 ? 47  GLU A N    7  
ATOM 10896 C CA   . GLU A 1 47  ? 7.924   9.647   -15.151 1.00 0.00 ? 47  GLU A CA   7  
ATOM 10897 C C    . GLU A 1 47  ? 6.923   8.545   -14.816 1.00 0.00 ? 47  GLU A C    7  
ATOM 10898 O O    . GLU A 1 47  ? 6.505   7.785   -15.691 1.00 0.00 ? 47  GLU A O    7  
ATOM 10899 C CB   . GLU A 1 47  ? 7.289   10.652  -16.115 1.00 0.00 ? 47  GLU A CB   7  
ATOM 10900 C CG   . GLU A 1 47  ? 6.223   11.522  -15.471 1.00 0.00 ? 47  GLU A CG   7  
ATOM 10901 C CD   . GLU A 1 47  ? 5.662   12.559  -16.425 1.00 0.00 ? 47  GLU A CD   7  
ATOM 10902 O OE1  . GLU A 1 47  ? 5.073   12.165  -17.453 1.00 0.00 ? 47  GLU A OE1  7  
ATOM 10903 O OE2  . GLU A 1 47  ? 5.813   13.767  -16.143 1.00 0.00 ? 47  GLU A OE2  7  
ATOM 10904 H H    . GLU A 1 47  ? 9.229   9.045   -16.705 1.00 0.00 ? 47  GLU A H    7  
ATOM 10905 H HA   . GLU A 1 47  ? 8.196   10.159  -14.240 1.00 0.00 ? 47  GLU A HA   7  
ATOM 10906 H HB2  . GLU A 1 47  ? 8.063   11.296  -16.505 1.00 0.00 ? 47  GLU A HB2  7  
ATOM 10907 H HB3  . GLU A 1 47  ? 6.837   10.111  -16.933 1.00 0.00 ? 47  GLU A HB3  7  
ATOM 10908 H HG2  . GLU A 1 47  ? 5.414   10.890  -15.136 1.00 0.00 ? 47  GLU A HG2  7  
ATOM 10909 H HG3  . GLU A 1 47  ? 6.655   12.031  -14.623 1.00 0.00 ? 47  GLU A HG3  7  
ATOM 10910 N N    . ILE A 1 48  ? 6.543   8.465   -13.545 1.00 0.00 ? 48  ILE A N    7  
ATOM 10911 C CA   . ILE A 1 48  ? 5.592   7.457   -13.095 1.00 0.00 ? 48  ILE A CA   7  
ATOM 10912 C C    . ILE A 1 48  ? 4.374   7.402   -14.012 1.00 0.00 ? 48  ILE A C    7  
ATOM 10913 O O    . ILE A 1 48  ? 3.965   8.415   -14.577 1.00 0.00 ? 48  ILE A O    7  
ATOM 10914 C CB   . ILE A 1 48  ? 5.122   7.730   -11.654 1.00 0.00 ? 48  ILE A CB   7  
ATOM 10915 C CG1  . ILE A 1 48  ? 6.320   7.766   -10.702 1.00 0.00 ? 48  ILE A CG1  7  
ATOM 10916 C CG2  . ILE A 1 48  ? 4.121   6.673   -11.214 1.00 0.00 ? 48  ILE A CG2  7  
ATOM 10917 C CD1  . ILE A 1 48  ? 7.137   6.493   -10.711 1.00 0.00 ? 48  ILE A CD1  7  
ATOM 10918 H H    . ILE A 1 48  ? 6.911   9.099   -12.896 1.00 0.00 ? 48  ILE A H    7  
ATOM 10919 H HA   . ILE A 1 48  ? 6.088   6.498   -13.115 1.00 0.00 ? 48  ILE A HA   7  
ATOM 10920 H HB   . ILE A 1 48  ? 4.628   8.689   -11.635 1.00 0.00 ? 48  ILE A HB   7  
ATOM 10921 H HG12 . ILE A 1 48  ? 6.971   8.579   -10.983 1.00 0.00 ? 48  ILE A HG12 7  
ATOM 10922 H HG13 . ILE A 1 48  ? 5.965   7.927   -9.695  1.00 0.00 ? 48  ILE A HG13 7  
ATOM 10923 H HG21 . ILE A 1 48  ? 3.710   6.944   -10.252 1.00 0.00 ? 48  ILE A HG21 7  
ATOM 10924 H HG22 . ILE A 1 48  ? 3.324   6.609   -11.939 1.00 0.00 ? 48  ILE A HG22 7  
ATOM 10925 H HG23 . ILE A 1 48  ? 4.616   5.717   -11.137 1.00 0.00 ? 48  ILE A HG23 7  
ATOM 10926 H HD11 . ILE A 1 48  ? 7.972   6.596   -10.034 1.00 0.00 ? 48  ILE A HD11 7  
ATOM 10927 H HD12 . ILE A 1 48  ? 6.518   5.665   -10.398 1.00 0.00 ? 48  ILE A HD12 7  
ATOM 10928 H HD13 . ILE A 1 48  ? 7.505   6.308   -11.710 1.00 0.00 ? 48  ILE A HD13 7  
ATOM 10929 N N    . GLN A 1 49  ? 3.800   6.211   -14.153 1.00 0.00 ? 49  GLN A N    7  
ATOM 10930 C CA   . GLN A 1 49  ? 2.629   6.024   -15.001 1.00 0.00 ? 49  GLN A CA   7  
ATOM 10931 C C    . GLN A 1 49  ? 1.387   5.748   -14.160 1.00 0.00 ? 49  GLN A C    7  
ATOM 10932 O O    . GLN A 1 49  ? 0.370   6.426   -14.295 1.00 0.00 ? 49  GLN A O    7  
ATOM 10933 C CB   . GLN A 1 49  ? 2.861   4.874   -15.982 1.00 0.00 ? 49  GLN A CB   7  
ATOM 10934 C CG   . GLN A 1 49  ? 4.011   5.119   -16.945 1.00 0.00 ? 49  GLN A CG   7  
ATOM 10935 C CD   . GLN A 1 49  ? 3.854   4.358   -18.247 1.00 0.00 ? 49  GLN A CD   7  
ATOM 10936 O OE1  . GLN A 1 49  ? 3.314   3.251   -18.271 1.00 0.00 ? 49  GLN A OE1  7  
ATOM 10937 N NE2  . GLN A 1 49  ? 4.327   4.947   -19.339 1.00 0.00 ? 49  GLN A NE2  7  
ATOM 10938 H H    . GLN A 1 49  ? 4.173   5.441   -13.676 1.00 0.00 ? 49  GLN A H    7  
ATOM 10939 H HA   . GLN A 1 49  ? 2.475   6.935   -15.558 1.00 0.00 ? 49  GLN A HA   7  
ATOM 10940 H HB2  . GLN A 1 49  ? 3.075   3.976   -15.421 1.00 0.00 ? 49  GLN A HB2  7  
ATOM 10941 H HB3  . GLN A 1 49  ? 1.962   4.722   -16.560 1.00 0.00 ? 49  GLN A HB3  7  
ATOM 10942 H HG2  . GLN A 1 49  ? 4.058   6.175   -17.168 1.00 0.00 ? 49  GLN A HG2  7  
ATOM 10943 H HG3  . GLN A 1 49  ? 4.932   4.811   -16.473 1.00 0.00 ? 49  GLN A HG3  7  
ATOM 10944 H HE21 . GLN A 1 49  ? 4.746   5.828   -19.244 1.00 0.00 ? 49  GLN A HE21 7  
ATOM 10945 H HE22 . GLN A 1 49  ? 4.240   4.477   -20.193 1.00 0.00 ? 49  GLN A HE22 7  
ATOM 10946 N N    . ASN A 1 50  ? 1.478   4.746   -13.291 1.00 0.00 ? 50  ASN A N    7  
ATOM 10947 C CA   . ASN A 1 50  ? 0.360   4.379   -12.428 1.00 0.00 ? 50  ASN A CA   7  
ATOM 10948 C C    . ASN A 1 50  ? 0.856   3.936   -11.055 1.00 0.00 ? 50  ASN A C    7  
ATOM 10949 O O    . ASN A 1 50  ? 1.965   3.416   -10.921 1.00 0.00 ? 50  ASN A O    7  
ATOM 10950 C CB   . ASN A 1 50  ? -0.462  3.260   -13.071 1.00 0.00 ? 50  ASN A CB   7  
ATOM 10951 C CG   . ASN A 1 50  ? 0.371   2.028   -13.368 1.00 0.00 ? 50  ASN A CG   7  
ATOM 10952 O OD1  . ASN A 1 50  ? 1.204   2.032   -14.274 1.00 0.00 ? 50  ASN A OD1  7  
ATOM 10953 N ND2  . ASN A 1 50  ? 0.149   0.966   -12.603 1.00 0.00 ? 50  ASN A ND2  7  
ATOM 10954 H H    . ASN A 1 50  ? 2.315   4.241   -13.228 1.00 0.00 ? 50  ASN A H    7  
ATOM 10955 H HA   . ASN A 1 50  ? -0.266  5.250   -12.308 1.00 0.00 ? 50  ASN A HA   7  
ATOM 10956 H HB2  . ASN A 1 50  ? -1.260  2.978   -12.401 1.00 0.00 ? 50  ASN A HB2  7  
ATOM 10957 H HB3  . ASN A 1 50  ? -0.884  3.619   -13.997 1.00 0.00 ? 50  ASN A HB3  7  
ATOM 10958 H HD21 . ASN A 1 50  ? -0.530  1.035   -11.900 1.00 0.00 ? 50  ASN A HD21 7  
ATOM 10959 H HD22 . ASN A 1 50  ? 0.674   0.156   -12.773 1.00 0.00 ? 50  ASN A HD22 7  
ATOM 10960 N N    . TYR A 1 51  ? 0.028   4.145   -10.037 1.00 0.00 ? 51  TYR A N    7  
ATOM 10961 C CA   . TYR A 1 51  ? 0.383   3.769   -8.674  1.00 0.00 ? 51  TYR A CA   7  
ATOM 10962 C C    . TYR A 1 51  ? -0.473  2.601   -8.191  1.00 0.00 ? 51  TYR A C    7  
ATOM 10963 O O    . TYR A 1 51  ? -1.693  2.717   -8.074  1.00 0.00 ? 51  TYR A O    7  
ATOM 10964 C CB   . TYR A 1 51  ? 0.214   4.963   -7.733  1.00 0.00 ? 51  TYR A CB   7  
ATOM 10965 C CG   . TYR A 1 51  ? 1.420   5.874   -7.689  1.00 0.00 ? 51  TYR A CG   7  
ATOM 10966 C CD1  . TYR A 1 51  ? 2.673   5.383   -7.343  1.00 0.00 ? 51  TYR A CD1  7  
ATOM 10967 C CD2  . TYR A 1 51  ? 1.307   7.225   -7.991  1.00 0.00 ? 51  TYR A CD2  7  
ATOM 10968 C CE1  . TYR A 1 51  ? 3.778   6.211   -7.301  1.00 0.00 ? 51  TYR A CE1  7  
ATOM 10969 C CE2  . TYR A 1 51  ? 2.406   8.060   -7.953  1.00 0.00 ? 51  TYR A CE2  7  
ATOM 10970 C CZ   . TYR A 1 51  ? 3.639   7.549   -7.607  1.00 0.00 ? 51  TYR A CZ   7  
ATOM 10971 O OH   . TYR A 1 51  ? 4.737   8.378   -7.566  1.00 0.00 ? 51  TYR A OH   7  
ATOM 10972 H H    . TYR A 1 51  ? -0.842  4.563   -10.207 1.00 0.00 ? 51  TYR A H    7  
ATOM 10973 H HA   . TYR A 1 51  ? 1.419   3.465   -8.672  1.00 0.00 ? 51  TYR A HA   7  
ATOM 10974 H HB2  . TYR A 1 51  ? -0.632  5.550   -8.055  1.00 0.00 ? 51  TYR A HB2  7  
ATOM 10975 H HB3  . TYR A 1 51  ? 0.035   4.601   -6.731  1.00 0.00 ? 51  TYR A HB3  7  
ATOM 10976 H HD1  . TYR A 1 51  ? 2.779   4.334   -7.104  1.00 0.00 ? 51  TYR A HD1  7  
ATOM 10977 H HD2  . TYR A 1 51  ? 0.339   7.622   -8.261  1.00 0.00 ? 51  TYR A HD2  7  
ATOM 10978 H HE1  . TYR A 1 51  ? 4.744   5.811   -7.030  1.00 0.00 ? 51  TYR A HE1  7  
ATOM 10979 H HE2  . TYR A 1 51  ? 2.298   9.108   -8.192  1.00 0.00 ? 51  TYR A HE2  7  
ATOM 10980 H HH   . TYR A 1 51  ? 4.809   8.770   -6.693  1.00 0.00 ? 51  TYR A HH   7  
ATOM 10981 N N    . LYS A 1 52  ? 0.176   1.477   -7.910  1.00 0.00 ? 52  LYS A N    7  
ATOM 10982 C CA   . LYS A 1 52  ? -0.522  0.287   -7.437  1.00 0.00 ? 52  LYS A CA   7  
ATOM 10983 C C    . LYS A 1 52  ? -0.591  0.266   -5.914  1.00 0.00 ? 52  LYS A C    7  
ATOM 10984 O O    . LYS A 1 52  ? 0.437   0.234   -5.236  1.00 0.00 ? 52  LYS A O    7  
ATOM 10985 C CB   . LYS A 1 52  ? 0.179   -0.975  -7.944  1.00 0.00 ? 52  LYS A CB   7  
ATOM 10986 C CG   . LYS A 1 52  ? -0.673  -2.228  -7.837  1.00 0.00 ? 52  LYS A CG   7  
ATOM 10987 C CD   . LYS A 1 52  ? -0.053  -3.391  -8.595  1.00 0.00 ? 52  LYS A CD   7  
ATOM 10988 C CE   . LYS A 1 52  ? -0.578  -3.469  -10.020 1.00 0.00 ? 52  LYS A CE   7  
ATOM 10989 N NZ   . LYS A 1 52  ? 0.300   -2.738  -10.976 1.00 0.00 ? 52  LYS A NZ   7  
ATOM 10990 H H    . LYS A 1 52  ? 1.150   1.446   -8.023  1.00 0.00 ? 52  LYS A H    7  
ATOM 10991 H HA   . LYS A 1 52  ? -1.526  0.314   -7.831  1.00 0.00 ? 52  LYS A HA   7  
ATOM 10992 H HB2  . LYS A 1 52  ? 0.445   -0.834  -8.981  1.00 0.00 ? 52  LYS A HB2  7  
ATOM 10993 H HB3  . LYS A 1 52  ? 1.080   -1.128  -7.368  1.00 0.00 ? 52  LYS A HB3  7  
ATOM 10994 H HG2  . LYS A 1 52  ? -0.767  -2.501  -6.796  1.00 0.00 ? 52  LYS A HG2  7  
ATOM 10995 H HG3  . LYS A 1 52  ? -1.652  -2.023  -8.248  1.00 0.00 ? 52  LYS A HG3  7  
ATOM 10996 H HD2  . LYS A 1 52  ? 1.018   -3.260  -8.625  1.00 0.00 ? 52  LYS A HD2  7  
ATOM 10997 H HD3  . LYS A 1 52  ? -0.291  -4.311  -8.082  1.00 0.00 ? 52  LYS A HD3  7  
ATOM 10998 H HE2  . LYS A 1 52  ? -0.630  -4.506  -10.314 1.00 0.00 ? 52  LYS A HE2  7  
ATOM 10999 H HE3  . LYS A 1 52  ? -1.567  -3.037  -10.050 1.00 0.00 ? 52  LYS A HE3  7  
ATOM 11000 H HZ1  . LYS A 1 52  ? 1.139   -3.310  -11.199 1.00 0.00 ? 52  LYS A HZ1  7  
ATOM 11001 H HZ2  . LYS A 1 52  ? 0.610   -1.837  -10.558 1.00 0.00 ? 52  LYS A HZ2  7  
ATOM 11002 H HZ3  . LYS A 1 52  ? -0.216  -2.540  -11.856 1.00 0.00 ? 52  LYS A HZ3  7  
ATOM 11003 N N    . LEU A 1 53  ? -1.808  0.283   -5.381  1.00 0.00 ? 53  LEU A N    7  
ATOM 11004 C CA   . LEU A 1 53  ? -2.011  0.265   -3.936  1.00 0.00 ? 53  LEU A CA   7  
ATOM 11005 C C    . LEU A 1 53  ? -2.698  -1.025  -3.500  1.00 0.00 ? 53  LEU A C    7  
ATOM 11006 O O    . LEU A 1 53  ? -3.867  -1.254  -3.811  1.00 0.00 ? 53  LEU A O    7  
ATOM 11007 C CB   . LEU A 1 53  ? -2.844  1.472   -3.503  1.00 0.00 ? 53  LEU A CB   7  
ATOM 11008 C CG   . LEU A 1 53  ? -3.579  1.337   -2.169  1.00 0.00 ? 53  LEU A CG   7  
ATOM 11009 C CD1  . LEU A 1 53  ? -2.590  1.312   -1.015  1.00 0.00 ? 53  LEU A CD1  7  
ATOM 11010 C CD2  . LEU A 1 53  ? -4.578  2.471   -1.993  1.00 0.00 ? 53  LEU A CD2  7  
ATOM 11011 H H    . LEU A 1 53  ? -2.588  0.309   -5.972  1.00 0.00 ? 53  LEU A H    7  
ATOM 11012 H HA   . LEU A 1 53  ? -1.041  0.319   -3.465  1.00 0.00 ? 53  LEU A HA   7  
ATOM 11013 H HB2  . LEU A 1 53  ? -2.182  2.322   -3.431  1.00 0.00 ? 53  LEU A HB2  7  
ATOM 11014 H HB3  . LEU A 1 53  ? -3.581  1.657   -4.272  1.00 0.00 ? 53  LEU A HB3  7  
ATOM 11015 H HG   . LEU A 1 53  ? -4.126  0.404   -2.160  1.00 0.00 ? 53  LEU A HG   7  
ATOM 11016 H HD11 . LEU A 1 53  ? -2.336  2.323   -0.736  1.00 0.00 ? 53  LEU A HD11 7  
ATOM 11017 H HD12 . LEU A 1 53  ? -1.696  0.786   -1.318  1.00 0.00 ? 53  LEU A HD12 7  
ATOM 11018 H HD13 . LEU A 1 53  ? -3.035  0.806   -0.170  1.00 0.00 ? 53  LEU A HD13 7  
ATOM 11019 H HD21 . LEU A 1 53  ? -5.535  2.172   -2.396  1.00 0.00 ? 53  LEU A HD21 7  
ATOM 11020 H HD22 . LEU A 1 53  ? -4.225  3.347   -2.518  1.00 0.00 ? 53  LEU A HD22 7  
ATOM 11021 H HD23 . LEU A 1 53  ? -4.684  2.698   -0.943  1.00 0.00 ? 53  LEU A HD23 7  
ATOM 11022 N N    . TYR A 1 54  ? -1.966  -1.863  -2.775  1.00 0.00 ? 54  TYR A N    7  
ATOM 11023 C CA   . TYR A 1 54  ? -2.505  -3.130  -2.296  1.00 0.00 ? 54  TYR A CA   7  
ATOM 11024 C C    . TYR A 1 54  ? -3.227  -2.946  -0.964  1.00 0.00 ? 54  TYR A C    7  
ATOM 11025 O O    . TYR A 1 54  ? -2.860  -2.090  -0.159  1.00 0.00 ? 54  TYR A O    7  
ATOM 11026 C CB   . TYR A 1 54  ? -1.384  -4.160  -2.142  1.00 0.00 ? 54  TYR A CB   7  
ATOM 11027 C CG   . TYR A 1 54  ? -0.603  -4.399  -3.415  1.00 0.00 ? 54  TYR A CG   7  
ATOM 11028 C CD1  . TYR A 1 54  ? 0.296   -3.452  -3.890  1.00 0.00 ? 54  TYR A CD1  7  
ATOM 11029 C CD2  . TYR A 1 54  ? -0.763  -5.573  -4.141  1.00 0.00 ? 54  TYR A CD2  7  
ATOM 11030 C CE1  . TYR A 1 54  ? 1.011   -3.666  -5.052  1.00 0.00 ? 54  TYR A CE1  7  
ATOM 11031 C CE2  . TYR A 1 54  ? -0.051  -5.796  -5.304  1.00 0.00 ? 54  TYR A CE2  7  
ATOM 11032 C CZ   . TYR A 1 54  ? 0.834   -4.839  -5.756  1.00 0.00 ? 54  TYR A CZ   7  
ATOM 11033 O OH   . TYR A 1 54  ? 1.545   -5.057  -6.913  1.00 0.00 ? 54  TYR A OH   7  
ATOM 11034 H H    . TYR A 1 54  ? -1.040  -1.626  -2.559  1.00 0.00 ? 54  TYR A H    7  
ATOM 11035 H HA   . TYR A 1 54  ? -3.212  -3.489  -3.029  1.00 0.00 ? 54  TYR A HA   7  
ATOM 11036 H HB2  . TYR A 1 54  ? -0.691  -3.819  -1.388  1.00 0.00 ? 54  TYR A HB2  7  
ATOM 11037 H HB3  . TYR A 1 54  ? -1.810  -5.103  -1.832  1.00 0.00 ? 54  TYR A HB3  7  
ATOM 11038 H HD1  . TYR A 1 54  ? 0.432   -2.534  -3.336  1.00 0.00 ? 54  TYR A HD1  7  
ATOM 11039 H HD2  . TYR A 1 54  ? -1.457  -6.320  -3.785  1.00 0.00 ? 54  TYR A HD2  7  
ATOM 11040 H HE1  . TYR A 1 54  ? 1.704   -2.917  -5.406  1.00 0.00 ? 54  TYR A HE1  7  
ATOM 11041 H HE2  . TYR A 1 54  ? -0.189  -6.714  -5.855  1.00 0.00 ? 54  TYR A HE2  7  
ATOM 11042 H HH   . TYR A 1 54  ? 1.085   -5.702  -7.455  1.00 0.00 ? 54  TYR A HH   7  
ATOM 11043 N N    . TYR A 1 55  ? -4.255  -3.756  -0.740  1.00 0.00 ? 55  TYR A N    7  
ATOM 11044 C CA   . TYR A 1 55  ? -5.031  -3.683  0.492   1.00 0.00 ? 55  TYR A CA   7  
ATOM 11045 C C    . TYR A 1 55  ? -5.600  -5.050  0.860   1.00 0.00 ? 55  TYR A C    7  
ATOM 11046 O O    . TYR A 1 55  ? -6.277  -5.690  0.056   1.00 0.00 ? 55  TYR A O    7  
ATOM 11047 C CB   . TYR A 1 55  ? -6.167  -2.669  0.345   1.00 0.00 ? 55  TYR A CB   7  
ATOM 11048 C CG   . TYR A 1 55  ? -7.315  -3.164  -0.505  1.00 0.00 ? 55  TYR A CG   7  
ATOM 11049 C CD1  . TYR A 1 55  ? -7.180  -3.296  -1.881  1.00 0.00 ? 55  TYR A CD1  7  
ATOM 11050 C CD2  . TYR A 1 55  ? -8.535  -3.500  0.069   1.00 0.00 ? 55  TYR A CD2  7  
ATOM 11051 C CE1  . TYR A 1 55  ? -8.227  -3.748  -2.662  1.00 0.00 ? 55  TYR A CE1  7  
ATOM 11052 C CE2  . TYR A 1 55  ? -9.587  -3.954  -0.703  1.00 0.00 ? 55  TYR A CE2  7  
ATOM 11053 C CZ   . TYR A 1 55  ? -9.428  -4.076  -2.068  1.00 0.00 ? 55  TYR A CZ   7  
ATOM 11054 O OH   . TYR A 1 55  ? -10.473 -4.527  -2.841  1.00 0.00 ? 55  TYR A OH   7  
ATOM 11055 H H    . TYR A 1 55  ? -4.500  -4.418  -1.420  1.00 0.00 ? 55  TYR A H    7  
ATOM 11056 H HA   . TYR A 1 55  ? -4.370  -3.356  1.282   1.00 0.00 ? 55  TYR A HA   7  
ATOM 11057 H HB2  . TYR A 1 55  ? -6.557  -2.431  1.322   1.00 0.00 ? 55  TYR A HB2  7  
ATOM 11058 H HB3  . TYR A 1 55  ? -5.780  -1.769  -0.112  1.00 0.00 ? 55  TYR A HB3  7  
ATOM 11059 H HD1  . TYR A 1 55  ? -6.238  -3.039  -2.343  1.00 0.00 ? 55  TYR A HD1  7  
ATOM 11060 H HD2  . TYR A 1 55  ? -8.656  -3.403  1.138   1.00 0.00 ? 55  TYR A HD2  7  
ATOM 11061 H HE1  . TYR A 1 55  ? -8.103  -3.844  -3.730  1.00 0.00 ? 55  TYR A HE1  7  
ATOM 11062 H HE2  . TYR A 1 55  ? -10.527 -4.211  -0.239  1.00 0.00 ? 55  TYR A HE2  7  
ATOM 11063 H HH   . TYR A 1 55  ? -10.131 -4.892  -3.660  1.00 0.00 ? 55  TYR A HH   7  
ATOM 11064 N N    . MET A 1 56  ? -5.320  -5.490  2.082   1.00 0.00 ? 56  MET A N    7  
ATOM 11065 C CA   . MET A 1 56  ? -5.805  -6.780  2.559   1.00 0.00 ? 56  MET A CA   7  
ATOM 11066 C C    . MET A 1 56  ? -5.916  -6.791  4.080   1.00 0.00 ? 56  MET A C    7  
ATOM 11067 O O    . MET A 1 56  ? -5.329  -5.950  4.760   1.00 0.00 ? 56  MET A O    7  
ATOM 11068 C CB   . MET A 1 56  ? -4.874  -7.902  2.096   1.00 0.00 ? 56  MET A CB   7  
ATOM 11069 C CG   . MET A 1 56  ? -3.781  -8.237  3.098   1.00 0.00 ? 56  MET A CG   7  
ATOM 11070 S SD   . MET A 1 56  ? -2.438  -9.193  2.367   1.00 0.00 ? 56  MET A SD   7  
ATOM 11071 C CE   . MET A 1 56  ? -2.002  -10.265 3.733   1.00 0.00 ? 56  MET A CE   7  
ATOM 11072 H H    . MET A 1 56  ? -4.776  -4.935  2.679   1.00 0.00 ? 56  MET A H    7  
ATOM 11073 H HA   . MET A 1 56  ? -6.786  -6.942  2.137   1.00 0.00 ? 56  MET A HA   7  
ATOM 11074 H HB2  . MET A 1 56  ? -5.460  -8.792  1.923   1.00 0.00 ? 56  MET A HB2  7  
ATOM 11075 H HB3  . MET A 1 56  ? -4.404  -7.605  1.170   1.00 0.00 ? 56  MET A HB3  7  
ATOM 11076 H HG2  . MET A 1 56  ? -3.376  -7.317  3.490   1.00 0.00 ? 56  MET A HG2  7  
ATOM 11077 H HG3  . MET A 1 56  ? -4.215  -8.810  3.904   1.00 0.00 ? 56  MET A HG3  7  
ATOM 11078 H HE1  . MET A 1 56  ? -2.186  -11.293 3.457   1.00 0.00 ? 56  MET A HE1  7  
ATOM 11079 H HE2  . MET A 1 56  ? -0.957  -10.138 3.972   1.00 0.00 ? 56  MET A HE2  7  
ATOM 11080 H HE3  . MET A 1 56  ? -2.603  -10.011 4.595   1.00 0.00 ? 56  MET A HE3  7  
ATOM 11081 N N    . GLU A 1 57  ? -6.672  -7.749  4.607   1.00 0.00 ? 57  GLU A N    7  
ATOM 11082 C CA   . GLU A 1 57  ? -6.860  -7.868  6.049   1.00 0.00 ? 57  GLU A CA   7  
ATOM 11083 C C    . GLU A 1 57  ? -5.738  -8.689  6.678   1.00 0.00 ? 57  GLU A C    7  
ATOM 11084 O O    . GLU A 1 57  ? -5.377  -9.755  6.177   1.00 0.00 ? 57  GLU A O    7  
ATOM 11085 C CB   . GLU A 1 57  ? -8.213  -8.510  6.358   1.00 0.00 ? 57  GLU A CB   7  
ATOM 11086 C CG   . GLU A 1 57  ? -8.361  -8.951  7.805   1.00 0.00 ? 57  GLU A CG   7  
ATOM 11087 C CD   . GLU A 1 57  ? -9.577  -9.830  8.025   1.00 0.00 ? 57  GLU A CD   7  
ATOM 11088 O OE1  . GLU A 1 57  ? -10.577 -9.651  7.300   1.00 0.00 ? 57  GLU A OE1  7  
ATOM 11089 O OE2  . GLU A 1 57  ? -9.528  -10.697 8.923   1.00 0.00 ? 57  GLU A OE2  7  
ATOM 11090 H H    . GLU A 1 57  ? -7.115  -8.391  4.013   1.00 0.00 ? 57  GLU A H    7  
ATOM 11091 H HA   . GLU A 1 57  ? -6.840  -6.873  6.468   1.00 0.00 ? 57  GLU A HA   7  
ATOM 11092 H HB2  . GLU A 1 57  ? -8.995  -7.798  6.138   1.00 0.00 ? 57  GLU A HB2  7  
ATOM 11093 H HB3  . GLU A 1 57  ? -8.340  -9.376  5.725   1.00 0.00 ? 57  GLU A HB3  7  
ATOM 11094 H HG2  . GLU A 1 57  ? -7.479  -9.505  8.091   1.00 0.00 ? 57  GLU A HG2  7  
ATOM 11095 H HG3  . GLU A 1 57  ? -8.451  -8.074  8.428   1.00 0.00 ? 57  GLU A HG3  7  
ATOM 11096 N N    . LYS A 1 58  ? -5.190  -8.187  7.779   1.00 0.00 ? 58  LYS A N    7  
ATOM 11097 C CA   . LYS A 1 58  ? -4.110  -8.872  8.478   1.00 0.00 ? 58  LYS A CA   7  
ATOM 11098 C C    . LYS A 1 58  ? -4.522  -10.292 8.856   1.00 0.00 ? 58  LYS A C    7  
ATOM 11099 O O    . LYS A 1 58  ? -5.220  -10.504 9.846   1.00 0.00 ? 58  LYS A O    7  
ATOM 11100 C CB   . LYS A 1 58  ? -3.714  -8.094  9.735   1.00 0.00 ? 58  LYS A CB   7  
ATOM 11101 C CG   . LYS A 1 58  ? -2.246  -8.236  10.100  1.00 0.00 ? 58  LYS A CG   7  
ATOM 11102 C CD   . LYS A 1 58  ? -1.413  -7.111  9.508   1.00 0.00 ? 58  LYS A CD   7  
ATOM 11103 C CE   . LYS A 1 58  ? -0.844  -7.495  8.151   1.00 0.00 ? 58  LYS A CE   7  
ATOM 11104 N NZ   . LYS A 1 58  ? 0.147   -8.601  8.258   1.00 0.00 ? 58  LYS A NZ   7  
ATOM 11105 H H    . LYS A 1 58  ? -5.521  -7.333  8.130   1.00 0.00 ? 58  LYS A H    7  
ATOM 11106 H HA   . LYS A 1 58  ? -3.262  -8.921  7.812   1.00 0.00 ? 58  LYS A HA   7  
ATOM 11107 H HB2  . LYS A 1 58  ? -3.924  -7.046  9.576   1.00 0.00 ? 58  LYS A HB2  7  
ATOM 11108 H HB3  . LYS A 1 58  ? -4.306  -8.449  10.566  1.00 0.00 ? 58  LYS A HB3  7  
ATOM 11109 H HG2  . LYS A 1 58  ? -2.149  -8.214  11.175  1.00 0.00 ? 58  LYS A HG2  7  
ATOM 11110 H HG3  . LYS A 1 58  ? -1.880  -9.180  9.723   1.00 0.00 ? 58  LYS A HG3  7  
ATOM 11111 H HD2  . LYS A 1 58  ? -2.035  -6.237  9.390   1.00 0.00 ? 58  LYS A HD2  7  
ATOM 11112 H HD3  . LYS A 1 58  ? -0.597  -6.887  10.181  1.00 0.00 ? 58  LYS A HD3  7  
ATOM 11113 H HE2  . LYS A 1 58  ? -1.654  -7.809  7.511   1.00 0.00 ? 58  LYS A HE2  7  
ATOM 11114 H HE3  . LYS A 1 58  ? -0.360  -6.630  7.721   1.00 0.00 ? 58  LYS A HE3  7  
ATOM 11115 H HZ1  . LYS A 1 58  ? 0.603   -8.763  7.337   1.00 0.00 ? 58  LYS A HZ1  7  
ATOM 11116 H HZ2  . LYS A 1 58  ? -0.327  -9.478  8.555   1.00 0.00 ? 58  LYS A HZ2  7  
ATOM 11117 H HZ3  . LYS A 1 58  ? 0.878   -8.360  8.957   1.00 0.00 ? 58  LYS A HZ3  7  
ATOM 11118 N N    . GLY A 1 59  ? -4.083  -11.262 8.059   1.00 0.00 ? 59  GLY A N    7  
ATOM 11119 C CA   . GLY A 1 59  ? -4.414  -12.649 8.328   1.00 0.00 ? 59  GLY A CA   7  
ATOM 11120 C C    . GLY A 1 59  ? -5.333  -13.239 7.276   1.00 0.00 ? 59  GLY A C    7  
ATOM 11121 O O    . GLY A 1 59  ? -6.284  -13.952 7.600   1.00 0.00 ? 59  GLY A O    7  
ATOM 11122 H H    . GLY A 1 59  ? -3.529  -11.034 7.283   1.00 0.00 ? 59  GLY A H    7  
ATOM 11123 H HA2  . GLY A 1 59  ? -3.502  -13.226 8.359   1.00 0.00 ? 59  GLY A HA2  7  
ATOM 11124 H HA3  . GLY A 1 59  ? -4.901  -12.711 9.290   1.00 0.00 ? 59  GLY A HA3  7  
ATOM 11125 N N    . THR A 1 60  ? -5.051  -12.942 6.012   1.00 0.00 ? 60  THR A N    7  
ATOM 11126 C CA   . THR A 1 60  ? -5.860  -13.446 4.909   1.00 0.00 ? 60  THR A CA   7  
ATOM 11127 C C    . THR A 1 60  ? -4.991  -14.110 3.848   1.00 0.00 ? 60  THR A C    7  
ATOM 11128 O O    . THR A 1 60  ? -5.363  -15.139 3.282   1.00 0.00 ? 60  THR A O    7  
ATOM 11129 C CB   . THR A 1 60  ? -6.680  -12.319 4.254   1.00 0.00 ? 60  THR A CB   7  
ATOM 11130 O OG1  . THR A 1 60  ? -7.060  -11.352 5.239   1.00 0.00 ? 60  THR A OG1  7  
ATOM 11131 C CG2  . THR A 1 60  ? -7.923  -12.877 3.577   1.00 0.00 ? 60  THR A CG2  7  
ATOM 11132 H H    . THR A 1 60  ? -4.280  -12.370 5.817   1.00 0.00 ? 60  THR A H    7  
ATOM 11133 H HA   . THR A 1 60  ? -6.548  -14.178 5.308   1.00 0.00 ? 60  THR A HA   7  
ATOM 11134 H HB   . THR A 1 60  ? -6.067  -11.836 3.506   1.00 0.00 ? 60  THR A HB   7  
ATOM 11135 H HG1  . THR A 1 60  ? -6.600  -10.526 5.072   1.00 0.00 ? 60  THR A HG1  7  
ATOM 11136 H HG21 . THR A 1 60  ? -8.787  -12.307 3.885   1.00 0.00 ? 60  THR A HG21 7  
ATOM 11137 H HG22 . THR A 1 60  ? -8.053  -13.910 3.860   1.00 0.00 ? 60  THR A HG22 7  
ATOM 11138 H HG23 . THR A 1 60  ? -7.811  -12.808 2.506   1.00 0.00 ? 60  THR A HG23 7  
ATOM 11139 N N    . ASP A 1 61  ? -3.833  -13.517 3.582   1.00 0.00 ? 61  ASP A N    7  
ATOM 11140 C CA   . ASP A 1 61  ? -2.909  -14.053 2.589   1.00 0.00 ? 61  ASP A CA   7  
ATOM 11141 C C    . ASP A 1 61  ? -3.484  -13.916 1.183   1.00 0.00 ? 61  ASP A C    7  
ATOM 11142 O O    . ASP A 1 61  ? -3.167  -14.704 0.291   1.00 0.00 ? 61  ASP A O    7  
ATOM 11143 C CB   . ASP A 1 61  ? -2.602  -15.521 2.887   1.00 0.00 ? 61  ASP A CB   7  
ATOM 11144 C CG   . ASP A 1 61  ? -1.453  -16.053 2.053   1.00 0.00 ? 61  ASP A CG   7  
ATOM 11145 O OD1  . ASP A 1 61  ? -0.298  -15.654 2.310   1.00 0.00 ? 61  ASP A OD1  7  
ATOM 11146 O OD2  . ASP A 1 61  ? -1.710  -16.870 1.144   1.00 0.00 ? 61  ASP A OD2  7  
ATOM 11147 H H    . ASP A 1 61  ? -3.592  -12.699 4.067   1.00 0.00 ? 61  ASP A H    7  
ATOM 11148 H HA   . ASP A 1 61  ? -1.993  -13.484 2.647   1.00 0.00 ? 61  ASP A HA   7  
ATOM 11149 H HB2  . ASP A 1 61  ? -2.341  -15.623 3.931   1.00 0.00 ? 61  ASP A HB2  7  
ATOM 11150 H HB3  . ASP A 1 61  ? -3.479  -16.115 2.680   1.00 0.00 ? 61  ASP A HB3  7  
ATOM 11151 N N    . LYS A 1 62  ? -4.332  -12.912 0.991   1.00 0.00 ? 62  LYS A N    7  
ATOM 11152 C CA   . LYS A 1 62  ? -4.952  -12.670 -0.306  1.00 0.00 ? 62  LYS A CA   7  
ATOM 11153 C C    . LYS A 1 62  ? -4.866  -11.195 -0.684  1.00 0.00 ? 62  LYS A C    7  
ATOM 11154 O O    . LYS A 1 62  ? -5.887  -10.525 -0.842  1.00 0.00 ? 62  LYS A O    7  
ATOM 11155 C CB   . LYS A 1 62  ? -6.415  -13.118 -0.286  1.00 0.00 ? 62  LYS A CB   7  
ATOM 11156 C CG   . LYS A 1 62  ? -6.613  -14.570 -0.686  1.00 0.00 ? 62  LYS A CG   7  
ATOM 11157 C CD   . LYS A 1 62  ? -6.408  -14.770 -2.179  1.00 0.00 ? 62  LYS A CD   7  
ATOM 11158 C CE   . LYS A 1 62  ? -6.673  -16.210 -2.589  1.00 0.00 ? 62  LYS A CE   7  
ATOM 11159 N NZ   . LYS A 1 62  ? -8.129  -16.525 -2.601  1.00 0.00 ? 62  LYS A NZ   7  
ATOM 11160 H H    . LYS A 1 62  ? -4.546  -12.317 1.741   1.00 0.00 ? 62  LYS A H    7  
ATOM 11161 H HA   . LYS A 1 62  ? -4.417  -13.250 -1.043  1.00 0.00 ? 62  LYS A HA   7  
ATOM 11162 H HB2  . LYS A 1 62  ? -6.807  -12.985 0.711   1.00 0.00 ? 62  LYS A HB2  7  
ATOM 11163 H HB3  . LYS A 1 62  ? -6.978  -12.499 -0.970  1.00 0.00 ? 62  LYS A HB3  7  
ATOM 11164 H HG2  . LYS A 1 62  ? -5.901  -15.181 -0.152  1.00 0.00 ? 62  LYS A HG2  7  
ATOM 11165 H HG3  . LYS A 1 62  ? -7.617  -14.873 -0.426  1.00 0.00 ? 62  LYS A HG3  7  
ATOM 11166 H HD2  . LYS A 1 62  ? -7.086  -14.124 -2.716  1.00 0.00 ? 62  LYS A HD2  7  
ATOM 11167 H HD3  . LYS A 1 62  ? -5.389  -14.515 -2.431  1.00 0.00 ? 62  LYS A HD3  7  
ATOM 11168 H HE2  . LYS A 1 62  ? -6.272  -16.368 -3.579  1.00 0.00 ? 62  LYS A HE2  7  
ATOM 11169 H HE3  . LYS A 1 62  ? -6.177  -16.867 -1.891  1.00 0.00 ? 62  LYS A HE3  7  
ATOM 11170 H HZ1  . LYS A 1 62  ? -8.584  -16.080 -3.423  1.00 0.00 ? 62  LYS A HZ1  7  
ATOM 11171 H HZ2  . LYS A 1 62  ? -8.578  -16.167 -1.734  1.00 0.00 ? 62  LYS A HZ2  7  
ATOM 11172 H HZ3  . LYS A 1 62  ? -8.272  -17.554 -2.653  1.00 0.00 ? 62  LYS A HZ3  7  
ATOM 11173 N N    . GLU A 1 63  ? -3.643  -10.696 -0.830  1.00 0.00 ? 63  GLU A N    7  
ATOM 11174 C CA   . GLU A 1 63  ? -3.425  -9.300  -1.190  1.00 0.00 ? 63  GLU A CA   7  
ATOM 11175 C C    . GLU A 1 63  ? -4.126  -8.962  -2.503  1.00 0.00 ? 63  GLU A C    7  
ATOM 11176 O O    . GLU A 1 63  ? -4.165  -9.776  -3.425  1.00 0.00 ? 63  GLU A O    7  
ATOM 11177 C CB   . GLU A 1 63  ? -1.928  -9.008  -1.308  1.00 0.00 ? 63  GLU A CB   7  
ATOM 11178 C CG   . GLU A 1 63  ? -1.602  -7.526  -1.393  1.00 0.00 ? 63  GLU A CG   7  
ATOM 11179 C CD   . GLU A 1 63  ? -1.470  -6.879  -0.028  1.00 0.00 ? 63  GLU A CD   7  
ATOM 11180 O OE1  . GLU A 1 63  ? -2.497  -6.424  0.516   1.00 0.00 ? 63  GLU A OE1  7  
ATOM 11181 O OE2  . GLU A 1 63  ? -0.337  -6.828  0.496   1.00 0.00 ? 63  GLU A OE2  7  
ATOM 11182 H H    . GLU A 1 63  ? -2.868  -11.280 -0.691  1.00 0.00 ? 63  GLU A H    7  
ATOM 11183 H HA   . GLU A 1 63  ? -3.842  -8.686  -0.406  1.00 0.00 ? 63  GLU A HA   7  
ATOM 11184 H HB2  . GLU A 1 63  ? -1.424  -9.418  -0.446  1.00 0.00 ? 63  GLU A HB2  7  
ATOM 11185 H HB3  . GLU A 1 63  ? -1.549  -9.489  -2.198  1.00 0.00 ? 63  GLU A HB3  7  
ATOM 11186 H HG2  . GLU A 1 63  ? -0.670  -7.405  -1.923  1.00 0.00 ? 63  GLU A HG2  7  
ATOM 11187 H HG3  . GLU A 1 63  ? -2.391  -7.027  -1.937  1.00 0.00 ? 63  GLU A HG3  7  
ATOM 11188 N N    . GLN A 1 64  ? -4.679  -7.755  -2.578  1.00 0.00 ? 64  GLN A N    7  
ATOM 11189 C CA   . GLN A 1 64  ? -5.379  -7.310  -3.777  1.00 0.00 ? 64  GLN A CA   7  
ATOM 11190 C C    . GLN A 1 64  ? -4.640  -6.153  -4.441  1.00 0.00 ? 64  GLN A C    7  
ATOM 11191 O O    . GLN A 1 64  ? -3.573  -5.741  -3.984  1.00 0.00 ? 64  GLN A O    7  
ATOM 11192 C CB   . GLN A 1 64  ? -6.808  -6.887  -3.431  1.00 0.00 ? 64  GLN A CB   7  
ATOM 11193 C CG   . GLN A 1 64  ? -7.766  -8.056  -3.266  1.00 0.00 ? 64  GLN A CG   7  
ATOM 11194 C CD   . GLN A 1 64  ? -8.891  -7.757  -2.295  1.00 0.00 ? 64  GLN A CD   7  
ATOM 11195 O OE1  . GLN A 1 64  ? -9.646  -6.801  -2.477  1.00 0.00 ? 64  GLN A OE1  7  
ATOM 11196 N NE2  . GLN A 1 64  ? -9.009  -8.574  -1.256  1.00 0.00 ? 64  GLN A NE2  7  
ATOM 11197 H H    . GLN A 1 64  ? -4.615  -7.151  -1.810  1.00 0.00 ? 64  GLN A H    7  
ATOM 11198 H HA   . GLN A 1 64  ? -5.416  -8.140  -4.466  1.00 0.00 ? 64  GLN A HA   7  
ATOM 11199 H HB2  . GLN A 1 64  ? -6.792  -6.329  -2.506  1.00 0.00 ? 64  GLN A HB2  7  
ATOM 11200 H HB3  . GLN A 1 64  ? -7.183  -6.251  -4.219  1.00 0.00 ? 64  GLN A HB3  7  
ATOM 11201 H HG2  . GLN A 1 64  ? -8.195  -8.291  -4.229  1.00 0.00 ? 64  GLN A HG2  7  
ATOM 11202 H HG3  . GLN A 1 64  ? -7.212  -8.909  -2.902  1.00 0.00 ? 64  GLN A HG3  7  
ATOM 11203 H HE21 . GLN A 1 64  ? -8.371  -9.314  -1.174  1.00 0.00 ? 64  GLN A HE21 7  
ATOM 11204 H HE22 . GLN A 1 64  ? -9.727  -8.404  -0.612  1.00 0.00 ? 64  GLN A HE22 7  
ATOM 11205 N N    . ASP A 1 65  ? -5.214  -5.632  -5.520  1.00 0.00 ? 65  ASP A N    7  
ATOM 11206 C CA   . ASP A 1 65  ? -4.610  -4.521  -6.246  1.00 0.00 ? 65  ASP A CA   7  
ATOM 11207 C C    . ASP A 1 65  ? -5.682  -3.644  -6.886  1.00 0.00 ? 65  ASP A C    7  
ATOM 11208 O O    . ASP A 1 65  ? -6.634  -4.146  -7.484  1.00 0.00 ? 65  ASP A O    7  
ATOM 11209 C CB   . ASP A 1 65  ? -3.655  -5.045  -7.319  1.00 0.00 ? 65  ASP A CB   7  
ATOM 11210 C CG   . ASP A 1 65  ? -4.368  -5.390  -8.612  1.00 0.00 ? 65  ASP A CG   7  
ATOM 11211 O OD1  . ASP A 1 65  ? -5.478  -5.960  -8.543  1.00 0.00 ? 65  ASP A OD1  7  
ATOM 11212 O OD2  . ASP A 1 65  ? -3.818  -5.090  -9.691  1.00 0.00 ? 65  ASP A OD2  7  
ATOM 11213 H H    . ASP A 1 65  ? -6.065  -6.003  -5.835  1.00 0.00 ? 65  ASP A H    7  
ATOM 11214 H HA   . ASP A 1 65  ? -4.052  -3.927  -5.539  1.00 0.00 ? 65  ASP A HA   7  
ATOM 11215 H HB2  . ASP A 1 65  ? -2.912  -4.290  -7.531  1.00 0.00 ? 65  ASP A HB2  7  
ATOM 11216 H HB3  . ASP A 1 65  ? -3.163  -5.934  -6.952  1.00 0.00 ? 65  ASP A HB3  7  
ATOM 11217 N N    . VAL A 1 66  ? -5.520  -2.331  -6.757  1.00 0.00 ? 66  VAL A N    7  
ATOM 11218 C CA   . VAL A 1 66  ? -6.473  -1.384  -7.322  1.00 0.00 ? 66  VAL A CA   7  
ATOM 11219 C C    . VAL A 1 66  ? -5.757  -0.260  -8.063  1.00 0.00 ? 66  VAL A C    7  
ATOM 11220 O O    . VAL A 1 66  ? -4.939  0.455   -7.486  1.00 0.00 ? 66  VAL A O    7  
ATOM 11221 C CB   . VAL A 1 66  ? -7.372  -0.773  -6.231  1.00 0.00 ? 66  VAL A CB   7  
ATOM 11222 C CG1  . VAL A 1 66  ? -8.231  -1.848  -5.582  1.00 0.00 ? 66  VAL A CG1  7  
ATOM 11223 C CG2  . VAL A 1 66  ? -6.529  -0.051  -5.190  1.00 0.00 ? 66  VAL A CG2  7  
ATOM 11224 H H    . VAL A 1 66  ? -4.740  -1.992  -6.269  1.00 0.00 ? 66  VAL A H    7  
ATOM 11225 H HA   . VAL A 1 66  ? -7.102  -1.918  -8.019  1.00 0.00 ? 66  VAL A HA   7  
ATOM 11226 H HB   . VAL A 1 66  ? -8.028  -0.051  -6.695  1.00 0.00 ? 66  VAL A HB   7  
ATOM 11227 H HG11 . VAL A 1 66  ? -9.256  -1.510  -5.537  1.00 0.00 ? 66  VAL A HG11 7  
ATOM 11228 H HG12 . VAL A 1 66  ? -8.174  -2.755  -6.166  1.00 0.00 ? 66  VAL A HG12 7  
ATOM 11229 H HG13 . VAL A 1 66  ? -7.871  -2.040  -4.582  1.00 0.00 ? 66  VAL A HG13 7  
ATOM 11230 H HG21 . VAL A 1 66  ? -5.757  -0.715  -4.830  1.00 0.00 ? 66  VAL A HG21 7  
ATOM 11231 H HG22 . VAL A 1 66  ? -6.074  0.821   -5.635  1.00 0.00 ? 66  VAL A HG22 7  
ATOM 11232 H HG23 . VAL A 1 66  ? -7.157  0.252   -4.365  1.00 0.00 ? 66  VAL A HG23 7  
ATOM 11233 N N    . ASP A 1 67  ? -6.071  -0.111  -9.346  1.00 0.00 ? 67  ASP A N    7  
ATOM 11234 C CA   . ASP A 1 67  ? -5.459  0.927   -10.167 1.00 0.00 ? 67  ASP A CA   7  
ATOM 11235 C C    . ASP A 1 67  ? -5.931  2.311   -9.734  1.00 0.00 ? 67  ASP A C    7  
ATOM 11236 O O    . ASP A 1 67  ? -7.085  2.681   -9.952  1.00 0.00 ? 67  ASP A O    7  
ATOM 11237 C CB   . ASP A 1 67  ? -5.789  0.700   -11.643 1.00 0.00 ? 67  ASP A CB   7  
ATOM 11238 C CG   . ASP A 1 67  ? -4.807  1.391   -12.569 1.00 0.00 ? 67  ASP A CG   7  
ATOM 11239 O OD1  . ASP A 1 67  ? -3.676  1.679   -12.125 1.00 0.00 ? 67  ASP A OD1  7  
ATOM 11240 O OD2  . ASP A 1 67  ? -5.170  1.642   -13.737 1.00 0.00 ? 67  ASP A OD2  7  
ATOM 11241 H H    . ASP A 1 67  ? -6.731  -0.713  -9.749  1.00 0.00 ? 67  ASP A H    7  
ATOM 11242 H HA   . ASP A 1 67  ? -4.389  0.868   -10.034 1.00 0.00 ? 67  ASP A HA   7  
ATOM 11243 H HB2  . ASP A 1 67  ? -5.767  -0.360  -11.851 1.00 0.00 ? 67  ASP A HB2  7  
ATOM 11244 H HB3  . ASP A 1 67  ? -6.779  1.083   -11.847 1.00 0.00 ? 67  ASP A HB3  7  
ATOM 11245 N N    . VAL A 1 68  ? -5.032  3.072   -9.119  1.00 0.00 ? 68  VAL A N    7  
ATOM 11246 C CA   . VAL A 1 68  ? -5.356  4.416   -8.655  1.00 0.00 ? 68  VAL A CA   7  
ATOM 11247 C C    . VAL A 1 68  ? -4.655  5.473   -9.500  1.00 0.00 ? 68  VAL A C    7  
ATOM 11248 O O    . VAL A 1 68  ? -3.538  5.264   -9.973  1.00 0.00 ? 68  VAL A O    7  
ATOM 11249 C CB   . VAL A 1 68  ? -4.962  4.611   -7.179  1.00 0.00 ? 68  VAL A CB   7  
ATOM 11250 C CG1  . VAL A 1 68  ? -5.187  6.053   -6.752  1.00 0.00 ? 68  VAL A CG1  7  
ATOM 11251 C CG2  . VAL A 1 68  ? -5.743  3.655   -6.289  1.00 0.00 ? 68  VAL A CG2  7  
ATOM 11252 H H    . VAL A 1 68  ? -4.128  2.722   -8.974  1.00 0.00 ? 68  VAL A H    7  
ATOM 11253 H HA   . VAL A 1 68  ? -6.425  4.550   -8.742  1.00 0.00 ? 68  VAL A HA   7  
ATOM 11254 H HB   . VAL A 1 68  ? -3.911  4.387   -7.075  1.00 0.00 ? 68  VAL A HB   7  
ATOM 11255 H HG11 . VAL A 1 68  ? -4.745  6.213   -5.779  1.00 0.00 ? 68  VAL A HG11 7  
ATOM 11256 H HG12 . VAL A 1 68  ? -4.728  6.717   -7.470  1.00 0.00 ? 68  VAL A HG12 7  
ATOM 11257 H HG13 . VAL A 1 68  ? -6.247  6.253   -6.702  1.00 0.00 ? 68  VAL A HG13 7  
ATOM 11258 H HG21 . VAL A 1 68  ? -5.126  3.354   -5.456  1.00 0.00 ? 68  VAL A HG21 7  
ATOM 11259 H HG22 . VAL A 1 68  ? -6.630  4.150   -5.919  1.00 0.00 ? 68  VAL A HG22 7  
ATOM 11260 H HG23 . VAL A 1 68  ? -6.029  2.784   -6.859  1.00 0.00 ? 68  VAL A HG23 7  
ATOM 11261 N N    . SER A 1 69  ? -5.318  6.610   -9.686  1.00 0.00 ? 69  SER A N    7  
ATOM 11262 C CA   . SER A 1 69  ? -4.760  7.700   -10.478 1.00 0.00 ? 69  SER A CA   7  
ATOM 11263 C C    . SER A 1 69  ? -4.228  8.810   -9.576  1.00 0.00 ? 69  SER A C    7  
ATOM 11264 O O    . SER A 1 69  ? -3.217  9.441   -9.881  1.00 0.00 ? 69  SER A O    7  
ATOM 11265 C CB   . SER A 1 69  ? -5.819  8.263   -11.428 1.00 0.00 ? 69  SER A CB   7  
ATOM 11266 O OG   . SER A 1 69  ? -6.134  7.334   -12.450 1.00 0.00 ? 69  SER A OG   7  
ATOM 11267 H H    . SER A 1 69  ? -6.206  6.717   -9.284  1.00 0.00 ? 69  SER A H    7  
ATOM 11268 H HA   . SER A 1 69  ? -3.942  7.302   -11.060 1.00 0.00 ? 69  SER A HA   7  
ATOM 11269 H HB2  . SER A 1 69  ? -6.717  8.485   -10.871 1.00 0.00 ? 69  SER A HB2  7  
ATOM 11270 H HB3  . SER A 1 69  ? -5.445  9.169   -11.883 1.00 0.00 ? 69  SER A HB3  7  
ATOM 11271 H HG   . SER A 1 69  ? -5.346  7.146   -12.966 1.00 0.00 ? 69  SER A HG   7  
ATOM 11272 N N    . SER A 1 70  ? -4.918  9.041   -8.463  1.00 0.00 ? 70  SER A N    7  
ATOM 11273 C CA   . SER A 1 70  ? -4.519  10.076  -7.517  1.00 0.00 ? 70  SER A CA   7  
ATOM 11274 C C    . SER A 1 70  ? -3.551  9.519   -6.478  1.00 0.00 ? 70  SER A C    7  
ATOM 11275 O O    . SER A 1 70  ? -3.530  8.316   -6.214  1.00 0.00 ? 70  SER A O    7  
ATOM 11276 C CB   . SER A 1 70  ? -5.748  10.663  -6.822  1.00 0.00 ? 70  SER A CB   7  
ATOM 11277 O OG   . SER A 1 70  ? -6.591  9.638   -6.324  1.00 0.00 ? 70  SER A OG   7  
ATOM 11278 H H    . SER A 1 70  ? -5.716  8.503   -8.276  1.00 0.00 ? 70  SER A H    7  
ATOM 11279 H HA   . SER A 1 70  ? -4.022  10.858  -8.072  1.00 0.00 ? 70  SER A HA   7  
ATOM 11280 H HB2  . SER A 1 70  ? -5.431  11.284  -5.998  1.00 0.00 ? 70  SER A HB2  7  
ATOM 11281 H HB3  . SER A 1 70  ? -6.307  11.261  -7.528  1.00 0.00 ? 70  SER A HB3  7  
ATOM 11282 H HG   . SER A 1 70  ? -6.057  8.966   -5.894  1.00 0.00 ? 70  SER A HG   7  
ATOM 11283 N N    . HIS A 1 71  ? -2.749  10.402  -5.892  1.00 0.00 ? 71  HIS A N    7  
ATOM 11284 C CA   . HIS A 1 71  ? -1.778  9.999   -4.880  1.00 0.00 ? 71  HIS A CA   7  
ATOM 11285 C C    . HIS A 1 71  ? -2.479  9.444   -3.644  1.00 0.00 ? 71  HIS A C    7  
ATOM 11286 O O    . HIS A 1 71  ? -1.914  8.635   -2.908  1.00 0.00 ? 71  HIS A O    7  
ATOM 11287 C CB   . HIS A 1 71  ? -0.894  11.185  -4.491  1.00 0.00 ? 71  HIS A CB   7  
ATOM 11288 C CG   . HIS A 1 71  ? 0.164   11.501  -5.502  1.00 0.00 ? 71  HIS A CG   7  
ATOM 11289 N ND1  . HIS A 1 71  ? 0.113   12.606  -6.325  1.00 0.00 ? 71  HIS A ND1  7  
ATOM 11290 C CD2  . HIS A 1 71  ? 1.307   10.850  -5.820  1.00 0.00 ? 71  HIS A CD2  7  
ATOM 11291 C CE1  . HIS A 1 71  ? 1.178   12.620  -7.106  1.00 0.00 ? 71  HIS A CE1  7  
ATOM 11292 N NE2  . HIS A 1 71  ? 1.919   11.565  -6.820  1.00 0.00 ? 71  HIS A NE2  7  
ATOM 11293 H H    . HIS A 1 71  ? -2.812  11.346  -6.144  1.00 0.00 ? 71  HIS A H    7  
ATOM 11294 H HA   . HIS A 1 71  ? -1.158  9.224   -5.305  1.00 0.00 ? 71  HIS A HA   7  
ATOM 11295 H HB2  . HIS A 1 71  ? -1.513  12.062  -4.373  1.00 0.00 ? 71  HIS A HB2  7  
ATOM 11296 H HB3  . HIS A 1 71  ? -0.404  10.967  -3.553  1.00 0.00 ? 71  HIS A HB3  7  
ATOM 11297 H HD1  . HIS A 1 71  ? -0.599  13.279  -6.335  1.00 0.00 ? 71  HIS A HD1  7  
ATOM 11298 H HD2  . HIS A 1 71  ? 1.672   9.936   -5.372  1.00 0.00 ? 71  HIS A HD2  7  
ATOM 11299 H HE1  . HIS A 1 71  ? 1.405   13.367  -7.852  1.00 0.00 ? 71  HIS A HE1  7  
ATOM 11300 H HE2  . HIS A 1 71  ? 2.721   11.289  -7.310  1.00 0.00 ? 71  HIS A HE2  7  
ATOM 11301 N N    . SER A 1 72  ? -3.713  9.885   -3.422  1.00 0.00 ? 72  SER A N    7  
ATOM 11302 C CA   . SER A 1 72  ? -4.490  9.436   -2.272  1.00 0.00 ? 72  SER A CA   7  
ATOM 11303 C C    . SER A 1 72  ? -5.773  8.742   -2.721  1.00 0.00 ? 72  SER A C    7  
ATOM 11304 O O    . SER A 1 72  ? -6.486  9.236   -3.595  1.00 0.00 ? 72  SER A O    7  
ATOM 11305 C CB   . SER A 1 72  ? -4.828  10.620  -1.364  1.00 0.00 ? 72  SER A CB   7  
ATOM 11306 O OG   . SER A 1 72  ? -3.669  11.376  -1.060  1.00 0.00 ? 72  SER A OG   7  
ATOM 11307 H H    . SER A 1 72  ? -4.110  10.530  -4.045  1.00 0.00 ? 72  SER A H    7  
ATOM 11308 H HA   . SER A 1 72  ? -3.887  8.730   -1.720  1.00 0.00 ? 72  SER A HA   7  
ATOM 11309 H HB2  . SER A 1 72  ? -5.540  11.260  -1.862  1.00 0.00 ? 72  SER A HB2  7  
ATOM 11310 H HB3  . SER A 1 72  ? -5.256  10.253  -0.443  1.00 0.00 ? 72  SER A HB3  7  
ATOM 11311 H HG   . SER A 1 72  ? -2.944  10.781  -0.852  1.00 0.00 ? 72  SER A HG   7  
ATOM 11312 N N    . TYR A 1 73  ? -6.059  7.595   -2.117  1.00 0.00 ? 73  TYR A N    7  
ATOM 11313 C CA   . TYR A 1 73  ? -7.254  6.830   -2.455  1.00 0.00 ? 73  TYR A CA   7  
ATOM 11314 C C    . TYR A 1 73  ? -8.080  6.531   -1.207  1.00 0.00 ? 73  TYR A C    7  
ATOM 11315 O O    . TYR A 1 73  ? -7.634  6.760   -0.082  1.00 0.00 ? 73  TYR A O    7  
ATOM 11316 C CB   . TYR A 1 73  ? -6.870  5.524   -3.151  1.00 0.00 ? 73  TYR A CB   7  
ATOM 11317 C CG   . TYR A 1 73  ? -8.057  4.726   -3.640  1.00 0.00 ? 73  TYR A CG   7  
ATOM 11318 C CD1  . TYR A 1 73  ? -8.816  5.163   -4.719  1.00 0.00 ? 73  TYR A CD1  7  
ATOM 11319 C CD2  . TYR A 1 73  ? -8.420  3.535   -3.023  1.00 0.00 ? 73  TYR A CD2  7  
ATOM 11320 C CE1  . TYR A 1 73  ? -9.902  4.437   -5.168  1.00 0.00 ? 73  TYR A CE1  7  
ATOM 11321 C CE2  . TYR A 1 73  ? -9.504  2.802   -3.467  1.00 0.00 ? 73  TYR A CE2  7  
ATOM 11322 C CZ   . TYR A 1 73  ? -10.242 3.258   -4.539  1.00 0.00 ? 73  TYR A CZ   7  
ATOM 11323 O OH   . TYR A 1 73  ? -11.323 2.531   -4.985  1.00 0.00 ? 73  TYR A OH   7  
ATOM 11324 H H    . TYR A 1 73  ? -5.452  7.252   -1.428  1.00 0.00 ? 73  TYR A H    7  
ATOM 11325 H HA   . TYR A 1 73  ? -7.848  7.426   -3.132  1.00 0.00 ? 73  TYR A HA   7  
ATOM 11326 H HB2  . TYR A 1 73  ? -6.248  5.748   -4.004  1.00 0.00 ? 73  TYR A HB2  7  
ATOM 11327 H HB3  . TYR A 1 73  ? -6.316  4.905   -2.460  1.00 0.00 ? 73  TYR A HB3  7  
ATOM 11328 H HD1  . TYR A 1 73  ? -8.547  6.087   -5.209  1.00 0.00 ? 73  TYR A HD1  7  
ATOM 11329 H HD2  . TYR A 1 73  ? -7.840  3.180   -2.184  1.00 0.00 ? 73  TYR A HD2  7  
ATOM 11330 H HE1  . TYR A 1 73  ? -10.480 4.794   -6.008  1.00 0.00 ? 73  TYR A HE1  7  
ATOM 11331 H HE2  . TYR A 1 73  ? -9.770  1.878   -2.975  1.00 0.00 ? 73  TYR A HE2  7  
ATOM 11332 H HH   . TYR A 1 73  ? -12.114 3.073   -4.936  1.00 0.00 ? 73  TYR A HH   7  
ATOM 11333 N N    . THR A 1 74  ? -9.289  6.017   -1.415  1.00 0.00 ? 74  THR A N    7  
ATOM 11334 C CA   . THR A 1 74  ? -10.179 5.686   -0.309  1.00 0.00 ? 74  THR A CA   7  
ATOM 11335 C C    . THR A 1 74  ? -10.822 4.319   -0.512  1.00 0.00 ? 74  THR A C    7  
ATOM 11336 O O    . THR A 1 74  ? -11.664 4.143   -1.393  1.00 0.00 ? 74  THR A O    7  
ATOM 11337 C CB   . THR A 1 74  ? -11.287 6.743   -0.145  1.00 0.00 ? 74  THR A CB   7  
ATOM 11338 O OG1  . THR A 1 74  ? -10.707 8.047   -0.024  1.00 0.00 ? 74  THR A OG1  7  
ATOM 11339 C CG2  . THR A 1 74  ? -12.140 6.447   1.079   1.00 0.00 ? 74  THR A CG2  7  
ATOM 11340 H H    . THR A 1 74  ? -9.588  5.858   -2.334  1.00 0.00 ? 74  THR A H    7  
ATOM 11341 H HA   . THR A 1 74  ? -9.591  5.667   0.597   1.00 0.00 ? 74  THR A HA   7  
ATOM 11342 H HB   . THR A 1 74  ? -11.920 6.719   -1.021  1.00 0.00 ? 74  THR A HB   7  
ATOM 11343 H HG1  . THR A 1 74  ? -10.143 8.218   -0.782  1.00 0.00 ? 74  THR A HG1  7  
ATOM 11344 H HG21 . THR A 1 74  ? -12.655 7.345   1.386   1.00 0.00 ? 74  THR A HG21 7  
ATOM 11345 H HG22 . THR A 1 74  ? -11.508 6.102   1.884   1.00 0.00 ? 74  THR A HG22 7  
ATOM 11346 H HG23 . THR A 1 74  ? -12.864 5.683   0.837   1.00 0.00 ? 74  THR A HG23 7  
ATOM 11347 N N    . ILE A 1 75  ? -10.421 3.355   0.310   1.00 0.00 ? 75  ILE A N    7  
ATOM 11348 C CA   . ILE A 1 75  ? -10.961 2.004   0.221   1.00 0.00 ? 75  ILE A CA   7  
ATOM 11349 C C    . ILE A 1 75  ? -12.146 1.822   1.164   1.00 0.00 ? 75  ILE A C    7  
ATOM 11350 O O    . ILE A 1 75  ? -12.049 2.096   2.359   1.00 0.00 ? 75  ILE A O    7  
ATOM 11351 C CB   . ILE A 1 75  ? -9.890  0.947   0.552   1.00 0.00 ? 75  ILE A CB   7  
ATOM 11352 C CG1  . ILE A 1 75  ? -8.748  1.012   -0.464  1.00 0.00 ? 75  ILE A CG1  7  
ATOM 11353 C CG2  . ILE A 1 75  ? -10.508 -0.443  0.574   1.00 0.00 ? 75  ILE A CG2  7  
ATOM 11354 C CD1  . ILE A 1 75  ? -7.535  0.202   -0.062  1.00 0.00 ? 75  ILE A CD1  7  
ATOM 11355 H H    . ILE A 1 75  ? -9.748  3.557   0.992   1.00 0.00 ? 75  ILE A H    7  
ATOM 11356 H HA   . ILE A 1 75  ? -11.295 1.844   -0.794  1.00 0.00 ? 75  ILE A HA   7  
ATOM 11357 H HB   . ILE A 1 75  ? -9.500  1.157   1.536   1.00 0.00 ? 75  ILE A HB   7  
ATOM 11358 H HG12 . ILE A 1 75  ? -9.097  0.638   -1.413  1.00 0.00 ? 75  ILE A HG12 7  
ATOM 11359 H HG13 . ILE A 1 75  ? -8.437  2.041   -0.579  1.00 0.00 ? 75  ILE A HG13 7  
ATOM 11360 H HG21 . ILE A 1 75  ? -11.518 -0.395  0.196   1.00 0.00 ? 75  ILE A HG21 7  
ATOM 11361 H HG22 . ILE A 1 75  ? -9.923  -1.106  -0.047  1.00 0.00 ? 75  ILE A HG22 7  
ATOM 11362 H HG23 . ILE A 1 75  ? -10.520 -0.816  1.587   1.00 0.00 ? 75  ILE A HG23 7  
ATOM 11363 H HD11 . ILE A 1 75  ? -7.037  -0.164  -0.948  1.00 0.00 ? 75  ILE A HD11 7  
ATOM 11364 H HD12 . ILE A 1 75  ? -6.857  0.824   0.502   1.00 0.00 ? 75  ILE A HD12 7  
ATOM 11365 H HD13 . ILE A 1 75  ? -7.847  -0.635  0.546   1.00 0.00 ? 75  ILE A HD13 7  
ATOM 11366 N N    . ASN A 1 76  ? -13.265 1.357   0.617   1.00 0.00 ? 76  ASN A N    7  
ATOM 11367 C CA   . ASN A 1 76  ? -14.469 1.137   1.409   1.00 0.00 ? 76  ASN A CA   7  
ATOM 11368 C C    . ASN A 1 76  ? -14.889 -0.329  1.365   1.00 0.00 ? 76  ASN A C    7  
ATOM 11369 O O    . ASN A 1 76  ? -14.363 -1.113  0.577   1.00 0.00 ? 76  ASN A O    7  
ATOM 11370 C CB   . ASN A 1 76  ? -15.609 2.021   0.899   1.00 0.00 ? 76  ASN A CB   7  
ATOM 11371 C CG   . ASN A 1 76  ? -15.145 3.425   0.560   1.00 0.00 ? 76  ASN A CG   7  
ATOM 11372 O OD1  . ASN A 1 76  ? -14.076 3.858   0.991   1.00 0.00 ? 76  ASN A OD1  7  
ATOM 11373 N ND2  . ASN A 1 76  ? -15.949 4.143   -0.215  1.00 0.00 ? 76  ASN A ND2  7  
ATOM 11374 H H    . ASN A 1 76  ? -13.281 1.157   -0.343  1.00 0.00 ? 76  ASN A H    7  
ATOM 11375 H HA   . ASN A 1 76  ? -14.247 1.406   2.431   1.00 0.00 ? 76  ASN A HA   7  
ATOM 11376 H HB2  . ASN A 1 76  ? -16.029 1.578   0.008   1.00 0.00 ? 76  ASN A HB2  7  
ATOM 11377 H HB3  . ASN A 1 76  ? -16.373 2.088   1.658   1.00 0.00 ? 76  ASN A HB3  7  
ATOM 11378 H HD21 . ASN A 1 76  ? -16.785 3.733   -0.521  1.00 0.00 ? 76  ASN A HD21 7  
ATOM 11379 H HD22 . ASN A 1 76  ? -15.673 5.053   -0.450  1.00 0.00 ? 76  ASN A HD22 7  
ATOM 11380 N N    . GLY A 1 77  ? -15.842 -0.692  2.219   1.00 0.00 ? 77  GLY A N    7  
ATOM 11381 C CA   . GLY A 1 77  ? -16.317 -2.062  2.261   1.00 0.00 ? 77  GLY A CA   7  
ATOM 11382 C C    . GLY A 1 77  ? -15.378 -2.978  3.021   1.00 0.00 ? 77  GLY A C    7  
ATOM 11383 O O    . GLY A 1 77  ? -14.909 -3.983  2.485   1.00 0.00 ? 77  GLY A O    7  
ATOM 11384 H H    . GLY A 1 77  ? -16.225 -0.023  2.825   1.00 0.00 ? 77  GLY A H    7  
ATOM 11385 H HA2  . GLY A 1 77  ? -17.286 -2.081  2.738   1.00 0.00 ? 77  GLY A HA2  7  
ATOM 11386 H HA3  . GLY A 1 77  ? -16.417 -2.428  1.250   1.00 0.00 ? 77  GLY A HA3  7  
ATOM 11387 N N    . LEU A 1 78  ? -15.102 -2.632  4.274   1.00 0.00 ? 78  LEU A N    7  
ATOM 11388 C CA   . LEU A 1 78  ? -14.211 -3.430  5.109   1.00 0.00 ? 78  LEU A CA   7  
ATOM 11389 C C    . LEU A 1 78  ? -14.879 -3.783  6.434   1.00 0.00 ? 78  LEU A C    7  
ATOM 11390 O O    . LEU A 1 78  ? -15.941 -3.257  6.767   1.00 0.00 ? 78  LEU A O    7  
ATOM 11391 C CB   . LEU A 1 78  ? -12.908 -2.672  5.368   1.00 0.00 ? 78  LEU A CB   7  
ATOM 11392 C CG   . LEU A 1 78  ? -12.262 -2.012  4.150   1.00 0.00 ? 78  LEU A CG   7  
ATOM 11393 C CD1  . LEU A 1 78  ? -11.096 -1.132  4.574   1.00 0.00 ? 78  LEU A CD1  7  
ATOM 11394 C CD2  . LEU A 1 78  ? -11.801 -3.066  3.154   1.00 0.00 ? 78  LEU A CD2  7  
ATOM 11395 H H    . LEU A 1 78  ? -15.506 -1.821  4.646   1.00 0.00 ? 78  LEU A H    7  
ATOM 11396 H HA   . LEU A 1 78  ? -13.987 -4.342  4.578   1.00 0.00 ? 78  LEU A HA   7  
ATOM 11397 H HB2  . LEU A 1 78  ? -13.113 -1.898  6.093   1.00 0.00 ? 78  LEU A HB2  7  
ATOM 11398 H HB3  . LEU A 1 78  ? -12.196 -3.371  5.783   1.00 0.00 ? 78  LEU A HB3  7  
ATOM 11399 H HG   . LEU A 1 78  ? -12.992 -1.383  3.659   1.00 0.00 ? 78  LEU A HG   7  
ATOM 11400 H HD11 . LEU A 1 78  ? -10.278 -1.258  3.881   1.00 0.00 ? 78  LEU A HD11 7  
ATOM 11401 H HD12 . LEU A 1 78  ? -10.775 -1.414  5.566   1.00 0.00 ? 78  LEU A HD12 7  
ATOM 11402 H HD13 . LEU A 1 78  ? -11.409 -0.098  4.579   1.00 0.00 ? 78  LEU A HD13 7  
ATOM 11403 H HD21 . LEU A 1 78  ? -12.654 -3.443  2.610   1.00 0.00 ? 78  LEU A HD21 7  
ATOM 11404 H HD22 . LEU A 1 78  ? -11.324 -3.878  3.684   1.00 0.00 ? 78  LEU A HD22 7  
ATOM 11405 H HD23 . LEU A 1 78  ? -11.099 -2.625  2.462   1.00 0.00 ? 78  LEU A HD23 7  
ATOM 11406 N N    . LYS A 1 79  ? -14.248 -4.678  7.188   1.00 0.00 ? 79  LYS A N    7  
ATOM 11407 C CA   . LYS A 1 79  ? -14.778 -5.100  8.479   1.00 0.00 ? 79  LYS A CA   7  
ATOM 11408 C C    . LYS A 1 79  ? -14.520 -4.041  9.546   1.00 0.00 ? 79  LYS A C    7  
ATOM 11409 O O    . LYS A 1 79  ? -13.586 -3.247  9.435   1.00 0.00 ? 79  LYS A O    7  
ATOM 11410 C CB   . LYS A 1 79  ? -14.148 -6.429  8.902   1.00 0.00 ? 79  LYS A CB   7  
ATOM 11411 C CG   . LYS A 1 79  ? -14.628 -7.617  8.086   1.00 0.00 ? 79  LYS A CG   7  
ATOM 11412 C CD   . LYS A 1 79  ? -15.967 -8.133  8.587   1.00 0.00 ? 79  LYS A CD   7  
ATOM 11413 C CE   . LYS A 1 79  ? -15.808 -8.949  9.860   1.00 0.00 ? 79  LYS A CE   7  
ATOM 11414 N NZ   . LYS A 1 79  ? -15.577 -10.391 9.569   1.00 0.00 ? 79  LYS A NZ   7  
ATOM 11415 H H    . LYS A 1 79  ? -13.405 -5.062  6.869   1.00 0.00 ? 79  LYS A H    7  
ATOM 11416 H HA   . LYS A 1 79  ? -15.844 -5.235  8.373   1.00 0.00 ? 79  LYS A HA   7  
ATOM 11417 H HB2  . LYS A 1 79  ? -13.076 -6.355  8.795   1.00 0.00 ? 79  LYS A HB2  7  
ATOM 11418 H HB3  . LYS A 1 79  ? -14.386 -6.612  9.940   1.00 0.00 ? 79  LYS A HB3  7  
ATOM 11419 H HG2  . LYS A 1 79  ? -14.734 -7.315  7.055   1.00 0.00 ? 79  LYS A HG2  7  
ATOM 11420 H HG3  . LYS A 1 79  ? -13.897 -8.410  8.158   1.00 0.00 ? 79  LYS A HG3  7  
ATOM 11421 H HD2  . LYS A 1 79  ? -16.614 -7.292  8.790   1.00 0.00 ? 79  LYS A HD2  7  
ATOM 11422 H HD3  . LYS A 1 79  ? -16.411 -8.755  7.823   1.00 0.00 ? 79  LYS A HD3  7  
ATOM 11423 H HE2  . LYS A 1 79  ? -14.968 -8.564  10.417  1.00 0.00 ? 79  LYS A HE2  7  
ATOM 11424 H HE3  . LYS A 1 79  ? -16.708 -8.850  10.450  1.00 0.00 ? 79  LYS A HE3  7  
ATOM 11425 H HZ1  . LYS A 1 79  ? -16.476 -10.913 9.615   1.00 0.00 ? 79  LYS A HZ1  7  
ATOM 11426 H HZ2  . LYS A 1 79  ? -14.919 -10.795 10.266  1.00 0.00 ? 79  LYS A HZ2  7  
ATOM 11427 H HZ3  . LYS A 1 79  ? -15.171 -10.504 8.618   1.00 0.00 ? 79  LYS A HZ3  7  
ATOM 11428 N N    . LYS A 1 80  ? -15.354 -4.035  10.581  1.00 0.00 ? 80  LYS A N    7  
ATOM 11429 C CA   . LYS A 1 80  ? -15.216 -3.076  11.670  1.00 0.00 ? 80  LYS A CA   7  
ATOM 11430 C C    . LYS A 1 80  ? -14.186 -3.554  12.689  1.00 0.00 ? 80  LYS A C    7  
ATOM 11431 O O    . LYS A 1 80  ? -14.022 -4.756  12.903  1.00 0.00 ? 80  LYS A O    7  
ATOM 11432 C CB   . LYS A 1 80  ? -16.565 -2.855  12.358  1.00 0.00 ? 80  LYS A CB   7  
ATOM 11433 C CG   . LYS A 1 80  ? -17.398 -1.756  11.723  1.00 0.00 ? 80  LYS A CG   7  
ATOM 11434 C CD   . LYS A 1 80  ? -18.886 -2.020  11.883  1.00 0.00 ? 80  LYS A CD   7  
ATOM 11435 C CE   . LYS A 1 80  ? -19.372 -3.080  10.907  1.00 0.00 ? 80  LYS A CE   7  
ATOM 11436 N NZ   . LYS A 1 80  ? -20.626 -3.733  11.376  1.00 0.00 ? 80  LYS A NZ   7  
ATOM 11437 H H    . LYS A 1 80  ? -16.080 -4.694  10.613  1.00 0.00 ? 80  LYS A H    7  
ATOM 11438 H HA   . LYS A 1 80  ? -14.879 -2.141  11.248  1.00 0.00 ? 80  LYS A HA   7  
ATOM 11439 H HB2  . LYS A 1 80  ? -17.130 -3.775  12.318  1.00 0.00 ? 80  LYS A HB2  7  
ATOM 11440 H HB3  . LYS A 1 80  ? -16.390 -2.594  13.392  1.00 0.00 ? 80  LYS A HB3  7  
ATOM 11441 H HG2  . LYS A 1 80  ? -17.158 -0.815  12.196  1.00 0.00 ? 80  LYS A HG2  7  
ATOM 11442 H HG3  . LYS A 1 80  ? -17.163 -1.701  10.669  1.00 0.00 ? 80  LYS A HG3  7  
ATOM 11443 H HD2  . LYS A 1 80  ? -19.076 -2.361  12.890  1.00 0.00 ? 80  LYS A HD2  7  
ATOM 11444 H HD3  . LYS A 1 80  ? -19.428 -1.102  11.704  1.00 0.00 ? 80  LYS A HD3  7  
ATOM 11445 H HE2  . LYS A 1 80  ? -19.555 -2.614  9.951   1.00 0.00 ? 80  LYS A HE2  7  
ATOM 11446 H HE3  . LYS A 1 80  ? -18.604 -3.831  10.800  1.00 0.00 ? 80  LYS A HE3  7  
ATOM 11447 H HZ1  . LYS A 1 80  ? -20.704 -3.654  12.410  1.00 0.00 ? 80  LYS A HZ1  7  
ATOM 11448 H HZ2  . LYS A 1 80  ? -20.624 -4.739  11.115  1.00 0.00 ? 80  LYS A HZ2  7  
ATOM 11449 H HZ3  . LYS A 1 80  ? -21.452 -3.274  10.941  1.00 0.00 ? 80  LYS A HZ3  7  
ATOM 11450 N N    . TYR A 1 81  ? -13.497 -2.608  13.316  1.00 0.00 ? 81  TYR A N    7  
ATOM 11451 C CA   . TYR A 1 81  ? -12.483 -2.933  14.312  1.00 0.00 ? 81  TYR A CA   7  
ATOM 11452 C C    . TYR A 1 81  ? -11.553 -4.031  13.804  1.00 0.00 ? 81  TYR A C    7  
ATOM 11453 O O    . TYR A 1 81  ? -11.203 -4.955  14.539  1.00 0.00 ? 81  TYR A O    7  
ATOM 11454 C CB   . TYR A 1 81  ? -13.145 -3.374  15.619  1.00 0.00 ? 81  TYR A CB   7  
ATOM 11455 C CG   . TYR A 1 81  ? -12.225 -3.304  16.817  1.00 0.00 ? 81  TYR A CG   7  
ATOM 11456 C CD1  . TYR A 1 81  ? -11.584 -2.119  17.158  1.00 0.00 ? 81  TYR A CD1  7  
ATOM 11457 C CD2  . TYR A 1 81  ? -11.998 -4.423  17.609  1.00 0.00 ? 81  TYR A CD2  7  
ATOM 11458 C CE1  . TYR A 1 81  ? -10.743 -2.052  18.251  1.00 0.00 ? 81  TYR A CE1  7  
ATOM 11459 C CE2  . TYR A 1 81  ? -11.159 -4.364  18.705  1.00 0.00 ? 81  TYR A CE2  7  
ATOM 11460 C CZ   . TYR A 1 81  ? -10.534 -3.176  19.022  1.00 0.00 ? 81  TYR A CZ   7  
ATOM 11461 O OH   . TYR A 1 81  ? -9.697  -3.112  20.112  1.00 0.00 ? 81  TYR A OH   7  
ATOM 11462 H H    . TYR A 1 81  ? -13.673 -1.667  13.103  1.00 0.00 ? 81  TYR A H    7  
ATOM 11463 H HA   . TYR A 1 81  ? -11.902 -2.042  14.497  1.00 0.00 ? 81  TYR A HA   7  
ATOM 11464 H HB2  . TYR A 1 81  ? -13.994 -2.739  15.816  1.00 0.00 ? 81  TYR A HB2  7  
ATOM 11465 H HB3  . TYR A 1 81  ? -13.481 -4.396  15.517  1.00 0.00 ? 81  TYR A HB3  7  
ATOM 11466 H HD1  . TYR A 1 81  ? -11.750 -1.240  16.552  1.00 0.00 ? 81  TYR A HD1  7  
ATOM 11467 H HD2  . TYR A 1 81  ? -12.490 -5.352  17.359  1.00 0.00 ? 81  TYR A HD2  7  
ATOM 11468 H HE1  . TYR A 1 81  ? -10.253 -1.121  18.499  1.00 0.00 ? 81  TYR A HE1  7  
ATOM 11469 H HE2  . TYR A 1 81  ? -10.995 -5.244  19.309  1.00 0.00 ? 81  TYR A HE2  7  
ATOM 11470 H HH   . TYR A 1 81  ? -10.139 -2.649  20.828  1.00 0.00 ? 81  TYR A HH   7  
ATOM 11471 N N    . THR A 1 82  ? -11.155 -3.922  12.541  1.00 0.00 ? 82  THR A N    7  
ATOM 11472 C CA   . THR A 1 82  ? -10.266 -4.904  11.932  1.00 0.00 ? 82  THR A CA   7  
ATOM 11473 C C    . THR A 1 82  ? -9.014  -4.239  11.371  1.00 0.00 ? 82  THR A C    7  
ATOM 11474 O O    . THR A 1 82  ? -9.028  -3.056  11.033  1.00 0.00 ? 82  THR A O    7  
ATOM 11475 C CB   . THR A 1 82  ? -10.972 -5.678  10.803  1.00 0.00 ? 82  THR A CB   7  
ATOM 11476 O OG1  . THR A 1 82  ? -12.191 -6.251  11.290  1.00 0.00 ? 82  THR A OG1  7  
ATOM 11477 C CG2  . THR A 1 82  ? -10.073 -6.776  10.255  1.00 0.00 ? 82  THR A CG2  7  
ATOM 11478 H H    . THR A 1 82  ? -11.468 -3.163  12.006  1.00 0.00 ? 82  THR A H    7  
ATOM 11479 H HA   . THR A 1 82  ? -9.975  -5.609  12.697  1.00 0.00 ? 82  THR A HA   7  
ATOM 11480 H HB   . THR A 1 82  ? -11.202 -4.988  10.004  1.00 0.00 ? 82  THR A HB   7  
ATOM 11481 H HG1  . THR A 1 82  ? -12.654 -5.606  11.831  1.00 0.00 ? 82  THR A HG1  7  
ATOM 11482 H HG21 . THR A 1 82  ? -9.312  -6.337  9.627   1.00 0.00 ? 82  THR A HG21 7  
ATOM 11483 H HG22 . THR A 1 82  ? -10.664 -7.468  9.675   1.00 0.00 ? 82  THR A HG22 7  
ATOM 11484 H HG23 . THR A 1 82  ? -9.606  -7.300  11.075  1.00 0.00 ? 82  THR A HG23 7  
ATOM 11485 N N    . GLU A 1 83  ? -7.934  -5.008  11.275  1.00 0.00 ? 83  GLU A N    7  
ATOM 11486 C CA   . GLU A 1 83  ? -6.673  -4.491  10.754  1.00 0.00 ? 83  GLU A CA   7  
ATOM 11487 C C    . GLU A 1 83  ? -6.546  -4.773  9.260   1.00 0.00 ? 83  GLU A C    7  
ATOM 11488 O O    . GLU A 1 83  ? -7.075  -5.765  8.757   1.00 0.00 ? 83  GLU A O    7  
ATOM 11489 C CB   . GLU A 1 83  ? -5.493  -5.113  11.504  1.00 0.00 ? 83  GLU A CB   7  
ATOM 11490 C CG   . GLU A 1 83  ? -4.274  -4.209  11.576  1.00 0.00 ? 83  GLU A CG   7  
ATOM 11491 C CD   . GLU A 1 83  ? -3.170  -4.786  12.442  1.00 0.00 ? 83  GLU A CD   7  
ATOM 11492 O OE1  . GLU A 1 83  ? -2.413  -5.645  11.945  1.00 0.00 ? 83  GLU A OE1  7  
ATOM 11493 O OE2  . GLU A 1 83  ? -3.064  -4.376  13.617  1.00 0.00 ? 83  GLU A OE2  7  
ATOM 11494 H H    . GLU A 1 83  ? -7.986  -5.944  11.561  1.00 0.00 ? 83  GLU A H    7  
ATOM 11495 H HA   . GLU A 1 83  ? -6.664  -3.423  10.909  1.00 0.00 ? 83  GLU A HA   7  
ATOM 11496 H HB2  . GLU A 1 83  ? -5.804  -5.344  12.513  1.00 0.00 ? 83  GLU A HB2  7  
ATOM 11497 H HB3  . GLU A 1 83  ? -5.208  -6.028  11.007  1.00 0.00 ? 83  GLU A HB3  7  
ATOM 11498 H HG2  . GLU A 1 83  ? -3.889  -4.066  10.577  1.00 0.00 ? 83  GLU A HG2  7  
ATOM 11499 H HG3  . GLU A 1 83  ? -4.572  -3.255  11.985  1.00 0.00 ? 83  GLU A HG3  7  
ATOM 11500 N N    . TYR A 1 84  ? -5.840  -3.895  8.557   1.00 0.00 ? 84  TYR A N    7  
ATOM 11501 C CA   . TYR A 1 84  ? -5.645  -4.046  7.120   1.00 0.00 ? 84  TYR A CA   7  
ATOM 11502 C C    . TYR A 1 84  ? -4.268  -3.541  6.701   1.00 0.00 ? 84  TYR A C    7  
ATOM 11503 O O    . TYR A 1 84  ? -3.852  -2.447  7.084   1.00 0.00 ? 84  TYR A O    7  
ATOM 11504 C CB   . TYR A 1 84  ? -6.732  -3.291  6.353   1.00 0.00 ? 84  TYR A CB   7  
ATOM 11505 C CG   . TYR A 1 84  ? -8.080  -3.976  6.383   1.00 0.00 ? 84  TYR A CG   7  
ATOM 11506 C CD1  . TYR A 1 84  ? -8.384  -4.994  5.487   1.00 0.00 ? 84  TYR A CD1  7  
ATOM 11507 C CD2  . TYR A 1 84  ? -9.050  -3.605  7.306   1.00 0.00 ? 84  TYR A CD2  7  
ATOM 11508 C CE1  . TYR A 1 84  ? -9.614  -5.622  5.510   1.00 0.00 ? 84  TYR A CE1  7  
ATOM 11509 C CE2  . TYR A 1 84  ? -10.282 -4.229  7.337   1.00 0.00 ? 84  TYR A CE2  7  
ATOM 11510 C CZ   . TYR A 1 84  ? -10.560 -5.236  6.437   1.00 0.00 ? 84  TYR A CZ   7  
ATOM 11511 O OH   . TYR A 1 84  ? -11.786 -5.860  6.463   1.00 0.00 ? 84  TYR A OH   7  
ATOM 11512 H H    . TYR A 1 84  ? -5.443  -3.124  9.014   1.00 0.00 ? 84  TYR A H    7  
ATOM 11513 H HA   . TYR A 1 84  ? -5.717  -5.098  6.884   1.00 0.00 ? 84  TYR A HA   7  
ATOM 11514 H HB2  . TYR A 1 84  ? -6.851  -2.309  6.784   1.00 0.00 ? 84  TYR A HB2  7  
ATOM 11515 H HB3  . TYR A 1 84  ? -6.432  -3.192  5.320   1.00 0.00 ? 84  TYR A HB3  7  
ATOM 11516 H HD1  . TYR A 1 84  ? -7.640  -5.295  4.763   1.00 0.00 ? 84  TYR A HD1  7  
ATOM 11517 H HD2  . TYR A 1 84  ? -8.829  -2.816  8.010   1.00 0.00 ? 84  TYR A HD2  7  
ATOM 11518 H HE1  . TYR A 1 84  ? -9.831  -6.411  4.805   1.00 0.00 ? 84  TYR A HE1  7  
ATOM 11519 H HE2  . TYR A 1 84  ? -11.023 -3.927  8.062   1.00 0.00 ? 84  TYR A HE2  7  
ATOM 11520 H HH   . TYR A 1 84  ? -11.780 -6.603  5.856   1.00 0.00 ? 84  TYR A HH   7  
ATOM 11521 N N    . SER A 1 85  ? -3.564  -4.346  5.911   1.00 0.00 ? 85  SER A N    7  
ATOM 11522 C CA   . SER A 1 85  ? -2.232  -3.983  5.441   1.00 0.00 ? 85  SER A CA   7  
ATOM 11523 C C    . SER A 1 85  ? -2.316  -3.095  4.204   1.00 0.00 ? 85  SER A C    7  
ATOM 11524 O O    . SER A 1 85  ? -3.275  -3.169  3.436   1.00 0.00 ? 85  SER A O    7  
ATOM 11525 C CB   . SER A 1 85  ? -1.420  -5.241  5.126   1.00 0.00 ? 85  SER A CB   7  
ATOM 11526 O OG   . SER A 1 85  ? -0.039  -5.028  5.362   1.00 0.00 ? 85  SER A OG   7  
ATOM 11527 H H    . SER A 1 85  ? -3.950  -5.205  5.640   1.00 0.00 ? 85  SER A H    7  
ATOM 11528 H HA   . SER A 1 85  ? -1.740  -3.436  6.231   1.00 0.00 ? 85  SER A HA   7  
ATOM 11529 H HB2  . SER A 1 85  ? -1.759  -6.052  5.752   1.00 0.00 ? 85  SER A HB2  7  
ATOM 11530 H HB3  . SER A 1 85  ? -1.559  -5.505  4.087   1.00 0.00 ? 85  SER A HB3  7  
ATOM 11531 H HG   . SER A 1 85  ? 0.453   -5.188  4.554   1.00 0.00 ? 85  SER A HG   7  
ATOM 11532 N N    . PHE A 1 86  ? -1.303  -2.254  4.018   1.00 0.00 ? 86  PHE A N    7  
ATOM 11533 C CA   . PHE A 1 86  ? -1.261  -1.349  2.875   1.00 0.00 ? 86  PHE A CA   7  
ATOM 11534 C C    . PHE A 1 86  ? 0.176   -1.117  2.418   1.00 0.00 ? 86  PHE A C    7  
ATOM 11535 O O    . PHE A 1 86  ? 1.066   -0.877  3.233   1.00 0.00 ? 86  PHE A O    7  
ATOM 11536 C CB   . PHE A 1 86  ? -1.918  -0.014  3.230   1.00 0.00 ? 86  PHE A CB   7  
ATOM 11537 C CG   . PHE A 1 86  ? -3.391  -0.124  3.504   1.00 0.00 ? 86  PHE A CG   7  
ATOM 11538 C CD1  . PHE A 1 86  ? -4.292  -0.288  2.464   1.00 0.00 ? 86  PHE A CD1  7  
ATOM 11539 C CD2  . PHE A 1 86  ? -3.874  -0.064  4.801   1.00 0.00 ? 86  PHE A CD2  7  
ATOM 11540 C CE1  . PHE A 1 86  ? -5.648  -0.389  2.713   1.00 0.00 ? 86  PHE A CE1  7  
ATOM 11541 C CE2  . PHE A 1 86  ? -5.229  -0.165  5.056   1.00 0.00 ? 86  PHE A CE2  7  
ATOM 11542 C CZ   . PHE A 1 86  ? -6.117  -0.328  4.011   1.00 0.00 ? 86  PHE A CZ   7  
ATOM 11543 H H    . PHE A 1 86  ? -0.567  -2.242  4.665   1.00 0.00 ? 86  PHE A H    7  
ATOM 11544 H HA   . PHE A 1 86  ? -1.813  -1.809  2.069   1.00 0.00 ? 86  PHE A HA   7  
ATOM 11545 H HB2  . PHE A 1 86  ? -1.446  0.387   4.114   1.00 0.00 ? 86  PHE A HB2  7  
ATOM 11546 H HB3  . PHE A 1 86  ? -1.782  0.675   2.410   1.00 0.00 ? 86  PHE A HB3  7  
ATOM 11547 H HD1  . PHE A 1 86  ? -3.927  -0.336  1.448   1.00 0.00 ? 86  PHE A HD1  7  
ATOM 11548 H HD2  . PHE A 1 86  ? -3.180  0.064   5.620   1.00 0.00 ? 86  PHE A HD2  7  
ATOM 11549 H HE1  . PHE A 1 86  ? -6.339  -0.517  1.894   1.00 0.00 ? 86  PHE A HE1  7  
ATOM 11550 H HE2  . PHE A 1 86  ? -5.592  -0.117  6.072   1.00 0.00 ? 86  PHE A HE2  7  
ATOM 11551 H HZ   . PHE A 1 86  ? -7.175  -0.407  4.208   1.00 0.00 ? 86  PHE A HZ   7  
ATOM 11552 N N    . ARG A 1 87  ? 0.393   -1.190  1.109   1.00 0.00 ? 87  ARG A N    7  
ATOM 11553 C CA   . ARG A 1 87  ? 1.722   -0.989  0.543   1.00 0.00 ? 87  ARG A CA   7  
ATOM 11554 C C    . ARG A 1 87  ? 1.630   -0.422  -0.871  1.00 0.00 ? 87  ARG A C    7  
ATOM 11555 O O    . ARG A 1 87  ? 0.954   -