data_1X5Z
# 
_entry.id   1X5Z 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1X5Z         
RCSB  RCSB024421   
WWPDB D_1000024421 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hso002001101.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1X5Z 
_pdbx_database_status.recvd_initial_deposition_date   2005-05-17 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yoneyama, M.'                                           1 
'Saito, K.'                                              2 
'Tochio, N.'                                             3 
'Koshiba, S.'                                            4 
'Inoue, M.'                                              5 
'Kigawa, T.'                                             6 
'Yokoyama, S.'                                           7 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 
# 
_citation.id                        primary 
_citation.title                     
'Solution structure of the fibronectin type-III domain of human protein tyrosine phosphatase, receptor type, D isoform 4 variant' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yoneyama, M.' 1 
primary 'Saito, K.'    2 
primary 'Tochio, N.'   3 
primary 'Koshiba, S.'  4 
primary 'Inoue, M.'    5 
primary 'Kigawa, T.'   6 
primary 'Yokoyama, S.' 7 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Receptor-type tyrosine-protein phosphatase delta' 
_entity.formula_weight             12272.406 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    3.1.3.48 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'Fibronectin type-III domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Protein-tyrosine phosphatase delta, R-PTP-delta, Protein tyrosine phosphatase, receptor type, D isoform 4' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGDIQVITQTGVPGQPLNFKAEPESETSILLSWTPPRSDTIANYELVYKDGEHGEEQRITIEPGTSYRLQGLKPN
SLYYFRLAARSPQGLGASTAEISARTMQSSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGDIQVITQTGVPGQPLNFKAEPESETSILLSWTPPRSDTIANYELVYKDGEHGEEQRITIEPGTSYRLQGLKPN
SLYYFRLAARSPQGLGASTAEISARTMQSSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hso002001101.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   ASP n 
1 9   ILE n 
1 10  GLN n 
1 11  VAL n 
1 12  ILE n 
1 13  THR n 
1 14  GLN n 
1 15  THR n 
1 16  GLY n 
1 17  VAL n 
1 18  PRO n 
1 19  GLY n 
1 20  GLN n 
1 21  PRO n 
1 22  LEU n 
1 23  ASN n 
1 24  PHE n 
1 25  LYS n 
1 26  ALA n 
1 27  GLU n 
1 28  PRO n 
1 29  GLU n 
1 30  SER n 
1 31  GLU n 
1 32  THR n 
1 33  SER n 
1 34  ILE n 
1 35  LEU n 
1 36  LEU n 
1 37  SER n 
1 38  TRP n 
1 39  THR n 
1 40  PRO n 
1 41  PRO n 
1 42  ARG n 
1 43  SER n 
1 44  ASP n 
1 45  THR n 
1 46  ILE n 
1 47  ALA n 
1 48  ASN n 
1 49  TYR n 
1 50  GLU n 
1 51  LEU n 
1 52  VAL n 
1 53  TYR n 
1 54  LYS n 
1 55  ASP n 
1 56  GLY n 
1 57  GLU n 
1 58  HIS n 
1 59  GLY n 
1 60  GLU n 
1 61  GLU n 
1 62  GLN n 
1 63  ARG n 
1 64  ILE n 
1 65  THR n 
1 66  ILE n 
1 67  GLU n 
1 68  PRO n 
1 69  GLY n 
1 70  THR n 
1 71  SER n 
1 72  TYR n 
1 73  ARG n 
1 74  LEU n 
1 75  GLN n 
1 76  GLY n 
1 77  LEU n 
1 78  LYS n 
1 79  PRO n 
1 80  ASN n 
1 81  SER n 
1 82  LEU n 
1 83  TYR n 
1 84  TYR n 
1 85  PHE n 
1 86  ARG n 
1 87  LEU n 
1 88  ALA n 
1 89  ALA n 
1 90  ARG n 
1 91  SER n 
1 92  PRO n 
1 93  GLN n 
1 94  GLY n 
1 95  LEU n 
1 96  GLY n 
1 97  ALA n 
1 98  SER n 
1 99  THR n 
1 100 ALA n 
1 101 GLU n 
1 102 ILE n 
1 103 SER n 
1 104 ALA n 
1 105 ARG n 
1 106 THR n 
1 107 MET n 
1 108 GLN n 
1 109 SER n 
1 110 SER n 
1 111 GLY n 
1 112 PRO n 
1 113 SER n 
1 114 SER n 
1 115 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 PTPRD 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P050131-05 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PTPRD_HUMAN 
_struct_ref.pdbx_db_accession          P23468 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DIQVITQTGVPGQPLNFKAEPESETSILLSWTPPRSDTIANYELVYKDGEHGEEQRITIEPGTSYRLQGLKPNSLYYFRL
AARSPQGLGASTAEISARTMQS
;
_struct_ref.pdbx_align_begin           506 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1X5Z 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 109 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P23468 
_struct_ref_seq.db_align_beg                  506 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  607 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       109 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1X5Z GLY A 1   ? UNP P23468 ? ? 'CLONING ARTIFACT' 1   1  
1 1X5Z SER A 2   ? UNP P23468 ? ? 'CLONING ARTIFACT' 2   2  
1 1X5Z SER A 3   ? UNP P23468 ? ? 'CLONING ARTIFACT' 3   3  
1 1X5Z GLY A 4   ? UNP P23468 ? ? 'CLONING ARTIFACT' 4   4  
1 1X5Z SER A 5   ? UNP P23468 ? ? 'CLONING ARTIFACT' 5   5  
1 1X5Z SER A 6   ? UNP P23468 ? ? 'CLONING ARTIFACT' 6   6  
1 1X5Z GLY A 7   ? UNP P23468 ? ? 'CLONING ARTIFACT' 7   7  
1 1X5Z SER A 110 ? UNP P23468 ? ? 'CLONING ARTIFACT' 110 8  
1 1X5Z GLY A 111 ? UNP P23468 ? ? 'CLONING ARTIFACT' 111 9  
1 1X5Z PRO A 112 ? UNP P23468 ? ? 'CLONING ARTIFACT' 112 10 
1 1X5Z SER A 113 ? UNP P23468 ? ? 'CLONING ARTIFACT' 113 11 
1 1X5Z SER A 114 ? UNP P23468 ? ? 'CLONING ARTIFACT' 114 12 
1 1X5Z GLY A 115 ? UNP P23468 ? ? 'CLONING ARTIFACT' 115 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.37mM fn3 domain U-15N, 13C; 20mM d-Tris-HCl (pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           1X5Z 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1X5Z 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'target function,structures with the lowest energy,structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1X5Z 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XWINNMR 2.6      Bruker           1 
processing           NMRPipe 20020425 'Delaglio, F.'   2 
'data analysis'      NMRview 5.0.4    'Johnson, B. A.' 3 
'data analysis'      Kujira  0.9295   'Kobayashi, N.'  4 
'structure solution' CYANA   2.0.17   'Guntert, P.'    5 
refinement           CYANA   2.0.17   'Guntert, P.'    6 
# 
_exptl.entry_id          1X5Z 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1X5Z 
_struct.title                     
'Solution structure of the fibronectin type-III domain of human protein tyrosine phosphatase, receptor type, D isoform 4 variant' 
_struct.pdbx_descriptor           'Receptor-type tyrosine-protein phosphatase delta (E.C.3.1.3.48)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1X5Z 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;Fibronectin type III domain containing protein, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
C ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 22  ? GLU A 27  ? LEU A 22  GLU A 27  
A 2 SER A 33  ? THR A 39  ? SER A 33  THR A 39  
A 3 SER A 71  ? GLN A 75  ? SER A 71  GLN A 75  
B 1 THR A 65  ? ILE A 66  ? THR A 65  ILE A 66  
B 2 ASN A 48  ? LEU A 51  ? ASN A 48  LEU A 51  
B 3 LEU A 87  ? ARG A 90  ? LEU A 87  ARG A 90  
B 4 LEU A 95  ? SER A 98  ? LEU A 95  SER A 98  
C 1 LYS A 54  ? ASP A 55  ? LYS A 54  ASP A 55  
C 2 LEU A 82  ? PHE A 85  ? LEU A 82  PHE A 85  
C 3 ILE A 102 ? ARG A 105 ? ILE A 102 ARG A 105 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LYS A 25 ? N LYS A 25 O SER A 37  ? O SER A 37  
A 2 3 N ILE A 34 ? N ILE A 34 O LEU A 74  ? O LEU A 74  
B 1 2 O ILE A 66 ? O ILE A 66 N TYR A 49  ? N TYR A 49  
B 2 3 N ASN A 48 ? N ASN A 48 O ARG A 90  ? O ARG A 90  
B 3 4 N ALA A 89 ? N ALA A 89 O GLY A 96  ? O GLY A 96  
C 1 2 N LYS A 54 ? N LYS A 54 O TYR A 84  ? O TYR A 84  
C 2 3 N PHE A 85 ? N PHE A 85 O ILE A 102 ? O ILE A 102 
# 
_database_PDB_matrix.entry_id          1X5Z 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1X5Z 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? 10.779  -6.731  39.344  1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? 10.540  -6.392  40.735  1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? 9.715   -5.129  40.890  1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? 8.490   -5.189  40.990  1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? 11.281  -6.114  38.771  1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? 10.019  -7.210  41.209  1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? 11.491  -6.249  41.227  1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? 10.388  -3.983  40.911  1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? 9.710   -2.701  41.061  1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? 10.165  -1.718  39.987  1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? 9.348   -1.160  39.255  1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? 9.978   -2.118  42.450  1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? 9.143   -1.001  42.703  1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? 11.365  -4.001  40.827  1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? 8.650   -2.872  40.950  1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? 9.787   -2.872  43.197  1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? 11.009  -1.802  42.512  1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? 8.960   -0.544  41.879  1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? 11.475  -1.510  39.901  1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? 12.040  -0.591  38.920  1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? 11.448  -0.842  37.536  1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? 11.627  -1.913  36.957  1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? 13.562  -0.736  38.870  1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? 14.181  0.024   39.894  1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? 12.075  -1.984  40.513  1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? 11.793  0.415   39.227  1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? 13.826  -1.775  39.000  1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? 13.923  -0.390  37.913  1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? 14.096  -0.437  40.731  1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? 10.742  0.155   37.011  1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? 10.134  0.023   35.700  1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? 10.672  1.034   34.707  1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? 11.193  2.079   35.096  1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? 10.632  0.986   37.519  1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? 10.325  -0.972  35.325  1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? 9.067   0.162   35.795  1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? 10.547  0.722   33.421  1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? 11.031  1.609   32.370  1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? 9.874   2.117   31.513  1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? 9.697   3.323   31.341  1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? 12.051  0.884   31.490  1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? 11.478  -0.260  30.881  1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? 10.123  -0.126  33.174  1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? 11.511  2.453   32.842  1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? 12.397  1.554   30.717  1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? 12.889  0.573   32.098  1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? 12.160  -0.751  30.417  1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? 9.090   1.187   30.978  1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? 7.952   1.538   30.136  1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? 8.391   2.418   28.970  1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? 7.716   3.385   28.619  1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? 6.884   2.259   30.961  1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? 6.079   1.336   31.672  1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? 9.282   0.241   31.152  1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? 7.535   0.623   29.744  1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? 7.363   2.919   31.668  1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? 6.253   2.836   30.300  1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? 5.167   1.418   31.384  1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? 9.528   2.074   28.372  1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? 10.039  2.842   27.252  1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? 9.693   2.217   25.915  1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? 10.331  1.254   25.489  1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? 10.024  1.293   28.695  1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? 9.621   3.837   27.291  1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? 11.114  2.910   27.337  1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . ASP A 1 8   ? 8.680   2.764   25.253  1.00 0.00 ? 8   ASP A N    1  
ATOM 67    C CA   . ASP A 1 8   ? 8.249   2.254   23.956  1.00 0.00 ? 8   ASP A CA   1  
ATOM 68    C C    . ASP A 1 8   ? 8.869   3.063   22.821  1.00 0.00 ? 8   ASP A C    1  
ATOM 69    O O    . ASP A 1 8   ? 9.158   4.249   22.977  1.00 0.00 ? 8   ASP A O    1  
ATOM 70    C CB   . ASP A 1 8   ? 6.724   2.289   23.851  1.00 0.00 ? 8   ASP A CB   1  
ATOM 71    C CG   . ASP A 1 8   ? 6.158   3.674   24.097  1.00 0.00 ? 8   ASP A CG   1  
ATOM 72    O OD1  . ASP A 1 8   ? 6.292   4.537   23.204  1.00 0.00 ? 8   ASP A OD1  1  
ATOM 73    O OD2  . ASP A 1 8   ? 5.582   3.895   25.182  1.00 0.00 ? 8   ASP A OD2  1  
ATOM 74    H H    . ASP A 1 8   ? 8.210   3.530   25.645  1.00 0.00 ? 8   ASP A H    1  
ATOM 75    H HA   . ASP A 1 8   ? 8.583   1.230   23.875  1.00 0.00 ? 8   ASP A HA   1  
ATOM 76    H HB2  . ASP A 1 8   ? 6.430   1.971   22.861  1.00 0.00 ? 8   ASP A HB2  1  
ATOM 77    H HB3  . ASP A 1 8   ? 6.303   1.613   24.581  1.00 0.00 ? 8   ASP A HB3  1  
ATOM 78    N N    . ILE A 1 9   ? 9.070   2.413   21.679  1.00 0.00 ? 9   ILE A N    1  
ATOM 79    C CA   . ILE A 1 9   ? 9.654   3.072   20.518  1.00 0.00 ? 9   ILE A CA   1  
ATOM 80    C C    . ILE A 1 9   ? 8.712   4.130   19.954  1.00 0.00 ? 9   ILE A C    1  
ATOM 81    O O    . ILE A 1 9   ? 7.541   3.856   19.694  1.00 0.00 ? 9   ILE A O    1  
ATOM 82    C CB   . ILE A 1 9   ? 9.995   2.060   19.409  1.00 0.00 ? 9   ILE A CB   1  
ATOM 83    C CG1  . ILE A 1 9   ? 10.676  2.767   18.235  1.00 0.00 ? 9   ILE A CG1  1  
ATOM 84    C CG2  . ILE A 1 9   ? 8.738   1.341   18.943  1.00 0.00 ? 9   ILE A CG2  1  
ATOM 85    C CD1  . ILE A 1 9   ? 12.179  2.866   18.378  1.00 0.00 ? 9   ILE A CD1  1  
ATOM 86    H H    . ILE A 1 9   ? 8.818   1.468   21.616  1.00 0.00 ? 9   ILE A H    1  
ATOM 87    H HA   . ILE A 1 9   ? 10.570  3.552   20.834  1.00 0.00 ? 9   ILE A HA   1  
ATOM 88    H HB   . ILE A 1 9   ? 10.671  1.325   19.818  1.00 0.00 ? 9   ILE A HB   1  
ATOM 89    H HG12 . ILE A 1 9   ? 10.465  2.227   17.326  1.00 0.00 ? 9   ILE A HG12 1  
ATOM 90    H HG13 . ILE A 1 9   ? 10.283  3.770   18.152  1.00 0.00 ? 9   ILE A HG13 1  
ATOM 91    H HG21 . ILE A 1 9   ? 9.005   0.569   18.236  1.00 0.00 ? 9   ILE A HG21 1  
ATOM 92    H HG22 . ILE A 1 9   ? 8.245   0.893   19.793  1.00 0.00 ? 9   ILE A HG22 1  
ATOM 93    H HG23 . ILE A 1 9   ? 8.072   2.047   18.471  1.00 0.00 ? 9   ILE A HG23 1  
ATOM 94    H HD11 . ILE A 1 9   ? 12.497  3.872   18.148  1.00 0.00 ? 9   ILE A HD11 1  
ATOM 95    H HD12 . ILE A 1 9   ? 12.461  2.621   19.391  1.00 0.00 ? 9   ILE A HD12 1  
ATOM 96    H HD13 . ILE A 1 9   ? 12.651  2.175   17.696  1.00 0.00 ? 9   ILE A HD13 1  
ATOM 97    N N    . GLN A 1 10  ? 9.233   5.339   19.767  1.00 0.00 ? 10  GLN A N    1  
ATOM 98    C CA   . GLN A 1 10  ? 8.438   6.438   19.232  1.00 0.00 ? 10  GLN A CA   1  
ATOM 99    C C    . GLN A 1 10  ? 8.197   6.258   17.737  1.00 0.00 ? 10  GLN A C    1  
ATOM 100   O O    . GLN A 1 10  ? 8.942   6.784   16.910  1.00 0.00 ? 10  GLN A O    1  
ATOM 101   C CB   . GLN A 1 10  ? 9.136   7.774   19.492  1.00 0.00 ? 10  GLN A CB   1  
ATOM 102   C CG   . GLN A 1 10  ? 9.162   8.172   20.959  1.00 0.00 ? 10  GLN A CG   1  
ATOM 103   C CD   . GLN A 1 10  ? 9.608   9.606   21.166  1.00 0.00 ? 10  GLN A CD   1  
ATOM 104   O OE1  . GLN A 1 10  ? 10.795  9.918   21.076  1.00 0.00 ? 10  GLN A OE1  1  
ATOM 105   N NE2  . GLN A 1 10  ? 8.655   10.488  21.446  1.00 0.00 ? 10  GLN A NE2  1  
ATOM 106   H H    . GLN A 1 10  ? 10.173  5.495   19.994  1.00 0.00 ? 10  GLN A H    1  
ATOM 107   H HA   . GLN A 1 10  ? 7.485   6.435   19.741  1.00 0.00 ? 10  GLN A HA   1  
ATOM 108   H HB2  . GLN A 1 10  ? 10.155  7.708   19.140  1.00 0.00 ? 10  GLN A HB2  1  
ATOM 109   H HB3  . GLN A 1 10  ? 8.623   8.548   18.940  1.00 0.00 ? 10  GLN A HB3  1  
ATOM 110   H HG2  . GLN A 1 10  ? 8.169   8.057   21.367  1.00 0.00 ? 10  GLN A HG2  1  
ATOM 111   H HG3  . GLN A 1 10  ? 9.844   7.519   21.483  1.00 0.00 ? 10  GLN A HG3  1  
ATOM 112   H HE21 . GLN A 1 10  ? 7.730   10.166  21.503  1.00 0.00 ? 10  GLN A HE21 1  
ATOM 113   H HE22 . GLN A 1 10  ? 8.915   11.421  21.586  1.00 0.00 ? 10  GLN A HE22 1  
ATOM 114   N N    . VAL A 1 11  ? 7.150   5.512   17.397  1.00 0.00 ? 11  VAL A N    1  
ATOM 115   C CA   . VAL A 1 11  ? 6.810   5.264   16.001  1.00 0.00 ? 11  VAL A CA   1  
ATOM 116   C C    . VAL A 1 11  ? 6.787   6.562   15.201  1.00 0.00 ? 11  VAL A C    1  
ATOM 117   O O    . VAL A 1 11  ? 6.373   7.606   15.706  1.00 0.00 ? 11  VAL A O    1  
ATOM 118   C CB   . VAL A 1 11  ? 5.442   4.570   15.871  1.00 0.00 ? 11  VAL A CB   1  
ATOM 119   C CG1  . VAL A 1 11  ? 5.110   4.310   14.410  1.00 0.00 ? 11  VAL A CG1  1  
ATOM 120   C CG2  . VAL A 1 11  ? 5.424   3.274   16.669  1.00 0.00 ? 11  VAL A CG2  1  
ATOM 121   H H    . VAL A 1 11  ? 6.593   5.120   18.101  1.00 0.00 ? 11  VAL A H    1  
ATOM 122   H HA   . VAL A 1 11  ? 7.563   4.609   15.585  1.00 0.00 ? 11  VAL A HA   1  
ATOM 123   H HB   . VAL A 1 11  ? 4.687   5.228   16.277  1.00 0.00 ? 11  VAL A HB   1  
ATOM 124   H HG11 . VAL A 1 11  ? 4.206   4.839   14.147  1.00 0.00 ? 11  VAL A HG11 1  
ATOM 125   H HG12 . VAL A 1 11  ? 5.924   4.655   13.789  1.00 0.00 ? 11  VAL A HG12 1  
ATOM 126   H HG13 . VAL A 1 11  ? 4.964   3.251   14.257  1.00 0.00 ? 11  VAL A HG13 1  
ATOM 127   H HG21 . VAL A 1 11  ? 6.430   2.892   16.755  1.00 0.00 ? 11  VAL A HG21 1  
ATOM 128   H HG22 . VAL A 1 11  ? 5.025   3.463   17.655  1.00 0.00 ? 11  VAL A HG22 1  
ATOM 129   H HG23 . VAL A 1 11  ? 4.805   2.548   16.164  1.00 0.00 ? 11  VAL A HG23 1  
ATOM 130   N N    . ILE A 1 12  ? 7.235   6.489   13.952  1.00 0.00 ? 12  ILE A N    1  
ATOM 131   C CA   . ILE A 1 12  ? 7.265   7.658   13.082  1.00 0.00 ? 12  ILE A CA   1  
ATOM 132   C C    . ILE A 1 12  ? 6.030   7.709   12.189  1.00 0.00 ? 12  ILE A C    1  
ATOM 133   O O    . ILE A 1 12  ? 5.836   6.852   11.327  1.00 0.00 ? 12  ILE A O    1  
ATOM 134   C CB   . ILE A 1 12  ? 8.525   7.670   12.198  1.00 0.00 ? 12  ILE A CB   1  
ATOM 135   C CG1  . ILE A 1 12  ? 9.785   7.663   13.066  1.00 0.00 ? 12  ILE A CG1  1  
ATOM 136   C CG2  . ILE A 1 12  ? 8.515   8.882   11.278  1.00 0.00 ? 12  ILE A CG2  1  
ATOM 137   C CD1  . ILE A 1 12  ? 11.017  7.170   12.341  1.00 0.00 ? 12  ILE A CD1  1  
ATOM 138   H H    . ILE A 1 12  ? 7.553   5.628   13.608  1.00 0.00 ? 12  ILE A H    1  
ATOM 139   H HA   . ILE A 1 12  ? 7.280   8.538   13.709  1.00 0.00 ? 12  ILE A HA   1  
ATOM 140   H HB   . ILE A 1 12  ? 8.515   6.782   11.584  1.00 0.00 ? 12  ILE A HB   1  
ATOM 141   H HG12 . ILE A 1 12  ? 9.982   8.666   13.410  1.00 0.00 ? 12  ILE A HG12 1  
ATOM 142   H HG13 . ILE A 1 12  ? 9.621   7.020   13.919  1.00 0.00 ? 12  ILE A HG13 1  
ATOM 143   H HG21 . ILE A 1 12  ? 9.520   9.267   11.180  1.00 0.00 ? 12  ILE A HG21 1  
ATOM 144   H HG22 . ILE A 1 12  ? 8.144   8.593   10.307  1.00 0.00 ? 12  ILE A HG22 1  
ATOM 145   H HG23 . ILE A 1 12  ? 7.877   9.646   11.696  1.00 0.00 ? 12  ILE A HG23 1  
ATOM 146   H HD11 . ILE A 1 12  ? 10.783  6.255   11.816  1.00 0.00 ? 12  ILE A HD11 1  
ATOM 147   H HD12 . ILE A 1 12  ? 11.343  7.918   11.634  1.00 0.00 ? 12  ILE A HD12 1  
ATOM 148   H HD13 . ILE A 1 12  ? 11.805  6.982   13.056  1.00 0.00 ? 12  ILE A HD13 1  
ATOM 149   N N    . THR A 1 13  ? 5.196   8.723   12.400  1.00 0.00 ? 13  THR A N    1  
ATOM 150   C CA   . THR A 1 13  ? 3.979   8.888   11.614  1.00 0.00 ? 13  THR A CA   1  
ATOM 151   C C    . THR A 1 13  ? 4.241   9.721   10.365  1.00 0.00 ? 13  THR A C    1  
ATOM 152   O O    . THR A 1 13  ? 4.376   10.942  10.440  1.00 0.00 ? 13  THR A O    1  
ATOM 153   C CB   . THR A 1 13  ? 2.864   9.557   12.439  1.00 0.00 ? 13  THR A CB   1  
ATOM 154   O OG1  . THR A 1 13  ? 2.696   8.870   13.684  1.00 0.00 ? 13  THR A OG1  1  
ATOM 155   C CG2  . THR A 1 13  ? 1.550   9.557   11.673  1.00 0.00 ? 13  THR A CG2  1  
ATOM 156   H H    . THR A 1 13  ? 5.404   9.375   13.101  1.00 0.00 ? 13  THR A H    1  
ATOM 157   H HA   . THR A 1 13  ? 3.639   7.907   11.316  1.00 0.00 ? 13  THR A HA   1  
ATOM 158   H HB   . THR A 1 13  ? 3.148   10.581  12.637  1.00 0.00 ? 13  THR A HB   1  
ATOM 159   H HG1  . THR A 1 13  ? 2.670   7.923   13.526  1.00 0.00 ? 13  THR A HG1  1  
ATOM 160   H HG21 . THR A 1 13  ? 1.427   10.503  11.167  1.00 0.00 ? 13  THR A HG21 1  
ATOM 161   H HG22 . THR A 1 13  ? 0.732   9.408   12.362  1.00 0.00 ? 13  THR A HG22 1  
ATOM 162   H HG23 . THR A 1 13  ? 1.558   8.759   10.946  1.00 0.00 ? 13  THR A HG23 1  
ATOM 163   N N    . GLN A 1 14  ? 4.310   9.054   9.217   1.00 0.00 ? 14  GLN A N    1  
ATOM 164   C CA   . GLN A 1 14  ? 4.555   9.734   7.951   1.00 0.00 ? 14  GLN A CA   1  
ATOM 165   C C    . GLN A 1 14  ? 3.374   9.562   7.003   1.00 0.00 ? 14  GLN A C    1  
ATOM 166   O O    . GLN A 1 14  ? 3.376   8.679   6.144   1.00 0.00 ? 14  GLN A O    1  
ATOM 167   C CB   . GLN A 1 14  ? 5.831   9.199   7.299   1.00 0.00 ? 14  GLN A CB   1  
ATOM 168   C CG   . GLN A 1 14  ? 6.170   9.875   5.981   1.00 0.00 ? 14  GLN A CG   1  
ATOM 169   C CD   . GLN A 1 14  ? 6.309   11.379  6.114   1.00 0.00 ? 14  GLN A CD   1  
ATOM 170   O OE1  . GLN A 1 14  ? 5.325   12.115  6.027   1.00 0.00 ? 14  GLN A OE1  1  
ATOM 171   N NE2  . GLN A 1 14  ? 7.534   11.844  6.328   1.00 0.00 ? 14  GLN A NE2  1  
ATOM 172   H H    . GLN A 1 14  ? 4.194   8.081   9.223   1.00 0.00 ? 14  GLN A H    1  
ATOM 173   H HA   . GLN A 1 14  ? 4.683   10.786  8.160   1.00 0.00 ? 14  GLN A HA   1  
ATOM 174   H HB2  . GLN A 1 14  ? 6.658   9.346   7.978   1.00 0.00 ? 14  GLN A HB2  1  
ATOM 175   H HB3  . GLN A 1 14  ? 5.711   8.141   7.116   1.00 0.00 ? 14  GLN A HB3  1  
ATOM 176   H HG2  . GLN A 1 14  ? 7.104   9.474   5.615   1.00 0.00 ? 14  GLN A HG2  1  
ATOM 177   H HG3  . GLN A 1 14  ? 5.385   9.662   5.270   1.00 0.00 ? 14  GLN A HG3  1  
ATOM 178   H HE21 . GLN A 1 14  ? 8.270   11.198  6.385   1.00 0.00 ? 14  GLN A HE21 1  
ATOM 179   H HE22 . GLN A 1 14  ? 7.653   12.811  6.418   1.00 0.00 ? 14  GLN A HE22 1  
ATOM 180   N N    . THR A 1 15  ? 2.363   10.411  7.163   1.00 0.00 ? 15  THR A N    1  
ATOM 181   C CA   . THR A 1 15  ? 1.174   10.351  6.322   1.00 0.00 ? 15  THR A CA   1  
ATOM 182   C C    . THR A 1 15  ? 1.548   10.213  4.850   1.00 0.00 ? 15  THR A C    1  
ATOM 183   O O    . THR A 1 15  ? 2.279   11.039  4.305   1.00 0.00 ? 15  THR A O    1  
ATOM 184   C CB   . THR A 1 15  ? 0.296   11.604  6.501   1.00 0.00 ? 15  THR A CB   1  
ATOM 185   O OG1  . THR A 1 15  ? 1.037   12.777  6.147   1.00 0.00 ? 15  THR A OG1  1  
ATOM 186   C CG2  . THR A 1 15  ? -0.192  11.721  7.937   1.00 0.00 ? 15  THR A CG2  1  
ATOM 187   H H    . THR A 1 15  ? 2.420   11.093  7.864   1.00 0.00 ? 15  THR A H    1  
ATOM 188   H HA   . THR A 1 15  ? 0.598   9.487   6.620   1.00 0.00 ? 15  THR A HA   1  
ATOM 189   H HB   . THR A 1 15  ? -0.562  11.519  5.851   1.00 0.00 ? 15  THR A HB   1  
ATOM 190   H HG1  . THR A 1 15  ? 0.428   13.483  5.919   1.00 0.00 ? 15  THR A HG1  1  
ATOM 191   H HG21 . THR A 1 15  ? 0.468   12.373  8.490   1.00 0.00 ? 15  THR A HG21 1  
ATOM 192   H HG22 . THR A 1 15  ? -0.200  10.744  8.396   1.00 0.00 ? 15  THR A HG22 1  
ATOM 193   H HG23 . THR A 1 15  ? -1.191  12.131  7.945   1.00 0.00 ? 15  THR A HG23 1  
ATOM 194   N N    . GLY A 1 16  ? 1.041   9.163   4.211   1.00 0.00 ? 16  GLY A N    1  
ATOM 195   C CA   . GLY A 1 16  ? 1.332   8.937   2.808   1.00 0.00 ? 16  GLY A CA   1  
ATOM 196   C C    . GLY A 1 16  ? 1.491   7.466   2.479   1.00 0.00 ? 16  GLY A C    1  
ATOM 197   O O    . GLY A 1 16  ? 2.340   7.091   1.670   1.00 0.00 ? 16  GLY A O    1  
ATOM 198   H H    . GLY A 1 16  ? 0.464   8.537   4.697   1.00 0.00 ? 16  GLY A H    1  
ATOM 199   H HA2  . GLY A 1 16  ? 0.527   9.343   2.214   1.00 0.00 ? 16  GLY A HA2  1  
ATOM 200   H HA3  . GLY A 1 16  ? 2.248   9.451   2.555   1.00 0.00 ? 16  GLY A HA3  1  
ATOM 201   N N    . VAL A 1 17  ? 0.673   6.628   3.108   1.00 0.00 ? 17  VAL A N    1  
ATOM 202   C CA   . VAL A 1 17  ? 0.726   5.190   2.879   1.00 0.00 ? 17  VAL A CA   1  
ATOM 203   C C    . VAL A 1 17  ? -0.667  4.619   2.640   1.00 0.00 ? 17  VAL A C    1  
ATOM 204   O O    . VAL A 1 17  ? -1.666  5.117   3.159   1.00 0.00 ? 17  VAL A O    1  
ATOM 205   C CB   . VAL A 1 17  ? 1.373   4.455   4.068   1.00 0.00 ? 17  VAL A CB   1  
ATOM 206   C CG1  . VAL A 1 17  ? 2.777   4.983   4.322   1.00 0.00 ? 17  VAL A CG1  1  
ATOM 207   C CG2  . VAL A 1 17  ? 0.509   4.592   5.312   1.00 0.00 ? 17  VAL A CG2  1  
ATOM 208   H H    . VAL A 1 17  ? 0.017   6.987   3.742   1.00 0.00 ? 17  VAL A H    1  
ATOM 209   H HA   . VAL A 1 17  ? 1.332   5.014   2.001   1.00 0.00 ? 17  VAL A HA   1  
ATOM 210   H HB   . VAL A 1 17  ? 1.447   3.406   3.820   1.00 0.00 ? 17  VAL A HB   1  
ATOM 211   H HG11 . VAL A 1 17  ? 3.350   4.937   3.408   1.00 0.00 ? 17  VAL A HG11 1  
ATOM 212   H HG12 . VAL A 1 17  ? 2.720   6.007   4.662   1.00 0.00 ? 17  VAL A HG12 1  
ATOM 213   H HG13 . VAL A 1 17  ? 3.257   4.379   5.078   1.00 0.00 ? 17  VAL A HG13 1  
ATOM 214   H HG21 . VAL A 1 17  ? 1.071   4.271   6.177   1.00 0.00 ? 17  VAL A HG21 1  
ATOM 215   H HG22 . VAL A 1 17  ? 0.217   5.625   5.436   1.00 0.00 ? 17  VAL A HG22 1  
ATOM 216   H HG23 . VAL A 1 17  ? -0.374  3.979   5.207   1.00 0.00 ? 17  VAL A HG23 1  
ATOM 217   N N    . PRO A 1 18  ? -0.738  3.548   1.835   1.00 0.00 ? 18  PRO A N    1  
ATOM 218   C CA   . PRO A 1 18  ? -2.004  2.885   1.510   1.00 0.00 ? 18  PRO A CA   1  
ATOM 219   C C    . PRO A 1 18  ? -2.596  2.148   2.706   1.00 0.00 ? 18  PRO A C    1  
ATOM 220   O O    . PRO A 1 18  ? -1.899  1.861   3.678   1.00 0.00 ? 18  PRO A O    1  
ATOM 221   C CB   . PRO A 1 18  ? -1.613  1.894   0.411   1.00 0.00 ? 18  PRO A CB   1  
ATOM 222   C CG   . PRO A 1 18  ? -0.166  1.624   0.641   1.00 0.00 ? 18  PRO A CG   1  
ATOM 223   C CD   . PRO A 1 18  ? 0.413   2.902   1.182   1.00 0.00 ? 18  PRO A CD   1  
ATOM 224   H HA   . PRO A 1 18  ? -2.731  3.585   1.124   1.00 0.00 ? 18  PRO A HA   1  
ATOM 225   H HB2  . PRO A 1 18  ? -2.204  0.994   0.507   1.00 0.00 ? 18  PRO A HB2  1  
ATOM 226   H HB3  . PRO A 1 18  ? -1.782  2.340   -0.558  1.00 0.00 ? 18  PRO A HB3  1  
ATOM 227   H HG2  . PRO A 1 18  ? -0.052  0.827   1.360   1.00 0.00 ? 18  PRO A HG2  1  
ATOM 228   H HG3  . PRO A 1 18  ? 0.311   1.361   -0.291  1.00 0.00 ? 18  PRO A HG3  1  
ATOM 229   H HD2  . PRO A 1 18  ? 1.194   2.690   1.897   1.00 0.00 ? 18  PRO A HD2  1  
ATOM 230   H HD3  . PRO A 1 18  ? 0.792   3.514   0.377   1.00 0.00 ? 18  PRO A HD3  1  
ATOM 231   N N    . GLY A 1 19  ? -3.888  1.842   2.627   1.00 0.00 ? 19  GLY A N    1  
ATOM 232   C CA   . GLY A 1 19  ? -4.552  1.140   3.710   1.00 0.00 ? 19  GLY A CA   1  
ATOM 233   C C    . GLY A 1 19  ? -4.694  -0.344  3.437   1.00 0.00 ? 19  GLY A C    1  
ATOM 234   O O    . GLY A 1 19  ? -5.174  -0.743  2.376   1.00 0.00 ? 19  GLY A O    1  
ATOM 235   H H    . GLY A 1 19  ? -4.394  2.096   1.827   1.00 0.00 ? 19  GLY A H    1  
ATOM 236   H HA2  . GLY A 1 19  ? -3.981  1.277   4.616   1.00 0.00 ? 19  GLY A HA2  1  
ATOM 237   H HA3  . GLY A 1 19  ? -5.536  1.565   3.849   1.00 0.00 ? 19  GLY A HA3  1  
ATOM 238   N N    . GLN A 1 20  ? -4.276  -1.163  4.397   1.00 0.00 ? 20  GLN A N    1  
ATOM 239   C CA   . GLN A 1 20  ? -4.357  -2.612  4.253   1.00 0.00 ? 20  GLN A CA   1  
ATOM 240   C C    . GLN A 1 20  ? -5.635  -3.016  3.526   1.00 0.00 ? 20  GLN A C    1  
ATOM 241   O O    . GLN A 1 20  ? -6.690  -2.402  3.686   1.00 0.00 ? 20  GLN A O    1  
ATOM 242   C CB   . GLN A 1 20  ? -4.302  -3.285  5.625   1.00 0.00 ? 20  GLN A CB   1  
ATOM 243   C CG   . GLN A 1 20  ? -5.555  -3.071  6.459   1.00 0.00 ? 20  GLN A CG   1  
ATOM 244   C CD   . GLN A 1 20  ? -5.332  -3.351  7.932   1.00 0.00 ? 20  GLN A CD   1  
ATOM 245   O OE1  . GLN A 1 20  ? -4.764  -2.530  8.653   1.00 0.00 ? 20  GLN A OE1  1  
ATOM 246   N NE2  . GLN A 1 20  ? -5.778  -4.516  8.387   1.00 0.00 ? 20  GLN A NE2  1  
ATOM 247   H H    . GLN A 1 20  ? -3.903  -0.784  5.220   1.00 0.00 ? 20  GLN A H    1  
ATOM 248   H HA   . GLN A 1 20  ? -3.508  -2.935  3.670   1.00 0.00 ? 20  GLN A HA   1  
ATOM 249   H HB2  . GLN A 1 20  ? -4.165  -4.347  5.487   1.00 0.00 ? 20  GLN A HB2  1  
ATOM 250   H HB3  . GLN A 1 20  ? -3.460  -2.890  6.174   1.00 0.00 ? 20  GLN A HB3  1  
ATOM 251   H HG2  . GLN A 1 20  ? -5.875  -2.045  6.348   1.00 0.00 ? 20  GLN A HG2  1  
ATOM 252   H HG3  . GLN A 1 20  ? -6.331  -3.729  6.095   1.00 0.00 ? 20  GLN A HG3  1  
ATOM 253   H HE21 . GLN A 1 20  ? -6.220  -5.121  7.755   1.00 0.00 ? 20  GLN A HE21 1  
ATOM 254   H HE22 . GLN A 1 20  ? -5.646  -4.723  9.335   1.00 0.00 ? 20  GLN A HE22 1  
ATOM 255   N N    . PRO A 1 21  ? -5.541  -4.073  2.706   1.00 0.00 ? 21  PRO A N    1  
ATOM 256   C CA   . PRO A 1 21  ? -6.681  -4.583  1.938   1.00 0.00 ? 21  PRO A CA   1  
ATOM 257   C C    . PRO A 1 21  ? -7.731  -5.241  2.826   1.00 0.00 ? 21  PRO A C    1  
ATOM 258   O O    . PRO A 1 21  ? -7.496  -5.478  4.012   1.00 0.00 ? 21  PRO A O    1  
ATOM 259   C CB   . PRO A 1 21  ? -6.045  -5.617  1.005   1.00 0.00 ? 21  PRO A CB   1  
ATOM 260   C CG   . PRO A 1 21  ? -4.809  -6.055  1.711   1.00 0.00 ? 21  PRO A CG   1  
ATOM 261   C CD   . PRO A 1 21  ? -4.315  -4.853  2.466   1.00 0.00 ? 21  PRO A CD   1  
ATOM 262   H HA   . PRO A 1 21  ? -7.144  -3.803  1.351   1.00 0.00 ? 21  PRO A HA   1  
ATOM 263   H HB2  . PRO A 1 21  ? -6.730  -6.440  0.856   1.00 0.00 ? 21  PRO A HB2  1  
ATOM 264   H HB3  . PRO A 1 21  ? -5.815  -5.157  0.055   1.00 0.00 ? 21  PRO A HB3  1  
ATOM 265   H HG2  . PRO A 1 21  ? -5.042  -6.858  2.394   1.00 0.00 ? 21  PRO A HG2  1  
ATOM 266   H HG3  . PRO A 1 21  ? -4.070  -6.375  0.991   1.00 0.00 ? 21  PRO A HG3  1  
ATOM 267   H HD2  . PRO A 1 21  ? -3.861  -5.153  3.399   1.00 0.00 ? 21  PRO A HD2  1  
ATOM 268   H HD3  . PRO A 1 21  ? -3.614  -4.292  1.866   1.00 0.00 ? 21  PRO A HD3  1  
ATOM 269   N N    . LEU A 1 22  ? -8.889  -5.535  2.246   1.00 0.00 ? 22  LEU A N    1  
ATOM 270   C CA   . LEU A 1 22  ? -9.976  -6.168  2.985   1.00 0.00 ? 22  LEU A CA   1  
ATOM 271   C C    . LEU A 1 22  ? -10.244 -7.575  2.462   1.00 0.00 ? 22  LEU A C    1  
ATOM 272   O O    . LEU A 1 22  ? -9.593  -8.034  1.525   1.00 0.00 ? 22  LEU A O    1  
ATOM 273   C CB   . LEU A 1 22  ? -11.247 -5.323  2.884   1.00 0.00 ? 22  LEU A CB   1  
ATOM 274   C CG   . LEU A 1 22  ? -11.154 -3.901  3.438   1.00 0.00 ? 22  LEU A CG   1  
ATOM 275   C CD1  . LEU A 1 22  ? -12.121 -2.980  2.709   1.00 0.00 ? 22  LEU A CD1  1  
ATOM 276   C CD2  . LEU A 1 22  ? -11.431 -3.892  4.934   1.00 0.00 ? 22  LEU A CD2  1  
ATOM 277   H H    . LEU A 1 22  ? -9.018  -5.323  1.298   1.00 0.00 ? 22  LEU A H    1  
ATOM 278   H HA   . LEU A 1 22  ? -9.678  -6.232  4.021   1.00 0.00 ? 22  LEU A HA   1  
ATOM 279   H HB2  . LEU A 1 22  ? -11.516 -5.254  1.841   1.00 0.00 ? 22  LEU A HB2  1  
ATOM 280   H HB3  . LEU A 1 22  ? -12.030 -5.838  3.423   1.00 0.00 ? 22  LEU A HB3  1  
ATOM 281   H HG   . LEU A 1 22  ? -10.153 -3.525  3.280   1.00 0.00 ? 22  LEU A HG   1  
ATOM 282   H HD11 . LEU A 1 22  ? -13.133 -3.226  2.990   1.00 0.00 ? 22  LEU A HD11 1  
ATOM 283   H HD12 . LEU A 1 22  ? -12.002 -3.104  1.643   1.00 0.00 ? 22  LEU A HD12 1  
ATOM 284   H HD13 . LEU A 1 22  ? -11.911 -1.954  2.977   1.00 0.00 ? 22  LEU A HD13 1  
ATOM 285   H HD21 . LEU A 1 22  ? -11.472 -2.871  5.286   1.00 0.00 ? 22  LEU A HD21 1  
ATOM 286   H HD22 . LEU A 1 22  ? -10.642 -4.419  5.449   1.00 0.00 ? 22  LEU A HD22 1  
ATOM 287   H HD23 . LEU A 1 22  ? -12.376 -4.378  5.128   1.00 0.00 ? 22  LEU A HD23 1  
ATOM 288   N N    . ASN A 1 23  ? -11.209 -8.254  3.074   1.00 0.00 ? 23  ASN A N    1  
ATOM 289   C CA   . ASN A 1 23  ? -11.565 -9.609  2.668   1.00 0.00 ? 23  ASN A CA   1  
ATOM 290   C C    . ASN A 1 23  ? -10.317 -10.425 2.344   1.00 0.00 ? 23  ASN A C    1  
ATOM 291   O O    . ASN A 1 23  ? -10.218 -11.030 1.277   1.00 0.00 ? 23  ASN A O    1  
ATOM 292   C CB   . ASN A 1 23  ? -12.494 -9.573  1.453   1.00 0.00 ? 23  ASN A CB   1  
ATOM 293   C CG   . ASN A 1 23  ? -13.851 -8.980  1.780   1.00 0.00 ? 23  ASN A CG   1  
ATOM 294   O OD1  . ASN A 1 23  ? -14.859 -9.686  1.804   1.00 0.00 ? 23  ASN A OD1  1  
ATOM 295   N ND2  . ASN A 1 23  ? -13.882 -7.677  2.032   1.00 0.00 ? 23  ASN A ND2  1  
ATOM 296   H H    . ASN A 1 23  ? -11.694 -7.835  3.815   1.00 0.00 ? 23  ASN A H    1  
ATOM 297   H HA   . ASN A 1 23  ? -12.083 -10.076 3.492   1.00 0.00 ? 23  ASN A HA   1  
ATOM 298   H HB2  . ASN A 1 23  ? -12.039 -8.975  0.677   1.00 0.00 ? 23  ASN A HB2  1  
ATOM 299   H HB3  . ASN A 1 23  ? -12.639 -10.579 1.088   1.00 0.00 ? 23  ASN A HB3  1  
ATOM 300   H HD21 . ASN A 1 23  ? -13.039 -7.178  1.995   1.00 0.00 ? 23  ASN A HD21 1  
ATOM 301   H HD22 . ASN A 1 23  ? -14.746 -7.268  2.247   1.00 0.00 ? 23  ASN A HD22 1  
ATOM 302   N N    . PHE A 1 24  ? -9.368  -10.438 3.274   1.00 0.00 ? 24  PHE A N    1  
ATOM 303   C CA   . PHE A 1 24  ? -8.126  -11.180 3.088   1.00 0.00 ? 24  PHE A CA   1  
ATOM 304   C C    . PHE A 1 24  ? -8.255  -12.602 3.626   1.00 0.00 ? 24  PHE A C    1  
ATOM 305   O O    . PHE A 1 24  ? -8.472  -12.809 4.820   1.00 0.00 ? 24  PHE A O    1  
ATOM 306   C CB   . PHE A 1 24  ? -6.969  -10.462 3.786   1.00 0.00 ? 24  PHE A CB   1  
ATOM 307   C CG   . PHE A 1 24  ? -5.637  -11.122 3.572   1.00 0.00 ? 24  PHE A CG   1  
ATOM 308   C CD1  . PHE A 1 24  ? -5.263  -11.565 2.314   1.00 0.00 ? 24  PHE A CD1  1  
ATOM 309   C CD2  . PHE A 1 24  ? -4.759  -11.300 4.629   1.00 0.00 ? 24  PHE A CD2  1  
ATOM 310   C CE1  . PHE A 1 24  ? -4.038  -12.173 2.114   1.00 0.00 ? 24  PHE A CE1  1  
ATOM 311   C CE2  . PHE A 1 24  ? -3.533  -11.908 4.436   1.00 0.00 ? 24  PHE A CE2  1  
ATOM 312   C CZ   . PHE A 1 24  ? -3.172  -12.344 3.177   1.00 0.00 ? 24  PHE A CZ   1  
ATOM 313   H H    . PHE A 1 24  ? -9.505  -9.936  4.105   1.00 0.00 ? 24  PHE A H    1  
ATOM 314   H HA   . PHE A 1 24  ? -7.923  -11.225 2.029   1.00 0.00 ? 24  PHE A HA   1  
ATOM 315   H HB2  . PHE A 1 24  ? -6.902  -9.452  3.410   1.00 0.00 ? 24  PHE A HB2  1  
ATOM 316   H HB3  . PHE A 1 24  ? -7.161  -10.434 4.848   1.00 0.00 ? 24  PHE A HB3  1  
ATOM 317   H HD1  . PHE A 1 24  ? -5.938  -11.431 1.482   1.00 0.00 ? 24  PHE A HD1  1  
ATOM 318   H HD2  . PHE A 1 24  ? -5.041  -10.959 5.616   1.00 0.00 ? 24  PHE A HD2  1  
ATOM 319   H HE1  . PHE A 1 24  ? -3.757  -12.513 1.129   1.00 0.00 ? 24  PHE A HE1  1  
ATOM 320   H HE2  . PHE A 1 24  ? -2.858  -12.040 5.269   1.00 0.00 ? 24  PHE A HE2  1  
ATOM 321   H HZ   . PHE A 1 24  ? -2.214  -12.820 3.023   1.00 0.00 ? 24  PHE A HZ   1  
ATOM 322   N N    . LYS A 1 25  ? -8.122  -13.579 2.736   1.00 0.00 ? 25  LYS A N    1  
ATOM 323   C CA   . LYS A 1 25  ? -8.223  -14.982 3.119   1.00 0.00 ? 25  LYS A CA   1  
ATOM 324   C C    . LYS A 1 25  ? -7.265  -15.841 2.299   1.00 0.00 ? 25  LYS A C    1  
ATOM 325   O O    . LYS A 1 25  ? -6.965  -15.524 1.148   1.00 0.00 ? 25  LYS A O    1  
ATOM 326   C CB   . LYS A 1 25  ? -9.658  -15.481 2.934   1.00 0.00 ? 25  LYS A CB   1  
ATOM 327   C CG   . LYS A 1 25  ? -9.962  -15.947 1.521   1.00 0.00 ? 25  LYS A CG   1  
ATOM 328   C CD   . LYS A 1 25  ? -11.450 -15.885 1.221   1.00 0.00 ? 25  LYS A CD   1  
ATOM 329   C CE   . LYS A 1 25  ? -11.869 -14.495 0.767   1.00 0.00 ? 25  LYS A CE   1  
ATOM 330   N NZ   . LYS A 1 25  ? -12.261 -13.631 1.915   1.00 0.00 ? 25  LYS A NZ   1  
ATOM 331   H H    . LYS A 1 25  ? -7.950  -13.351 1.798   1.00 0.00 ? 25  LYS A H    1  
ATOM 332   H HA   . LYS A 1 25  ? -7.955  -15.062 4.162   1.00 0.00 ? 25  LYS A HA   1  
ATOM 333   H HB2  . LYS A 1 25  ? -9.829  -16.307 3.608   1.00 0.00 ? 25  LYS A HB2  1  
ATOM 334   H HB3  . LYS A 1 25  ? -10.339 -14.679 3.180   1.00 0.00 ? 25  LYS A HB3  1  
ATOM 335   H HG2  . LYS A 1 25  ? -9.438  -15.313 0.821   1.00 0.00 ? 25  LYS A HG2  1  
ATOM 336   H HG3  . LYS A 1 25  ? -9.624  -16.968 1.408   1.00 0.00 ? 25  LYS A HG3  1  
ATOM 337   H HD2  . LYS A 1 25  ? -11.681 -16.591 0.438   1.00 0.00 ? 25  LYS A HD2  1  
ATOM 338   H HD3  . LYS A 1 25  ? -12.000 -16.143 2.115   1.00 0.00 ? 25  LYS A HD3  1  
ATOM 339   H HE2  . LYS A 1 25  ? -11.042 -14.035 0.248   1.00 0.00 ? 25  LYS A HE2  1  
ATOM 340   H HE3  . LYS A 1 25  ? -12.709 -14.588 0.095   1.00 0.00 ? 25  LYS A HE3  1  
ATOM 341   H HZ1  . LYS A 1 25  ? -12.124 -14.143 2.810   1.00 0.00 ? 25  LYS A HZ1  1  
ATOM 342   H HZ2  . LYS A 1 25  ? -13.262 -13.360 1.834   1.00 0.00 ? 25  LYS A HZ2  1  
ATOM 343   H HZ3  . LYS A 1 25  ? -11.679 -12.769 1.929   1.00 0.00 ? 25  LYS A HZ3  1  
ATOM 344   N N    . ALA A 1 26  ? -6.791  -16.928 2.898   1.00 0.00 ? 26  ALA A N    1  
ATOM 345   C CA   . ALA A 1 26  ? -5.871  -17.833 2.221   1.00 0.00 ? 26  ALA A CA   1  
ATOM 346   C C    . ALA A 1 26  ? -6.422  -19.255 2.191   1.00 0.00 ? 26  ALA A C    1  
ATOM 347   O O    . ALA A 1 26  ? -6.845  -19.787 3.217   1.00 0.00 ? 26  ALA A O    1  
ATOM 348   C CB   . ALA A 1 26  ? -4.510  -17.807 2.899   1.00 0.00 ? 26  ALA A CB   1  
ATOM 349   H H    . ALA A 1 26  ? -7.068  -17.127 3.816   1.00 0.00 ? 26  ALA A H    1  
ATOM 350   H HA   . ALA A 1 26  ? -5.747  -17.485 1.205   1.00 0.00 ? 26  ALA A HA   1  
ATOM 351   H HB1  . ALA A 1 26  ? -4.642  -17.707 3.967   1.00 0.00 ? 26  ALA A HB1  1  
ATOM 352   H HB2  . ALA A 1 26  ? -3.983  -18.725 2.686   1.00 0.00 ? 26  ALA A HB2  1  
ATOM 353   H HB3  . ALA A 1 26  ? -3.939  -16.969 2.527   1.00 0.00 ? 26  ALA A HB3  1  
ATOM 354   N N    . GLU A 1 27  ? -6.414  -19.863 1.009   1.00 0.00 ? 27  GLU A N    1  
ATOM 355   C CA   . GLU A 1 27  ? -6.915  -21.223 0.847   1.00 0.00 ? 27  GLU A CA   1  
ATOM 356   C C    . GLU A 1 27  ? -5.917  -22.083 0.077   1.00 0.00 ? 27  GLU A C    1  
ATOM 357   O O    . GLU A 1 27  ? -5.330  -21.656 -0.918  1.00 0.00 ? 27  GLU A O    1  
ATOM 358   C CB   . GLU A 1 27  ? -8.262  -21.211 0.122   1.00 0.00 ? 27  GLU A CB   1  
ATOM 359   C CG   . GLU A 1 27  ? -9.351  -20.462 0.871   1.00 0.00 ? 27  GLU A CG   1  
ATOM 360   C CD   . GLU A 1 27  ? -9.989  -21.299 1.963   1.00 0.00 ? 27  GLU A CD   1  
ATOM 361   O OE1  . GLU A 1 27  ? -10.170 -22.515 1.748   1.00 0.00 ? 27  GLU A OE1  1  
ATOM 362   O OE2  . GLU A 1 27  ? -10.307 -20.737 3.032   1.00 0.00 ? 27  GLU A OE2  1  
ATOM 363   H H    . GLU A 1 27  ? -6.064  -19.387 0.228   1.00 0.00 ? 27  GLU A H    1  
ATOM 364   H HA   . GLU A 1 27  ? -7.051  -21.646 1.831   1.00 0.00 ? 27  GLU A HA   1  
ATOM 365   H HB2  . GLU A 1 27  ? -8.133  -20.746 -0.845  1.00 0.00 ? 27  GLU A HB2  1  
ATOM 366   H HB3  . GLU A 1 27  ? -8.589  -22.231 -0.021  1.00 0.00 ? 27  GLU A HB3  1  
ATOM 367   H HG2  . GLU A 1 27  ? -8.919  -19.580 1.320   1.00 0.00 ? 27  GLU A HG2  1  
ATOM 368   H HG3  . GLU A 1 27  ? -10.117 -20.169 0.169   1.00 0.00 ? 27  GLU A HG3  1  
ATOM 369   N N    . PRO A 1 28  ? -5.719  -23.324 0.546   1.00 0.00 ? 28  PRO A N    1  
ATOM 370   C CA   . PRO A 1 28  ? -4.793  -24.269 -0.083  1.00 0.00 ? 28  PRO A CA   1  
ATOM 371   C C    . PRO A 1 28  ? -5.293  -24.756 -1.439  1.00 0.00 ? 28  PRO A C    1  
ATOM 372   O O    . PRO A 1 28  ? -6.031  -25.737 -1.522  1.00 0.00 ? 28  PRO A O    1  
ATOM 373   C CB   . PRO A 1 28  ? -4.738  -25.429 0.914   1.00 0.00 ? 28  PRO A CB   1  
ATOM 374   C CG   . PRO A 1 28  ? -6.032  -25.359 1.649   1.00 0.00 ? 28  PRO A CG   1  
ATOM 375   C CD   . PRO A 1 28  ? -6.385  -23.899 1.727   1.00 0.00 ? 28  PRO A CD   1  
ATOM 376   H HA   . PRO A 1 28  ? -3.807  -23.843 -0.197  1.00 0.00 ? 28  PRO A HA   1  
ATOM 377   H HB2  . PRO A 1 28  ? -4.636  -26.363 0.379   1.00 0.00 ? 28  PRO A HB2  1  
ATOM 378   H HB3  . PRO A 1 28  ? -3.898  -25.296 1.580   1.00 0.00 ? 28  PRO A HB3  1  
ATOM 379   H HG2  . PRO A 1 28  ? -6.792  -25.900 1.106   1.00 0.00 ? 28  PRO A HG2  1  
ATOM 380   H HG3  . PRO A 1 28  ? -5.913  -25.768 2.641   1.00 0.00 ? 28  PRO A HG3  1  
ATOM 381   H HD2  . PRO A 1 28  ? -7.455  -23.766 1.669   1.00 0.00 ? 28  PRO A HD2  1  
ATOM 382   H HD3  . PRO A 1 28  ? -5.997  -23.465 2.637   1.00 0.00 ? 28  PRO A HD3  1  
ATOM 383   N N    . GLU A 1 29  ? -4.886  -24.064 -2.498  1.00 0.00 ? 29  GLU A N    1  
ATOM 384   C CA   . GLU A 1 29  ? -5.295  -24.427 -3.850  1.00 0.00 ? 29  GLU A CA   1  
ATOM 385   C C    . GLU A 1 29  ? -4.690  -25.767 -4.260  1.00 0.00 ? 29  GLU A C    1  
ATOM 386   O O    . GLU A 1 29  ? -5.161  -26.412 -5.196  1.00 0.00 ? 29  GLU A O    1  
ATOM 387   C CB   . GLU A 1 29  ? -4.875  -23.341 -4.843  1.00 0.00 ? 29  GLU A CB   1  
ATOM 388   C CG   . GLU A 1 29  ? -3.370  -23.175 -4.963  1.00 0.00 ? 29  GLU A CG   1  
ATOM 389   C CD   . GLU A 1 29  ? -2.945  -22.673 -6.329  1.00 0.00 ? 29  GLU A CD   1  
ATOM 390   O OE1  . GLU A 1 29  ? -3.556  -21.702 -6.822  1.00 0.00 ? 29  GLU A OE1  1  
ATOM 391   O OE2  . GLU A 1 29  ? -2.001  -23.252 -6.906  1.00 0.00 ? 29  GLU A OE2  1  
ATOM 392   H H    . GLU A 1 29  ? -4.298  -23.291 -2.368  1.00 0.00 ? 29  GLU A H    1  
ATOM 393   H HA   . GLU A 1 29  ? -6.371  -24.514 -3.859  1.00 0.00 ? 29  GLU A HA   1  
ATOM 394   H HB2  . GLU A 1 29  ? -5.268  -23.590 -5.818  1.00 0.00 ? 29  GLU A HB2  1  
ATOM 395   H HB3  . GLU A 1 29  ? -5.296  -22.399 -4.525  1.00 0.00 ? 29  GLU A HB3  1  
ATOM 396   H HG2  . GLU A 1 29  ? -3.038  -22.467 -4.218  1.00 0.00 ? 29  GLU A HG2  1  
ATOM 397   H HG3  . GLU A 1 29  ? -2.899  -24.130 -4.784  1.00 0.00 ? 29  GLU A HG3  1  
ATOM 398   N N    . SER A 1 30  ? -3.643  -26.178 -3.552  1.00 0.00 ? 30  SER A N    1  
ATOM 399   C CA   . SER A 1 30  ? -2.971  -27.439 -3.844  1.00 0.00 ? 30  SER A CA   1  
ATOM 400   C C    . SER A 1 30  ? -2.078  -27.860 -2.680  1.00 0.00 ? 30  SER A C    1  
ATOM 401   O O    . SER A 1 30  ? -1.960  -27.147 -1.685  1.00 0.00 ? 30  SER A O    1  
ATOM 402   C CB   . SER A 1 30  ? -2.138  -27.313 -5.121  1.00 0.00 ? 30  SER A CB   1  
ATOM 403   O OG   . SER A 1 30  ? -2.907  -26.769 -6.179  1.00 0.00 ? 30  SER A OG   1  
ATOM 404   H H    . SER A 1 30  ? -3.314  -25.619 -2.817  1.00 0.00 ? 30  SER A H    1  
ATOM 405   H HA   . SER A 1 30  ? -3.729  -28.193 -3.992  1.00 0.00 ? 30  SER A HA   1  
ATOM 406   H HB2  . SER A 1 30  ? -1.294  -26.666 -4.935  1.00 0.00 ? 30  SER A HB2  1  
ATOM 407   H HB3  . SER A 1 30  ? -1.784  -28.291 -5.414  1.00 0.00 ? 30  SER A HB3  1  
ATOM 408   H HG   . SER A 1 30  ? -2.815  -25.813 -6.184  1.00 0.00 ? 30  SER A HG   1  
ATOM 409   N N    . GLU A 1 31  ? -1.452  -29.025 -2.815  1.00 0.00 ? 31  GLU A N    1  
ATOM 410   C CA   . GLU A 1 31  ? -0.570  -29.542 -1.775  1.00 0.00 ? 31  GLU A CA   1  
ATOM 411   C C    . GLU A 1 31  ? 0.744   -28.767 -1.740  1.00 0.00 ? 31  GLU A C    1  
ATOM 412   O O    . GLU A 1 31  ? 1.404   -28.688 -0.704  1.00 0.00 ? 31  GLU A O    1  
ATOM 413   C CB   . GLU A 1 31  ? -0.292  -31.030 -2.004  1.00 0.00 ? 31  GLU A CB   1  
ATOM 414   C CG   . GLU A 1 31  ? 0.667   -31.299 -3.152  1.00 0.00 ? 31  GLU A CG   1  
ATOM 415   C CD   . GLU A 1 31  ? -0.005  -31.208 -4.508  1.00 0.00 ? 31  GLU A CD   1  
ATOM 416   O OE1  . GLU A 1 31  ? -1.102  -31.783 -4.667  1.00 0.00 ? 31  GLU A OE1  1  
ATOM 417   O OE2  . GLU A 1 31  ? 0.566   -30.560 -5.410  1.00 0.00 ? 31  GLU A OE2  1  
ATOM 418   H H    . GLU A 1 31  ? -1.586  -29.549 -3.632  1.00 0.00 ? 31  GLU A H    1  
ATOM 419   H HA   . GLU A 1 31  ? -1.070  -29.422 -0.826  1.00 0.00 ? 31  GLU A HA   1  
ATOM 420   H HB2  . GLU A 1 31  ? 0.131   -31.448 -1.103  1.00 0.00 ? 31  GLU A HB2  1  
ATOM 421   H HB3  . GLU A 1 31  ? -1.226  -31.529 -2.218  1.00 0.00 ? 31  GLU A HB3  1  
ATOM 422   H HG2  . GLU A 1 31  ? 1.466   -30.575 -3.114  1.00 0.00 ? 31  GLU A HG2  1  
ATOM 423   H HG3  . GLU A 1 31  ? 1.077   -32.292 -3.036  1.00 0.00 ? 31  GLU A HG3  1  
ATOM 424   N N    . THR A 1 32  ? 1.118   -28.197 -2.881  1.00 0.00 ? 32  THR A N    1  
ATOM 425   C CA   . THR A 1 32  ? 2.353   -27.430 -2.983  1.00 0.00 ? 32  THR A CA   1  
ATOM 426   C C    . THR A 1 32  ? 2.078   -26.004 -3.447  1.00 0.00 ? 32  THR A C    1  
ATOM 427   O O    . THR A 1 32  ? 3.004   -25.224 -3.668  1.00 0.00 ? 32  THR A O    1  
ATOM 428   C CB   . THR A 1 32  ? 3.347   -28.091 -3.957  1.00 0.00 ? 32  THR A CB   1  
ATOM 429   O OG1  . THR A 1 32  ? 2.730   -28.274 -5.236  1.00 0.00 ? 32  THR A OG1  1  
ATOM 430   C CG2  . THR A 1 32  ? 3.819   -29.434 -3.419  1.00 0.00 ? 32  THR A CG2  1  
ATOM 431   H H    . THR A 1 32  ? 0.549   -28.296 -3.673  1.00 0.00 ? 32  THR A H    1  
ATOM 432   H HA   . THR A 1 32  ? 2.808   -27.399 -2.004  1.00 0.00 ? 32  THR A HA   1  
ATOM 433   H HB   . THR A 1 32  ? 4.204   -27.443 -4.068  1.00 0.00 ? 32  THR A HB   1  
ATOM 434   H HG1  . THR A 1 32  ? 3.226   -28.924 -5.741  1.00 0.00 ? 32  THR A HG1  1  
ATOM 435   H HG21 . THR A 1 32  ? 3.555   -29.516 -2.375  1.00 0.00 ? 32  THR A HG21 1  
ATOM 436   H HG22 . THR A 1 32  ? 4.891   -29.508 -3.527  1.00 0.00 ? 32  THR A HG22 1  
ATOM 437   H HG23 . THR A 1 32  ? 3.345   -30.230 -3.974  1.00 0.00 ? 32  THR A HG23 1  
ATOM 438   N N    . SER A 1 33  ? 0.800   -25.670 -3.591  1.00 0.00 ? 33  SER A N    1  
ATOM 439   C CA   . SER A 1 33  ? 0.403   -24.338 -4.031  1.00 0.00 ? 33  SER A CA   1  
ATOM 440   C C    . SER A 1 33  ? -0.710  -23.782 -3.148  1.00 0.00 ? 33  SER A C    1  
ATOM 441   O O    . SER A 1 33  ? -1.523  -24.534 -2.609  1.00 0.00 ? 33  SER A O    1  
ATOM 442   C CB   . SER A 1 33  ? -0.060  -24.376 -5.489  1.00 0.00 ? 33  SER A CB   1  
ATOM 443   O OG   . SER A 1 33  ? 0.794   -25.191 -6.274  1.00 0.00 ? 33  SER A OG   1  
ATOM 444   H H    . SER A 1 33  ? 0.107   -26.337 -3.399  1.00 0.00 ? 33  SER A H    1  
ATOM 445   H HA   . SER A 1 33  ? 1.265   -23.692 -3.953  1.00 0.00 ? 33  SER A HA   1  
ATOM 446   H HB2  . SER A 1 33  ? -1.061  -24.775 -5.536  1.00 0.00 ? 33  SER A HB2  1  
ATOM 447   H HB3  . SER A 1 33  ? -0.052  -23.374 -5.893  1.00 0.00 ? 33  SER A HB3  1  
ATOM 448   H HG   . SER A 1 33  ? 0.836   -24.844 -7.168  1.00 0.00 ? 33  SER A HG   1  
ATOM 449   N N    . ILE A 1 34  ? -0.739  -22.462 -3.003  1.00 0.00 ? 34  ILE A N    1  
ATOM 450   C CA   . ILE A 1 34  ? -1.751  -21.805 -2.186  1.00 0.00 ? 34  ILE A CA   1  
ATOM 451   C C    . ILE A 1 34  ? -2.216  -20.503 -2.828  1.00 0.00 ? 34  ILE A C    1  
ATOM 452   O O    . ILE A 1 34  ? -1.403  -19.697 -3.283  1.00 0.00 ? 34  ILE A O    1  
ATOM 453   C CB   . ILE A 1 34  ? -1.225  -21.507 -0.769  1.00 0.00 ? 34  ILE A CB   1  
ATOM 454   C CG1  . ILE A 1 34  ? -0.917  -22.811 -0.031  1.00 0.00 ? 34  ILE A CG1  1  
ATOM 455   C CG2  . ILE A 1 34  ? -2.238  -20.679 0.008   1.00 0.00 ? 34  ILE A CG2  1  
ATOM 456   C CD1  . ILE A 1 34  ? -0.190  -22.606 1.279   1.00 0.00 ? 34  ILE A CD1  1  
ATOM 457   H H    . ILE A 1 34  ? -0.063  -21.916 -3.457  1.00 0.00 ? 34  ILE A H    1  
ATOM 458   H HA   . ILE A 1 34  ? -2.596  -22.474 -2.101  1.00 0.00 ? 34  ILE A HA   1  
ATOM 459   H HB   . ILE A 1 34  ? -0.318  -20.930 -0.861  1.00 0.00 ? 34  ILE A HB   1  
ATOM 460   H HG12 . ILE A 1 34  ? -1.841  -23.326 0.180   1.00 0.00 ? 34  ILE A HG12 1  
ATOM 461   H HG13 . ILE A 1 34  ? -0.298  -23.434 -0.661  1.00 0.00 ? 34  ILE A HG13 1  
ATOM 462   H HG21 . ILE A 1 34  ? -3.224  -20.840 -0.401  1.00 0.00 ? 34  ILE A HG21 1  
ATOM 463   H HG22 . ILE A 1 34  ? -2.226  -20.978 1.045   1.00 0.00 ? 34  ILE A HG22 1  
ATOM 464   H HG23 . ILE A 1 34  ? -1.982  -19.633 -0.069  1.00 0.00 ? 34  ILE A HG23 1  
ATOM 465   H HD11 . ILE A 1 34  ? 0.577   -21.856 1.153   1.00 0.00 ? 34  ILE A HD11 1  
ATOM 466   H HD12 . ILE A 1 34  ? -0.891  -22.283 2.034   1.00 0.00 ? 34  ILE A HD12 1  
ATOM 467   H HD13 . ILE A 1 34  ? 0.266   -23.536 1.587   1.00 0.00 ? 34  ILE A HD13 1  
ATOM 468   N N    . LEU A 1 35  ? -3.529  -20.301 -2.860  1.00 0.00 ? 35  LEU A N    1  
ATOM 469   C CA   . LEU A 1 35  ? -4.103  -19.094 -3.445  1.00 0.00 ? 35  LEU A CA   1  
ATOM 470   C C    . LEU A 1 35  ? -4.486  -18.092 -2.360  1.00 0.00 ? 35  LEU A C    1  
ATOM 471   O O    . LEU A 1 35  ? -4.911  -18.474 -1.269  1.00 0.00 ? 35  LEU A O    1  
ATOM 472   C CB   . LEU A 1 35  ? -5.332  -19.446 -4.286  1.00 0.00 ? 35  LEU A CB   1  
ATOM 473   C CG   . LEU A 1 35  ? -5.676  -18.471 -5.412  1.00 0.00 ? 35  LEU A CG   1  
ATOM 474   C CD1  . LEU A 1 35  ? -4.485  -18.283 -6.338  1.00 0.00 ? 35  LEU A CD1  1  
ATOM 475   C CD2  . LEU A 1 35  ? -6.887  -18.962 -6.191  1.00 0.00 ? 35  LEU A CD2  1  
ATOM 476   H H    . LEU A 1 35  ? -4.127  -20.978 -2.482  1.00 0.00 ? 35  LEU A H    1  
ATOM 477   H HA   . LEU A 1 35  ? -3.356  -18.647 -4.084  1.00 0.00 ? 35  LEU A HA   1  
ATOM 478   H HB2  . LEU A 1 35  ? -5.162  -20.416 -4.728  1.00 0.00 ? 35  LEU A HB2  1  
ATOM 479   H HB3  . LEU A 1 35  ? -6.182  -19.499 -3.621  1.00 0.00 ? 35  LEU A HB3  1  
ATOM 480   H HG   . LEU A 1 35  ? -5.921  -17.508 -4.984  1.00 0.00 ? 35  LEU A HG   1  
ATOM 481   H HD11 . LEU A 1 35  ? -4.813  -18.346 -7.364  1.00 0.00 ? 35  LEU A HD11 1  
ATOM 482   H HD12 . LEU A 1 35  ? -3.754  -19.054 -6.145  1.00 0.00 ? 35  LEU A HD12 1  
ATOM 483   H HD13 . LEU A 1 35  ? -4.041  -17.314 -6.161  1.00 0.00 ? 35  LEU A HD13 1  
ATOM 484   H HD21 . LEU A 1 35  ? -6.995  -18.378 -7.093  1.00 0.00 ? 35  LEU A HD21 1  
ATOM 485   H HD22 . LEU A 1 35  ? -7.774  -18.853 -5.584  1.00 0.00 ? 35  LEU A HD22 1  
ATOM 486   H HD23 . LEU A 1 35  ? -6.752  -20.002 -6.449  1.00 0.00 ? 35  LEU A HD23 1  
ATOM 487   N N    . LEU A 1 36  ? -4.333  -16.809 -2.668  1.00 0.00 ? 36  LEU A N    1  
ATOM 488   C CA   . LEU A 1 36  ? -4.665  -15.750 -1.720  1.00 0.00 ? 36  LEU A CA   1  
ATOM 489   C C    . LEU A 1 36  ? -5.678  -14.780 -2.319  1.00 0.00 ? 36  LEU A C    1  
ATOM 490   O O    . LEU A 1 36  ? -5.480  -14.259 -3.416  1.00 0.00 ? 36  LEU A O    1  
ATOM 491   C CB   . LEU A 1 36  ? -3.401  -14.994 -1.307  1.00 0.00 ? 36  LEU A CB   1  
ATOM 492   C CG   . LEU A 1 36  ? -2.183  -15.856 -0.971  1.00 0.00 ? 36  LEU A CG   1  
ATOM 493   C CD1  . LEU A 1 36  ? -0.914  -15.019 -0.996  1.00 0.00 ? 36  LEU A CD1  1  
ATOM 494   C CD2  . LEU A 1 36  ? -2.358  -16.521 0.387   1.00 0.00 ? 36  LEU A CD2  1  
ATOM 495   H H    . LEU A 1 36  ? -3.990  -16.566 -3.552  1.00 0.00 ? 36  LEU A H    1  
ATOM 496   H HA   . LEU A 1 36  ? -5.100  -16.212 -0.846  1.00 0.00 ? 36  LEU A HA   1  
ATOM 497   H HB2  . LEU A 1 36  ? -3.127  -14.339 -2.119  1.00 0.00 ? 36  LEU A HB2  1  
ATOM 498   H HB3  . LEU A 1 36  ? -3.640  -14.403 -0.434  1.00 0.00 ? 36  LEU A HB3  1  
ATOM 499   H HG   . LEU A 1 36  ? -2.084  -16.634 -1.715  1.00 0.00 ? 36  LEU A HG   1  
ATOM 500   H HD11 . LEU A 1 36  ? -0.514  -15.000 -1.999  1.00 0.00 ? 36  LEU A HD11 1  
ATOM 501   H HD12 . LEU A 1 36  ? -0.184  -15.450 -0.326  1.00 0.00 ? 36  LEU A HD12 1  
ATOM 502   H HD13 . LEU A 1 36  ? -1.141  -14.011 -0.679  1.00 0.00 ? 36  LEU A HD13 1  
ATOM 503   H HD21 . LEU A 1 36  ? -1.998  -17.538 0.338   1.00 0.00 ? 36  LEU A HD21 1  
ATOM 504   H HD22 . LEU A 1 36  ? -3.405  -16.523 0.654   1.00 0.00 ? 36  LEU A HD22 1  
ATOM 505   H HD23 . LEU A 1 36  ? -1.797  -15.975 1.130   1.00 0.00 ? 36  LEU A HD23 1  
ATOM 506   N N    . SER A 1 37  ? -6.763  -14.541 -1.590  1.00 0.00 ? 37  SER A N    1  
ATOM 507   C CA   . SER A 1 37  ? -7.809  -13.635 -2.050  1.00 0.00 ? 37  SER A CA   1  
ATOM 508   C C    . SER A 1 37  ? -7.877  -12.392 -1.169  1.00 0.00 ? 37  SER A C    1  
ATOM 509   O O    . SER A 1 37  ? -8.154  -12.480 0.027   1.00 0.00 ? 37  SER A O    1  
ATOM 510   C CB   . SER A 1 37  ? -9.164  -14.346 -2.054  1.00 0.00 ? 37  SER A CB   1  
ATOM 511   O OG   . SER A 1 37  ? -9.258  -15.259 -3.133  1.00 0.00 ? 37  SER A OG   1  
ATOM 512   H H    . SER A 1 37  ? -6.864  -14.988 -0.723  1.00 0.00 ? 37  SER A H    1  
ATOM 513   H HA   . SER A 1 37  ? -7.567  -13.335 -3.059  1.00 0.00 ? 37  SER A HA   1  
ATOM 514   H HB2  . SER A 1 37  ? -9.286  -14.887 -1.128  1.00 0.00 ? 37  SER A HB2  1  
ATOM 515   H HB3  . SER A 1 37  ? -9.952  -13.612 -2.149  1.00 0.00 ? 37  SER A HB3  1  
ATOM 516   H HG   . SER A 1 37  ? -8.889  -16.105 -2.870  1.00 0.00 ? 37  SER A HG   1  
ATOM 517   N N    . TRP A 1 38  ? -7.621  -11.235 -1.769  1.00 0.00 ? 38  TRP A N    1  
ATOM 518   C CA   . TRP A 1 38  ? -7.653  -9.972  -1.039  1.00 0.00 ? 38  TRP A CA   1  
ATOM 519   C C    . TRP A 1 38  ? -8.281  -8.870  -1.885  1.00 0.00 ? 38  TRP A C    1  
ATOM 520   O O    . TRP A 1 38  ? -8.323  -8.963  -3.112  1.00 0.00 ? 38  TRP A O    1  
ATOM 521   C CB   . TRP A 1 38  ? -6.239  -9.567  -0.620  1.00 0.00 ? 38  TRP A CB   1  
ATOM 522   C CG   . TRP A 1 38  ? -5.426  -8.999  -1.743  1.00 0.00 ? 38  TRP A CG   1  
ATOM 523   C CD1  . TRP A 1 38  ? -5.544  -7.754  -2.293  1.00 0.00 ? 38  TRP A CD1  1  
ATOM 524   C CD2  . TRP A 1 38  ? -4.371  -9.656  -2.455  1.00 0.00 ? 38  TRP A CD2  1  
ATOM 525   N NE1  . TRP A 1 38  ? -4.626  -7.598  -3.304  1.00 0.00 ? 38  TRP A NE1  1  
ATOM 526   C CE2  . TRP A 1 38  ? -3.894  -8.750  -3.422  1.00 0.00 ? 38  TRP A CE2  1  
ATOM 527   C CE3  . TRP A 1 38  ? -3.782  -10.920 -2.368  1.00 0.00 ? 38  TRP A CE3  1  
ATOM 528   C CZ2  . TRP A 1 38  ? -2.858  -9.070  -4.295  1.00 0.00 ? 38  TRP A CZ2  1  
ATOM 529   C CZ3  . TRP A 1 38  ? -2.754  -11.237 -3.235  1.00 0.00 ? 38  TRP A CZ3  1  
ATOM 530   C CH2  . TRP A 1 38  ? -2.299  -10.315 -4.188  1.00 0.00 ? 38  TRP A CH2  1  
ATOM 531   H H    . TRP A 1 38  ? -7.406  -11.229 -2.725  1.00 0.00 ? 38  TRP A H    1  
ATOM 532   H HA   . TRP A 1 38  ? -8.254  -10.117 -0.154  1.00 0.00 ? 38  TRP A HA   1  
ATOM 533   H HB2  . TRP A 1 38  ? -6.301  -8.820  0.158   1.00 0.00 ? 38  TRP A HB2  1  
ATOM 534   H HB3  . TRP A 1 38  ? -5.721  -10.435 -0.238  1.00 0.00 ? 38  TRP A HB3  1  
ATOM 535   H HD1  . TRP A 1 38  ? -6.259  -7.013  -1.972  1.00 0.00 ? 38  TRP A HD1  1  
ATOM 536   H HE1  . TRP A 1 38  ? -4.513  -6.791  -3.849  1.00 0.00 ? 38  TRP A HE1  1  
ATOM 537   H HE3  . TRP A 1 38  ? -4.118  -11.644 -1.640  1.00 0.00 ? 38  TRP A HE3  1  
ATOM 538   H HZ2  . TRP A 1 38  ? -2.496  -8.371  -5.034  1.00 0.00 ? 38  TRP A HZ2  1  
ATOM 539   H HZ3  . TRP A 1 38  ? -2.286  -12.209 -3.183  1.00 0.00 ? 38  TRP A HZ3  1  
ATOM 540   H HH2  . TRP A 1 38  ? -1.494  -10.605 -4.844  1.00 0.00 ? 38  TRP A HH2  1  
ATOM 541   N N    . THR A 1 39  ? -8.769  -7.826  -1.222  1.00 0.00 ? 39  THR A N    1  
ATOM 542   C CA   . THR A 1 39  ? -9.396  -6.707  -1.913  1.00 0.00 ? 39  THR A CA   1  
ATOM 543   C C    . THR A 1 39  ? -8.570  -5.435  -1.761  1.00 0.00 ? 39  THR A C    1  
ATOM 544   O O    . THR A 1 39  ? -8.327  -4.952  -0.655  1.00 0.00 ? 39  THR A O    1  
ATOM 545   C CB   . THR A 1 39  ? -10.819 -6.447  -1.386  1.00 0.00 ? 39  THR A CB   1  
ATOM 546   O OG1  . THR A 1 39  ? -11.631 -7.612  -1.572  1.00 0.00 ? 39  THR A OG1  1  
ATOM 547   C CG2  . THR A 1 39  ? -11.453 -5.262  -2.099  1.00 0.00 ? 39  THR A CG2  1  
ATOM 548   H H    . THR A 1 39  ? -8.705  -7.811  -0.244  1.00 0.00 ? 39  THR A H    1  
ATOM 549   H HA   . THR A 1 39  ? -9.463  -6.958  -2.962  1.00 0.00 ? 39  THR A HA   1  
ATOM 550   H HB   . THR A 1 39  ? -10.760 -6.223  -0.330  1.00 0.00 ? 39  THR A HB   1  
ATOM 551   H HG1  . THR A 1 39  ? -12.558 -7.364  -1.545  1.00 0.00 ? 39  THR A HG1  1  
ATOM 552   H HG21 . THR A 1 39  ? -11.794 -5.571  -3.076  1.00 0.00 ? 39  THR A HG21 1  
ATOM 553   H HG22 . THR A 1 39  ? -10.723 -4.474  -2.205  1.00 0.00 ? 39  THR A HG22 1  
ATOM 554   H HG23 . THR A 1 39  ? -12.292 -4.902  -1.522  1.00 0.00 ? 39  THR A HG23 1  
ATOM 555   N N    . PRO A 1 40  ? -8.127  -4.877  -2.898  1.00 0.00 ? 40  PRO A N    1  
ATOM 556   C CA   . PRO A 1 40  ? -7.322  -3.651  -2.917  1.00 0.00 ? 40  PRO A CA   1  
ATOM 557   C C    . PRO A 1 40  ? -8.128  -2.422  -2.512  1.00 0.00 ? 40  PRO A C    1  
ATOM 558   O O    . PRO A 1 40  ? -9.289  -2.259  -2.888  1.00 0.00 ? 40  PRO A O    1  
ATOM 559   C CB   . PRO A 1 40  ? -6.878  -3.542  -4.377  1.00 0.00 ? 40  PRO A CB   1  
ATOM 560   C CG   . PRO A 1 40  ? -7.918  -4.281  -5.146  1.00 0.00 ? 40  PRO A CG   1  
ATOM 561   C CD   . PRO A 1 40  ? -8.379  -5.398  -4.252  1.00 0.00 ? 40  PRO A CD   1  
ATOM 562   H HA   . PRO A 1 40  ? -6.454  -3.737  -2.280  1.00 0.00 ? 40  PRO A HA   1  
ATOM 563   H HB2  . PRO A 1 40  ? -6.836  -2.501  -4.667  1.00 0.00 ? 40  PRO A HB2  1  
ATOM 564   H HB3  . PRO A 1 40  ? -5.904  -3.993  -4.496  1.00 0.00 ? 40  PRO A HB3  1  
ATOM 565   H HG2  . PRO A 1 40  ? -8.741  -3.622  -5.378  1.00 0.00 ? 40  PRO A HG2  1  
ATOM 566   H HG3  . PRO A 1 40  ? -7.488  -4.681  -6.053  1.00 0.00 ? 40  PRO A HG3  1  
ATOM 567   H HD2  . PRO A 1 40  ? -9.431  -5.592  -4.401  1.00 0.00 ? 40  PRO A HD2  1  
ATOM 568   H HD3  . PRO A 1 40  ? -7.799  -6.291  -4.434  1.00 0.00 ? 40  PRO A HD3  1  
ATOM 569   N N    . PRO A 1 41  ? -7.500  -1.534  -1.727  1.00 0.00 ? 41  PRO A N    1  
ATOM 570   C CA   . PRO A 1 41  ? -8.141  -0.303  -1.254  1.00 0.00 ? 41  PRO A CA   1  
ATOM 571   C C    . PRO A 1 41  ? -8.364  0.702   -2.379  1.00 0.00 ? 41  PRO A C    1  
ATOM 572   O O    . PRO A 1 41  ? -8.063  0.426   -3.540  1.00 0.00 ? 41  PRO A O    1  
ATOM 573   C CB   . PRO A 1 41  ? -7.140  0.249   -0.235  1.00 0.00 ? 41  PRO A CB   1  
ATOM 574   C CG   . PRO A 1 41  ? -5.825  -0.309  -0.656  1.00 0.00 ? 41  PRO A CG   1  
ATOM 575   C CD   . PRO A 1 41  ? -6.116  -1.663  -1.240  1.00 0.00 ? 41  PRO A CD   1  
ATOM 576   H HA   . PRO A 1 41  ? -9.081  -0.508  -0.764  1.00 0.00 ? 41  PRO A HA   1  
ATOM 577   H HB2  . PRO A 1 41  ? -7.143  1.329   -0.273  1.00 0.00 ? 41  PRO A HB2  1  
ATOM 578   H HB3  . PRO A 1 41  ? -7.411  -0.083  0.756   1.00 0.00 ? 41  PRO A HB3  1  
ATOM 579   H HG2  . PRO A 1 41  ? -5.375  0.331   -1.399  1.00 0.00 ? 41  PRO A HG2  1  
ATOM 580   H HG3  . PRO A 1 41  ? -5.175  -0.403  0.202   1.00 0.00 ? 41  PRO A HG3  1  
ATOM 581   H HD2  . PRO A 1 41  ? -5.440  -1.877  -2.054  1.00 0.00 ? 41  PRO A HD2  1  
ATOM 582   H HD3  . PRO A 1 41  ? -6.046  -2.426  -0.478  1.00 0.00 ? 41  PRO A HD3  1  
ATOM 583   N N    . ARG A 1 42  ? -8.894  1.869   -2.026  1.00 0.00 ? 42  ARG A N    1  
ATOM 584   C CA   . ARG A 1 42  ? -9.158  2.915   -3.007  1.00 0.00 ? 42  ARG A CA   1  
ATOM 585   C C    . ARG A 1 42  ? -7.887  3.281   -3.769  1.00 0.00 ? 42  ARG A C    1  
ATOM 586   O O    . ARG A 1 42  ? -7.911  3.455   -4.987  1.00 0.00 ? 42  ARG A O    1  
ATOM 587   C CB   . ARG A 1 42  ? -9.727  4.157   -2.318  1.00 0.00 ? 42  ARG A CB   1  
ATOM 588   C CG   . ARG A 1 42  ? -8.784  4.775   -1.299  1.00 0.00 ? 42  ARG A CG   1  
ATOM 589   C CD   . ARG A 1 42  ? -9.489  5.820   -0.449  1.00 0.00 ? 42  ARG A CD   1  
ATOM 590   N NE   . ARG A 1 42  ? -9.926  6.966   -1.241  1.00 0.00 ? 42  ARG A NE   1  
ATOM 591   C CZ   . ARG A 1 42  ? -10.349 8.108   -0.710  1.00 0.00 ? 42  ARG A CZ   1  
ATOM 592   N NH1  . ARG A 1 42  ? -10.390 8.256   0.607   1.00 0.00 ? 42  ARG A NH1  1  
ATOM 593   N NH2  . ARG A 1 42  ? -10.730 9.106   -1.497  1.00 0.00 ? 42  ARG A NH2  1  
ATOM 594   H H    . ARG A 1 42  ? -9.112  2.031   -1.085  1.00 0.00 ? 42  ARG A H    1  
ATOM 595   H HA   . ARG A 1 42  ? -9.888  2.537   -3.707  1.00 0.00 ? 42  ARG A HA   1  
ATOM 596   H HB2  . ARG A 1 42  ? -9.948  4.902   -3.069  1.00 0.00 ? 42  ARG A HB2  1  
ATOM 597   H HB3  . ARG A 1 42  ? -10.641 3.886   -1.812  1.00 0.00 ? 42  ARG A HB3  1  
ATOM 598   H HG2  . ARG A 1 42  ? -8.407  3.996   -0.653  1.00 0.00 ? 42  ARG A HG2  1  
ATOM 599   H HG3  . ARG A 1 42  ? -7.962  5.242   -1.821  1.00 0.00 ? 42  ARG A HG3  1  
ATOM 600   H HD2  . ARG A 1 42  ? -10.351 5.365   0.015   1.00 0.00 ? 42  ARG A HD2  1  
ATOM 601   H HD3  . ARG A 1 42  ? -8.807  6.161   0.316   1.00 0.00 ? 42  ARG A HD3  1  
ATOM 602   H HE   . ARG A 1 42  ? -9.904  6.878   -2.216  1.00 0.00 ? 42  ARG A HE   1  
ATOM 603   H HH11 . ARG A 1 42  ? -10.102 7.506   1.202   1.00 0.00 ? 42  ARG A HH11 1  
ATOM 604   H HH12 . ARG A 1 42  ? -10.707 9.117   1.004   1.00 0.00 ? 42  ARG A HH12 1  
ATOM 605   H HH21 . ARG A 1 42  ? -10.700 8.998   -2.491  1.00 0.00 ? 42  ARG A HH21 1  
ATOM 606   H HH22 . ARG A 1 42  ? -11.048 9.965   -1.097  1.00 0.00 ? 42  ARG A HH22 1  
ATOM 607   N N    . SER A 1 43  ? -6.780  3.394   -3.042  1.00 0.00 ? 43  SER A N    1  
ATOM 608   C CA   . SER A 1 43  ? -5.501  3.743   -3.648  1.00 0.00 ? 43  SER A CA   1  
ATOM 609   C C    . SER A 1 43  ? -5.253  2.916   -4.907  1.00 0.00 ? 43  SER A C    1  
ATOM 610   O O    . SER A 1 43  ? -4.984  1.717   -4.832  1.00 0.00 ? 43  SER A O    1  
ATOM 611   C CB   . SER A 1 43  ? -4.363  3.526   -2.649  1.00 0.00 ? 43  SER A CB   1  
ATOM 612   O OG   . SER A 1 43  ? -4.475  4.411   -1.548  1.00 0.00 ? 43  SER A OG   1  
ATOM 613   H H    . SER A 1 43  ? -6.826  3.243   -2.075  1.00 0.00 ? 43  SER A H    1  
ATOM 614   H HA   . SER A 1 43  ? -5.536  4.788   -3.919  1.00 0.00 ? 43  SER A HA   1  
ATOM 615   H HB2  . SER A 1 43  ? -4.396  2.510   -2.284  1.00 0.00 ? 43  SER A HB2  1  
ATOM 616   H HB3  . SER A 1 43  ? -3.417  3.700   -3.142  1.00 0.00 ? 43  SER A HB3  1  
ATOM 617   H HG   . SER A 1 43  ? -4.848  5.244   -1.844  1.00 0.00 ? 43  SER A HG   1  
ATOM 618   N N    . ASP A 1 44  ? -5.345  3.566   -6.061  1.00 0.00 ? 44  ASP A N    1  
ATOM 619   C CA   . ASP A 1 44  ? -5.130  2.893   -7.337  1.00 0.00 ? 44  ASP A CA   1  
ATOM 620   C C    . ASP A 1 44  ? -3.643  2.660   -7.585  1.00 0.00 ? 44  ASP A C    1  
ATOM 621   O O    . ASP A 1 44  ? -3.246  1.627   -8.125  1.00 0.00 ? 44  ASP A O    1  
ATOM 622   C CB   . ASP A 1 44  ? -5.727  3.716   -8.480  1.00 0.00 ? 44  ASP A CB   1  
ATOM 623   C CG   . ASP A 1 44  ? -5.406  5.193   -8.358  1.00 0.00 ? 44  ASP A CG   1  
ATOM 624   O OD1  . ASP A 1 44  ? -6.005  5.861   -7.489  1.00 0.00 ? 44  ASP A OD1  1  
ATOM 625   O OD2  . ASP A 1 44  ? -4.556  5.680   -9.132  1.00 0.00 ? 44  ASP A OD2  1  
ATOM 626   H H    . ASP A 1 44  ? -5.563  4.522   -6.056  1.00 0.00 ? 44  ASP A H    1  
ATOM 627   H HA   . ASP A 1 44  ? -5.629  1.937   -7.296  1.00 0.00 ? 44  ASP A HA   1  
ATOM 628   H HB2  . ASP A 1 44  ? -5.331  3.357   -9.419  1.00 0.00 ? 44  ASP A HB2  1  
ATOM 629   H HB3  . ASP A 1 44  ? -6.801  3.598   -8.477  1.00 0.00 ? 44  ASP A HB3  1  
ATOM 630   N N    . THR A 1 45  ? -2.823  3.628   -7.186  1.00 0.00 ? 45  THR A N    1  
ATOM 631   C CA   . THR A 1 45  ? -1.380  3.530   -7.367  1.00 0.00 ? 45  THR A CA   1  
ATOM 632   C C    . THR A 1 45  ? -0.771  2.530   -6.390  1.00 0.00 ? 45  THR A C    1  
ATOM 633   O O    . THR A 1 45  ? -0.567  2.841   -5.217  1.00 0.00 ? 45  THR A O    1  
ATOM 634   C CB   . THR A 1 45  ? -0.696  4.897   -7.178  1.00 0.00 ? 45  THR A CB   1  
ATOM 635   O OG1  . THR A 1 45  ? -1.185  5.529   -5.990  1.00 0.00 ? 45  THR A OG1  1  
ATOM 636   C CG2  . THR A 1 45  ? -0.947  5.798   -8.378  1.00 0.00 ? 45  THR A CG2  1  
ATOM 637   H H    . THR A 1 45  ? -3.199  4.427   -6.762  1.00 0.00 ? 45  THR A H    1  
ATOM 638   H HA   . THR A 1 45  ? -1.192  3.193   -8.376  1.00 0.00 ? 45  THR A HA   1  
ATOM 639   H HB   . THR A 1 45  ? 0.369   4.739   -7.081  1.00 0.00 ? 45  THR A HB   1  
ATOM 640   H HG1  . THR A 1 45  ? -2.013  5.975   -6.182  1.00 0.00 ? 45  THR A HG1  1  
ATOM 641   H HG21 . THR A 1 45  ? -1.130  5.191   -9.252  1.00 0.00 ? 45  THR A HG21 1  
ATOM 642   H HG22 . THR A 1 45  ? -0.081  6.421   -8.547  1.00 0.00 ? 45  THR A HG22 1  
ATOM 643   H HG23 . THR A 1 45  ? -1.807  6.421   -8.186  1.00 0.00 ? 45  THR A HG23 1  
ATOM 644   N N    . ILE A 1 46  ? -0.482  1.330   -6.883  1.00 0.00 ? 46  ILE A N    1  
ATOM 645   C CA   . ILE A 1 46  ? 0.106   0.286   -6.053  1.00 0.00 ? 46  ILE A CA   1  
ATOM 646   C C    . ILE A 1 46  ? 1.269   -0.395  -6.768  1.00 0.00 ? 46  ILE A C    1  
ATOM 647   O O    . ILE A 1 46  ? 1.131   -0.854  -7.901  1.00 0.00 ? 46  ILE A O    1  
ATOM 648   C CB   . ILE A 1 46  ? -0.937  -0.779  -5.665  1.00 0.00 ? 46  ILE A CB   1  
ATOM 649   C CG1  . ILE A 1 46  ? -2.101  -0.132  -4.910  1.00 0.00 ? 46  ILE A CG1  1  
ATOM 650   C CG2  . ILE A 1 46  ? -0.292  -1.869  -4.822  1.00 0.00 ? 46  ILE A CG2  1  
ATOM 651   C CD1  . ILE A 1 46  ? -3.313  -1.028  -4.788  1.00 0.00 ? 46  ILE A CD1  1  
ATOM 652   H H    . ILE A 1 46  ? -0.668  1.143   -7.826  1.00 0.00 ? 46  ILE A H    1  
ATOM 653   H HA   . ILE A 1 46  ? 0.474   0.747   -5.148  1.00 0.00 ? 46  ILE A HA   1  
ATOM 654   H HB   . ILE A 1 46  ? -1.311  -1.231  -6.570  1.00 0.00 ? 46  ILE A HB   1  
ATOM 655   H HG12 . ILE A 1 46  ? -1.777  0.125   -3.914  1.00 0.00 ? 46  ILE A HG12 1  
ATOM 656   H HG13 . ILE A 1 46  ? -2.402  0.766   -5.430  1.00 0.00 ? 46  ILE A HG13 1  
ATOM 657   H HG21 . ILE A 1 46  ? -0.938  -2.111  -3.991  1.00 0.00 ? 46  ILE A HG21 1  
ATOM 658   H HG22 . ILE A 1 46  ? -0.142  -2.750  -5.427  1.00 0.00 ? 46  ILE A HG22 1  
ATOM 659   H HG23 . ILE A 1 46  ? 0.659   -1.521  -4.449  1.00 0.00 ? 46  ILE A HG23 1  
ATOM 660   H HD11 . ILE A 1 46  ? -3.929  -0.924  -5.669  1.00 0.00 ? 46  ILE A HD11 1  
ATOM 661   H HD12 . ILE A 1 46  ? -2.995  -2.055  -4.689  1.00 0.00 ? 46  ILE A HD12 1  
ATOM 662   H HD13 . ILE A 1 46  ? -3.884  -0.744  -3.915  1.00 0.00 ? 46  ILE A HD13 1  
ATOM 663   N N    . ALA A 1 47  ? 2.414   -0.457  -6.096  1.00 0.00 ? 47  ALA A N    1  
ATOM 664   C CA   . ALA A 1 47  ? 3.600   -1.085  -6.665  1.00 0.00 ? 47  ALA A CA   1  
ATOM 665   C C    . ALA A 1 47  ? 3.532   -2.603  -6.537  1.00 0.00 ? 47  ALA A C    1  
ATOM 666   O O    . ALA A 1 47  ? 3.695   -3.326  -7.519  1.00 0.00 ? 47  ALA A O    1  
ATOM 667   C CB   . ALA A 1 47  ? 4.855   -0.552  -5.990  1.00 0.00 ? 47  ALA A CB   1  
ATOM 668   H H    . ALA A 1 47  ? 2.462   -0.073  -5.196  1.00 0.00 ? 47  ALA A H    1  
ATOM 669   H HA   . ALA A 1 47  ? 3.646   -0.824  -7.713  1.00 0.00 ? 47  ALA A HA   1  
ATOM 670   H HB1  . ALA A 1 47  ? 5.069   -1.144  -5.112  1.00 0.00 ? 47  ALA A HB1  1  
ATOM 671   H HB2  . ALA A 1 47  ? 5.686   -0.612  -6.677  1.00 0.00 ? 47  ALA A HB2  1  
ATOM 672   H HB3  . ALA A 1 47  ? 4.698   0.476   -5.701  1.00 0.00 ? 47  ALA A HB3  1  
ATOM 673   N N    . ASN A 1 48  ? 3.291   -3.080  -5.320  1.00 0.00 ? 48  ASN A N    1  
ATOM 674   C CA   . ASN A 1 48  ? 3.203   -4.513  -5.064  1.00 0.00 ? 48  ASN A CA   1  
ATOM 675   C C    . ASN A 1 48  ? 2.769   -4.783  -3.626  1.00 0.00 ? 48  ASN A C    1  
ATOM 676   O O    . ASN A 1 48  ? 2.572   -3.855  -2.842  1.00 0.00 ? 48  ASN A O    1  
ATOM 677   C CB   . ASN A 1 48  ? 4.550   -5.184  -5.336  1.00 0.00 ? 48  ASN A CB   1  
ATOM 678   C CG   . ASN A 1 48  ? 5.722   -4.267  -5.045  1.00 0.00 ? 48  ASN A CG   1  
ATOM 679   O OD1  . ASN A 1 48  ? 5.744   -3.572  -4.029  1.00 0.00 ? 48  ASN A OD1  1  
ATOM 680   N ND2  . ASN A 1 48  ? 6.705   -4.262  -5.938  1.00 0.00 ? 48  ASN A ND2  1  
ATOM 681   H H    . ASN A 1 48  ? 3.169   -2.453  -4.577  1.00 0.00 ? 48  ASN A H    1  
ATOM 682   H HA   . ASN A 1 48  ? 2.463   -4.924  -5.734  1.00 0.00 ? 48  ASN A HA   1  
ATOM 683   H HB2  . ASN A 1 48  ? 4.641   -6.062  -4.712  1.00 0.00 ? 48  ASN A HB2  1  
ATOM 684   H HB3  . ASN A 1 48  ? 4.596   -5.479  -6.374  1.00 0.00 ? 48  ASN A HB3  1  
ATOM 685   H HD21 . ASN A 1 48  ? 6.620   -4.841  -6.724  1.00 0.00 ? 48  ASN A HD21 1  
ATOM 686   H HD22 . ASN A 1 48  ? 7.475   -3.678  -5.775  1.00 0.00 ? 48  ASN A HD22 1  
ATOM 687   N N    . TYR A 1 49  ? 2.622   -6.059  -3.289  1.00 0.00 ? 49  TYR A N    1  
ATOM 688   C CA   . TYR A 1 49  ? 2.210   -6.451  -1.946  1.00 0.00 ? 49  TYR A CA   1  
ATOM 689   C C    . TYR A 1 49  ? 3.286   -7.296  -1.271  1.00 0.00 ? 49  TYR A C    1  
ATOM 690   O O    . TYR A 1 49  ? 4.022   -8.027  -1.933  1.00 0.00 ? 49  TYR A O    1  
ATOM 691   C CB   . TYR A 1 49  ? 0.894   -7.230  -2.001  1.00 0.00 ? 49  TYR A CB   1  
ATOM 692   C CG   . TYR A 1 49  ? -0.306  -6.368  -2.321  1.00 0.00 ? 49  TYR A CG   1  
ATOM 693   C CD1  . TYR A 1 49  ? -0.513  -5.879  -3.604  1.00 0.00 ? 49  TYR A CD1  1  
ATOM 694   C CD2  . TYR A 1 49  ? -1.235  -6.045  -1.339  1.00 0.00 ? 49  TYR A CD2  1  
ATOM 695   C CE1  . TYR A 1 49  ? -1.608  -5.090  -3.900  1.00 0.00 ? 49  TYR A CE1  1  
ATOM 696   C CE2  . TYR A 1 49  ? -2.334  -5.259  -1.626  1.00 0.00 ? 49  TYR A CE2  1  
ATOM 697   C CZ   . TYR A 1 49  ? -2.516  -4.784  -2.908  1.00 0.00 ? 49  TYR A CZ   1  
ATOM 698   O OH   . TYR A 1 49  ? -3.609  -4.000  -3.199  1.00 0.00 ? 49  TYR A OH   1  
ATOM 699   H H    . TYR A 1 49  ? 2.794   -6.754  -3.958  1.00 0.00 ? 49  TYR A H    1  
ATOM 700   H HA   . TYR A 1 49  ? 2.060   -5.551  -1.369  1.00 0.00 ? 49  TYR A HA   1  
ATOM 701   H HB2  . TYR A 1 49  ? 0.966   -7.992  -2.762  1.00 0.00 ? 49  TYR A HB2  1  
ATOM 702   H HB3  . TYR A 1 49  ? 0.721   -7.699  -1.044  1.00 0.00 ? 49  TYR A HB3  1  
ATOM 703   H HD1  . TYR A 1 49  ? 0.200   -6.121  -4.380  1.00 0.00 ? 49  TYR A HD1  1  
ATOM 704   H HD2  . TYR A 1 49  ? -1.090  -6.419  -0.336  1.00 0.00 ? 49  TYR A HD2  1  
ATOM 705   H HE1  . TYR A 1 49  ? -1.751  -4.719  -4.904  1.00 0.00 ? 49  TYR A HE1  1  
ATOM 706   H HE2  . TYR A 1 49  ? -3.045  -5.018  -0.849  1.00 0.00 ? 49  TYR A HE2  1  
ATOM 707   H HH   . TYR A 1 49  ? -4.376  -4.560  -3.339  1.00 0.00 ? 49  TYR A HH   1  
ATOM 708   N N    . GLU A 1 50  ? 3.369   -7.190  0.051   1.00 0.00 ? 50  GLU A N    1  
ATOM 709   C CA   . GLU A 1 50  ? 4.355   -7.944  0.817   1.00 0.00 ? 50  GLU A CA   1  
ATOM 710   C C    . GLU A 1 50  ? 3.724   -9.183  1.445   1.00 0.00 ? 50  GLU A C    1  
ATOM 711   O O    . GLU A 1 50  ? 2.739   -9.089  2.178   1.00 0.00 ? 50  GLU A O    1  
ATOM 712   C CB   . GLU A 1 50  ? 4.969   -7.063  1.907   1.00 0.00 ? 50  GLU A CB   1  
ATOM 713   C CG   . GLU A 1 50  ? 6.384   -7.465  2.289   1.00 0.00 ? 50  GLU A CG   1  
ATOM 714   C CD   . GLU A 1 50  ? 6.956   -6.603  3.398   1.00 0.00 ? 50  GLU A CD   1  
ATOM 715   O OE1  . GLU A 1 50  ? 6.348   -6.556  4.487   1.00 0.00 ? 50  GLU A OE1  1  
ATOM 716   O OE2  . GLU A 1 50  ? 8.012   -5.975  3.174   1.00 0.00 ? 50  GLU A OE2  1  
ATOM 717   H H    . GLU A 1 50  ? 2.754   -6.590  0.523   1.00 0.00 ? 50  GLU A H    1  
ATOM 718   H HA   . GLU A 1 50  ? 5.134   -8.256  0.138   1.00 0.00 ? 50  GLU A HA   1  
ATOM 719   H HB2  . GLU A 1 50  ? 4.989   -6.041  1.559   1.00 0.00 ? 50  GLU A HB2  1  
ATOM 720   H HB3  . GLU A 1 50  ? 4.350   -7.120  2.790   1.00 0.00 ? 50  GLU A HB3  1  
ATOM 721   H HG2  . GLU A 1 50  ? 6.375   -8.492  2.622   1.00 0.00 ? 50  GLU A HG2  1  
ATOM 722   H HG3  . GLU A 1 50  ? 7.018   -7.375  1.419   1.00 0.00 ? 50  GLU A HG3  1  
ATOM 723   N N    . LEU A 1 51  ? 4.298   -10.345 1.152   1.00 0.00 ? 51  LEU A N    1  
ATOM 724   C CA   . LEU A 1 51  ? 3.793   -11.605 1.687   1.00 0.00 ? 51  LEU A CA   1  
ATOM 725   C C    . LEU A 1 51  ? 4.813   -12.247 2.622   1.00 0.00 ? 51  LEU A C    1  
ATOM 726   O O    . LEU A 1 51  ? 5.621   -13.076 2.202   1.00 0.00 ? 51  LEU A O    1  
ATOM 727   C CB   . LEU A 1 51  ? 3.454   -12.566 0.546   1.00 0.00 ? 51  LEU A CB   1  
ATOM 728   C CG   . LEU A 1 51  ? 3.182   -14.016 0.949   1.00 0.00 ? 51  LEU A CG   1  
ATOM 729   C CD1  . LEU A 1 51  ? 2.084   -14.082 1.998   1.00 0.00 ? 51  LEU A CD1  1  
ATOM 730   C CD2  . LEU A 1 51  ? 2.808   -14.847 -0.270  1.00 0.00 ? 51  LEU A CD2  1  
ATOM 731   H H    . LEU A 1 51  ? 5.081   -10.357 0.562   1.00 0.00 ? 51  LEU A H    1  
ATOM 732   H HA   . LEU A 1 51  ? 2.895   -11.391 2.246   1.00 0.00 ? 51  LEU A HA   1  
ATOM 733   H HB2  . LEU A 1 51  ? 2.573   -12.191 0.049   1.00 0.00 ? 51  LEU A HB2  1  
ATOM 734   H HB3  . LEU A 1 51  ? 4.284   -12.563 -0.146  1.00 0.00 ? 51  LEU A HB3  1  
ATOM 735   H HG   . LEU A 1 51  ? 4.080   -14.437 1.379   1.00 0.00 ? 51  LEU A HG   1  
ATOM 736   H HD11 . LEU A 1 51  ? 2.482   -14.500 2.910   1.00 0.00 ? 51  LEU A HD11 1  
ATOM 737   H HD12 . LEU A 1 51  ? 1.279   -14.705 1.638   1.00 0.00 ? 51  LEU A HD12 1  
ATOM 738   H HD13 . LEU A 1 51  ? 1.710   -13.087 2.191   1.00 0.00 ? 51  LEU A HD13 1  
ATOM 739   H HD21 . LEU A 1 51  ? 1.964   -14.394 -0.768  1.00 0.00 ? 51  LEU A HD21 1  
ATOM 740   H HD22 . LEU A 1 51  ? 2.548   -15.848 0.043   1.00 0.00 ? 51  LEU A HD22 1  
ATOM 741   H HD23 . LEU A 1 51  ? 3.647   -14.888 -0.949  1.00 0.00 ? 51  LEU A HD23 1  
ATOM 742   N N    . VAL A 1 52  ? 4.768   -11.861 3.893   1.00 0.00 ? 52  VAL A N    1  
ATOM 743   C CA   . VAL A 1 52  ? 5.685   -12.401 4.889   1.00 0.00 ? 52  VAL A CA   1  
ATOM 744   C C    . VAL A 1 52  ? 5.235   -13.779 5.361   1.00 0.00 ? 52  VAL A C    1  
ATOM 745   O O    . VAL A 1 52  ? 4.305   -13.901 6.159   1.00 0.00 ? 52  VAL A O    1  
ATOM 746   C CB   . VAL A 1 52  ? 5.804   -11.467 6.108   1.00 0.00 ? 52  VAL A CB   1  
ATOM 747   C CG1  . VAL A 1 52  ? 6.720   -12.075 7.159   1.00 0.00 ? 52  VAL A CG1  1  
ATOM 748   C CG2  . VAL A 1 52  ? 6.304   -10.096 5.681   1.00 0.00 ? 52  VAL A CG2  1  
ATOM 749   H H    . VAL A 1 52  ? 4.101   -11.197 4.167   1.00 0.00 ? 52  VAL A H    1  
ATOM 750   H HA   . VAL A 1 52  ? 6.660   -12.488 4.433   1.00 0.00 ? 52  VAL A HA   1  
ATOM 751   H HB   . VAL A 1 52  ? 4.822   -11.350 6.543   1.00 0.00 ? 52  VAL A HB   1  
ATOM 752   H HG11 . VAL A 1 52  ? 7.749   -11.866 6.903   1.00 0.00 ? 52  VAL A HG11 1  
ATOM 753   H HG12 . VAL A 1 52  ? 6.494   -11.647 8.125   1.00 0.00 ? 52  VAL A HG12 1  
ATOM 754   H HG13 . VAL A 1 52  ? 6.569   -13.144 7.194   1.00 0.00 ? 52  VAL A HG13 1  
ATOM 755   H HG21 . VAL A 1 52  ? 5.748   -9.763  4.817   1.00 0.00 ? 52  VAL A HG21 1  
ATOM 756   H HG22 . VAL A 1 52  ? 6.165   -9.393  6.490   1.00 0.00 ? 52  VAL A HG22 1  
ATOM 757   H HG23 . VAL A 1 52  ? 7.354   -10.156 5.434   1.00 0.00 ? 52  VAL A HG23 1  
ATOM 758   N N    . TYR A 1 53  ? 5.900   -14.815 4.862   1.00 0.00 ? 53  TYR A N    1  
ATOM 759   C CA   . TYR A 1 53  ? 5.567   -16.186 5.231   1.00 0.00 ? 53  TYR A CA   1  
ATOM 760   C C    . TYR A 1 53  ? 6.739   -16.860 5.938   1.00 0.00 ? 53  TYR A C    1  
ATOM 761   O O    . TYR A 1 53  ? 7.901   -16.550 5.674   1.00 0.00 ? 53  TYR A O    1  
ATOM 762   C CB   . TYR A 1 53  ? 5.175   -16.990 3.990   1.00 0.00 ? 53  TYR A CB   1  
ATOM 763   C CG   . TYR A 1 53  ? 6.359   -17.465 3.178   1.00 0.00 ? 53  TYR A CG   1  
ATOM 764   C CD1  . TYR A 1 53  ? 6.909   -16.668 2.181   1.00 0.00 ? 53  TYR A CD1  1  
ATOM 765   C CD2  . TYR A 1 53  ? 6.928   -18.712 3.408   1.00 0.00 ? 53  TYR A CD2  1  
ATOM 766   C CE1  . TYR A 1 53  ? 7.990   -17.099 1.437   1.00 0.00 ? 53  TYR A CE1  1  
ATOM 767   C CE2  . TYR A 1 53  ? 8.010   -19.150 2.669   1.00 0.00 ? 53  TYR A CE2  1  
ATOM 768   C CZ   . TYR A 1 53  ? 8.537   -18.341 1.684   1.00 0.00 ? 53  TYR A CZ   1  
ATOM 769   O OH   . TYR A 1 53  ? 9.614   -18.773 0.946   1.00 0.00 ? 53  TYR A OH   1  
ATOM 770   H H    . TYR A 1 53  ? 6.632   -14.655 4.230   1.00 0.00 ? 53  TYR A H    1  
ATOM 771   H HA   . TYR A 1 53  ? 4.725   -16.153 5.906   1.00 0.00 ? 53  TYR A HA   1  
ATOM 772   H HB2  . TYR A 1 53  ? 4.612   -17.858 4.294   1.00 0.00 ? 53  TYR A HB2  1  
ATOM 773   H HB3  . TYR A 1 53  ? 4.560   -16.374 3.350   1.00 0.00 ? 53  TYR A HB3  1  
ATOM 774   H HD1  . TYR A 1 53  ? 6.478   -15.696 1.991   1.00 0.00 ? 53  TYR A HD1  1  
ATOM 775   H HD2  . TYR A 1 53  ? 6.513   -19.344 4.179   1.00 0.00 ? 53  TYR A HD2  1  
ATOM 776   H HE1  . TYR A 1 53  ? 8.403   -16.465 0.666   1.00 0.00 ? 53  TYR A HE1  1  
ATOM 777   H HE2  . TYR A 1 53  ? 8.439   -20.123 2.862   1.00 0.00 ? 53  TYR A HE2  1  
ATOM 778   H HH   . TYR A 1 53  ? 9.945   -19.596 1.314   1.00 0.00 ? 53  TYR A HH   1  
ATOM 779   N N    . LYS A 1 54  ? 6.426   -17.786 6.838   1.00 0.00 ? 54  LYS A N    1  
ATOM 780   C CA   . LYS A 1 54  ? 7.450   -18.507 7.583   1.00 0.00 ? 54  LYS A CA   1  
ATOM 781   C C    . LYS A 1 54  ? 7.004   -19.936 7.879   1.00 0.00 ? 54  LYS A C    1  
ATOM 782   O O    . LYS A 1 54  ? 5.856   -20.172 8.254   1.00 0.00 ? 54  LYS A O    1  
ATOM 783   C CB   . LYS A 1 54  ? 7.766   -17.779 8.891   1.00 0.00 ? 54  LYS A CB   1  
ATOM 784   C CG   . LYS A 1 54  ? 6.538   -17.480 9.733   1.00 0.00 ? 54  LYS A CG   1  
ATOM 785   C CD   . LYS A 1 54  ? 6.896   -16.692 10.982  1.00 0.00 ? 54  LYS A CD   1  
ATOM 786   C CE   . LYS A 1 54  ? 5.662   -16.369 11.810  1.00 0.00 ? 54  LYS A CE   1  
ATOM 787   N NZ   . LYS A 1 54  ? 6.007   -16.069 13.227  1.00 0.00 ? 54  LYS A NZ   1  
ATOM 788   H H    . LYS A 1 54  ? 5.481   -17.990 7.004   1.00 0.00 ? 54  LYS A H    1  
ATOM 789   H HA   . LYS A 1 54  ? 8.342   -18.540 6.975   1.00 0.00 ? 54  LYS A HA   1  
ATOM 790   H HB2  . LYS A 1 54  ? 8.438   -18.390 9.476   1.00 0.00 ? 54  LYS A HB2  1  
ATOM 791   H HB3  . LYS A 1 54  ? 8.255   -16.844 8.660   1.00 0.00 ? 54  LYS A HB3  1  
ATOM 792   H HG2  . LYS A 1 54  ? 5.841   -16.903 9.144   1.00 0.00 ? 54  LYS A HG2  1  
ATOM 793   H HG3  . LYS A 1 54  ? 6.078   -18.413 10.026  1.00 0.00 ? 54  LYS A HG3  1  
ATOM 794   H HD2  . LYS A 1 54  ? 7.576   -17.276 11.583  1.00 0.00 ? 54  LYS A HD2  1  
ATOM 795   H HD3  . LYS A 1 54  ? 7.374   -15.768 10.689  1.00 0.00 ? 54  LYS A HD3  1  
ATOM 796   H HE2  . LYS A 1 54  ? 5.170   -15.510 11.379  1.00 0.00 ? 54  LYS A HE2  1  
ATOM 797   H HE3  . LYS A 1 54  ? 4.994   -17.217 11.782  1.00 0.00 ? 54  LYS A HE3  1  
ATOM 798   H HZ1  . LYS A 1 54  ? 5.261   -16.423 13.859  1.00 0.00 ? 54  LYS A HZ1  1  
ATOM 799   H HZ2  . LYS A 1 54  ? 6.102   -15.043 13.362  1.00 0.00 ? 54  LYS A HZ2  1  
ATOM 800   H HZ3  . LYS A 1 54  ? 6.907   -16.526 13.480  1.00 0.00 ? 54  LYS A HZ3  1  
ATOM 801   N N    . ASP A 1 55  ? 7.919   -20.884 7.708   1.00 0.00 ? 55  ASP A N    1  
ATOM 802   C CA   . ASP A 1 55  ? 7.619   -22.289 7.959   1.00 0.00 ? 55  ASP A CA   1  
ATOM 803   C C    . ASP A 1 55  ? 7.107   -22.489 9.382   1.00 0.00 ? 55  ASP A C    1  
ATOM 804   O O    . ASP A 1 55  ? 7.881   -22.485 10.338  1.00 0.00 ? 55  ASP A O    1  
ATOM 805   C CB   . ASP A 1 55  ? 8.864   -23.147 7.727   1.00 0.00 ? 55  ASP A CB   1  
ATOM 806   C CG   . ASP A 1 55  ? 8.865   -24.406 8.571   1.00 0.00 ? 55  ASP A CG   1  
ATOM 807   O OD1  . ASP A 1 55  ? 7.771   -24.951 8.825   1.00 0.00 ? 55  ASP A OD1  1  
ATOM 808   O OD2  . ASP A 1 55  ? 9.961   -24.847 8.977   1.00 0.00 ? 55  ASP A OD2  1  
ATOM 809   H H    . ASP A 1 55  ? 8.817   -20.633 7.407   1.00 0.00 ? 55  ASP A H    1  
ATOM 810   H HA   . ASP A 1 55  ? 6.850   -22.593 7.267   1.00 0.00 ? 55  ASP A HA   1  
ATOM 811   H HB2  . ASP A 1 55  ? 8.907   -23.434 6.686   1.00 0.00 ? 55  ASP A HB2  1  
ATOM 812   H HB3  . ASP A 1 55  ? 9.743   -22.569 7.973   1.00 0.00 ? 55  ASP A HB3  1  
ATOM 813   N N    . GLY A 1 56  ? 5.795   -22.664 9.514   1.00 0.00 ? 56  GLY A N    1  
ATOM 814   C CA   . GLY A 1 56  ? 5.201   -22.862 10.823  1.00 0.00 ? 56  GLY A CA   1  
ATOM 815   C C    . GLY A 1 56  ? 5.465   -21.701 11.761  1.00 0.00 ? 56  GLY A C    1  
ATOM 816   O O    . GLY A 1 56  ? 5.329   -20.541 11.375  1.00 0.00 ? 56  GLY A O    1  
ATOM 817   H H    . GLY A 1 56  ? 5.226   -22.659 8.716   1.00 0.00 ? 56  GLY A H    1  
ATOM 818   H HA2  . GLY A 1 56  ? 4.135   -22.984 10.708  1.00 0.00 ? 56  GLY A HA2  1  
ATOM 819   H HA3  . GLY A 1 56  ? 5.611   -23.762 11.259  1.00 0.00 ? 56  GLY A HA3  1  
ATOM 820   N N    . GLU A 1 57  ? 5.841   -22.015 12.997  1.00 0.00 ? 57  GLU A N    1  
ATOM 821   C CA   . GLU A 1 57  ? 6.122   -20.987 13.993  1.00 0.00 ? 57  GLU A CA   1  
ATOM 822   C C    . GLU A 1 57  ? 7.609   -20.648 14.021  1.00 0.00 ? 57  GLU A C    1  
ATOM 823   O O    . GLU A 1 57  ? 7.990   -19.484 14.156  1.00 0.00 ? 57  GLU A O    1  
ATOM 824   C CB   . GLU A 1 57  ? 5.667   -21.451 15.379  1.00 0.00 ? 57  GLU A CB   1  
ATOM 825   C CG   . GLU A 1 57  ? 6.131   -20.544 16.506  1.00 0.00 ? 57  GLU A CG   1  
ATOM 826   C CD   . GLU A 1 57  ? 5.917   -21.160 17.876  1.00 0.00 ? 57  GLU A CD   1  
ATOM 827   O OE1  . GLU A 1 57  ? 4.747   -21.362 18.260  1.00 0.00 ? 57  GLU A OE1  1  
ATOM 828   O OE2  . GLU A 1 57  ? 6.922   -21.441 18.562  1.00 0.00 ? 57  GLU A OE2  1  
ATOM 829   H H    . GLU A 1 57  ? 5.932   -22.958 13.245  1.00 0.00 ? 57  GLU A H    1  
ATOM 830   H HA   . GLU A 1 57  ? 5.568   -20.101 13.721  1.00 0.00 ? 57  GLU A HA   1  
ATOM 831   H HB2  . GLU A 1 57  ? 4.588   -21.490 15.396  1.00 0.00 ? 57  GLU A HB2  1  
ATOM 832   H HB3  . GLU A 1 57  ? 6.057   -22.442 15.559  1.00 0.00 ? 57  GLU A HB3  1  
ATOM 833   H HG2  . GLU A 1 57  ? 7.184   -20.344 16.380  1.00 0.00 ? 57  GLU A HG2  1  
ATOM 834   H HG3  . GLU A 1 57  ? 5.581   -19.617 16.455  1.00 0.00 ? 57  GLU A HG3  1  
ATOM 835   N N    . HIS A 1 58  ? 8.446   -21.672 13.893  1.00 0.00 ? 58  HIS A N    1  
ATOM 836   C CA   . HIS A 1 58  ? 9.893   -21.484 13.903  1.00 0.00 ? 58  HIS A CA   1  
ATOM 837   C C    . HIS A 1 58  ? 10.426  -21.293 12.487  1.00 0.00 ? 58  HIS A C    1  
ATOM 838   O O    . HIS A 1 58  ? 11.552  -21.681 12.179  1.00 0.00 ? 58  HIS A O    1  
ATOM 839   C CB   . HIS A 1 58  ? 10.580  -22.681 14.562  1.00 0.00 ? 58  HIS A CB   1  
ATOM 840   C CG   . HIS A 1 58  ? 10.721  -22.547 16.047  1.00 0.00 ? 58  HIS A CG   1  
ATOM 841   N ND1  . HIS A 1 58  ? 11.865  -22.902 16.729  1.00 0.00 ? 58  HIS A ND1  1  
ATOM 842   C CD2  . HIS A 1 58  ? 9.853   -22.093 16.982  1.00 0.00 ? 58  HIS A CD2  1  
ATOM 843   C CE1  . HIS A 1 58  ? 11.695  -22.673 18.019  1.00 0.00 ? 58  HIS A CE1  1  
ATOM 844   N NE2  . HIS A 1 58  ? 10.482  -22.182 18.199  1.00 0.00 ? 58  HIS A NE2  1  
ATOM 845   H H    . HIS A 1 58  ? 8.083   -22.576 13.789  1.00 0.00 ? 58  HIS A H    1  
ATOM 846   H HA   . HIS A 1 58  ? 10.107  -20.596 14.478  1.00 0.00 ? 58  HIS A HA   1  
ATOM 847   H HB2  . HIS A 1 58  ? 10.004  -23.572 14.363  1.00 0.00 ? 58  HIS A HB2  1  
ATOM 848   H HB3  . HIS A 1 58  ? 11.569  -22.796 14.143  1.00 0.00 ? 58  HIS A HB3  1  
ATOM 849   H HD1  . HIS A 1 58  ? 12.680  -23.268 16.328  1.00 0.00 ? 58  HIS A HD1  1  
ATOM 850   H HD2  . HIS A 1 58  ? 8.851   -21.728 16.804  1.00 0.00 ? 58  HIS A HD2  1  
ATOM 851   H HE1  . HIS A 1 58  ? 12.423  -22.856 18.795  1.00 0.00 ? 58  HIS A HE1  1  
ATOM 852   H HE2  . HIS A 1 58  ? 10.069  -22.005 19.069  1.00 0.00 ? 58  HIS A HE2  1  
ATOM 853   N N    . GLY A 1 59  ? 9.608   -20.693 11.627  1.00 0.00 ? 59  GLY A N    1  
ATOM 854   C CA   . GLY A 1 59  ? 10.015  -20.462 10.254  1.00 0.00 ? 59  GLY A CA   1  
ATOM 855   C C    . GLY A 1 59  ? 10.682  -19.114 10.065  1.00 0.00 ? 59  GLY A C    1  
ATOM 856   O O    . GLY A 1 59  ? 10.813  -18.342 11.014  1.00 0.00 ? 59  GLY A O    1  
ATOM 857   H H    . GLY A 1 59  ? 8.721   -20.404 11.929  1.00 0.00 ? 59  GLY A H    1  
ATOM 858   H HA2  . GLY A 1 59  ? 10.705  -21.238 9.959   1.00 0.00 ? 59  GLY A HA2  1  
ATOM 859   H HA3  . GLY A 1 59  ? 9.142   -20.510 9.619   1.00 0.00 ? 59  GLY A HA3  1  
ATOM 860   N N    . GLU A 1 60  ? 11.106  -18.832 8.837   1.00 0.00 ? 60  GLU A N    1  
ATOM 861   C CA   . GLU A 1 60  ? 11.766  -17.568 8.529   1.00 0.00 ? 60  GLU A CA   1  
ATOM 862   C C    . GLU A 1 60  ? 10.805  -16.607 7.835   1.00 0.00 ? 60  GLU A C    1  
ATOM 863   O O    . GLU A 1 60  ? 10.062  -16.999 6.936   1.00 0.00 ? 60  GLU A O    1  
ATOM 864   C CB   . GLU A 1 60  ? 12.990  -17.809 7.644   1.00 0.00 ? 60  GLU A CB   1  
ATOM 865   C CG   . GLU A 1 60  ? 14.198  -18.330 8.405   1.00 0.00 ? 60  GLU A CG   1  
ATOM 866   C CD   . GLU A 1 60  ? 15.230  -18.969 7.495   1.00 0.00 ? 60  GLU A CD   1  
ATOM 867   O OE1  . GLU A 1 60  ? 16.022  -18.223 6.883   1.00 0.00 ? 60  GLU A OE1  1  
ATOM 868   O OE2  . GLU A 1 60  ? 15.245  -20.213 7.396   1.00 0.00 ? 60  GLU A OE2  1  
ATOM 869   H H    . GLU A 1 60  ? 10.972  -19.488 8.122   1.00 0.00 ? 60  GLU A H    1  
ATOM 870   H HA   . GLU A 1 60  ? 12.087  -17.127 9.460   1.00 0.00 ? 60  GLU A HA   1  
ATOM 871   H HB2  . GLU A 1 60  ? 12.732  -18.529 6.882   1.00 0.00 ? 60  GLU A HB2  1  
ATOM 872   H HB3  . GLU A 1 60  ? 13.265  -16.879 7.169   1.00 0.00 ? 60  GLU A HB3  1  
ATOM 873   H HG2  . GLU A 1 60  ? 14.662  -17.507 8.927   1.00 0.00 ? 60  GLU A HG2  1  
ATOM 874   H HG3  . GLU A 1 60  ? 13.866  -19.067 9.122   1.00 0.00 ? 60  GLU A HG3  1  
ATOM 875   N N    . GLU A 1 61  ? 10.825  -15.348 8.262   1.00 0.00 ? 61  GLU A N    1  
ATOM 876   C CA   . GLU A 1 61  ? 9.955   -14.332 7.682   1.00 0.00 ? 61  GLU A CA   1  
ATOM 877   C C    . GLU A 1 61  ? 10.483  -13.871 6.327   1.00 0.00 ? 61  GLU A C    1  
ATOM 878   O O    . GLU A 1 61  ? 11.238  -12.904 6.241   1.00 0.00 ? 61  GLU A O    1  
ATOM 879   C CB   . GLU A 1 61  ? 9.831   -13.135 8.628   1.00 0.00 ? 61  GLU A CB   1  
ATOM 880   C CG   . GLU A 1 61  ? 9.048   -13.438 9.894   1.00 0.00 ? 61  GLU A CG   1  
ATOM 881   C CD   . GLU A 1 61  ? 9.038   -12.274 10.866  1.00 0.00 ? 61  GLU A CD   1  
ATOM 882   O OE1  . GLU A 1 61  ? 10.134  -11.803 11.238  1.00 0.00 ? 61  GLU A OE1  1  
ATOM 883   O OE2  . GLU A 1 61  ? 7.936   -11.834 11.255  1.00 0.00 ? 61  GLU A OE2  1  
ATOM 884   H H    . GLU A 1 61  ? 11.440  -15.097 8.983   1.00 0.00 ? 61  GLU A H    1  
ATOM 885   H HA   . GLU A 1 61  ? 8.978   -14.771 7.544   1.00 0.00 ? 61  GLU A HA   1  
ATOM 886   H HB2  . GLU A 1 61  ? 10.822  -12.811 8.910   1.00 0.00 ? 61  GLU A HB2  1  
ATOM 887   H HB3  . GLU A 1 61  ? 9.335   -12.330 8.106   1.00 0.00 ? 61  GLU A HB3  1  
ATOM 888   H HG2  . GLU A 1 61  ? 8.029   -13.670 9.625   1.00 0.00 ? 61  GLU A HG2  1  
ATOM 889   H HG3  . GLU A 1 61  ? 9.494   -14.292 10.382  1.00 0.00 ? 61  GLU A HG3  1  
ATOM 890   N N    . GLN A 1 62  ? 10.080  -14.572 5.272   1.00 0.00 ? 62  GLN A N    1  
ATOM 891   C CA   . GLN A 1 62  ? 10.514  -14.236 3.921   1.00 0.00 ? 62  GLN A CA   1  
ATOM 892   C C    . GLN A 1 62  ? 9.455   -13.409 3.200   1.00 0.00 ? 62  GLN A C    1  
ATOM 893   O O    . GLN A 1 62  ? 8.256   -13.608 3.397   1.00 0.00 ? 62  GLN A O    1  
ATOM 894   C CB   . GLN A 1 62  ? 10.812  -15.509 3.127   1.00 0.00 ? 62  GLN A CB   1  
ATOM 895   C CG   . GLN A 1 62  ? 12.027  -16.270 3.632   1.00 0.00 ? 62  GLN A CG   1  
ATOM 896   C CD   . GLN A 1 62  ? 13.315  -15.488 3.468   1.00 0.00 ? 62  GLN A CD   1  
ATOM 897   O OE1  . GLN A 1 62  ? 13.682  -15.098 2.359   1.00 0.00 ? 62  GLN A OE1  1  
ATOM 898   N NE2  . GLN A 1 62  ? 14.010  -15.253 4.575   1.00 0.00 ? 62  GLN A NE2  1  
ATOM 899   H H    . GLN A 1 62  ? 9.478   -15.333 5.405   1.00 0.00 ? 62  GLN A H    1  
ATOM 900   H HA   . GLN A 1 62  ? 11.418  -13.652 3.999   1.00 0.00 ? 62  GLN A HA   1  
ATOM 901   H HB2  . GLN A 1 62  ? 9.955   -16.163 3.183   1.00 0.00 ? 62  GLN A HB2  1  
ATOM 902   H HB3  . GLN A 1 62  ? 10.985  -15.243 2.095   1.00 0.00 ? 62  GLN A HB3  1  
ATOM 903   H HG2  . GLN A 1 62  ? 11.889  -16.490 4.680   1.00 0.00 ? 62  GLN A HG2  1  
ATOM 904   H HG3  . GLN A 1 62  ? 12.111  -17.194 3.079   1.00 0.00 ? 62  GLN A HG3  1  
ATOM 905   H HE21 . GLN A 1 62  ? 13.658  -15.595 5.424   1.00 0.00 ? 62  GLN A HE21 1  
ATOM 906   H HE22 . GLN A 1 62  ? 14.847  -14.751 4.498   1.00 0.00 ? 62  GLN A HE22 1  
ATOM 907   N N    . ARG A 1 63  ? 9.906   -12.480 2.363   1.00 0.00 ? 63  ARG A N    1  
ATOM 908   C CA   . ARG A 1 63  ? 8.998   -11.621 1.613   1.00 0.00 ? 63  ARG A CA   1  
ATOM 909   C C    . ARG A 1 63  ? 9.030   -11.962 0.126   1.00 0.00 ? 63  ARG A C    1  
ATOM 910   O O    . ARG A 1 63  ? 10.089  -12.246 -0.433  1.00 0.00 ? 63  ARG A O    1  
ATOM 911   C CB   . ARG A 1 63  ? 9.366   -10.150 1.818   1.00 0.00 ? 63  ARG A CB   1  
ATOM 912   C CG   . ARG A 1 63  ? 9.060   -9.634  3.214   1.00 0.00 ? 63  ARG A CG   1  
ATOM 913   C CD   . ARG A 1 63  ? 10.181  -9.964  4.188   1.00 0.00 ? 63  ARG A CD   1  
ATOM 914   N NE   . ARG A 1 63  ? 11.242  -8.961  4.161   1.00 0.00 ? 63  ARG A NE   1  
ATOM 915   C CZ   . ARG A 1 63  ? 11.118  -7.746  4.683   1.00 0.00 ? 63  ARG A CZ   1  
ATOM 916   N NH1  . ARG A 1 63  ? 9.985   -7.385  5.270   1.00 0.00 ? 63  ARG A NH1  1  
ATOM 917   N NH2  . ARG A 1 63  ? 12.129  -6.888  4.619   1.00 0.00 ? 63  ARG A NH2  1  
ATOM 918   H H    . ARG A 1 63  ? 10.873  -12.368 2.248   1.00 0.00 ? 63  ARG A H    1  
ATOM 919   H HA   . ARG A 1 63  ? 7.999   -11.788 1.987   1.00 0.00 ? 63  ARG A HA   1  
ATOM 920   H HB2  . ARG A 1 63  ? 10.424  -10.028 1.637   1.00 0.00 ? 63  ARG A HB2  1  
ATOM 921   H HB3  . ARG A 1 63  ? 8.816   -9.552  1.108   1.00 0.00 ? 63  ARG A HB3  1  
ATOM 922   H HG2  . ARG A 1 63  ? 8.938   -8.562  3.173   1.00 0.00 ? 63  ARG A HG2  1  
ATOM 923   H HG3  . ARG A 1 63  ? 8.146   -10.090 3.564   1.00 0.00 ? 63  ARG A HG3  1  
ATOM 924   H HD2  . ARG A 1 63  ? 9.770   -10.013 5.185   1.00 0.00 ? 63  ARG A HD2  1  
ATOM 925   H HD3  . ARG A 1 63  ? 10.598  -10.924 3.923   1.00 0.00 ? 63  ARG A HD3  1  
ATOM 926   H HE   . ARG A 1 63  ? 12.088  -9.206  3.732   1.00 0.00 ? 63  ARG A HE   1  
ATOM 927   H HH11 . ARG A 1 63  ? 9.222   -8.029  5.320   1.00 0.00 ? 63  ARG A HH11 1  
ATOM 928   H HH12 . ARG A 1 63  ? 9.895   -6.470  5.663   1.00 0.00 ? 63  ARG A HH12 1  
ATOM 929   H HH21 . ARG A 1 63  ? 12.984  -7.157  4.178   1.00 0.00 ? 63  ARG A HH21 1  
ATOM 930   H HH22 . ARG A 1 63  ? 12.034  -5.974  5.012   1.00 0.00 ? 63  ARG A HH22 1  
ATOM 931   N N    . ILE A 1 64  ? 7.862   -11.933 -0.507  1.00 0.00 ? 64  ILE A N    1  
ATOM 932   C CA   . ILE A 1 64  ? 7.757   -12.239 -1.929  1.00 0.00 ? 64  ILE A CA   1  
ATOM 933   C C    . ILE A 1 64  ? 7.247   -11.035 -2.714  1.00 0.00 ? 64  ILE A C    1  
ATOM 934   O O    . ILE A 1 64  ? 6.398   -10.282 -2.237  1.00 0.00 ? 64  ILE A O    1  
ATOM 935   C CB   . ILE A 1 64  ? 6.820   -13.435 -2.180  1.00 0.00 ? 64  ILE A CB   1  
ATOM 936   C CG1  . ILE A 1 64  ? 7.173   -14.592 -1.242  1.00 0.00 ? 64  ILE A CG1  1  
ATOM 937   C CG2  . ILE A 1 64  ? 6.905   -13.879 -3.632  1.00 0.00 ? 64  ILE A CG2  1  
ATOM 938   C CD1  . ILE A 1 64  ? 6.249   -15.782 -1.378  1.00 0.00 ? 64  ILE A CD1  1  
ATOM 939   H H    . ILE A 1 64  ? 7.053   -11.700 -0.008  1.00 0.00 ? 64  ILE A H    1  
ATOM 940   H HA   . ILE A 1 64  ? 8.743   -12.498 -2.287  1.00 0.00 ? 64  ILE A HA   1  
ATOM 941   H HB   . ILE A 1 64  ? 5.807   -13.118 -1.984  1.00 0.00 ? 64  ILE A HB   1  
ATOM 942   H HG12 . ILE A 1 64  ? 8.176   -14.926 -1.454  1.00 0.00 ? 64  ILE A HG12 1  
ATOM 943   H HG13 . ILE A 1 64  ? 7.121   -14.246 -0.220  1.00 0.00 ? 64  ILE A HG13 1  
ATOM 944   H HG21 . ILE A 1 64  ? 7.312   -13.076 -4.230  1.00 0.00 ? 64  ILE A HG21 1  
ATOM 945   H HG22 . ILE A 1 64  ? 7.547   -14.743 -3.707  1.00 0.00 ? 64  ILE A HG22 1  
ATOM 946   H HG23 . ILE A 1 64  ? 5.918   -14.130 -3.991  1.00 0.00 ? 64  ILE A HG23 1  
ATOM 947   H HD11 . ILE A 1 64  ? 5.727   -15.941 -0.446  1.00 0.00 ? 64  ILE A HD11 1  
ATOM 948   H HD12 . ILE A 1 64  ? 5.534   -15.596 -2.165  1.00 0.00 ? 64  ILE A HD12 1  
ATOM 949   H HD13 . ILE A 1 64  ? 6.828   -16.662 -1.619  1.00 0.00 ? 64  ILE A HD13 1  
ATOM 950   N N    . THR A 1 65  ? 7.771   -10.859 -3.923  1.00 0.00 ? 65  THR A N    1  
ATOM 951   C CA   . THR A 1 65  ? 7.369   -9.747  -4.776  1.00 0.00 ? 65  THR A CA   1  
ATOM 952   C C    . THR A 1 65  ? 6.095   -10.076 -5.544  1.00 0.00 ? 65  THR A C    1  
ATOM 953   O O    . THR A 1 65  ? 6.147   -10.633 -6.641  1.00 0.00 ? 65  THR A O    1  
ATOM 954   C CB   . THR A 1 65  ? 8.479   -9.379  -5.778  1.00 0.00 ? 65  THR A CB   1  
ATOM 955   O OG1  . THR A 1 65  ? 9.723   -9.205  -5.091  1.00 0.00 ? 65  THR A OG1  1  
ATOM 956   C CG2  . THR A 1 65  ? 8.127   -8.104  -6.530  1.00 0.00 ? 65  THR A CG2  1  
ATOM 957   H H    . THR A 1 65  ? 8.445   -11.492 -4.248  1.00 0.00 ? 65  THR A H    1  
ATOM 958   H HA   . THR A 1 65  ? 7.186   -8.891  -4.143  1.00 0.00 ? 65  THR A HA   1  
ATOM 959   H HB   . THR A 1 65  ? 8.580   -10.184 -6.492  1.00 0.00 ? 65  THR A HB   1  
ATOM 960   H HG1  . THR A 1 65  ? 10.266  -9.989  -5.208  1.00 0.00 ? 65  THR A HG1  1  
ATOM 961   H HG21 . THR A 1 65  ? 7.070   -8.094  -6.748  1.00 0.00 ? 65  THR A HG21 1  
ATOM 962   H HG22 . THR A 1 65  ? 8.685   -8.065  -7.454  1.00 0.00 ? 65  THR A HG22 1  
ATOM 963   H HG23 . THR A 1 65  ? 8.377   -7.247  -5.922  1.00 0.00 ? 65  THR A HG23 1  
ATOM 964   N N    . ILE A 1 66  ? 4.952   -9.728  -4.962  1.00 0.00 ? 66  ILE A N    1  
ATOM 965   C CA   . ILE A 1 66  ? 3.664   -9.986  -5.594  1.00 0.00 ? 66  ILE A CA   1  
ATOM 966   C C    . ILE A 1 66  ? 3.233   -8.809  -6.463  1.00 0.00 ? 66  ILE A C    1  
ATOM 967   O O    . ILE A 1 66  ? 3.577   -7.661  -6.184  1.00 0.00 ? 66  ILE A O    1  
ATOM 968   C CB   . ILE A 1 66  ? 2.569   -10.264 -4.547  1.00 0.00 ? 66  ILE A CB   1  
ATOM 969   C CG1  . ILE A 1 66  ? 3.169   -10.958 -3.322  1.00 0.00 ? 66  ILE A CG1  1  
ATOM 970   C CG2  . ILE A 1 66  ? 1.461   -11.112 -5.153  1.00 0.00 ? 66  ILE A CG2  1  
ATOM 971   C CD1  . ILE A 1 66  ? 2.133   -11.411 -2.317  1.00 0.00 ? 66  ILE A CD1  1  
ATOM 972   H H    . ILE A 1 66  ? 4.976   -9.287  -4.087  1.00 0.00 ? 66  ILE A H    1  
ATOM 973   H HA   . ILE A 1 66  ? 3.769   -10.861 -6.218  1.00 0.00 ? 66  ILE A HA   1  
ATOM 974   H HB   . ILE A 1 66  ? 2.143   -9.320  -4.245  1.00 0.00 ? 66  ILE A HB   1  
ATOM 975   H HG12 . ILE A 1 66  ? 3.721   -11.827 -3.643  1.00 0.00 ? 66  ILE A HG12 1  
ATOM 976   H HG13 . ILE A 1 66  ? 3.840   -10.274 -2.823  1.00 0.00 ? 66  ILE A HG13 1  
ATOM 977   H HG21 . ILE A 1 66  ? 1.490   -11.027 -6.229  1.00 0.00 ? 66  ILE A HG21 1  
ATOM 978   H HG22 . ILE A 1 66  ? 1.603   -12.145 -4.871  1.00 0.00 ? 66  ILE A HG22 1  
ATOM 979   H HG23 . ILE A 1 66  ? 0.504   -10.768 -4.790  1.00 0.00 ? 66  ILE A HG23 1  
ATOM 980   H HD11 . ILE A 1 66  ? 1.144   -11.243 -2.718  1.00 0.00 ? 66  ILE A HD11 1  
ATOM 981   H HD12 . ILE A 1 66  ? 2.266   -12.462 -2.112  1.00 0.00 ? 66  ILE A HD12 1  
ATOM 982   H HD13 . ILE A 1 66  ? 2.250   -10.848 -1.402  1.00 0.00 ? 66  ILE A HD13 1  
ATOM 983   N N    . GLU A 1 67  ? 2.477   -9.104  -7.516  1.00 0.00 ? 67  GLU A N    1  
ATOM 984   C CA   . GLU A 1 67  ? 1.998   -8.069  -8.425  1.00 0.00 ? 67  GLU A CA   1  
ATOM 985   C C    . GLU A 1 67  ? 0.837   -7.296  -7.807  1.00 0.00 ? 67  GLU A C    1  
ATOM 986   O O    . GLU A 1 67  ? 0.002   -7.849  -7.090  1.00 0.00 ? 67  GLU A O    1  
ATOM 987   C CB   . GLU A 1 67  ? 1.562   -8.689  -9.754  1.00 0.00 ? 67  GLU A CB   1  
ATOM 988   C CG   . GLU A 1 67  ? 0.289   -9.512  -9.653  1.00 0.00 ? 67  GLU A CG   1  
ATOM 989   C CD   . GLU A 1 67  ? 0.036   -10.348 -10.893 1.00 0.00 ? 67  GLU A CD   1  
ATOM 990   O OE1  . GLU A 1 67  ? 0.028   -9.777  -12.003 1.00 0.00 ? 67  GLU A OE1  1  
ATOM 991   O OE2  . GLU A 1 67  ? -0.155  -11.574 -10.752 1.00 0.00 ? 67  GLU A OE2  1  
ATOM 992   H H    . GLU A 1 67  ? 2.236   -10.038 -7.686  1.00 0.00 ? 67  GLU A H    1  
ATOM 993   H HA   . GLU A 1 67  ? 2.813   -7.385  -8.608  1.00 0.00 ? 67  GLU A HA   1  
ATOM 994   H HB2  . GLU A 1 67  ? 1.399   -7.897  -10.471 1.00 0.00 ? 67  GLU A HB2  1  
ATOM 995   H HB3  . GLU A 1 67  ? 2.353   -9.330  -10.114 1.00 0.00 ? 67  GLU A HB3  1  
ATOM 996   H HG2  . GLU A 1 67  ? 0.369   -10.173 -8.803  1.00 0.00 ? 67  GLU A HG2  1  
ATOM 997   H HG3  . GLU A 1 67  ? -0.546  -8.843  -9.511  1.00 0.00 ? 67  GLU A HG3  1  
ATOM 998   N N    . PRO A 1 68  ? 0.782   -5.986  -8.088  1.00 0.00 ? 68  PRO A N    1  
ATOM 999   C CA   . PRO A 1 68  ? -0.272  -5.108  -7.570  1.00 0.00 ? 68  PRO A CA   1  
ATOM 1000  C C    . PRO A 1 68  ? -1.630  -5.400  -8.198  1.00 0.00 ? 68  PRO A C    1  
ATOM 1001  O O    . PRO A 1 68  ? -2.050  -4.724  -9.136  1.00 0.00 ? 68  PRO A O    1  
ATOM 1002  C CB   . PRO A 1 68  ? 0.208   -3.708  -7.962  1.00 0.00 ? 68  PRO A CB   1  
ATOM 1003  C CG   . PRO A 1 68  ? 1.084   -3.926  -9.147  1.00 0.00 ? 68  PRO A CG   1  
ATOM 1004  C CD   . PRO A 1 68  ? 1.744   -5.260  -8.935  1.00 0.00 ? 68  PRO A CD   1  
ATOM 1005  H HA   . PRO A 1 68  ? -0.351  -5.176  -6.495  1.00 0.00 ? 68  PRO A HA   1  
ATOM 1006  H HB2  . PRO A 1 68  ? -0.643  -3.089  -8.206  1.00 0.00 ? 68  PRO A HB2  1  
ATOM 1007  H HB3  . PRO A 1 68  ? 0.756   -3.270  -7.141  1.00 0.00 ? 68  PRO A HB3  1  
ATOM 1008  H HG2  . PRO A 1 68  ? 0.488   -3.941  -10.046 1.00 0.00 ? 68  PRO A HG2  1  
ATOM 1009  H HG3  . PRO A 1 68  ? 1.828   -3.145  -9.201  1.00 0.00 ? 68  PRO A HG3  1  
ATOM 1010  H HD2  . PRO A 1 68  ? 1.885   -5.766  -9.879  1.00 0.00 ? 68  PRO A HD2  1  
ATOM 1011  H HD3  . PRO A 1 68  ? 2.688   -5.138  -8.426  1.00 0.00 ? 68  PRO A HD3  1  
ATOM 1012  N N    . GLY A 1 69  ? -2.314  -6.413  -7.674  1.00 0.00 ? 69  GLY A N    1  
ATOM 1013  C CA   . GLY A 1 69  ? -3.619  -6.776  -8.196  1.00 0.00 ? 69  GLY A CA   1  
ATOM 1014  C C    . GLY A 1 69  ? -4.628  -7.047  -7.097  1.00 0.00 ? 69  GLY A C    1  
ATOM 1015  O O    . GLY A 1 69  ? -4.801  -6.234  -6.188  1.00 0.00 ? 69  GLY A O    1  
ATOM 1016  H H    . GLY A 1 69  ? -1.930  -6.917  -6.926  1.00 0.00 ? 69  GLY A H    1  
ATOM 1017  H HA2  . GLY A 1 69  ? -3.984  -5.971  -8.815  1.00 0.00 ? 69  GLY A HA2  1  
ATOM 1018  H HA3  . GLY A 1 69  ? -3.517  -7.665  -8.801  1.00 0.00 ? 69  GLY A HA3  1  
ATOM 1019  N N    . THR A 1 70  ? -5.299  -8.191  -7.181  1.00 0.00 ? 70  THR A N    1  
ATOM 1020  C CA   . THR A 1 70  ? -6.299  -8.565  -6.189  1.00 0.00 ? 70  THR A CA   1  
ATOM 1021  C C    . THR A 1 70  ? -5.985  -9.926  -5.579  1.00 0.00 ? 70  THR A C    1  
ATOM 1022  O O    . THR A 1 70  ? -6.260  -10.169 -4.403  1.00 0.00 ? 70  THR A O    1  
ATOM 1023  C CB   . THR A 1 70  ? -7.712  -8.604  -6.801  1.00 0.00 ? 70  THR A CB   1  
ATOM 1024  O OG1  . THR A 1 70  ? -7.714  -9.422  -7.977  1.00 0.00 ? 70  THR A OG1  1  
ATOM 1025  C CG2  . THR A 1 70  ? -8.188  -7.202  -7.152  1.00 0.00 ? 70  THR A CG2  1  
ATOM 1026  H H    . THR A 1 70  ? -5.117  -8.797  -7.930  1.00 0.00 ? 70  THR A H    1  
ATOM 1027  H HA   . THR A 1 70  ? -6.288  -7.820  -5.407  1.00 0.00 ? 70  THR A HA   1  
ATOM 1028  H HB   . THR A 1 70  ? -8.391  -9.028  -6.075  1.00 0.00 ? 70  THR A HB   1  
ATOM 1029  H HG1  . THR A 1 70  ? -8.608  -9.482  -8.323  1.00 0.00 ? 70  THR A HG1  1  
ATOM 1030  H HG21 . THR A 1 70  ? -8.936  -6.887  -6.439  1.00 0.00 ? 70  THR A HG21 1  
ATOM 1031  H HG22 . THR A 1 70  ? -8.613  -7.204  -8.144  1.00 0.00 ? 70  THR A HG22 1  
ATOM 1032  H HG23 . THR A 1 70  ? -7.352  -6.520  -7.120  1.00 0.00 ? 70  THR A HG23 1  
ATOM 1033  N N    . SER A 1 71  ? -5.406  -10.812 -6.384  1.00 0.00 ? 71  SER A N    1  
ATOM 1034  C CA   . SER A 1 71  ? -5.058  -12.151 -5.923  1.00 0.00 ? 71  SER A CA   1  
ATOM 1035  C C    . SER A 1 71  ? -3.727  -12.601 -6.519  1.00 0.00 ? 71  SER A C    1  
ATOM 1036  O O    . SER A 1 71  ? -3.244  -12.024 -7.494  1.00 0.00 ? 71  SER A O    1  
ATOM 1037  C CB   . SER A 1 71  ? -6.159  -13.144 -6.296  1.00 0.00 ? 71  SER A CB   1  
ATOM 1038  O OG   . SER A 1 71  ? -6.255  -13.296 -7.702  1.00 0.00 ? 71  SER A OG   1  
ATOM 1039  H H    . SER A 1 71  ? -5.212  -10.559 -7.311  1.00 0.00 ? 71  SER A H    1  
ATOM 1040  H HA   . SER A 1 71  ? -4.964  -12.117 -4.848  1.00 0.00 ? 71  SER A HA   1  
ATOM 1041  H HB2  . SER A 1 71  ? -5.937  -14.105 -5.858  1.00 0.00 ? 71  SER A HB2  1  
ATOM 1042  H HB3  . SER A 1 71  ? -7.106  -12.786 -5.919  1.00 0.00 ? 71  SER A HB3  1  
ATOM 1043  H HG   . SER A 1 71  ? -6.012  -12.471 -8.130  1.00 0.00 ? 71  SER A HG   1  
ATOM 1044  N N    . TYR A 1 72  ? -3.141  -13.635 -5.927  1.00 0.00 ? 72  TYR A N    1  
ATOM 1045  C CA   . TYR A 1 72  ? -1.865  -14.162 -6.396  1.00 0.00 ? 72  TYR A CA   1  
ATOM 1046  C C    . TYR A 1 72  ? -1.770  -15.664 -6.144  1.00 0.00 ? 72  TYR A C    1  
ATOM 1047  O O    . TYR A 1 72  ? -2.349  -16.182 -5.189  1.00 0.00 ? 72  TYR A O    1  
ATOM 1048  C CB   . TYR A 1 72  ? -0.706  -13.443 -5.704  1.00 0.00 ? 72  TYR A CB   1  
ATOM 1049  C CG   . TYR A 1 72  ? 0.641   -14.082 -5.956  1.00 0.00 ? 72  TYR A CG   1  
ATOM 1050  C CD1  . TYR A 1 72  ? 1.378   -13.771 -7.092  1.00 0.00 ? 72  TYR A CD1  1  
ATOM 1051  C CD2  . TYR A 1 72  ? 1.176   -14.997 -5.058  1.00 0.00 ? 72  TYR A CD2  1  
ATOM 1052  C CE1  . TYR A 1 72  ? 2.608   -14.354 -7.326  1.00 0.00 ? 72  TYR A CE1  1  
ATOM 1053  C CE2  . TYR A 1 72  ? 2.406   -15.584 -5.283  1.00 0.00 ? 72  TYR A CE2  1  
ATOM 1054  C CZ   . TYR A 1 72  ? 3.118   -15.259 -6.419  1.00 0.00 ? 72  TYR A CZ   1  
ATOM 1055  O OH   . TYR A 1 72  ? 4.344   -15.841 -6.648  1.00 0.00 ? 72  TYR A OH   1  
ATOM 1056  H H    . TYR A 1 72  ? -3.575  -14.053 -5.154  1.00 0.00 ? 72  TYR A H    1  
ATOM 1057  H HA   . TYR A 1 72  ? -1.803  -13.983 -7.460  1.00 0.00 ? 72  TYR A HA   1  
ATOM 1058  H HB2  . TYR A 1 72  ? -0.660  -12.424 -6.058  1.00 0.00 ? 72  TYR A HB2  1  
ATOM 1059  H HB3  . TYR A 1 72  ? -0.878  -13.441 -4.638  1.00 0.00 ? 72  TYR A HB3  1  
ATOM 1060  H HD1  . TYR A 1 72  ? 0.976   -13.061 -7.800  1.00 0.00 ? 72  TYR A HD1  1  
ATOM 1061  H HD2  . TYR A 1 72  ? 0.616   -15.249 -4.169  1.00 0.00 ? 72  TYR A HD2  1  
ATOM 1062  H HE1  . TYR A 1 72  ? 3.166   -14.100 -8.215  1.00 0.00 ? 72  TYR A HE1  1  
ATOM 1063  H HE2  . TYR A 1 72  ? 2.806   -16.293 -4.573  1.00 0.00 ? 72  TYR A HE2  1  
ATOM 1064  H HH   . TYR A 1 72  ? 4.540   -16.464 -5.944  1.00 0.00 ? 72  TYR A HH   1  
ATOM 1065  N N    . ARG A 1 73  ? -1.035  -16.357 -7.007  1.00 0.00 ? 73  ARG A N    1  
ATOM 1066  C CA   . ARG A 1 73  ? -0.863  -17.799 -6.879  1.00 0.00 ? 73  ARG A CA   1  
ATOM 1067  C C    . ARG A 1 73  ? 0.561   -18.141 -6.450  1.00 0.00 ? 73  ARG A C    1  
ATOM 1068  O O    . ARG A 1 73  ? 1.514   -17.934 -7.202  1.00 0.00 ? 73  ARG A O    1  
ATOM 1069  C CB   . ARG A 1 73  ? -1.188  -18.492 -8.204  1.00 0.00 ? 73  ARG A CB   1  
ATOM 1070  C CG   . ARG A 1 73  ? -1.159  -20.009 -8.120  1.00 0.00 ? 73  ARG A CG   1  
ATOM 1071  C CD   . ARG A 1 73  ? -1.479  -20.647 -9.463  1.00 0.00 ? 73  ARG A CD   1  
ATOM 1072  N NE   . ARG A 1 73  ? -0.282  -20.839 -10.278 1.00 0.00 ? 73  ARG A NE   1  
ATOM 1073  C CZ   . ARG A 1 73  ? -0.314  -21.133 -11.573 1.00 0.00 ? 73  ARG A CZ   1  
ATOM 1074  N NH1  . ARG A 1 73  ? -1.476  -21.268 -12.197 1.00 0.00 ? 73  ARG A NH1  1  
ATOM 1075  N NH2  . ARG A 1 73  ? 0.818   -21.291 -12.246 1.00 0.00 ? 73  ARG A NH2  1  
ATOM 1076  H H    . ARG A 1 73  ? -0.598  -15.887 -7.748  1.00 0.00 ? 73  ARG A H    1  
ATOM 1077  H HA   . ARG A 1 73  ? -1.549  -18.149 -6.122  1.00 0.00 ? 73  ARG A HA   1  
ATOM 1078  H HB2  . ARG A 1 73  ? -2.175  -18.190 -8.522  1.00 0.00 ? 73  ARG A HB2  1  
ATOM 1079  H HB3  . ARG A 1 73  ? -0.468  -18.180 -8.945  1.00 0.00 ? 73  ARG A HB3  1  
ATOM 1080  H HG2  . ARG A 1 73  ? -0.174  -20.325 -7.810  1.00 0.00 ? 73  ARG A HG2  1  
ATOM 1081  H HG3  . ARG A 1 73  ? -1.888  -20.334 -7.393  1.00 0.00 ? 73  ARG A HG3  1  
ATOM 1082  H HD2  . ARG A 1 73  ? -1.942  -21.607 -9.289  1.00 0.00 ? 73  ARG A HD2  1  
ATOM 1083  H HD3  . ARG A 1 73  ? -2.167  -20.008 -9.995  1.00 0.00 ? 73  ARG A HD3  1  
ATOM 1084  H HE   . ARG A 1 73  ? 0.587   -20.743 -9.836  1.00 0.00 ? 73  ARG A HE   1  
ATOM 1085  H HH11 . ARG A 1 73  ? -2.331  -21.148 -11.692 1.00 0.00 ? 73  ARG A HH11 1  
ATOM 1086  H HH12 . ARG A 1 73  ? -1.497  -21.488 -13.172 1.00 0.00 ? 73  ARG A HH12 1  
ATOM 1087  H HH21 . ARG A 1 73  ? 1.696   -21.190 -11.779 1.00 0.00 ? 73  ARG A HH21 1  
ATOM 1088  H HH22 . ARG A 1 73  ? 0.793   -21.513 -13.220 1.00 0.00 ? 73  ARG A HH22 1  
ATOM 1089  N N    . LEU A 1 74  ? 0.697   -18.665 -5.237  1.00 0.00 ? 74  LEU A N    1  
ATOM 1090  C CA   . LEU A 1 74  ? 2.004   -19.036 -4.706  1.00 0.00 ? 74  LEU A CA   1  
ATOM 1091  C C    . LEU A 1 74  ? 2.267   -20.526 -4.898  1.00 0.00 ? 74  LEU A C    1  
ATOM 1092  O O    . LEU A 1 74  ? 1.399   -21.357 -4.633  1.00 0.00 ? 74  LEU A O    1  
ATOM 1093  C CB   . LEU A 1 74  ? 2.095   -18.677 -3.222  1.00 0.00 ? 74  LEU A CB   1  
ATOM 1094  C CG   . LEU A 1 74  ? 3.426   -18.989 -2.536  1.00 0.00 ? 74  LEU A CG   1  
ATOM 1095  C CD1  . LEU A 1 74  ? 4.563   -18.238 -3.211  1.00 0.00 ? 74  LEU A CD1  1  
ATOM 1096  C CD2  . LEU A 1 74  ? 3.357   -18.639 -1.056  1.00 0.00 ? 74  LEU A CD2  1  
ATOM 1097  H H    . LEU A 1 74  ? -0.099  -18.806 -4.684  1.00 0.00 ? 74  LEU A H    1  
ATOM 1098  H HA   . LEU A 1 74  ? 2.753   -18.478 -5.249  1.00 0.00 ? 74  LEU A HA   1  
ATOM 1099  H HB2  . LEU A 1 74  ? 1.914   -17.618 -3.126  1.00 0.00 ? 74  LEU A HB2  1  
ATOM 1100  H HB3  . LEU A 1 74  ? 1.319   -19.222 -2.703  1.00 0.00 ? 74  LEU A HB3  1  
ATOM 1101  H HG   . LEU A 1 74  ? 3.628   -20.047 -2.622  1.00 0.00 ? 74  LEU A HG   1  
ATOM 1102  H HD11 . LEU A 1 74  ? 4.253   -17.224 -3.415  1.00 0.00 ? 74  LEU A HD11 1  
ATOM 1103  H HD12 . LEU A 1 74  ? 4.819   -18.730 -4.138  1.00 0.00 ? 74  LEU A HD12 1  
ATOM 1104  H HD13 . LEU A 1 74  ? 5.424   -18.228 -2.560  1.00 0.00 ? 74  LEU A HD13 1  
ATOM 1105  H HD21 . LEU A 1 74  ? 2.981   -19.487 -0.504  1.00 0.00 ? 74  LEU A HD21 1  
ATOM 1106  H HD22 . LEU A 1 74  ? 2.697   -17.796 -0.916  1.00 0.00 ? 74  LEU A HD22 1  
ATOM 1107  H HD23 . LEU A 1 74  ? 4.345   -18.387 -0.700  1.00 0.00 ? 74  LEU A HD23 1  
ATOM 1108  N N    . GLN A 1 75  ? 3.470   -20.855 -5.358  1.00 0.00 ? 75  GLN A N    1  
ATOM 1109  C CA   . GLN A 1 75  ? 3.847   -22.246 -5.583  1.00 0.00 ? 75  GLN A CA   1  
ATOM 1110  C C    . GLN A 1 75  ? 5.173   -22.567 -4.902  1.00 0.00 ? 75  GLN A C    1  
ATOM 1111  O O    . GLN A 1 75  ? 5.925   -21.668 -4.528  1.00 0.00 ? 75  GLN A O    1  
ATOM 1112  C CB   . GLN A 1 75  ? 3.947   -22.532 -7.082  1.00 0.00 ? 75  GLN A CB   1  
ATOM 1113  C CG   . GLN A 1 75  ? 2.719   -22.102 -7.867  1.00 0.00 ? 75  GLN A CG   1  
ATOM 1114  C CD   . GLN A 1 75  ? 2.690   -22.680 -9.269  1.00 0.00 ? 75  GLN A CD   1  
ATOM 1115  O OE1  . GLN A 1 75  ? 3.677   -22.609 -10.002 1.00 0.00 ? 75  GLN A OE1  1  
ATOM 1116  N NE2  . GLN A 1 75  ? 1.556   -23.256 -9.648  1.00 0.00 ? 75  GLN A NE2  1  
ATOM 1117  H H    . GLN A 1 75  ? 4.119   -20.147 -5.550  1.00 0.00 ? 75  GLN A H    1  
ATOM 1118  H HA   . GLN A 1 75  ? 3.077   -22.871 -5.157  1.00 0.00 ? 75  GLN A HA   1  
ATOM 1119  H HB2  . GLN A 1 75  ? 4.804   -22.010 -7.480  1.00 0.00 ? 75  GLN A HB2  1  
ATOM 1120  H HB3  . GLN A 1 75  ? 4.085   -23.594 -7.225  1.00 0.00 ? 75  GLN A HB3  1  
ATOM 1121  H HG2  . GLN A 1 75  ? 1.836   -22.433 -7.340  1.00 0.00 ? 75  GLN A HG2  1  
ATOM 1122  H HG3  . GLN A 1 75  ? 2.712   -21.024 -7.938  1.00 0.00 ? 75  GLN A HG3  1  
ATOM 1123  H HE21 . GLN A 1 75  ? 0.811   -23.274 -9.011  1.00 0.00 ? 75  GLN A HE21 1  
ATOM 1124  H HE22 . GLN A 1 75  ? 1.509   -23.637 -10.549 1.00 0.00 ? 75  GLN A HE22 1  
ATOM 1125  N N    . GLY A 1 76  ? 5.454   -23.857 -4.743  1.00 0.00 ? 76  GLY A N    1  
ATOM 1126  C CA   . GLY A 1 76  ? 6.689   -24.275 -4.107  1.00 0.00 ? 76  GLY A CA   1  
ATOM 1127  C C    . GLY A 1 76  ? 6.555   -24.394 -2.601  1.00 0.00 ? 76  GLY A C    1  
ATOM 1128  O O    . GLY A 1 76  ? 7.233   -23.690 -1.852  1.00 0.00 ? 76  GLY A O    1  
ATOM 1129  H H    . GLY A 1 76  ? 4.817   -24.531 -5.061  1.00 0.00 ? 76  GLY A H    1  
ATOM 1130  H HA2  . GLY A 1 76  ? 6.983   -25.233 -4.508  1.00 0.00 ? 76  GLY A HA2  1  
ATOM 1131  H HA3  . GLY A 1 76  ? 7.459   -23.551 -4.331  1.00 0.00 ? 76  GLY A HA3  1  
ATOM 1132  N N    . LEU A 1 77  ? 5.676   -25.286 -2.157  1.00 0.00 ? 77  LEU A N    1  
ATOM 1133  C CA   . LEU A 1 77  ? 5.453   -25.494 -0.730  1.00 0.00 ? 77  LEU A CA   1  
ATOM 1134  C C    . LEU A 1 77  ? 5.448   -26.981 -0.391  1.00 0.00 ? 77  LEU A C    1  
ATOM 1135  O O    . LEU A 1 77  ? 5.441   -27.832 -1.280  1.00 0.00 ? 77  LEU A O    1  
ATOM 1136  C CB   . LEU A 1 77  ? 4.129   -24.858 -0.303  1.00 0.00 ? 77  LEU A CB   1  
ATOM 1137  C CG   . LEU A 1 77  ? 3.950   -23.380 -0.654  1.00 0.00 ? 77  LEU A CG   1  
ATOM 1138  C CD1  . LEU A 1 77  ? 2.487   -22.978 -0.543  1.00 0.00 ? 77  LEU A CD1  1  
ATOM 1139  C CD2  . LEU A 1 77  ? 4.814   -22.510 0.247   1.00 0.00 ? 77  LEU A CD2  1  
ATOM 1140  H H    . LEU A 1 77  ? 5.165   -25.817 -2.802  1.00 0.00 ? 77  LEU A H    1  
ATOM 1141  H HA   . LEU A 1 77  ? 6.261   -25.017 -0.195  1.00 0.00 ? 77  LEU A HA   1  
ATOM 1142  H HB2  . LEU A 1 77  ? 3.330   -25.408 -0.775  1.00 0.00 ? 77  LEU A HB2  1  
ATOM 1143  H HB3  . LEU A 1 77  ? 4.047   -24.956 0.770   1.00 0.00 ? 77  LEU A HB3  1  
ATOM 1144  H HG   . LEU A 1 77  ? 4.263   -23.219 -1.676  1.00 0.00 ? 77  LEU A HG   1  
ATOM 1145  H HD11 . LEU A 1 77  ? 2.219   -22.362 -1.388  1.00 0.00 ? 77  LEU A HD11 1  
ATOM 1146  H HD12 . LEU A 1 77  ? 2.335   -22.424 0.371   1.00 0.00 ? 77  LEU A HD12 1  
ATOM 1147  H HD13 . LEU A 1 77  ? 1.871   -23.865 -0.533  1.00 0.00 ? 77  LEU A HD13 1  
ATOM 1148  H HD21 . LEU A 1 77  ? 5.820   -22.476 -0.143  1.00 0.00 ? 77  LEU A HD21 1  
ATOM 1149  H HD22 . LEU A 1 77  ? 4.828   -22.927 1.244   1.00 0.00 ? 77  LEU A HD22 1  
ATOM 1150  H HD23 . LEU A 1 77  ? 4.406   -21.510 0.280   1.00 0.00 ? 77  LEU A HD23 1  
ATOM 1151  N N    . LYS A 1 78  ? 5.451   -27.287 0.902   1.00 0.00 ? 78  LYS A N    1  
ATOM 1152  C CA   . LYS A 1 78  ? 5.444   -28.672 1.361   1.00 0.00 ? 78  LYS A CA   1  
ATOM 1153  C C    . LYS A 1 78  ? 4.027   -29.126 1.696   1.00 0.00 ? 78  LYS A C    1  
ATOM 1154  O O    . LYS A 1 78  ? 3.204   -28.358 2.194   1.00 0.00 ? 78  LYS A O    1  
ATOM 1155  C CB   . LYS A 1 78  ? 6.345   -28.829 2.588   1.00 0.00 ? 78  LYS A CB   1  
ATOM 1156  C CG   . LYS A 1 78  ? 7.828   -28.745 2.268   1.00 0.00 ? 78  LYS A CG   1  
ATOM 1157  C CD   . LYS A 1 78  ? 8.359   -30.067 1.739   1.00 0.00 ? 78  LYS A CD   1  
ATOM 1158  C CE   . LYS A 1 78  ? 9.764   -29.917 1.176   1.00 0.00 ? 78  LYS A CE   1  
ATOM 1159  N NZ   . LYS A 1 78  ? 10.798  -29.959 2.247   1.00 0.00 ? 78  LYS A NZ   1  
ATOM 1160  H H    . LYS A 1 78  ? 5.457   -26.564 1.564   1.00 0.00 ? 78  LYS A H    1  
ATOM 1161  H HA   . LYS A 1 78  ? 5.827   -29.288 0.562   1.00 0.00 ? 78  LYS A HA   1  
ATOM 1162  H HB2  . LYS A 1 78  ? 6.107   -28.050 3.297   1.00 0.00 ? 78  LYS A HB2  1  
ATOM 1163  H HB3  . LYS A 1 78  ? 6.150   -29.789 3.042   1.00 0.00 ? 78  LYS A HB3  1  
ATOM 1164  H HG2  . LYS A 1 78  ? 7.983   -27.982 1.520   1.00 0.00 ? 78  LYS A HG2  1  
ATOM 1165  H HG3  . LYS A 1 78  ? 8.367   -28.485 3.168   1.00 0.00 ? 78  LYS A HG3  1  
ATOM 1166  H HD2  . LYS A 1 78  ? 8.382   -30.785 2.546   1.00 0.00 ? 78  LYS A HD2  1  
ATOM 1167  H HD3  . LYS A 1 78  ? 7.703   -30.422 0.957   1.00 0.00 ? 78  LYS A HD3  1  
ATOM 1168  H HE2  . LYS A 1 78  ? 9.946   -30.722 0.480   1.00 0.00 ? 78  LYS A HE2  1  
ATOM 1169  H HE3  . LYS A 1 78  ? 9.831   -28.972 0.659   1.00 0.00 ? 78  LYS A HE3  1  
ATOM 1170  H HZ1  . LYS A 1 78  ? 11.742  -30.086 1.827   1.00 0.00 ? 78  LYS A HZ1  1  
ATOM 1171  H HZ2  . LYS A 1 78  ? 10.610  -30.751 2.894   1.00 0.00 ? 78  LYS A HZ2  1  
ATOM 1172  H HZ3  . LYS A 1 78  ? 10.788  -29.072 2.789   1.00 0.00 ? 78  LYS A HZ3  1  
ATOM 1173  N N    . PRO A 1 79  ? 3.734   -30.405 1.419   1.00 0.00 ? 79  PRO A N    1  
ATOM 1174  C CA   . PRO A 1 79  ? 2.417   -30.991 1.685   1.00 0.00 ? 79  PRO A CA   1  
ATOM 1175  C C    . PRO A 1 79  ? 2.144   -31.150 3.177   1.00 0.00 ? 79  PRO A C    1  
ATOM 1176  O O    . PRO A 1 79  ? 3.070   -31.234 3.981   1.00 0.00 ? 79  PRO A O    1  
ATOM 1177  C CB   . PRO A 1 79  ? 2.495   -32.362 1.007   1.00 0.00 ? 79  PRO A CB   1  
ATOM 1178  C CG   . PRO A 1 79  ? 3.948   -32.690 0.983   1.00 0.00 ? 79  PRO A CG   1  
ATOM 1179  C CD   . PRO A 1 79  ? 4.666   -31.378 0.825   1.00 0.00 ? 79  PRO A CD   1  
ATOM 1180  H HA   . PRO A 1 79  ? 1.626   -30.410 1.235   1.00 0.00 ? 79  PRO A HA   1  
ATOM 1181  H HB2  . PRO A 1 79  ? 1.935   -33.084 1.585   1.00 0.00 ? 79  PRO A HB2  1  
ATOM 1182  H HB3  . PRO A 1 79  ? 2.088   -32.297 0.010   1.00 0.00 ? 79  PRO A HB3  1  
ATOM 1183  H HG2  . PRO A 1 79  ? 4.233   -33.165 1.909   1.00 0.00 ? 79  PRO A HG2  1  
ATOM 1184  H HG3  . PRO A 1 79  ? 4.163   -33.338 0.146   1.00 0.00 ? 79  PRO A HG3  1  
ATOM 1185  H HD2  . PRO A 1 79  ? 5.602   -31.394 1.363   1.00 0.00 ? 79  PRO A HD2  1  
ATOM 1186  H HD3  . PRO A 1 79  ? 4.833   -31.163 -0.221  1.00 0.00 ? 79  PRO A HD3  1  
ATOM 1187  N N    . ASN A 1 80  ? 0.865   -31.189 3.539   1.00 0.00 ? 80  ASN A N    1  
ATOM 1188  C CA   . ASN A 1 80  ? 0.471   -31.338 4.935   1.00 0.00 ? 80  ASN A CA   1  
ATOM 1189  C C    . ASN A 1 80  ? 1.416   -30.568 5.852   1.00 0.00 ? 80  ASN A C    1  
ATOM 1190  O O    . ASN A 1 80  ? 1.947   -31.119 6.816   1.00 0.00 ? 80  ASN A O    1  
ATOM 1191  C CB   . ASN A 1 80  ? 0.452   -32.816 5.327   1.00 0.00 ? 80  ASN A CB   1  
ATOM 1192  C CG   . ASN A 1 80  ? 1.779   -33.501 5.063   1.00 0.00 ? 80  ASN A CG   1  
ATOM 1193  O OD1  . ASN A 1 80  ? 2.063   -33.916 3.939   1.00 0.00 ? 80  ASN A OD1  1  
ATOM 1194  N ND2  . ASN A 1 80  ? 2.599   -33.623 6.100   1.00 0.00 ? 80  ASN A ND2  1  
ATOM 1195  H H    . ASN A 1 80  ? 0.171   -31.117 2.851   1.00 0.00 ? 80  ASN A H    1  
ATOM 1196  H HA   . ASN A 1 80  ? -0.525  -30.933 5.042   1.00 0.00 ? 80  ASN A HA   1  
ATOM 1197  H HB2  . ASN A 1 80  ? 0.230   -32.900 6.381   1.00 0.00 ? 80  ASN A HB2  1  
ATOM 1198  H HB3  . ASN A 1 80  ? -0.314  -33.324 4.760   1.00 0.00 ? 80  ASN A HB3  1  
ATOM 1199  H HD21 . ASN A 1 80  ? 2.306   -33.269 6.966   1.00 0.00 ? 80  ASN A HD21 1  
ATOM 1200  H HD22 . ASN A 1 80  ? 3.464   -34.061 5.957   1.00 0.00 ? 80  ASN A HD22 1  
ATOM 1201  N N    . SER A 1 81  ? 1.621   -29.291 5.545   1.00 0.00 ? 81  SER A N    1  
ATOM 1202  C CA   . SER A 1 81  ? 2.505   -28.446 6.340   1.00 0.00 ? 81  SER A CA   1  
ATOM 1203  C C    . SER A 1 81  ? 1.881   -27.073 6.571   1.00 0.00 ? 81  SER A C    1  
ATOM 1204  O O    . SER A 1 81  ? 1.227   -26.519 5.686   1.00 0.00 ? 81  SER A O    1  
ATOM 1205  C CB   . SER A 1 81  ? 3.860   -28.294 5.645   1.00 0.00 ? 81  SER A CB   1  
ATOM 1206  O OG   . SER A 1 81  ? 4.658   -29.450 5.825   1.00 0.00 ? 81  SER A OG   1  
ATOM 1207  H H    . SER A 1 81  ? 1.169   -28.909 4.764   1.00 0.00 ? 81  SER A H    1  
ATOM 1208  H HA   . SER A 1 81  ? 2.652   -28.927 7.296   1.00 0.00 ? 81  SER A HA   1  
ATOM 1209  H HB2  . SER A 1 81  ? 3.704   -28.140 4.588   1.00 0.00 ? 81  SER A HB2  1  
ATOM 1210  H HB3  . SER A 1 81  ? 4.380   -27.443 6.061   1.00 0.00 ? 81  SER A HB3  1  
ATOM 1211  H HG   . SER A 1 81  ? 4.334   -30.155 5.260   1.00 0.00 ? 81  SER A HG   1  
ATOM 1212  N N    . LEU A 1 82  ? 2.088   -26.530 7.765   1.00 0.00 ? 82  LEU A N    1  
ATOM 1213  C CA   . LEU A 1 82  ? 1.547   -25.221 8.114   1.00 0.00 ? 82  LEU A CA   1  
ATOM 1214  C C    . LEU A 1 82  ? 2.492   -24.106 7.676   1.00 0.00 ? 82  LEU A C    1  
ATOM 1215  O O    . LEU A 1 82  ? 3.706   -24.202 7.856   1.00 0.00 ? 82  LEU A O    1  
ATOM 1216  C CB   . LEU A 1 82  ? 1.302   -25.134 9.621   1.00 0.00 ? 82  LEU A CB   1  
ATOM 1217  C CG   . LEU A 1 82  ? 0.469   -23.944 10.099  1.00 0.00 ? 82  LEU A CG   1  
ATOM 1218  C CD1  . LEU A 1 82  ? -0.972  -24.079 9.632   1.00 0.00 ? 82  LEU A CD1  1  
ATOM 1219  C CD2  . LEU A 1 82  ? 0.532   -23.822 11.614  1.00 0.00 ? 82  LEU A CD2  1  
ATOM 1220  H H    . LEU A 1 82  ? 2.617   -27.019 8.428   1.00 0.00 ? 82  LEU A H    1  
ATOM 1221  H HA   . LEU A 1 82  ? 0.606   -25.103 7.597   1.00 0.00 ? 82  LEU A HA   1  
ATOM 1222  H HB2  . LEU A 1 82  ? 0.794   -26.036 9.926   1.00 0.00 ? 82  LEU A HB2  1  
ATOM 1223  H HB3  . LEU A 1 82  ? 2.264   -25.083 10.110  1.00 0.00 ? 82  LEU A HB3  1  
ATOM 1224  H HG   . LEU A 1 82  ? 0.873   -23.036 9.672   1.00 0.00 ? 82  LEU A HG   1  
ATOM 1225  H HD11 . LEU A 1 82  ? -1.031  -24.831 8.860   1.00 0.00 ? 82  LEU A HD11 1  
ATOM 1226  H HD12 . LEU A 1 82  ? -1.314  -23.133 9.240   1.00 0.00 ? 82  LEU A HD12 1  
ATOM 1227  H HD13 . LEU A 1 82  ? -1.595  -24.369 10.466  1.00 0.00 ? 82  LEU A HD13 1  
ATOM 1228  H HD21 . LEU A 1 82  ? 0.581   -22.779 11.889  1.00 0.00 ? 82  LEU A HD21 1  
ATOM 1229  H HD22 . LEU A 1 82  ? 1.411   -24.333 11.980  1.00 0.00 ? 82  LEU A HD22 1  
ATOM 1230  H HD23 . LEU A 1 82  ? -0.351  -24.268 12.048  1.00 0.00 ? 82  LEU A HD23 1  
ATOM 1231  N N    . TYR A 1 83  ? 1.926   -23.050 7.103   1.00 0.00 ? 83  TYR A N    1  
ATOM 1232  C CA   . TYR A 1 83  ? 2.718   -21.917 6.639   1.00 0.00 ? 83  TYR A CA   1  
ATOM 1233  C C    . TYR A 1 83  ? 1.978   -20.603 6.872   1.00 0.00 ? 83  TYR A C    1  
ATOM 1234  O O    . TYR A 1 83  ? 0.889   -20.388 6.339   1.00 0.00 ? 83  TYR A O    1  
ATOM 1235  C CB   . TYR A 1 83  ? 3.048   -22.073 5.153   1.00 0.00 ? 83  TYR A CB   1  
ATOM 1236  C CG   . TYR A 1 83  ? 4.080   -23.142 4.871   1.00 0.00 ? 83  TYR A CG   1  
ATOM 1237  C CD1  . TYR A 1 83  ? 5.422   -22.934 5.162   1.00 0.00 ? 83  TYR A CD1  1  
ATOM 1238  C CD2  . TYR A 1 83  ? 3.711   -24.360 4.314   1.00 0.00 ? 83  TYR A CD2  1  
ATOM 1239  C CE1  . TYR A 1 83  ? 6.368   -23.908 4.905   1.00 0.00 ? 83  TYR A CE1  1  
ATOM 1240  C CE2  . TYR A 1 83  ? 4.649   -25.340 4.055   1.00 0.00 ? 83  TYR A CE2  1  
ATOM 1241  C CZ   . TYR A 1 83  ? 5.976   -25.109 4.352   1.00 0.00 ? 83  TYR A CZ   1  
ATOM 1242  O OH   . TYR A 1 83  ? 6.915   -26.083 4.095   1.00 0.00 ? 83  TYR A OH   1  
ATOM 1243  H H    . TYR A 1 83  ? 0.953   -23.032 6.987   1.00 0.00 ? 83  TYR A H    1  
ATOM 1244  H HA   . TYR A 1 83  ? 3.640   -21.903 7.203   1.00 0.00 ? 83  TYR A HA   1  
ATOM 1245  H HB2  . TYR A 1 83  ? 2.149   -22.331 4.617   1.00 0.00 ? 83  TYR A HB2  1  
ATOM 1246  H HB3  . TYR A 1 83  ? 3.430   -21.135 4.776   1.00 0.00 ? 83  TYR A HB3  1  
ATOM 1247  H HD1  . TYR A 1 83  ? 5.725   -21.992 5.596   1.00 0.00 ? 83  TYR A HD1  1  
ATOM 1248  H HD2  . TYR A 1 83  ? 2.670   -24.538 4.083   1.00 0.00 ? 83  TYR A HD2  1  
ATOM 1249  H HE1  . TYR A 1 83  ? 7.407   -23.728 5.137   1.00 0.00 ? 83  TYR A HE1  1  
ATOM 1250  H HE2  . TYR A 1 83  ? 4.343   -26.281 3.621   1.00 0.00 ? 83  TYR A HE2  1  
ATOM 1251  H HH   . TYR A 1 83  ? 7.185   -26.492 4.921   1.00 0.00 ? 83  TYR A HH   1  
ATOM 1252  N N    . TYR A 1 84  ? 2.578   -19.728 7.671   1.00 0.00 ? 84  TYR A N    1  
ATOM 1253  C CA   . TYR A 1 84  ? 1.977   -18.436 7.977   1.00 0.00 ? 84  TYR A CA   1  
ATOM 1254  C C    . TYR A 1 84  ? 2.058   -17.498 6.776   1.00 0.00 ? 84  TYR A C    1  
ATOM 1255  O O    . TYR A 1 84  ? 2.928   -17.645 5.917   1.00 0.00 ? 84  TYR A O    1  
ATOM 1256  C CB   . TYR A 1 84  ? 2.671   -17.800 9.183   1.00 0.00 ? 84  TYR A CB   1  
ATOM 1257  C CG   . TYR A 1 84  ? 2.344   -18.475 10.496  1.00 0.00 ? 84  TYR A CG   1  
ATOM 1258  C CD1  . TYR A 1 84  ? 2.656   -19.813 10.707  1.00 0.00 ? 84  TYR A CD1  1  
ATOM 1259  C CD2  . TYR A 1 84  ? 1.724   -17.777 11.524  1.00 0.00 ? 84  TYR A CD2  1  
ATOM 1260  C CE1  . TYR A 1 84  ? 2.359   -20.435 11.904  1.00 0.00 ? 84  TYR A CE1  1  
ATOM 1261  C CE2  . TYR A 1 84  ? 1.425   -18.391 12.725  1.00 0.00 ? 84  TYR A CE2  1  
ATOM 1262  C CZ   . TYR A 1 84  ? 1.744   -19.720 12.910  1.00 0.00 ? 84  TYR A CZ   1  
ATOM 1263  O OH   . TYR A 1 84  ? 1.446   -20.335 14.105  1.00 0.00 ? 84  TYR A OH   1  
ATOM 1264  H H    . TYR A 1 84  ? 3.445   -19.957 8.066   1.00 0.00 ? 84  TYR A H    1  
ATOM 1265  H HA   . TYR A 1 84  ? 0.937   -18.603 8.219   1.00 0.00 ? 84  TYR A HA   1  
ATOM 1266  H HB2  . TYR A 1 84  ? 3.739   -17.849 9.042   1.00 0.00 ? 84  TYR A HB2  1  
ATOM 1267  H HB3  . TYR A 1 84  ? 2.369   -16.765 9.258   1.00 0.00 ? 84  TYR A HB3  1  
ATOM 1268  H HD1  . TYR A 1 84  ? 3.137   -20.371 9.917   1.00 0.00 ? 84  TYR A HD1  1  
ATOM 1269  H HD2  . TYR A 1 84  ? 1.475   -16.736 11.375  1.00 0.00 ? 84  TYR A HD2  1  
ATOM 1270  H HE1  . TYR A 1 84  ? 2.609   -21.476 12.050  1.00 0.00 ? 84  TYR A HE1  1  
ATOM 1271  H HE2  . TYR A 1 84  ? 0.943   -17.831 13.513  1.00 0.00 ? 84  TYR A HE2  1  
ATOM 1272  H HH   . TYR A 1 84  ? 0.528   -20.614 14.101  1.00 0.00 ? 84  TYR A HH   1  
ATOM 1273  N N    . PHE A 1 85  ? 1.146   -16.534 6.724   1.00 0.00 ? 85  PHE A N    1  
ATOM 1274  C CA   . PHE A 1 85  ? 1.113   -15.571 5.629   1.00 0.00 ? 85  PHE A CA   1  
ATOM 1275  C C    . PHE A 1 85  ? 0.604   -14.216 6.111   1.00 0.00 ? 85  PHE A C    1  
ATOM 1276  O O    . PHE A 1 85  ? -0.275  -14.141 6.969   1.00 0.00 ? 85  PHE A O    1  
ATOM 1277  C CB   . PHE A 1 85  ? 0.226   -16.088 4.494   1.00 0.00 ? 85  PHE A CB   1  
ATOM 1278  C CG   . PHE A 1 85  ? 0.539   -17.498 4.082   1.00 0.00 ? 85  PHE A CG   1  
ATOM 1279  C CD1  . PHE A 1 85  ? 1.744   -17.803 3.469   1.00 0.00 ? 85  PHE A CD1  1  
ATOM 1280  C CD2  . PHE A 1 85  ? -0.370  -18.518 4.308   1.00 0.00 ? 85  PHE A CD2  1  
ATOM 1281  C CE1  . PHE A 1 85  ? 2.036   -19.099 3.089   1.00 0.00 ? 85  PHE A CE1  1  
ATOM 1282  C CE2  . PHE A 1 85  ? -0.084  -19.816 3.931   1.00 0.00 ? 85  PHE A CE2  1  
ATOM 1283  C CZ   . PHE A 1 85  ? 1.120   -20.107 3.320   1.00 0.00 ? 85  PHE A CZ   1  
ATOM 1284  H H    . PHE A 1 85  ? 0.478   -16.468 7.439   1.00 0.00 ? 85  PHE A H    1  
ATOM 1285  H HA   . PHE A 1 85  ? 2.121   -15.454 5.261   1.00 0.00 ? 85  PHE A HA   1  
ATOM 1286  H HB2  . PHE A 1 85  ? -0.806  -16.057 4.811   1.00 0.00 ? 85  PHE A HB2  1  
ATOM 1287  H HB3  . PHE A 1 85  ? 0.352   -15.452 3.631   1.00 0.00 ? 85  PHE A HB3  1  
ATOM 1288  H HD1  . PHE A 1 85  ? 2.461   -17.015 3.288   1.00 0.00 ? 85  PHE A HD1  1  
ATOM 1289  H HD2  . PHE A 1 85  ? -1.313  -18.292 4.785   1.00 0.00 ? 85  PHE A HD2  1  
ATOM 1290  H HE1  . PHE A 1 85  ? 2.978   -19.323 2.611   1.00 0.00 ? 85  PHE A HE1  1  
ATOM 1291  H HE2  . PHE A 1 85  ? -0.802  -20.602 4.112   1.00 0.00 ? 85  PHE A HE2  1  
ATOM 1292  H HZ   . PHE A 1 85  ? 1.346   -21.121 3.024   1.00 0.00 ? 85  PHE A HZ   1  
ATOM 1293  N N    . ARG A 1 86  ? 1.164   -13.148 5.552   1.00 0.00 ? 86  ARG A N    1  
ATOM 1294  C CA   . ARG A 1 86  ? 0.769   -11.795 5.926   1.00 0.00 ? 86  ARG A CA   1  
ATOM 1295  C C    . ARG A 1 86  ? 0.898   -10.844 4.740   1.00 0.00 ? 86  ARG A C    1  
ATOM 1296  O O    . ARG A 1 86  ? 1.984   -10.668 4.187   1.00 0.00 ? 86  ARG A O    1  
ATOM 1297  C CB   . ARG A 1 86  ? 1.625   -11.294 7.090   1.00 0.00 ? 86  ARG A CB   1  
ATOM 1298  C CG   . ARG A 1 86  ? 1.067   -11.656 8.457   1.00 0.00 ? 86  ARG A CG   1  
ATOM 1299  C CD   . ARG A 1 86  ? 1.480   -10.644 9.514   1.00 0.00 ? 86  ARG A CD   1  
ATOM 1300  N NE   . ARG A 1 86  ? 2.891   -10.770 9.870   1.00 0.00 ? 86  ARG A NE   1  
ATOM 1301  C CZ   . ARG A 1 86  ? 3.457   -10.111 10.875  1.00 0.00 ? 86  ARG A CZ   1  
ATOM 1302  N NH1  . ARG A 1 86  ? 2.736   -9.285  11.620  1.00 0.00 ? 86  ARG A NH1  1  
ATOM 1303  N NH2  . ARG A 1 86  ? 4.747   -10.279 11.137  1.00 0.00 ? 86  ARG A NH2  1  
ATOM 1304  H H    . ARG A 1 86  ? 1.860   -13.272 4.873   1.00 0.00 ? 86  ARG A H    1  
ATOM 1305  H HA   . ARG A 1 86  ? -0.265  -11.825 6.237   1.00 0.00 ? 86  ARG A HA   1  
ATOM 1306  H HB2  . ARG A 1 86  ? 2.613   -11.721 7.005   1.00 0.00 ? 86  ARG A HB2  1  
ATOM 1307  H HB3  . ARG A 1 86  ? 1.700   -10.219 7.030   1.00 0.00 ? 86  ARG A HB3  1  
ATOM 1308  H HG2  . ARG A 1 86  ? -0.012  -11.680 8.400   1.00 0.00 ? 86  ARG A HG2  1  
ATOM 1309  H HG3  . ARG A 1 86  ? 1.436   -12.631 8.739   1.00 0.00 ? 86  ARG A HG3  1  
ATOM 1310  H HD2  . ARG A 1 86  ? 1.303   -9.650  9.130   1.00 0.00 ? 86  ARG A HD2  1  
ATOM 1311  H HD3  . ARG A 1 86  ? 0.880   -10.801 10.397  1.00 0.00 ? 86  ARG A HD3  1  
ATOM 1312  H HE   . ARG A 1 86  ? 3.442   -11.376 9.332   1.00 0.00 ? 86  ARG A HE   1  
ATOM 1313  H HH11 . ARG A 1 86  ? 1.764   -9.157  11.425  1.00 0.00 ? 86  ARG A HH11 1  
ATOM 1314  H HH12 . ARG A 1 86  ? 3.164   -8.791  12.377  1.00 0.00 ? 86  ARG A HH12 1  
ATOM 1315  H HH21 . ARG A 1 86  ? 5.294   -10.901 10.578  1.00 0.00 ? 86  ARG A HH21 1  
ATOM 1316  H HH22 . ARG A 1 86  ? 5.172   -9.783  11.893  1.00 0.00 ? 86  ARG A HH22 1  
ATOM 1317  N N    . LEU A 1 87  ? -0.217  -10.234 4.354   1.00 0.00 ? 87  LEU A N    1  
ATOM 1318  C CA   . LEU A 1 87  ? -0.230  -9.300  3.232   1.00 0.00 ? 87  LEU A CA   1  
ATOM 1319  C C    . LEU A 1 87  ? -0.098  -7.861  3.721   1.00 0.00 ? 87  LEU A C    1  
ATOM 1320  O O    . LEU A 1 87  ? -0.545  -7.524  4.816   1.00 0.00 ? 87  LEU A O    1  
ATOM 1321  C CB   . LEU A 1 87  ? -1.519  -9.461  2.424   1.00 0.00 ? 87  LEU A CB   1  
ATOM 1322  C CG   . LEU A 1 87  ? -1.426  -9.117  0.937   1.00 0.00 ? 87  LEU A CG   1  
ATOM 1323  C CD1  . LEU A 1 87  ? -0.521  -10.105 0.216   1.00 0.00 ? 87  LEU A CD1  1  
ATOM 1324  C CD2  . LEU A 1 87  ? -2.810  -9.100  0.306   1.00 0.00 ? 87  LEU A CD2  1  
ATOM 1325  H H    . LEU A 1 87  ? -1.052  -10.414 4.833   1.00 0.00 ? 87  LEU A H    1  
ATOM 1326  H HA   . LEU A 1 87  ? 0.614   -9.532  2.599   1.00 0.00 ? 87  LEU A HA   1  
ATOM 1327  H HB2  . LEU A 1 87  ? -1.834  -10.489 2.506   1.00 0.00 ? 87  LEU A HB2  1  
ATOM 1328  H HB3  . LEU A 1 87  ? -2.268  -8.820  2.867   1.00 0.00 ? 87  LEU A HB3  1  
ATOM 1329  H HG   . LEU A 1 87  ? -0.995  -8.131  0.828   1.00 0.00 ? 87  LEU A HG   1  
ATOM 1330  H HD11 . LEU A 1 87  ? -1.126  -10.814 -0.329  1.00 0.00 ? 87  LEU A HD11 1  
ATOM 1331  H HD12 . LEU A 1 87  ? 0.086   -10.630 0.939   1.00 0.00 ? 87  LEU A HD12 1  
ATOM 1332  H HD13 . LEU A 1 87  ? 0.119   -9.572  -0.471  1.00 0.00 ? 87  LEU A HD13 1  
ATOM 1333  H HD21 . LEU A 1 87  ? -3.492  -9.668  0.920   1.00 0.00 ? 87  LEU A HD21 1  
ATOM 1334  H HD22 . LEU A 1 87  ? -2.762  -9.539  -0.680  1.00 0.00 ? 87  LEU A HD22 1  
ATOM 1335  H HD23 . LEU A 1 87  ? -3.158  -8.080  0.230   1.00 0.00 ? 87  LEU A HD23 1  
ATOM 1336  N N    . ALA A 1 88  ? 0.516   -7.017  2.898   1.00 0.00 ? 88  ALA A N    1  
ATOM 1337  C CA   . ALA A 1 88  ? 0.703   -5.613  3.244   1.00 0.00 ? 88  ALA A CA   1  
ATOM 1338  C C    . ALA A 1 88  ? 1.035   -4.783  2.009   1.00 0.00 ? 88  ALA A C    1  
ATOM 1339  O O    . ALA A 1 88  ? 2.133   -4.879  1.462   1.00 0.00 ? 88  ALA A O    1  
ATOM 1340  C CB   . ALA A 1 88  ? 1.798   -5.469  4.290   1.00 0.00 ? 88  ALA A CB   1  
ATOM 1341  H H    . ALA A 1 88  ? 0.850   -7.346  2.038   1.00 0.00 ? 88  ALA A H    1  
ATOM 1342  H HA   . ALA A 1 88  ? -0.220  -5.249  3.672   1.00 0.00 ? 88  ALA A HA   1  
ATOM 1343  H HB1  . ALA A 1 88  ? 2.705   -5.124  3.815   1.00 0.00 ? 88  ALA A HB1  1  
ATOM 1344  H HB2  . ALA A 1 88  ? 1.489   -4.754  5.038   1.00 0.00 ? 88  ALA A HB2  1  
ATOM 1345  H HB3  . ALA A 1 88  ? 1.978   -6.425  4.757   1.00 0.00 ? 88  ALA A HB3  1  
ATOM 1346  N N    . ALA A 1 89  ? 0.079   -3.968  1.575   1.00 0.00 ? 89  ALA A N    1  
ATOM 1347  C CA   . ALA A 1 89  ? 0.271   -3.120  0.405   1.00 0.00 ? 89  ALA A CA   1  
ATOM 1348  C C    . ALA A 1 89  ? 1.594   -2.367  0.484   1.00 0.00 ? 89  ALA A C    1  
ATOM 1349  O O    . ALA A 1 89  ? 1.938   -1.806  1.525   1.00 0.00 ? 89  ALA A O    1  
ATOM 1350  C CB   . ALA A 1 89  ? -0.887  -2.144  0.265   1.00 0.00 ? 89  ALA A CB   1  
ATOM 1351  H H    . ALA A 1 89  ? -0.775  -3.936  2.053   1.00 0.00 ? 89  ALA A H    1  
ATOM 1352  H HA   . ALA A 1 89  ? 0.282   -3.755  -0.470  1.00 0.00 ? 89  ALA A HA   1  
ATOM 1353  H HB1  . ALA A 1 89  ? -0.986  -1.850  -0.771  1.00 0.00 ? 89  ALA A HB1  1  
ATOM 1354  H HB2  . ALA A 1 89  ? -1.800  -2.619  0.593   1.00 0.00 ? 89  ALA A HB2  1  
ATOM 1355  H HB3  . ALA A 1 89  ? -0.697  -1.271  0.870   1.00 0.00 ? 89  ALA A HB3  1  
ATOM 1356  N N    . ARG A 1 90  ? 2.333   -2.358  -0.621  1.00 0.00 ? 90  ARG A N    1  
ATOM 1357  C CA   . ARG A 1 90  ? 3.619   -1.674  -0.674  1.00 0.00 ? 90  ARG A CA   1  
ATOM 1358  C C    . ARG A 1 90  ? 3.580   -0.519  -1.670  1.00 0.00 ? 90  ARG A C    1  
ATOM 1359  O O    . ARG A 1 90  ? 3.401   -0.726  -2.870  1.00 0.00 ? 90  ARG A O    1  
ATOM 1360  C CB   . ARG A 1 90  ? 4.727   -2.656  -1.060  1.00 0.00 ? 90  ARG A CB   1  
ATOM 1361  C CG   . ARG A 1 90  ? 6.123   -2.169  -0.708  1.00 0.00 ? 90  ARG A CG   1  
ATOM 1362  C CD   . ARG A 1 90  ? 7.178   -2.816  -1.592  1.00 0.00 ? 90  ARG A CD   1  
ATOM 1363  N NE   . ARG A 1 90  ? 8.477   -2.890  -0.928  1.00 0.00 ? 90  ARG A NE   1  
ATOM 1364  C CZ   . ARG A 1 90  ? 8.715   -3.645  0.138   1.00 0.00 ? 90  ARG A CZ   1  
ATOM 1365  N NH1  . ARG A 1 90  ? 7.748   -4.386  0.659   1.00 0.00 ? 90  ARG A NH1  1  
ATOM 1366  N NH2  . ARG A 1 90  ? 9.924   -3.659  0.686   1.00 0.00 ? 90  ARG A NH2  1  
ATOM 1367  H H    . ARG A 1 90  ? 2.005   -2.823  -1.419  1.00 0.00 ? 90  ARG A H    1  
ATOM 1368  H HA   . ARG A 1 90  ? 3.827   -1.280  0.309   1.00 0.00 ? 90  ARG A HA   1  
ATOM 1369  H HB2  . ARG A 1 90  ? 4.557   -3.592  -0.548  1.00 0.00 ? 90  ARG A HB2  1  
ATOM 1370  H HB3  . ARG A 1 90  ? 4.686   -2.825  -2.126  1.00 0.00 ? 90  ARG A HB3  1  
ATOM 1371  H HG2  . ARG A 1 90  ? 6.165   -1.098  -0.842  1.00 0.00 ? 90  ARG A HG2  1  
ATOM 1372  H HG3  . ARG A 1 90  ? 6.330   -2.413  0.323   1.00 0.00 ? 90  ARG A HG3  1  
ATOM 1373  H HD2  . ARG A 1 90  ? 6.855   -3.815  -1.842  1.00 0.00 ? 90  ARG A HD2  1  
ATOM 1374  H HD3  . ARG A 1 90  ? 7.278   -2.233  -2.495  1.00 0.00 ? 90  ARG A HD3  1  
ATOM 1375  H HE   . ARG A 1 90  ? 9.206   -2.350  -1.297  1.00 0.00 ? 90  ARG A HE   1  
ATOM 1376  H HH11 . ARG A 1 90  ? 6.836   -4.378  0.248   1.00 0.00 ? 90  ARG A HH11 1  
ATOM 1377  H HH12 . ARG A 1 90  ? 7.930   -4.955  1.462   1.00 0.00 ? 90  ARG A HH12 1  
ATOM 1378  H HH21 . ARG A 1 90  ? 10.656  -3.101  0.296   1.00 0.00 ? 90  ARG A HH21 1  
ATOM 1379  H HH22 . ARG A 1 90  ? 10.102  -4.227  1.489   1.00 0.00 ? 90  ARG A HH22 1  
ATOM 1380  N N    . SER A 1 91  ? 3.747   0.699   -1.163  1.00 0.00 ? 91  SER A N    1  
ATOM 1381  C CA   . SER A 1 91  ? 3.727   1.888   -2.007  1.00 0.00 ? 91  SER A CA   1  
ATOM 1382  C C    . SER A 1 91  ? 5.140   2.409   -2.246  1.00 0.00 ? 91  SER A C    1  
ATOM 1383  O O    . SER A 1 91  ? 6.048   2.209   -1.438  1.00 0.00 ? 91  SER A O    1  
ATOM 1384  C CB   . SER A 1 91  ? 2.869   2.980   -1.365  1.00 0.00 ? 91  SER A CB   1  
ATOM 1385  O OG   . SER A 1 91  ? 3.646   3.801   -0.511  1.00 0.00 ? 91  SER A OG   1  
ATOM 1386  H H    . SER A 1 91  ? 3.886   0.799   -0.198  1.00 0.00 ? 91  SER A H    1  
ATOM 1387  H HA   . SER A 1 91  ? 3.292   1.612   -2.957  1.00 0.00 ? 91  SER A HA   1  
ATOM 1388  H HB2  . SER A 1 91  ? 2.435   3.594   -2.138  1.00 0.00 ? 91  SER A HB2  1  
ATOM 1389  H HB3  . SER A 1 91  ? 2.082   2.521   -0.785  1.00 0.00 ? 91  SER A HB3  1  
ATOM 1390  H HG   . SER A 1 91  ? 3.084   4.468   -0.109  1.00 0.00 ? 91  SER A HG   1  
ATOM 1391  N N    . PRO A 1 92  ? 5.333   3.095   -3.382  1.00 0.00 ? 92  PRO A N    1  
ATOM 1392  C CA   . PRO A 1 92  ? 6.633   3.661   -3.754  1.00 0.00 ? 92  PRO A CA   1  
ATOM 1393  C C    . PRO A 1 92  ? 7.032   4.833   -2.864  1.00 0.00 ? 92  PRO A C    1  
ATOM 1394  O O    . PRO A 1 92  ? 8.114   5.399   -3.016  1.00 0.00 ? 92  PRO A O    1  
ATOM 1395  C CB   . PRO A 1 92  ? 6.415   4.133   -5.194  1.00 0.00 ? 92  PRO A CB   1  
ATOM 1396  C CG   . PRO A 1 92  ? 4.950   4.382   -5.294  1.00 0.00 ? 92  PRO A CG   1  
ATOM 1397  C CD   . PRO A 1 92  ? 4.297   3.372   -4.391  1.00 0.00 ? 92  PRO A CD   1  
ATOM 1398  H HA   . PRO A 1 92  ? 7.412   2.913   -3.733  1.00 0.00 ? 92  PRO A HA   1  
ATOM 1399  H HB2  . PRO A 1 92  ? 6.983   5.037   -5.369  1.00 0.00 ? 92  PRO A HB2  1  
ATOM 1400  H HB3  . PRO A 1 92  ? 6.733   3.363   -5.881  1.00 0.00 ? 92  PRO A HB3  1  
ATOM 1401  H HG2  . PRO A 1 92  ? 4.724   5.383   -4.962  1.00 0.00 ? 92  PRO A HG2  1  
ATOM 1402  H HG3  . PRO A 1 92  ? 4.622   4.239   -6.313  1.00 0.00 ? 92  PRO A HG3  1  
ATOM 1403  H HD2  . PRO A 1 92  ? 3.414   3.792   -3.931  1.00 0.00 ? 92  PRO A HD2  1  
ATOM 1404  H HD3  . PRO A 1 92  ? 4.048   2.478   -4.942  1.00 0.00 ? 92  PRO A HD3  1  
ATOM 1405  N N    . GLN A 1 93  ? 6.151   5.191   -1.935  1.00 0.00 ? 93  GLN A N    1  
ATOM 1406  C CA   . GLN A 1 93  ? 6.412   6.297   -1.021  1.00 0.00 ? 93  GLN A CA   1  
ATOM 1407  C C    . GLN A 1 93  ? 6.652   5.786   0.396   1.00 0.00 ? 93  GLN A C    1  
ATOM 1408  O O    . GLN A 1 93  ? 7.333   6.431   1.192   1.00 0.00 ? 93  GLN A O    1  
ATOM 1409  C CB   . GLN A 1 93  ? 5.242   7.281   -1.030  1.00 0.00 ? 93  GLN A CB   1  
ATOM 1410  C CG   . GLN A 1 93  ? 5.377   8.379   -2.072  1.00 0.00 ? 93  GLN A CG   1  
ATOM 1411  C CD   . GLN A 1 93  ? 5.122   7.881   -3.481  1.00 0.00 ? 93  GLN A CD   1  
ATOM 1412  O OE1  . GLN A 1 93  ? 4.034   7.396   -3.793  1.00 0.00 ? 93  GLN A OE1  1  
ATOM 1413  N NE2  . GLN A 1 93  ? 6.126   7.998   -4.342  1.00 0.00 ? 93  GLN A NE2  1  
ATOM 1414  H H    . GLN A 1 93  ? 5.306   4.702   -1.864  1.00 0.00 ? 93  GLN A H    1  
ATOM 1415  H HA   . GLN A 1 93  ? 7.301   6.806   -1.362  1.00 0.00 ? 93  GLN A HA   1  
ATOM 1416  H HB2  . GLN A 1 93  ? 4.330   6.737   -1.228  1.00 0.00 ? 93  GLN A HB2  1  
ATOM 1417  H HB3  . GLN A 1 93  ? 5.170   7.746   -0.057  1.00 0.00 ? 93  GLN A HB3  1  
ATOM 1418  H HG2  . GLN A 1 93  ? 4.666   9.160   -1.849  1.00 0.00 ? 93  GLN A HG2  1  
ATOM 1419  H HG3  . GLN A 1 93  ? 6.379   8.781   -2.024  1.00 0.00 ? 93  GLN A HG3  1  
ATOM 1420  H HE21 . GLN A 1 93  ? 6.965   8.393   -4.023  1.00 0.00 ? 93  GLN A HE21 1  
ATOM 1421  H HE22 . GLN A 1 93  ? 5.989   7.683   -5.259  1.00 0.00 ? 93  GLN A HE22 1  
ATOM 1422  N N    . GLY A 1 94  ? 6.087   4.622   0.704   1.00 0.00 ? 94  GLY A N    1  
ATOM 1423  C CA   . GLY A 1 94  ? 6.251   4.045   2.025   1.00 0.00 ? 94  GLY A CA   1  
ATOM 1424  C C    . GLY A 1 94  ? 5.346   2.851   2.252   1.00 0.00 ? 94  GLY A C    1  
ATOM 1425  O O    . GLY A 1 94  ? 4.265   2.761   1.668   1.00 0.00 ? 94  GLY A O    1  
ATOM 1426  H H    . GLY A 1 94  ? 5.555   4.152   0.028   1.00 0.00 ? 94  GLY A H    1  
ATOM 1427  H HA2  . GLY A 1 94  ? 7.278   3.733   2.145   1.00 0.00 ? 94  GLY A HA2  1  
ATOM 1428  H HA3  . GLY A 1 94  ? 6.025   4.799   2.765   1.00 0.00 ? 94  GLY A HA3  1  
ATOM 1429  N N    . LEU A 1 95  ? 5.787   1.929   3.101   1.00 0.00 ? 95  LEU A N    1  
ATOM 1430  C CA   . LEU A 1 95  ? 5.009   0.732   3.404   1.00 0.00 ? 95  LEU A CA   1  
ATOM 1431  C C    . LEU A 1 95  ? 3.696   1.095   4.089   1.00 0.00 ? 95  LEU A C    1  
ATOM 1432  O O    . LEU A 1 95  ? 3.608   2.100   4.793   1.00 0.00 ? 95  LEU A O    1  
ATOM 1433  C CB   . LEU A 1 95  ? 5.818   -0.214  4.293   1.00 0.00 ? 95  LEU A CB   1  
ATOM 1434  C CG   . LEU A 1 95  ? 5.250   -1.624  4.463   1.00 0.00 ? 95  LEU A CG   1  
ATOM 1435  C CD1  . LEU A 1 95  ? 5.434   -2.431  3.187   1.00 0.00 ? 95  LEU A CD1  1  
ATOM 1436  C CD2  . LEU A 1 95  ? 5.911   -2.326  5.640   1.00 0.00 ? 95  LEU A CD2  1  
ATOM 1437  H H    . LEU A 1 95  ? 6.656   2.055   3.536   1.00 0.00 ? 95  LEU A H    1  
ATOM 1438  H HA   . LEU A 1 95  ? 4.789   0.236   2.470   1.00 0.00 ? 95  LEU A HA   1  
ATOM 1439  H HB2  . LEU A 1 95  ? 6.805   -0.304  3.868   1.00 0.00 ? 95  LEU A HB2  1  
ATOM 1440  H HB3  . LEU A 1 95  ? 5.889   0.236   5.273   1.00 0.00 ? 95  LEU A HB3  1  
ATOM 1441  H HG   . LEU A 1 95  ? 4.190   -1.556  4.665   1.00 0.00 ? 95  LEU A HG   1  
ATOM 1442  H HD11 . LEU A 1 95  ? 5.060   -1.866  2.347   1.00 0.00 ? 95  LEU A HD11 1  
ATOM 1443  H HD12 . LEU A 1 95  ? 4.891   -3.360  3.268   1.00 0.00 ? 95  LEU A HD12 1  
ATOM 1444  H HD13 . LEU A 1 95  ? 6.484   -2.640  3.042   1.00 0.00 ? 95  LEU A HD13 1  
ATOM 1445  H HD21 . LEU A 1 95  ? 6.972   -2.123  5.631   1.00 0.00 ? 95  LEU A HD21 1  
ATOM 1446  H HD22 . LEU A 1 95  ? 5.748   -3.391  5.561   1.00 0.00 ? 95  LEU A HD22 1  
ATOM 1447  H HD23 . LEU A 1 95  ? 5.482   -1.963  6.563   1.00 0.00 ? 95  LEU A HD23 1  
ATOM 1448  N N    . GLY A 1 96  ? 2.676   0.267   3.879   1.00 0.00 ? 96  GLY A N    1  
ATOM 1449  C CA   . GLY A 1 96  ? 1.382   0.517   4.486   1.00 0.00 ? 96  GLY A CA   1  
ATOM 1450  C C    . GLY A 1 96  ? 1.154   -0.318  5.730   1.00 0.00 ? 96  GLY A C    1  
ATOM 1451  O O    . GLY A 1 96  ? 2.042   -0.444  6.572   1.00 0.00 ? 96  GLY A O    1  
ATOM 1452  H H    . GLY A 1 96  ? 2.805   -0.519  3.309   1.00 0.00 ? 96  GLY A H    1  
ATOM 1453  H HA2  . GLY A 1 96  ? 1.315   1.562   4.748   1.00 0.00 ? 96  GLY A HA2  1  
ATOM 1454  H HA3  . GLY A 1 96  ? 0.610   0.287   3.766   1.00 0.00 ? 96  GLY A HA3  1  
ATOM 1455  N N    . ALA A 1 97  ? -0.041  -0.888  5.848   1.00 0.00 ? 97  ALA A N    1  
ATOM 1456  C CA   . ALA A 1 97  ? -0.383  -1.715  6.998   1.00 0.00 ? 97  ALA A CA   1  
ATOM 1457  C C    . ALA A 1 97  ? -0.448  -3.189  6.615   1.00 0.00 ? 97  ALA A C    1  
ATOM 1458  O O    . ALA A 1 97  ? -0.684  -3.529  5.456   1.00 0.00 ? 97  ALA A O    1  
ATOM 1459  C CB   . ALA A 1 97  ? -1.707  -1.265  7.597   1.00 0.00 ? 97  ALA A CB   1  
ATOM 1460  H H    . ALA A 1 97  ? -0.708  -0.750  5.143   1.00 0.00 ? 97  ALA A H    1  
ATOM 1461  H HA   . ALA A 1 97  ? 0.386   -1.581  7.746   1.00 0.00 ? 97  ALA A HA   1  
ATOM 1462  H HB1  . ALA A 1 97  ? -1.522  -0.530  8.367   1.00 0.00 ? 97  ALA A HB1  1  
ATOM 1463  H HB2  . ALA A 1 97  ? -2.322  -0.829  6.824   1.00 0.00 ? 97  ALA A HB2  1  
ATOM 1464  H HB3  . ALA A 1 97  ? -2.216  -2.115  8.025   1.00 0.00 ? 97  ALA A HB3  1  
ATOM 1465  N N    . SER A 1 98  ? -0.235  -4.061  7.596   1.00 0.00 ? 98  SER A N    1  
ATOM 1466  C CA   . SER A 1 98  ? -0.265  -5.500  7.360   1.00 0.00 ? 98  SER A CA   1  
ATOM 1467  C C    . SER A 1 98  ? -1.573  -6.105  7.859   1.00 0.00 ? 98  SER A C    1  
ATOM 1468  O O    . SER A 1 98  ? -2.051  -5.773  8.944   1.00 0.00 ? 98  SER A O    1  
ATOM 1469  C CB   . SER A 1 98  ? 0.920   -6.176  8.051   1.00 0.00 ? 98  SER A CB   1  
ATOM 1470  O OG   . SER A 1 98  ? 0.713   -6.260  9.451   1.00 0.00 ? 98  SER A OG   1  
ATOM 1471  H H    . SER A 1 98  ? -0.052  -3.728  8.499   1.00 0.00 ? 98  SER A H    1  
ATOM 1472  H HA   . SER A 1 98  ? -0.190  -5.662  6.295   1.00 0.00 ? 98  SER A HA   1  
ATOM 1473  H HB2  . SER A 1 98  ? 1.043   -7.173  7.657   1.00 0.00 ? 98  SER A HB2  1  
ATOM 1474  H HB3  . SER A 1 98  ? 1.817   -5.602  7.866   1.00 0.00 ? 98  SER A HB3  1  
ATOM 1475  H HG   . SER A 1 98  ? 0.285   -5.459  9.760   1.00 0.00 ? 98  SER A HG   1  
ATOM 1476  N N    . THR A 1 99  ? -2.149  -6.997  7.058   1.00 0.00 ? 99  THR A N    1  
ATOM 1477  C CA   . THR A 1 99  ? -3.402  -7.649  7.417   1.00 0.00 ? 99  THR A CA   1  
ATOM 1478  C C    . THR A 1 99  ? -3.201  -8.635  8.561   1.00 0.00 ? 99  THR A C    1  
ATOM 1479  O O    . THR A 1 99  ? -2.078  -8.854  9.014   1.00 0.00 ? 99  THR A O    1  
ATOM 1480  C CB   . THR A 1 99  ? -4.012  -8.393  6.214   1.00 0.00 ? 99  THR A CB   1  
ATOM 1481  O OG1  . THR A 1 99  ? -3.030  -9.247  5.616   1.00 0.00 ? 99  THR A OG1  1  
ATOM 1482  C CG2  . THR A 1 99  ? -4.534  -7.409  5.177   1.00 0.00 ? 99  THR A CG2  1  
ATOM 1483  H H    . THR A 1 99  ? -1.720  -7.220  6.206   1.00 0.00 ? 99  THR A H    1  
ATOM 1484  H HA   . THR A 1 99  ? -4.098  -6.884  7.731   1.00 0.00 ? 99  THR A HA   1  
ATOM 1485  H HB   . THR A 1 99  ? -4.838  -8.996  6.564   1.00 0.00 ? 99  THR A HB   1  
ATOM 1486  H HG1  . THR A 1 99  ? -3.127  -10.137 5.963   1.00 0.00 ? 99  THR A HG1  1  
ATOM 1487  H HG21 . THR A 1 99  ? -4.333  -6.400  5.505   1.00 0.00 ? 99  THR A HG21 1  
ATOM 1488  H HG22 . THR A 1 99  ? -5.599  -7.544  5.058   1.00 0.00 ? 99  THR A HG22 1  
ATOM 1489  H HG23 . THR A 1 99  ? -4.041  -7.586  4.233   1.00 0.00 ? 99  THR A HG23 1  
ATOM 1490  N N    . ALA A 1 100 ? -4.297  -9.229  9.024   1.00 0.00 ? 100 ALA A N    1  
ATOM 1491  C CA   . ALA A 1 100 ? -4.240  -10.195 10.114  1.00 0.00 ? 100 ALA A CA   1  
ATOM 1492  C C    . ALA A 1 100 ? -3.411  -11.414 9.724   1.00 0.00 ? 100 ALA A C    1  
ATOM 1493  O O    . ALA A 1 100 ? -3.506  -11.906 8.601   1.00 0.00 ? 100 ALA A O    1  
ATOM 1494  C CB   . ALA A 1 100 ? -5.644  -10.616 10.519  1.00 0.00 ? 100 ALA A CB   1  
ATOM 1495  H H    . ALA A 1 100 ? -5.163  -9.013  8.621   1.00 0.00 ? 100 ALA A H    1  
ATOM 1496  H HA   . ALA A 1 100 ? -3.776  -9.713  10.963  1.00 0.00 ? 100 ALA A HA   1  
ATOM 1497  H HB1  . ALA A 1 100 ? -5.946  -10.062 11.396  1.00 0.00 ? 100 ALA A HB1  1  
ATOM 1498  H HB2  . ALA A 1 100 ? -6.329  -10.412 9.710   1.00 0.00 ? 100 ALA A HB2  1  
ATOM 1499  H HB3  . ALA A 1 100 ? -5.653  -11.673 10.740  1.00 0.00 ? 100 ALA A HB3  1  
ATOM 1500  N N    . GLU A 1 101 ? -2.599  -11.896 10.660  1.00 0.00 ? 101 GLU A N    1  
ATOM 1501  C CA   . GLU A 1 101 ? -1.752  -13.057 10.412  1.00 0.00 ? 101 GLU A CA   1  
ATOM 1502  C C    . GLU A 1 101 ? -2.597  -14.311 10.203  1.00 0.00 ? 101 GLU A C    1  
ATOM 1503  O O    . GLU A 1 101 ? -3.138  -14.873 11.155  1.00 0.00 ? 101 GLU A O    1  
ATOM 1504  C CB   . GLU A 1 101 ? -0.785  -13.269 11.579  1.00 0.00 ? 101 GLU A CB   1  
ATOM 1505  C CG   . GLU A 1 101 ? 0.361   -14.212 11.255  1.00 0.00 ? 101 GLU A CG   1  
ATOM 1506  C CD   . GLU A 1 101 ? 1.582   -13.965 12.120  1.00 0.00 ? 101 GLU A CD   1  
ATOM 1507  O OE1  . GLU A 1 101 ? 2.129   -12.843 12.066  1.00 0.00 ? 101 GLU A OE1  1  
ATOM 1508  O OE2  . GLU A 1 101 ? 1.990   -14.892 12.850  1.00 0.00 ? 101 GLU A OE2  1  
ATOM 1509  H H    . GLU A 1 101 ? -2.568  -11.459 11.537  1.00 0.00 ? 101 GLU A H    1  
ATOM 1510  H HA   . GLU A 1 101 ? -1.183  -12.867 9.515   1.00 0.00 ? 101 GLU A HA   1  
ATOM 1511  H HB2  . GLU A 1 101 ? -0.370  -12.314 11.865  1.00 0.00 ? 101 GLU A HB2  1  
ATOM 1512  H HB3  . GLU A 1 101 ? -1.334  -13.677 12.415  1.00 0.00 ? 101 GLU A HB3  1  
ATOM 1513  H HG2  . GLU A 1 101 ? 0.030   -15.228 11.410  1.00 0.00 ? 101 GLU A HG2  1  
ATOM 1514  H HG3  . GLU A 1 101 ? 0.639   -14.079 10.220  1.00 0.00 ? 101 GLU A HG3  1  
ATOM 1515  N N    . ILE A 1 102 ? -2.705  -14.742 8.951   1.00 0.00 ? 102 ILE A N    1  
ATOM 1516  C CA   . ILE A 1 102 ? -3.482  -15.928 8.616   1.00 0.00 ? 102 ILE A CA   1  
ATOM 1517  C C    . ILE A 1 102 ? -2.581  -17.053 8.117   1.00 0.00 ? 102 ILE A C    1  
ATOM 1518  O O    . ILE A 1 102 ? -1.538  -16.805 7.512   1.00 0.00 ? 102 ILE A O    1  
ATOM 1519  C CB   . ILE A 1 102 ? -4.544  -15.622 7.543   1.00 0.00 ? 102 ILE A CB   1  
ATOM 1520  C CG1  . ILE A 1 102 ? -3.872  -15.294 6.209   1.00 0.00 ? 102 ILE A CG1  1  
ATOM 1521  C CG2  . ILE A 1 102 ? -5.433  -14.472 7.992   1.00 0.00 ? 102 ILE A CG2  1  
ATOM 1522  C CD1  . ILE A 1 102 ? -4.801  -15.405 5.021   1.00 0.00 ? 102 ILE A CD1  1  
ATOM 1523  H H    . ILE A 1 102 ? -2.250  -14.251 8.235   1.00 0.00 ? 102 ILE A H    1  
ATOM 1524  H HA   . ILE A 1 102 ? -3.989  -16.258 9.512   1.00 0.00 ? 102 ILE A HA   1  
ATOM 1525  H HB   . ILE A 1 102 ? -5.163  -16.497 7.421   1.00 0.00 ? 102 ILE A HB   1  
ATOM 1526  H HG12 . ILE A 1 102 ? -3.494  -14.284 6.241   1.00 0.00 ? 102 ILE A HG12 1  
ATOM 1527  H HG13 . ILE A 1 102 ? -3.049  -15.976 6.051   1.00 0.00 ? 102 ILE A HG13 1  
ATOM 1528  H HG21 . ILE A 1 102 ? -5.620  -13.815 7.155   1.00 0.00 ? 102 ILE A HG21 1  
ATOM 1529  H HG22 . ILE A 1 102 ? -6.370  -14.863 8.358   1.00 0.00 ? 102 ILE A HG22 1  
ATOM 1530  H HG23 . ILE A 1 102 ? -4.940  -13.921 8.778   1.00 0.00 ? 102 ILE A HG23 1  
ATOM 1531  H HD11 . ILE A 1 102 ? -4.242  -15.722 4.153   1.00 0.00 ? 102 ILE A HD11 1  
ATOM 1532  H HD12 . ILE A 1 102 ? -5.576  -16.125 5.235   1.00 0.00 ? 102 ILE A HD12 1  
ATOM 1533  H HD13 . ILE A 1 102 ? -5.251  -14.441 4.825   1.00 0.00 ? 102 ILE A HD13 1  
ATOM 1534  N N    . SER A 1 103 ? -2.992  -18.291 8.374   1.00 0.00 ? 103 SER A N    1  
ATOM 1535  C CA   . SER A 1 103 ? -2.221  -19.455 7.952   1.00 0.00 ? 103 SER A CA   1  
ATOM 1536  C C    . SER A 1 103 ? -3.115  -20.473 7.249   1.00 0.00 ? 103 SER A C    1  
ATOM 1537  O O    . SER A 1 103 ? -4.285  -20.632 7.596   1.00 0.00 ? 103 SER A O    1  
ATOM 1538  C CB   . SER A 1 103 ? -1.539  -20.105 9.158   1.00 0.00 ? 103 SER A CB   1  
ATOM 1539  O OG   . SER A 1 103 ? -0.681  -19.187 9.814   1.00 0.00 ? 103 SER A OG   1  
ATOM 1540  H H    . SER A 1 103 ? -3.833  -18.424 8.860   1.00 0.00 ? 103 SER A H    1  
ATOM 1541  H HA   . SER A 1 103 ? -1.465  -19.118 7.259   1.00 0.00 ? 103 SER A HA   1  
ATOM 1542  H HB2  . SER A 1 103 ? -2.291  -20.440 9.856   1.00 0.00 ? 103 SER A HB2  1  
ATOM 1543  H HB3  . SER A 1 103 ? -0.955  -20.950 8.824   1.00 0.00 ? 103 SER A HB3  1  
ATOM 1544  H HG   . SER A 1 103 ? 0.014   -19.668 10.269  1.00 0.00 ? 103 SER A HG   1  
ATOM 1545  N N    . ALA A 1 104 ? -2.554  -21.159 6.259   1.00 0.00 ? 104 ALA A N    1  
ATOM 1546  C CA   . ALA A 1 104 ? -3.297  -22.162 5.508   1.00 0.00 ? 104 ALA A CA   1  
ATOM 1547  C C    . ALA A 1 104 ? -2.569  -23.502 5.511   1.00 0.00 ? 104 ALA A C    1  
ATOM 1548  O O    . ALA A 1 104 ? -1.341  -23.551 5.442   1.00 0.00 ? 104 ALA A O    1  
ATOM 1549  C CB   . ALA A 1 104 ? -3.529  -21.689 4.081   1.00 0.00 ? 104 ALA A CB   1  
ATOM 1550  H H    . ALA A 1 104 ? -1.617  -20.987 6.029   1.00 0.00 ? 104 ALA A H    1  
ATOM 1551  H HA   . ALA A 1 104 ? -4.261  -22.287 5.981   1.00 0.00 ? 104 ALA A HA   1  
ATOM 1552  H HB1  . ALA A 1 104 ? -3.548  -22.542 3.418   1.00 0.00 ? 104 ALA A HB1  1  
ATOM 1553  H HB2  . ALA A 1 104 ? -4.472  -21.167 4.023   1.00 0.00 ? 104 ALA A HB2  1  
ATOM 1554  H HB3  . ALA A 1 104 ? -2.730  -21.024 3.788   1.00 0.00 ? 104 ALA A HB3  1  
ATOM 1555  N N    . ARG A 1 105 ? -3.333  -24.586 5.593   1.00 0.00 ? 105 ARG A N    1  
ATOM 1556  C CA   . ARG A 1 105 ? -2.760  -25.926 5.608   1.00 0.00 ? 105 ARG A CA   1  
ATOM 1557  C C    . ARG A 1 105 ? -2.834  -26.564 4.224   1.00 0.00 ? 105 ARG A C    1  
ATOM 1558  O O    . ARG A 1 105 ? -3.902  -26.628 3.613   1.00 0.00 ? 105 ARG A O    1  
ATOM 1559  C CB   . ARG A 1 105 ? -3.489  -26.805 6.626   1.00 0.00 ? 105 ARG A CB   1  
ATOM 1560  C CG   . ARG A 1 105 ? -3.074  -28.267 6.576   1.00 0.00 ? 105 ARG A CG   1  
ATOM 1561  C CD   . ARG A 1 105 ? -3.816  -29.091 7.616   1.00 0.00 ? 105 ARG A CD   1  
ATOM 1562  N NE   . ARG A 1 105 ? -5.258  -29.095 7.385   1.00 0.00 ? 105 ARG A NE   1  
ATOM 1563  C CZ   . ARG A 1 105 ? -6.135  -29.636 8.224   1.00 0.00 ? 105 ARG A CZ   1  
ATOM 1564  N NH1  . ARG A 1 105 ? -5.719  -30.214 9.342   1.00 0.00 ? 105 ARG A NH1  1  
ATOM 1565  N NH2  . ARG A 1 105 ? -7.432  -29.599 7.944   1.00 0.00 ? 105 ARG A NH2  1  
ATOM 1566  H H    . ARG A 1 105 ? -4.307  -24.482 5.646   1.00 0.00 ? 105 ARG A H    1  
ATOM 1567  H HA   . ARG A 1 105 ? -1.723  -25.840 5.896   1.00 0.00 ? 105 ARG A HA   1  
ATOM 1568  H HB2  . ARG A 1 105 ? -3.286  -26.430 7.618   1.00 0.00 ? 105 ARG A HB2  1  
ATOM 1569  H HB3  . ARG A 1 105 ? -4.550  -26.747 6.438   1.00 0.00 ? 105 ARG A HB3  1  
ATOM 1570  H HG2  . ARG A 1 105 ? -3.296  -28.661 5.595   1.00 0.00 ? 105 ARG A HG2  1  
ATOM 1571  H HG3  . ARG A 1 105 ? -2.013  -28.337 6.763   1.00 0.00 ? 105 ARG A HG3  1  
ATOM 1572  H HD2  . ARG A 1 105 ? -3.453  -30.107 7.576   1.00 0.00 ? 105 ARG A HD2  1  
ATOM 1573  H HD3  . ARG A 1 105 ? -3.618  -28.676 8.593   1.00 0.00 ? 105 ARG A HD3  1  
ATOM 1574  H HE   . ARG A 1 105 ? -5.588  -28.673 6.565   1.00 0.00 ? 105 ARG A HE   1  
ATOM 1575  H HH11 . ARG A 1 105 ? -4.743  -30.242 9.556   1.00 0.00 ? 105 ARG A HH11 1  
ATOM 1576  H HH12 . ARG A 1 105 ? -6.382  -30.620 9.972   1.00 0.00 ? 105 ARG A HH12 1  
ATOM 1577  H HH21 . ARG A 1 105 ? -7.749  -29.164 7.102   1.00 0.00 ? 105 ARG A HH21 1  
ATOM 1578  H HH22 . ARG A 1 105 ? -8.091  -30.007 8.575   1.00 0.00 ? 105 ARG A HH22 1  
ATOM 1579  N N    . THR A 1 106 ? -1.692  -27.036 3.733   1.00 0.00 ? 106 THR A N    1  
ATOM 1580  C CA   . THR A 1 106 ? -1.627  -27.667 2.421   1.00 0.00 ? 106 THR A CA   1  
ATOM 1581  C C    . THR A 1 106 ? -2.415  -28.972 2.399   1.00 0.00 ? 106 THR A C    1  
ATOM 1582  O O    . THR A 1 106 ? -2.638  -29.591 3.439   1.00 0.00 ? 106 THR A O    1  
ATOM 1583  C CB   . THR A 1 106 ? -0.171  -27.953 2.007   1.00 0.00 ? 106 THR A CB   1  
ATOM 1584  O OG1  . THR A 1 106 ? 0.579   -28.410 3.137   1.00 0.00 ? 106 THR A OG1  1  
ATOM 1585  C CG2  . THR A 1 106 ? 0.482   -26.706 1.430   1.00 0.00 ? 106 THR A CG2  1  
ATOM 1586  H H    . THR A 1 106 ? -0.874  -26.956 4.267   1.00 0.00 ? 106 THR A H    1  
ATOM 1587  H HA   . THR A 1 106 ? -2.057  -26.986 1.701   1.00 0.00 ? 106 THR A HA   1  
ATOM 1588  H HB   . THR A 1 106 ? -0.173  -28.724 1.249   1.00 0.00 ? 106 THR A HB   1  
ATOM 1589  H HG1  . THR A 1 106 ? 1.514   -28.420 2.919   1.00 0.00 ? 106 THR A HG1  1  
ATOM 1590  H HG21 . THR A 1 106 ? 0.248   -26.631 0.378   1.00 0.00 ? 106 THR A HG21 1  
ATOM 1591  H HG22 . THR A 1 106 ? 1.553   -26.769 1.557   1.00 0.00 ? 106 THR A HG22 1  
ATOM 1592  H HG23 . THR A 1 106 ? 0.109   -25.834 1.944   1.00 0.00 ? 106 THR A HG23 1  
ATOM 1593  N N    . MET A 1 107 ? -2.833  -29.385 1.207   1.00 0.00 ? 107 MET A N    1  
ATOM 1594  C CA   . MET A 1 107 ? -3.594  -30.619 1.050   1.00 0.00 ? 107 MET A CA   1  
ATOM 1595  C C    . MET A 1 107 ? -2.786  -31.821 1.527   1.00 0.00 ? 107 MET A C    1  
ATOM 1596  O O    . MET A 1 107 ? -1.556  -31.810 1.482   1.00 0.00 ? 107 MET A O    1  
ATOM 1597  C CB   . MET A 1 107 ? -4.001  -30.810 -0.412  1.00 0.00 ? 107 MET A CB   1  
ATOM 1598  C CG   . MET A 1 107 ? -4.811  -29.654 -0.974  1.00 0.00 ? 107 MET A CG   1  
ATOM 1599  S SD   . MET A 1 107 ? -5.937  -30.167 -2.286  1.00 0.00 ? 107 MET A SD   1  
ATOM 1600  C CE   . MET A 1 107 ? -6.977  -28.715 -2.427  1.00 0.00 ? 107 MET A CE   1  
ATOM 1601  H H    . MET A 1 107 ? -2.624  -28.849 0.414   1.00 0.00 ? 107 MET A H    1  
ATOM 1602  H HA   . MET A 1 107 ? -4.486  -30.537 1.654   1.00 0.00 ? 107 MET A HA   1  
ATOM 1603  H HB2  . MET A 1 107 ? -3.108  -30.921 -1.010  1.00 0.00 ? 107 MET A HB2  1  
ATOM 1604  H HB3  . MET A 1 107 ? -4.593  -31.709 -0.495  1.00 0.00 ? 107 MET A HB3  1  
ATOM 1605  H HG2  . MET A 1 107 ? -5.389  -29.214 -0.175  1.00 0.00 ? 107 MET A HG2  1  
ATOM 1606  H HG3  . MET A 1 107 ? -4.130  -28.915 -1.371  1.00 0.00 ? 107 MET A HG3  1  
ATOM 1607  H HE1  . MET A 1 107 ? -8.014  -29.015 -2.441  1.00 0.00 ? 107 MET A HE1  1  
ATOM 1608  H HE2  . MET A 1 107 ? -6.802  -28.064 -1.583  1.00 0.00 ? 107 MET A HE2  1  
ATOM 1609  H HE3  . MET A 1 107 ? -6.741  -28.191 -3.341  1.00 0.00 ? 107 MET A HE3  1  
ATOM 1610  N N    . GLN A 1 108 ? -3.485  -32.855 1.984   1.00 0.00 ? 108 GLN A N    1  
ATOM 1611  C CA   . GLN A 1 108 ? -2.831  -34.064 2.470   1.00 0.00 ? 108 GLN A CA   1  
ATOM 1612  C C    . GLN A 1 108 ? -2.429  -34.970 1.310   1.00 0.00 ? 108 GLN A C    1  
ATOM 1613  O O    . GLN A 1 108 ? -3.251  -35.716 0.778   1.00 0.00 ? 108 GLN A O    1  
ATOM 1614  C CB   . GLN A 1 108 ? -3.755  -34.821 3.426   1.00 0.00 ? 108 GLN A CB   1  
ATOM 1615  C CG   . GLN A 1 108 ? -3.046  -35.895 4.235   1.00 0.00 ? 108 GLN A CG   1  
ATOM 1616  C CD   . GLN A 1 108 ? -2.332  -35.335 5.449   1.00 0.00 ? 108 GLN A CD   1  
ATOM 1617  O OE1  . GLN A 1 108 ? -2.494  -34.164 5.794   1.00 0.00 ? 108 GLN A OE1  1  
ATOM 1618  N NE2  . GLN A 1 108 ? -1.537  -36.171 6.106   1.00 0.00 ? 108 GLN A NE2  1  
ATOM 1619  H H    . GLN A 1 108 ? -4.463  -32.804 1.995   1.00 0.00 ? 108 GLN A H    1  
ATOM 1620  H HA   . GLN A 1 108 ? -1.941  -33.768 3.004   1.00 0.00 ? 108 GLN A HA   1  
ATOM 1621  H HB2  . GLN A 1 108 ? -4.197  -34.115 4.114   1.00 0.00 ? 108 GLN A HB2  1  
ATOM 1622  H HB3  . GLN A 1 108 ? -4.539  -35.292 2.852   1.00 0.00 ? 108 GLN A HB3  1  
ATOM 1623  H HG2  . GLN A 1 108 ? -3.776  -36.618 4.568   1.00 0.00 ? 108 GLN A HG2  1  
ATOM 1624  H HG3  . GLN A 1 108 ? -2.320  -36.383 3.602   1.00 0.00 ? 108 GLN A HG3  1  
ATOM 1625  H HE21 . GLN A 1 108 ? -1.456  -37.090 5.773   1.00 0.00 ? 108 GLN A HE21 1  
ATOM 1626  H HE22 . GLN A 1 108 ? -1.062  -35.836 6.894   1.00 0.00 ? 108 GLN A HE22 1  
ATOM 1627  N N    . SER A 1 109 ? -1.160  -34.898 0.922   1.00 0.00 ? 109 SER A N    1  
ATOM 1628  C CA   . SER A 1 109 ? -0.649  -35.708 -0.178  1.00 0.00 ? 109 SER A CA   1  
ATOM 1629  C C    . SER A 1 109 ? -0.659  -37.189 0.189   1.00 0.00 ? 109 SER A C    1  
ATOM 1630  O O    . SER A 1 109 ? -0.287  -37.568 1.299   1.00 0.00 ? 109 SER A O    1  
ATOM 1631  C CB   . SER A 1 109 ? 0.770   -35.271 -0.545  1.00 0.00 ? 109 SER A CB   1  
ATOM 1632  O OG   . SER A 1 109 ? 1.632   -35.340 0.578   1.00 0.00 ? 109 SER A OG   1  
ATOM 1633  H H    . SER A 1 109 ? -0.553  -34.283 1.386   1.00 0.00 ? 109 SER A H    1  
ATOM 1634  H HA   . SER A 1 109 ? -1.296  -35.556 -1.029  1.00 0.00 ? 109 SER A HA   1  
ATOM 1635  H HB2  . SER A 1 109 ? 1.154   -35.918 -1.319  1.00 0.00 ? 109 SER A HB2  1  
ATOM 1636  H HB3  . SER A 1 109 ? 0.748   -34.252 -0.906  1.00 0.00 ? 109 SER A HB3  1  
ATOM 1637  H HG   . SER A 1 109 ? 2.328   -35.979 0.408   1.00 0.00 ? 109 SER A HG   1  
ATOM 1638  N N    . SER A 1 110 ? -1.087  -38.022 -0.754  1.00 0.00 ? 110 SER A N    1  
ATOM 1639  C CA   . SER A 1 110 ? -1.149  -39.462 -0.531  1.00 0.00 ? 110 SER A CA   1  
ATOM 1640  C C    . SER A 1 110 ? 0.251   -40.048 -0.374  1.00 0.00 ? 110 SER A C    1  
ATOM 1641  O O    . SER A 1 110 ? 1.247   -39.395 -0.679  1.00 0.00 ? 110 SER A O    1  
ATOM 1642  C CB   . SER A 1 110 ? -1.875  -40.148 -1.690  1.00 0.00 ? 110 SER A CB   1  
ATOM 1643  O OG   . SER A 1 110 ? -0.997  -40.373 -2.780  1.00 0.00 ? 110 SER A OG   1  
ATOM 1644  H H    . SER A 1 110 ? -1.370  -37.660 -1.620  1.00 0.00 ? 110 SER A H    1  
ATOM 1645  H HA   . SER A 1 110 ? -1.703  -39.633 0.380   1.00 0.00 ? 110 SER A HA   1  
ATOM 1646  H HB2  . SER A 1 110 ? -2.264  -41.098 -1.356  1.00 0.00 ? 110 SER A HB2  1  
ATOM 1647  H HB3  . SER A 1 110 ? -2.690  -39.522 -2.022  1.00 0.00 ? 110 SER A HB3  1  
ATOM 1648  H HG   . SER A 1 110 ? -0.850  -41.316 -2.884  1.00 0.00 ? 110 SER A HG   1  
ATOM 1649  N N    . GLY A 1 111 ? 0.316   -41.287 0.105   1.00 0.00 ? 111 GLY A N    1  
ATOM 1650  C CA   . GLY A 1 111 ? 1.597   -41.942 0.296   1.00 0.00 ? 111 GLY A CA   1  
ATOM 1651  C C    . GLY A 1 111 ? 2.095   -42.619 -0.966  1.00 0.00 ? 111 GLY A C    1  
ATOM 1652  O O    . GLY A 1 111 ? 1.317   -43.137 -1.767  1.00 0.00 ? 111 GLY A O    1  
ATOM 1653  H H    . GLY A 1 111 ? -0.512  -41.760 0.332   1.00 0.00 ? 111 GLY A H    1  
ATOM 1654  H HA2  . GLY A 1 111 ? 2.323   -41.205 0.607   1.00 0.00 ? 111 GLY A HA2  1  
ATOM 1655  H HA3  . GLY A 1 111 ? 1.497   -42.685 1.073   1.00 0.00 ? 111 GLY A HA3  1  
ATOM 1656  N N    . PRO A 1 112 ? 3.423   -42.619 -1.158  1.00 0.00 ? 112 PRO A N    1  
ATOM 1657  C CA   . PRO A 1 112 ? 4.053   -43.233 -2.330  1.00 0.00 ? 112 PRO A CA   1  
ATOM 1658  C C    . PRO A 1 112 ? 3.958   -44.755 -2.309  1.00 0.00 ? 112 PRO A C    1  
ATOM 1659  O O    . PRO A 1 112 ? 4.868   -45.437 -1.838  1.00 0.00 ? 112 PRO A O    1  
ATOM 1660  C CB   . PRO A 1 112 ? 5.514   -42.788 -2.221  1.00 0.00 ? 112 PRO A CB   1  
ATOM 1661  C CG   . PRO A 1 112 ? 5.724   -42.530 -0.769  1.00 0.00 ? 112 PRO A CG   1  
ATOM 1662  C CD   . PRO A 1 112 ? 4.411   -42.020 -0.244  1.00 0.00 ? 112 PRO A CD   1  
ATOM 1663  H HA   . PRO A 1 112 ? 3.629   -42.860 -3.250  1.00 0.00 ? 112 PRO A HA   1  
ATOM 1664  H HB2  . PRO A 1 112 ? 6.161   -43.575 -2.582  1.00 0.00 ? 112 PRO A HB2  1  
ATOM 1665  H HB3  . PRO A 1 112 ? 5.666   -41.893 -2.807  1.00 0.00 ? 112 PRO A HB3  1  
ATOM 1666  H HG2  . PRO A 1 112 ? 5.998   -43.446 -0.269  1.00 0.00 ? 112 PRO A HG2  1  
ATOM 1667  H HG3  . PRO A 1 112 ? 6.495   -41.785 -0.637  1.00 0.00 ? 112 PRO A HG3  1  
ATOM 1668  H HD2  . PRO A 1 112 ? 4.253   -42.357 0.769   1.00 0.00 ? 112 PRO A HD2  1  
ATOM 1669  H HD3  . PRO A 1 112 ? 4.377   -40.942 -0.295  1.00 0.00 ? 112 PRO A HD3  1  
ATOM 1670  N N    . SER A 1 113 ? 2.851   -45.281 -2.823  1.00 0.00 ? 113 SER A N    1  
ATOM 1671  C CA   . SER A 1 113 ? 2.635   -46.723 -2.860  1.00 0.00 ? 113 SER A CA   1  
ATOM 1672  C C    . SER A 1 113 ? 3.805   -47.429 -3.538  1.00 0.00 ? 113 SER A C    1  
ATOM 1673  O O    . SER A 1 113 ? 4.154   -47.121 -4.677  1.00 0.00 ? 113 SER A O    1  
ATOM 1674  C CB   . SER A 1 113 ? 1.333   -47.046 -3.595  1.00 0.00 ? 113 SER A CB   1  
ATOM 1675  O OG   . SER A 1 113 ? 0.883   -48.353 -3.284  1.00 0.00 ? 113 SER A OG   1  
ATOM 1676  H H    . SER A 1 113 ? 2.161   -44.684 -3.183  1.00 0.00 ? 113 SER A H    1  
ATOM 1677  H HA   . SER A 1 113 ? 2.560   -47.073 -1.841  1.00 0.00 ? 113 SER A HA   1  
ATOM 1678  H HB2  . SER A 1 113 ? 0.573   -46.338 -3.304  1.00 0.00 ? 113 SER A HB2  1  
ATOM 1679  H HB3  . SER A 1 113 ? 1.499   -46.979 -4.661  1.00 0.00 ? 113 SER A HB3  1  
ATOM 1680  H HG   . SER A 1 113 ? 1.638   -48.916 -3.098  1.00 0.00 ? 113 SER A HG   1  
ATOM 1681  N N    . SER A 1 114 ? 4.406   -48.379 -2.828  1.00 0.00 ? 114 SER A N    1  
ATOM 1682  C CA   . SER A 1 114 ? 5.539   -49.128 -3.358  1.00 0.00 ? 114 SER A CA   1  
ATOM 1683  C C    . SER A 1 114 ? 5.132   -49.926 -4.594  1.00 0.00 ? 114 SER A C    1  
ATOM 1684  O O    . SER A 1 114 ? 5.562   -49.629 -5.708  1.00 0.00 ? 114 SER A O    1  
ATOM 1685  C CB   . SER A 1 114 ? 6.099   -50.070 -2.291  1.00 0.00 ? 114 SER A CB   1  
ATOM 1686  O OG   . SER A 1 114 ? 7.057   -49.410 -1.481  1.00 0.00 ? 114 SER A OG   1  
ATOM 1687  H H    . SER A 1 114 ? 4.081   -48.579 -1.925  1.00 0.00 ? 114 SER A H    1  
ATOM 1688  H HA   . SER A 1 114 ? 6.304   -48.419 -3.638  1.00 0.00 ? 114 SER A HA   1  
ATOM 1689  H HB2  . SER A 1 114 ? 5.294   -50.418 -1.663  1.00 0.00 ? 114 SER A HB2  1  
ATOM 1690  H HB3  . SER A 1 114 ? 6.572   -50.914 -2.772  1.00 0.00 ? 114 SER A HB3  1  
ATOM 1691  H HG   . SER A 1 114 ? 7.720   -50.041 -1.191  1.00 0.00 ? 114 SER A HG   1  
ATOM 1692  N N    . GLY A 1 115 ? 4.300   -50.942 -4.387  1.00 0.00 ? 115 GLY A N    1  
ATOM 1693  C CA   . GLY A 1 115 ? 3.849   -51.768 -5.492  1.00 0.00 ? 115 GLY A CA   1  
ATOM 1694  C C    . GLY A 1 115 ? 4.913   -52.739 -5.962  1.00 0.00 ? 115 GLY A C    1  
ATOM 1695  O O    . GLY A 1 115 ? 6.050   -52.700 -5.492  1.00 0.00 ? 115 GLY A O    1  
ATOM 1696  H H    . GLY A 1 115 ? 3.990   -51.133 -3.477  1.00 0.00 ? 115 GLY A H    1  
ATOM 1697  H HA2  . GLY A 1 115 ? 2.980   -52.327 -5.177  1.00 0.00 ? 115 GLY A HA2  1  
ATOM 1698  H HA3  . GLY A 1 115 ? 3.573   -51.127 -6.316  1.00 0.00 ? 115 GLY A HA3  1  
ATOM 1699  N N    . GLY A 1 1   ? -33.387 23.988  9.444   1.00 0.00 ? 1   GLY A N    2  
ATOM 1700  C CA   . GLY A 1 1   ? -32.157 23.729  8.719   1.00 0.00 ? 1   GLY A CA   2  
ATOM 1701  C C    . GLY A 1 1   ? -31.239 24.936  8.685   1.00 0.00 ? 1   GLY A C    2  
ATOM 1702  O O    . GLY A 1 1   ? -31.702 26.076  8.710   1.00 0.00 ? 1   GLY A O    2  
ATOM 1703  H H1   . GLY A 1 1   ? -33.350 24.300  10.373  1.00 0.00 ? 1   GLY A H1   2  
ATOM 1704  H HA2  . GLY A 1 1   ? -31.638 22.909  9.192   1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1705  H HA3  . GLY A 1 1   ? -32.402 23.450  7.705   1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1706  N N    . SER A 1 2   ? -29.935 24.684  8.630   1.00 0.00 ? 2   SER A N    2  
ATOM 1707  C CA   . SER A 1 2   ? -28.950 25.759  8.598   1.00 0.00 ? 2   SER A CA   2  
ATOM 1708  C C    . SER A 1 2   ? -27.611 25.252  8.072   1.00 0.00 ? 2   SER A C    2  
ATOM 1709  O O    . SER A 1 2   ? -27.249 24.094  8.278   1.00 0.00 ? 2   SER A O    2  
ATOM 1710  C CB   . SER A 1 2   ? -28.770 26.355  9.995   1.00 0.00 ? 2   SER A CB   2  
ATOM 1711  O OG   . SER A 1 2   ? -29.771 27.320  10.271  1.00 0.00 ? 2   SER A OG   2  
ATOM 1712  H H    . SER A 1 2   ? -29.629 23.753  8.612   1.00 0.00 ? 2   SER A H    2  
ATOM 1713  H HA   . SER A 1 2   ? -29.318 26.526  7.933   1.00 0.00 ? 2   SER A HA   2  
ATOM 1714  H HB2  . SER A 1 2   ? -28.834 25.568  10.731  1.00 0.00 ? 2   SER A HB2  2  
ATOM 1715  H HB3  . SER A 1 2   ? -27.802 26.830  10.059  1.00 0.00 ? 2   SER A HB3  2  
ATOM 1716  H HG   . SER A 1 2   ? -30.270 27.052  11.045  1.00 0.00 ? 2   SER A HG   2  
ATOM 1717  N N    . SER A 1 3   ? -26.879 26.130  7.393   1.00 0.00 ? 3   SER A N    2  
ATOM 1718  C CA   . SER A 1 3   ? -25.580 25.772  6.834   1.00 0.00 ? 3   SER A CA   2  
ATOM 1719  C C    . SER A 1 3   ? -24.448 26.323  7.695   1.00 0.00 ? 3   SER A C    2  
ATOM 1720  O O    . SER A 1 3   ? -24.681 27.066  8.646   1.00 0.00 ? 3   SER A O    2  
ATOM 1721  C CB   . SER A 1 3   ? -25.454 26.302  5.404   1.00 0.00 ? 3   SER A CB   2  
ATOM 1722  O OG   . SER A 1 3   ? -26.059 25.418  4.477   1.00 0.00 ? 3   SER A OG   2  
ATOM 1723  H H    . SER A 1 3   ? -27.222 27.039  7.263   1.00 0.00 ? 3   SER A H    2  
ATOM 1724  H HA   . SER A 1 3   ? -25.513 24.694  6.817   1.00 0.00 ? 3   SER A HA   2  
ATOM 1725  H HB2  . SER A 1 3   ? -25.939 27.264  5.335   1.00 0.00 ? 3   SER A HB2  2  
ATOM 1726  H HB3  . SER A 1 3   ? -24.408 26.407  5.154   1.00 0.00 ? 3   SER A HB3  2  
ATOM 1727  H HG   . SER A 1 3   ? -26.984 25.650  4.369   1.00 0.00 ? 3   SER A HG   2  
ATOM 1728  N N    . GLY A 1 4   ? -23.218 25.950  7.353   1.00 0.00 ? 4   GLY A N    2  
ATOM 1729  C CA   . GLY A 1 4   ? -22.066 26.415  8.103   1.00 0.00 ? 4   GLY A CA   2  
ATOM 1730  C C    . GLY A 1 4   ? -20.761 25.872  7.558   1.00 0.00 ? 4   GLY A C    2  
ATOM 1731  O O    . GLY A 1 4   ? -20.384 24.737  7.846   1.00 0.00 ? 4   GLY A O    2  
ATOM 1732  H H    . GLY A 1 4   ? -23.092 25.355  6.584   1.00 0.00 ? 4   GLY A H    2  
ATOM 1733  H HA2  . GLY A 1 4   ? -22.039 27.494  8.068   1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1734  H HA3  . GLY A 1 4   ? -22.171 26.102  9.132   1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1735  N N    . SER A 1 5   ? -20.069 26.685  6.765   1.00 0.00 ? 5   SER A N    2  
ATOM 1736  C CA   . SER A 1 5   ? -18.800 26.277  6.172   1.00 0.00 ? 5   SER A CA   2  
ATOM 1737  C C    . SER A 1 5   ? -17.725 27.333  6.411   1.00 0.00 ? 5   SER A C    2  
ATOM 1738  O O    . SER A 1 5   ? -17.944 28.521  6.175   1.00 0.00 ? 5   SER A O    2  
ATOM 1739  C CB   . SER A 1 5   ? -18.969 26.034  4.671   1.00 0.00 ? 5   SER A CB   2  
ATOM 1740  O OG   . SER A 1 5   ? -20.030 25.130  4.417   1.00 0.00 ? 5   SER A OG   2  
ATOM 1741  H H    . SER A 1 5   ? -20.422 27.579  6.572   1.00 0.00 ? 5   SER A H    2  
ATOM 1742  H HA   . SER A 1 5   ? -18.494 25.356  6.645   1.00 0.00 ? 5   SER A HA   2  
ATOM 1743  H HB2  . SER A 1 5   ? -19.184 26.971  4.180   1.00 0.00 ? 5   SER A HB2  2  
ATOM 1744  H HB3  . SER A 1 5   ? -18.054 25.620  4.272   1.00 0.00 ? 5   SER A HB3  2  
ATOM 1745  H HG   . SER A 1 5   ? -19.688 24.354  3.966   1.00 0.00 ? 5   SER A HG   2  
ATOM 1746  N N    . SER A 1 6   ? -16.563 26.890  6.880   1.00 0.00 ? 6   SER A N    2  
ATOM 1747  C CA   . SER A 1 6   ? -15.454 27.797  7.155   1.00 0.00 ? 6   SER A CA   2  
ATOM 1748  C C    . SER A 1 6   ? -14.481 27.835  5.981   1.00 0.00 ? 6   SER A C    2  
ATOM 1749  O O    . SER A 1 6   ? -14.412 26.898  5.186   1.00 0.00 ? 6   SER A O    2  
ATOM 1750  C CB   . SER A 1 6   ? -14.721 27.368  8.427   1.00 0.00 ? 6   SER A CB   2  
ATOM 1751  O OG   . SER A 1 6   ? -14.149 28.484  9.086   1.00 0.00 ? 6   SER A OG   2  
ATOM 1752  H H    . SER A 1 6   ? -16.450 25.931  7.048   1.00 0.00 ? 6   SER A H    2  
ATOM 1753  H HA   . SER A 1 6   ? -15.863 28.785  7.301   1.00 0.00 ? 6   SER A HA   2  
ATOM 1754  H HB2  . SER A 1 6   ? -15.418 26.888  9.097   1.00 0.00 ? 6   SER A HB2  2  
ATOM 1755  H HB3  . SER A 1 6   ? -13.933 26.675  8.169   1.00 0.00 ? 6   SER A HB3  2  
ATOM 1756  H HG   . SER A 1 6   ? -13.961 29.173  8.445   1.00 0.00 ? 6   SER A HG   2  
ATOM 1757  N N    . GLY A 1 7   ? -13.729 28.927  5.879   1.00 0.00 ? 7   GLY A N    2  
ATOM 1758  C CA   . GLY A 1 7   ? -12.769 29.068  4.800   1.00 0.00 ? 7   GLY A CA   2  
ATOM 1759  C C    . GLY A 1 7   ? -11.786 27.915  4.744   1.00 0.00 ? 7   GLY A C    2  
ATOM 1760  O O    . GLY A 1 7   ? -11.974 26.897  5.409   1.00 0.00 ? 7   GLY A O    2  
ATOM 1761  H H    . GLY A 1 7   ? -13.827 29.642  6.542   1.00 0.00 ? 7   GLY A H    2  
ATOM 1762  H HA2  . GLY A 1 7   ? -13.302 29.119  3.862   1.00 0.00 ? 7   GLY A HA2  2  
ATOM 1763  H HA3  . GLY A 1 7   ? -12.219 29.988  4.940   1.00 0.00 ? 7   GLY A HA3  2  
ATOM 1764  N N    . ASP A 1 8   ? -10.735 28.075  3.947   1.00 0.00 ? 8   ASP A N    2  
ATOM 1765  C CA   . ASP A 1 8   ? -9.719  27.038  3.805   1.00 0.00 ? 8   ASP A CA   2  
ATOM 1766  C C    . ASP A 1 8   ? -8.387  27.639  3.365   1.00 0.00 ? 8   ASP A C    2  
ATOM 1767  O O    . ASP A 1 8   ? -8.345  28.503  2.488   1.00 0.00 ? 8   ASP A O    2  
ATOM 1768  C CB   . ASP A 1 8   ? -10.174 25.982  2.797   1.00 0.00 ? 8   ASP A CB   2  
ATOM 1769  C CG   . ASP A 1 8   ? -11.580 25.487  3.072   1.00 0.00 ? 8   ASP A CG   2  
ATOM 1770  O OD1  . ASP A 1 8   ? -11.743 24.631  3.966   1.00 0.00 ? 8   ASP A OD1  2  
ATOM 1771  O OD2  . ASP A 1 8   ? -12.518 25.956  2.393   1.00 0.00 ? 8   ASP A OD2  2  
ATOM 1772  H H    . ASP A 1 8   ? -10.640 28.909  3.442   1.00 0.00 ? 8   ASP A H    2  
ATOM 1773  H HA   . ASP A 1 8   ? -9.586  26.570  4.769   1.00 0.00 ? 8   ASP A HA   2  
ATOM 1774  H HB2  . ASP A 1 8   ? -10.149 26.407  1.804   1.00 0.00 ? 8   ASP A HB2  2  
ATOM 1775  H HB3  . ASP A 1 8   ? -9.500  25.139  2.841   1.00 0.00 ? 8   ASP A HB3  2  
ATOM 1776  N N    . ILE A 1 9   ? -7.303  27.178  3.979   1.00 0.00 ? 9   ILE A N    2  
ATOM 1777  C CA   . ILE A 1 9   ? -5.972  27.670  3.650   1.00 0.00 ? 9   ILE A CA   2  
ATOM 1778  C C    . ILE A 1 9   ? -5.414  26.965  2.419   1.00 0.00 ? 9   ILE A C    2  
ATOM 1779  O O    . ILE A 1 9   ? -6.073  26.107  1.831   1.00 0.00 ? 9   ILE A O    2  
ATOM 1780  C CB   . ILE A 1 9   ? -4.994  27.478  4.825   1.00 0.00 ? 9   ILE A CB   2  
ATOM 1781  C CG1  . ILE A 1 9   ? -4.878  25.995  5.183   1.00 0.00 ? 9   ILE A CG1  2  
ATOM 1782  C CG2  . ILE A 1 9   ? -5.451  28.285  6.031   1.00 0.00 ? 9   ILE A CG2  2  
ATOM 1783  C CD1  . ILE A 1 9   ? -3.622  25.656  5.955   1.00 0.00 ? 9   ILE A CD1  2  
ATOM 1784  H H    . ILE A 1 9   ? -7.402  26.490  4.670   1.00 0.00 ? 9   ILE A H    2  
ATOM 1785  H HA   . ILE A 1 9   ? -6.049  28.727  3.442   1.00 0.00 ? 9   ILE A HA   2  
ATOM 1786  H HB   . ILE A 1 9   ? -4.026  27.845  4.522   1.00 0.00 ? 9   ILE A HB   2  
ATOM 1787  H HG12 . ILE A 1 9   ? -5.724  25.708  5.786   1.00 0.00 ? 9   ILE A HG12 2  
ATOM 1788  H HG13 . ILE A 1 9   ? -4.876  25.412  4.273   1.00 0.00 ? 9   ILE A HG13 2  
ATOM 1789  H HG21 . ILE A 1 9   ? -6.167  29.029  5.716   1.00 0.00 ? 9   ILE A HG21 2  
ATOM 1790  H HG22 . ILE A 1 9   ? -5.912  27.625  6.751   1.00 0.00 ? 9   ILE A HG22 2  
ATOM 1791  H HG23 . ILE A 1 9   ? -4.600  28.772  6.482   1.00 0.00 ? 9   ILE A HG23 2  
ATOM 1792  H HD11 . ILE A 1 9   ? -3.767  25.888  6.999   1.00 0.00 ? 9   ILE A HD11 2  
ATOM 1793  H HD12 . ILE A 1 9   ? -3.403  24.605  5.845   1.00 0.00 ? 9   ILE A HD12 2  
ATOM 1794  H HD13 . ILE A 1 9   ? -2.795  26.237  5.570   1.00 0.00 ? 9   ILE A HD13 2  
ATOM 1795  N N    . GLN A 1 10  ? -4.195  27.331  2.036   1.00 0.00 ? 10  GLN A N    2  
ATOM 1796  C CA   . GLN A 1 10  ? -3.548  26.732  0.874   1.00 0.00 ? 10  GLN A CA   2  
ATOM 1797  C C    . GLN A 1 10  ? -3.220  25.265  1.130   1.00 0.00 ? 10  GLN A C    2  
ATOM 1798  O O    . GLN A 1 10  ? -2.176  24.941  1.698   1.00 0.00 ? 10  GLN A O    2  
ATOM 1799  C CB   . GLN A 1 10  ? -2.271  27.498  0.523   1.00 0.00 ? 10  GLN A CB   2  
ATOM 1800  C CG   . GLN A 1 10  ? -2.509  28.691  -0.389  1.00 0.00 ? 10  GLN A CG   2  
ATOM 1801  C CD   . GLN A 1 10  ? -1.360  29.679  -0.369  1.00 0.00 ? 10  GLN A CD   2  
ATOM 1802  O OE1  . GLN A 1 10  ? -0.308  29.438  -0.963  1.00 0.00 ? 10  GLN A OE1  2  
ATOM 1803  N NE2  . GLN A 1 10  ? -1.555  30.800  0.315   1.00 0.00 ? 10  GLN A NE2  2  
ATOM 1804  H H    . GLN A 1 10  ? -3.720  28.020  2.545   1.00 0.00 ? 10  GLN A H    2  
ATOM 1805  H HA   . GLN A 1 10  ? -4.234  26.795  0.043   1.00 0.00 ? 10  GLN A HA   2  
ATOM 1806  H HB2  . GLN A 1 10  ? -1.818  27.855  1.436   1.00 0.00 ? 10  GLN A HB2  2  
ATOM 1807  H HB3  . GLN A 1 10  ? -1.586  26.826  0.029   1.00 0.00 ? 10  GLN A HB3  2  
ATOM 1808  H HG2  . GLN A 1 10  ? -2.638  28.334  -1.400  1.00 0.00 ? 10  GLN A HG2  2  
ATOM 1809  H HG3  . GLN A 1 10  ? -3.407  29.198  -0.070  1.00 0.00 ? 10  GLN A HG3  2  
ATOM 1810  H HE21 . GLN A 1 10  ? -2.418  30.923  0.764   1.00 0.00 ? 10  GLN A HE21 2  
ATOM 1811  H HE22 . GLN A 1 10  ? -0.829  31.456  0.346   1.00 0.00 ? 10  GLN A HE22 2  
ATOM 1812  N N    . VAL A 1 11  ? -4.118  24.380  0.709   1.00 0.00 ? 11  VAL A N    2  
ATOM 1813  C CA   . VAL A 1 11  ? -3.924  22.947  0.892   1.00 0.00 ? 11  VAL A CA   2  
ATOM 1814  C C    . VAL A 1 11  ? -4.558  22.157  -0.248  1.00 0.00 ? 11  VAL A C    2  
ATOM 1815  O O    . VAL A 1 11  ? -5.550  22.586  -0.838  1.00 0.00 ? 11  VAL A O    2  
ATOM 1816  C CB   . VAL A 1 11  ? -4.519  22.466  2.228   1.00 0.00 ? 11  VAL A CB   2  
ATOM 1817  C CG1  . VAL A 1 11  ? -6.038  22.527  2.190   1.00 0.00 ? 11  VAL A CG1  2  
ATOM 1818  C CG2  . VAL A 1 11  ? -4.041  21.057  2.547   1.00 0.00 ? 11  VAL A CG2  2  
ATOM 1819  H H    . VAL A 1 11  ? -4.930  24.699  0.263   1.00 0.00 ? 11  VAL A H    2  
ATOM 1820  H HA   . VAL A 1 11  ? -2.861  22.753  0.904   1.00 0.00 ? 11  VAL A HA   2  
ATOM 1821  H HB   . VAL A 1 11  ? -4.174  23.126  3.011   1.00 0.00 ? 11  VAL A HB   2  
ATOM 1822  H HG11 . VAL A 1 11  ? -6.360  23.551  2.313   1.00 0.00 ? 11  VAL A HG11 2  
ATOM 1823  H HG12 . VAL A 1 11  ? -6.390  22.150  1.241   1.00 0.00 ? 11  VAL A HG12 2  
ATOM 1824  H HG13 . VAL A 1 11  ? -6.443  21.925  2.990   1.00 0.00 ? 11  VAL A HG13 2  
ATOM 1825  H HG21 . VAL A 1 11  ? -3.853  20.973  3.607   1.00 0.00 ? 11  VAL A HG21 2  
ATOM 1826  H HG22 . VAL A 1 11  ? -4.802  20.345  2.260   1.00 0.00 ? 11  VAL A HG22 2  
ATOM 1827  H HG23 . VAL A 1 11  ? -3.132  20.853  2.002   1.00 0.00 ? 11  VAL A HG23 2  
ATOM 1828  N N    . ILE A 1 12  ? -3.979  21.000  -0.552  1.00 0.00 ? 12  ILE A N    2  
ATOM 1829  C CA   . ILE A 1 12  ? -4.489  20.149  -1.619  1.00 0.00 ? 12  ILE A CA   2  
ATOM 1830  C C    . ILE A 1 12  ? -4.658  18.710  -1.142  1.00 0.00 ? 12  ILE A C    2  
ATOM 1831  O O    . ILE A 1 12  ? -4.114  18.318  -0.109  1.00 0.00 ? 12  ILE A O    2  
ATOM 1832  C CB   . ILE A 1 12  ? -3.557  20.165  -2.846  1.00 0.00 ? 12  ILE A CB   2  
ATOM 1833  C CG1  . ILE A 1 12  ? -2.158  19.685  -2.456  1.00 0.00 ? 12  ILE A CG1  2  
ATOM 1834  C CG2  . ILE A 1 12  ? -3.496  21.561  -3.446  1.00 0.00 ? 12  ILE A CG2  2  
ATOM 1835  C CD1  . ILE A 1 12  ? -1.284  19.342  -3.643  1.00 0.00 ? 12  ILE A CD1  2  
ATOM 1836  H H    . ILE A 1 12  ? -3.192  20.712  -0.045  1.00 0.00 ? 12  ILE A H    2  
ATOM 1837  H HA   . ILE A 1 12  ? -5.453  20.533  -1.920  1.00 0.00 ? 12  ILE A HA   2  
ATOM 1838  H HB   . ILE A 1 12  ? -3.965  19.497  -3.589  1.00 0.00 ? 12  ILE A HB   2  
ATOM 1839  H HG12 . ILE A 1 12  ? -1.662  20.460  -1.893  1.00 0.00 ? 12  ILE A HG12 2  
ATOM 1840  H HG13 . ILE A 1 12  ? -2.247  18.800  -1.842  1.00 0.00 ? 12  ILE A HG13 2  
ATOM 1841  H HG21 . ILE A 1 12  ? -2.780  21.575  -4.255  1.00 0.00 ? 12  ILE A HG21 2  
ATOM 1842  H HG22 . ILE A 1 12  ? -4.470  21.833  -3.825  1.00 0.00 ? 12  ILE A HG22 2  
ATOM 1843  H HG23 . ILE A 1 12  ? -3.195  22.267  -2.687  1.00 0.00 ? 12  ILE A HG23 2  
ATOM 1844  H HD11 . ILE A 1 12  ? -1.475  20.041  -4.444  1.00 0.00 ? 12  ILE A HD11 2  
ATOM 1845  H HD12 . ILE A 1 12  ? -0.246  19.398  -3.355  1.00 0.00 ? 12  ILE A HD12 2  
ATOM 1846  H HD13 . ILE A 1 12  ? -1.511  18.341  -3.979  1.00 0.00 ? 12  ILE A HD13 2  
ATOM 1847  N N    . THR A 1 13  ? -5.414  17.925  -1.903  1.00 0.00 ? 13  THR A N    2  
ATOM 1848  C CA   . THR A 1 13  ? -5.655  16.529  -1.559  1.00 0.00 ? 13  THR A CA   2  
ATOM 1849  C C    . THR A 1 13  ? -4.354  15.735  -1.541  1.00 0.00 ? 13  THR A C    2  
ATOM 1850  O O    . THR A 1 13  ? -3.660  15.641  -2.553  1.00 0.00 ? 13  THR A O    2  
ATOM 1851  C CB   . THR A 1 13  ? -6.633  15.867  -2.549  1.00 0.00 ? 13  THR A CB   2  
ATOM 1852  O OG1  . THR A 1 13  ? -6.107  15.938  -3.879  1.00 0.00 ? 13  THR A OG1  2  
ATOM 1853  C CG2  . THR A 1 13  ? -7.994  16.545  -2.500  1.00 0.00 ? 13  THR A CG2  2  
ATOM 1854  H H    . THR A 1 13  ? -5.820  18.295  -2.715  1.00 0.00 ? 13  THR A H    2  
ATOM 1855  H HA   . THR A 1 13  ? -6.097  16.500  -0.574  1.00 0.00 ? 13  THR A HA   2  
ATOM 1856  H HB   . THR A 1 13  ? -6.754  14.830  -2.272  1.00 0.00 ? 13  THR A HB   2  
ATOM 1857  H HG1  . THR A 1 13  ? -5.177  15.696  -3.869  1.00 0.00 ? 13  THR A HG1  2  
ATOM 1858  H HG21 . THR A 1 13  ? -8.454  16.500  -3.475  1.00 0.00 ? 13  THR A HG21 2  
ATOM 1859  H HG22 . THR A 1 13  ? -7.871  17.578  -2.207  1.00 0.00 ? 13  THR A HG22 2  
ATOM 1860  H HG23 . THR A 1 13  ? -8.622  16.040  -1.782  1.00 0.00 ? 13  THR A HG23 2  
ATOM 1861  N N    . GLN A 1 14  ? -4.030  15.166  -0.385  1.00 0.00 ? 14  GLN A N    2  
ATOM 1862  C CA   . GLN A 1 14  ? -2.811  14.380  -0.236  1.00 0.00 ? 14  GLN A CA   2  
ATOM 1863  C C    . GLN A 1 14  ? -3.134  12.946  0.172   1.00 0.00 ? 14  GLN A C    2  
ATOM 1864  O O    . GLN A 1 14  ? -3.979  12.711  1.037   1.00 0.00 ? 14  GLN A O    2  
ATOM 1865  C CB   . GLN A 1 14  ? -1.887  15.022  0.801   1.00 0.00 ? 14  GLN A CB   2  
ATOM 1866  C CG   . GLN A 1 14  ? -0.460  14.503  0.748   1.00 0.00 ? 14  GLN A CG   2  
ATOM 1867  C CD   . GLN A 1 14  ? 0.288   14.721  2.049   1.00 0.00 ? 14  GLN A CD   2  
ATOM 1868  O OE1  . GLN A 1 14  ? -0.263  14.536  3.134   1.00 0.00 ? 14  GLN A OE1  2  
ATOM 1869  N NE2  . GLN A 1 14  ? 1.552   15.116  1.947   1.00 0.00 ? 14  GLN A NE2  2  
ATOM 1870  H H    . GLN A 1 14  ? -4.624  15.277  0.386   1.00 0.00 ? 14  GLN A H    2  
ATOM 1871  H HA   . GLN A 1 14  ? -2.308  14.364  -1.191  1.00 0.00 ? 14  GLN A HA   2  
ATOM 1872  H HB2  . GLN A 1 14  ? -1.867  16.089  0.634   1.00 0.00 ? 14  GLN A HB2  2  
ATOM 1873  H HB3  . GLN A 1 14  ? -2.282  14.827  1.787   1.00 0.00 ? 14  GLN A HB3  2  
ATOM 1874  H HG2  . GLN A 1 14  ? -0.482  13.444  0.537   1.00 0.00 ? 14  GLN A HG2  2  
ATOM 1875  H HG3  . GLN A 1 14  ? 0.067   15.016  -0.043  1.00 0.00 ? 14  GLN A HG3  2  
ATOM 1876  H HE21 . GLN A 1 14  ? 1.925   15.244  1.049   1.00 0.00 ? 14  GLN A HE21 2  
ATOM 1877  H HE22 . GLN A 1 14  ? 2.059   15.264  2.771   1.00 0.00 ? 14  GLN A HE22 2  
ATOM 1878  N N    . THR A 1 15  ? -2.456  11.990  -0.455  1.00 0.00 ? 15  THR A N    2  
ATOM 1879  C CA   . THR A 1 15  ? -2.672  10.580  -0.158  1.00 0.00 ? 15  THR A CA   2  
ATOM 1880  C C    . THR A 1 15  ? -1.380  9.910   0.298   1.00 0.00 ? 15  THR A C    2  
ATOM 1881  O O    . THR A 1 15  ? -0.438  9.763   -0.479  1.00 0.00 ? 15  THR A O    2  
ATOM 1882  C CB   . THR A 1 15  ? -3.223  9.826   -1.383  1.00 0.00 ? 15  THR A CB   2  
ATOM 1883  O OG1  . THR A 1 15  ? -4.423  10.454  -1.846  1.00 0.00 ? 15  THR A OG1  2  
ATOM 1884  C CG2  . THR A 1 15  ? -3.504  8.370   -1.041  1.00 0.00 ? 15  THR A CG2  2  
ATOM 1885  H H    . THR A 1 15  ? -1.796  12.241  -1.134  1.00 0.00 ? 15  THR A H    2  
ATOM 1886  H HA   . THR A 1 15  ? -3.400  10.514  0.637   1.00 0.00 ? 15  THR A HA   2  
ATOM 1887  H HB   . THR A 1 15  ? -2.482  9.858   -2.170  1.00 0.00 ? 15  THR A HB   2  
ATOM 1888  H HG1  . THR A 1 15  ? -4.926  9.831   -2.377  1.00 0.00 ? 15  THR A HG1  2  
ATOM 1889  H HG21 . THR A 1 15  ? -3.257  7.747   -1.888  1.00 0.00 ? 15  THR A HG21 2  
ATOM 1890  H HG22 . THR A 1 15  ? -4.551  8.253   -0.801  1.00 0.00 ? 15  THR A HG22 2  
ATOM 1891  H HG23 . THR A 1 15  ? -2.905  8.078   -0.192  1.00 0.00 ? 15  THR A HG23 2  
ATOM 1892  N N    . GLY A 1 16  ? -1.344  9.504   1.564   1.00 0.00 ? 16  GLY A N    2  
ATOM 1893  C CA   . GLY A 1 16  ? -0.163  8.854   2.101   1.00 0.00 ? 16  GLY A CA   2  
ATOM 1894  C C    . GLY A 1 16  ? -0.174  7.355   1.876   1.00 0.00 ? 16  GLY A C    2  
ATOM 1895  O O    . GLY A 1 16  ? -0.907  6.853   1.024   1.00 0.00 ? 16  GLY A O    2  
ATOM 1896  H H    . GLY A 1 16  ? -2.126  9.648   2.137   1.00 0.00 ? 16  GLY A H    2  
ATOM 1897  H HA2  . GLY A 1 16  ? 0.712   9.273   1.627   1.00 0.00 ? 16  GLY A HA2  2  
ATOM 1898  H HA3  . GLY A 1 16  ? -0.112  9.046   3.163   1.00 0.00 ? 16  GLY A HA3  2  
ATOM 1899  N N    . VAL A 1 17  ? 0.644   6.638   2.639   1.00 0.00 ? 17  VAL A N    2  
ATOM 1900  C CA   . VAL A 1 17  ? 0.727   5.187   2.519   1.00 0.00 ? 17  VAL A CA   2  
ATOM 1901  C C    . VAL A 1 17  ? -0.656  4.571   2.341   1.00 0.00 ? 17  VAL A C    2  
ATOM 1902  O O    . VAL A 1 17  ? -1.647  5.035   2.904   1.00 0.00 ? 17  VAL A O    2  
ATOM 1903  C CB   . VAL A 1 17  ? 1.402   4.559   3.752   1.00 0.00 ? 17  VAL A CB   2  
ATOM 1904  C CG1  . VAL A 1 17  ? 2.713   5.266   4.062   1.00 0.00 ? 17  VAL A CG1  2  
ATOM 1905  C CG2  . VAL A 1 17  ? 0.467   4.603   4.951   1.00 0.00 ? 17  VAL A CG2  2  
ATOM 1906  H H    . VAL A 1 17  ? 1.205   7.095   3.300   1.00 0.00 ? 17  VAL A H    2  
ATOM 1907  H HA   . VAL A 1 17  ? 1.328   4.958   1.650   1.00 0.00 ? 17  VAL A HA   2  
ATOM 1908  H HB   . VAL A 1 17  ? 1.621   3.525   3.530   1.00 0.00 ? 17  VAL A HB   2  
ATOM 1909  H HG11 . VAL A 1 17  ? 3.239   5.468   3.141   1.00 0.00 ? 17  VAL A HG11 2  
ATOM 1910  H HG12 . VAL A 1 17  ? 2.508   6.196   4.573   1.00 0.00 ? 17  VAL A HG12 2  
ATOM 1911  H HG13 . VAL A 1 17  ? 3.322   4.635   4.693   1.00 0.00 ? 17  VAL A HG13 2  
ATOM 1912  H HG21 . VAL A 1 17  ? 0.997   4.995   5.806   1.00 0.00 ? 17  VAL A HG21 2  
ATOM 1913  H HG22 . VAL A 1 17  ? -0.377  5.240   4.727   1.00 0.00 ? 17  VAL A HG22 2  
ATOM 1914  H HG23 . VAL A 1 17  ? 0.116   3.605   5.171   1.00 0.00 ? 17  VAL A HG23 2  
ATOM 1915  N N    . PRO A 1 18  ? -0.726  3.498   1.538   1.00 0.00 ? 18  PRO A N    2  
ATOM 1916  C CA   . PRO A 1 18  ? -1.983  2.794   1.267   1.00 0.00 ? 18  PRO A CA   2  
ATOM 1917  C C    . PRO A 1 18  ? -2.497  2.037   2.487   1.00 0.00 ? 18  PRO A C    2  
ATOM 1918  O O    . PRO A 1 18  ? -1.741  1.744   3.413   1.00 0.00 ? 18  PRO A O    2  
ATOM 1919  C CB   . PRO A 1 18  ? -1.608  1.817   0.150   1.00 0.00 ? 18  PRO A CB   2  
ATOM 1920  C CG   . PRO A 1 18  ? -0.145  1.594   0.317   1.00 0.00 ? 18  PRO A CG   2  
ATOM 1921  C CD   . PRO A 1 18  ? 0.415   2.891   0.833   1.00 0.00 ? 18  PRO A CD   2  
ATOM 1922  H HA   . PRO A 1 18  ? -2.749  3.469   0.915   1.00 0.00 ? 18  PRO A HA   2  
ATOM 1923  H HB2  . PRO A 1 18  ? -2.165  0.898   0.271   1.00 0.00 ? 18  PRO A HB2  2  
ATOM 1924  H HB3  . PRO A 1 18  ? -1.834  2.257   -0.809  1.00 0.00 ? 18  PRO A HB3  2  
ATOM 1925  H HG2  . PRO A 1 18  ? 0.028   0.802   1.028   1.00 0.00 ? 18  PRO A HG2  2  
ATOM 1926  H HG3  . PRO A 1 18  ? 0.299   1.348   -0.637  1.00 0.00 ? 18  PRO A HG3  2  
ATOM 1927  H HD2  . PRO A 1 18  ? 1.233   2.705   1.513   1.00 0.00 ? 18  PRO A HD2  2  
ATOM 1928  H HD3  . PRO A 1 18  ? 0.738   3.516   0.013   1.00 0.00 ? 18  PRO A HD3  2  
ATOM 1929  N N    . GLY A 1 19  ? -3.789  1.722   2.481   1.00 0.00 ? 19  GLY A N    2  
ATOM 1930  C CA   . GLY A 1 19  ? -4.382  1.001   3.593   1.00 0.00 ? 19  GLY A CA   2  
ATOM 1931  C C    . GLY A 1 19  ? -4.485  -0.488  3.329   1.00 0.00 ? 19  GLY A C    2  
ATOM 1932  O O    . GLY A 1 19  ? -4.922  -0.906  2.257   1.00 0.00 ? 19  GLY A O    2  
ATOM 1933  H H    . GLY A 1 19  ? -4.344  1.981   1.716   1.00 0.00 ? 19  GLY A H    2  
ATOM 1934  H HA2  . GLY A 1 19  ? -3.778  1.159   4.473   1.00 0.00 ? 19  GLY A HA2  2  
ATOM 1935  H HA3  . GLY A 1 19  ? -5.373  1.392   3.773   1.00 0.00 ? 19  GLY A HA3  2  
ATOM 1936  N N    . GLN A 1 20  ? -4.079  -1.290  4.308   1.00 0.00 ? 20  GLN A N    2  
ATOM 1937  C CA   . GLN A 1 20  ? -4.126  -2.742  4.175   1.00 0.00 ? 20  GLN A CA   2  
ATOM 1938  C C    . GLN A 1 20  ? -5.391  -3.181  3.446   1.00 0.00 ? 20  GLN A C    2  
ATOM 1939  O O    . GLN A 1 20  ? -6.455  -2.576  3.579   1.00 0.00 ? 20  GLN A O    2  
ATOM 1940  C CB   . GLN A 1 20  ? -4.061  -3.404  5.553   1.00 0.00 ? 20  GLN A CB   2  
ATOM 1941  C CG   . GLN A 1 20  ? -5.352  -3.284  6.347   1.00 0.00 ? 20  GLN A CG   2  
ATOM 1942  C CD   . GLN A 1 20  ? -5.215  -3.803  7.765   1.00 0.00 ? 20  GLN A CD   2  
ATOM 1943  O OE1  . GLN A 1 20  ? -4.644  -3.137  8.629   1.00 0.00 ? 20  GLN A OE1  2  
ATOM 1944  N NE2  . GLN A 1 20  ? -5.739  -4.998  8.011   1.00 0.00 ? 20  GLN A NE2  2  
ATOM 1945  H H    . GLN A 1 20  ? -3.741  -0.897  5.139   1.00 0.00 ? 20  GLN A H    2  
ATOM 1946  H HA   . GLN A 1 20  ? -3.267  -3.049  3.597   1.00 0.00 ? 20  GLN A HA   2  
ATOM 1947  H HB2  . GLN A 1 20  ? -3.837  -4.452  5.425   1.00 0.00 ? 20  GLN A HB2  2  
ATOM 1948  H HB3  . GLN A 1 20  ? -3.269  -2.942  6.124   1.00 0.00 ? 20  GLN A HB3  2  
ATOM 1949  H HG2  . GLN A 1 20  ? -5.640  -2.244  6.387   1.00 0.00 ? 20  GLN A HG2  2  
ATOM 1950  H HG3  . GLN A 1 20  ? -6.121  -3.851  5.844   1.00 0.00 ? 20  GLN A HG3  2  
ATOM 1951  H HE21 . GLN A 1 20  ? -6.177  -5.472  7.273   1.00 0.00 ? 20  GLN A HE21 2  
ATOM 1952  H HE22 . GLN A 1 20  ? -5.664  -5.357  8.919   1.00 0.00 ? 20  GLN A HE22 2  
ATOM 1953  N N    . PRO A 1 21  ? -5.276  -4.259  2.656   1.00 0.00 ? 21  PRO A N    2  
ATOM 1954  C CA   . PRO A 1 21  ? -6.401  -4.804  1.891   1.00 0.00 ? 21  PRO A CA   2  
ATOM 1955  C C    . PRO A 1 21  ? -7.452  -5.451  2.786   1.00 0.00 ? 21  PRO A C    2  
ATOM 1956  O O    . PRO A 1 21  ? -7.183  -5.772  3.944   1.00 0.00 ? 21  PRO A O    2  
ATOM 1957  C CB   . PRO A 1 21  ? -5.743  -5.854  0.993   1.00 0.00 ? 21  PRO A CB   2  
ATOM 1958  C CG   . PRO A 1 21  ? -4.509  -6.258  1.723   1.00 0.00 ? 21  PRO A CG   2  
ATOM 1959  C CD   . PRO A 1 21  ? -4.038  -5.030  2.451   1.00 0.00 ? 21  PRO A CD   2  
ATOM 1960  H HA   . PRO A 1 21  ? -6.868  -4.046  1.278   1.00 0.00 ? 21  PRO A HA   2  
ATOM 1961  H HB2  . PRO A 1 21  ? -6.416  -6.690  0.860   1.00 0.00 ? 21  PRO A HB2  2  
ATOM 1962  H HB3  . PRO A 1 21  ? -5.509  -5.418  0.033   1.00 0.00 ? 21  PRO A HB3  2  
ATOM 1963  H HG2  . PRO A 1 21  ? -4.739  -7.045  2.425   1.00 0.00 ? 21  PRO A HG2  2  
ATOM 1964  H HG3  . PRO A 1 21  ? -3.759  -6.588  1.020   1.00 0.00 ? 21  PRO A HG3  2  
ATOM 1965  H HD2  . PRO A 1 21  ? -3.590  -5.299  3.396   1.00 0.00 ? 21  PRO A HD2  2  
ATOM 1966  H HD3  . PRO A 1 21  ? -3.337  -4.477  1.843   1.00 0.00 ? 21  PRO A HD3  2  
ATOM 1967  N N    . LEU A 1 22  ? -8.650  -5.639  2.243   1.00 0.00 ? 22  LEU A N    2  
ATOM 1968  C CA   . LEU A 1 22  ? -9.743  -6.249  2.992   1.00 0.00 ? 22  LEU A CA   2  
ATOM 1969  C C    . LEU A 1 22  ? -10.084 -7.626  2.433   1.00 0.00 ? 22  LEU A C    2  
ATOM 1970  O O    . LEU A 1 22  ? -9.670  -7.980  1.330   1.00 0.00 ? 22  LEU A O    2  
ATOM 1971  C CB   . LEU A 1 22  ? -10.979 -5.349  2.953   1.00 0.00 ? 22  LEU A CB   2  
ATOM 1972  C CG   . LEU A 1 22  ? -10.799 -3.937  3.510   1.00 0.00 ? 22  LEU A CG   2  
ATOM 1973  C CD1  . LEU A 1 22  ? -11.855 -3.000  2.943   1.00 0.00 ? 22  LEU A CD1  2  
ATOM 1974  C CD2  . LEU A 1 22  ? -10.859 -3.952  5.031   1.00 0.00 ? 22  LEU A CD2  2  
ATOM 1975  H H    . LEU A 1 22  ? -8.804  -5.362  1.316   1.00 0.00 ? 22  LEU A H    2  
ATOM 1976  H HA   . LEU A 1 22  ? -9.420  -6.359  4.017   1.00 0.00 ? 22  LEU A HA   2  
ATOM 1977  H HB2  . LEU A 1 22  ? -11.291 -5.261  1.923   1.00 0.00 ? 22  LEU A HB2  2  
ATOM 1978  H HB3  . LEU A 1 22  ? -11.758 -5.834  3.523   1.00 0.00 ? 22  LEU A HB3  2  
ATOM 1979  H HG   . LEU A 1 22  ? -9.828  -3.561  3.217   1.00 0.00 ? 22  LEU A HG   2  
ATOM 1980  H HD11 . LEU A 1 22  ? -11.377 -2.243  2.340   1.00 0.00 ? 22  LEU A HD11 2  
ATOM 1981  H HD12 . LEU A 1 22  ? -12.392 -2.530  3.754   1.00 0.00 ? 22  LEU A HD12 2  
ATOM 1982  H HD13 . LEU A 1 22  ? -12.546 -3.564  2.333   1.00 0.00 ? 22  LEU A HD13 2  
ATOM 1983  H HD21 . LEU A 1 22  ? -10.035 -4.534  5.417   1.00 0.00 ? 22  LEU A HD21 2  
ATOM 1984  H HD22 . LEU A 1 22  ? -11.792 -4.394  5.350   1.00 0.00 ? 22  LEU A HD22 2  
ATOM 1985  H HD23 . LEU A 1 22  ? -10.792 -2.941  5.404   1.00 0.00 ? 22  LEU A HD23 2  
ATOM 1986  N N    . ASN A 1 23  ? -10.845 -8.399  3.202   1.00 0.00 ? 23  ASN A N    2  
ATOM 1987  C CA   . ASN A 1 23  ? -11.244 -9.738  2.783   1.00 0.00 ? 23  ASN A CA   2  
ATOM 1988  C C    . ASN A 1 23  ? -10.022 -10.621 2.546   1.00 0.00 ? 23  ASN A C    2  
ATOM 1989  O O    . ASN A 1 23  ? -9.990  -11.416 1.607   1.00 0.00 ? 23  ASN A O    2  
ATOM 1990  C CB   . ASN A 1 23  ? -12.089 -9.665  1.510   1.00 0.00 ? 23  ASN A CB   2  
ATOM 1991  C CG   . ASN A 1 23  ? -13.462 -9.071  1.760   1.00 0.00 ? 23  ASN A CG   2  
ATOM 1992  O OD1  . ASN A 1 23  ? -14.423 -9.792  2.028   1.00 0.00 ? 23  ASN A OD1  2  
ATOM 1993  N ND2  . ASN A 1 23  ? -13.559 -7.750  1.672   1.00 0.00 ? 23  ASN A ND2  2  
ATOM 1994  H H    . ASN A 1 23  ? -11.144 -8.062  4.072   1.00 0.00 ? 23  ASN A H    2  
ATOM 1995  H HA   . ASN A 1 23  ? -11.838 -10.170 3.574   1.00 0.00 ? 23  ASN A HA   2  
ATOM 1996  H HB2  . ASN A 1 23  ? -11.580 -9.051  0.781   1.00 0.00 ? 23  ASN A HB2  2  
ATOM 1997  H HB3  . ASN A 1 23  ? -12.215 -10.661 1.110   1.00 0.00 ? 23  ASN A HB3  2  
ATOM 1998  H HD21 . ASN A 1 23  ? -12.751 -7.239  1.454   1.00 0.00 ? 23  ASN A HD21 2  
ATOM 1999  H HD22 . ASN A 1 23  ? -14.435 -7.339  1.830   1.00 0.00 ? 23  ASN A HD22 2  
ATOM 2000  N N    . PHE A 1 24  ? -9.019  -10.475 3.405   1.00 0.00 ? 24  PHE A N    2  
ATOM 2001  C CA   . PHE A 1 24  ? -7.794  -11.259 3.290   1.00 0.00 ? 24  PHE A CA   2  
ATOM 2002  C C    . PHE A 1 24  ? -8.009  -12.681 3.800   1.00 0.00 ? 24  PHE A C    2  
ATOM 2003  O O    . PHE A 1 24  ? -8.202  -12.902 4.996   1.00 0.00 ? 24  PHE A O    2  
ATOM 2004  C CB   . PHE A 1 24  ? -6.661  -10.591 4.071   1.00 0.00 ? 24  PHE A CB   2  
ATOM 2005  C CG   . PHE A 1 24  ? -5.314  -11.203 3.813   1.00 0.00 ? 24  PHE A CG   2  
ATOM 2006  C CD1  . PHE A 1 24  ? -4.924  -11.536 2.526   1.00 0.00 ? 24  PHE A CD1  2  
ATOM 2007  C CD2  . PHE A 1 24  ? -4.436  -11.444 4.858   1.00 0.00 ? 24  PHE A CD2  2  
ATOM 2008  C CE1  . PHE A 1 24  ? -3.685  -12.100 2.286   1.00 0.00 ? 24  PHE A CE1  2  
ATOM 2009  C CE2  . PHE A 1 24  ? -3.196  -12.007 4.625   1.00 0.00 ? 24  PHE A CE2  2  
ATOM 2010  C CZ   . PHE A 1 24  ? -2.820  -12.335 3.337   1.00 0.00 ? 24  PHE A CZ   2  
ATOM 2011  H H    . PHE A 1 24  ? -9.104  -9.825  4.134   1.00 0.00 ? 24  PHE A H    2  
ATOM 2012  H HA   . PHE A 1 24  ? -7.525  -11.301 2.246   1.00 0.00 ? 24  PHE A HA   2  
ATOM 2013  H HB2  . PHE A 1 24  ? -6.609  -9.548  3.795   1.00 0.00 ? 24  PHE A HB2  2  
ATOM 2014  H HB3  . PHE A 1 24  ? -6.866  -10.670 5.128   1.00 0.00 ? 24  PHE A HB3  2  
ATOM 2015  H HD1  . PHE A 1 24  ? -5.599  -11.352 1.703   1.00 0.00 ? 24  PHE A HD1  2  
ATOM 2016  H HD2  . PHE A 1 24  ? -4.730  -11.188 5.867   1.00 0.00 ? 24  PHE A HD2  2  
ATOM 2017  H HE1  . PHE A 1 24  ? -3.393  -12.355 1.278   1.00 0.00 ? 24  PHE A HE1  2  
ATOM 2018  H HE2  . PHE A 1 24  ? -2.522  -12.189 5.448   1.00 0.00 ? 24  PHE A HE2  2  
ATOM 2019  H HZ   . PHE A 1 24  ? -1.851  -12.776 3.152   1.00 0.00 ? 24  PHE A HZ   2  
ATOM 2020  N N    . LYS A 1 25  ? -7.974  -13.643 2.884   1.00 0.00 ? 25  LYS A N    2  
ATOM 2021  C CA   . LYS A 1 25  ? -8.164  -15.045 3.239   1.00 0.00 ? 25  LYS A CA   2  
ATOM 2022  C C    . LYS A 1 25  ? -7.190  -15.936 2.474   1.00 0.00 ? 25  LYS A C    2  
ATOM 2023  O O    . LYS A 1 25  ? -6.822  -15.638 1.338   1.00 0.00 ? 25  LYS A O    2  
ATOM 2024  C CB   . LYS A 1 25  ? -9.603  -15.476 2.946   1.00 0.00 ? 25  LYS A CB   2  
ATOM 2025  C CG   . LYS A 1 25  ? -9.820  -15.942 1.517   1.00 0.00 ? 25  LYS A CG   2  
ATOM 2026  C CD   . LYS A 1 25  ? -11.258 -15.733 1.075   1.00 0.00 ? 25  LYS A CD   2  
ATOM 2027  C CE   . LYS A 1 25  ? -12.145 -16.895 1.496   1.00 0.00 ? 25  LYS A CE   2  
ATOM 2028  N NZ   . LYS A 1 25  ? -12.573 -16.779 2.918   1.00 0.00 ? 25  LYS A NZ   2  
ATOM 2029  H H    . LYS A 1 25  ? -7.817  -13.404 1.946   1.00 0.00 ? 25  LYS A H    2  
ATOM 2030  H HA   . LYS A 1 25  ? -7.974  -15.148 4.296   1.00 0.00 ? 25  LYS A HA   2  
ATOM 2031  H HB2  . LYS A 1 25  ? -9.865  -16.286 3.611   1.00 0.00 ? 25  LYS A HB2  2  
ATOM 2032  H HB3  . LYS A 1 25  ? -10.261 -14.640 3.134   1.00 0.00 ? 25  LYS A HB3  2  
ATOM 2033  H HG2  . LYS A 1 25  ? -9.169  -15.381 0.862   1.00 0.00 ? 25  LYS A HG2  2  
ATOM 2034  H HG3  . LYS A 1 25  ? -9.581  -16.994 1.451   1.00 0.00 ? 25  LYS A HG3  2  
ATOM 2035  H HD2  . LYS A 1 25  ? -11.636 -14.826 1.523   1.00 0.00 ? 25  LYS A HD2  2  
ATOM 2036  H HD3  . LYS A 1 25  ? -11.285 -15.643 -0.002  1.00 0.00 ? 25  LYS A HD3  2  
ATOM 2037  H HE2  . LYS A 1 25  ? -13.020 -16.910 0.865   1.00 0.00 ? 25  LYS A HE2  2  
ATOM 2038  H HE3  . LYS A 1 25  ? -11.594 -17.816 1.370   1.00 0.00 ? 25  LYS A HE3  2  
ATOM 2039  H HZ1  . LYS A 1 25  ? -12.575 -17.716 3.368   1.00 0.00 ? 25  LYS A HZ1  2  
ATOM 2040  H HZ2  . LYS A 1 25  ? -13.532 -16.380 2.970   1.00 0.00 ? 25  LYS A HZ2  2  
ATOM 2041  H HZ3  . LYS A 1 25  ? -11.922 -16.157 3.438   1.00 0.00 ? 25  LYS A HZ3  2  
ATOM 2042  N N    . ALA A 1 26  ? -6.777  -17.030 3.105   1.00 0.00 ? 26  ALA A N    2  
ATOM 2043  C CA   . ALA A 1 26  ? -5.848  -17.966 2.483   1.00 0.00 ? 26  ALA A CA   2  
ATOM 2044  C C    . ALA A 1 26  ? -6.434  -19.373 2.439   1.00 0.00 ? 26  ALA A C    2  
ATOM 2045  O O    . ALA A 1 26  ? -6.961  -19.866 3.436   1.00 0.00 ? 26  ALA A O    2  
ATOM 2046  C CB   . ALA A 1 26  ? -4.521  -17.967 3.227   1.00 0.00 ? 26  ALA A CB   2  
ATOM 2047  H H    . ALA A 1 26  ? -7.105  -17.213 4.009   1.00 0.00 ? 26  ALA A H    2  
ATOM 2048  H HA   . ALA A 1 26  ? -5.665  -17.632 1.471   1.00 0.00 ? 26  ALA A HA   2  
ATOM 2049  H HB1  . ALA A 1 26  ? -3.853  -18.682 2.769   1.00 0.00 ? 26  ALA A HB1  2  
ATOM 2050  H HB2  . ALA A 1 26  ? -4.082  -16.982 3.180   1.00 0.00 ? 26  ALA A HB2  2  
ATOM 2051  H HB3  . ALA A 1 26  ? -4.688  -18.239 4.259   1.00 0.00 ? 26  ALA A HB3  2  
ATOM 2052  N N    . GLU A 1 27  ? -6.338  -20.014 1.278   1.00 0.00 ? 27  GLU A N    2  
ATOM 2053  C CA   . GLU A 1 27  ? -6.860  -21.364 1.106   1.00 0.00 ? 27  GLU A CA   2  
ATOM 2054  C C    . GLU A 1 27  ? -5.905  -22.215 0.274   1.00 0.00 ? 27  GLU A C    2  
ATOM 2055  O O    . GLU A 1 27  ? -5.333  -21.762 -0.717  1.00 0.00 ? 27  GLU A O    2  
ATOM 2056  C CB   . GLU A 1 27  ? -8.236  -21.322 0.438   1.00 0.00 ? 27  GLU A CB   2  
ATOM 2057  C CG   . GLU A 1 27  ? -9.372  -21.027 1.403   1.00 0.00 ? 27  GLU A CG   2  
ATOM 2058  C CD   . GLU A 1 27  ? -9.696  -22.206 2.301   1.00 0.00 ? 27  GLU A CD   2  
ATOM 2059  O OE1  . GLU A 1 27  ? -9.606  -23.356 1.823   1.00 0.00 ? 27  GLU A OE1  2  
ATOM 2060  O OE2  . GLU A 1 27  ? -10.040 -21.978 3.479   1.00 0.00 ? 27  GLU A OE2  2  
ATOM 2061  H H    . GLU A 1 27  ? -5.906  -19.568 0.520   1.00 0.00 ? 27  GLU A H    2  
ATOM 2062  H HA   . GLU A 1 27  ? -6.959  -21.809 2.085   1.00 0.00 ? 27  GLU A HA   2  
ATOM 2063  H HB2  . GLU A 1 27  ? -8.230  -20.556 -0.323  1.00 0.00 ? 27  GLU A HB2  2  
ATOM 2064  H HB3  . GLU A 1 27  ? -8.426  -22.278 -0.027  1.00 0.00 ? 27  GLU A HB3  2  
ATOM 2065  H HG2  . GLU A 1 27  ? -9.092  -20.189 2.024   1.00 0.00 ? 27  GLU A HG2  2  
ATOM 2066  H HG3  . GLU A 1 27  ? -10.254 -20.773 0.834   1.00 0.00 ? 27  GLU A HG3  2  
ATOM 2067  N N    . PRO A 1 28  ? -5.727  -23.479 0.687   1.00 0.00 ? 28  PRO A N    2  
ATOM 2068  C CA   . PRO A 1 28  ? -4.842  -24.420 -0.006  1.00 0.00 ? 28  PRO A CA   2  
ATOM 2069  C C    . PRO A 1 28  ? -5.390  -24.838 -1.366  1.00 0.00 ? 28  PRO A C    2  
ATOM 2070  O O    . PRO A 1 28  ? -6.167  -25.786 -1.467  1.00 0.00 ? 28  PRO A O    2  
ATOM 2071  C CB   . PRO A 1 28  ? -4.790  -25.622 0.942   1.00 0.00 ? 28  PRO A CB   2  
ATOM 2072  C CG   . PRO A 1 28  ? -6.063  -25.550 1.713   1.00 0.00 ? 28  PRO A CG   2  
ATOM 2073  C CD   . PRO A 1 28  ? -6.376  -24.087 1.860   1.00 0.00 ? 28  PRO A CD   2  
ATOM 2074  H HA   . PRO A 1 28  ? -3.848  -24.014 -0.129  1.00 0.00 ? 28  PRO A HA   2  
ATOM 2075  H HB2  . PRO A 1 28  ? -4.727  -26.535 0.366   1.00 0.00 ? 28  PRO A HB2  2  
ATOM 2076  H HB3  . PRO A 1 28  ? -3.931  -25.537 1.589   1.00 0.00 ? 28  PRO A HB3  2  
ATOM 2077  H HG2  . PRO A 1 28  ? -6.851  -26.049 1.170   1.00 0.00 ? 28  PRO A HG2  2  
ATOM 2078  H HG3  . PRO A 1 28  ? -5.929  -26.004 2.684   1.00 0.00 ? 28  PRO A HG3  2  
ATOM 2079  H HD2  . PRO A 1 28  ? -7.444  -23.925 1.837   1.00 0.00 ? 28  PRO A HD2  2  
ATOM 2080  H HD3  . PRO A 1 28  ? -5.954  -23.701 2.776   1.00 0.00 ? 28  PRO A HD3  2  
ATOM 2081  N N    . GLU A 1 29  ? -4.978  -24.124 -2.409  1.00 0.00 ? 29  GLU A N    2  
ATOM 2082  C CA   . GLU A 1 29  ? -5.430  -24.422 -3.764  1.00 0.00 ? 29  GLU A CA   2  
ATOM 2083  C C    . GLU A 1 29  ? -4.860  -25.752 -4.247  1.00 0.00 ? 29  GLU A C    2  
ATOM 2084  O O    . GLU A 1 29  ? -5.434  -26.406 -5.117  1.00 0.00 ? 29  GLU A O    2  
ATOM 2085  C CB   . GLU A 1 29  ? -5.018  -23.300 -4.720  1.00 0.00 ? 29  GLU A CB   2  
ATOM 2086  C CG   . GLU A 1 29  ? -3.613  -23.460 -5.277  1.00 0.00 ? 29  GLU A CG   2  
ATOM 2087  C CD   . GLU A 1 29  ? -3.585  -24.250 -6.571  1.00 0.00 ? 29  GLU A CD   2  
ATOM 2088  O OE1  . GLU A 1 29  ? -4.670  -24.620 -7.065  1.00 0.00 ? 29  GLU A OE1  2  
ATOM 2089  O OE2  . GLU A 1 29  ? -2.476  -24.497 -7.090  1.00 0.00 ? 29  GLU A OE2  2  
ATOM 2090  H H    . GLU A 1 29  ? -4.358  -23.380 -2.265  1.00 0.00 ? 29  GLU A H    2  
ATOM 2091  H HA   . GLU A 1 29  ? -6.507  -24.490 -3.747  1.00 0.00 ? 29  GLU A HA   2  
ATOM 2092  H HB2  . GLU A 1 29  ? -5.711  -23.278 -5.548  1.00 0.00 ? 29  GLU A HB2  2  
ATOM 2093  H HB3  . GLU A 1 29  ? -5.069  -22.359 -4.194  1.00 0.00 ? 29  GLU A HB3  2  
ATOM 2094  H HG2  . GLU A 1 29  ? -3.200  -22.480 -5.462  1.00 0.00 ? 29  GLU A HG2  2  
ATOM 2095  H HG3  . GLU A 1 29  ? -3.006  -23.973 -4.545  1.00 0.00 ? 29  GLU A HG3  2  
ATOM 2096  N N    . SER A 1 30  ? -3.726  -26.146 -3.676  1.00 0.00 ? 30  SER A N    2  
ATOM 2097  C CA   . SER A 1 30  ? -3.075  -27.395 -4.051  1.00 0.00 ? 30  SER A CA   2  
ATOM 2098  C C    . SER A 1 30  ? -2.229  -27.934 -2.901  1.00 0.00 ? 30  SER A C    2  
ATOM 2099  O O    . SER A 1 30  ? -2.195  -27.352 -1.817  1.00 0.00 ? 30  SER A O    2  
ATOM 2100  C CB   . SER A 1 30  ? -2.199  -27.188 -5.289  1.00 0.00 ? 30  SER A CB   2  
ATOM 2101  O OG   . SER A 1 30  ? -2.004  -28.406 -5.985  1.00 0.00 ? 30  SER A OG   2  
ATOM 2102  H H    . SER A 1 30  ? -3.316  -25.580 -2.988  1.00 0.00 ? 30  SER A H    2  
ATOM 2103  H HA   . SER A 1 30  ? -3.846  -28.114 -4.283  1.00 0.00 ? 30  SER A HA   2  
ATOM 2104  H HB2  . SER A 1 30  ? -2.678  -26.482 -5.950  1.00 0.00 ? 30  SER A HB2  2  
ATOM 2105  H HB3  . SER A 1 30  ? -1.237  -26.802 -4.985  1.00 0.00 ? 30  SER A HB3  2  
ATOM 2106  H HG   . SER A 1 30  ? -1.093  -28.693 -5.880  1.00 0.00 ? 30  SER A HG   2  
ATOM 2107  N N    . GLU A 1 31  ? -1.549  -29.049 -3.146  1.00 0.00 ? 31  GLU A N    2  
ATOM 2108  C CA   . GLU A 1 31  ? -0.704  -29.667 -2.131  1.00 0.00 ? 31  GLU A CA   2  
ATOM 2109  C C    . GLU A 1 31  ? 0.621   -28.923 -1.999  1.00 0.00 ? 31  GLU A C    2  
ATOM 2110  O O    . GLU A 1 31  ? 1.267   -28.960 -0.951  1.00 0.00 ? 31  GLU A O    2  
ATOM 2111  C CB   . GLU A 1 31  ? -0.445  -31.135 -2.476  1.00 0.00 ? 31  GLU A CB   2  
ATOM 2112  C CG   . GLU A 1 31  ? 0.681   -31.336 -3.477  1.00 0.00 ? 31  GLU A CG   2  
ATOM 2113  C CD   . GLU A 1 31  ? 0.309   -30.875 -4.873  1.00 0.00 ? 31  GLU A CD   2  
ATOM 2114  O OE1  . GLU A 1 31  ? -0.798  -31.221 -5.337  1.00 0.00 ? 31  GLU A OE1  2  
ATOM 2115  O OE2  . GLU A 1 31  ? 1.125   -30.168 -5.501  1.00 0.00 ? 31  GLU A OE2  2  
ATOM 2116  H H    . GLU A 1 31  ? -1.617  -29.466 -4.031  1.00 0.00 ? 31  GLU A H    2  
ATOM 2117  H HA   . GLU A 1 31  ? -1.227  -29.616 -1.188  1.00 0.00 ? 31  GLU A HA   2  
ATOM 2118  H HB2  . GLU A 1 31  ? -0.192  -31.666 -1.570  1.00 0.00 ? 31  GLU A HB2  2  
ATOM 2119  H HB3  . GLU A 1 31  ? -1.347  -31.559 -2.891  1.00 0.00 ? 31  GLU A HB3  2  
ATOM 2120  H HG2  . GLU A 1 31  ? 1.543   -30.775 -3.148  1.00 0.00 ? 31  GLU A HG2  2  
ATOM 2121  H HG3  . GLU A 1 31  ? 0.929   -32.386 -3.515  1.00 0.00 ? 31  GLU A HG3  2  
ATOM 2122  N N    . THR A 1 32  ? 1.023   -28.246 -3.071  1.00 0.00 ? 32  THR A N    2  
ATOM 2123  C CA   . THR A 1 32  ? 2.271   -27.494 -3.077  1.00 0.00 ? 32  THR A CA   2  
ATOM 2124  C C    . THR A 1 32  ? 2.044   -26.055 -3.525  1.00 0.00 ? 32  THR A C    2  
ATOM 2125  O O    . THR A 1 32  ? 2.994   -25.293 -3.704  1.00 0.00 ? 32  THR A O    2  
ATOM 2126  C CB   . THR A 1 32  ? 3.317   -28.148 -4.000  1.00 0.00 ? 32  THR A CB   2  
ATOM 2127  O OG1  . THR A 1 32  ? 2.769   -28.326 -5.311  1.00 0.00 ? 32  THR A OG1  2  
ATOM 2128  C CG2  . THR A 1 32  ? 3.763   -29.493 -3.445  1.00 0.00 ? 32  THR A CG2  2  
ATOM 2129  H H    . THR A 1 32  ? 0.465   -28.255 -3.877  1.00 0.00 ? 32  THR A H    2  
ATOM 2130  H HA   . THR A 1 32  ? 2.663   -27.490 -2.070  1.00 0.00 ? 32  THR A HA   2  
ATOM 2131  H HB   . THR A 1 32  ? 4.177   -27.497 -4.062  1.00 0.00 ? 32  THR A HB   2  
ATOM 2132  H HG1  . THR A 1 32  ? 3.272   -28.998 -5.780  1.00 0.00 ? 32  THR A HG1  2  
ATOM 2133  H HG21 . THR A 1 32  ? 4.842   -29.544 -3.451  1.00 0.00 ? 32  THR A HG21 2  
ATOM 2134  H HG22 . THR A 1 32  ? 3.361   -30.286 -4.057  1.00 0.00 ? 32  THR A HG22 2  
ATOM 2135  H HG23 . THR A 1 32  ? 3.404   -29.601 -2.433  1.00 0.00 ? 32  THR A HG23 2  
ATOM 2136  N N    . SER A 1 33  ? 0.779   -25.689 -3.705  1.00 0.00 ? 33  SER A N    2  
ATOM 2137  C CA   . SER A 1 33  ? 0.427   -24.341 -4.136  1.00 0.00 ? 33  SER A CA   2  
ATOM 2138  C C    . SER A 1 33  ? -0.752  -23.803 -3.330  1.00 0.00 ? 33  SER A C    2  
ATOM 2139  O O    . SER A 1 33  ? -1.634  -24.559 -2.922  1.00 0.00 ? 33  SER A O    2  
ATOM 2140  C CB   . SER A 1 33  ? 0.087   -24.331 -5.627  1.00 0.00 ? 33  SER A CB   2  
ATOM 2141  O OG   . SER A 1 33  ? 1.225   -24.642 -6.412  1.00 0.00 ? 33  SER A OG   2  
ATOM 2142  H H    . SER A 1 33  ? 0.065   -26.342 -3.547  1.00 0.00 ? 33  SER A H    2  
ATOM 2143  H HA   . SER A 1 33  ? 1.283   -23.705 -3.966  1.00 0.00 ? 33  SER A HA   2  
ATOM 2144  H HB2  . SER A 1 33  ? -0.681  -25.064 -5.823  1.00 0.00 ? 33  SER A HB2  2  
ATOM 2145  H HB3  . SER A 1 33  ? -0.272  -23.351 -5.905  1.00 0.00 ? 33  SER A HB3  2  
ATOM 2146  H HG   . SER A 1 33  ? 1.043   -24.443 -7.333  1.00 0.00 ? 33  SER A HG   2  
ATOM 2147  N N    . ILE A 1 34  ? -0.758  -22.494 -3.105  1.00 0.00 ? 34  ILE A N    2  
ATOM 2148  C CA   . ILE A 1 34  ? -1.828  -21.855 -2.349  1.00 0.00 ? 34  ILE A CA   2  
ATOM 2149  C C    . ILE A 1 34  ? -2.331  -20.603 -3.060  1.00 0.00 ? 34  ILE A C    2  
ATOM 2150  O O    . ILE A 1 34  ? -1.552  -19.860 -3.659  1.00 0.00 ? 34  ILE A O    2  
ATOM 2151  C CB   . ILE A 1 34  ? -1.366  -21.475 -0.930  1.00 0.00 ? 34  ILE A CB   2  
ATOM 2152  C CG1  . ILE A 1 34  ? -0.945  -22.725 -0.155  1.00 0.00 ? 34  ILE A CG1  2  
ATOM 2153  C CG2  . ILE A 1 34  ? -2.473  -20.735 -0.193  1.00 0.00 ? 34  ILE A CG2  2  
ATOM 2154  C CD1  . ILE A 1 34  ? -0.650  -22.460 1.305   1.00 0.00 ? 34  ILE A CD1  2  
ATOM 2155  H H    . ILE A 1 34  ? -0.027  -21.945 -3.456  1.00 0.00 ? 34  ILE A H    2  
ATOM 2156  H HA   . ILE A 1 34  ? -2.643  -22.559 -2.264  1.00 0.00 ? 34  ILE A HA   2  
ATOM 2157  H HB   . ILE A 1 34  ? -0.519  -20.812 -1.017  1.00 0.00 ? 34  ILE A HB   2  
ATOM 2158  H HG12 . ILE A 1 34  ? -1.737  -23.456 -0.206  1.00 0.00 ? 34  ILE A HG12 2  
ATOM 2159  H HG13 . ILE A 1 34  ? -0.053  -23.135 -0.606  1.00 0.00 ? 34  ILE A HG13 2  
ATOM 2160  H HG21 . ILE A 1 34  ? -2.061  -20.248 0.679   1.00 0.00 ? 34  ILE A HG21 2  
ATOM 2161  H HG22 . ILE A 1 34  ? -2.907  -19.994 -0.846  1.00 0.00 ? 34  ILE A HG22 2  
ATOM 2162  H HG23 . ILE A 1 34  ? -3.234  -21.437 0.113   1.00 0.00 ? 34  ILE A HG23 2  
ATOM 2163  H HD11 . ILE A 1 34  ? -1.460  -21.892 1.739   1.00 0.00 ? 34  ILE A HD11 2  
ATOM 2164  H HD12 . ILE A 1 34  ? -0.547  -23.399 1.828   1.00 0.00 ? 34  ILE A HD12 2  
ATOM 2165  H HD13 . ILE A 1 34  ? 0.269   -21.898 1.390   1.00 0.00 ? 34  ILE A HD13 2  
ATOM 2166  N N    . LEU A 1 35  ? -3.638  -20.373 -2.988  1.00 0.00 ? 35  LEU A N    2  
ATOM 2167  C CA   . LEU A 1 35  ? -4.246  -19.209 -3.623  1.00 0.00 ? 35  LEU A CA   2  
ATOM 2168  C C    . LEU A 1 35  ? -4.722  -18.205 -2.578  1.00 0.00 ? 35  LEU A C    2  
ATOM 2169  O O    . LEU A 1 35  ? -5.543  -18.530 -1.719  1.00 0.00 ? 35  LEU A O    2  
ATOM 2170  C CB   . LEU A 1 35  ? -5.419  -19.640 -4.505  1.00 0.00 ? 35  LEU A CB   2  
ATOM 2171  C CG   . LEU A 1 35  ? -5.906  -18.610 -5.525  1.00 0.00 ? 35  LEU A CG   2  
ATOM 2172  C CD1  . LEU A 1 35  ? -4.829  -18.333 -6.561  1.00 0.00 ? 35  LEU A CD1  2  
ATOM 2173  C CD2  . LEU A 1 35  ? -7.185  -19.088 -6.197  1.00 0.00 ? 35  LEU A CD2  2  
ATOM 2174  H H    . LEU A 1 35  ? -4.208  -21.000 -2.497  1.00 0.00 ? 35  LEU A H    2  
ATOM 2175  H HA   . LEU A 1 35  ? -3.496  -18.739 -4.241  1.00 0.00 ? 35  LEU A HA   2  
ATOM 2176  H HB2  . LEU A 1 35  ? -5.119  -20.524 -5.047  1.00 0.00 ? 35  LEU A HB2  2  
ATOM 2177  H HB3  . LEU A 1 35  ? -6.249  -19.882 -3.856  1.00 0.00 ? 35  LEU A HB3  2  
ATOM 2178  H HG   . LEU A 1 35  ? -6.123  -17.682 -5.014  1.00 0.00 ? 35  LEU A HG   2  
ATOM 2179  H HD11 . LEU A 1 35  ? -4.719  -17.267 -6.691  1.00 0.00 ? 35  LEU A HD11 2  
ATOM 2180  H HD12 . LEU A 1 35  ? -5.110  -18.784 -7.502  1.00 0.00 ? 35  LEU A HD12 2  
ATOM 2181  H HD13 . LEU A 1 35  ? -3.892  -18.754 -6.227  1.00 0.00 ? 35  LEU A HD13 2  
ATOM 2182  H HD21 . LEU A 1 35  ? -8.039  -18.735 -5.637  1.00 0.00 ? 35  LEU A HD21 2  
ATOM 2183  H HD22 . LEU A 1 35  ? -7.195  -20.168 -6.225  1.00 0.00 ? 35  LEU A HD22 2  
ATOM 2184  H HD23 . LEU A 1 35  ? -7.230  -18.700 -7.203  1.00 0.00 ? 35  LEU A HD23 2  
ATOM 2185  N N    . LEU A 1 36  ? -4.204  -16.985 -2.659  1.00 0.00 ? 36  LEU A N    2  
ATOM 2186  C CA   . LEU A 1 36  ? -4.578  -15.932 -1.721  1.00 0.00 ? 36  LEU A CA   2  
ATOM 2187  C C    . LEU A 1 36  ? -5.500  -14.914 -2.385  1.00 0.00 ? 36  LEU A C    2  
ATOM 2188  O O    . LEU A 1 36  ? -5.323  -14.570 -3.554  1.00 0.00 ? 36  LEU A O    2  
ATOM 2189  C CB   . LEU A 1 36  ? -3.328  -15.231 -1.185  1.00 0.00 ? 36  LEU A CB   2  
ATOM 2190  C CG   . LEU A 1 36  ? -2.170  -16.143 -0.778  1.00 0.00 ? 36  LEU A CG   2  
ATOM 2191  C CD1  . LEU A 1 36  ? -0.858  -15.374 -0.780  1.00 0.00 ? 36  LEU A CD1  2  
ATOM 2192  C CD2  . LEU A 1 36  ? -2.430  -16.755 0.591   1.00 0.00 ? 36  LEU A CD2  2  
ATOM 2193  H H    . LEU A 1 36  ? -3.555  -16.786 -3.365  1.00 0.00 ? 36  LEU A H    2  
ATOM 2194  H HA   . LEU A 1 36  ? -5.103  -16.392 -0.898  1.00 0.00 ? 36  LEU A HA   2  
ATOM 2195  H HB2  . LEU A 1 36  ? -2.968  -14.564 -1.953  1.00 0.00 ? 36  LEU A HB2  2  
ATOM 2196  H HB3  . LEU A 1 36  ? -3.618  -14.656 -0.318  1.00 0.00 ? 36  LEU A HB3  2  
ATOM 2197  H HG   . LEU A 1 36  ? -2.085  -16.949 -1.494  1.00 0.00 ? 36  LEU A HG   2  
ATOM 2198  H HD11 . LEU A 1 36  ? -0.456  -15.351 -1.781  1.00 0.00 ? 36  LEU A HD11 2  
ATOM 2199  H HD12 . LEU A 1 36  ? -0.155  -15.861 -0.121  1.00 0.00 ? 36  LEU A HD12 2  
ATOM 2200  H HD13 . LEU A 1 36  ? -1.033  -14.364 -0.437  1.00 0.00 ? 36  LEU A HD13 2  
ATOM 2201  H HD21 . LEU A 1 36  ? -3.446  -16.547 0.891   1.00 0.00 ? 36  LEU A HD21 2  
ATOM 2202  H HD22 . LEU A 1 36  ? -1.748  -16.327 1.312   1.00 0.00 ? 36  LEU A HD22 2  
ATOM 2203  H HD23 . LEU A 1 36  ? -2.280  -17.823 0.542   1.00 0.00 ? 36  LEU A HD23 2  
ATOM 2204  N N    . SER A 1 37  ? -6.483  -14.434 -1.631  1.00 0.00 ? 37  SER A N    2  
ATOM 2205  C CA   . SER A 1 37  ? -7.435  -13.456 -2.146  1.00 0.00 ? 37  SER A CA   2  
ATOM 2206  C C    . SER A 1 37  ? -7.484  -12.222 -1.251  1.00 0.00 ? 37  SER A C    2  
ATOM 2207  O O    . SER A 1 37  ? -7.585  -12.332 -0.029  1.00 0.00 ? 37  SER A O    2  
ATOM 2208  C CB   . SER A 1 37  ? -8.828  -14.078 -2.255  1.00 0.00 ? 37  SER A CB   2  
ATOM 2209  O OG   . SER A 1 37  ? -9.566  -13.493 -3.315  1.00 0.00 ? 37  SER A OG   2  
ATOM 2210  H H    . SER A 1 37  ? -6.573  -14.747 -0.706  1.00 0.00 ? 37  SER A H    2  
ATOM 2211  H HA   . SER A 1 37  ? -7.104  -13.159 -3.131  1.00 0.00 ? 37  SER A HA   2  
ATOM 2212  H HB2  . SER A 1 37  ? -8.734  -15.137 -2.440  1.00 0.00 ? 37  SER A HB2  2  
ATOM 2213  H HB3  . SER A 1 37  ? -9.363  -13.919 -1.330  1.00 0.00 ? 37  SER A HB3  2  
ATOM 2214  H HG   . SER A 1 37  ? -9.507  -12.537 -3.257  1.00 0.00 ? 37  SER A HG   2  
ATOM 2215  N N    . TRP A 1 38  ? -7.413  -11.048 -1.868  1.00 0.00 ? 38  TRP A N    2  
ATOM 2216  C CA   . TRP A 1 38  ? -7.450  -9.792  -1.127  1.00 0.00 ? 38  TRP A CA   2  
ATOM 2217  C C    . TRP A 1 38  ? -8.197  -8.720  -1.912  1.00 0.00 ? 38  TRP A C    2  
ATOM 2218  O O    . TRP A 1 38  ? -8.369  -8.830  -3.126  1.00 0.00 ? 38  TRP A O    2  
ATOM 2219  C CB   . TRP A 1 38  ? -6.029  -9.318  -0.817  1.00 0.00 ? 38  TRP A CB   2  
ATOM 2220  C CG   . TRP A 1 38  ? -5.290  -8.826  -2.025  1.00 0.00 ? 38  TRP A CG   2  
ATOM 2221  C CD1  . TRP A 1 38  ? -5.490  -7.647  -2.685  1.00 0.00 ? 38  TRP A CD1  2  
ATOM 2222  C CD2  . TRP A 1 38  ? -4.234  -9.502  -2.717  1.00 0.00 ? 38  TRP A CD2  2  
ATOM 2223  N NE1  . TRP A 1 38  ? -4.623  -7.549  -3.746  1.00 0.00 ? 38  TRP A NE1  2  
ATOM 2224  C CE2  . TRP A 1 38  ? -3.841  -8.673  -3.787  1.00 0.00 ? 38  TRP A CE2  2  
ATOM 2225  C CE3  . TRP A 1 38  ? -3.582  -10.724 -2.537  1.00 0.00 ? 38  TRP A CE3  2  
ATOM 2226  C CZ2  . TRP A 1 38  ? -2.826  -9.031  -4.670  1.00 0.00 ? 38  TRP A CZ2  2  
ATOM 2227  C CZ3  . TRP A 1 38  ? -2.575  -11.077 -3.415  1.00 0.00 ? 38  TRP A CZ3  2  
ATOM 2228  C CH2  . TRP A 1 38  ? -2.204  -10.233 -4.470  1.00 0.00 ? 38  TRP A CH2  2  
ATOM 2229  H H    . TRP A 1 38  ? -7.334  -11.025 -2.845  1.00 0.00 ? 38  TRP A H    2  
ATOM 2230  H HA   . TRP A 1 38  ? -7.970  -9.971  -0.198  1.00 0.00 ? 38  TRP A HA   2  
ATOM 2231  H HB2  . TRP A 1 38  ? -6.074  -8.510  -0.102  1.00 0.00 ? 38  TRP A HB2  2  
ATOM 2232  H HB3  . TRP A 1 38  ? -5.468  -10.138 -0.393  1.00 0.00 ? 38  TRP A HB3  2  
ATOM 2233  H HD1  . TRP A 1 38  ? -6.228  -6.911  -2.404  1.00 0.00 ? 38  TRP A HD1  2  
ATOM 2234  H HE1  . TRP A 1 38  ? -4.571  -6.795  -4.371  1.00 0.00 ? 38  TRP A HE1  2  
ATOM 2235  H HE3  . TRP A 1 38  ? -3.853  -11.388 -1.729  1.00 0.00 ? 38  TRP A HE3  2  
ATOM 2236  H HZ2  . TRP A 1 38  ? -2.529  -8.391  -5.488  1.00 0.00 ? 38  TRP A HZ2  2  
ATOM 2237  H HZ3  . TRP A 1 38  ? -2.059  -12.019 -3.291  1.00 0.00 ? 38  TRP A HZ3  2  
ATOM 2238  H HH2  . TRP A 1 38  ? -1.413  -10.550 -5.131  1.00 0.00 ? 38  TRP A HH2  2  
ATOM 2239  N N    . THR A 1 39  ? -8.641  -7.681  -1.210  1.00 0.00 ? 39  THR A N    2  
ATOM 2240  C CA   . THR A 1 39  ? -9.371  -6.589  -1.841  1.00 0.00 ? 39  THR A CA   2  
ATOM 2241  C C    . THR A 1 39  ? -8.546  -5.307  -1.847  1.00 0.00 ? 39  THR A C    2  
ATOM 2242  O O    . THR A 1 39  ? -8.223  -4.743  -0.801  1.00 0.00 ? 39  THR A O    2  
ATOM 2243  C CB   . THR A 1 39  ? -10.709 -6.321  -1.127  1.00 0.00 ? 39  THR A CB   2  
ATOM 2244  O OG1  . THR A 1 39  ? -11.599 -7.425  -1.325  1.00 0.00 ? 39  THR A OG1  2  
ATOM 2245  C CG2  . THR A 1 39  ? -11.354 -5.045  -1.646  1.00 0.00 ? 39  THR A CG2  2  
ATOM 2246  H H    . THR A 1 39  ? -8.472  -7.650  -0.246  1.00 0.00 ? 39  THR A H    2  
ATOM 2247  H HA   . THR A 1 39  ? -9.582  -6.874  -2.862  1.00 0.00 ? 39  THR A HA   2  
ATOM 2248  H HB   . THR A 1 39  ? -10.519 -6.207  -0.069  1.00 0.00 ? 39  THR A HB   2  
ATOM 2249  H HG1  . THR A 1 39  ? -11.091 -8.237  -1.396  1.00 0.00 ? 39  THR A HG1  2  
ATOM 2250  H HG21 . THR A 1 39  ? -10.785 -4.669  -2.483  1.00 0.00 ? 39  THR A HG21 2  
ATOM 2251  H HG22 . THR A 1 39  ? -11.370 -4.305  -0.860  1.00 0.00 ? 39  THR A HG22 2  
ATOM 2252  H HG23 . THR A 1 39  ? -12.364 -5.256  -1.963  1.00 0.00 ? 39  THR A HG23 2  
ATOM 2253  N N    . PRO A 1 40  ? -8.196  -4.832  -3.052  1.00 0.00 ? 40  PRO A N    2  
ATOM 2254  C CA   . PRO A 1 40  ? -7.405  -3.610  -3.222  1.00 0.00 ? 40  PRO A CA   2  
ATOM 2255  C C    . PRO A 1 40  ? -8.188  -2.356  -2.847  1.00 0.00 ? 40  PRO A C    2  
ATOM 2256  O O    . PRO A 1 40  ? -9.308  -2.134  -3.307  1.00 0.00 ? 40  PRO A O    2  
ATOM 2257  C CB   . PRO A 1 40  ? -7.075  -3.607  -4.717  1.00 0.00 ? 40  PRO A CB   2  
ATOM 2258  C CG   . PRO A 1 40  ? -8.165  -4.403  -5.348  1.00 0.00 ? 40  PRO A CG   2  
ATOM 2259  C CD   . PRO A 1 40  ? -8.547  -5.453  -4.341  1.00 0.00 ? 40  PRO A CD   2  
ATOM 2260  H HA   . PRO A 1 40  ? -6.490  -3.647  -2.650  1.00 0.00 ? 40  PRO A HA   2  
ATOM 2261  H HB2  . PRO A 1 40  ? -7.064  -2.590  -5.084  1.00 0.00 ? 40  PRO A HB2  2  
ATOM 2262  H HB3  . PRO A 1 40  ? -6.110  -4.064  -4.877  1.00 0.00 ? 40  PRO A HB3  2  
ATOM 2263  H HG2  . PRO A 1 40  ? -9.008  -3.765  -5.563  1.00 0.00 ? 40  PRO A HG2  2  
ATOM 2264  H HG3  . PRO A 1 40  ? -7.803  -4.868  -6.253  1.00 0.00 ? 40  PRO A HG3  2  
ATOM 2265  H HD2  . PRO A 1 40  ? -9.605  -5.659  -4.394  1.00 0.00 ? 40  PRO A HD2  2  
ATOM 2266  H HD3  . PRO A 1 40  ? -7.976  -6.355  -4.501  1.00 0.00 ? 40  PRO A HD3  2  
ATOM 2267  N N    . PRO A 1 41  ? -7.586  -1.515  -1.993  1.00 0.00 ? 41  PRO A N    2  
ATOM 2268  C CA   . PRO A 1 41  ? -8.208  -0.269  -1.539  1.00 0.00 ? 41  PRO A CA   2  
ATOM 2269  C C    . PRO A 1 41  ? -8.302  0.771   -2.650  1.00 0.00 ? 41  PRO A C    2  
ATOM 2270  O O    . PRO A 1 41  ? -7.713  0.606   -3.719  1.00 0.00 ? 41  PRO A O    2  
ATOM 2271  C CB   . PRO A 1 41  ? -7.268  0.215   -0.432  1.00 0.00 ? 41  PRO A CB   2  
ATOM 2272  C CG   . PRO A 1 41  ? -5.948  -0.390  -0.765  1.00 0.00 ? 41  PRO A CG   2  
ATOM 2273  C CD   . PRO A 1 41  ? -6.250  -1.717  -1.406  1.00 0.00 ? 41  PRO A CD   2  
ATOM 2274  H HA   . PRO A 1 41  ? -9.192  -0.443  -1.127  1.00 0.00 ? 41  PRO A HA   2  
ATOM 2275  H HB2  . PRO A 1 41  ? -7.222  1.295   -0.441  1.00 0.00 ? 41  PRO A HB2  2  
ATOM 2276  H HB3  . PRO A 1 41  ? -7.628  -0.128  0.526   1.00 0.00 ? 41  PRO A HB3  2  
ATOM 2277  H HG2  . PRO A 1 41  ? -5.416  0.247   -1.455  1.00 0.00 ? 41  PRO A HG2  2  
ATOM 2278  H HG3  . PRO A 1 41  ? -5.372  -0.533  0.137   1.00 0.00 ? 41  PRO A HG3  2  
ATOM 2279  H HD2  . PRO A 1 41  ? -5.522  -1.941  -2.171  1.00 0.00 ? 41  PRO A HD2  2  
ATOM 2280  H HD3  . PRO A 1 41  ? -6.271  -2.499  -0.662  1.00 0.00 ? 41  PRO A HD3  2  
ATOM 2281  N N    . ARG A 1 42  ? -9.044  1.843   -2.391  1.00 0.00 ? 42  ARG A N    2  
ATOM 2282  C CA   . ARG A 1 42  ? -9.215  2.909   -3.370  1.00 0.00 ? 42  ARG A CA   2  
ATOM 2283  C C    . ARG A 1 42  ? -7.883  3.266   -4.022  1.00 0.00 ? 42  ARG A C    2  
ATOM 2284  O O    . ARG A 1 42  ? -7.822  3.545   -5.220  1.00 0.00 ? 42  ARG A O    2  
ATOM 2285  C CB   . ARG A 1 42  ? -9.818  4.148   -2.706  1.00 0.00 ? 42  ARG A CB   2  
ATOM 2286  C CG   . ARG A 1 42  ? -9.961  5.334   -3.646  1.00 0.00 ? 42  ARG A CG   2  
ATOM 2287  C CD   . ARG A 1 42  ? -11.238 5.243   -4.467  1.00 0.00 ? 42  ARG A CD   2  
ATOM 2288  N NE   . ARG A 1 42  ? -11.116 5.936   -5.747  1.00 0.00 ? 42  ARG A NE   2  
ATOM 2289  C CZ   . ARG A 1 42  ? -10.489 5.426   -6.802  1.00 0.00 ? 42  ARG A CZ   2  
ATOM 2290  N NH1  . ARG A 1 42  ? -9.931  4.226   -6.729  1.00 0.00 ? 42  ARG A NH1  2  
ATOM 2291  N NH2  . ARG A 1 42  ? -10.421 6.117   -7.932  1.00 0.00 ? 42  ARG A NH2  2  
ATOM 2292  H H    . ARG A 1 42  ? -9.489  1.917   -1.520  1.00 0.00 ? 42  ARG A H    2  
ATOM 2293  H HA   . ARG A 1 42  ? -9.892  2.555   -4.132  1.00 0.00 ? 42  ARG A HA   2  
ATOM 2294  H HB2  . ARG A 1 42  ? -10.798 3.898   -2.326  1.00 0.00 ? 42  ARG A HB2  2  
ATOM 2295  H HB3  . ARG A 1 42  ? -9.186  4.444   -1.882  1.00 0.00 ? 42  ARG A HB3  2  
ATOM 2296  H HG2  . ARG A 1 42  ? -9.986  6.243   -3.063  1.00 0.00 ? 42  ARG A HG2  2  
ATOM 2297  H HG3  . ARG A 1 42  ? -9.114  5.356   -4.315  1.00 0.00 ? 42  ARG A HG3  2  
ATOM 2298  H HD2  . ARG A 1 42  ? -11.458 4.202   -4.652  1.00 0.00 ? 42  ARG A HD2  2  
ATOM 2299  H HD3  . ARG A 1 42  ? -12.045 5.687   -3.903  1.00 0.00 ? 42  ARG A HD3  2  
ATOM 2300  H HE   . ARG A 1 42  ? -11.521 6.824   -5.823  1.00 0.00 ? 42  ARG A HE   2  
ATOM 2301  H HH11 . ARG A 1 42  ? -9.983  3.702   -5.879  1.00 0.00 ? 42  ARG A HH11 2  
ATOM 2302  H HH12 . ARG A 1 42  ? -9.461  3.844   -7.525  1.00 0.00 ? 42  ARG A HH12 2  
ATOM 2303  H HH21 . ARG A 1 42  ? -10.840 7.023   -7.991  1.00 0.00 ? 42  ARG A HH21 2  
ATOM 2304  H HH22 . ARG A 1 42  ? -9.949  5.733   -8.725  1.00 0.00 ? 42  ARG A HH22 2  
ATOM 2305  N N    . SER A 1 43  ? -6.818  3.256   -3.227  1.00 0.00 ? 43  SER A N    2  
ATOM 2306  C CA   . SER A 1 43  ? -5.488  3.583   -3.725  1.00 0.00 ? 43  SER A CA   2  
ATOM 2307  C C    . SER A 1 43  ? -5.176  2.799   -4.997  1.00 0.00 ? 43  SER A C    2  
ATOM 2308  O O    . SER A 1 43  ? -4.894  1.602   -4.947  1.00 0.00 ? 43  SER A O    2  
ATOM 2309  C CB   . SER A 1 43  ? -4.432  3.286   -2.658  1.00 0.00 ? 43  SER A CB   2  
ATOM 2310  O OG   . SER A 1 43  ? -4.422  4.290   -1.658  1.00 0.00 ? 43  SER A OG   2  
ATOM 2311  H H    . SER A 1 43  ? -6.931  3.026   -2.281  1.00 0.00 ? 43  SER A H    2  
ATOM 2312  H HA   . SER A 1 43  ? -5.469  4.638   -3.954  1.00 0.00 ? 43  SER A HA   2  
ATOM 2313  H HB2  . SER A 1 43  ? -4.650  2.336   -2.195  1.00 0.00 ? 43  SER A HB2  2  
ATOM 2314  H HB3  . SER A 1 43  ? -3.457  3.246   -3.121  1.00 0.00 ? 43  SER A HB3  2  
ATOM 2315  H HG   . SER A 1 43  ? -3.859  4.013   -0.932  1.00 0.00 ? 43  SER A HG   2  
ATOM 2316  N N    . ASP A 1 44  ? -5.230  3.483   -6.134  1.00 0.00 ? 44  ASP A N    2  
ATOM 2317  C CA   . ASP A 1 44  ? -4.953  2.852   -7.419  1.00 0.00 ? 44  ASP A CA   2  
ATOM 2318  C C    . ASP A 1 44  ? -3.455  2.629   -7.603  1.00 0.00 ? 44  ASP A C    2  
ATOM 2319  O O    . ASP A 1 44  ? -3.029  1.600   -8.129  1.00 0.00 ? 44  ASP A O    2  
ATOM 2320  C CB   . ASP A 1 44  ? -5.497  3.712   -8.561  1.00 0.00 ? 44  ASP A CB   2  
ATOM 2321  C CG   . ASP A 1 44  ? -5.079  3.196   -9.924  1.00 0.00 ? 44  ASP A CG   2  
ATOM 2322  O OD1  . ASP A 1 44  ? -3.860  3.063   -10.161 1.00 0.00 ? 44  ASP A OD1  2  
ATOM 2323  O OD2  . ASP A 1 44  ? -5.971  2.924   -10.754 1.00 0.00 ? 44  ASP A OD2  2  
ATOM 2324  H H    . ASP A 1 44  ? -5.461  4.435   -6.109  1.00 0.00 ? 44  ASP A H    2  
ATOM 2325  H HA   . ASP A 1 44  ? -5.451  1.895   -7.433  1.00 0.00 ? 44  ASP A HA   2  
ATOM 2326  H HB2  . ASP A 1 44  ? -6.576  3.719   -8.515  1.00 0.00 ? 44  ASP A HB2  2  
ATOM 2327  H HB3  . ASP A 1 44  ? -5.129  4.721   -8.450  1.00 0.00 ? 44  ASP A HB3  2  
ATOM 2328  N N    . THR A 1 45  ? -2.659  3.600   -7.167  1.00 0.00 ? 45  THR A N    2  
ATOM 2329  C CA   . THR A 1 45  ? -1.209  3.511   -7.286  1.00 0.00 ? 45  THR A CA   2  
ATOM 2330  C C    . THR A 1 45  ? -0.643  2.465   -6.332  1.00 0.00 ? 45  THR A C    2  
ATOM 2331  O O    . THR A 1 45  ? -0.372  2.757   -5.166  1.00 0.00 ? 45  THR A O    2  
ATOM 2332  C CB   . THR A 1 45  ? -0.537  4.867   -7.000  1.00 0.00 ? 45  THR A CB   2  
ATOM 2333  O OG1  . THR A 1 45  ? -1.100  5.454   -5.821  1.00 0.00 ? 45  THR A OG1  2  
ATOM 2334  C CG2  . THR A 1 45  ? -0.711  5.815   -8.177  1.00 0.00 ? 45  THR A CG2  2  
ATOM 2335  H H    . THR A 1 45  ? -3.058  4.395   -6.757  1.00 0.00 ? 45  THR A H    2  
ATOM 2336  H HA   . THR A 1 45  ? -0.974  3.223   -8.300  1.00 0.00 ? 45  THR A HA   2  
ATOM 2337  H HB   . THR A 1 45  ? 0.519   4.703   -6.842  1.00 0.00 ? 45  THR A HB   2  
ATOM 2338  H HG1  . THR A 1 45  ? -1.028  6.410   -5.873  1.00 0.00 ? 45  THR A HG1  2  
ATOM 2339  H HG21 . THR A 1 45  ? -1.392  6.608   -7.903  1.00 0.00 ? 45  THR A HG21 2  
ATOM 2340  H HG22 . THR A 1 45  ? -1.111  5.273   -9.021  1.00 0.00 ? 45  THR A HG22 2  
ATOM 2341  H HG23 . THR A 1 45  ? 0.246   6.239   -8.441  1.00 0.00 ? 45  THR A HG23 2  
ATOM 2342  N N    . ILE A 1 46  ? -0.466  1.248   -6.833  1.00 0.00 ? 46  ILE A N    2  
ATOM 2343  C CA   . ILE A 1 46  ? 0.070   0.160   -6.025  1.00 0.00 ? 46  ILE A CA   2  
ATOM 2344  C C    . ILE A 1 46  ? 1.250   -0.512  -6.720  1.00 0.00 ? 46  ILE A C    2  
ATOM 2345  O O    . ILE A 1 46  ? 1.102   -1.087  -7.798  1.00 0.00 ? 46  ILE A O    2  
ATOM 2346  C CB   . ILE A 1 46  ? -1.005  -0.901  -5.723  1.00 0.00 ? 46  ILE A CB   2  
ATOM 2347  C CG1  . ILE A 1 46  ? -2.139  -0.289  -4.898  1.00 0.00 ? 46  ILE A CG1  2  
ATOM 2348  C CG2  . ILE A 1 46  ? -0.391  -2.086  -4.993  1.00 0.00 ? 46  ILE A CG2  2  
ATOM 2349  C CD1  . ILE A 1 46  ? -3.405  -1.116  -4.903  1.00 0.00 ? 46  ILE A CD1  2  
ATOM 2350  H H    . ILE A 1 46  ? -0.701  1.077   -7.769  1.00 0.00 ? 46  ILE A H    2  
ATOM 2351  H HA   . ILE A 1 46  ? 0.409   0.577   -5.087  1.00 0.00 ? 46  ILE A HA   2  
ATOM 2352  H HB   . ILE A 1 46  ? -1.404  -1.254  -6.662  1.00 0.00 ? 46  ILE A HB   2  
ATOM 2353  H HG12 . ILE A 1 46  ? -1.815  -0.186  -3.874  1.00 0.00 ? 46  ILE A HG12 2  
ATOM 2354  H HG13 . ILE A 1 46  ? -2.377  0.688   -5.295  1.00 0.00 ? 46  ILE A HG13 2  
ATOM 2355  H HG21 . ILE A 1 46  ? -1.091  -2.909  -4.990  1.00 0.00 ? 46  ILE A HG21 2  
ATOM 2356  H HG22 . ILE A 1 46  ? 0.516   -2.387  -5.496  1.00 0.00 ? 46  ILE A HG22 2  
ATOM 2357  H HG23 . ILE A 1 46  ? -0.163  -1.804  -3.976  1.00 0.00 ? 46  ILE A HG23 2  
ATOM 2358  H HD11 . ILE A 1 46  ? -3.161  -2.150  -4.710  1.00 0.00 ? 46  ILE A HD11 2  
ATOM 2359  H HD12 . ILE A 1 46  ? -4.076  -0.754  -4.138  1.00 0.00 ? 46  ILE A HD12 2  
ATOM 2360  H HD13 . ILE A 1 46  ? -3.884  -1.034  -5.869  1.00 0.00 ? 46  ILE A HD13 2  
ATOM 2361  N N    . ALA A 1 47  ? 2.419   -0.437  -6.093  1.00 0.00 ? 47  ALA A N    2  
ATOM 2362  C CA   . ALA A 1 47  ? 3.624   -1.041  -6.650  1.00 0.00 ? 47  ALA A CA   2  
ATOM 2363  C C    . ALA A 1 47  ? 3.568   -2.563  -6.557  1.00 0.00 ? 47  ALA A C    2  
ATOM 2364  O O    . ALA A 1 47  ? 3.796   -3.263  -7.542  1.00 0.00 ? 47  ALA A O    2  
ATOM 2365  C CB   . ALA A 1 47  ? 4.858   -0.512  -5.935  1.00 0.00 ? 47  ALA A CB   2  
ATOM 2366  H H    . ALA A 1 47  ? 2.473   0.034   -5.236  1.00 0.00 ? 47  ALA A H    2  
ATOM 2367  H HA   . ALA A 1 47  ? 3.690   -0.757  -7.690  1.00 0.00 ? 47  ALA A HA   2  
ATOM 2368  H HB1  . ALA A 1 47  ? 4.648   0.469   -5.534  1.00 0.00 ? 47  ALA A HB1  2  
ATOM 2369  H HB2  . ALA A 1 47  ? 5.123   -1.181  -5.131  1.00 0.00 ? 47  ALA A HB2  2  
ATOM 2370  H HB3  . ALA A 1 47  ? 5.678   -0.446  -6.635  1.00 0.00 ? 47  ALA A HB3  2  
ATOM 2371  N N    . ASN A 1 48  ? 3.264   -3.067  -5.365  1.00 0.00 ? 48  ASN A N    2  
ATOM 2372  C CA   . ASN A 1 48  ? 3.180   -4.506  -5.143  1.00 0.00 ? 48  ASN A CA   2  
ATOM 2373  C C    . ASN A 1 48  ? 2.694   -4.811  -3.730  1.00 0.00 ? 48  ASN A C    2  
ATOM 2374  O O    . ASN A 1 48  ? 2.515   -3.906  -2.915  1.00 0.00 ? 48  ASN A O    2  
ATOM 2375  C CB   . ASN A 1 48  ? 4.543   -5.160  -5.378  1.00 0.00 ? 48  ASN A CB   2  
ATOM 2376  C CG   . ASN A 1 48  ? 5.695   -4.239  -5.025  1.00 0.00 ? 48  ASN A CG   2  
ATOM 2377  O OD1  . ASN A 1 48  ? 5.553   -3.339  -4.197  1.00 0.00 ? 48  ASN A OD1  2  
ATOM 2378  N ND2  . ASN A 1 48  ? 6.844   -4.460  -5.653  1.00 0.00 ? 48  ASN A ND2  2  
ATOM 2379  H H    . ASN A 1 48  ? 3.093   -2.458  -4.617  1.00 0.00 ? 48  ASN A H    2  
ATOM 2380  H HA   . ASN A 1 48  ? 2.471   -4.909  -5.850  1.00 0.00 ? 48  ASN A HA   2  
ATOM 2381  H HB2  . ASN A 1 48  ? 4.619   -6.049  -4.769  1.00 0.00 ? 48  ASN A HB2  2  
ATOM 2382  H HB3  . ASN A 1 48  ? 4.631   -5.433  -6.419  1.00 0.00 ? 48  ASN A HB3  2  
ATOM 2383  H HD21 . ASN A 1 48  ? 6.884   -5.195  -6.301  1.00 0.00 ? 48  ASN A HD21 2  
ATOM 2384  H HD22 . ASN A 1 48  ? 7.605   -3.880  -5.443  1.00 0.00 ? 48  ASN A HD22 2  
ATOM 2385  N N    . TYR A 1 49  ? 2.483   -6.092  -3.446  1.00 0.00 ? 49  TYR A N    2  
ATOM 2386  C CA   . TYR A 1 49  ? 2.016   -6.517  -2.132  1.00 0.00 ? 49  TYR A CA   2  
ATOM 2387  C C    . TYR A 1 49  ? 3.072   -7.361  -1.425  1.00 0.00 ? 49  TYR A C    2  
ATOM 2388  O O    . TYR A 1 49  ? 3.728   -8.198  -2.044  1.00 0.00 ? 49  TYR A O    2  
ATOM 2389  C CB   . TYR A 1 49  ? 0.715   -7.311  -2.262  1.00 0.00 ? 49  TYR A CB   2  
ATOM 2390  C CG   . TYR A 1 49  ? -0.476  -6.463  -2.648  1.00 0.00 ? 49  TYR A CG   2  
ATOM 2391  C CD1  . TYR A 1 49  ? -0.800  -6.253  -3.983  1.00 0.00 ? 49  TYR A CD1  2  
ATOM 2392  C CD2  . TYR A 1 49  ? -1.277  -5.873  -1.679  1.00 0.00 ? 49  TYR A CD2  2  
ATOM 2393  C CE1  . TYR A 1 49  ? -1.887  -5.478  -4.340  1.00 0.00 ? 49  TYR A CE1  2  
ATOM 2394  C CE2  . TYR A 1 49  ? -2.366  -5.098  -2.027  1.00 0.00 ? 49  TYR A CE2  2  
ATOM 2395  C CZ   . TYR A 1 49  ? -2.667  -4.903  -3.359  1.00 0.00 ? 49  TYR A CZ   2  
ATOM 2396  O OH   . TYR A 1 49  ? -3.751  -4.132  -3.711  1.00 0.00 ? 49  TYR A OH   2  
ATOM 2397  H H    . TYR A 1 49  ? 2.643   -6.767  -4.138  1.00 0.00 ? 49  TYR A H    2  
ATOM 2398  H HA   . TYR A 1 49  ? 1.828   -5.630  -1.544  1.00 0.00 ? 49  TYR A HA   2  
ATOM 2399  H HB2  . TYR A 1 49  ? 0.839   -8.071  -3.017  1.00 0.00 ? 49  TYR A HB2  2  
ATOM 2400  H HB3  . TYR A 1 49  ? 0.494   -7.783  -1.316  1.00 0.00 ? 49  TYR A HB3  2  
ATOM 2401  H HD1  . TYR A 1 49  ? -0.187  -6.705  -4.749  1.00 0.00 ? 49  TYR A HD1  2  
ATOM 2402  H HD2  . TYR A 1 49  ? -1.039  -6.027  -0.636  1.00 0.00 ? 49  TYR A HD2  2  
ATOM 2403  H HE1  . TYR A 1 49  ? -2.122  -5.326  -5.383  1.00 0.00 ? 49  TYR A HE1  2  
ATOM 2404  H HE2  . TYR A 1 49  ? -2.977  -4.647  -1.259  1.00 0.00 ? 49  TYR A HE2  2  
ATOM 2405  H HH   . TYR A 1 49  ? -3.829  -4.109  -4.668  1.00 0.00 ? 49  TYR A HH   2  
ATOM 2406  N N    . GLU A 1 50  ? 3.229   -7.134  -0.125  1.00 0.00 ? 50  GLU A N    2  
ATOM 2407  C CA   . GLU A 1 50  ? 4.205   -7.874  0.666   1.00 0.00 ? 50  GLU A CA   2  
ATOM 2408  C C    . GLU A 1 50  ? 3.560   -9.086  1.332   1.00 0.00 ? 50  GLU A C    2  
ATOM 2409  O O    . GLU A 1 50  ? 2.560   -8.961  2.041   1.00 0.00 ? 50  GLU A O    2  
ATOM 2410  C CB   . GLU A 1 50  ? 4.827   -6.966  1.729   1.00 0.00 ? 50  GLU A CB   2  
ATOM 2411  C CG   . GLU A 1 50  ? 6.181   -7.445  2.223   1.00 0.00 ? 50  GLU A CG   2  
ATOM 2412  C CD   . GLU A 1 50  ? 6.795   -6.508  3.245   1.00 0.00 ? 50  GLU A CD   2  
ATOM 2413  O OE1  . GLU A 1 50  ? 6.161   -6.280  4.297   1.00 0.00 ? 50  GLU A OE1  2  
ATOM 2414  O OE2  . GLU A 1 50  ? 7.909   -6.004  2.993   1.00 0.00 ? 50  GLU A OE2  2  
ATOM 2415  H H    . GLU A 1 50  ? 2.676   -6.454  0.312   1.00 0.00 ? 50  GLU A H    2  
ATOM 2416  H HA   . GLU A 1 50  ? 4.982   -8.216  0.000   1.00 0.00 ? 50  GLU A HA   2  
ATOM 2417  H HB2  . GLU A 1 50  ? 4.947   -5.976  1.314   1.00 0.00 ? 50  GLU A HB2  2  
ATOM 2418  H HB3  . GLU A 1 50  ? 4.157   -6.912  2.575   1.00 0.00 ? 50  GLU A HB3  2  
ATOM 2419  H HG2  . GLU A 1 50  ? 6.061   -8.418  2.676   1.00 0.00 ? 50  GLU A HG2  2  
ATOM 2420  H HG3  . GLU A 1 50  ? 6.851   -7.523  1.380   1.00 0.00 ? 50  GLU A HG3  2  
ATOM 2421  N N    . LEU A 1 51  ? 4.137   -10.259 1.098   1.00 0.00 ? 51  LEU A N    2  
ATOM 2422  C CA   . LEU A 1 51  ? 3.619   -11.496 1.674   1.00 0.00 ? 51  LEU A CA   2  
ATOM 2423  C C    . LEU A 1 51  ? 4.595   -12.072 2.695   1.00 0.00 ? 51  LEU A C    2  
ATOM 2424  O O    . LEU A 1 51  ? 5.512   -12.815 2.342   1.00 0.00 ? 51  LEU A O    2  
ATOM 2425  C CB   . LEU A 1 51  ? 3.351   -12.522 0.572   1.00 0.00 ? 51  LEU A CB   2  
ATOM 2426  C CG   . LEU A 1 51  ? 3.102   -13.957 1.037   1.00 0.00 ? 51  LEU A CG   2  
ATOM 2427  C CD1  . LEU A 1 51  ? 1.895   -14.017 1.960   1.00 0.00 ? 51  LEU A CD1  2  
ATOM 2428  C CD2  . LEU A 1 51  ? 2.908   -14.879 -0.158  1.00 0.00 ? 51  LEU A CD2  2  
ATOM 2429  H H    . LEU A 1 51  ? 4.931   -10.297 0.525   1.00 0.00 ? 51  LEU A H    2  
ATOM 2430  H HA   . LEU A 1 51  ? 2.690   -11.265 2.173   1.00 0.00 ? 51  LEU A HA   2  
ATOM 2431  H HB2  . LEU A 1 51  ? 2.481   -12.197 0.022   1.00 0.00 ? 51  LEU A HB2  2  
ATOM 2432  H HB3  . LEU A 1 51  ? 4.209   -12.530 -0.087  1.00 0.00 ? 51  LEU A HB3  2  
ATOM 2433  H HG   . LEU A 1 51  ? 3.963   -14.304 1.591   1.00 0.00 ? 51  LEU A HG   2  
ATOM 2434  H HD11 . LEU A 1 51  ? 2.132   -13.530 2.894   1.00 0.00 ? 51  LEU A HD11 2  
ATOM 2435  H HD12 . LEU A 1 51  ? 1.637   -15.048 2.148   1.00 0.00 ? 51  LEU A HD12 2  
ATOM 2436  H HD13 . LEU A 1 51  ? 1.060   -13.516 1.494   1.00 0.00 ? 51  LEU A HD13 2  
ATOM 2437  H HD21 . LEU A 1 51  ? 2.074   -15.540 0.029   1.00 0.00 ? 51  LEU A HD21 2  
ATOM 2438  H HD22 . LEU A 1 51  ? 3.803   -15.464 -0.311  1.00 0.00 ? 51  LEU A HD22 2  
ATOM 2439  H HD23 . LEU A 1 51  ? 2.708   -14.288 -1.040  1.00 0.00 ? 51  LEU A HD23 2  
ATOM 2440  N N    . VAL A 1 52  ? 4.391   -11.726 3.962   1.00 0.00 ? 52  VAL A N    2  
ATOM 2441  C CA   . VAL A 1 52  ? 5.251   -12.212 5.035   1.00 0.00 ? 52  VAL A CA   2  
ATOM 2442  C C    . VAL A 1 52  ? 4.863   -13.625 5.453   1.00 0.00 ? 52  VAL A C    2  
ATOM 2443  O O    . VAL A 1 52  ? 3.911   -13.821 6.208   1.00 0.00 ? 52  VAL A O    2  
ATOM 2444  C CB   . VAL A 1 52  ? 5.188   -11.288 6.266   1.00 0.00 ? 52  VAL A CB   2  
ATOM 2445  C CG1  . VAL A 1 52  ? 6.010   -11.864 7.408   1.00 0.00 ? 52  VAL A CG1  2  
ATOM 2446  C CG2  . VAL A 1 52  ? 5.665   -9.889  5.907   1.00 0.00 ? 52  VAL A CG2  2  
ATOM 2447  H H    . VAL A 1 52  ? 3.644   -11.131 4.180   1.00 0.00 ? 52  VAL A H    2  
ATOM 2448  H HA   . VAL A 1 52  ? 6.268   -12.221 4.670   1.00 0.00 ? 52  VAL A HA   2  
ATOM 2449  H HB   . VAL A 1 52  ? 4.159   -11.223 6.589   1.00 0.00 ? 52  VAL A HB   2  
ATOM 2450  H HG11 . VAL A 1 52  ? 5.390   -11.953 8.288   1.00 0.00 ? 52  VAL A HG11 2  
ATOM 2451  H HG12 . VAL A 1 52  ? 6.382   -12.839 7.129   1.00 0.00 ? 52  VAL A HG12 2  
ATOM 2452  H HG13 . VAL A 1 52  ? 6.841   -11.208 7.620   1.00 0.00 ? 52  VAL A HG13 2  
ATOM 2453  H HG21 . VAL A 1 52  ? 6.599   -9.955  5.370   1.00 0.00 ? 52  VAL A HG21 2  
ATOM 2454  H HG22 . VAL A 1 52  ? 4.926   -9.404  5.285   1.00 0.00 ? 52  VAL A HG22 2  
ATOM 2455  H HG23 . VAL A 1 52  ? 5.807   -9.314  6.810   1.00 0.00 ? 52  VAL A HG23 2  
ATOM 2456  N N    . TYR A 1 53  ? 5.607   -14.608 4.957   1.00 0.00 ? 53  TYR A N    2  
ATOM 2457  C CA   . TYR A 1 53  ? 5.340   -16.005 5.278   1.00 0.00 ? 53  TYR A CA   2  
ATOM 2458  C C    . TYR A 1 53  ? 6.559   -16.659 5.922   1.00 0.00 ? 53  TYR A C    2  
ATOM 2459  O O    . TYR A 1 53  ? 7.698   -16.282 5.648   1.00 0.00 ? 53  TYR A O    2  
ATOM 2460  C CB   . TYR A 1 53  ? 4.944   -16.773 4.015   1.00 0.00 ? 53  TYR A CB   2  
ATOM 2461  C CG   . TYR A 1 53  ? 6.123   -17.330 3.250   1.00 0.00 ? 53  TYR A CG   2  
ATOM 2462  C CD1  . TYR A 1 53  ? 6.793   -16.559 2.309   1.00 0.00 ? 53  TYR A CD1  2  
ATOM 2463  C CD2  . TYR A 1 53  ? 6.567   -18.629 3.470   1.00 0.00 ? 53  TYR A CD2  2  
ATOM 2464  C CE1  . TYR A 1 53  ? 7.870   -17.065 1.607   1.00 0.00 ? 53  TYR A CE1  2  
ATOM 2465  C CE2  . TYR A 1 53  ? 7.644   -19.142 2.774   1.00 0.00 ? 53  TYR A CE2  2  
ATOM 2466  C CZ   . TYR A 1 53  ? 8.292   -18.357 1.844   1.00 0.00 ? 53  TYR A CZ   2  
ATOM 2467  O OH   . TYR A 1 53  ? 9.365   -18.864 1.148   1.00 0.00 ? 53  TYR A OH   2  
ATOM 2468  H H    . TYR A 1 53  ? 6.353   -14.389 4.360   1.00 0.00 ? 53  TYR A H    2  
ATOM 2469  H HA   . TYR A 1 53  ? 4.518   -16.034 5.978   1.00 0.00 ? 53  TYR A HA   2  
ATOM 2470  H HB2  . TYR A 1 53  ? 4.307   -17.599 4.290   1.00 0.00 ? 53  TYR A HB2  2  
ATOM 2471  H HB3  . TYR A 1 53  ? 4.402   -16.111 3.355   1.00 0.00 ? 53  TYR A HB3  2  
ATOM 2472  H HD1  . TYR A 1 53  ? 6.460   -15.548 2.127   1.00 0.00 ? 53  TYR A HD1  2  
ATOM 2473  H HD2  . TYR A 1 53  ? 6.057   -19.242 4.199   1.00 0.00 ? 53  TYR A HD2  2  
ATOM 2474  H HE1  . TYR A 1 53  ? 8.378   -16.450 0.879   1.00 0.00 ? 53  TYR A HE1  2  
ATOM 2475  H HE2  . TYR A 1 53  ? 7.975   -20.154 2.958   1.00 0.00 ? 53  TYR A HE2  2  
ATOM 2476  H HH   . TYR A 1 53  ? 9.960   -18.148 0.910   1.00 0.00 ? 53  TYR A HH   2  
ATOM 2477  N N    . LYS A 1 54  ? 6.310   -17.641 6.781   1.00 0.00 ? 54  LYS A N    2  
ATOM 2478  C CA   . LYS A 1 54  ? 7.384   -18.350 7.465   1.00 0.00 ? 54  LYS A CA   2  
ATOM 2479  C C    . LYS A 1 54  ? 7.005   -19.808 7.710   1.00 0.00 ? 54  LYS A C    2  
ATOM 2480  O O    . LYS A 1 54  ? 5.829   -20.133 7.877   1.00 0.00 ? 54  LYS A O    2  
ATOM 2481  C CB   . LYS A 1 54  ? 7.708   -17.667 8.796   1.00 0.00 ? 54  LYS A CB   2  
ATOM 2482  C CG   . LYS A 1 54  ? 6.510   -17.532 9.719   1.00 0.00 ? 54  LYS A CG   2  
ATOM 2483  C CD   . LYS A 1 54  ? 6.695   -16.398 10.713  1.00 0.00 ? 54  LYS A CD   2  
ATOM 2484  C CE   . LYS A 1 54  ? 5.663   -16.459 11.828  1.00 0.00 ? 54  LYS A CE   2  
ATOM 2485  N NZ   . LYS A 1 54  ? 5.995   -15.531 12.943  1.00 0.00 ? 54  LYS A NZ   2  
ATOM 2486  H H    . LYS A 1 54  ? 5.379   -17.896 6.959   1.00 0.00 ? 54  LYS A H    2  
ATOM 2487  H HA   . LYS A 1 54  ? 8.258   -18.320 6.832   1.00 0.00 ? 54  LYS A HA   2  
ATOM 2488  H HB2  . LYS A 1 54  ? 8.467   -18.242 9.306   1.00 0.00 ? 54  LYS A HB2  2  
ATOM 2489  H HB3  . LYS A 1 54  ? 8.093   -16.678 8.594   1.00 0.00 ? 54  LYS A HB3  2  
ATOM 2490  H HG2  . LYS A 1 54  ? 5.630   -17.335 9.125   1.00 0.00 ? 54  LYS A HG2  2  
ATOM 2491  H HG3  . LYS A 1 54  ? 6.379   -18.458 10.262  1.00 0.00 ? 54  LYS A HG3  2  
ATOM 2492  H HD2  . LYS A 1 54  ? 7.682   -16.470 11.147  1.00 0.00 ? 54  LYS A HD2  2  
ATOM 2493  H HD3  . LYS A 1 54  ? 6.596   -15.456 10.193  1.00 0.00 ? 54  LYS A HD3  2  
ATOM 2494  H HE2  . LYS A 1 54  ? 4.699   -16.192 11.423  1.00 0.00 ? 54  LYS A HE2  2  
ATOM 2495  H HE3  . LYS A 1 54  ? 5.625   -17.469 12.210  1.00 0.00 ? 54  LYS A HE3  2  
ATOM 2496  H HZ1  . LYS A 1 54  ? 6.969   -15.182 12.839  1.00 0.00 ? 54  LYS A HZ1  2  
ATOM 2497  H HZ2  . LYS A 1 54  ? 5.911   -16.023 13.855  1.00 0.00 ? 54  LYS A HZ2  2  
ATOM 2498  H HZ3  . LYS A 1 54  ? 5.345   -14.719 12.938  1.00 0.00 ? 54  LYS A HZ3  2  
ATOM 2499  N N    . ASP A 1 55  ? 8.007   -20.680 7.730   1.00 0.00 ? 55  ASP A N    2  
ATOM 2500  C CA   . ASP A 1 55  ? 7.778   -22.102 7.957   1.00 0.00 ? 55  ASP A CA   2  
ATOM 2501  C C    . ASP A 1 55  ? 7.332   -22.358 9.393   1.00 0.00 ? 55  ASP A C    2  
ATOM 2502  O O    . ASP A 1 55  ? 8.141   -22.333 10.319  1.00 0.00 ? 55  ASP A O    2  
ATOM 2503  C CB   . ASP A 1 55  ? 9.048   -22.899 7.654   1.00 0.00 ? 55  ASP A CB   2  
ATOM 2504  C CG   . ASP A 1 55  ? 9.129   -24.185 8.453   1.00 0.00 ? 55  ASP A CG   2  
ATOM 2505  O OD1  . ASP A 1 55  ? 8.138   -24.945 8.456   1.00 0.00 ? 55  ASP A OD1  2  
ATOM 2506  O OD2  . ASP A 1 55  ? 10.183  -24.431 9.075   1.00 0.00 ? 55  ASP A OD2  2  
ATOM 2507  H H    . ASP A 1 55  ? 8.922   -20.359 7.590   1.00 0.00 ? 55  ASP A H    2  
ATOM 2508  H HA   . ASP A 1 55  ? 6.995   -22.423 7.287   1.00 0.00 ? 55  ASP A HA   2  
ATOM 2509  H HB2  . ASP A 1 55  ? 9.066   -23.149 6.603   1.00 0.00 ? 55  ASP A HB2  2  
ATOM 2510  H HB3  . ASP A 1 55  ? 9.910   -22.293 7.891   1.00 0.00 ? 55  ASP A HB3  2  
ATOM 2511  N N    . GLY A 1 56  ? 6.037   -22.605 9.570   1.00 0.00 ? 56  GLY A N    2  
ATOM 2512  C CA   . GLY A 1 56  ? 5.505   -22.861 10.896  1.00 0.00 ? 56  GLY A CA   2  
ATOM 2513  C C    . GLY A 1 56  ? 5.629   -21.660 11.812  1.00 0.00 ? 56  GLY A C    2  
ATOM 2514  O O    . GLY A 1 56  ? 5.799   -20.533 11.348  1.00 0.00 ? 56  GLY A O    2  
ATOM 2515  H H    . GLY A 1 56  ? 5.438   -22.612 8.794   1.00 0.00 ? 56  GLY A H    2  
ATOM 2516  H HA2  . GLY A 1 56  ? 4.463   -23.128 10.808  1.00 0.00 ? 56  GLY A HA2  2  
ATOM 2517  H HA3  . GLY A 1 56  ? 6.044   -23.689 11.333  1.00 0.00 ? 56  GLY A HA3  2  
ATOM 2518  N N    . GLU A 1 57  ? 5.541   -21.901 13.117  1.00 0.00 ? 57  GLU A N    2  
ATOM 2519  C CA   . GLU A 1 57  ? 5.641   -20.828 14.099  1.00 0.00 ? 57  GLU A CA   2  
ATOM 2520  C C    . GLU A 1 57  ? 7.085   -20.357 14.244  1.00 0.00 ? 57  GLU A C    2  
ATOM 2521  O O    . GLU A 1 57  ? 7.361   -19.156 14.251  1.00 0.00 ? 57  GLU A O    2  
ATOM 2522  C CB   . GLU A 1 57  ? 5.107   -21.297 15.455  1.00 0.00 ? 57  GLU A CB   2  
ATOM 2523  C CG   . GLU A 1 57  ? 5.845   -22.501 16.016  1.00 0.00 ? 57  GLU A CG   2  
ATOM 2524  C CD   . GLU A 1 57  ? 4.996   -23.306 16.981  1.00 0.00 ? 57  GLU A CD   2  
ATOM 2525  O OE1  . GLU A 1 57  ? 3.804   -23.525 16.682  1.00 0.00 ? 57  GLU A OE1  2  
ATOM 2526  O OE2  . GLU A 1 57  ? 5.525   -23.718 18.035  1.00 0.00 ? 57  GLU A OE2  2  
ATOM 2527  H H    . GLU A 1 57  ? 5.405   -22.821 13.425  1.00 0.00 ? 57  GLU A H    2  
ATOM 2528  H HA   . GLU A 1 57  ? 5.039   -20.002 13.752  1.00 0.00 ? 57  GLU A HA   2  
ATOM 2529  H HB2  . GLU A 1 57  ? 5.194   -20.485 16.162  1.00 0.00 ? 57  GLU A HB2  2  
ATOM 2530  H HB3  . GLU A 1 57  ? 4.065   -21.558 15.346  1.00 0.00 ? 57  GLU A HB3  2  
ATOM 2531  H HG2  . GLU A 1 57  ? 6.137   -23.141 15.197  1.00 0.00 ? 57  GLU A HG2  2  
ATOM 2532  H HG3  . GLU A 1 57  ? 6.727   -22.157 16.535  1.00 0.00 ? 57  GLU A HG3  2  
ATOM 2533  N N    . HIS A 1 58  ? 8.004   -21.310 14.362  1.00 0.00 ? 58  HIS A N    2  
ATOM 2534  C CA   . HIS A 1 58  ? 9.420   -20.994 14.507  1.00 0.00 ? 58  HIS A CA   2  
ATOM 2535  C C    . HIS A 1 58  ? 10.098  -20.897 13.143  1.00 0.00 ? 58  HIS A C    2  
ATOM 2536  O O    . HIS A 1 58  ? 11.266  -21.252 12.993  1.00 0.00 ? 58  HIS A O    2  
ATOM 2537  C CB   . HIS A 1 58  ? 10.117  -22.054 15.361  1.00 0.00 ? 58  HIS A CB   2  
ATOM 2538  C CG   . HIS A 1 58  ? 9.476   -22.260 16.699  1.00 0.00 ? 58  HIS A CG   2  
ATOM 2539  N ND1  . HIS A 1 58  ? 9.547   -23.450 17.392  1.00 0.00 ? 58  HIS A ND1  2  
ATOM 2540  C CD2  . HIS A 1 58  ? 8.752   -21.418 17.473  1.00 0.00 ? 58  HIS A CD2  2  
ATOM 2541  C CE1  . HIS A 1 58  ? 8.892   -23.332 18.533  1.00 0.00 ? 58  HIS A CE1  2  
ATOM 2542  N NE2  . HIS A 1 58  ? 8.401   -22.108 18.607  1.00 0.00 ? 58  HIS A NE2  2  
ATOM 2543  H H    . HIS A 1 58  ? 7.723   -22.249 14.350  1.00 0.00 ? 58  HIS A H    2  
ATOM 2544  H HA   . HIS A 1 58  ? 9.497   -20.038 15.002  1.00 0.00 ? 58  HIS A HA   2  
ATOM 2545  H HB2  . HIS A 1 58  ? 10.099  -22.998 14.837  1.00 0.00 ? 58  HIS A HB2  2  
ATOM 2546  H HB3  . HIS A 1 58  ? 11.143  -21.758 15.525  1.00 0.00 ? 58  HIS A HB3  2  
ATOM 2547  H HD1  . HIS A 1 58  ? 10.006  -24.261 17.091  1.00 0.00 ? 58  HIS A HD1  2  
ATOM 2548  H HD2  . HIS A 1 58  ? 8.497   -20.393 17.243  1.00 0.00 ? 58  HIS A HD2  2  
ATOM 2549  H HE1  . HIS A 1 58  ? 8.777   -24.104 19.279  1.00 0.00 ? 58  HIS A HE1  2  
ATOM 2550  H HE2  . HIS A 1 58  ? 7.801   -21.783 19.310  1.00 0.00 ? 58  HIS A HE2  2  
ATOM 2551  N N    . GLY A 1 59  ? 9.355   -20.414 12.152  1.00 0.00 ? 59  GLY A N    2  
ATOM 2552  C CA   . GLY A 1 59  ? 9.901   -20.280 10.814  1.00 0.00 ? 59  GLY A CA   2  
ATOM 2553  C C    . GLY A 1 59  ? 10.622  -18.962 10.611  1.00 0.00 ? 59  GLY A C    2  
ATOM 2554  O O    . GLY A 1 59  ? 10.926  -18.260 11.574  1.00 0.00 ? 59  GLY A O    2  
ATOM 2555  H H    . GLY A 1 59  ? 8.429   -20.147 12.330  1.00 0.00 ? 59  GLY A H    2  
ATOM 2556  H HA2  . GLY A 1 59  ? 10.595  -21.088 10.637  1.00 0.00 ? 59  GLY A HA2  2  
ATOM 2557  H HA3  . GLY A 1 59  ? 9.094   -20.349 10.099  1.00 0.00 ? 59  GLY A HA3  2  
ATOM 2558  N N    . GLU A 1 60  ? 10.896  -18.627 9.354   1.00 0.00 ? 60  GLU A N    2  
ATOM 2559  C CA   . GLU A 1 60  ? 11.588  -17.385 9.029   1.00 0.00 ? 60  GLU A CA   2  
ATOM 2560  C C    . GLU A 1 60  ? 10.681  -16.447 8.238   1.00 0.00 ? 60  GLU A C    2  
ATOM 2561  O O    . GLU A 1 60  ? 10.139  -16.822 7.199   1.00 0.00 ? 60  GLU A O    2  
ATOM 2562  C CB   . GLU A 1 60  ? 12.859  -17.678 8.228   1.00 0.00 ? 60  GLU A CB   2  
ATOM 2563  C CG   . GLU A 1 60  ? 13.964  -18.317 9.053   1.00 0.00 ? 60  GLU A CG   2  
ATOM 2564  C CD   . GLU A 1 60  ? 15.125  -18.793 8.202   1.00 0.00 ? 60  GLU A CD   2  
ATOM 2565  O OE1  . GLU A 1 60  ? 15.050  -19.922 7.673   1.00 0.00 ? 60  GLU A OE1  2  
ATOM 2566  O OE2  . GLU A 1 60  ? 16.109  -18.036 8.065   1.00 0.00 ? 60  GLU A OE2  2  
ATOM 2567  H H    . GLU A 1 60  ? 10.628  -19.228 8.629   1.00 0.00 ? 60  GLU A H    2  
ATOM 2568  H HA   . GLU A 1 60  ? 11.861  -16.905 9.957   1.00 0.00 ? 60  GLU A HA   2  
ATOM 2569  H HB2  . GLU A 1 60  ? 12.612  -18.344 7.415   1.00 0.00 ? 60  GLU A HB2  2  
ATOM 2570  H HB3  . GLU A 1 60  ? 13.234  -16.751 7.820   1.00 0.00 ? 60  GLU A HB3  2  
ATOM 2571  H HG2  . GLU A 1 60  ? 14.332  -17.591 9.762   1.00 0.00 ? 60  GLU A HG2  2  
ATOM 2572  H HG3  . GLU A 1 60  ? 13.555  -19.163 9.584   1.00 0.00 ? 60  GLU A HG3  2  
ATOM 2573  N N    . GLU A 1 61  ? 10.520  -15.226 8.740   1.00 0.00 ? 61  GLU A N    2  
ATOM 2574  C CA   . GLU A 1 61  ? 9.677   -14.236 8.081   1.00 0.00 ? 61  GLU A CA   2  
ATOM 2575  C C    . GLU A 1 61  ? 10.313  -13.760 6.778   1.00 0.00 ? 61  GLU A C    2  
ATOM 2576  O O    . GLU A 1 61  ? 11.322  -13.056 6.790   1.00 0.00 ? 61  GLU A O    2  
ATOM 2577  C CB   . GLU A 1 61  ? 9.434   -13.043 9.008   1.00 0.00 ? 61  GLU A CB   2  
ATOM 2578  C CG   . GLU A 1 61  ? 8.374   -13.300 10.066  1.00 0.00 ? 61  GLU A CG   2  
ATOM 2579  C CD   . GLU A 1 61  ? 8.404   -12.275 11.183  1.00 0.00 ? 61  GLU A CD   2  
ATOM 2580  O OE1  . GLU A 1 61  ? 9.321   -12.347 12.028  1.00 0.00 ? 61  GLU A OE1  2  
ATOM 2581  O OE2  . GLU A 1 61  ? 7.511   -11.403 11.213  1.00 0.00 ? 61  GLU A OE2  2  
ATOM 2582  H H    . GLU A 1 61  ? 10.979  -14.987 9.572   1.00 0.00 ? 61  GLU A H    2  
ATOM 2583  H HA   . GLU A 1 61  ? 8.730   -14.703 7.856   1.00 0.00 ? 61  GLU A HA   2  
ATOM 2584  H HB2  . GLU A 1 61  ? 10.359  -12.796 9.508   1.00 0.00 ? 61  GLU A HB2  2  
ATOM 2585  H HB3  . GLU A 1 61  ? 9.121   -12.198 8.413   1.00 0.00 ? 61  GLU A HB3  2  
ATOM 2586  H HG2  . GLU A 1 61  ? 7.401   -13.270 9.597   1.00 0.00 ? 61  GLU A HG2  2  
ATOM 2587  H HG3  . GLU A 1 61  ? 8.537   -14.279 10.490  1.00 0.00 ? 61  GLU A HG3  2  
ATOM 2588  N N    . GLN A 1 62  ? 9.715   -14.150 5.657   1.00 0.00 ? 62  GLN A N    2  
ATOM 2589  C CA   . GLN A 1 62  ? 10.224  -13.765 4.346   1.00 0.00 ? 62  GLN A CA   2  
ATOM 2590  C C    . GLN A 1 62  ? 9.169   -12.997 3.557   1.00 0.00 ? 62  GLN A C    2  
ATOM 2591  O O    . GLN A 1 62  ? 7.971   -13.239 3.705   1.00 0.00 ? 62  GLN A O    2  
ATOM 2592  C CB   . GLN A 1 62  ? 10.663  -15.003 3.562   1.00 0.00 ? 62  GLN A CB   2  
ATOM 2593  C CG   . GLN A 1 62  ? 11.763  -15.798 4.247   1.00 0.00 ? 62  GLN A CG   2  
ATOM 2594  C CD   . GLN A 1 62  ? 13.101  -15.086 4.221   1.00 0.00 ? 62  GLN A CD   2  
ATOM 2595  O OE1  . GLN A 1 62  ? 13.575  -14.670 3.163   1.00 0.00 ? 62  GLN A OE1  2  
ATOM 2596  N NE2  . GLN A 1 62  ? 13.718  -14.941 5.388   1.00 0.00 ? 62  GLN A NE2  2  
ATOM 2597  H H    . GLN A 1 62  ? 8.914   -14.711 5.713   1.00 0.00 ? 62  GLN A H    2  
ATOM 2598  H HA   . GLN A 1 62  ? 11.079  -13.124 4.498   1.00 0.00 ? 62  GLN A HA   2  
ATOM 2599  H HB2  . GLN A 1 62  ? 9.810   -15.651 3.428   1.00 0.00 ? 62  GLN A HB2  2  
ATOM 2600  H HB3  . GLN A 1 62  ? 11.025  -14.691 2.594   1.00 0.00 ? 62  GLN A HB3  2  
ATOM 2601  H HG2  . GLN A 1 62  ? 11.482  -15.965 5.277   1.00 0.00 ? 62  GLN A HG2  2  
ATOM 2602  H HG3  . GLN A 1 62  ? 11.867  -16.749 3.746   1.00 0.00 ? 62  GLN A HG3  2  
ATOM 2603  H HE21 . GLN A 1 62  ? 13.281  -15.299 6.189   1.00 0.00 ? 62  GLN A HE21 2  
ATOM 2604  H HE22 . GLN A 1 62  ? 14.585  -14.486 5.400   1.00 0.00 ? 62  GLN A HE22 2  
ATOM 2605  N N    . ARG A 1 63  ? 9.622   -12.070 2.719   1.00 0.00 ? 63  ARG A N    2  
ATOM 2606  C CA   . ARG A 1 63  ? 8.717   -11.266 1.908   1.00 0.00 ? 63  ARG A CA   2  
ATOM 2607  C C    . ARG A 1 63  ? 8.823   -11.647 0.434   1.00 0.00 ? 63  ARG A C    2  
ATOM 2608  O O    . ARG A 1 63  ? 9.921   -11.832 -0.092  1.00 0.00 ? 63  ARG A O    2  
ATOM 2609  C CB   . ARG A 1 63  ? 9.026   -9.778  2.084   1.00 0.00 ? 63  ARG A CB   2  
ATOM 2610  C CG   . ARG A 1 63  ? 8.832   -9.280  3.507   1.00 0.00 ? 63  ARG A CG   2  
ATOM 2611  C CD   . ARG A 1 63  ? 10.102  -9.432  4.328   1.00 0.00 ? 63  ARG A CD   2  
ATOM 2612  N NE   . ARG A 1 63  ? 10.987  -8.279  4.187   1.00 0.00 ? 63  ARG A NE   2  
ATOM 2613  C CZ   . ARG A 1 63  ? 10.690  -7.065  4.638   1.00 0.00 ? 63  ARG A CZ   2  
ATOM 2614  N NH1  . ARG A 1 63  ? 9.538   -6.848  5.257   1.00 0.00 ? 63  ARG A NH1  2  
ATOM 2615  N NH2  . ARG A 1 63  ? 11.547  -6.066  4.471   1.00 0.00 ? 63  ARG A NH2  2  
ATOM 2616  H H    . ARG A 1 63  ? 10.588  -11.924 2.645   1.00 0.00 ? 63  ARG A H    2  
ATOM 2617  H HA   . ARG A 1 63  ? 7.709   -11.457 2.245   1.00 0.00 ? 63  ARG A HA   2  
ATOM 2618  H HB2  . ARG A 1 63  ? 10.053  -9.599  1.801   1.00 0.00 ? 63  ARG A HB2  2  
ATOM 2619  H HB3  . ARG A 1 63  ? 8.377   -9.209  1.435   1.00 0.00 ? 63  ARG A HB3  2  
ATOM 2620  H HG2  . ARG A 1 63  ? 8.558   -8.236  3.479   1.00 0.00 ? 63  ARG A HG2  2  
ATOM 2621  H HG3  . ARG A 1 63  ? 8.042   -9.849  3.973   1.00 0.00 ? 63  ARG A HG3  2  
ATOM 2622  H HD2  . ARG A 1 63  ? 9.832   -9.541  5.368   1.00 0.00 ? 63  ARG A HD2  2  
ATOM 2623  H HD3  . ARG A 1 63  ? 10.625  -10.318 3.998   1.00 0.00 ? 63  ARG A HD3  2  
ATOM 2624  H HE   . ARG A 1 63  ? 11.844  -8.417  3.733   1.00 0.00 ? 63  ARG A HE   2  
ATOM 2625  H HH11 . ARG A 1 63  ? 8.891   -7.599  5.385   1.00 0.00 ? 63  ARG A HH11 2  
ATOM 2626  H HH12 . ARG A 1 63  ? 9.318   -5.933  5.596   1.00 0.00 ? 63  ARG A HH12 2  
ATOM 2627  H HH21 . ARG A 1 63  ? 12.417  -6.226  4.005   1.00 0.00 ? 63  ARG A HH21 2  
ATOM 2628  H HH22 . ARG A 1 63  ? 11.323  -5.153  4.811   1.00 0.00 ? 63  ARG A HH22 2  
ATOM 2629  N N    . ILE A 1 64  ? 7.675   -11.764 -0.226  1.00 0.00 ? 64  ILE A N    2  
ATOM 2630  C CA   . ILE A 1 64  ? 7.640   -12.122 -1.638  1.00 0.00 ? 64  ILE A CA   2  
ATOM 2631  C C    . ILE A 1 64  ? 7.146   -10.957 -2.489  1.00 0.00 ? 64  ILE A C    2  
ATOM 2632  O O    . ILE A 1 64  ? 6.221   -10.240 -2.104  1.00 0.00 ? 64  ILE A O    2  
ATOM 2633  C CB   . ILE A 1 64  ? 6.735   -13.344 -1.886  1.00 0.00 ? 64  ILE A CB   2  
ATOM 2634  C CG1  . ILE A 1 64  ? 7.166   -14.514 -0.999  1.00 0.00 ? 64  ILE A CG1  2  
ATOM 2635  C CG2  . ILE A 1 64  ? 6.774   -13.743 -3.354  1.00 0.00 ? 64  ILE A CG2  2  
ATOM 2636  C CD1  . ILE A 1 64  ? 6.452   -15.809 -1.318  1.00 0.00 ? 64  ILE A CD1  2  
ATOM 2637  H H    . ILE A 1 64  ? 6.833   -11.604 0.249   1.00 0.00 ? 64  ILE A H    2  
ATOM 2638  H HA   . ILE A 1 64  ? 8.645   -12.376 -1.942  1.00 0.00 ? 64  ILE A HA   2  
ATOM 2639  H HB   . ILE A 1 64  ? 5.721   -13.069 -1.639  1.00 0.00 ? 64  ILE A HB   2  
ATOM 2640  H HG12 . ILE A 1 64  ? 8.224   -14.680 -1.122  1.00 0.00 ? 64  ILE A HG12 2  
ATOM 2641  H HG13 . ILE A 1 64  ? 6.962   -14.267 0.033   1.00 0.00 ? 64  ILE A HG13 2  
ATOM 2642  H HG21 . ILE A 1 64  ? 5.799   -13.592 -3.793  1.00 0.00 ? 64  ILE A HG21 2  
ATOM 2643  H HG22 . ILE A 1 64  ? 7.499   -13.134 -3.872  1.00 0.00 ? 64  ILE A HG22 2  
ATOM 2644  H HG23 . ILE A 1 64  ? 7.050   -14.783 -3.437  1.00 0.00 ? 64  ILE A HG23 2  
ATOM 2645  H HD11 . ILE A 1 64  ? 7.172   -16.548 -1.638  1.00 0.00 ? 64  ILE A HD11 2  
ATOM 2646  H HD12 . ILE A 1 64  ? 5.938   -16.163 -0.438  1.00 0.00 ? 64  ILE A HD12 2  
ATOM 2647  H HD13 . ILE A 1 64  ? 5.736   -15.639 -2.109  1.00 0.00 ? 64  ILE A HD13 2  
ATOM 2648  N N    . THR A 1 65  ? 7.768   -10.774 -3.650  1.00 0.00 ? 65  THR A N    2  
ATOM 2649  C CA   . THR A 1 65  ? 7.392   -9.696  -4.556  1.00 0.00 ? 65  THR A CA   2  
ATOM 2650  C C    . THR A 1 65  ? 6.151   -10.064 -5.362  1.00 0.00 ? 65  THR A C    2  
ATOM 2651  O O    . THR A 1 65  ? 6.246   -10.706 -6.408  1.00 0.00 ? 65  THR A O    2  
ATOM 2652  C CB   . THR A 1 65  ? 8.538   -9.354  -5.527  1.00 0.00 ? 65  THR A CB   2  
ATOM 2653  O OG1  . THR A 1 65  ? 9.753   -9.150  -4.798  1.00 0.00 ? 65  THR A OG1  2  
ATOM 2654  C CG2  . THR A 1 65  ? 8.209   -8.107  -6.334  1.00 0.00 ? 65  THR A CG2  2  
ATOM 2655  H H    . THR A 1 65  ? 8.497   -11.378 -3.900  1.00 0.00 ? 65  THR A H    2  
ATOM 2656  H HA   . THR A 1 65  ? 7.177   -8.820  -3.962  1.00 0.00 ? 65  THR A HA   2  
ATOM 2657  H HB   . THR A 1 65  ? 8.670   -10.181 -6.209  1.00 0.00 ? 65  THR A HB   2  
ATOM 2658  H HG1  . THR A 1 65  ? 9.786   -9.756  -4.054  1.00 0.00 ? 65  THR A HG1  2  
ATOM 2659  H HG21 . THR A 1 65  ? 7.926   -7.308  -5.663  1.00 0.00 ? 65  THR A HG21 2  
ATOM 2660  H HG22 . THR A 1 65  ? 7.391   -8.319  -7.006  1.00 0.00 ? 65  THR A HG22 2  
ATOM 2661  H HG23 . THR A 1 65  ? 9.076   -7.808  -6.903  1.00 0.00 ? 65  THR A HG23 2  
ATOM 2662  N N    . ILE A 1 66  ? 4.988   -9.651  -4.869  1.00 0.00 ? 66  ILE A N    2  
ATOM 2663  C CA   . ILE A 1 66  ? 3.728   -9.936  -5.545  1.00 0.00 ? 66  ILE A CA   2  
ATOM 2664  C C    . ILE A 1 66  ? 3.295   -8.762  -6.416  1.00 0.00 ? 66  ILE A C    2  
ATOM 2665  O O    . ILE A 1 66  ? 3.457   -7.602  -6.037  1.00 0.00 ? 66  ILE A O    2  
ATOM 2666  C CB   . ILE A 1 66  ? 2.608   -10.254 -4.537  1.00 0.00 ? 66  ILE A CB   2  
ATOM 2667  C CG1  . ILE A 1 66  ? 3.186   -10.947 -3.301  1.00 0.00 ? 66  ILE A CG1  2  
ATOM 2668  C CG2  . ILE A 1 66  ? 1.542   -11.122 -5.188  1.00 0.00 ? 66  ILE A CG2  2  
ATOM 2669  C CD1  . ILE A 1 66  ? 2.143   -11.295 -2.262  1.00 0.00 ? 66  ILE A CD1  2  
ATOM 2670  H H    . ILE A 1 66  ? 4.977   -9.143  -4.031  1.00 0.00 ? 66  ILE A H    2  
ATOM 2671  H HA   . ILE A 1 66  ? 3.876   -10.802 -6.174  1.00 0.00 ? 66  ILE A HA   2  
ATOM 2672  H HB   . ILE A 1 66  ? 2.148   -9.325  -4.239  1.00 0.00 ? 66  ILE A HB   2  
ATOM 2673  H HG12 . ILE A 1 66  ? 3.671   -11.861 -3.603  1.00 0.00 ? 66  ILE A HG12 2  
ATOM 2674  H HG13 . ILE A 1 66  ? 3.912   -10.294 -2.839  1.00 0.00 ? 66  ILE A HG13 2  
ATOM 2675  H HG21 . ILE A 1 66  ? 1.664   -12.146 -4.864  1.00 0.00 ? 66  ILE A HG21 2  
ATOM 2676  H HG22 . ILE A 1 66  ? 0.564   -10.769 -4.898  1.00 0.00 ? 66  ILE A HG22 2  
ATOM 2677  H HG23 . ILE A 1 66  ? 1.640   -11.070 -6.262  1.00 0.00 ? 66  ILE A HG23 2  
ATOM 2678  H HD11 . ILE A 1 66  ? 2.318   -10.715 -1.368  1.00 0.00 ? 66  ILE A HD11 2  
ATOM 2679  H HD12 . ILE A 1 66  ? 1.160   -11.075 -2.649  1.00 0.00 ? 66  ILE A HD12 2  
ATOM 2680  H HD13 . ILE A 1 66  ? 2.209   -12.347 -2.025  1.00 0.00 ? 66  ILE A HD13 2  
ATOM 2681  N N    . GLU A 1 67  ? 2.741   -9.072  -7.584  1.00 0.00 ? 67  GLU A N    2  
ATOM 2682  C CA   . GLU A 1 67  ? 2.283   -8.041  -8.509  1.00 0.00 ? 67  GLU A CA   2  
ATOM 2683  C C    . GLU A 1 67  ? 1.068   -7.308  -7.948  1.00 0.00 ? 67  GLU A C    2  
ATOM 2684  O O    . GLU A 1 67  ? 0.215   -7.891  -7.278  1.00 0.00 ? 67  GLU A O    2  
ATOM 2685  C CB   . GLU A 1 67  ? 1.939   -8.659  -9.866  1.00 0.00 ? 67  GLU A CB   2  
ATOM 2686  C CG   . GLU A 1 67  ? 0.669   -9.494  -9.850  1.00 0.00 ? 67  GLU A CG   2  
ATOM 2687  C CD   . GLU A 1 67  ? 0.361   -10.114 -11.199 1.00 0.00 ? 67  GLU A CD   2  
ATOM 2688  O OE1  . GLU A 1 67  ? -0.107  -9.382  -12.096 1.00 0.00 ? 67  GLU A OE1  2  
ATOM 2689  O OE2  . GLU A 1 67  ? 0.590   -11.331 -11.358 1.00 0.00 ? 67  GLU A OE2  2  
ATOM 2690  H H    . GLU A 1 67  ? 2.639   -10.015 -7.831  1.00 0.00 ? 67  GLU A H    2  
ATOM 2691  H HA   . GLU A 1 67  ? 3.087   -7.333  -8.641  1.00 0.00 ? 67  GLU A HA   2  
ATOM 2692  H HB2  . GLU A 1 67  ? 1.815   -7.866  -10.588 1.00 0.00 ? 67  GLU A HB2  2  
ATOM 2693  H HB3  . GLU A 1 67  ? 2.756   -9.292  -10.177 1.00 0.00 ? 67  GLU A HB3  2  
ATOM 2694  H HG2  . GLU A 1 67  ? 0.783   -10.285 -9.125  1.00 0.00 ? 67  GLU A HG2  2  
ATOM 2695  H HG3  . GLU A 1 67  ? -0.159  -8.861  -9.564  1.00 0.00 ? 67  GLU A HG3  2  
ATOM 2696  N N    . PRO A 1 68  ? 0.986   -5.999  -8.228  1.00 0.00 ? 68  PRO A N    2  
ATOM 2697  C CA   . PRO A 1 68  ? -0.120  -5.158  -7.762  1.00 0.00 ? 68  PRO A CA   2  
ATOM 2698  C C    . PRO A 1 68  ? -1.435  -5.489  -8.459  1.00 0.00 ? 68  PRO A C    2  
ATOM 2699  O O    . PRO A 1 68  ? -1.817  -4.835  -9.428  1.00 0.00 ? 68  PRO A O    2  
ATOM 2700  C CB   . PRO A 1 68  ? 0.335   -3.742  -8.124  1.00 0.00 ? 68  PRO A CB   2  
ATOM 2701  C CG   . PRO A 1 68  ? 1.276   -3.926  -9.263  1.00 0.00 ? 68  PRO A CG   2  
ATOM 2702  C CD   . PRO A 1 68  ? 1.966   -5.240  -9.022  1.00 0.00 ? 68  PRO A CD   2  
ATOM 2703  H HA   . PRO A 1 68  ? -0.252  -5.233  -6.692  1.00 0.00 ? 68  PRO A HA   2  
ATOM 2704  H HB2  . PRO A 1 68  ? -0.522  -3.148  -8.410  1.00 0.00 ? 68  PRO A HB2  2  
ATOM 2705  H HB3  . PRO A 1 68  ? 0.826   -3.290  -7.275  1.00 0.00 ? 68  PRO A HB3  2  
ATOM 2706  H HG2  . PRO A 1 68  ? 0.727   -3.955  -10.192 1.00 0.00 ? 68  PRO A HG2  2  
ATOM 2707  H HG3  . PRO A 1 68  ? 1.997   -3.121  -9.277  1.00 0.00 ? 68  PRO A HG3  2  
ATOM 2708  H HD2  . PRO A 1 68  ? 2.171   -5.736  -9.960  1.00 0.00 ? 68  PRO A HD2  2  
ATOM 2709  H HD3  . PRO A 1 68  ? 2.879   -5.090  -8.465  1.00 0.00 ? 68  PRO A HD3  2  
ATOM 2710  N N    . GLY A 1 69  ? -2.124  -6.511  -7.959  1.00 0.00 ? 69  GLY A N    2  
ATOM 2711  C CA   . GLY A 1 69  ? -3.389  -6.911  -8.547  1.00 0.00 ? 69  GLY A CA   2  
ATOM 2712  C C    . GLY A 1 69  ? -4.471  -7.121  -7.507  1.00 0.00 ? 69  GLY A C    2  
ATOM 2713  O O    . GLY A 1 69  ? -4.717  -6.250  -6.671  1.00 0.00 ? 69  GLY A O    2  
ATOM 2714  H H    . GLY A 1 69  ? -1.770  -6.997  -7.185  1.00 0.00 ? 69  GLY A H    2  
ATOM 2715  H HA2  . GLY A 1 69  ? -3.711  -6.146  -9.237  1.00 0.00 ? 69  GLY A HA2  2  
ATOM 2716  H HA3  . GLY A 1 69  ? -3.245  -7.834  -9.090  1.00 0.00 ? 69  GLY A HA3  2  
ATOM 2717  N N    . THR A 1 70  ? -5.122  -8.279  -7.557  1.00 0.00 ? 70  THR A N    2  
ATOM 2718  C CA   . THR A 1 70  ? -6.186  -8.599  -6.614  1.00 0.00 ? 70  THR A CA   2  
ATOM 2719  C C    . THR A 1 70  ? -5.923  -9.931  -5.920  1.00 0.00 ? 70  THR A C    2  
ATOM 2720  O O    . THR A 1 70  ? -6.225  -10.096 -4.738  1.00 0.00 ? 70  THR A O    2  
ATOM 2721  C CB   . THR A 1 70  ? -7.557  -8.659  -7.313  1.00 0.00 ? 70  THR A CB   2  
ATOM 2722  O OG1  . THR A 1 70  ? -7.474  -9.477  -8.485  1.00 0.00 ? 70  THR A OG1  2  
ATOM 2723  C CG2  . THR A 1 70  ? -8.032  -7.265  -7.693  1.00 0.00 ? 70  THR A CG2  2  
ATOM 2724  H H    . THR A 1 70  ? -4.880  -8.932  -8.246  1.00 0.00 ? 70  THR A H    2  
ATOM 2725  H HA   . THR A 1 70  ? -6.219  -7.817  -5.869  1.00 0.00 ? 70  THR A HA   2  
ATOM 2726  H HB   . THR A 1 70  ? -8.274  -9.094  -6.630  1.00 0.00 ? 70  THR A HB   2  
ATOM 2727  H HG1  . THR A 1 70  ? -8.217  -9.286  -9.062  1.00 0.00 ? 70  THR A HG1  2  
ATOM 2728  H HG21 . THR A 1 70  ? -8.910  -7.014  -7.117  1.00 0.00 ? 70  THR A HG21 2  
ATOM 2729  H HG22 . THR A 1 70  ? -8.272  -7.242  -8.746  1.00 0.00 ? 70  THR A HG22 2  
ATOM 2730  H HG23 . THR A 1 70  ? -7.250  -6.550  -7.487  1.00 0.00 ? 70  THR A HG23 2  
ATOM 2731  N N    . SER A 1 71  ? -5.359  -10.878 -6.662  1.00 0.00 ? 71  SER A N    2  
ATOM 2732  C CA   . SER A 1 71  ? -5.058  -12.198 -6.119  1.00 0.00 ? 71  SER A CA   2  
ATOM 2733  C C    . SER A 1 71  ? -3.711  -12.700 -6.627  1.00 0.00 ? 71  SER A C    2  
ATOM 2734  O O    . SER A 1 71  ? -3.175  -12.188 -7.610  1.00 0.00 ? 71  SER A O    2  
ATOM 2735  C CB   . SER A 1 71  ? -6.160  -13.190 -6.494  1.00 0.00 ? 71  SER A CB   2  
ATOM 2736  O OG   . SER A 1 71  ? -6.299  -13.291 -7.901  1.00 0.00 ? 71  SER A OG   2  
ATOM 2737  H H    . SER A 1 71  ? -5.142  -10.686 -7.599  1.00 0.00 ? 71  SER A H    2  
ATOM 2738  H HA   . SER A 1 71  ? -5.015  -12.111 -5.043  1.00 0.00 ? 71  SER A HA   2  
ATOM 2739  H HB2  . SER A 1 71  ? -5.914  -14.164 -6.098  1.00 0.00 ? 71  SER A HB2  2  
ATOM 2740  H HB3  . SER A 1 71  ? -7.099  -12.858 -6.074  1.00 0.00 ? 71  SER A HB3  2  
ATOM 2741  H HG   . SER A 1 71  ? -6.342  -12.411 -8.282  1.00 0.00 ? 71  SER A HG   2  
ATOM 2742  N N    . TYR A 1 72  ? -3.168  -13.706 -5.949  1.00 0.00 ? 72  TYR A N    2  
ATOM 2743  C CA   . TYR A 1 72  ? -1.882  -14.277 -6.330  1.00 0.00 ? 72  TYR A CA   2  
ATOM 2744  C C    . TYR A 1 72  ? -1.809  -15.754 -5.953  1.00 0.00 ? 72  TYR A C    2  
ATOM 2745  O O    . TYR A 1 72  ? -2.349  -16.173 -4.929  1.00 0.00 ? 72  TYR A O    2  
ATOM 2746  C CB   . TYR A 1 72  ? -0.741  -13.512 -5.657  1.00 0.00 ? 72  TYR A CB   2  
ATOM 2747  C CG   . TYR A 1 72  ? 0.620   -14.131 -5.883  1.00 0.00 ? 72  TYR A CG   2  
ATOM 2748  C CD1  . TYR A 1 72  ? 1.380   -13.798 -6.998  1.00 0.00 ? 72  TYR A CD1  2  
ATOM 2749  C CD2  . TYR A 1 72  ? 1.146   -15.047 -4.981  1.00 0.00 ? 72  TYR A CD2  2  
ATOM 2750  C CE1  . TYR A 1 72  ? 2.623   -14.362 -7.209  1.00 0.00 ? 72  TYR A CE1  2  
ATOM 2751  C CE2  . TYR A 1 72  ? 2.390   -15.615 -5.183  1.00 0.00 ? 72  TYR A CE2  2  
ATOM 2752  C CZ   . TYR A 1 72  ? 3.124   -15.269 -6.299  1.00 0.00 ? 72  TYR A CZ   2  
ATOM 2753  O OH   . TYR A 1 72  ? 4.363   -15.832 -6.504  1.00 0.00 ? 72  TYR A OH   2  
ATOM 2754  H H    . TYR A 1 72  ? -3.643  -14.072 -5.174  1.00 0.00 ? 72  TYR A H    2  
ATOM 2755  H HA   . TYR A 1 72  ? -1.781  -14.185 -7.401  1.00 0.00 ? 72  TYR A HA   2  
ATOM 2756  H HB2  . TYR A 1 72  ? -0.715  -12.505 -6.044  1.00 0.00 ? 72  TYR A HB2  2  
ATOM 2757  H HB3  . TYR A 1 72  ? -0.918  -13.478 -4.592  1.00 0.00 ? 72  TYR A HB3  2  
ATOM 2758  H HD1  . TYR A 1 72  ? 0.984   -13.087 -7.709  1.00 0.00 ? 72  TYR A HD1  2  
ATOM 2759  H HD2  . TYR A 1 72  ? 0.569   -15.316 -4.108  1.00 0.00 ? 72  TYR A HD2  2  
ATOM 2760  H HE1  . TYR A 1 72  ? 3.198   -14.091 -8.082  1.00 0.00 ? 72  TYR A HE1  2  
ATOM 2761  H HE2  . TYR A 1 72  ? 2.782   -16.326 -4.471  1.00 0.00 ? 72  TYR A HE2  2  
ATOM 2762  H HH   . TYR A 1 72  ? 4.274   -16.603 -7.070  1.00 0.00 ? 72  TYR A HH   2  
ATOM 2763  N N    . ARG A 1 73  ? -1.137  -16.538 -6.790  1.00 0.00 ? 73  ARG A N    2  
ATOM 2764  C CA   . ARG A 1 73  ? -0.993  -17.969 -6.547  1.00 0.00 ? 73  ARG A CA   2  
ATOM 2765  C C    . ARG A 1 73  ? 0.457   -18.323 -6.230  1.00 0.00 ? 73  ARG A C    2  
ATOM 2766  O O    . ARG A 1 73  ? 1.313   -18.333 -7.117  1.00 0.00 ? 73  ARG A O    2  
ATOM 2767  C CB   . ARG A 1 73  ? -1.470  -18.765 -7.762  1.00 0.00 ? 73  ARG A CB   2  
ATOM 2768  C CG   . ARG A 1 73  ? -1.432  -20.271 -7.558  1.00 0.00 ? 73  ARG A CG   2  
ATOM 2769  C CD   . ARG A 1 73  ? -2.065  -21.008 -8.728  1.00 0.00 ? 73  ARG A CD   2  
ATOM 2770  N NE   . ARG A 1 73  ? -3.523  -20.934 -8.697  1.00 0.00 ? 73  ARG A NE   2  
ATOM 2771  C CZ   . ARG A 1 73  ? -4.301  -21.336 -9.696  1.00 0.00 ? 73  ARG A CZ   2  
ATOM 2772  N NH1  . ARG A 1 73  ? -3.763  -21.838 -10.799 1.00 0.00 ? 73  ARG A NH1  2  
ATOM 2773  N NH2  . ARG A 1 73  ? -5.620  -21.236 -9.593  1.00 0.00 ? 73  ARG A NH2  2  
ATOM 2774  H H    . ARG A 1 73  ? -0.728  -16.146 -7.590  1.00 0.00 ? 73  ARG A H    2  
ATOM 2775  H HA   . ARG A 1 73  ? -1.607  -18.224 -5.696  1.00 0.00 ? 73  ARG A HA   2  
ATOM 2776  H HB2  . ARG A 1 73  ? -2.488  -18.480 -7.988  1.00 0.00 ? 73  ARG A HB2  2  
ATOM 2777  H HB3  . ARG A 1 73  ? -0.842  -18.522 -8.606  1.00 0.00 ? 73  ARG A HB3  2  
ATOM 2778  H HG2  . ARG A 1 73  ? -0.403  -20.585 -7.463  1.00 0.00 ? 73  ARG A HG2  2  
ATOM 2779  H HG3  . ARG A 1 73  ? -1.970  -20.516 -6.655  1.00 0.00 ? 73  ARG A HG3  2  
ATOM 2780  H HD2  . ARG A 1 73  ? -1.711  -20.567 -9.648  1.00 0.00 ? 73  ARG A HD2  2  
ATOM 2781  H HD3  . ARG A 1 73  ? -1.765  -22.044 -8.687  1.00 0.00 ? 73  ARG A HD3  2  
ATOM 2782  H HE   . ARG A 1 73  ? -3.942  -20.566 -7.891  1.00 0.00 ? 73  ARG A HE   2  
ATOM 2783  H HH11 . ARG A 1 73  ? -2.769  -21.915 -10.879 1.00 0.00 ? 73  ARG A HH11 2  
ATOM 2784  H HH12 . ARG A 1 73  ? -4.350  -22.141 -11.549 1.00 0.00 ? 73  ARG A HH12 2  
ATOM 2785  H HH21 . ARG A 1 73  ? -6.029  -20.858 -8.763  1.00 0.00 ? 73  ARG A HH21 2  
ATOM 2786  H HH22 . ARG A 1 73  ? -6.204  -21.539 -10.345 1.00 0.00 ? 73  ARG A HH22 2  
ATOM 2787  N N    . LEU A 1 74  ? 0.727   -18.613 -4.962  1.00 0.00 ? 74  LEU A N    2  
ATOM 2788  C CA   . LEU A 1 74  ? 2.074   -18.968 -4.529  1.00 0.00 ? 74  LEU A CA   2  
ATOM 2789  C C    . LEU A 1 74  ? 2.353   -20.447 -4.776  1.00 0.00 ? 74  LEU A C    2  
ATOM 2790  O O    . LEU A 1 74  ? 1.570   -21.311 -4.382  1.00 0.00 ? 74  LEU A O    2  
ATOM 2791  C CB   . LEU A 1 74  ? 2.254   -18.645 -3.044  1.00 0.00 ? 74  LEU A CB   2  
ATOM 2792  C CG   . LEU A 1 74  ? 3.593   -19.051 -2.427  1.00 0.00 ? 74  LEU A CG   2  
ATOM 2793  C CD1  . LEU A 1 74  ? 4.735   -18.285 -3.076  1.00 0.00 ? 74  LEU A CD1  2  
ATOM 2794  C CD2  . LEU A 1 74  ? 3.579   -18.819 -0.923  1.00 0.00 ? 74  LEU A CD2  2  
ATOM 2795  H H    . LEU A 1 74  ? 0.004   -18.589 -4.302  1.00 0.00 ? 74  LEU A H    2  
ATOM 2796  H HA   . LEU A 1 74  ? 2.773   -18.381 -5.104  1.00 0.00 ? 74  LEU A HA   2  
ATOM 2797  H HB2  . LEU A 1 74  ? 2.145   -17.578 -2.923  1.00 0.00 ? 74  LEU A HB2  2  
ATOM 2798  H HB3  . LEU A 1 74  ? 1.470   -19.150 -2.499  1.00 0.00 ? 74  LEU A HB3  2  
ATOM 2799  H HG   . LEU A 1 74  ? 3.757   -20.106 -2.602  1.00 0.00 ? 74  LEU A HG   2  
ATOM 2800  H HD11 . LEU A 1 74  ? 4.401   -17.292 -3.334  1.00 0.00 ? 74  LEU A HD11 2  
ATOM 2801  H HD12 . LEU A 1 74  ? 5.052   -18.802 -3.970  1.00 0.00 ? 74  LEU A HD12 2  
ATOM 2802  H HD13 . LEU A 1 74  ? 5.563   -18.219 -2.385  1.00 0.00 ? 74  LEU A HD13 2  
ATOM 2803  H HD21 . LEU A 1 74  ? 2.747   -19.350 -0.485  1.00 0.00 ? 74  LEU A HD21 2  
ATOM 2804  H HD22 . LEU A 1 74  ? 3.476   -17.762 -0.723  1.00 0.00 ? 74  LEU A HD22 2  
ATOM 2805  H HD23 . LEU A 1 74  ? 4.502   -19.179 -0.495  1.00 0.00 ? 74  LEU A HD23 2  
ATOM 2806  N N    . GLN A 1 75  ? 3.476   -20.730 -5.429  1.00 0.00 ? 75  GLN A N    2  
ATOM 2807  C CA   . GLN A 1 75  ? 3.859   -22.105 -5.727  1.00 0.00 ? 75  GLN A CA   2  
ATOM 2808  C C    . GLN A 1 75  ? 5.212   -22.440 -5.108  1.00 0.00 ? 75  GLN A C    2  
ATOM 2809  O O    . GLN A 1 75  ? 6.081   -21.577 -4.986  1.00 0.00 ? 75  GLN A O    2  
ATOM 2810  C CB   . GLN A 1 75  ? 3.909   -22.326 -7.240  1.00 0.00 ? 75  GLN A CB   2  
ATOM 2811  C CG   . GLN A 1 75  ? 2.677   -21.816 -7.970  1.00 0.00 ? 75  GLN A CG   2  
ATOM 2812  C CD   . GLN A 1 75  ? 2.979   -21.385 -9.392  1.00 0.00 ? 75  GLN A CD   2  
ATOM 2813  O OE1  . GLN A 1 75  ? 3.891   -21.909 -10.032 1.00 0.00 ? 75  GLN A OE1  2  
ATOM 2814  N NE2  . GLN A 1 75  ? 2.211   -20.425 -9.896  1.00 0.00 ? 75  GLN A NE2  2  
ATOM 2815  H H    . GLN A 1 75  ? 4.059   -19.998 -5.717  1.00 0.00 ? 75  GLN A H    2  
ATOM 2816  H HA   . GLN A 1 75  ? 3.112   -22.757 -5.302  1.00 0.00 ? 75  GLN A HA   2  
ATOM 2817  H HB2  . GLN A 1 75  ? 4.774   -21.818 -7.638  1.00 0.00 ? 75  GLN A HB2  2  
ATOM 2818  H HB3  . GLN A 1 75  ? 4.002   -23.385 -7.434  1.00 0.00 ? 75  GLN A HB3  2  
ATOM 2819  H HG2  . GLN A 1 75  ? 1.939   -22.603 -7.998  1.00 0.00 ? 75  GLN A HG2  2  
ATOM 2820  H HG3  . GLN A 1 75  ? 2.280   -20.970 -7.430  1.00 0.00 ? 75  GLN A HG3  2  
ATOM 2821  H HE21 . GLN A 1 75  ? 1.504   -20.053 -9.328  1.00 0.00 ? 75  GLN A HE21 2  
ATOM 2822  H HE22 . GLN A 1 75  ? 2.384   -20.127 -10.812 1.00 0.00 ? 75  GLN A HE22 2  
ATOM 2823  N N    . GLY A 1 76  ? 5.384   -23.699 -4.717  1.00 0.00 ? 76  GLY A N    2  
ATOM 2824  C CA   . GLY A 1 76  ? 6.634   -24.125 -4.115  1.00 0.00 ? 76  GLY A CA   2  
ATOM 2825  C C    . GLY A 1 76  ? 6.527   -24.286 -2.611  1.00 0.00 ? 76  GLY A C    2  
ATOM 2826  O O    . GLY A 1 76  ? 7.112   -23.511 -1.853  1.00 0.00 ? 76  GLY A O    2  
ATOM 2827  H H    . GLY A 1 76  ? 4.656   -24.344 -4.839  1.00 0.00 ? 76  GLY A H    2  
ATOM 2828  H HA2  . GLY A 1 76  ? 6.926   -25.070 -4.548  1.00 0.00 ? 76  GLY A HA2  2  
ATOM 2829  H HA3  . GLY A 1 76  ? 7.394   -23.389 -4.333  1.00 0.00 ? 76  GLY A HA3  2  
ATOM 2830  N N    . LEU A 1 77  ? 5.777   -25.293 -2.178  1.00 0.00 ? 77  LEU A N    2  
ATOM 2831  C CA   . LEU A 1 77  ? 5.594   -25.553 -0.754  1.00 0.00 ? 77  LEU A CA   2  
ATOM 2832  C C    . LEU A 1 77  ? 5.522   -27.052 -0.479  1.00 0.00 ? 77  LEU A C    2  
ATOM 2833  O O    . LEU A 1 77  ? 5.436   -27.860 -1.403  1.00 0.00 ? 77  LEU A O    2  
ATOM 2834  C CB   . LEU A 1 77  ? 4.323   -24.868 -0.250  1.00 0.00 ? 77  LEU A CB   2  
ATOM 2835  C CG   . LEU A 1 77  ? 4.214   -23.368 -0.526  1.00 0.00 ? 77  LEU A CG   2  
ATOM 2836  C CD1  . LEU A 1 77  ? 2.775   -22.901 -0.373  1.00 0.00 ? 77  LEU A CD1  2  
ATOM 2837  C CD2  . LEU A 1 77  ? 5.132   -22.587 0.402   1.00 0.00 ? 77  LEU A CD2  2  
ATOM 2838  H H    . LEU A 1 77  ? 5.336   -25.877 -2.830  1.00 0.00 ? 77  LEU A H    2  
ATOM 2839  H HA   . LEU A 1 77  ? 6.446   -25.144 -0.231  1.00 0.00 ? 77  LEU A HA   2  
ATOM 2840  H HB2  . LEU A 1 77  ? 3.479   -25.352 -0.717  1.00 0.00 ? 77  LEU A HB2  2  
ATOM 2841  H HB3  . LEU A 1 77  ? 4.272   -25.013 0.820   1.00 0.00 ? 77  LEU A HB3  2  
ATOM 2842  H HG   . LEU A 1 77  ? 4.521   -23.173 -1.544  1.00 0.00 ? 77  LEU A HG   2  
ATOM 2843  H HD11 . LEU A 1 77  ? 2.575   -22.112 -1.083  1.00 0.00 ? 77  LEU A HD11 2  
ATOM 2844  H HD12 . LEU A 1 77  ? 2.621   -22.529 0.629   1.00 0.00 ? 77  LEU A HD12 2  
ATOM 2845  H HD13 . LEU A 1 77  ? 2.106   -23.729 -0.556  1.00 0.00 ? 77  LEU A HD13 2  
ATOM 2846  H HD21 . LEU A 1 77  ? 5.226   -21.572 0.044   1.00 0.00 ? 77  LEU A HD21 2  
ATOM 2847  H HD22 . LEU A 1 77  ? 6.106   -23.054 0.421   1.00 0.00 ? 77  LEU A HD22 2  
ATOM 2848  H HD23 . LEU A 1 77  ? 4.715   -22.580 1.398   1.00 0.00 ? 77  LEU A HD23 2  
ATOM 2849  N N    . LYS A 1 78  ? 5.555   -27.416 0.798   1.00 0.00 ? 78  LYS A N    2  
ATOM 2850  C CA   . LYS A 1 78  ? 5.489   -28.816 1.197   1.00 0.00 ? 78  LYS A CA   2  
ATOM 2851  C C    . LYS A 1 78  ? 4.058   -29.219 1.538   1.00 0.00 ? 78  LYS A C    2  
ATOM 2852  O O    . LYS A 1 78  ? 3.285   -28.439 2.096   1.00 0.00 ? 78  LYS A O    2  
ATOM 2853  C CB   . LYS A 1 78  ? 6.402   -29.069 2.400   1.00 0.00 ? 78  LYS A CB   2  
ATOM 2854  C CG   . LYS A 1 78  ? 7.880   -29.069 2.052   1.00 0.00 ? 78  LYS A CG   2  
ATOM 2855  C CD   . LYS A 1 78  ? 8.709   -29.726 3.143   1.00 0.00 ? 78  LYS A CD   2  
ATOM 2856  C CE   . LYS A 1 78  ? 9.091   -28.731 4.229   1.00 0.00 ? 78  LYS A CE   2  
ATOM 2857  N NZ   . LYS A 1 78  ? 9.598   -29.413 5.452   1.00 0.00 ? 78  LYS A NZ   2  
ATOM 2858  H H    . LYS A 1 78  ? 5.624   -26.724 1.491   1.00 0.00 ? 78  LYS A H    2  
ATOM 2859  H HA   . LYS A 1 78  ? 5.830   -29.414 0.366   1.00 0.00 ? 78  LYS A HA   2  
ATOM 2860  H HB2  . LYS A 1 78  ? 6.227   -28.299 3.137   1.00 0.00 ? 78  LYS A HB2  2  
ATOM 2861  H HB3  . LYS A 1 78  ? 6.154   -30.029 2.829   1.00 0.00 ? 78  LYS A HB3  2  
ATOM 2862  H HG2  . LYS A 1 78  ? 8.024   -29.612 1.130   1.00 0.00 ? 78  LYS A HG2  2  
ATOM 2863  H HG3  . LYS A 1 78  ? 8.211   -28.048 1.927   1.00 0.00 ? 78  LYS A HG3  2  
ATOM 2864  H HD2  . LYS A 1 78  ? 8.135   -30.525 3.589   1.00 0.00 ? 78  LYS A HD2  2  
ATOM 2865  H HD3  . LYS A 1 78  ? 9.611   -30.130 2.704   1.00 0.00 ? 78  LYS A HD3  2  
ATOM 2866  H HE2  . LYS A 1 78  ? 9.859   -28.078 3.846   1.00 0.00 ? 78  LYS A HE2  2  
ATOM 2867  H HE3  . LYS A 1 78  ? 8.219   -28.149 4.487   1.00 0.00 ? 78  LYS A HE3  2  
ATOM 2868  H HZ1  . LYS A 1 78  ? 10.290  -30.144 5.192   1.00 0.00 ? 78  LYS A HZ1  2  
ATOM 2869  H HZ2  . LYS A 1 78  ? 8.812   -29.861 5.963   1.00 0.00 ? 78  LYS A HZ2  2  
ATOM 2870  H HZ3  . LYS A 1 78  ? 10.058  -28.723 6.080   1.00 0.00 ? 78  LYS A HZ3  2  
ATOM 2871  N N    . PRO A 1 79  ? 3.696   -30.465 1.198   1.00 0.00 ? 79  PRO A N    2  
ATOM 2872  C CA   . PRO A 1 79  ? 2.356   -30.999 1.461   1.00 0.00 ? 79  PRO A CA   2  
ATOM 2873  C C    . PRO A 1 79  ? 2.104   -31.226 2.947   1.00 0.00 ? 79  PRO A C    2  
ATOM 2874  O O    . PRO A 1 79  ? 3.026   -31.526 3.704   1.00 0.00 ? 79  PRO A O    2  
ATOM 2875  C CB   . PRO A 1 79  ? 2.352   -32.331 0.708   1.00 0.00 ? 79  PRO A CB   2  
ATOM 2876  C CG   . PRO A 1 79  ? 3.786   -32.729 0.633   1.00 0.00 ? 79  PRO A CG   2  
ATOM 2877  C CD   . PRO A 1 79  ? 4.566   -31.448 0.531   1.00 0.00 ? 79  PRO A CD   2  
ATOM 2878  H HA   . PRO A 1 79  ? 1.587   -30.355 1.061   1.00 0.00 ? 79  PRO A HA   2  
ATOM 2879  H HB2  . PRO A 1 79  ? 1.768   -33.056 1.257   1.00 0.00 ? 79  PRO A HB2  2  
ATOM 2880  H HB3  . PRO A 1 79  ? 1.929   -32.192 -0.276  1.00 0.00 ? 79  PRO A HB3  2  
ATOM 2881  H HG2  . PRO A 1 79  ? 4.064   -33.268 1.526   1.00 0.00 ? 79  PRO A HG2  2  
ATOM 2882  H HG3  . PRO A 1 79  ? 3.952   -33.339 -0.243  1.00 0.00 ? 79  PRO A HG3  2  
ATOM 2883  H HD2  . PRO A 1 79  ? 5.510   -31.539 1.047   1.00 0.00 ? 79  PRO A HD2  2  
ATOM 2884  H HD3  . PRO A 1 79  ? 4.723   -31.183 -0.504  1.00 0.00 ? 79  PRO A HD3  2  
ATOM 2885  N N    . ASN A 1 80  ? 0.848   -31.082 3.359   1.00 0.00 ? 80  ASN A N    2  
ATOM 2886  C CA   . ASN A 1 80  ? 0.475   -31.272 4.756   1.00 0.00 ? 80  ASN A CA   2  
ATOM 2887  C C    . ASN A 1 80  ? 1.419   -30.508 5.679   1.00 0.00 ? 80  ASN A C    2  
ATOM 2888  O O    . ASN A 1 80  ? 2.006   -31.082 6.597   1.00 0.00 ? 80  ASN A O    2  
ATOM 2889  C CB   . ASN A 1 80  ? 0.489   -32.760 5.111   1.00 0.00 ? 80  ASN A CB   2  
ATOM 2890  C CG   . ASN A 1 80  ? -0.206  -33.046 6.428   1.00 0.00 ? 80  ASN A CG   2  
ATOM 2891  O OD1  . ASN A 1 80  ? -1.364  -32.678 6.624   1.00 0.00 ? 80  ASN A OD1  2  
ATOM 2892  N ND2  . ASN A 1 80  ? 0.501   -33.706 7.339   1.00 0.00 ? 80  ASN A ND2  2  
ATOM 2893  H H    . ASN A 1 80  ? 0.156   -30.841 2.708   1.00 0.00 ? 80  ASN A H    2  
ATOM 2894  H HA   . ASN A 1 80  ? -0.526  -30.889 4.886   1.00 0.00 ? 80  ASN A HA   2  
ATOM 2895  H HB2  . ASN A 1 80  ? -0.014  -33.314 4.333   1.00 0.00 ? 80  ASN A HB2  2  
ATOM 2896  H HB3  . ASN A 1 80  ? 1.512   -33.097 5.184   1.00 0.00 ? 80  ASN A HB3  2  
ATOM 2897  H HD21 . ASN A 1 80  ? 1.418   -33.967 7.113   1.00 0.00 ? 80  ASN A HD21 2  
ATOM 2898  H HD22 . ASN A 1 80  ? 0.076   -33.905 8.199   1.00 0.00 ? 80  ASN A HD22 2  
ATOM 2899  N N    . SER A 1 81  ? 1.559   -29.209 5.431   1.00 0.00 ? 81  SER A N    2  
ATOM 2900  C CA   . SER A 1 81  ? 2.433   -28.367 6.238   1.00 0.00 ? 81  SER A CA   2  
ATOM 2901  C C    . SER A 1 81  ? 1.810   -26.992 6.459   1.00 0.00 ? 81  SER A C    2  
ATOM 2902  O O    . SER A 1 81  ? 1.216   -26.413 5.549   1.00 0.00 ? 81  SER A O    2  
ATOM 2903  C CB   . SER A 1 81  ? 3.798   -28.218 5.563   1.00 0.00 ? 81  SER A CB   2  
ATOM 2904  O OG   . SER A 1 81  ? 4.665   -29.279 5.925   1.00 0.00 ? 81  SER A OG   2  
ATOM 2905  H H    . SER A 1 81  ? 1.064   -28.810 4.685   1.00 0.00 ? 81  SER A H    2  
ATOM 2906  H HA   . SER A 1 81  ? 2.565   -28.847 7.196   1.00 0.00 ? 81  SER A HA   2  
ATOM 2907  H HB2  . SER A 1 81  ? 3.670   -28.224 4.491   1.00 0.00 ? 81  SER A HB2  2  
ATOM 2908  H HB3  . SER A 1 81  ? 4.247   -27.283 5.867   1.00 0.00 ? 81  SER A HB3  2  
ATOM 2909  H HG   . SER A 1 81  ? 5.269   -29.460 5.202   1.00 0.00 ? 81  SER A HG   2  
ATOM 2910  N N    . LEU A 1 82  ? 1.950   -26.474 7.675   1.00 0.00 ? 82  LEU A N    2  
ATOM 2911  C CA   . LEU A 1 82  ? 1.402   -25.167 8.018   1.00 0.00 ? 82  LEU A CA   2  
ATOM 2912  C C    . LEU A 1 82  ? 2.335   -24.049 7.564   1.00 0.00 ? 82  LEU A C    2  
ATOM 2913  O O    . LEU A 1 82  ? 3.556   -24.164 7.671   1.00 0.00 ? 82  LEU A O    2  
ATOM 2914  C CB   . LEU A 1 82  ? 1.167   -25.070 9.526   1.00 0.00 ? 82  LEU A CB   2  
ATOM 2915  C CG   . LEU A 1 82  ? 0.312   -23.894 9.998   1.00 0.00 ? 82  LEU A CG   2  
ATOM 2916  C CD1  . LEU A 1 82  ? -1.154  -24.135 9.672   1.00 0.00 ? 82  LEU A CD1  2  
ATOM 2917  C CD2  . LEU A 1 82  ? 0.497   -23.665 11.491  1.00 0.00 ? 82  LEU A CD2  2  
ATOM 2918  H H    . LEU A 1 82  ? 2.434   -26.983 8.358   1.00 0.00 ? 82  LEU A H    2  
ATOM 2919  H HA   . LEU A 1 82  ? 0.456   -25.060 7.507   1.00 0.00 ? 82  LEU A HA   2  
ATOM 2920  H HB2  . LEU A 1 82  ? 0.682   -25.980 9.844   1.00 0.00 ? 82  LEU A HB2  2  
ATOM 2921  H HB3  . LEU A 1 82  ? 2.132   -24.992 10.006  1.00 0.00 ? 82  LEU A HB3  2  
ATOM 2922  H HG   . LEU A 1 82  ? 0.626   -22.998 9.480   1.00 0.00 ? 82  LEU A HG   2  
ATOM 2923  H HD11 . LEU A 1 82  ? -1.543  -23.293 9.119   1.00 0.00 ? 82  LEU A HD11 2  
ATOM 2924  H HD12 . LEU A 1 82  ? -1.712  -24.252 10.588  1.00 0.00 ? 82  LEU A HD12 2  
ATOM 2925  H HD13 . LEU A 1 82  ? -1.248  -25.031 9.076   1.00 0.00 ? 82  LEU A HD13 2  
ATOM 2926  H HD21 . LEU A 1 82  ? -0.288  -23.020 11.856  1.00 0.00 ? 82  LEU A HD21 2  
ATOM 2927  H HD22 . LEU A 1 82  ? 1.456   -23.201 11.668  1.00 0.00 ? 82  LEU A HD22 2  
ATOM 2928  H HD23 . LEU A 1 82  ? 0.454   -24.612 12.008  1.00 0.00 ? 82  LEU A HD23 2  
ATOM 2929  N N    . TYR A 1 83  ? 1.751   -22.968 7.059   1.00 0.00 ? 83  TYR A N    2  
ATOM 2930  C CA   . TYR A 1 83  ? 2.530   -21.828 6.588   1.00 0.00 ? 83  TYR A CA   2  
ATOM 2931  C C    . TYR A 1 83  ? 1.773   -20.522 6.808   1.00 0.00 ? 83  TYR A C    2  
ATOM 2932  O O    . TYR A 1 83  ? 0.715   -20.298 6.220   1.00 0.00 ? 83  TYR A O    2  
ATOM 2933  C CB   . TYR A 1 83  ? 2.868   -21.992 5.105   1.00 0.00 ? 83  TYR A CB   2  
ATOM 2934  C CG   . TYR A 1 83  ? 3.870   -23.090 4.830   1.00 0.00 ? 83  TYR A CG   2  
ATOM 2935  C CD1  . TYR A 1 83  ? 5.201   -22.953 5.204   1.00 0.00 ? 83  TYR A CD1  2  
ATOM 2936  C CD2  . TYR A 1 83  ? 3.486   -24.265 4.195   1.00 0.00 ? 83  TYR A CD2  2  
ATOM 2937  C CE1  . TYR A 1 83  ? 6.120   -23.953 4.954   1.00 0.00 ? 83  TYR A CE1  2  
ATOM 2938  C CE2  . TYR A 1 83  ? 4.398   -25.271 3.942   1.00 0.00 ? 83  TYR A CE2  2  
ATOM 2939  C CZ   . TYR A 1 83  ? 5.714   -25.110 4.322   1.00 0.00 ? 83  TYR A CZ   2  
ATOM 2940  O OH   . TYR A 1 83  ? 6.626   -26.109 4.072   1.00 0.00 ? 83  TYR A OH   2  
ATOM 2941  H H    . TYR A 1 83  ? 0.774   -22.935 6.999   1.00 0.00 ? 83  TYR A H    2  
ATOM 2942  H HA   . TYR A 1 83  ? 3.450   -21.798 7.155   1.00 0.00 ? 83  TYR A HA   2  
ATOM 2943  H HB2  . TYR A 1 83  ? 1.965   -22.223 4.561   1.00 0.00 ? 83  TYR A HB2  2  
ATOM 2944  H HB3  . TYR A 1 83  ? 3.279   -21.065 4.733   1.00 0.00 ? 83  TYR A HB3  2  
ATOM 2945  H HD1  . TYR A 1 83  ? 5.516   -22.045 5.699   1.00 0.00 ? 83  TYR A HD1  2  
ATOM 2946  H HD2  . TYR A 1 83  ? 2.454   -24.387 3.898   1.00 0.00 ? 83  TYR A HD2  2  
ATOM 2947  H HE1  . TYR A 1 83  ? 7.150   -23.828 5.252   1.00 0.00 ? 83  TYR A HE1  2  
ATOM 2948  H HE2  . TYR A 1 83  ? 4.080   -26.177 3.447   1.00 0.00 ? 83  TYR A HE2  2  
ATOM 2949  H HH   . TYR A 1 83  ? 6.712   -26.234 3.124   1.00 0.00 ? 83  TYR A HH   2  
ATOM 2950  N N    . TYR A 1 84  ? 2.323   -19.664 7.660   1.00 0.00 ? 84  TYR A N    2  
ATOM 2951  C CA   . TYR A 1 84  ? 1.700   -18.380 7.960   1.00 0.00 ? 84  TYR A CA   2  
ATOM 2952  C C    . TYR A 1 84  ? 1.804   -17.432 6.770   1.00 0.00 ? 84  TYR A C    2  
ATOM 2953  O O    . TYR A 1 84  ? 2.688   -17.573 5.924   1.00 0.00 ? 84  TYR A O    2  
ATOM 2954  C CB   . TYR A 1 84  ? 2.354   -17.747 9.189   1.00 0.00 ? 84  TYR A CB   2  
ATOM 2955  C CG   . TYR A 1 84  ? 2.061   -18.482 10.478  1.00 0.00 ? 84  TYR A CG   2  
ATOM 2956  C CD1  . TYR A 1 84  ? 2.613   -19.732 10.729  1.00 0.00 ? 84  TYR A CD1  2  
ATOM 2957  C CD2  . TYR A 1 84  ? 1.230   -17.926 11.443  1.00 0.00 ? 84  TYR A CD2  2  
ATOM 2958  C CE1  . TYR A 1 84  ? 2.347   -20.407 11.905  1.00 0.00 ? 84  TYR A CE1  2  
ATOM 2959  C CE2  . TYR A 1 84  ? 0.959   -18.594 12.622  1.00 0.00 ? 84  TYR A CE2  2  
ATOM 2960  C CZ   . TYR A 1 84  ? 1.520   -19.834 12.848  1.00 0.00 ? 84  TYR A CZ   2  
ATOM 2961  O OH   . TYR A 1 84  ? 1.252   -20.502 14.021  1.00 0.00 ? 84  TYR A OH   2  
ATOM 2962  H H    . TYR A 1 84  ? 3.167   -19.899 8.098   1.00 0.00 ? 84  TYR A H    2  
ATOM 2963  H HA   . TYR A 1 84  ? 0.656   -18.560 8.173   1.00 0.00 ? 84  TYR A HA   2  
ATOM 2964  H HB2  . TYR A 1 84  ? 3.425   -17.734 9.052   1.00 0.00 ? 84  TYR A HB2  2  
ATOM 2965  H HB3  . TYR A 1 84  ? 1.998   -16.733 9.296   1.00 0.00 ? 84  TYR A HB3  2  
ATOM 2966  H HD1  . TYR A 1 84  ? 3.261   -20.178 9.988   1.00 0.00 ? 84  TYR A HD1  2  
ATOM 2967  H HD2  . TYR A 1 84  ? 0.792   -16.955 11.263  1.00 0.00 ? 84  TYR A HD2  2  
ATOM 2968  H HE1  . TYR A 1 84  ? 2.786   -21.377 12.082  1.00 0.00 ? 84  TYR A HE1  2  
ATOM 2969  H HE2  . TYR A 1 84  ? 0.311   -18.145 13.361  1.00 0.00 ? 84  TYR A HE2  2  
ATOM 2970  H HH   . TYR A 1 84  ? 0.992   -21.405 13.822  1.00 0.00 ? 84  TYR A HH   2  
ATOM 2971  N N    . PHE A 1 85  ? 0.894   -16.465 6.710   1.00 0.00 ? 85  PHE A N    2  
ATOM 2972  C CA   . PHE A 1 85  ? 0.882   -15.493 5.624   1.00 0.00 ? 85  PHE A CA   2  
ATOM 2973  C C    . PHE A 1 85  ? 0.360   -14.143 6.108   1.00 0.00 ? 85  PHE A C    2  
ATOM 2974  O O    . PHE A 1 85  ? -0.430  -14.072 7.049   1.00 0.00 ? 85  PHE A O    2  
ATOM 2975  C CB   . PHE A 1 85  ? 0.019   -16.000 4.466   1.00 0.00 ? 85  PHE A CB   2  
ATOM 2976  C CG   . PHE A 1 85  ? 0.432   -17.352 3.959   1.00 0.00 ? 85  PHE A CG   2  
ATOM 2977  C CD1  . PHE A 1 85  ? 1.669   -17.536 3.364   1.00 0.00 ? 85  PHE A CD1  2  
ATOM 2978  C CD2  . PHE A 1 85  ? -0.418  -18.440 4.078   1.00 0.00 ? 85  PHE A CD2  2  
ATOM 2979  C CE1  . PHE A 1 85  ? 2.052   -18.779 2.896   1.00 0.00 ? 85  PHE A CE1  2  
ATOM 2980  C CE2  . PHE A 1 85  ? -0.040  -19.686 3.613   1.00 0.00 ? 85  PHE A CE2  2  
ATOM 2981  C CZ   . PHE A 1 85  ? 1.196   -19.855 3.020   1.00 0.00 ? 85  PHE A CZ   2  
ATOM 2982  H H    . PHE A 1 85  ? 0.215   -16.405 7.414   1.00 0.00 ? 85  PHE A H    2  
ATOM 2983  H HA   . PHE A 1 85  ? 1.897   -15.370 5.278   1.00 0.00 ? 85  PHE A HA   2  
ATOM 2984  H HB2  . PHE A 1 85  ? -1.007  -16.069 4.795   1.00 0.00 ? 85  PHE A HB2  2  
ATOM 2985  H HB3  . PHE A 1 85  ? 0.085   -15.302 3.645   1.00 0.00 ? 85  PHE A HB3  2  
ATOM 2986  H HD1  . PHE A 1 85  ? 2.340   -16.694 3.266   1.00 0.00 ? 85  PHE A HD1  2  
ATOM 2987  H HD2  . PHE A 1 85  ? -1.385  -18.310 4.540   1.00 0.00 ? 85  PHE A HD2  2  
ATOM 2988  H HE1  . PHE A 1 85  ? 3.020   -18.907 2.433   1.00 0.00 ? 85  PHE A HE1  2  
ATOM 2989  H HE2  . PHE A 1 85  ? -0.712  -20.526 3.711   1.00 0.00 ? 85  PHE A HE2  2  
ATOM 2990  H HZ   . PHE A 1 85  ? 1.493   -20.827 2.656   1.00 0.00 ? 85  PHE A HZ   2  
ATOM 2991  N N    . ARG A 1 86  ? 0.809   -13.074 5.458   1.00 0.00 ? 86  ARG A N    2  
ATOM 2992  C CA   . ARG A 1 86  ? 0.390   -11.726 5.822   1.00 0.00 ? 86  ARG A CA   2  
ATOM 2993  C C    . ARG A 1 86  ? 0.583   -10.762 4.655   1.00 0.00 ? 86  ARG A C    2  
ATOM 2994  O O    . ARG A 1 86  ? 1.702   -10.562 4.181   1.00 0.00 ? 86  ARG A O    2  
ATOM 2995  C CB   . ARG A 1 86  ? 1.177   -11.236 7.039   1.00 0.00 ? 86  ARG A CB   2  
ATOM 2996  C CG   . ARG A 1 86  ? 0.523   -11.580 8.367   1.00 0.00 ? 86  ARG A CG   2  
ATOM 2997  C CD   . ARG A 1 86  ? 1.292   -10.987 9.537   1.00 0.00 ? 86  ARG A CD   2  
ATOM 2998  N NE   . ARG A 1 86  ? 0.420   -10.685 10.669  1.00 0.00 ? 86  ARG A NE   2  
ATOM 2999  C CZ   . ARG A 1 86  ? 0.728   -9.812  11.621  1.00 0.00 ? 86  ARG A CZ   2  
ATOM 3000  N NH1  . ARG A 1 86  ? 1.880   -9.157  11.578  1.00 0.00 ? 86  ARG A NH1  2  
ATOM 3001  N NH2  . ARG A 1 86  ? -0.118  -9.591  12.619  1.00 0.00 ? 86  ARG A NH2  2  
ATOM 3002  H H    . ARG A 1 86  ? 1.438   -13.195 4.716   1.00 0.00 ? 86  ARG A H    2  
ATOM 3003  H HA   . ARG A 1 86  ? -0.659  -11.762 6.074   1.00 0.00 ? 86  ARG A HA   2  
ATOM 3004  H HB2  . ARG A 1 86  ? 2.160   -11.682 7.021   1.00 0.00 ? 86  ARG A HB2  2  
ATOM 3005  H HB3  . ARG A 1 86  ? 1.277   -10.163 6.979   1.00 0.00 ? 86  ARG A HB3  2  
ATOM 3006  H HG2  . ARG A 1 86  ? -0.483  -11.185 8.375   1.00 0.00 ? 86  ARG A HG2  2  
ATOM 3007  H HG3  . ARG A 1 86  ? 0.491   -12.654 8.475   1.00 0.00 ? 86  ARG A HG3  2  
ATOM 3008  H HD2  . ARG A 1 86  ? 2.043   -11.696 9.853   1.00 0.00 ? 86  ARG A HD2  2  
ATOM 3009  H HD3  . ARG A 1 86  ? 1.772   -10.076 9.211   1.00 0.00 ? 86  ARG A HD3  2  
ATOM 3010  H HE   . ARG A 1 86  ? -0.436  -11.158 10.721  1.00 0.00 ? 86  ARG A HE   2  
ATOM 3011  H HH11 . ARG A 1 86  ? 2.519   -9.320  10.826  1.00 0.00 ? 86  ARG A HH11 2  
ATOM 3012  H HH12 . ARG A 1 86  ? 2.108   -8.498  12.295  1.00 0.00 ? 86  ARG A HH12 2  
ATOM 3013  H HH21 . ARG A 1 86  ? -0.987  -10.083 12.656  1.00 0.00 ? 86  ARG A HH21 2  
ATOM 3014  H HH22 . ARG A 1 86  ? 0.114   -8.934  13.335  1.00 0.00 ? 86  ARG A HH22 2  
ATOM 3015  N N    . LEU A 1 87  ? -0.513  -10.169 4.197   1.00 0.00 ? 87  LEU A N    2  
ATOM 3016  C CA   . LEU A 1 87  ? -0.465  -9.226  3.085   1.00 0.00 ? 87  LEU A CA   2  
ATOM 3017  C C    . LEU A 1 87  ? -0.278  -7.799  3.589   1.00 0.00 ? 87  LEU A C    2  
ATOM 3018  O O    . LEU A 1 87  ? -0.846  -7.411  4.610   1.00 0.00 ? 87  LEU A O    2  
ATOM 3019  C CB   . LEU A 1 87  ? -1.745  -9.322  2.253   1.00 0.00 ? 87  LEU A CB   2  
ATOM 3020  C CG   . LEU A 1 87  ? -1.608  -8.986  0.768   1.00 0.00 ? 87  LEU A CG   2  
ATOM 3021  C CD1  . LEU A 1 87  ? -0.822  -10.070 0.046   1.00 0.00 ? 87  LEU A CD1  2  
ATOM 3022  C CD2  . LEU A 1 87  ? -2.979  -8.806  0.132   1.00 0.00 ? 87  LEU A CD2  2  
ATOM 3023  H H    . LEU A 1 87  ? -1.376  -10.369 4.616   1.00 0.00 ? 87  LEU A H    2  
ATOM 3024  H HA   . LEU A 1 87  ? 0.378   -9.489  2.464   1.00 0.00 ? 87  LEU A HA   2  
ATOM 3025  H HB2  . LEU A 1 87  ? -2.115  -10.333 2.331   1.00 0.00 ? 87  LEU A HB2  2  
ATOM 3026  H HB3  . LEU A 1 87  ? -2.469  -8.642  2.682   1.00 0.00 ? 87  LEU A HB3  2  
ATOM 3027  H HG   . LEU A 1 87  ? -1.065  -8.056  0.664   1.00 0.00 ? 87  LEU A HG   2  
ATOM 3028  H HD11 . LEU A 1 87  ? -0.280  -9.633  -0.779  1.00 0.00 ? 87  LEU A HD11 2  
ATOM 3029  H HD12 . LEU A 1 87  ? -1.502  -10.820 -0.327  1.00 0.00 ? 87  LEU A HD12 2  
ATOM 3030  H HD13 . LEU A 1 87  ? -0.124  -10.527 0.734   1.00 0.00 ? 87  LEU A HD13 2  
ATOM 3031  H HD21 . LEU A 1 87  ? -3.212  -9.672  -0.470  1.00 0.00 ? 87  LEU A HD21 2  
ATOM 3032  H HD22 . LEU A 1 87  ? -2.973  -7.924  -0.492  1.00 0.00 ? 87  LEU A HD22 2  
ATOM 3033  H HD23 . LEU A 1 87  ? -3.723  -8.696  0.907   1.00 0.00 ? 87  LEU A HD23 2  
ATOM 3034  N N    . ALA A 1 88  ? 0.520   -7.021  2.865   1.00 0.00 ? 88  ALA A N    2  
ATOM 3035  C CA   . ALA A 1 88  ? 0.778   -5.635  3.237   1.00 0.00 ? 88  ALA A CA   2  
ATOM 3036  C C    . ALA A 1 88  ? 1.114   -4.792  2.011   1.00 0.00 ? 88  ALA A C    2  
ATOM 3037  O O    . ALA A 1 88  ? 2.199   -4.911  1.443   1.00 0.00 ? 88  ALA A O    2  
ATOM 3038  C CB   . ALA A 1 88  ? 1.906   -5.563  4.255   1.00 0.00 ? 88  ALA A CB   2  
ATOM 3039  H H    . ALA A 1 88  ? 0.944   -7.387  2.062   1.00 0.00 ? 88  ALA A H    2  
ATOM 3040  H HA   . ALA A 1 88  ? -0.116  -5.241  3.698   1.00 0.00 ? 88  ALA A HA   2  
ATOM 3041  H HB1  . ALA A 1 88  ? 2.734   -5.010  3.835   1.00 0.00 ? 88  ALA A HB1  2  
ATOM 3042  H HB2  . ALA A 1 88  ? 1.555   -5.065  5.146   1.00 0.00 ? 88  ALA A HB2  2  
ATOM 3043  H HB3  . ALA A 1 88  ? 2.231   -6.562  4.504   1.00 0.00 ? 88  ALA A HB3  2  
ATOM 3044  N N    . ALA A 1 89  ? 0.176   -3.941  1.609   1.00 0.00 ? 89  ALA A N    2  
ATOM 3045  C CA   . ALA A 1 89  ? 0.373   -3.077  0.452   1.00 0.00 ? 89  ALA A CA   2  
ATOM 3046  C C    . ALA A 1 89  ? 1.706   -2.340  0.538   1.00 0.00 ? 89  ALA A C    2  
ATOM 3047  O O    . ALA A 1 89  ? 2.094   -1.863  1.605   1.00 0.00 ? 89  ALA A O    2  
ATOM 3048  C CB   . ALA A 1 89  ? -0.774  -2.085  0.332   1.00 0.00 ? 89  ALA A CB   2  
ATOM 3049  H H    . ALA A 1 89  ? -0.669  -3.892  2.104   1.00 0.00 ? 89  ALA A H    2  
ATOM 3050  H HA   . ALA A 1 89  ? 0.374   -3.698  -0.432  1.00 0.00 ? 89  ALA A HA   2  
ATOM 3051  H HB1  . ALA A 1 89  ? -1.250  -2.201  -0.631  1.00 0.00 ? 89  ALA A HB1  2  
ATOM 3052  H HB2  . ALA A 1 89  ? -1.494  -2.271  1.114   1.00 0.00 ? 89  ALA A HB2  2  
ATOM 3053  H HB3  . ALA A 1 89  ? -0.391  -1.079  0.426   1.00 0.00 ? 89  ALA A HB3  2  
ATOM 3054  N N    . ARG A 1 90  ? 2.401   -2.251  -0.591  1.00 0.00 ? 90  ARG A N    2  
ATOM 3055  C CA   . ARG A 1 90  ? 3.691   -1.573  -0.642  1.00 0.00 ? 90  ARG A CA   2  
ATOM 3056  C C    . ARG A 1 90  ? 3.678   -0.457  -1.682  1.00 0.00 ? 90  ARG A C    2  
ATOM 3057  O O    . ARG A 1 90  ? 3.437   -0.699  -2.864  1.00 0.00 ? 90  ARG A O    2  
ATOM 3058  C CB   . ARG A 1 90  ? 4.804   -2.573  -0.965  1.00 0.00 ? 90  ARG A CB   2  
ATOM 3059  C CG   . ARG A 1 90  ? 6.186   -2.104  -0.541  1.00 0.00 ? 90  ARG A CG   2  
ATOM 3060  C CD   . ARG A 1 90  ? 7.273   -2.719  -1.408  1.00 0.00 ? 90  ARG A CD   2  
ATOM 3061  N NE   . ARG A 1 90  ? 7.740   -3.996  -0.876  1.00 0.00 ? 90  ARG A NE   2  
ATOM 3062  C CZ   . ARG A 1 90  ? 8.535   -4.105  0.183   1.00 0.00 ? 90  ARG A CZ   2  
ATOM 3063  N NH1  . ARG A 1 90  ? 8.949   -3.018  0.819   1.00 0.00 ? 90  ARG A NH1  2  
ATOM 3064  N NH2  . ARG A 1 90  ? 8.917   -5.303  0.607   1.00 0.00 ? 90  ARG A NH2  2  
ATOM 3065  H H    . ARG A 1 90  ? 2.039   -2.651  -1.409  1.00 0.00 ? 90  ARG A H    2  
ATOM 3066  H HA   . ARG A 1 90  ? 3.878   -1.142  0.330   1.00 0.00 ? 90  ARG A HA   2  
ATOM 3067  H HB2  . ARG A 1 90  ? 4.593   -3.504  -0.459  1.00 0.00 ? 90  ARG A HB2  2  
ATOM 3068  H HB3  . ARG A 1 90  ? 4.817   -2.746  -2.030  1.00 0.00 ? 90  ARG A HB3  2  
ATOM 3069  H HG2  . ARG A 1 90  ? 6.234   -1.028  -0.632  1.00 0.00 ? 90  ARG A HG2  2  
ATOM 3070  H HG3  . ARG A 1 90  ? 6.353   -2.388  0.487   1.00 0.00 ? 90  ARG A HG3  2  
ATOM 3071  H HD2  . ARG A 1 90  ? 6.878   -2.876  -2.401  1.00 0.00 ? 90  ARG A HD2  2  
ATOM 3072  H HD3  . ARG A 1 90  ? 8.106   -2.034  -1.457  1.00 0.00 ? 90  ARG A HD3  2  
ATOM 3073  H HE   . ARG A 1 90  ? 7.446   -4.812  -1.332  1.00 0.00 ? 90  ARG A HE   2  
ATOM 3074  H HH11 . ARG A 1 90  ? 8.662   -2.114  0.503   1.00 0.00 ? 90  ARG A HH11 2  
ATOM 3075  H HH12 . ARG A 1 90  ? 9.546   -3.103  1.617   1.00 0.00 ? 90  ARG A HH12 2  
ATOM 3076  H HH21 . ARG A 1 90  ? 8.607   -6.124  0.129   1.00 0.00 ? 90  ARG A HH21 2  
ATOM 3077  H HH22 . ARG A 1 90  ? 9.515   -5.384  1.403   1.00 0.00 ? 90  ARG A HH22 2  
ATOM 3078  N N    . SER A 1 91  ? 3.940   0.766   -1.233  1.00 0.00 ? 91  SER A N    2  
ATOM 3079  C CA   . SER A 1 91  ? 3.954   1.921   -2.123  1.00 0.00 ? 91  SER A CA   2  
ATOM 3080  C C    . SER A 1 91  ? 5.328   2.585   -2.130  1.00 0.00 ? 91  SER A C    2  
ATOM 3081  O O    . SER A 1 91  ? 6.089   2.504   -1.166  1.00 0.00 ? 91  SER A O    2  
ATOM 3082  C CB   . SER A 1 91  ? 2.888   2.932   -1.699  1.00 0.00 ? 91  SER A CB   2  
ATOM 3083  O OG   . SER A 1 91  ? 3.277   4.254   -2.030  1.00 0.00 ? 91  SER A OG   2  
ATOM 3084  H H    . SER A 1 91  ? 4.125   0.895   -0.279  1.00 0.00 ? 91  SER A H    2  
ATOM 3085  H HA   . SER A 1 91  ? 3.731   1.573   -3.121  1.00 0.00 ? 91  SER A HA   2  
ATOM 3086  H HB2  . SER A 1 91  ? 1.960   2.706   -2.203  1.00 0.00 ? 91  SER A HB2  2  
ATOM 3087  H HB3  . SER A 1 91  ? 2.742   2.870   -0.630  1.00 0.00 ? 91  SER A HB3  2  
ATOM 3088  H HG   . SER A 1 91  ? 2.626   4.642   -2.619  1.00 0.00 ? 91  SER A HG   2  
ATOM 3089  N N    . PRO A 1 92  ? 5.653   3.259   -3.243  1.00 0.00 ? 92  PRO A N    2  
ATOM 3090  C CA   . PRO A 1 92  ? 6.935   3.952   -3.402  1.00 0.00 ? 92  PRO A CA   2  
ATOM 3091  C C    . PRO A 1 92  ? 7.045   5.182   -2.508  1.00 0.00 ? 92  PRO A C    2  
ATOM 3092  O O    . PRO A 1 92  ? 8.106   5.797   -2.412  1.00 0.00 ? 92  PRO A O    2  
ATOM 3093  C CB   . PRO A 1 92  ? 6.935   4.362   -4.877  1.00 0.00 ? 92  PRO A CB   2  
ATOM 3094  C CG   . PRO A 1 92  ? 5.494   4.449   -5.247  1.00 0.00 ? 92  PRO A CG   2  
ATOM 3095  C CD   . PRO A 1 92  ? 4.794   3.398   -4.430  1.00 0.00 ? 92  PRO A CD   2  
ATOM 3096  H HA   . PRO A 1 92  ? 7.769   3.293   -3.210  1.00 0.00 ? 92  PRO A HA   2  
ATOM 3097  H HB2  . PRO A 1 92  ? 7.431   5.316   -4.988  1.00 0.00 ? 92  PRO A HB2  2  
ATOM 3098  H HB3  . PRO A 1 92  ? 7.448   3.613   -5.463  1.00 0.00 ? 92  PRO A HB3  2  
ATOM 3099  H HG2  . PRO A 1 92  ? 5.112   5.428   -5.005  1.00 0.00 ? 92  PRO A HG2  2  
ATOM 3100  H HG3  . PRO A 1 92  ? 5.373   4.247   -6.301  1.00 0.00 ? 92  PRO A HG3  2  
ATOM 3101  H HD2  . PRO A 1 92  ? 3.805   3.732   -4.154  1.00 0.00 ? 92  PRO A HD2  2  
ATOM 3102  H HD3  . PRO A 1 92  ? 4.741   2.468   -4.978  1.00 0.00 ? 92  PRO A HD3  2  
ATOM 3103  N N    . GLN A 1 93  ? 5.942   5.533   -1.855  1.00 0.00 ? 93  GLN A N    2  
ATOM 3104  C CA   . GLN A 1 93  ? 5.916   6.691   -0.968  1.00 0.00 ? 93  GLN A CA   2  
ATOM 3105  C C    . GLN A 1 93  ? 6.114   6.268   0.484   1.00 0.00 ? 93  GLN A C    2  
ATOM 3106  O O    . GLN A 1 93  ? 6.549   7.062   1.318   1.00 0.00 ? 93  GLN A O    2  
ATOM 3107  C CB   . GLN A 1 93  ? 4.593   7.444   -1.116  1.00 0.00 ? 93  GLN A CB   2  
ATOM 3108  C CG   . GLN A 1 93  ? 4.709   8.935   -0.848  1.00 0.00 ? 93  GLN A CG   2  
ATOM 3109  C CD   . GLN A 1 93  ? 5.942   9.548   -1.480  1.00 0.00 ? 93  GLN A CD   2  
ATOM 3110  O OE1  . GLN A 1 93  ? 6.882   9.937   -0.786  1.00 0.00 ? 93  GLN A OE1  2  
ATOM 3111  N NE2  . GLN A 1 93  ? 5.946   9.639   -2.805  1.00 0.00 ? 93  GLN A NE2  2  
ATOM 3112  H H    . GLN A 1 93  ? 5.127   5.003   -1.972  1.00 0.00 ? 93  GLN A H    2  
ATOM 3113  H HA   . GLN A 1 93  ? 6.726   7.345   -1.253  1.00 0.00 ? 93  GLN A HA   2  
ATOM 3114  H HB2  . GLN A 1 93  ? 4.226   7.308   -2.123  1.00 0.00 ? 93  GLN A HB2  2  
ATOM 3115  H HB3  . GLN A 1 93  ? 3.877   7.030   -0.422  1.00 0.00 ? 93  GLN A HB3  2  
ATOM 3116  H HG2  . GLN A 1 93  ? 3.835   9.429   -1.247  1.00 0.00 ? 93  GLN A HG2  2  
ATOM 3117  H HG3  . GLN A 1 93  ? 4.753   9.093   0.220   1.00 0.00 ? 93  GLN A HG3  2  
ATOM 3118  H HE21 . GLN A 1 93  ? 5.161   9.310   -3.293  1.00 0.00 ? 93  GLN A HE21 2  
ATOM 3119  H HE22 . GLN A 1 93  ? 6.730   10.031  -3.241  1.00 0.00 ? 93  GLN A HE22 2  
ATOM 3120  N N    . GLY A 1 94  ? 5.792   5.012   0.780   1.00 0.00 ? 94  GLY A N    2  
ATOM 3121  C CA   . GLY A 1 94  ? 5.941   4.507   2.132   1.00 0.00 ? 94  GLY A CA   2  
ATOM 3122  C C    . GLY A 1 94  ? 5.143   3.240   2.368   1.00 0.00 ? 94  GLY A C    2  
ATOM 3123  O O    . GLY A 1 94  ? 4.034   3.091   1.854   1.00 0.00 ? 94  GLY A O    2  
ATOM 3124  H H    . GLY A 1 94  ? 5.451   4.424   0.073   1.00 0.00 ? 94  GLY A H    2  
ATOM 3125  H HA2  . GLY A 1 94  ? 6.986   4.301   2.314   1.00 0.00 ? 94  GLY A HA2  2  
ATOM 3126  H HA3  . GLY A 1 94  ? 5.607   5.264   2.826   1.00 0.00 ? 94  GLY A HA3  2  
ATOM 3127  N N    . LEU A 1 95  ? 5.707   2.324   3.148   1.00 0.00 ? 95  LEU A N    2  
ATOM 3128  C CA   . LEU A 1 95  ? 5.040   1.062   3.451   1.00 0.00 ? 95  LEU A CA   2  
ATOM 3129  C C    . LEU A 1 95  ? 3.726   1.303   4.186   1.00 0.00 ? 95  LEU A C    2  
ATOM 3130  O O    . LEU A 1 95  ? 3.572   2.298   4.894   1.00 0.00 ? 95  LEU A O    2  
ATOM 3131  C CB   . LEU A 1 95  ? 5.954   0.170   4.293   1.00 0.00 ? 95  LEU A CB   2  
ATOM 3132  C CG   . LEU A 1 95  ? 5.437   -1.240  4.579   1.00 0.00 ? 95  LEU A CG   2  
ATOM 3133  C CD1  . LEU A 1 95  ? 5.343   -2.045  3.292   1.00 0.00 ? 95  LEU A CD1  2  
ATOM 3134  C CD2  . LEU A 1 95  ? 6.335   -1.944  5.586   1.00 0.00 ? 95  LEU A CD2  2  
ATOM 3135  H H    . LEU A 1 95  ? 6.592   2.499   3.529   1.00 0.00 ? 95  LEU A H    2  
ATOM 3136  H HA   . LEU A 1 95  ? 4.829   0.566   2.515   1.00 0.00 ? 95  LEU A HA   2  
ATOM 3137  H HB2  . LEU A 1 95  ? 6.896   0.078   3.775   1.00 0.00 ? 95  LEU A HB2  2  
ATOM 3138  H HB3  . LEU A 1 95  ? 6.113   0.663   5.241   1.00 0.00 ? 95  LEU A HB3  2  
ATOM 3139  H HG   . LEU A 1 95  ? 4.444   -1.174  5.003   1.00 0.00 ? 95  LEU A HG   2  
ATOM 3140  H HD11 . LEU A 1 95  ? 4.308   -2.267  3.081   1.00 0.00 ? 95  LEU A HD11 2  
ATOM 3141  H HD12 . LEU A 1 95  ? 5.893   -2.968  3.403   1.00 0.00 ? 95  LEU A HD12 2  
ATOM 3142  H HD13 . LEU A 1 95  ? 5.762   -1.472  2.478   1.00 0.00 ? 95  LEU A HD13 2  
ATOM 3143  H HD21 . LEU A 1 95  ? 6.975   -2.643  5.069   1.00 0.00 ? 95  LEU A HD21 2  
ATOM 3144  H HD22 . LEU A 1 95  ? 5.725   -2.476  6.302   1.00 0.00 ? 95  LEU A HD22 2  
ATOM 3145  H HD23 . LEU A 1 95  ? 6.940   -1.213  6.100   1.00 0.00 ? 95  LEU A HD23 2  
ATOM 3146  N N    . GLY A 1 96  ? 2.781   0.384   4.016   1.00 0.00 ? 96  GLY A N    2  
ATOM 3147  C CA   . GLY A 1 96  ? 1.493   0.514   4.672   1.00 0.00 ? 96  GLY A CA   2  
ATOM 3148  C C    . GLY A 1 96  ? 1.371   -0.378  5.892   1.00 0.00 ? 96  GLY A C    2  
ATOM 3149  O O    . GLY A 1 96  ? 2.308   -0.493  6.681   1.00 0.00 ? 96  GLY A O    2  
ATOM 3150  H H    . GLY A 1 96  ? 2.960   -0.389  3.440   1.00 0.00 ? 96  GLY A H    2  
ATOM 3151  H HA2  . GLY A 1 96  ? 1.357   1.541   4.974   1.00 0.00 ? 96  GLY A HA2  2  
ATOM 3152  H HA3  . GLY A 1 96  ? 0.716   0.250   3.969   1.00 0.00 ? 96  GLY A HA3  2  
ATOM 3153  N N    . ALA A 1 97  ? 0.212   -1.009  6.048   1.00 0.00 ? 97  ALA A N    2  
ATOM 3154  C CA   . ALA A 1 97  ? -0.029  -1.895  7.180   1.00 0.00 ? 97  ALA A CA   2  
ATOM 3155  C C    . ALA A 1 97  ? -0.173  -3.343  6.724   1.00 0.00 ? 97  ALA A C    2  
ATOM 3156  O O    . ALA A 1 97  ? -0.408  -3.612  5.546   1.00 0.00 ? 97  ALA A O    2  
ATOM 3157  C CB   . ALA A 1 97  ? -1.270  -1.453  7.941   1.00 0.00 ? 97  ALA A CB   2  
ATOM 3158  H H    . ALA A 1 97  ? -0.497  -0.877  5.385   1.00 0.00 ? 97  ALA A H    2  
ATOM 3159  H HA   . ALA A 1 97  ? 0.818   -1.821  7.848   1.00 0.00 ? 97  ALA A HA   2  
ATOM 3160  H HB1  . ALA A 1 97  ? -1.726  -2.311  8.413   1.00 0.00 ? 97  ALA A HB1  2  
ATOM 3161  H HB2  . ALA A 1 97  ? -0.993  -0.732  8.695   1.00 0.00 ? 97  ALA A HB2  2  
ATOM 3162  H HB3  . ALA A 1 97  ? -1.973  -1.005  7.254   1.00 0.00 ? 97  ALA A HB3  2  
ATOM 3163  N N    . SER A 1 98  ? -0.029  -4.271  7.664   1.00 0.00 ? 98  SER A N    2  
ATOM 3164  C CA   . SER A 1 98  ? -0.139  -5.693  7.357   1.00 0.00 ? 98  SER A CA   2  
ATOM 3165  C C    . SER A 1 98  ? -1.458  -6.260  7.872   1.00 0.00 ? 98  SER A C    2  
ATOM 3166  O O    . SER A 1 98  ? -1.914  -5.913  8.962   1.00 0.00 ? 98  SER A O    2  
ATOM 3167  C CB   . SER A 1 98  ? 1.033   -6.461  7.972   1.00 0.00 ? 98  SER A CB   2  
ATOM 3168  O OG   . SER A 1 98  ? 2.271   -6.001  7.456   1.00 0.00 ? 98  SER A OG   2  
ATOM 3169  H H    . SER A 1 98  ? 0.158   -3.994  8.586   1.00 0.00 ? 98  SER A H    2  
ATOM 3170  H HA   . SER A 1 98  ? -0.107  -5.804  6.284   1.00 0.00 ? 98  SER A HA   2  
ATOM 3171  H HB2  . SER A 1 98  ? 1.030   -6.322  9.042   1.00 0.00 ? 98  SER A HB2  2  
ATOM 3172  H HB3  . SER A 1 98  ? 0.930   -7.512  7.745   1.00 0.00 ? 98  SER A HB3  2  
ATOM 3173  H HG   . SER A 1 98  ? 2.232   -5.050  7.331   1.00 0.00 ? 98  SER A HG   2  
ATOM 3174  N N    . THR A 1 99  ? -2.069  -7.135  7.079   1.00 0.00 ? 99  THR A N    2  
ATOM 3175  C CA   . THR A 1 99  ? -3.336  -7.749  7.451   1.00 0.00 ? 99  THR A CA   2  
ATOM 3176  C C    . THR A 1 99  ? -3.145  -8.774  8.563   1.00 0.00 ? 99  THR A C    2  
ATOM 3177  O O    . THR A 1 99  ? -2.040  -9.274  8.776   1.00 0.00 ? 99  THR A O    2  
ATOM 3178  C CB   . THR A 1 99  ? -4.004  -8.437  6.245   1.00 0.00 ? 99  THR A CB   2  
ATOM 3179  O OG1  . THR A 1 99  ? -3.058  -9.279  5.577   1.00 0.00 ? 99  THR A OG1  2  
ATOM 3180  C CG2  . THR A 1 99  ? -4.550  -7.406  5.269   1.00 0.00 ? 99  THR A CG2  2  
ATOM 3181  H H    . THR A 1 99  ? -1.656  -7.371  6.222   1.00 0.00 ? 99  THR A H    2  
ATOM 3182  H HA   . THR A 1 99  ? -3.995  -6.969  7.804   1.00 0.00 ? 99  THR A HA   2  
ATOM 3183  H HB   . THR A 1 99  ? -4.824  -9.042  6.603   1.00 0.00 ? 99  THR A HB   2  
ATOM 3184  H HG1  . THR A 1 99  ? -2.652  -9.872  6.213   1.00 0.00 ? 99  THR A HG1  2  
ATOM 3185  H HG21 . THR A 1 99  ? -4.411  -6.415  5.676   1.00 0.00 ? 99  THR A HG21 2  
ATOM 3186  H HG22 . THR A 1 99  ? -5.603  -7.585  5.109   1.00 0.00 ? 99  THR A HG22 2  
ATOM 3187  H HG23 . THR A 1 99  ? -4.025  -7.486  4.329   1.00 0.00 ? 99  THR A HG23 2  
ATOM 3188  N N    . ALA A 1 100 ? -4.227  -9.083  9.270   1.00 0.00 ? 100 ALA A N    2  
ATOM 3189  C CA   . ALA A 1 100 ? -4.178  -10.050 10.359  1.00 0.00 ? 100 ALA A CA   2  
ATOM 3190  C C    . ALA A 1 100 ? -3.337  -11.264 9.978   1.00 0.00 ? 100 ALA A C    2  
ATOM 3191  O O    . ALA A 1 100 ? -3.192  -11.583 8.798   1.00 0.00 ? 100 ALA A O    2  
ATOM 3192  C CB   . ALA A 1 100 ? -5.584  -10.481 10.747  1.00 0.00 ? 100 ALA A CB   2  
ATOM 3193  H H    . ALA A 1 100 ? -5.079  -8.650  9.053   1.00 0.00 ? 100 ALA A H    2  
ATOM 3194  H HA   . ALA A 1 100 ? -3.727  -9.568  11.215  1.00 0.00 ? 100 ALA A HA   2  
ATOM 3195  H HB1  . ALA A 1 100 ? -5.637  -11.560 10.765  1.00 0.00 ? 100 ALA A HB1  2  
ATOM 3196  H HB2  . ALA A 1 100 ? -5.823  -10.092 11.725  1.00 0.00 ? 100 ALA A HB2  2  
ATOM 3197  H HB3  . ALA A 1 100 ? -6.290  -10.098 10.024  1.00 0.00 ? 100 ALA A HB3  2  
ATOM 3198  N N    . GLU A 1 101 ? -2.785  -11.936 10.983  1.00 0.00 ? 101 GLU A N    2  
ATOM 3199  C CA   . GLU A 1 101 ? -1.957  -13.114 10.751  1.00 0.00 ? 101 GLU A CA   2  
ATOM 3200  C C    . GLU A 1 101 ? -2.822  -14.336 10.456  1.00 0.00 ? 101 GLU A C    2  
ATOM 3201  O O    . GLU A 1 101 ? -3.554  -14.815 11.323  1.00 0.00 ? 101 GLU A O    2  
ATOM 3202  C CB   . GLU A 1 101 ? -1.066  -13.386 11.964  1.00 0.00 ? 101 GLU A CB   2  
ATOM 3203  C CG   . GLU A 1 101 ? 0.198   -14.161 11.630  1.00 0.00 ? 101 GLU A CG   2  
ATOM 3204  C CD   . GLU A 1 101 ? 1.056   -14.431 12.851  1.00 0.00 ? 101 GLU A CD   2  
ATOM 3205  O OE1  . GLU A 1 101 ? 1.650   -13.469 13.382  1.00 0.00 ? 101 GLU A OE1  2  
ATOM 3206  O OE2  . GLU A 1 101 ? 1.135   -15.603 13.274  1.00 0.00 ? 101 GLU A OE2  2  
ATOM 3207  H H    . GLU A 1 101 ? -2.937  -11.632 11.902  1.00 0.00 ? 101 GLU A H    2  
ATOM 3208  H HA   . GLU A 1 101 ? -1.331  -12.916 9.894   1.00 0.00 ? 101 GLU A HA   2  
ATOM 3209  H HB2  . GLU A 1 101 ? -0.779  -12.442 12.404  1.00 0.00 ? 101 GLU A HB2  2  
ATOM 3210  H HB3  . GLU A 1 101 ? -1.630  -13.954 12.689  1.00 0.00 ? 101 GLU A HB3  2  
ATOM 3211  H HG2  . GLU A 1 101 ? -0.081  -15.106 11.189  1.00 0.00 ? 101 GLU A HG2  2  
ATOM 3212  H HG3  . GLU A 1 101 ? 0.777   -13.590 10.920  1.00 0.00 ? 101 GLU A HG3  2  
ATOM 3213  N N    . ILE A 1 102 ? -2.731  -14.836 9.228   1.00 0.00 ? 102 ILE A N    2  
ATOM 3214  C CA   . ILE A 1 102 ? -3.504  -16.002 8.820   1.00 0.00 ? 102 ILE A CA   2  
ATOM 3215  C C    . ILE A 1 102 ? -2.593  -17.112 8.306   1.00 0.00 ? 102 ILE A C    2  
ATOM 3216  O O    . ILE A 1 102 ? -1.455  -16.862 7.910   1.00 0.00 ? 102 ILE A O    2  
ATOM 3217  C CB   . ILE A 1 102 ? -4.526  -15.645 7.725   1.00 0.00 ? 102 ILE A CB   2  
ATOM 3218  C CG1  . ILE A 1 102 ? -3.817  -15.427 6.386   1.00 0.00 ? 102 ILE A CG1  2  
ATOM 3219  C CG2  . ILE A 1 102 ? -5.315  -14.406 8.121   1.00 0.00 ? 102 ILE A CG2  2  
ATOM 3220  C CD1  . ILE A 1 102 ? -4.766  -15.240 5.223   1.00 0.00 ? 102 ILE A CD1  2  
ATOM 3221  H H    . ILE A 1 102 ? -2.130  -14.410 8.582   1.00 0.00 ? 102 ILE A H    2  
ATOM 3222  H HA   . ILE A 1 102 ? -4.043  -16.364 9.684   1.00 0.00 ? 102 ILE A HA   2  
ATOM 3223  H HB   . ILE A 1 102 ? -5.218  -16.467 7.628   1.00 0.00 ? 102 ILE A HB   2  
ATOM 3224  H HG12 . ILE A 1 102 ? -3.199  -14.546 6.453   1.00 0.00 ? 102 ILE A HG12 2  
ATOM 3225  H HG13 . ILE A 1 102 ? -3.195  -16.284 6.174   1.00 0.00 ? 102 ILE A HG13 2  
ATOM 3226  H HG21 . ILE A 1 102 ? -6.304  -14.696 8.442   1.00 0.00 ? 102 ILE A HG21 2  
ATOM 3227  H HG22 . ILE A 1 102 ? -4.809  -13.901 8.930   1.00 0.00 ? 102 ILE A HG22 2  
ATOM 3228  H HG23 . ILE A 1 102 ? -5.392  -13.741 7.273   1.00 0.00 ? 102 ILE A HG23 2  
ATOM 3229  H HD11 . ILE A 1 102 ? -5.519  -16.014 5.245   1.00 0.00 ? 102 ILE A HD11 2  
ATOM 3230  H HD12 . ILE A 1 102 ? -5.241  -14.273 5.296   1.00 0.00 ? 102 ILE A HD12 2  
ATOM 3231  H HD13 . ILE A 1 102 ? -4.215  -15.301 4.296   1.00 0.00 ? 102 ILE A HD13 2  
ATOM 3232  N N    . SER A 1 103 ? -3.103  -18.340 8.315   1.00 0.00 ? 103 SER A N    2  
ATOM 3233  C CA   . SER A 1 103 ? -2.335  -19.490 7.853   1.00 0.00 ? 103 SER A CA   2  
ATOM 3234  C C    . SER A 1 103 ? -3.227  -20.470 7.096   1.00 0.00 ? 103 SER A C    2  
ATOM 3235  O O    . SER A 1 103 ? -4.447  -20.467 7.257   1.00 0.00 ? 103 SER A O    2  
ATOM 3236  C CB   . SER A 1 103 ? -1.671  -20.196 9.036   1.00 0.00 ? 103 SER A CB   2  
ATOM 3237  O OG   . SER A 1 103 ? -2.494  -20.144 10.188  1.00 0.00 ? 103 SER A OG   2  
ATOM 3238  H H    . SER A 1 103 ? -4.017  -18.475 8.644   1.00 0.00 ? 103 SER A H    2  
ATOM 3239  H HA   . SER A 1 103 ? -1.568  -19.129 7.183   1.00 0.00 ? 103 SER A HA   2  
ATOM 3240  H HB2  . SER A 1 103 ? -1.493  -21.230 8.782   1.00 0.00 ? 103 SER A HB2  2  
ATOM 3241  H HB3  . SER A 1 103 ? -0.730  -19.713 9.257   1.00 0.00 ? 103 SER A HB3  2  
ATOM 3242  H HG   . SER A 1 103 ? -2.133  -19.508 10.811  1.00 0.00 ? 103 SER A HG   2  
ATOM 3243  N N    . ALA A 1 104 ? -2.608  -21.308 6.271   1.00 0.00 ? 104 ALA A N    2  
ATOM 3244  C CA   . ALA A 1 104 ? -3.344  -22.295 5.491   1.00 0.00 ? 104 ALA A CA   2  
ATOM 3245  C C    . ALA A 1 104 ? -2.601  -23.626 5.449   1.00 0.00 ? 104 ALA A C    2  
ATOM 3246  O O    . ALA A 1 104 ? -1.374  -23.660 5.364   1.00 0.00 ? 104 ALA A O    2  
ATOM 3247  C CB   . ALA A 1 104 ? -3.586  -21.779 4.080   1.00 0.00 ? 104 ALA A CB   2  
ATOM 3248  H H    . ALA A 1 104 ? -1.633  -21.261 6.185   1.00 0.00 ? 104 ALA A H    2  
ATOM 3249  H HA   . ALA A 1 104 ? -4.304  -22.444 5.963   1.00 0.00 ? 104 ALA A HA   2  
ATOM 3250  H HB1  . ALA A 1 104 ? -4.214  -20.900 4.122   1.00 0.00 ? 104 ALA A HB1  2  
ATOM 3251  H HB2  . ALA A 1 104 ? -2.642  -21.526 3.622   1.00 0.00 ? 104 ALA A HB2  2  
ATOM 3252  H HB3  . ALA A 1 104 ? -4.077  -22.543 3.496   1.00 0.00 ? 104 ALA A HB3  2  
ATOM 3253  N N    . ARG A 1 105 ? -3.353  -24.720 5.509   1.00 0.00 ? 105 ARG A N    2  
ATOM 3254  C CA   . ARG A 1 105 ? -2.766  -26.054 5.480   1.00 0.00 ? 105 ARG A CA   2  
ATOM 3255  C C    . ARG A 1 105 ? -2.858  -26.658 4.082   1.00 0.00 ? 105 ARG A C    2  
ATOM 3256  O O    . ARG A 1 105 ? -3.927  -26.677 3.471   1.00 0.00 ? 105 ARG A O    2  
ATOM 3257  C CB   . ARG A 1 105 ? -3.467  -26.965 6.488   1.00 0.00 ? 105 ARG A CB   2  
ATOM 3258  C CG   . ARG A 1 105 ? -2.973  -28.403 6.456   1.00 0.00 ? 105 ARG A CG   2  
ATOM 3259  C CD   . ARG A 1 105 ? -3.363  -29.154 7.719   1.00 0.00 ? 105 ARG A CD   2  
ATOM 3260  N NE   . ARG A 1 105 ? -4.763  -29.570 7.698   1.00 0.00 ? 105 ARG A NE   2  
ATOM 3261  C CZ   . ARG A 1 105 ? -5.332  -30.284 8.663   1.00 0.00 ? 105 ARG A CZ   2  
ATOM 3262  N NH1  . ARG A 1 105 ? -4.625  -30.659 9.720   1.00 0.00 ? 105 ARG A NH1  2  
ATOM 3263  N NH2  . ARG A 1 105 ? -6.612  -30.624 8.572   1.00 0.00 ? 105 ARG A NH2  2  
ATOM 3264  H H    . ARG A 1 105 ? -4.327  -24.628 5.576   1.00 0.00 ? 105 ARG A H    2  
ATOM 3265  H HA   . ARG A 1 105 ? -1.725  -25.964 5.752   1.00 0.00 ? 105 ARG A HA   2  
ATOM 3266  H HB2  . ARG A 1 105 ? -3.305  -26.575 7.483   1.00 0.00 ? 105 ARG A HB2  2  
ATOM 3267  H HB3  . ARG A 1 105 ? -4.526  -26.966 6.279   1.00 0.00 ? 105 ARG A HB3  2  
ATOM 3268  H HG2  . ARG A 1 105 ? -3.408  -28.904 5.604   1.00 0.00 ? 105 ARG A HG2  2  
ATOM 3269  H HG3  . ARG A 1 105 ? -1.897  -28.402 6.366   1.00 0.00 ? 105 ARG A HG3  2  
ATOM 3270  H HD2  . ARG A 1 105 ? -2.739  -30.031 7.808   1.00 0.00 ? 105 ARG A HD2  2  
ATOM 3271  H HD3  . ARG A 1 105 ? -3.202  -28.510 8.570   1.00 0.00 ? 105 ARG A HD3  2  
ATOM 3272  H HE   . ARG A 1 105 ? -5.304  -29.304 6.926   1.00 0.00 ? 105 ARG A HE   2  
ATOM 3273  H HH11 . ARG A 1 105 ? -3.661  -30.403 9.792   1.00 0.00 ? 105 ARG A HH11 2  
ATOM 3274  H HH12 . ARG A 1 105 ? -5.057  -31.195 10.446  1.00 0.00 ? 105 ARG A HH12 2  
ATOM 3275  H HH21 . ARG A 1 105 ? -7.148  -30.343 7.777   1.00 0.00 ? 105 ARG A HH21 2  
ATOM 3276  H HH22 . ARG A 1 105 ? -7.039  -31.161 9.299   1.00 0.00 ? 105 ARG A HH22 2  
ATOM 3277  N N    . THR A 1 106 ? -1.729  -27.151 3.580   1.00 0.00 ? 106 THR A N    2  
ATOM 3278  C CA   . THR A 1 106 ? -1.682  -27.754 2.254   1.00 0.00 ? 106 THR A CA   2  
ATOM 3279  C C    . THR A 1 106 ? -2.377  -29.110 2.242   1.00 0.00 ? 106 THR A C    2  
ATOM 3280  O O    . THR A 1 106 ? -2.592  -29.717 3.291   1.00 0.00 ? 106 THR A O    2  
ATOM 3281  C CB   . THR A 1 106 ? -0.231  -27.928 1.768   1.00 0.00 ? 106 THR A CB   2  
ATOM 3282  O OG1  . THR A 1 106 ? 0.607   -28.324 2.860   1.00 0.00 ? 106 THR A OG1  2  
ATOM 3283  C CG2  . THR A 1 106 ? 0.295   -26.637 1.160   1.00 0.00 ? 106 THR A CG2  2  
ATOM 3284  H H    . THR A 1 106 ? -0.910  -27.106 4.115   1.00 0.00 ? 106 THR A H    2  
ATOM 3285  H HA   . THR A 1 106 ? -2.192  -27.093 1.568   1.00 0.00 ? 106 THR A HA   2  
ATOM 3286  H HB   . THR A 1 106 ? -0.211  -28.699 1.011   1.00 0.00 ? 106 THR A HB   2  
ATOM 3287  H HG1  . THR A 1 106 ? 1.523   -28.335 2.572   1.00 0.00 ? 106 THR A HG1  2  
ATOM 3288  H HG21 . THR A 1 106 ? 0.497   -25.925 1.947   1.00 0.00 ? 106 THR A HG21 2  
ATOM 3289  H HG22 . THR A 1 106 ? -0.443  -26.230 0.485   1.00 0.00 ? 106 THR A HG22 2  
ATOM 3290  H HG23 . THR A 1 106 ? 1.206   -26.840 0.617   1.00 0.00 ? 106 THR A HG23 2  
ATOM 3291  N N    . MET A 1 107 ? -2.725  -29.581 1.049   1.00 0.00 ? 107 MET A N    2  
ATOM 3292  C CA   . MET A 1 107 ? -3.394  -30.868 0.901   1.00 0.00 ? 107 MET A CA   2  
ATOM 3293  C C    . MET A 1 107 ? -2.527  -31.998 1.448   1.00 0.00 ? 107 MET A C    2  
ATOM 3294  O O    . MET A 1 107 ? -1.338  -31.811 1.703   1.00 0.00 ? 107 MET A O    2  
ATOM 3295  C CB   . MET A 1 107 ? -3.724  -31.130 -0.570  1.00 0.00 ? 107 MET A CB   2  
ATOM 3296  C CG   . MET A 1 107 ? -4.636  -30.080 -1.184  1.00 0.00 ? 107 MET A CG   2  
ATOM 3297  S SD   . MET A 1 107 ? -6.363  -30.298 -0.713  1.00 0.00 ? 107 MET A SD   2  
ATOM 3298  C CE   . MET A 1 107 ? -7.018  -28.668 -1.065  1.00 0.00 ? 107 MET A CE   2  
ATOM 3299  H H    . MET A 1 107 ? -2.527  -29.051 0.248   1.00 0.00 ? 107 MET A H    2  
ATOM 3300  H HA   . MET A 1 107 ? -4.314  -30.830 1.466   1.00 0.00 ? 107 MET A HA   2  
ATOM 3301  H HB2  . MET A 1 107 ? -2.805  -31.152 -1.134  1.00 0.00 ? 107 MET A HB2  2  
ATOM 3302  H HB3  . MET A 1 107 ? -4.212  -32.090 -0.652  1.00 0.00 ? 107 MET A HB3  2  
ATOM 3303  H HG2  . MET A 1 107 ? -4.310  -29.104 -0.858  1.00 0.00 ? 107 MET A HG2  2  
ATOM 3304  H HG3  . MET A 1 107 ? -4.559  -30.142 -2.259  1.00 0.00 ? 107 MET A HG3  2  
ATOM 3305  H HE1  . MET A 1 107 ? -6.202  -27.985 -1.253  1.00 0.00 ? 107 MET A HE1  2  
ATOM 3306  H HE2  . MET A 1 107 ? -7.654  -28.717 -1.936  1.00 0.00 ? 107 MET A HE2  2  
ATOM 3307  H HE3  . MET A 1 107 ? -7.591  -28.320 -0.218  1.00 0.00 ? 107 MET A HE3  2  
ATOM 3308  N N    . GLN A 1 108 ? -3.131  -33.168 1.627   1.00 0.00 ? 108 GLN A N    2  
ATOM 3309  C CA   . GLN A 1 108 ? -2.413  -34.327 2.145   1.00 0.00 ? 108 GLN A CA   2  
ATOM 3310  C C    . GLN A 1 108 ? -1.896  -35.201 1.007   1.00 0.00 ? 108 GLN A C    2  
ATOM 3311  O O    . GLN A 1 108 ? -2.576  -36.127 0.565   1.00 0.00 ? 108 GLN A O    2  
ATOM 3312  C CB   . GLN A 1 108 ? -3.321  -35.148 3.062   1.00 0.00 ? 108 GLN A CB   2  
ATOM 3313  C CG   . GLN A 1 108 ? -2.633  -36.355 3.678   1.00 0.00 ? 108 GLN A CG   2  
ATOM 3314  C CD   . GLN A 1 108 ? -3.556  -37.163 4.568   1.00 0.00 ? 108 GLN A CD   2  
ATOM 3315  O OE1  . GLN A 1 108 ? -4.657  -36.723 4.901   1.00 0.00 ? 108 GLN A OE1  2  
ATOM 3316  N NE2  . GLN A 1 108 ? -3.113  -38.352 4.957   1.00 0.00 ? 108 GLN A NE2  2  
ATOM 3317  H H    . GLN A 1 108 ? -4.081  -33.255 1.406   1.00 0.00 ? 108 GLN A H    2  
ATOM 3318  H HA   . GLN A 1 108 ? -1.571  -33.966 2.716   1.00 0.00 ? 108 GLN A HA   2  
ATOM 3319  H HB2  . GLN A 1 108 ? -3.673  -34.514 3.862   1.00 0.00 ? 108 GLN A HB2  2  
ATOM 3320  H HB3  . GLN A 1 108 ? -4.169  -35.497 2.491   1.00 0.00 ? 108 GLN A HB3  2  
ATOM 3321  H HG2  . GLN A 1 108 ? -2.274  -36.993 2.884   1.00 0.00 ? 108 GLN A HG2  2  
ATOM 3322  H HG3  . GLN A 1 108 ? -1.796  -36.013 4.269   1.00 0.00 ? 108 GLN A HG3  2  
ATOM 3323  H HE21 . GLN A 1 108 ? -2.225  -38.637 4.654   1.00 0.00 ? 108 GLN A HE21 2  
ATOM 3324  H HE22 . GLN A 1 108 ? -3.689  -38.895 5.533   1.00 0.00 ? 108 GLN A HE22 2  
ATOM 3325  N N    . SER A 1 109 ? -0.690  -34.899 0.537   1.00 0.00 ? 109 SER A N    2  
ATOM 3326  C CA   . SER A 1 109 ? -0.084  -35.655 -0.553  1.00 0.00 ? 109 SER A CA   2  
ATOM 3327  C C    . SER A 1 109 ? 0.370   -37.030 -0.074  1.00 0.00 ? 109 SER A C    2  
ATOM 3328  O O    . SER A 1 109 ? 0.786   -37.194 1.073   1.00 0.00 ? 109 SER A O    2  
ATOM 3329  C CB   . SER A 1 109 ? 1.106   -34.887 -1.134  1.00 0.00 ? 109 SER A CB   2  
ATOM 3330  O OG   . SER A 1 109 ? 1.593   -35.514 -2.307  1.00 0.00 ? 109 SER A OG   2  
ATOM 3331  H H    . SER A 1 109 ? -0.197  -34.149 0.931   1.00 0.00 ? 109 SER A H    2  
ATOM 3332  H HA   . SER A 1 109 ? -0.830  -35.782 -1.323  1.00 0.00 ? 109 SER A HA   2  
ATOM 3333  H HB2  . SER A 1 109 ? 0.797   -33.882 -1.379  1.00 0.00 ? 109 SER A HB2  2  
ATOM 3334  H HB3  . SER A 1 109 ? 1.900   -34.852 -0.402  1.00 0.00 ? 109 SER A HB3  2  
ATOM 3335  H HG   . SER A 1 109 ? 0.888   -36.022 -2.715  1.00 0.00 ? 109 SER A HG   2  
ATOM 3336  N N    . SER A 1 110 ? 0.285   -38.017 -0.961  1.00 0.00 ? 110 SER A N    2  
ATOM 3337  C CA   . SER A 1 110 ? 0.682   -39.380 -0.629  1.00 0.00 ? 110 SER A CA   2  
ATOM 3338  C C    . SER A 1 110 ? 1.981   -39.754 -1.336  1.00 0.00 ? 110 SER A C    2  
ATOM 3339  O O    . SER A 1 110 ? 2.286   -39.241 -2.412  1.00 0.00 ? 110 SER A O    2  
ATOM 3340  C CB   . SER A 1 110 ? -0.424  -40.364 -1.014  1.00 0.00 ? 110 SER A CB   2  
ATOM 3341  O OG   . SER A 1 110 ? -0.332  -41.557 -0.254  1.00 0.00 ? 110 SER A OG   2  
ATOM 3342  H H    . SER A 1 110 ? -0.055  -37.823 -1.859  1.00 0.00 ? 110 SER A H    2  
ATOM 3343  H HA   . SER A 1 110 ? 0.840   -39.428 0.438   1.00 0.00 ? 110 SER A HA   2  
ATOM 3344  H HB2  . SER A 1 110 ? -1.386  -39.909 -0.834  1.00 0.00 ? 110 SER A HB2  2  
ATOM 3345  H HB3  . SER A 1 110 ? -0.333  -40.611 -2.062  1.00 0.00 ? 110 SER A HB3  2  
ATOM 3346  H HG   . SER A 1 110 ? -0.453  -41.353 0.677   1.00 0.00 ? 110 SER A HG   2  
ATOM 3347  N N    . GLY A 1 111 ? 2.744   -40.654 -0.722  1.00 0.00 ? 111 GLY A N    2  
ATOM 3348  C CA   . GLY A 1 111 ? 4.001   -41.083 -1.306  1.00 0.00 ? 111 GLY A CA   2  
ATOM 3349  C C    . GLY A 1 111 ? 4.068   -42.585 -1.501  1.00 0.00 ? 111 GLY A C    2  
ATOM 3350  O O    . GLY A 1 111 ? 4.640   -43.313 -0.690  1.00 0.00 ? 111 GLY A O    2  
ATOM 3351  H H    . GLY A 1 111 ? 2.450   -41.030 0.135   1.00 0.00 ? 111 GLY A H    2  
ATOM 3352  H HA2  . GLY A 1 111 ? 4.124   -40.600 -2.264  1.00 0.00 ? 111 GLY A HA2  2  
ATOM 3353  H HA3  . GLY A 1 111 ? 4.809   -40.781 -0.655  1.00 0.00 ? 111 GLY A HA3  2  
ATOM 3354  N N    . PRO A 1 112 ? 3.470   -43.070 -2.600  1.00 0.00 ? 112 PRO A N    2  
ATOM 3355  C CA   . PRO A 1 112 ? 3.449   -44.499 -2.924  1.00 0.00 ? 112 PRO A CA   2  
ATOM 3356  C C    . PRO A 1 112 ? 4.824   -45.024 -3.321  1.00 0.00 ? 112 PRO A C    2  
ATOM 3357  O O    . PRO A 1 112 ? 5.510   -44.428 -4.152  1.00 0.00 ? 112 PRO A O    2  
ATOM 3358  C CB   . PRO A 1 112 ? 2.483   -44.580 -4.108  1.00 0.00 ? 112 PRO A CB   2  
ATOM 3359  C CG   . PRO A 1 112 ? 2.538   -43.230 -4.735  1.00 0.00 ? 112 PRO A CG   2  
ATOM 3360  C CD   . PRO A 1 112 ? 2.769   -42.260 -3.610  1.00 0.00 ? 112 PRO A CD   2  
ATOM 3361  H HA   . PRO A 1 112 ? 3.064   -45.087 -2.103  1.00 0.00 ? 112 PRO A HA   2  
ATOM 3362  H HB2  . PRO A 1 112 ? 2.812   -45.349 -4.793  1.00 0.00 ? 112 PRO A HB2  2  
ATOM 3363  H HB3  . PRO A 1 112 ? 1.489   -44.809 -3.752  1.00 0.00 ? 112 PRO A HB3  2  
ATOM 3364  H HG2  . PRO A 1 112 ? 3.354   -43.187 -5.441  1.00 0.00 ? 112 PRO A HG2  2  
ATOM 3365  H HG3  . PRO A 1 112 ? 1.602   -43.016 -5.228  1.00 0.00 ? 112 PRO A HG3  2  
ATOM 3366  H HD2  . PRO A 1 112 ? 3.386   -41.438 -3.941  1.00 0.00 ? 112 PRO A HD2  2  
ATOM 3367  H HD3  . PRO A 1 112 ? 1.827   -41.896 -3.226  1.00 0.00 ? 112 PRO A HD3  2  
ATOM 3368  N N    . SER A 1 113 ? 5.221   -46.143 -2.724  1.00 0.00 ? 113 SER A N    2  
ATOM 3369  C CA   . SER A 1 113 ? 6.517   -46.746 -3.014  1.00 0.00 ? 113 SER A CA   2  
ATOM 3370  C C    . SER A 1 113 ? 6.346   -48.138 -3.614  1.00 0.00 ? 113 SER A C    2  
ATOM 3371  O O    . SER A 1 113 ? 5.227   -48.584 -3.867  1.00 0.00 ? 113 SER A O    2  
ATOM 3372  C CB   . SER A 1 113 ? 7.362   -46.827 -1.741  1.00 0.00 ? 113 SER A CB   2  
ATOM 3373  O OG   . SER A 1 113 ? 8.729   -47.035 -2.048  1.00 0.00 ? 113 SER A OG   2  
ATOM 3374  H H    . SER A 1 113 ? 4.629   -46.572 -2.071  1.00 0.00 ? 113 SER A H    2  
ATOM 3375  H HA   . SER A 1 113 ? 7.022   -46.117 -3.731  1.00 0.00 ? 113 SER A HA   2  
ATOM 3376  H HB2  . SER A 1 113 ? 7.266   -45.905 -1.188  1.00 0.00 ? 113 SER A HB2  2  
ATOM 3377  H HB3  . SER A 1 113 ? 7.013   -47.649 -1.132  1.00 0.00 ? 113 SER A HB3  2  
ATOM 3378  H HG   . SER A 1 113 ? 9.197   -46.197 -2.012  1.00 0.00 ? 113 SER A HG   2  
ATOM 3379  N N    . SER A 1 114 ? 7.465   -48.820 -3.839  1.00 0.00 ? 114 SER A N    2  
ATOM 3380  C CA   . SER A 1 114 ? 7.440   -50.160 -4.413  1.00 0.00 ? 114 SER A CA   2  
ATOM 3381  C C    . SER A 1 114 ? 7.989   -51.185 -3.424  1.00 0.00 ? 114 SER A C    2  
ATOM 3382  O O    . SER A 1 114 ? 9.047   -50.985 -2.829  1.00 0.00 ? 114 SER A O    2  
ATOM 3383  C CB   . SER A 1 114 ? 8.254   -50.198 -5.708  1.00 0.00 ? 114 SER A CB   2  
ATOM 3384  O OG   . SER A 1 114 ? 7.464   -49.807 -6.817  1.00 0.00 ? 114 SER A OG   2  
ATOM 3385  H H    . SER A 1 114 ? 8.327   -48.411 -3.615  1.00 0.00 ? 114 SER A H    2  
ATOM 3386  H HA   . SER A 1 114 ? 6.413   -50.407 -4.635  1.00 0.00 ? 114 SER A HA   2  
ATOM 3387  H HB2  . SER A 1 114 ? 9.093   -49.525 -5.623  1.00 0.00 ? 114 SER A HB2  2  
ATOM 3388  H HB3  . SER A 1 114 ? 8.614   -51.203 -5.874  1.00 0.00 ? 114 SER A HB3  2  
ATOM 3389  H HG   . SER A 1 114 ? 6.789   -49.189 -6.528  1.00 0.00 ? 114 SER A HG   2  
ATOM 3390  N N    . GLY A 1 115 ? 7.260   -52.284 -3.254  1.00 0.00 ? 115 GLY A N    2  
ATOM 3391  C CA   . GLY A 1 115 ? 7.689   -53.324 -2.337  1.00 0.00 ? 115 GLY A CA   2  
ATOM 3392  C C    . GLY A 1 115 ? 6.752   -53.477 -1.155  1.00 0.00 ? 115 GLY A C    2  
ATOM 3393  O O    . GLY A 1 115 ? 5.572   -53.139 -1.243  1.00 0.00 ? 115 GLY A O    2  
ATOM 3394  H H    . GLY A 1 115 ? 6.425   -52.389 -3.756  1.00 0.00 ? 115 GLY A H    2  
ATOM 3395  H HA2  . GLY A 1 115 ? 7.736   -54.262 -2.870  1.00 0.00 ? 115 GLY A HA2  2  
ATOM 3396  H HA3  . GLY A 1 115 ? 8.675   -53.080 -1.970  1.00 0.00 ? 115 GLY A HA3  2  
ATOM 3397  N N    . GLY A 1 1   ? -11.836 -18.402 15.544  1.00 0.00 ? 1   GLY A N    3  
ATOM 3398  C CA   . GLY A 1 1   ? -11.038 -17.362 16.167  1.00 0.00 ? 1   GLY A CA   3  
ATOM 3399  C C    . GLY A 1 1   ? -9.894  -16.903 15.285  1.00 0.00 ? 1   GLY A C    3  
ATOM 3400  O O    . GLY A 1 1   ? -10.080 -16.067 14.400  1.00 0.00 ? 1   GLY A O    3  
ATOM 3401  H H1   . GLY A 1 1   ? -11.991 -18.385 14.576  1.00 0.00 ? 1   GLY A H1   3  
ATOM 3402  H HA2  . GLY A 1 1   ? -11.674 -16.517 16.383  1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3403  H HA3  . GLY A 1 1   ? -10.633 -17.741 17.094  1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3404  N N    . SER A 1 2   ? -8.706  -17.448 15.528  1.00 0.00 ? 2   SER A N    3  
ATOM 3405  C CA   . SER A 1 2   ? -7.526  -17.085 14.752  1.00 0.00 ? 2   SER A CA   3  
ATOM 3406  C C    . SER A 1 2   ? -7.373  -15.569 14.672  1.00 0.00 ? 2   SER A C    3  
ATOM 3407  O O    . SER A 1 2   ? -7.013  -15.025 13.629  1.00 0.00 ? 2   SER A O    3  
ATOM 3408  C CB   . SER A 1 2   ? -7.614  -17.675 13.344  1.00 0.00 ? 2   SER A CB   3  
ATOM 3409  O OG   . SER A 1 2   ? -8.398  -16.855 12.495  1.00 0.00 ? 2   SER A OG   3  
ATOM 3410  H H    . SER A 1 2   ? -8.622  -18.108 16.247  1.00 0.00 ? 2   SER A H    3  
ATOM 3411  H HA   . SER A 1 2   ? -6.662  -17.496 15.252  1.00 0.00 ? 2   SER A HA   3  
ATOM 3412  H HB2  . SER A 1 2   ? -6.621  -17.757 12.928  1.00 0.00 ? 2   SER A HB2  3  
ATOM 3413  H HB3  . SER A 1 2   ? -8.065  -18.656 13.395  1.00 0.00 ? 2   SER A HB3  3  
ATOM 3414  H HG   . SER A 1 2   ? -9.323  -16.935 12.737  1.00 0.00 ? 2   SER A HG   3  
ATOM 3415  N N    . SER A 1 3   ? -7.651  -14.893 15.783  1.00 0.00 ? 3   SER A N    3  
ATOM 3416  C CA   . SER A 1 3   ? -7.549  -13.440 15.838  1.00 0.00 ? 3   SER A CA   3  
ATOM 3417  C C    . SER A 1 3   ? -6.493  -13.008 16.851  1.00 0.00 ? 3   SER A C    3  
ATOM 3418  O O    . SER A 1 3   ? -5.973  -13.825 17.610  1.00 0.00 ? 3   SER A O    3  
ATOM 3419  C CB   . SER A 1 3   ? -8.902  -12.826 16.202  1.00 0.00 ? 3   SER A CB   3  
ATOM 3420  O OG   . SER A 1 3   ? -9.396  -13.363 17.417  1.00 0.00 ? 3   SER A OG   3  
ATOM 3421  H H    . SER A 1 3   ? -7.934  -15.384 16.583  1.00 0.00 ? 3   SER A H    3  
ATOM 3422  H HA   . SER A 1 3   ? -7.256  -13.090 14.860  1.00 0.00 ? 3   SER A HA   3  
ATOM 3423  H HB2  . SER A 1 3   ? -8.792  -11.758 16.314  1.00 0.00 ? 3   SER A HB2  3  
ATOM 3424  H HB3  . SER A 1 3   ? -9.612  -13.034 15.415  1.00 0.00 ? 3   SER A HB3  3  
ATOM 3425  H HG   . SER A 1 3   ? -8.840  -13.076 18.144  1.00 0.00 ? 3   SER A HG   3  
ATOM 3426  N N    . GLY A 1 4   ? -6.181  -11.715 16.857  1.00 0.00 ? 4   GLY A N    3  
ATOM 3427  C CA   . GLY A 1 4   ? -5.189  -11.195 17.780  1.00 0.00 ? 4   GLY A CA   3  
ATOM 3428  C C    . GLY A 1 4   ? -4.626  -9.860  17.335  1.00 0.00 ? 4   GLY A C    3  
ATOM 3429  O O    . GLY A 1 4   ? -4.450  -9.620  16.141  1.00 0.00 ? 4   GLY A O    3  
ATOM 3430  H H    . GLY A 1 4   ? -6.629  -11.109 16.230  1.00 0.00 ? 4   GLY A H    3  
ATOM 3431  H HA2  . GLY A 1 4   ? -5.645  -11.076 18.752  1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3432  H HA3  . GLY A 1 4   ? -4.380  -11.906 17.858  1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3433  N N    . SER A 1 5   ? -4.345  -8.988  18.298  1.00 0.00 ? 5   SER A N    3  
ATOM 3434  C CA   . SER A 1 5   ? -3.804  -7.667  17.998  1.00 0.00 ? 5   SER A CA   3  
ATOM 3435  C C    . SER A 1 5   ? -2.350  -7.561  18.448  1.00 0.00 ? 5   SER A C    3  
ATOM 3436  O O    . SER A 1 5   ? -1.908  -8.291  19.335  1.00 0.00 ? 5   SER A O    3  
ATOM 3437  C CB   . SER A 1 5   ? -4.641  -6.583  18.680  1.00 0.00 ? 5   SER A CB   3  
ATOM 3438  O OG   . SER A 1 5   ? -5.900  -6.438  18.047  1.00 0.00 ? 5   SER A OG   3  
ATOM 3439  H H    . SER A 1 5   ? -4.507  -9.238  19.231  1.00 0.00 ? 5   SER A H    3  
ATOM 3440  H HA   . SER A 1 5   ? -3.849  -7.525  16.929  1.00 0.00 ? 5   SER A HA   3  
ATOM 3441  H HB2  . SER A 1 5   ? -4.800  -6.852  19.713  1.00 0.00 ? 5   SER A HB2  3  
ATOM 3442  H HB3  . SER A 1 5   ? -4.115  -5.641  18.629  1.00 0.00 ? 5   SER A HB3  3  
ATOM 3443  H HG   . SER A 1 5   ? -6.363  -5.685  18.422  1.00 0.00 ? 5   SER A HG   3  
ATOM 3444  N N    . SER A 1 6   ? -1.611  -6.646  17.829  1.00 0.00 ? 6   SER A N    3  
ATOM 3445  C CA   . SER A 1 6   ? -0.205  -6.445  18.162  1.00 0.00 ? 6   SER A CA   3  
ATOM 3446  C C    . SER A 1 6   ? 0.337   -5.185  17.495  1.00 0.00 ? 6   SER A C    3  
ATOM 3447  O O    . SER A 1 6   ? 0.227   -5.016  16.281  1.00 0.00 ? 6   SER A O    3  
ATOM 3448  C CB   . SER A 1 6   ? 0.621   -7.659  17.733  1.00 0.00 ? 6   SER A CB   3  
ATOM 3449  O OG   . SER A 1 6   ? 2.008   -7.378  17.791  1.00 0.00 ? 6   SER A OG   3  
ATOM 3450  H H    . SER A 1 6   ? -2.021  -6.094  17.130  1.00 0.00 ? 6   SER A H    3  
ATOM 3451  H HA   . SER A 1 6   ? -0.132  -6.331  19.234  1.00 0.00 ? 6   SER A HA   3  
ATOM 3452  H HB2  . SER A 1 6   ? 0.406   -8.488  18.390  1.00 0.00 ? 6   SER A HB2  3  
ATOM 3453  H HB3  . SER A 1 6   ? 0.361   -7.927  16.719  1.00 0.00 ? 6   SER A HB3  3  
ATOM 3454  H HG   . SER A 1 6   ? 2.492   -8.189  17.965  1.00 0.00 ? 6   SER A HG   3  
ATOM 3455  N N    . GLY A 1 7   ? 0.922   -4.302  18.298  1.00 0.00 ? 7   GLY A N    3  
ATOM 3456  C CA   . GLY A 1 7   ? 1.473   -3.068  17.769  1.00 0.00 ? 7   GLY A CA   3  
ATOM 3457  C C    . GLY A 1 7   ? 2.935   -2.886  18.125  1.00 0.00 ? 7   GLY A C    3  
ATOM 3458  O O    . GLY A 1 7   ? 3.762   -3.754  17.844  1.00 0.00 ? 7   GLY A O    3  
ATOM 3459  H H    . GLY A 1 7   ? 0.981   -4.490  19.258  1.00 0.00 ? 7   GLY A H    3  
ATOM 3460  H HA2  . GLY A 1 7   ? 1.373   -3.075  16.693  1.00 0.00 ? 7   GLY A HA2  3  
ATOM 3461  H HA3  . GLY A 1 7   ? 0.911   -2.237  18.167  1.00 0.00 ? 7   GLY A HA3  3  
ATOM 3462  N N    . ASP A 1 8   ? 3.255   -1.755  18.743  1.00 0.00 ? 8   ASP A N    3  
ATOM 3463  C CA   . ASP A 1 8   ? 4.628   -1.461  19.138  1.00 0.00 ? 8   ASP A CA   3  
ATOM 3464  C C    . ASP A 1 8   ? 4.680   -0.245  20.058  1.00 0.00 ? 8   ASP A C    3  
ATOM 3465  O O    . ASP A 1 8   ? 3.664   0.406   20.301  1.00 0.00 ? 8   ASP A O    3  
ATOM 3466  C CB   . ASP A 1 8   ? 5.496   -1.218  17.901  1.00 0.00 ? 8   ASP A CB   3  
ATOM 3467  C CG   . ASP A 1 8   ? 6.978   -1.283  18.213  1.00 0.00 ? 8   ASP A CG   3  
ATOM 3468  O OD1  . ASP A 1 8   ? 7.492   -2.403  18.419  1.00 0.00 ? 8   ASP A OD1  3  
ATOM 3469  O OD2  . ASP A 1 8   ? 7.623   -0.215  18.249  1.00 0.00 ? 8   ASP A OD2  3  
ATOM 3470  H H    . ASP A 1 8   ? 2.551   -1.102  18.940  1.00 0.00 ? 8   ASP A H    3  
ATOM 3471  H HA   . ASP A 1 8   ? 5.010   -2.317  19.672  1.00 0.00 ? 8   ASP A HA   3  
ATOM 3472  H HB2  . ASP A 1 8   ? 5.270   -1.969  17.158  1.00 0.00 ? 8   ASP A HB2  3  
ATOM 3473  H HB3  . ASP A 1 8   ? 5.273   -0.241  17.500  1.00 0.00 ? 8   ASP A HB3  3  
ATOM 3474  N N    . ILE A 1 9   ? 5.871   0.054   20.567  1.00 0.00 ? 9   ILE A N    3  
ATOM 3475  C CA   . ILE A 1 9   ? 6.055   1.191   21.460  1.00 0.00 ? 9   ILE A CA   3  
ATOM 3476  C C    . ILE A 1 9   ? 6.106   2.500   20.680  1.00 0.00 ? 9   ILE A C    3  
ATOM 3477  O O    . ILE A 1 9   ? 5.261   3.376   20.863  1.00 0.00 ? 9   ILE A O    3  
ATOM 3478  C CB   . ILE A 1 9   ? 7.344   1.051   22.291  1.00 0.00 ? 9   ILE A CB   3  
ATOM 3479  C CG1  . ILE A 1 9   ? 7.302   -0.231  23.125  1.00 0.00 ? 9   ILE A CG1  3  
ATOM 3480  C CG2  . ILE A 1 9   ? 7.531   2.266   23.187  1.00 0.00 ? 9   ILE A CG2  3  
ATOM 3481  C CD1  . ILE A 1 9   ? 8.670   -0.732  23.533  1.00 0.00 ? 9   ILE A CD1  3  
ATOM 3482  H H    . ILE A 1 9   ? 6.643   -0.503  20.336  1.00 0.00 ? 9   ILE A H    3  
ATOM 3483  H HA   . ILE A 1 9   ? 5.214   1.221   22.138  1.00 0.00 ? 9   ILE A HA   3  
ATOM 3484  H HB   . ILE A 1 9   ? 8.181   1.003   21.611  1.00 0.00 ? 9   ILE A HB   3  
ATOM 3485  H HG12 . ILE A 1 9   ? 6.734   -0.051  24.024  1.00 0.00 ? 9   ILE A HG12 3  
ATOM 3486  H HG13 . ILE A 1 9   ? 6.821   -1.010  22.551  1.00 0.00 ? 9   ILE A HG13 3  
ATOM 3487  H HG21 . ILE A 1 9   ? 8.400   2.821   22.865  1.00 0.00 ? 9   ILE A HG21 3  
ATOM 3488  H HG22 . ILE A 1 9   ? 6.658   2.898   23.123  1.00 0.00 ? 9   ILE A HG22 3  
ATOM 3489  H HG23 . ILE A 1 9   ? 7.668   1.943   24.208  1.00 0.00 ? 9   ILE A HG23 3  
ATOM 3490  H HD11 . ILE A 1 9   ? 9.430   -0.098  23.099  1.00 0.00 ? 9   ILE A HD11 3  
ATOM 3491  H HD12 . ILE A 1 9   ? 8.755   -0.713  24.609  1.00 0.00 ? 9   ILE A HD12 3  
ATOM 3492  H HD13 . ILE A 1 9   ? 8.803   -1.744  23.179  1.00 0.00 ? 9   ILE A HD13 3  
ATOM 3493  N N    . GLN A 1 10  ? 7.102   2.625   19.809  1.00 0.00 ? 10  GLN A N    3  
ATOM 3494  C CA   . GLN A 1 10  ? 7.263   3.827   18.999  1.00 0.00 ? 10  GLN A CA   3  
ATOM 3495  C C    . GLN A 1 10  ? 6.342   3.792   17.784  1.00 0.00 ? 10  GLN A C    3  
ATOM 3496  O O    . GLN A 1 10  ? 6.710   3.277   16.728  1.00 0.00 ? 10  GLN A O    3  
ATOM 3497  C CB   . GLN A 1 10  ? 8.717   3.973   18.548  1.00 0.00 ? 10  GLN A CB   3  
ATOM 3498  C CG   . GLN A 1 10  ? 9.659   4.401   19.662  1.00 0.00 ? 10  GLN A CG   3  
ATOM 3499  C CD   . GLN A 1 10  ? 11.119  4.264   19.276  1.00 0.00 ? 10  GLN A CD   3  
ATOM 3500  O OE1  . GLN A 1 10  ? 11.664  5.103   18.558  1.00 0.00 ? 10  GLN A OE1  3  
ATOM 3501  N NE2  . GLN A 1 10  ? 11.760  3.203   19.751  1.00 0.00 ? 10  GLN A NE2  3  
ATOM 3502  H H    . GLN A 1 10  ? 7.744   1.892   19.708  1.00 0.00 ? 10  GLN A H    3  
ATOM 3503  H HA   . GLN A 1 10  ? 6.998   4.676   19.611  1.00 0.00 ? 10  GLN A HA   3  
ATOM 3504  H HB2  . GLN A 1 10  ? 9.058   3.025   18.161  1.00 0.00 ? 10  GLN A HB2  3  
ATOM 3505  H HB3  . GLN A 1 10  ? 8.765   4.713   17.763  1.00 0.00 ? 10  GLN A HB3  3  
ATOM 3506  H HG2  . GLN A 1 10  ? 9.463   5.434   19.906  1.00 0.00 ? 10  GLN A HG2  3  
ATOM 3507  H HG3  . GLN A 1 10  ? 9.472   3.786   20.530  1.00 0.00 ? 10  GLN A HG3  3  
ATOM 3508  H HE21 . GLN A 1 10  ? 11.261  2.576   20.316  1.00 0.00 ? 10  GLN A HE21 3  
ATOM 3509  H HE22 . GLN A 1 10  ? 12.704  3.089   19.517  1.00 0.00 ? 10  GLN A HE22 3  
ATOM 3510  N N    . VAL A 1 11  ? 5.142   4.344   17.940  1.00 0.00 ? 11  VAL A N    3  
ATOM 3511  C CA   . VAL A 1 11  ? 4.169   4.376   16.856  1.00 0.00 ? 11  VAL A CA   3  
ATOM 3512  C C    . VAL A 1 11  ? 3.708   5.802   16.573  1.00 0.00 ? 11  VAL A C    3  
ATOM 3513  O O    . VAL A 1 11  ? 3.363   6.546   17.491  1.00 0.00 ? 11  VAL A O    3  
ATOM 3514  C CB   . VAL A 1 11  ? 2.940   3.506   17.178  1.00 0.00 ? 11  VAL A CB   3  
ATOM 3515  C CG1  . VAL A 1 11  ? 3.355   2.061   17.412  1.00 0.00 ? 11  VAL A CG1  3  
ATOM 3516  C CG2  . VAL A 1 11  ? 2.198   4.058   18.386  1.00 0.00 ? 11  VAL A CG2  3  
ATOM 3517  H H    . VAL A 1 11  ? 4.907   4.739   18.806  1.00 0.00 ? 11  VAL A H    3  
ATOM 3518  H HA   . VAL A 1 11  ? 4.643   3.979   15.969  1.00 0.00 ? 11  VAL A HA   3  
ATOM 3519  H HB   . VAL A 1 11  ? 2.272   3.532   16.329  1.00 0.00 ? 11  VAL A HB   3  
ATOM 3520  H HG11 . VAL A 1 11  ? 3.529   1.903   18.466  1.00 0.00 ? 11  VAL A HG11 3  
ATOM 3521  H HG12 . VAL A 1 11  ? 2.570   1.401   17.072  1.00 0.00 ? 11  VAL A HG12 3  
ATOM 3522  H HG13 . VAL A 1 11  ? 4.262   1.854   16.863  1.00 0.00 ? 11  VAL A HG13 3  
ATOM 3523  H HG21 . VAL A 1 11  ? 2.834   4.756   18.909  1.00 0.00 ? 11  VAL A HG21 3  
ATOM 3524  H HG22 . VAL A 1 11  ? 1.302   4.564   18.058  1.00 0.00 ? 11  VAL A HG22 3  
ATOM 3525  H HG23 . VAL A 1 11  ? 1.932   3.247   19.047  1.00 0.00 ? 11  VAL A HG23 3  
ATOM 3526  N N    . ILE A 1 12  ? 3.705   6.175   15.298  1.00 0.00 ? 12  ILE A N    3  
ATOM 3527  C CA   . ILE A 1 12  ? 3.285   7.511   14.895  1.00 0.00 ? 12  ILE A CA   3  
ATOM 3528  C C    . ILE A 1 12  ? 2.247   7.448   13.779  1.00 0.00 ? 12  ILE A C    3  
ATOM 3529  O O    . ILE A 1 12  ? 2.148   6.450   13.064  1.00 0.00 ? 12  ILE A O    3  
ATOM 3530  C CB   . ILE A 1 12  ? 4.480   8.359   14.422  1.00 0.00 ? 12  ILE A CB   3  
ATOM 3531  C CG1  . ILE A 1 12  ? 4.065   9.822   14.262  1.00 0.00 ? 12  ILE A CG1  3  
ATOM 3532  C CG2  . ILE A 1 12  ? 5.032   7.813   13.113  1.00 0.00 ? 12  ILE A CG2  3  
ATOM 3533  C CD1  . ILE A 1 12  ? 5.229   10.758  14.024  1.00 0.00 ? 12  ILE A CD1  3  
ATOM 3534  H H    . ILE A 1 12  ? 3.991   5.537   14.612  1.00 0.00 ? 12  ILE A H    3  
ATOM 3535  H HA   . ILE A 1 12  ? 2.844   7.995   15.755  1.00 0.00 ? 12  ILE A HA   3  
ATOM 3536  H HB   . ILE A 1 12  ? 5.258   8.292   15.167  1.00 0.00 ? 12  ILE A HB   3  
ATOM 3537  H HG12 . ILE A 1 12  ? 3.393   9.910   13.422  1.00 0.00 ? 12  ILE A HG12 3  
ATOM 3538  H HG13 . ILE A 1 12  ? 3.557   10.145  15.159  1.00 0.00 ? 12  ILE A HG13 3  
ATOM 3539  H HG21 . ILE A 1 12  ? 5.641   6.944   13.314  1.00 0.00 ? 12  ILE A HG21 3  
ATOM 3540  H HG22 . ILE A 1 12  ? 4.213   7.535   12.466  1.00 0.00 ? 12  ILE A HG22 3  
ATOM 3541  H HG23 . ILE A 1 12  ? 5.631   8.570   12.631  1.00 0.00 ? 12  ILE A HG23 3  
ATOM 3542  H HD11 . ILE A 1 12  ? 5.428   11.322  14.923  1.00 0.00 ? 12  ILE A HD11 3  
ATOM 3543  H HD12 . ILE A 1 12  ? 6.104   10.185  13.756  1.00 0.00 ? 12  ILE A HD12 3  
ATOM 3544  H HD13 . ILE A 1 12  ? 4.985   11.439  13.220  1.00 0.00 ? 12  ILE A HD13 3  
ATOM 3545  N N    . THR A 1 13  ? 1.477   8.521   13.633  1.00 0.00 ? 13  THR A N    3  
ATOM 3546  C CA   . THR A 1 13  ? 0.447   8.589   12.604  1.00 0.00 ? 13  THR A CA   3  
ATOM 3547  C C    . THR A 1 13  ? 0.916   9.414   11.411  1.00 0.00 ? 13  THR A C    3  
ATOM 3548  O O    . THR A 1 13  ? 1.398   10.535  11.571  1.00 0.00 ? 13  THR A O    3  
ATOM 3549  C CB   . THR A 1 13  ? -0.857  9.197   13.153  1.00 0.00 ? 13  THR A CB   3  
ATOM 3550  O OG1  . THR A 1 13  ? -1.583  9.835   12.096  1.00 0.00 ? 13  THR A OG1  3  
ATOM 3551  C CG2  . THR A 1 13  ? -0.563  10.205  14.254  1.00 0.00 ? 13  THR A CG2  3  
ATOM 3552  H H    . THR A 1 13  ? 1.604   9.285   14.234  1.00 0.00 ? 13  THR A H    3  
ATOM 3553  H HA   . THR A 1 13  ? 0.239   7.582   12.273  1.00 0.00 ? 13  THR A HA   3  
ATOM 3554  H HB   . THR A 1 13  ? -1.461  8.401   13.565  1.00 0.00 ? 13  THR A HB   3  
ATOM 3555  H HG1  . THR A 1 13  ? -2.497  9.957   12.364  1.00 0.00 ? 13  THR A HG1  3  
ATOM 3556  H HG21 . THR A 1 13  ? 0.065   10.992  13.863  1.00 0.00 ? 13  THR A HG21 3  
ATOM 3557  H HG22 . THR A 1 13  ? -0.056  9.710   15.068  1.00 0.00 ? 13  THR A HG22 3  
ATOM 3558  H HG23 . THR A 1 13  ? -1.490  10.628  14.610  1.00 0.00 ? 13  THR A HG23 3  
ATOM 3559  N N    . GLN A 1 14  ? 0.770   8.853   10.215  1.00 0.00 ? 14  GLN A N    3  
ATOM 3560  C CA   . GLN A 1 14  ? 1.179   9.538   8.995   1.00 0.00 ? 14  GLN A CA   3  
ATOM 3561  C C    . GLN A 1 14  ? 0.370   9.049   7.798   1.00 0.00 ? 14  GLN A C    3  
ATOM 3562  O O    . GLN A 1 14  ? 0.475   7.890   7.395   1.00 0.00 ? 14  GLN A O    3  
ATOM 3563  C CB   . GLN A 1 14  ? 2.672   9.321   8.739   1.00 0.00 ? 14  GLN A CB   3  
ATOM 3564  C CG   . GLN A 1 14  ? 3.568   9.946   9.796   1.00 0.00 ? 14  GLN A CG   3  
ATOM 3565  C CD   . GLN A 1 14  ? 4.965   10.232  9.282   1.00 0.00 ? 14  GLN A CD   3  
ATOM 3566  O OE1  . GLN A 1 14  ? 5.228   11.301  8.730   1.00 0.00 ? 14  GLN A OE1  3  
ATOM 3567  N NE2  . GLN A 1 14  ? 5.869   9.277   9.461   1.00 0.00 ? 14  GLN A NE2  3  
ATOM 3568  H H    . GLN A 1 14  ? 0.379   7.957   10.152  1.00 0.00 ? 14  GLN A H    3  
ATOM 3569  H HA   . GLN A 1 14  ? 0.997   10.593  9.130   1.00 0.00 ? 14  GLN A HA   3  
ATOM 3570  H HB2  . GLN A 1 14  ? 2.870   8.260   8.711   1.00 0.00 ? 14  GLN A HB2  3  
ATOM 3571  H HB3  . GLN A 1 14  ? 2.927   9.752   7.782   1.00 0.00 ? 14  GLN A HB3  3  
ATOM 3572  H HG2  . GLN A 1 14  ? 3.124   10.874  10.123  1.00 0.00 ? 14  GLN A HG2  3  
ATOM 3573  H HG3  . GLN A 1 14  ? 3.640   9.268   10.634  1.00 0.00 ? 14  GLN A HG3  3  
ATOM 3574  H HE21 . GLN A 1 14  ? 5.587   8.451   9.908   1.00 0.00 ? 14  GLN A HE21 3  
ATOM 3575  H HE22 . GLN A 1 14  ? 6.780   9.435   9.138   1.00 0.00 ? 14  GLN A HE22 3  
ATOM 3576  N N    . THR A 1 15  ? -0.439  9.940   7.233   1.00 0.00 ? 15  THR A N    3  
ATOM 3577  C CA   . THR A 1 15  ? -1.268  9.600   6.084   1.00 0.00 ? 15  THR A CA   3  
ATOM 3578  C C    . THR A 1 15  ? -0.417  9.381   4.838   1.00 0.00 ? 15  THR A C    3  
ATOM 3579  O O    . THR A 1 15  ? 0.750   9.768   4.796   1.00 0.00 ? 15  THR A O    3  
ATOM 3580  C CB   . THR A 1 15  ? -2.308  10.699  5.795   1.00 0.00 ? 15  THR A CB   3  
ATOM 3581  O OG1  . THR A 1 15  ? -1.670  11.981  5.767   1.00 0.00 ? 15  THR A OG1  3  
ATOM 3582  C CG2  . THR A 1 15  ? -3.405  10.696  6.849   1.00 0.00 ? 15  THR A CG2  3  
ATOM 3583  H H    . THR A 1 15  ? -0.479  10.848  7.600   1.00 0.00 ? 15  THR A H    3  
ATOM 3584  H HA   . THR A 1 15  ? -1.796  8.685   6.313   1.00 0.00 ? 15  THR A HA   3  
ATOM 3585  H HB   . THR A 1 15  ? -2.755  10.506  4.831   1.00 0.00 ? 15  THR A HB   3  
ATOM 3586  H HG1  . THR A 1 15  ? -0.951  11.967  5.130   1.00 0.00 ? 15  THR A HG1  3  
ATOM 3587  H HG21 . THR A 1 15  ? -3.119  11.340  7.668   1.00 0.00 ? 15  THR A HG21 3  
ATOM 3588  H HG22 . THR A 1 15  ? -3.549  9.691   7.216   1.00 0.00 ? 15  THR A HG22 3  
ATOM 3589  H HG23 . THR A 1 15  ? -4.324  11.056  6.413   1.00 0.00 ? 15  THR A HG23 3  
ATOM 3590  N N    . GLY A 1 16  ? -1.010  8.759   3.823   1.00 0.00 ? 16  GLY A N    3  
ATOM 3591  C CA   . GLY A 1 16  ? -0.291  8.501   2.589   1.00 0.00 ? 16  GLY A CA   3  
ATOM 3592  C C    . GLY A 1 16  ? -0.265  7.028   2.231   1.00 0.00 ? 16  GLY A C    3  
ATOM 3593  O O    . GLY A 1 16  ? -1.019  6.578   1.369   1.00 0.00 ? 16  GLY A O    3  
ATOM 3594  H H    . GLY A 1 16  ? -1.943  8.473   3.914   1.00 0.00 ? 16  GLY A H    3  
ATOM 3595  H HA2  . GLY A 1 16  ? -0.766  9.047   1.788   1.00 0.00 ? 16  GLY A HA2  3  
ATOM 3596  H HA3  . GLY A 1 16  ? 0.725   8.851   2.698   1.00 0.00 ? 16  GLY A HA3  3  
ATOM 3597  N N    . VAL A 1 17  ? 0.608   6.275   2.893   1.00 0.00 ? 17  VAL A N    3  
ATOM 3598  C CA   . VAL A 1 17  ? 0.730   4.845   2.640   1.00 0.00 ? 17  VAL A CA   3  
ATOM 3599  C C    . VAL A 1 17  ? -0.636  4.208   2.413   1.00 0.00 ? 17  VAL A C    3  
ATOM 3600  O O    . VAL A 1 17  ? -1.642  4.614   2.994   1.00 0.00 ? 17  VAL A O    3  
ATOM 3601  C CB   . VAL A 1 17  ? 1.432   4.126   3.807   1.00 0.00 ? 17  VAL A CB   3  
ATOM 3602  C CG1  . VAL A 1 17  ? 2.827   4.693   4.022   1.00 0.00 ? 17  VAL A CG1  3  
ATOM 3603  C CG2  . VAL A 1 17  ? 0.602   4.236   5.077   1.00 0.00 ? 17  VAL A CG2  3  
ATOM 3604  H H    . VAL A 1 17  ? 1.183   6.692   3.569   1.00 0.00 ? 17  VAL A H    3  
ATOM 3605  H HA   . VAL A 1 17  ? 1.330   4.714   1.751   1.00 0.00 ? 17  VAL A HA   3  
ATOM 3606  H HB   . VAL A 1 17  ? 1.528   3.080   3.554   1.00 0.00 ? 17  VAL A HB   3  
ATOM 3607  H HG11 . VAL A 1 17  ? 2.754   5.736   4.293   1.00 0.00 ? 17  VAL A HG11 3  
ATOM 3608  H HG12 . VAL A 1 17  ? 3.320   4.148   4.815   1.00 0.00 ? 17  VAL A HG12 3  
ATOM 3609  H HG13 . VAL A 1 17  ? 3.399   4.598   3.111   1.00 0.00 ? 17  VAL A HG13 3  
ATOM 3610  H HG21 . VAL A 1 17  ? 0.570   3.276   5.569   1.00 0.00 ? 17  VAL A HG21 3  
ATOM 3611  H HG22 . VAL A 1 17  ? 1.048   4.965   5.738   1.00 0.00 ? 17  VAL A HG22 3  
ATOM 3612  H HG23 . VAL A 1 17  ? -0.402  4.546   4.825   1.00 0.00 ? 17  VAL A HG23 3  
ATOM 3613  N N    . PRO A 1 18  ? -0.675  3.184   1.547   1.00 0.00 ? 18  PRO A N    3  
ATOM 3614  C CA   . PRO A 1 18  ? -1.912  2.468   1.224   1.00 0.00 ? 18  PRO A CA   3  
ATOM 3615  C C    . PRO A 1 18  ? -2.418  1.627   2.392   1.00 0.00 ? 18  PRO A C    3  
ATOM 3616  O O    . PRO A 1 18  ? -1.650  0.906   3.028   1.00 0.00 ? 18  PRO A O    3  
ATOM 3617  C CB   . PRO A 1 18  ? -1.506  1.568   0.054   1.00 0.00 ? 18  PRO A CB   3  
ATOM 3618  C CG   . PRO A 1 18  ? -0.039  1.370   0.220   1.00 0.00 ? 18  PRO A CG   3  
ATOM 3619  C CD   . PRO A 1 18  ? 0.486   2.647   0.818   1.00 0.00 ? 18  PRO A CD   3  
ATOM 3620  H HA   . PRO A 1 18  ? -2.691  3.145   0.906   1.00 0.00 ? 18  PRO A HA   3  
ATOM 3621  H HB2  . PRO A 1 18  ? -2.041  0.630   0.115   1.00 0.00 ? 18  PRO A HB2  3  
ATOM 3622  H HB3  . PRO A 1 18  ? -1.735  2.059   -0.879  1.00 0.00 ? 18  PRO A HB3  3  
ATOM 3623  H HG2  . PRO A 1 18  ? 0.148   0.541   0.885   1.00 0.00 ? 18  PRO A HG2  3  
ATOM 3624  H HG3  . PRO A 1 18  ? 0.418   1.192   -0.742  1.00 0.00 ? 18  PRO A HG3  3  
ATOM 3625  H HD2  . PRO A 1 18  ? 1.303   2.439   1.493   1.00 0.00 ? 18  PRO A HD2  3  
ATOM 3626  H HD3  . PRO A 1 18  ? 0.800   3.327   0.040   1.00 0.00 ? 18  PRO A HD3  3  
ATOM 3627  N N    . GLY A 1 19  ? -3.715  1.725   2.668   1.00 0.00 ? 19  GLY A N    3  
ATOM 3628  C CA   . GLY A 1 19  ? -4.300  0.968   3.760   1.00 0.00 ? 19  GLY A CA   3  
ATOM 3629  C C    . GLY A 1 19  ? -4.427  -0.508  3.438   1.00 0.00 ? 19  GLY A C    3  
ATOM 3630  O O    . GLY A 1 19  ? -4.843  -0.876  2.340   1.00 0.00 ? 19  GLY A O    3  
ATOM 3631  H H    . GLY A 1 19  ? -4.279  2.317   2.127   1.00 0.00 ? 19  GLY A H    3  
ATOM 3632  H HA2  . GLY A 1 19  ? -3.680  1.084   4.636   1.00 0.00 ? 19  GLY A HA2  3  
ATOM 3633  H HA3  . GLY A 1 19  ? -5.282  1.365   3.971   1.00 0.00 ? 19  GLY A HA3  3  
ATOM 3634  N N    . GLN A 1 20  ? -4.066  -1.353  4.398   1.00 0.00 ? 20  GLN A N    3  
ATOM 3635  C CA   . GLN A 1 20  ? -4.140  -2.797  4.210   1.00 0.00 ? 20  GLN A CA   3  
ATOM 3636  C C    . GLN A 1 20  ? -5.437  -3.190  3.509   1.00 0.00 ? 20  GLN A C    3  
ATOM 3637  O O    . GLN A 1 20  ? -6.495  -2.601  3.733   1.00 0.00 ? 20  GLN A O    3  
ATOM 3638  C CB   . GLN A 1 20  ? -4.039  -3.514  5.558   1.00 0.00 ? 20  GLN A CB   3  
ATOM 3639  C CG   . GLN A 1 20  ? -5.209  -3.232  6.487   1.00 0.00 ? 20  GLN A CG   3  
ATOM 3640  C CD   . GLN A 1 20  ? -5.079  -3.941  7.820   1.00 0.00 ? 20  GLN A CD   3  
ATOM 3641  O OE1  . GLN A 1 20  ? -4.310  -3.524  8.687   1.00 0.00 ? 20  GLN A OE1  3  
ATOM 3642  N NE2  . GLN A 1 20  ? -5.834  -5.020  7.993   1.00 0.00 ? 20  GLN A NE2  3  
ATOM 3643  H H    . GLN A 1 20  ? -3.743  -0.998  5.252   1.00 0.00 ? 20  GLN A H    3  
ATOM 3644  H HA   . GLN A 1 20  ? -3.307  -3.094  3.592   1.00 0.00 ? 20  GLN A HA   3  
ATOM 3645  H HB2  . GLN A 1 20  ? -3.994  -4.579  5.384   1.00 0.00 ? 20  GLN A HB2  3  
ATOM 3646  H HB3  . GLN A 1 20  ? -3.131  -3.200  6.052   1.00 0.00 ? 20  GLN A HB3  3  
ATOM 3647  H HG2  . GLN A 1 20  ? -5.261  -2.168  6.666   1.00 0.00 ? 20  GLN A HG2  3  
ATOM 3648  H HG3  . GLN A 1 20  ? -6.119  -3.560  6.008   1.00 0.00 ? 20  GLN A HG3  3  
ATOM 3649  H HE21 . GLN A 1 20  ? -6.422  -5.295  7.258   1.00 0.00 ? 20  GLN A HE21 3  
ATOM 3650  H HE22 . GLN A 1 20  ? -5.770  -5.499  8.845   1.00 0.00 ? 20  GLN A HE22 3  
ATOM 3651  N N    . PRO A 1 21  ? -5.355  -4.207  2.639   1.00 0.00 ? 21  PRO A N    3  
ATOM 3652  C CA   . PRO A 1 21  ? -6.512  -4.700  1.887   1.00 0.00 ? 21  PRO A CA   3  
ATOM 3653  C C    . PRO A 1 21  ? -7.521  -5.416  2.779   1.00 0.00 ? 21  PRO A C    3  
ATOM 3654  O O    . PRO A 1 21  ? -7.206  -5.799  3.907   1.00 0.00 ? 21  PRO A O    3  
ATOM 3655  C CB   . PRO A 1 21  ? -5.894  -5.680  0.886   1.00 0.00 ? 21  PRO A CB   3  
ATOM 3656  C CG   . PRO A 1 21  ? -4.627  -6.129  1.529   1.00 0.00 ? 21  PRO A CG   3  
ATOM 3657  C CD   . PRO A 1 21  ? -4.126  -4.954  2.322   1.00 0.00 ? 21  PRO A CD   3  
ATOM 3658  H HA   . PRO A 1 21  ? -7.008  -3.903  1.353   1.00 0.00 ? 21  PRO A HA   3  
ATOM 3659  H HB2  . PRO A 1 21  ? -6.571  -6.507  0.723   1.00 0.00 ? 21  PRO A HB2  3  
ATOM 3660  H HB3  . PRO A 1 21  ? -5.704  -5.174  -0.048  1.00 0.00 ? 21  PRO A HB3  3  
ATOM 3661  H HG2  . PRO A 1 21  ? -4.824  -6.966  2.182   1.00 0.00 ? 21  PRO A HG2  3  
ATOM 3662  H HG3  . PRO A 1 21  ? -3.909  -6.404  0.771   1.00 0.00 ? 21  PRO A HG3  3  
ATOM 3663  H HD2  . PRO A 1 21  ? -3.635  -5.289  3.224   1.00 0.00 ? 21  PRO A HD2  3  
ATOM 3664  H HD3  . PRO A 1 21  ? -3.454  -4.355  1.725   1.00 0.00 ? 21  PRO A HD3  3  
ATOM 3665  N N    . LEU A 1 22  ? -8.734  -5.594  2.268   1.00 0.00 ? 22  LEU A N    3  
ATOM 3666  C CA   . LEU A 1 22  ? -9.790  -6.265  3.018   1.00 0.00 ? 22  LEU A CA   3  
ATOM 3667  C C    . LEU A 1 22  ? -10.070 -7.650  2.444   1.00 0.00 ? 22  LEU A C    3  
ATOM 3668  O O    . LEU A 1 22  ? -9.397  -8.096  1.516   1.00 0.00 ? 22  LEU A O    3  
ATOM 3669  C CB   . LEU A 1 22  ? -11.068 -5.425  3.001   1.00 0.00 ? 22  LEU A CB   3  
ATOM 3670  C CG   . LEU A 1 22  ? -10.961 -4.029  3.617   1.00 0.00 ? 22  LEU A CG   3  
ATOM 3671  C CD1  . LEU A 1 22  ? -11.992 -3.095  3.002   1.00 0.00 ? 22  LEU A CD1  3  
ATOM 3672  C CD2  . LEU A 1 22  ? -11.134 -4.097  5.127   1.00 0.00 ? 22  LEU A CD2  3  
ATOM 3673  H H    . LEU A 1 22  ? -8.925  -5.268  1.364   1.00 0.00 ? 22  LEU A H    3  
ATOM 3674  H HA   . LEU A 1 22  ? -9.453  -6.374  4.039   1.00 0.00 ? 22  LEU A HA   3  
ATOM 3675  H HB2  . LEU A 1 22  ? -11.374 -5.310  1.973   1.00 0.00 ? 22  LEU A HB2  3  
ATOM 3676  H HB3  . LEU A 1 22  ? -11.828 -5.970  3.544   1.00 0.00 ? 22  LEU A HB3  3  
ATOM 3677  H HG   . LEU A 1 22  ? -9.980  -3.625  3.409   1.00 0.00 ? 22  LEU A HG   3  
ATOM 3678  H HD11 . LEU A 1 22  ? -12.321 -2.384  3.745   1.00 0.00 ? 22  LEU A HD11 3  
ATOM 3679  H HD12 . LEU A 1 22  ? -12.838 -3.671  2.656   1.00 0.00 ? 22  LEU A HD12 3  
ATOM 3680  H HD13 . LEU A 1 22  ? -11.550 -2.569  2.169   1.00 0.00 ? 22  LEU A HD13 3  
ATOM 3681  H HD21 . LEU A 1 22  ? -12.156 -3.862  5.383   1.00 0.00 ? 22  LEU A HD21 3  
ATOM 3682  H HD22 . LEU A 1 22  ? -10.472 -3.385  5.597   1.00 0.00 ? 22  LEU A HD22 3  
ATOM 3683  H HD23 . LEU A 1 22  ? -10.896 -5.093  5.472   1.00 0.00 ? 22  LEU A HD23 3  
ATOM 3684  N N    . ASN A 1 23  ? -11.071 -8.325  3.001   1.00 0.00 ? 23  ASN A N    3  
ATOM 3685  C CA   . ASN A 1 23  ? -11.443 -9.658  2.543   1.00 0.00 ? 23  ASN A CA   3  
ATOM 3686  C C    . ASN A 1 23  ? -10.203 -10.513 2.296   1.00 0.00 ? 23  ASN A C    3  
ATOM 3687  O O    . ASN A 1 23  ? -10.052 -11.113 1.231   1.00 0.00 ? 23  ASN A O    3  
ATOM 3688  C CB   . ASN A 1 23  ? -12.277 -9.567  1.264   1.00 0.00 ? 23  ASN A CB   3  
ATOM 3689  C CG   . ASN A 1 23  ? -13.622 -8.907  1.496   1.00 0.00 ? 23  ASN A CG   3  
ATOM 3690  O OD1  . ASN A 1 23  ? -14.666 -9.552  1.410   1.00 0.00 ? 23  ASN A OD1  3  
ATOM 3691  N ND2  . ASN A 1 23  ? -13.602 -7.612  1.794   1.00 0.00 ? 23  ASN A ND2  3  
ATOM 3692  H H    . ASN A 1 23  ? -11.572 -7.916  3.738   1.00 0.00 ? 23  ASN A H    3  
ATOM 3693  H HA   . ASN A 1 23  ? -12.036 -10.121 3.317   1.00 0.00 ? 23  ASN A HA   3  
ATOM 3694  H HB2  . ASN A 1 23  ? -11.736 -8.988  0.529   1.00 0.00 ? 23  ASN A HB2  3  
ATOM 3695  H HB3  . ASN A 1 23  ? -12.446 -10.562 0.879   1.00 0.00 ? 23  ASN A HB3  3  
ATOM 3696  H HD21 . ASN A 1 23  ? -12.732 -7.162  1.845   1.00 0.00 ? 23  ASN A HD21 3  
ATOM 3697  H HD22 . ASN A 1 23  ? -14.457 -7.160  1.950   1.00 0.00 ? 23  ASN A HD22 3  
ATOM 3698  N N    . PHE A 1 24  ? -9.319  -10.564 3.286   1.00 0.00 ? 24  PHE A N    3  
ATOM 3699  C CA   . PHE A 1 24  ? -8.092  -11.345 3.176   1.00 0.00 ? 24  PHE A CA   3  
ATOM 3700  C C    . PHE A 1 24  ? -8.297  -12.757 3.716   1.00 0.00 ? 24  PHE A C    3  
ATOM 3701  O O    . PHE A 1 24  ? -8.626  -12.946 4.887   1.00 0.00 ? 24  PHE A O    3  
ATOM 3702  C CB   . PHE A 1 24  ? -6.955  -10.657 3.934   1.00 0.00 ? 24  PHE A CB   3  
ATOM 3703  C CG   . PHE A 1 24  ? -5.619  -11.314 3.736   1.00 0.00 ? 24  PHE A CG   3  
ATOM 3704  C CD1  . PHE A 1 24  ? -5.133  -11.554 2.461   1.00 0.00 ? 24  PHE A CD1  3  
ATOM 3705  C CD2  . PHE A 1 24  ? -4.849  -11.690 4.825   1.00 0.00 ? 24  PHE A CD2  3  
ATOM 3706  C CE1  . PHE A 1 24  ? -3.904  -12.160 2.276   1.00 0.00 ? 24  PHE A CE1  3  
ATOM 3707  C CE2  . PHE A 1 24  ? -3.619  -12.296 4.646   1.00 0.00 ? 24  PHE A CE2  3  
ATOM 3708  C CZ   . PHE A 1 24  ? -3.146  -12.529 3.370   1.00 0.00 ? 24  PHE A CZ   3  
ATOM 3709  H H    . PHE A 1 24  ? -9.495  -10.064 4.111   1.00 0.00 ? 24  PHE A H    3  
ATOM 3710  H HA   . PHE A 1 24  ? -7.832  -11.406 2.131   1.00 0.00 ? 24  PHE A HA   3  
ATOM 3711  H HB2  . PHE A 1 24  ? -6.874  -9.634  3.597   1.00 0.00 ? 24  PHE A HB2  3  
ATOM 3712  H HB3  . PHE A 1 24  ? -7.178  -10.667 4.990   1.00 0.00 ? 24  PHE A HB3  3  
ATOM 3713  H HD1  . PHE A 1 24  ? -5.724  -11.265 1.605   1.00 0.00 ? 24  PHE A HD1  3  
ATOM 3714  H HD2  . PHE A 1 24  ? -5.219  -11.508 5.824   1.00 0.00 ? 24  PHE A HD2  3  
ATOM 3715  H HE1  . PHE A 1 24  ? -3.536  -12.341 1.278   1.00 0.00 ? 24  PHE A HE1  3  
ATOM 3716  H HE2  . PHE A 1 24  ? -3.029  -12.584 5.504   1.00 0.00 ? 24  PHE A HE2  3  
ATOM 3717  H HZ   . PHE A 1 24  ? -2.186  -13.003 3.228   1.00 0.00 ? 24  PHE A HZ   3  
ATOM 3718  N N    . LYS A 1 25  ? -8.099  -13.748 2.853   1.00 0.00 ? 25  LYS A N    3  
ATOM 3719  C CA   . LYS A 1 25  ? -8.261  -15.145 3.240   1.00 0.00 ? 25  LYS A CA   3  
ATOM 3720  C C    . LYS A 1 25  ? -7.277  -16.035 2.489   1.00 0.00 ? 25  LYS A C    3  
ATOM 3721  O O    . LYS A 1 25  ? -6.963  -15.785 1.325   1.00 0.00 ? 25  LYS A O    3  
ATOM 3722  C CB   . LYS A 1 25  ? -9.694  -15.608 2.970   1.00 0.00 ? 25  LYS A CB   3  
ATOM 3723  C CG   . LYS A 1 25  ? -9.911  -16.118 1.556   1.00 0.00 ? 25  LYS A CG   3  
ATOM 3724  C CD   . LYS A 1 25  ? -11.368 -16.001 1.139   1.00 0.00 ? 25  LYS A CD   3  
ATOM 3725  C CE   . LYS A 1 25  ? -12.239 -17.014 1.867   1.00 0.00 ? 25  LYS A CE   3  
ATOM 3726  N NZ   . LYS A 1 25  ? -12.597 -16.553 3.237   1.00 0.00 ? 25  LYS A NZ   3  
ATOM 3727  H H    . LYS A 1 25  ? -7.838  -13.535 1.932   1.00 0.00 ? 25  LYS A H    3  
ATOM 3728  H HA   . LYS A 1 25  ? -8.061  -15.221 4.298   1.00 0.00 ? 25  LYS A HA   3  
ATOM 3729  H HB2  . LYS A 1 25  ? -9.938  -16.403 3.659   1.00 0.00 ? 25  LYS A HB2  3  
ATOM 3730  H HB3  . LYS A 1 25  ? -10.366 -14.779 3.138   1.00 0.00 ? 25  LYS A HB3  3  
ATOM 3731  H HG2  . LYS A 1 25  ? -9.306  -15.537 0.876   1.00 0.00 ? 25  LYS A HG2  3  
ATOM 3732  H HG3  . LYS A 1 25  ? -9.615  -17.156 1.507   1.00 0.00 ? 25  LYS A HG3  3  
ATOM 3733  H HD2  . LYS A 1 25  ? -11.721 -15.008 1.370   1.00 0.00 ? 25  LYS A HD2  3  
ATOM 3734  H HD3  . LYS A 1 25  ? -11.444 -16.174 0.074   1.00 0.00 ? 25  LYS A HD3  3  
ATOM 3735  H HE2  . LYS A 1 25  ? -13.144 -17.165 1.299   1.00 0.00 ? 25  LYS A HE2  3  
ATOM 3736  H HE3  . LYS A 1 25  ? -11.700 -17.947 1.939   1.00 0.00 ? 25  LYS A HE3  3  
ATOM 3737  H HZ1  . LYS A 1 25  ? -12.358 -15.547 3.350   1.00 0.00 ? 25  LYS A HZ1  3  
ATOM 3738  H HZ2  . LYS A 1 25  ? -12.073 -17.104 3.947   1.00 0.00 ? 25  LYS A HZ2  3  
ATOM 3739  H HZ3  . LYS A 1 25  ? -13.616 -16.677 3.401   1.00 0.00 ? 25  LYS A HZ3  3  
ATOM 3740  N N    . ALA A 1 26  ? -6.794  -17.075 3.161   1.00 0.00 ? 26  ALA A N    3  
ATOM 3741  C CA   . ALA A 1 26  ? -5.849  -18.005 2.554   1.00 0.00 ? 26  ALA A CA   3  
ATOM 3742  C C    . ALA A 1 26  ? -6.444  -19.405 2.452   1.00 0.00 ? 26  ALA A C    3  
ATOM 3743  O O    . ALA A 1 26  ? -6.917  -19.961 3.442   1.00 0.00 ? 26  ALA A O    3  
ATOM 3744  C CB   . ALA A 1 26  ? -4.554  -18.036 3.353   1.00 0.00 ? 26  ALA A CB   3  
ATOM 3745  H H    . ALA A 1 26  ? -7.082  -17.222 4.086   1.00 0.00 ? 26  ALA A H    3  
ATOM 3746  H HA   . ALA A 1 26  ? -5.621  -17.648 1.560   1.00 0.00 ? 26  ALA A HA   3  
ATOM 3747  H HB1  . ALA A 1 26  ? -4.216  -17.026 3.529   1.00 0.00 ? 26  ALA A HB1  3  
ATOM 3748  H HB2  . ALA A 1 26  ? -4.727  -18.528 4.299   1.00 0.00 ? 26  ALA A HB2  3  
ATOM 3749  H HB3  . ALA A 1 26  ? -3.802  -18.576 2.798   1.00 0.00 ? 26  ALA A HB3  3  
ATOM 3750  N N    . GLU A 1 27  ? -6.418  -19.967 1.248   1.00 0.00 ? 27  GLU A N    3  
ATOM 3751  C CA   . GLU A 1 27  ? -6.958  -21.303 1.018   1.00 0.00 ? 27  GLU A CA   3  
ATOM 3752  C C    . GLU A 1 27  ? -6.000  -22.138 0.173   1.00 0.00 ? 27  GLU A C    3  
ATOM 3753  O O    . GLU A 1 27  ? -5.443  -21.673 -0.822  1.00 0.00 ? 27  GLU A O    3  
ATOM 3754  C CB   . GLU A 1 27  ? -8.320  -21.214 0.327   1.00 0.00 ? 27  GLU A CB   3  
ATOM 3755  C CG   . GLU A 1 27  ? -9.248  -20.180 0.941   1.00 0.00 ? 27  GLU A CG   3  
ATOM 3756  C CD   . GLU A 1 27  ? -10.489 -19.939 0.103   1.00 0.00 ? 27  GLU A CD   3  
ATOM 3757  O OE1  . GLU A 1 27  ? -11.079 -20.927 -0.382  1.00 0.00 ? 27  GLU A OE1  3  
ATOM 3758  O OE2  . GLU A 1 27  ? -10.869 -18.762 -0.067  1.00 0.00 ? 27  GLU A OE2  3  
ATOM 3759  H H    . GLU A 1 27  ? -6.028  -19.473 0.497   1.00 0.00 ? 27  GLU A H    3  
ATOM 3760  H HA   . GLU A 1 27  ? -7.082  -21.780 1.978   1.00 0.00 ? 27  GLU A HA   3  
ATOM 3761  H HB2  . GLU A 1 27  ? -8.168  -20.960 -0.712  1.00 0.00 ? 27  GLU A HB2  3  
ATOM 3762  H HB3  . GLU A 1 27  ? -8.802  -22.179 0.384   1.00 0.00 ? 27  GLU A HB3  3  
ATOM 3763  H HG2  . GLU A 1 27  ? -9.554  -20.525 1.918   1.00 0.00 ? 27  GLU A HG2  3  
ATOM 3764  H HG3  . GLU A 1 27  ? -8.712  -19.248 1.041   1.00 0.00 ? 27  GLU A HG3  3  
ATOM 3765  N N    . PRO A 1 28  ? -5.802  -23.401 0.579   1.00 0.00 ? 28  PRO A N    3  
ATOM 3766  C CA   . PRO A 1 28  ? -4.911  -24.328 -0.126  1.00 0.00 ? 28  PRO A CA   3  
ATOM 3767  C C    . PRO A 1 28  ? -5.467  -24.747 -1.483  1.00 0.00 ? 28  PRO A C    3  
ATOM 3768  O O    . PRO A 1 28  ? -6.287  -25.660 -1.572  1.00 0.00 ? 28  PRO A O    3  
ATOM 3769  C CB   . PRO A 1 28  ? -4.836  -25.532 0.816   1.00 0.00 ? 28  PRO A CB   3  
ATOM 3770  C CG   . PRO A 1 28  ? -6.102  -25.480 1.600   1.00 0.00 ? 28  PRO A CG   3  
ATOM 3771  C CD   . PRO A 1 28  ? -6.432  -24.021 1.756   1.00 0.00 ? 28  PRO A CD   3  
ATOM 3772  H HA   . PRO A 1 28  ? -3.925  -23.909 -0.257  1.00 0.00 ? 28  PRO A HA   3  
ATOM 3773  H HB2  . PRO A 1 28  ? -4.767  -26.442 0.237   1.00 0.00 ? 28  PRO A HB2  3  
ATOM 3774  H HB3  . PRO A 1 28  ? -3.972  -25.440 1.456   1.00 0.00 ? 28  PRO A HB3  3  
ATOM 3775  H HG2  . PRO A 1 28  ? -6.888  -25.987 1.062   1.00 0.00 ? 28  PRO A HG2  3  
ATOM 3776  H HG3  . PRO A 1 28  ? -5.953  -25.935 2.568   1.00 0.00 ? 28  PRO A HG3  3  
ATOM 3777  H HD2  . PRO A 1 28  ? -7.502  -23.873 1.744   1.00 0.00 ? 28  PRO A HD2  3  
ATOM 3778  H HD3  . PRO A 1 28  ? -6.006  -23.633 2.670   1.00 0.00 ? 28  PRO A HD3  3  
ATOM 3779  N N    . GLU A 1 29  ? -5.014  -24.075 -2.536  1.00 0.00 ? 29  GLU A N    3  
ATOM 3780  C CA   . GLU A 1 29  ? -5.468  -24.378 -3.888  1.00 0.00 ? 29  GLU A CA   3  
ATOM 3781  C C    . GLU A 1 29  ? -4.860  -25.687 -4.385  1.00 0.00 ? 29  GLU A C    3  
ATOM 3782  O O    . GLU A 1 29  ? -5.378  -26.313 -5.309  1.00 0.00 ? 29  GLU A O    3  
ATOM 3783  C CB   . GLU A 1 29  ? -5.102  -23.239 -4.841  1.00 0.00 ? 29  GLU A CB   3  
ATOM 3784  C CG   . GLU A 1 29  ? -3.619  -23.169 -5.166  1.00 0.00 ? 29  GLU A CG   3  
ATOM 3785  C CD   . GLU A 1 29  ? -3.349  -22.592 -6.541  1.00 0.00 ? 29  GLU A CD   3  
ATOM 3786  O OE1  . GLU A 1 29  ? -4.161  -21.767 -7.009  1.00 0.00 ? 29  GLU A OE1  3  
ATOM 3787  O OE2  . GLU A 1 29  ? -2.325  -22.966 -7.151  1.00 0.00 ? 29  GLU A OE2  3  
ATOM 3788  H H    . GLU A 1 29  ? -4.361  -23.357 -2.401  1.00 0.00 ? 29  GLU A H    3  
ATOM 3789  H HA   . GLU A 1 29  ? -6.542  -24.482 -3.862  1.00 0.00 ? 29  GLU A HA   3  
ATOM 3790  H HB2  . GLU A 1 29  ? -5.646  -23.369 -5.765  1.00 0.00 ? 29  GLU A HB2  3  
ATOM 3791  H HB3  . GLU A 1 29  ? -5.394  -22.302 -4.391  1.00 0.00 ? 29  GLU A HB3  3  
ATOM 3792  H HG2  . GLU A 1 29  ? -3.131  -22.548 -4.430  1.00 0.00 ? 29  GLU A HG2  3  
ATOM 3793  H HG3  . GLU A 1 29  ? -3.207  -24.167 -5.123  1.00 0.00 ? 29  GLU A HG3  3  
ATOM 3794  N N    . SER A 1 30  ? -3.756  -26.093 -3.764  1.00 0.00 ? 30  SER A N    3  
ATOM 3795  C CA   . SER A 1 30  ? -3.074  -27.324 -4.146  1.00 0.00 ? 30  SER A CA   3  
ATOM 3796  C C    . SER A 1 30  ? -2.262  -27.878 -2.979  1.00 0.00 ? 30  SER A C    3  
ATOM 3797  O O    . SER A 1 30  ? -2.302  -27.343 -1.872  1.00 0.00 ? 30  SER A O    3  
ATOM 3798  C CB   . SER A 1 30  ? -2.159  -27.074 -5.346  1.00 0.00 ? 30  SER A CB   3  
ATOM 3799  O OG   . SER A 1 30  ? -1.988  -28.254 -6.112  1.00 0.00 ? 30  SER A OG   3  
ATOM 3800  H H    . SER A 1 30  ? -3.392  -25.550 -3.034  1.00 0.00 ? 30  SER A H    3  
ATOM 3801  H HA   . SER A 1 30  ? -3.826  -28.048 -4.422  1.00 0.00 ? 30  SER A HA   3  
ATOM 3802  H HB2  . SER A 1 30  ? -2.593  -26.311 -5.974  1.00 0.00 ? 30  SER A HB2  3  
ATOM 3803  H HB3  . SER A 1 30  ? -1.192  -26.744 -4.995  1.00 0.00 ? 30  SER A HB3  3  
ATOM 3804  H HG   . SER A 1 30  ? -2.180  -28.068 -7.034  1.00 0.00 ? 30  SER A HG   3  
ATOM 3805  N N    . GLU A 1 31  ? -1.526  -28.955 -3.237  1.00 0.00 ? 31  GLU A N    3  
ATOM 3806  C CA   . GLU A 1 31  ? -0.705  -29.583 -2.209  1.00 0.00 ? 31  GLU A CA   3  
ATOM 3807  C C    . GLU A 1 31  ? 0.622   -28.847 -2.047  1.00 0.00 ? 31  GLU A C    3  
ATOM 3808  O O    . GLU A 1 31  ? 1.267   -28.927 -1.001  1.00 0.00 ? 31  GLU A O    3  
ATOM 3809  C CB   . GLU A 1 31  ? -0.447  -31.051 -2.556  1.00 0.00 ? 31  GLU A CB   3  
ATOM 3810  C CG   . GLU A 1 31  ? 0.615   -31.246 -3.624  1.00 0.00 ? 31  GLU A CG   3  
ATOM 3811  C CD   . GLU A 1 31  ? 0.106   -30.933 -5.018  1.00 0.00 ? 31  GLU A CD   3  
ATOM 3812  O OE1  . GLU A 1 31  ? -0.669  -31.746 -5.563  1.00 0.00 ? 31  GLU A OE1  3  
ATOM 3813  O OE2  . GLU A 1 31  ? 0.483   -29.874 -5.563  1.00 0.00 ? 31  GLU A OE2  3  
ATOM 3814  H H    . GLU A 1 31  ? -1.535  -29.335 -4.140  1.00 0.00 ? 31  GLU A H    3  
ATOM 3815  H HA   . GLU A 1 31  ? -1.246  -29.533 -1.276  1.00 0.00 ? 31  GLU A HA   3  
ATOM 3816  H HB2  . GLU A 1 31  ? -0.131  -31.569 -1.663  1.00 0.00 ? 31  GLU A HB2  3  
ATOM 3817  H HB3  . GLU A 1 31  ? -1.368  -31.491 -2.910  1.00 0.00 ? 31  GLU A HB3  3  
ATOM 3818  H HG2  . GLU A 1 31  ? 1.449   -30.595 -3.408  1.00 0.00 ? 31  GLU A HG2  3  
ATOM 3819  H HG3  . GLU A 1 31  ? 0.947   -32.273 -3.600  1.00 0.00 ? 31  GLU A HG3  3  
ATOM 3820  N N    . THR A 1 32  ? 1.025   -28.129 -3.091  1.00 0.00 ? 32  THR A N    3  
ATOM 3821  C CA   . THR A 1 32  ? 2.275   -27.380 -3.067  1.00 0.00 ? 32  THR A CA   3  
ATOM 3822  C C    . THR A 1 32  ? 2.047   -25.918 -3.431  1.00 0.00 ? 32  THR A C    3  
ATOM 3823  O O    . THR A 1 32  ? 2.984   -25.120 -3.455  1.00 0.00 ? 32  THR A O    3  
ATOM 3824  C CB   . THR A 1 32  ? 3.310   -27.983 -4.035  1.00 0.00 ? 32  THR A CB   3  
ATOM 3825  O OG1  . THR A 1 32  ? 2.740   -28.114 -5.342  1.00 0.00 ? 32  THR A OG1  3  
ATOM 3826  C CG2  . THR A 1 32  ? 3.783   -29.343 -3.544  1.00 0.00 ? 32  THR A CG2  3  
ATOM 3827  H H    . THR A 1 32  ? 0.468   -28.105 -3.897  1.00 0.00 ? 32  THR A H    3  
ATOM 3828  H HA   . THR A 1 32  ? 2.677   -27.433 -2.065  1.00 0.00 ? 32  THR A HA   3  
ATOM 3829  H HB   . THR A 1 32  ? 4.162   -27.319 -4.087  1.00 0.00 ? 32  THR A HB   3  
ATOM 3830  H HG1  . THR A 1 32  ? 2.226   -27.329 -5.547  1.00 0.00 ? 32  THR A HG1  3  
ATOM 3831  H HG21 . THR A 1 32  ? 3.219   -29.625 -2.667  1.00 0.00 ? 32  THR A HG21 3  
ATOM 3832  H HG22 . THR A 1 32  ? 4.832   -29.291 -3.296  1.00 0.00 ? 32  THR A HG22 3  
ATOM 3833  H HG23 . THR A 1 32  ? 3.632   -30.078 -4.320  1.00 0.00 ? 32  THR A HG23 3  
ATOM 3834  N N    . SER A 1 33  ? 0.795   -25.571 -3.713  1.00 0.00 ? 33  SER A N    3  
ATOM 3835  C CA   . SER A 1 33  ? 0.444   -24.204 -4.079  1.00 0.00 ? 33  SER A CA   3  
ATOM 3836  C C    . SER A 1 33  ? -0.716  -23.695 -3.229  1.00 0.00 ? 33  SER A C    3  
ATOM 3837  O O    . SER A 1 33  ? -1.552  -24.474 -2.771  1.00 0.00 ? 33  SER A O    3  
ATOM 3838  C CB   . SER A 1 33  ? 0.076   -24.129 -5.562  1.00 0.00 ? 33  SER A CB   3  
ATOM 3839  O OG   . SER A 1 33  ? 1.182   -24.469 -6.380  1.00 0.00 ? 33  SER A OG   3  
ATOM 3840  H H    . SER A 1 33  ? 0.091   -26.253 -3.677  1.00 0.00 ? 33  SER A H    3  
ATOM 3841  H HA   . SER A 1 33  ? 1.308   -23.581 -3.900  1.00 0.00 ? 33  SER A HA   3  
ATOM 3842  H HB2  . SER A 1 33  ? -0.731  -24.817 -5.765  1.00 0.00 ? 33  SER A HB2  3  
ATOM 3843  H HB3  . SER A 1 33  ? -0.238  -23.124 -5.802  1.00 0.00 ? 33  SER A HB3  3  
ATOM 3844  H HG   . SER A 1 33  ? 1.150   -25.406 -6.590  1.00 0.00 ? 33  SER A HG   3  
ATOM 3845  N N    . ILE A 1 34  ? -0.759  -22.383 -3.023  1.00 0.00 ? 34  ILE A N    3  
ATOM 3846  C CA   . ILE A 1 34  ? -1.816  -21.769 -2.230  1.00 0.00 ? 34  ILE A CA   3  
ATOM 3847  C C    . ILE A 1 34  ? -2.294  -20.468 -2.865  1.00 0.00 ? 34  ILE A C    3  
ATOM 3848  O O    . ILE A 1 34  ? -1.489  -19.635 -3.283  1.00 0.00 ? 34  ILE A O    3  
ATOM 3849  C CB   . ILE A 1 34  ? -1.346  -21.482 -0.792  1.00 0.00 ? 34  ILE A CB   3  
ATOM 3850  C CG1  . ILE A 1 34  ? -1.004  -22.790 -0.074  1.00 0.00 ? 34  ILE A CG1  3  
ATOM 3851  C CG2  . ILE A 1 34  ? -2.416  -20.717 -0.027  1.00 0.00 ? 34  ILE A CG2  3  
ATOM 3852  C CD1  . ILE A 1 34  ? -0.517  -22.591 1.345   1.00 0.00 ? 34  ILE A CD1  3  
ATOM 3853  H H    . ILE A 1 34  ? -0.063  -21.814 -3.415  1.00 0.00 ? 34  ILE A H    3  
ATOM 3854  H HA   . ILE A 1 34  ? -2.644  -22.461 -2.186  1.00 0.00 ? 34  ILE A HA   3  
ATOM 3855  H HB   . ILE A 1 34  ? -0.462  -20.865 -0.841  1.00 0.00 ? 34  ILE A HB   3  
ATOM 3856  H HG12 . ILE A 1 34  ? -1.882  -23.414 -0.038  1.00 0.00 ? 34  ILE A HG12 3  
ATOM 3857  H HG13 . ILE A 1 34  ? -0.226  -23.300 -0.624  1.00 0.00 ? 34  ILE A HG13 3  
ATOM 3858  H HG21 . ILE A 1 34  ? -2.283  -20.875 1.033   1.00 0.00 ? 34  ILE A HG21 3  
ATOM 3859  H HG22 . ILE A 1 34  ? -2.329  -19.663 -0.246  1.00 0.00 ? 34  ILE A HG22 3  
ATOM 3860  H HG23 . ILE A 1 34  ? -3.392  -21.068 -0.325  1.00 0.00 ? 34  ILE A HG23 3  
ATOM 3861  H HD11 . ILE A 1 34  ? 0.056   -21.677 1.404   1.00 0.00 ? 34  ILE A HD11 3  
ATOM 3862  H HD12 . ILE A 1 34  ? -1.364  -22.530 2.011   1.00 0.00 ? 34  ILE A HD12 3  
ATOM 3863  H HD13 . ILE A 1 34  ? 0.108   -23.425 1.631   1.00 0.00 ? 34  ILE A HD13 3  
ATOM 3864  N N    . LEU A 1 35  ? -3.610  -20.298 -2.932  1.00 0.00 ? 35  LEU A N    3  
ATOM 3865  C CA   . LEU A 1 35  ? -4.198  -19.096 -3.515  1.00 0.00 ? 35  LEU A CA   3  
ATOM 3866  C C    . LEU A 1 35  ? -4.703  -18.154 -2.426  1.00 0.00 ? 35  LEU A C    3  
ATOM 3867  O O    . LEU A 1 35  ? -5.312  -18.589 -1.447  1.00 0.00 ? 35  LEU A O    3  
ATOM 3868  C CB   . LEU A 1 35  ? -5.346  -19.470 -4.454  1.00 0.00 ? 35  LEU A CB   3  
ATOM 3869  C CG   . LEU A 1 35  ? -5.673  -18.456 -5.551  1.00 0.00 ? 35  LEU A CG   3  
ATOM 3870  C CD1  . LEU A 1 35  ? -4.458  -18.213 -6.433  1.00 0.00 ? 35  LEU A CD1  3  
ATOM 3871  C CD2  . LEU A 1 35  ? -6.853  -18.934 -6.385  1.00 0.00 ? 35  LEU A CD2  3  
ATOM 3872  H H    . LEU A 1 35  ? -4.202  -20.996 -2.582  1.00 0.00 ? 35  LEU A H    3  
ATOM 3873  H HA   . LEU A 1 35  ? -3.429  -18.593 -4.081  1.00 0.00 ? 35  LEU A HA   3  
ATOM 3874  H HB2  . LEU A 1 35  ? -5.091  -20.403 -4.932  1.00 0.00 ? 35  LEU A HB2  3  
ATOM 3875  H HB3  . LEU A 1 35  ? -6.233  -19.606 -3.852  1.00 0.00 ? 35  LEU A HB3  3  
ATOM 3876  H HG   . LEU A 1 35  ? -5.945  -17.515 -5.092  1.00 0.00 ? 35  LEU A HG   3  
ATOM 3877  H HD11 . LEU A 1 35  ? -4.187  -17.169 -6.393  1.00 0.00 ? 35  LEU A HD11 3  
ATOM 3878  H HD12 . LEU A 1 35  ? -4.692  -18.485 -7.451  1.00 0.00 ? 35  LEU A HD12 3  
ATOM 3879  H HD13 . LEU A 1 35  ? -3.632  -18.814 -6.081  1.00 0.00 ? 35  LEU A HD13 3  
ATOM 3880  H HD21 . LEU A 1 35  ? -6.866  -18.403 -7.325  1.00 0.00 ? 35  LEU A HD21 3  
ATOM 3881  H HD22 . LEU A 1 35  ? -7.772  -18.743 -5.850  1.00 0.00 ? 35  LEU A HD22 3  
ATOM 3882  H HD23 . LEU A 1 35  ? -6.756  -19.993 -6.570  1.00 0.00 ? 35  LEU A HD23 3  
ATOM 3883  N N    . LEU A 1 36  ? -4.447  -16.863 -2.603  1.00 0.00 ? 36  LEU A N    3  
ATOM 3884  C CA   . LEU A 1 36  ? -4.878  -15.858 -1.637  1.00 0.00 ? 36  LEU A CA   3  
ATOM 3885  C C    . LEU A 1 36  ? -5.903  -14.913 -2.255  1.00 0.00 ? 36  LEU A C    3  
ATOM 3886  O O    . LEU A 1 36  ? -5.794  -14.539 -3.423  1.00 0.00 ? 36  LEU A O    3  
ATOM 3887  C CB   . LEU A 1 36  ? -3.674  -15.062 -1.130  1.00 0.00 ? 36  LEU A CB   3  
ATOM 3888  C CG   . LEU A 1 36  ? -2.423  -15.875 -0.798  1.00 0.00 ? 36  LEU A CG   3  
ATOM 3889  C CD1  . LEU A 1 36  ? -1.190  -14.985 -0.806  1.00 0.00 ? 36  LEU A CD1  3  
ATOM 3890  C CD2  . LEU A 1 36  ? -2.577  -16.565 0.550   1.00 0.00 ? 36  LEU A CD2  3  
ATOM 3891  H H    . LEU A 1 36  ? -3.958  -16.577 -3.402  1.00 0.00 ? 36  LEU A H    3  
ATOM 3892  H HA   . LEU A 1 36  ? -5.335  -16.373 -0.806  1.00 0.00 ? 36  LEU A HA   3  
ATOM 3893  H HB2  . LEU A 1 36  ? -3.409  -14.343 -1.889  1.00 0.00 ? 36  LEU A HB2  3  
ATOM 3894  H HB3  . LEU A 1 36  ? -3.979  -14.540 -0.233  1.00 0.00 ? 36  LEU A HB3  3  
ATOM 3895  H HG   . LEU A 1 36  ? -2.287  -16.639 -1.552  1.00 0.00 ? 36  LEU A HG   3  
ATOM 3896  H HD11 . LEU A 1 36  ? -0.760  -14.975 -1.796  1.00 0.00 ? 36  LEU A HD11 3  
ATOM 3897  H HD12 . LEU A 1 36  ? -0.465  -15.368 -0.102  1.00 0.00 ? 36  LEU A HD12 3  
ATOM 3898  H HD13 . LEU A 1 36  ? -1.469  -13.981 -0.523  1.00 0.00 ? 36  LEU A HD13 3  
ATOM 3899  H HD21 . LEU A 1 36  ? -1.667  -16.447 1.120   1.00 0.00 ? 36  LEU A HD21 3  
ATOM 3900  H HD22 . LEU A 1 36  ? -2.772  -17.616 0.396   1.00 0.00 ? 36  LEU A HD22 3  
ATOM 3901  H HD23 . LEU A 1 36  ? -3.400  -16.121 1.090   1.00 0.00 ? 36  LEU A HD23 3  
ATOM 3902  N N    . SER A 1 37  ? -6.899  -14.528 -1.463  1.00 0.00 ? 37  SER A N    3  
ATOM 3903  C CA   . SER A 1 37  ? -7.945  -13.627 -1.932  1.00 0.00 ? 37  SER A CA   3  
ATOM 3904  C C    . SER A 1 37  ? -8.007  -12.370 -1.070  1.00 0.00 ? 37  SER A C    3  
ATOM 3905  O O    . SER A 1 37  ? -8.286  -12.439 0.127   1.00 0.00 ? 37  SER A O    3  
ATOM 3906  C CB   . SER A 1 37  ? -9.301  -14.336 -1.919  1.00 0.00 ? 37  SER A CB   3  
ATOM 3907  O OG   . SER A 1 37  ? -9.454  -15.165 -3.058  1.00 0.00 ? 37  SER A OG   3  
ATOM 3908  H H    . SER A 1 37  ? -6.931  -14.860 -0.541  1.00 0.00 ? 37  SER A H    3  
ATOM 3909  H HA   . SER A 1 37  ? -7.707  -13.343 -2.946  1.00 0.00 ? 37  SER A HA   3  
ATOM 3910  H HB2  . SER A 1 37  ? -9.377  -14.946 -1.032  1.00 0.00 ? 37  SER A HB2  3  
ATOM 3911  H HB3  . SER A 1 37  ? -10.090 -13.597 -1.917  1.00 0.00 ? 37  SER A HB3  3  
ATOM 3912  H HG   . SER A 1 37  ? -10.339 -15.060 -3.414  1.00 0.00 ? 37  SER A HG   3  
ATOM 3913  N N    . TRP A 1 38  ? -7.744  -11.224 -1.687  1.00 0.00 ? 38  TRP A N    3  
ATOM 3914  C CA   . TRP A 1 38  ? -7.770  -9.951  -0.976  1.00 0.00 ? 38  TRP A CA   3  
ATOM 3915  C C    . TRP A 1 38  ? -8.415  -8.864  -1.829  1.00 0.00 ? 38  TRP A C    3  
ATOM 3916  O O    . TRP A 1 38  ? -8.509  -8.993  -3.050  1.00 0.00 ? 38  TRP A O    3  
ATOM 3917  C CB   . TRP A 1 38  ? -6.351  -9.534  -0.584  1.00 0.00 ? 38  TRP A CB   3  
ATOM 3918  C CG   . TRP A 1 38  ? -5.555  -8.985  -1.729  1.00 0.00 ? 38  TRP A CG   3  
ATOM 3919  C CD1  . TRP A 1 38  ? -5.767  -7.805  -2.383  1.00 0.00 ? 38  TRP A CD1  3  
ATOM 3920  C CD2  . TRP A 1 38  ? -4.422  -9.596  -2.355  1.00 0.00 ? 38  TRP A CD2  3  
ATOM 3921  N NE1  . TRP A 1 38  ? -4.833  -7.646  -3.379  1.00 0.00 ? 38  TRP A NE1  3  
ATOM 3922  C CE2  . TRP A 1 38  ? -3.996  -8.730  -3.382  1.00 0.00 ? 38  TRP A CE2  3  
ATOM 3923  C CE3  . TRP A 1 38  ? -3.724  -10.788 -2.147  1.00 0.00 ? 38  TRP A CE3  3  
ATOM 3924  C CZ2  . TRP A 1 38  ? -2.906  -9.022  -4.197  1.00 0.00 ? 38  TRP A CZ2  3  
ATOM 3925  C CZ3  . TRP A 1 38  ? -2.642  -11.077 -2.957  1.00 0.00 ? 38  TRP A CZ3  3  
ATOM 3926  C CH2  . TRP A 1 38  ? -2.241  -10.197 -3.971  1.00 0.00 ? 38  TRP A CH2  3  
ATOM 3927  H H    . TRP A 1 38  ? -7.528  -11.234 -2.643  1.00 0.00 ? 38  TRP A H    3  
ATOM 3928  H HA   . TRP A 1 38  ? -8.357  -10.084 -0.079  1.00 0.00 ? 38  TRP A HA   3  
ATOM 3929  H HB2  . TRP A 1 38  ? -6.405  -8.772  0.180   1.00 0.00 ? 38  TRP A HB2  3  
ATOM 3930  H HB3  . TRP A 1 38  ? -5.826  -10.394 -0.193  1.00 0.00 ? 38  TRP A HB3  3  
ATOM 3931  H HD1  . TRP A 1 38  ? -6.557  -7.111  -2.144  1.00 0.00 ? 38  TRP A HD1  3  
ATOM 3932  H HE1  . TRP A 1 38  ? -4.776  -6.879  -3.987  1.00 0.00 ? 38  TRP A HE1  3  
ATOM 3933  H HE3  . TRP A 1 38  ? -4.017  -11.480 -1.371  1.00 0.00 ? 38  TRP A HE3  3  
ATOM 3934  H HZ2  . TRP A 1 38  ? -2.584  -8.354  -4.982  1.00 0.00 ? 38  TRP A HZ2  3  
ATOM 3935  H HZ3  . TRP A 1 38  ? -2.091  -11.994 -2.812  1.00 0.00 ? 38  TRP A HZ3  3  
ATOM 3936  H HH2  . TRP A 1 38  ? -1.391  -10.463 -4.580  1.00 0.00 ? 38  TRP A HH2  3  
ATOM 3937  N N    . THR A 1 39  ? -8.858  -7.792  -1.180  1.00 0.00 ? 39  THR A N    3  
ATOM 3938  C CA   . THR A 1 39  ? -9.495  -6.684  -1.879  1.00 0.00 ? 39  THR A CA   3  
ATOM 3939  C C    . THR A 1 39  ? -8.697  -5.396  -1.710  1.00 0.00 ? 39  THR A C    3  
ATOM 3940  O O    . THR A 1 39  ? -8.457  -4.927  -0.597  1.00 0.00 ? 39  THR A O    3  
ATOM 3941  C CB   . THR A 1 39  ? -10.932 -6.453  -1.376  1.00 0.00 ? 39  THR A CB   3  
ATOM 3942  O OG1  . THR A 1 39  ? -11.792 -7.492  -1.857  1.00 0.00 ? 39  THR A OG1  3  
ATOM 3943  C CG2  . THR A 1 39  ? -11.456 -5.101  -1.835  1.00 0.00 ? 39  THR A CG2  3  
ATOM 3944  H H    . THR A 1 39  ? -8.754  -7.748  -0.206  1.00 0.00 ? 39  THR A H    3  
ATOM 3945  H HA   . THR A 1 39  ? -9.539  -6.933  -2.929  1.00 0.00 ? 39  THR A HA   3  
ATOM 3946  H HB   . THR A 1 39  ? -10.927 -6.473  -0.295  1.00 0.00 ? 39  THR A HB   3  
ATOM 3947  H HG1  . THR A 1 39  ? -12.515 -7.621  -1.239  1.00 0.00 ? 39  THR A HG1  3  
ATOM 3948  H HG21 . THR A 1 39  ? -12.489 -4.995  -1.536  1.00 0.00 ? 39  THR A HG21 3  
ATOM 3949  H HG22 . THR A 1 39  ? -11.383 -5.033  -2.910  1.00 0.00 ? 39  THR A HG22 3  
ATOM 3950  H HG23 . THR A 1 39  ? -10.869 -4.316  -1.383  1.00 0.00 ? 39  THR A HG23 3  
ATOM 3951  N N    . PRO A 1 40  ? -8.275  -4.807  -2.839  1.00 0.00 ? 40  PRO A N    3  
ATOM 3952  C CA   . PRO A 1 40  ? -7.498  -3.564  -2.841  1.00 0.00 ? 40  PRO A CA   3  
ATOM 3953  C C    . PRO A 1 40  ? -8.329  -2.361  -2.409  1.00 0.00 ? 40  PRO A C    3  
ATOM 3954  O O    . PRO A 1 40  ? -9.500  -2.225  -2.764  1.00 0.00 ? 40  PRO A O    3  
ATOM 3955  C CB   . PRO A 1 40  ? -7.066  -3.419  -4.303  1.00 0.00 ? 40  PRO A CB   3  
ATOM 3956  C CG   . PRO A 1 40  ? -8.095  -4.167  -5.078  1.00 0.00 ? 40  PRO A CG   3  
ATOM 3957  C CD   . PRO A 1 40  ? -8.524  -5.310  -4.200  1.00 0.00 ? 40  PRO A CD   3  
ATOM 3958  H HA   . PRO A 1 40  ? -6.624  -3.641  -2.212  1.00 0.00 ? 40  PRO A HA   3  
ATOM 3959  H HB2  . PRO A 1 40  ? -7.051  -2.372  -4.573  1.00 0.00 ? 40  PRO A HB2  3  
ATOM 3960  H HB3  . PRO A 1 40  ? -6.084  -3.845  -4.436  1.00 0.00 ? 40  PRO A HB3  3  
ATOM 3961  H HG2  . PRO A 1 40  ? -8.934  -3.523  -5.293  1.00 0.00 ? 40  PRO A HG2  3  
ATOM 3962  H HG3  . PRO A 1 40  ? -7.663  -4.541  -5.995  1.00 0.00 ? 40  PRO A HG3  3  
ATOM 3963  H HD2  . PRO A 1 40  ? -9.572  -5.525  -4.346  1.00 0.00 ? 40  PRO A HD2  3  
ATOM 3964  H HD3  . PRO A 1 40  ? -7.926  -6.187  -4.402  1.00 0.00 ? 40  PRO A HD3  3  
ATOM 3965  N N    . PRO A 1 41  ? -7.711  -1.465  -1.625  1.00 0.00 ? 41  PRO A N    3  
ATOM 3966  C CA   . PRO A 1 41  ? -8.376  -0.257  -1.128  1.00 0.00 ? 41  PRO A CA   3  
ATOM 3967  C C    . PRO A 1 41  ? -8.645  0.755   -2.237  1.00 0.00 ? 41  PRO A C    3  
ATOM 3968  O O    . PRO A 1 41  ? -8.368  0.494   -3.408  1.00 0.00 ? 41  PRO A O    3  
ATOM 3969  C CB   . PRO A 1 41  ? -7.373  0.310   -0.119  1.00 0.00 ? 41  PRO A CB   3  
ATOM 3970  C CG   . PRO A 1 41  ? -6.050  -0.208  -0.568  1.00 0.00 ? 41  PRO A CG   3  
ATOM 3971  C CD   . PRO A 1 41  ? -6.316  -1.563  -1.162  1.00 0.00 ? 41  PRO A CD   3  
ATOM 3972  H HA   . PRO A 1 41  ? -9.302  -0.492  -0.624  1.00 0.00 ? 41  PRO A HA   3  
ATOM 3973  H HB2  . PRO A 1 41  ? -7.405  1.390   -0.145  1.00 0.00 ? 41  PRO A HB2  3  
ATOM 3974  H HB3  . PRO A 1 41  ? -7.618  -0.039  0.872   1.00 0.00 ? 41  PRO A HB3  3  
ATOM 3975  H HG2  . PRO A 1 41  ? -5.631  0.452   -1.312  1.00 0.00 ? 41  PRO A HG2  3  
ATOM 3976  H HG3  . PRO A 1 41  ? -5.384  -0.295  0.278   1.00 0.00 ? 41  PRO A HG3  3  
ATOM 3977  H HD2  . PRO A 1 41  ? -5.648  -1.750  -1.990  1.00 0.00 ? 41  PRO A HD2  3  
ATOM 3978  H HD3  . PRO A 1 41  ? -6.213  -2.332  -0.411  1.00 0.00 ? 41  PRO A HD3  3  
ATOM 3979  N N    . ARG A 1 42  ? -9.185  1.909   -1.861  1.00 0.00 ? 42  ARG A N    3  
ATOM 3980  C CA   . ARG A 1 42  ? -9.491  2.959   -2.825  1.00 0.00 ? 42  ARG A CA   3  
ATOM 3981  C C    . ARG A 1 42  ? -8.246  3.355   -3.612  1.00 0.00 ? 42  ARG A C    3  
ATOM 3982  O O    . ARG A 1 42  ? -8.321  3.650   -4.805  1.00 0.00 ? 42  ARG A O    3  
ATOM 3983  C CB   . ARG A 1 42  ? -10.067 4.184   -2.111  1.00 0.00 ? 42  ARG A CB   3  
ATOM 3984  C CG   . ARG A 1 42  ? -9.078  4.868   -1.181  1.00 0.00 ? 42  ARG A CG   3  
ATOM 3985  C CD   . ARG A 1 42  ? -9.758  5.926   -0.326  1.00 0.00 ? 42  ARG A CD   3  
ATOM 3986  N NE   . ARG A 1 42  ? -10.622 5.334   0.692   1.00 0.00 ? 42  ARG A NE   3  
ATOM 3987  C CZ   . ARG A 1 42  ? -11.164 6.026   1.688   1.00 0.00 ? 42  ARG A CZ   3  
ATOM 3988  N NH1  . ARG A 1 42  ? -10.932 7.327   1.800   1.00 0.00 ? 42  ARG A NH1  3  
ATOM 3989  N NH2  . ARG A 1 42  ? -11.939 5.417   2.576   1.00 0.00 ? 42  ARG A NH2  3  
ATOM 3990  H H    . ARG A 1 42  ? -9.382  2.058   -0.912  1.00 0.00 ? 42  ARG A H    3  
ATOM 3991  H HA   . ARG A 1 42  ? -10.230 2.574   -3.512  1.00 0.00 ? 42  ARG A HA   3  
ATOM 3992  H HB2  . ARG A 1 42  ? -10.386 4.901   -2.852  1.00 0.00 ? 42  ARG A HB2  3  
ATOM 3993  H HB3  . ARG A 1 42  ? -10.922 3.876   -1.528  1.00 0.00 ? 42  ARG A HB3  3  
ATOM 3994  H HG2  . ARG A 1 42  ? -8.636  4.127   -0.533  1.00 0.00 ? 42  ARG A HG2  3  
ATOM 3995  H HG3  . ARG A 1 42  ? -8.307  5.337   -1.774  1.00 0.00 ? 42  ARG A HG3  3  
ATOM 3996  H HD2  . ARG A 1 42  ? -8.998  6.519   0.161   1.00 0.00 ? 42  ARG A HD2  3  
ATOM 3997  H HD3  . ARG A 1 42  ? -10.353 6.559   -0.967  1.00 0.00 ? 42  ARG A HD3  3  
ATOM 3998  H HE   . ARG A 1 42  ? -10.806 4.374   0.629   1.00 0.00 ? 42  ARG A HE   3  
ATOM 3999  H HH11 . ARG A 1 42  ? -10.349 7.789   1.132   1.00 0.00 ? 42  ARG A HH11 3  
ATOM 4000  H HH12 . ARG A 1 42  ? -11.342 7.845   2.550   1.00 0.00 ? 42  ARG A HH12 3  
ATOM 4001  H HH21 . ARG A 1 42  ? -12.116 4.436   2.495   1.00 0.00 ? 42  ARG A HH21 3  
ATOM 4002  H HH22 . ARG A 1 42  ? -12.346 5.938   3.325   1.00 0.00 ? 42  ARG A HH22 3  
ATOM 4003  N N    . SER A 1 43  ? -7.101  3.361   -2.936  1.00 0.00 ? 43  SER A N    3  
ATOM 4004  C CA   . SER A 1 43  ? -5.840  3.725   -3.571  1.00 0.00 ? 43  SER A CA   3  
ATOM 4005  C C    . SER A 1 43  ? -5.712  3.066   -4.941  1.00 0.00 ? 43  SER A C    3  
ATOM 4006  O O    . SER A 1 43  ? -5.984  1.876   -5.098  1.00 0.00 ? 43  SER A O    3  
ATOM 4007  C CB   . SER A 1 43  ? -4.662  3.317   -2.684  1.00 0.00 ? 43  SER A CB   3  
ATOM 4008  O OG   . SER A 1 43  ? -4.629  4.086   -1.494  1.00 0.00 ? 43  SER A OG   3  
ATOM 4009  H H    . SER A 1 43  ? -7.106  3.116   -1.987  1.00 0.00 ? 43  SER A H    3  
ATOM 4010  H HA   . SER A 1 43  ? -5.830  4.797   -3.697  1.00 0.00 ? 43  SER A HA   3  
ATOM 4011  H HB2  . SER A 1 43  ? -4.756  2.274   -2.422  1.00 0.00 ? 43  SER A HB2  3  
ATOM 4012  H HB3  . SER A 1 43  ? -3.739  3.471   -3.224  1.00 0.00 ? 43  SER A HB3  3  
ATOM 4013  H HG   . SER A 1 43  ? -4.368  4.986   -1.701  1.00 0.00 ? 43  SER A HG   3  
ATOM 4014  N N    . ASP A 1 44  ? -5.296  3.850   -5.930  1.00 0.00 ? 44  ASP A N    3  
ATOM 4015  C CA   . ASP A 1 44  ? -5.130  3.344   -7.288  1.00 0.00 ? 44  ASP A CA   3  
ATOM 4016  C C    . ASP A 1 44  ? -3.652  3.165   -7.624  1.00 0.00 ? 44  ASP A C    3  
ATOM 4017  O O    . ASP A 1 44  ? -3.288  2.322   -8.444  1.00 0.00 ? 44  ASP A O    3  
ATOM 4018  C CB   . ASP A 1 44  ? -5.783  4.294   -8.292  1.00 0.00 ? 44  ASP A CB   3  
ATOM 4019  C CG   . ASP A 1 44  ? -7.297  4.275   -8.208  1.00 0.00 ? 44  ASP A CG   3  
ATOM 4020  O OD1  . ASP A 1 44  ? -7.838  4.705   -7.168  1.00 0.00 ? 44  ASP A OD1  3  
ATOM 4021  O OD2  . ASP A 1 44  ? -7.940  3.829   -9.181  1.00 0.00 ? 44  ASP A OD2  3  
ATOM 4022  H H    . ASP A 1 44  ? -5.095  4.790   -5.742  1.00 0.00 ? 44  ASP A H    3  
ATOM 4023  H HA   . ASP A 1 44  ? -5.618  2.383   -7.346  1.00 0.00 ? 44  ASP A HA   3  
ATOM 4024  H HB2  . ASP A 1 44  ? -5.443  5.302   -8.098  1.00 0.00 ? 44  ASP A HB2  3  
ATOM 4025  H HB3  . ASP A 1 44  ? -5.492  4.007   -9.292  1.00 0.00 ? 44  ASP A HB3  3  
ATOM 4026  N N    . THR A 1 45  ? -2.804  3.966   -6.986  1.00 0.00 ? 45  THR A N    3  
ATOM 4027  C CA   . THR A 1 45  ? -1.367  3.898   -7.219  1.00 0.00 ? 45  THR A CA   3  
ATOM 4028  C C    . THR A 1 45  ? -0.691  2.971   -6.215  1.00 0.00 ? 45  THR A C    3  
ATOM 4029  O O    . THR A 1 45  ? -0.429  3.360   -5.076  1.00 0.00 ? 45  THR A O    3  
ATOM 4030  C CB   . THR A 1 45  ? -0.718  5.292   -7.132  1.00 0.00 ? 45  THR A CB   3  
ATOM 4031  O OG1  . THR A 1 45  ? -1.295  6.035   -6.053  1.00 0.00 ? 45  THR A OG1  3  
ATOM 4032  C CG2  . THR A 1 45  ? -0.900  6.056   -8.435  1.00 0.00 ? 45  THR A CG2  3  
ATOM 4033  H H    . THR A 1 45  ? -3.155  4.617   -6.344  1.00 0.00 ? 45  THR A H    3  
ATOM 4034  H HA   . THR A 1 45  ? -1.209  3.511   -8.215  1.00 0.00 ? 45  THR A HA   3  
ATOM 4035  H HB   . THR A 1 45  ? 0.340   5.169   -6.949  1.00 0.00 ? 45  THR A HB   3  
ATOM 4036  H HG1  . THR A 1 45  ? -1.502  5.439   -5.329  1.00 0.00 ? 45  THR A HG1  3  
ATOM 4037  H HG21 . THR A 1 45  ? -0.908  5.361   -9.262  1.00 0.00 ? 45  THR A HG21 3  
ATOM 4038  H HG22 . THR A 1 45  ? -0.086  6.755   -8.559  1.00 0.00 ? 45  THR A HG22 3  
ATOM 4039  H HG23 . THR A 1 45  ? -1.836  6.594   -8.408  1.00 0.00 ? 45  THR A HG23 3  
ATOM 4040  N N    . ILE A 1 46  ? -0.409  1.746   -6.645  1.00 0.00 ? 46  ILE A N    3  
ATOM 4041  C CA   . ILE A 1 46  ? 0.239   0.765   -5.783  1.00 0.00 ? 46  ILE A CA   3  
ATOM 4042  C C    . ILE A 1 46  ? 1.349   0.029   -6.526  1.00 0.00 ? 46  ILE A C    3  
ATOM 4043  O O    . ILE A 1 46  ? 1.101   -0.633  -7.534  1.00 0.00 ? 46  ILE A O    3  
ATOM 4044  C CB   . ILE A 1 46  ? -0.771  -0.264  -5.242  1.00 0.00 ? 46  ILE A CB   3  
ATOM 4045  C CG1  . ILE A 1 46  ? -1.753  0.410   -4.281  1.00 0.00 ? 46  ILE A CG1  3  
ATOM 4046  C CG2  . ILE A 1 46  ? -0.044  -1.407  -4.550  1.00 0.00 ? 46  ILE A CG2  3  
ATOM 4047  C CD1  . ILE A 1 46  ? -3.003  -0.402  -4.027  1.00 0.00 ? 46  ILE A CD1  3  
ATOM 4048  H H    . ILE A 1 46  ? -0.642  1.496   -7.563  1.00 0.00 ? 46  ILE A H    3  
ATOM 4049  H HA   . ILE A 1 46  ? 0.670   1.292   -4.944  1.00 0.00 ? 46  ILE A HA   3  
ATOM 4050  H HB   . ILE A 1 46  ? -1.319  -0.671  -6.078  1.00 0.00 ? 46  ILE A HB   3  
ATOM 4051  H HG12 . ILE A 1 46  ? -1.265  0.572   -3.333  1.00 0.00 ? 46  ILE A HG12 3  
ATOM 4052  H HG13 . ILE A 1 46  ? -2.053  1.362   -4.694  1.00 0.00 ? 46  ILE A HG13 3  
ATOM 4053  H HG21 . ILE A 1 46  ? -0.200  -2.320  -5.104  1.00 0.00 ? 46  ILE A HG21 3  
ATOM 4054  H HG22 . ILE A 1 46  ? 1.012   -1.188  -4.508  1.00 0.00 ? 46  ILE A HG22 3  
ATOM 4055  H HG23 . ILE A 1 46  ? -0.428  -1.524  -3.548  1.00 0.00 ? 46  ILE A HG23 3  
ATOM 4056  H HD11 . ILE A 1 46  ? -3.336  -0.244  -3.011  1.00 0.00 ? 46  ILE A HD11 3  
ATOM 4057  H HD12 . ILE A 1 46  ? -3.778  -0.095  -4.713  1.00 0.00 ? 46  ILE A HD12 3  
ATOM 4058  H HD13 . ILE A 1 46  ? -2.787  -1.451  -4.174  1.00 0.00 ? 46  ILE A HD13 3  
ATOM 4059  N N    . ALA A 1 47  ? 2.572   0.147   -6.020  1.00 0.00 ? 47  ALA A N    3  
ATOM 4060  C CA   . ALA A 1 47  ? 3.719   -0.511  -6.633  1.00 0.00 ? 47  ALA A CA   3  
ATOM 4061  C C    . ALA A 1 47  ? 3.528   -2.023  -6.674  1.00 0.00 ? 47  ALA A C    3  
ATOM 4062  O O    . ALA A 1 47  ? 3.613   -2.641  -7.734  1.00 0.00 ? 47  ALA A O    3  
ATOM 4063  C CB   . ALA A 1 47  ? 4.994   -0.157  -5.882  1.00 0.00 ? 47  ALA A CB   3  
ATOM 4064  H H    . ALA A 1 47  ? 2.705   0.688   -5.214  1.00 0.00 ? 47  ALA A H    3  
ATOM 4065  H HA   . ALA A 1 47  ? 3.813   -0.143  -7.645  1.00 0.00 ? 47  ALA A HA   3  
ATOM 4066  H HB1  . ALA A 1 47  ? 5.655   -1.012  -5.874  1.00 0.00 ? 47  ALA A HB1  3  
ATOM 4067  H HB2  . ALA A 1 47  ? 5.482   0.672   -6.371  1.00 0.00 ? 47  ALA A HB2  3  
ATOM 4068  H HB3  . ALA A 1 47  ? 4.748   0.117   -4.867  1.00 0.00 ? 47  ALA A HB3  3  
ATOM 4069  N N    . ASN A 1 48  ? 3.270   -2.614  -5.511  1.00 0.00 ? 48  ASN A N    3  
ATOM 4070  C CA   . ASN A 1 48  ? 3.069   -4.055  -5.414  1.00 0.00 ? 48  ASN A CA   3  
ATOM 4071  C C    . ASN A 1 48  ? 2.699   -4.458  -3.990  1.00 0.00 ? 48  ASN A C    3  
ATOM 4072  O O    . ASN A 1 48  ? 2.529   -3.606  -3.117  1.00 0.00 ? 48  ASN A O    3  
ATOM 4073  C CB   . ASN A 1 48  ? 4.332   -4.798  -5.855  1.00 0.00 ? 48  ASN A CB   3  
ATOM 4074  C CG   . ASN A 1 48  ? 5.583   -3.957  -5.694  1.00 0.00 ? 48  ASN A CG   3  
ATOM 4075  O OD1  . ASN A 1 48  ? 6.095   -3.394  -6.661  1.00 0.00 ? 48  ASN A OD1  3  
ATOM 4076  N ND2  . ASN A 1 48  ? 6.083   -3.869  -4.466  1.00 0.00 ? 48  ASN A ND2  3  
ATOM 4077  H H    . ASN A 1 48  ? 3.215   -2.068  -4.699  1.00 0.00 ? 48  ASN A H    3  
ATOM 4078  H HA   . ASN A 1 48  ? 2.257   -4.321  -6.074  1.00 0.00 ? 48  ASN A HA   3  
ATOM 4079  H HB2  . ASN A 1 48  ? 4.442   -5.692  -5.258  1.00 0.00 ? 48  ASN A HB2  3  
ATOM 4080  H HB3  . ASN A 1 48  ? 4.236   -5.074  -6.894  1.00 0.00 ? 48  ASN A HB3  3  
ATOM 4081  H HD21 . ASN A 1 48  ? 5.622   -4.345  -3.743  1.00 0.00 ? 48  ASN A HD21 3  
ATOM 4082  H HD22 . ASN A 1 48  ? 6.891   -3.332  -4.333  1.00 0.00 ? 48  ASN A HD22 3  
ATOM 4083  N N    . TYR A 1 49  ? 2.577   -5.761  -3.762  1.00 0.00 ? 49  TYR A N    3  
ATOM 4084  C CA   . TYR A 1 49  ? 2.226   -6.277  -2.445  1.00 0.00 ? 49  TYR A CA   3  
ATOM 4085  C C    . TYR A 1 49  ? 3.367   -7.106  -1.863  1.00 0.00 ? 49  TYR A C    3  
ATOM 4086  O O    . TYR A 1 49  ? 4.240   -7.576  -2.591  1.00 0.00 ? 49  TYR A O    3  
ATOM 4087  C CB   . TYR A 1 49  ? 0.956   -7.124  -2.528  1.00 0.00 ? 49  TYR A CB   3  
ATOM 4088  C CG   . TYR A 1 49  ? -0.306  -6.309  -2.696  1.00 0.00 ? 49  TYR A CG   3  
ATOM 4089  C CD1  . TYR A 1 49  ? -0.774  -5.967  -3.959  1.00 0.00 ? 49  TYR A CD1  3  
ATOM 4090  C CD2  . TYR A 1 49  ? -1.032  -5.880  -1.591  1.00 0.00 ? 49  TYR A CD2  3  
ATOM 4091  C CE1  . TYR A 1 49  ? -1.926  -5.222  -4.116  1.00 0.00 ? 49  TYR A CE1  3  
ATOM 4092  C CE2  . TYR A 1 49  ? -2.186  -5.135  -1.739  1.00 0.00 ? 49  TYR A CE2  3  
ATOM 4093  C CZ   . TYR A 1 49  ? -2.629  -4.808  -3.004  1.00 0.00 ? 49  TYR A CZ   3  
ATOM 4094  O OH   . TYR A 1 49  ? -3.777  -4.066  -3.156  1.00 0.00 ? 49  TYR A OH   3  
ATOM 4095  H H    . TYR A 1 49  ? 2.726   -6.391  -4.498  1.00 0.00 ? 49  TYR A H    3  
ATOM 4096  H HA   . TYR A 1 49  ? 2.042   -5.433  -1.796  1.00 0.00 ? 49  TYR A HA   3  
ATOM 4097  H HB2  . TYR A 1 49  ? 1.032   -7.793  -3.371  1.00 0.00 ? 49  TYR A HB2  3  
ATOM 4098  H HB3  . TYR A 1 49  ? 0.858   -7.704  -1.622  1.00 0.00 ? 49  TYR A HB3  3  
ATOM 4099  H HD1  . TYR A 1 49  ? -0.222  -6.294  -4.828  1.00 0.00 ? 49  TYR A HD1  3  
ATOM 4100  H HD2  . TYR A 1 49  ? -0.682  -6.137  -0.601  1.00 0.00 ? 49  TYR A HD2  3  
ATOM 4101  H HE1  . TYR A 1 49  ? -2.274  -4.966  -5.107  1.00 0.00 ? 49  TYR A HE1  3  
ATOM 4102  H HE2  . TYR A 1 49  ? -2.736  -4.810  -0.868  1.00 0.00 ? 49  TYR A HE2  3  
ATOM 4103  H HH   . TYR A 1 49  ? -4.182  -4.273  -4.002  1.00 0.00 ? 49  TYR A HH   3  
ATOM 4104  N N    . GLU A 1 50  ? 3.350   -7.281  -0.545  1.00 0.00 ? 50  GLU A N    3  
ATOM 4105  C CA   . GLU A 1 50  ? 4.383   -8.054  0.135   1.00 0.00 ? 50  GLU A CA   3  
ATOM 4106  C C    . GLU A 1 50  ? 3.771   -9.219  0.907   1.00 0.00 ? 50  GLU A C    3  
ATOM 4107  O O    . GLU A 1 50  ? 2.854   -9.034  1.709   1.00 0.00 ? 50  GLU A O    3  
ATOM 4108  C CB   . GLU A 1 50  ? 5.177   -7.157  1.088   1.00 0.00 ? 50  GLU A CB   3  
ATOM 4109  C CG   . GLU A 1 50  ? 6.610   -7.615  1.302   1.00 0.00 ? 50  GLU A CG   3  
ATOM 4110  C CD   . GLU A 1 50  ? 7.515   -7.260  0.139   1.00 0.00 ? 50  GLU A CD   3  
ATOM 4111  O OE1  . GLU A 1 50  ? 7.297   -7.797  -0.967  1.00 0.00 ? 50  GLU A OE1  3  
ATOM 4112  O OE2  . GLU A 1 50  ? 8.442   -6.446  0.335   1.00 0.00 ? 50  GLU A OE2  3  
ATOM 4113  H H    . GLU A 1 50  ? 2.627   -6.881  -0.018  1.00 0.00 ? 50  GLU A H    3  
ATOM 4114  H HA   . GLU A 1 50  ? 5.052   -8.447  -0.615  1.00 0.00 ? 50  GLU A HA   3  
ATOM 4115  H HB2  . GLU A 1 50  ? 5.196   -6.155  0.688   1.00 0.00 ? 50  GLU A HB2  3  
ATOM 4116  H HB3  . GLU A 1 50  ? 4.679   -7.142  2.047   1.00 0.00 ? 50  GLU A HB3  3  
ATOM 4117  H HG2  . GLU A 1 50  ? 6.995   -7.145  2.195   1.00 0.00 ? 50  GLU A HG2  3  
ATOM 4118  H HG3  . GLU A 1 50  ? 6.616   -8.687  1.430   1.00 0.00 ? 50  GLU A HG3  3  
ATOM 4119  N N    . LEU A 1 51  ? 4.283   -10.419 0.659   1.00 0.00 ? 51  LEU A N    3  
ATOM 4120  C CA   . LEU A 1 51  ? 3.788   -11.616 1.330   1.00 0.00 ? 51  LEU A CA   3  
ATOM 4121  C C    . LEU A 1 51  ? 4.849   -12.200 2.257   1.00 0.00 ? 51  LEU A C    3  
ATOM 4122  O O    . LEU A 1 51  ? 5.807   -12.827 1.805   1.00 0.00 ? 51  LEU A O    3  
ATOM 4123  C CB   . LEU A 1 51  ? 3.364   -12.664 0.299   1.00 0.00 ? 51  LEU A CB   3  
ATOM 4124  C CG   . LEU A 1 51  ? 3.326   -14.112 0.789   1.00 0.00 ? 51  LEU A CG   3  
ATOM 4125  C CD1  . LEU A 1 51  ? 2.105   -14.347 1.664   1.00 0.00 ? 51  LEU A CD1  3  
ATOM 4126  C CD2  . LEU A 1 51  ? 3.334   -15.074 -0.389  1.00 0.00 ? 51  LEU A CD2  3  
ATOM 4127  H H    . LEU A 1 51  ? 5.012   -10.504 0.010   1.00 0.00 ? 51  LEU A H    3  
ATOM 4128  H HA   . LEU A 1 51  ? 2.928   -11.334 1.919   1.00 0.00 ? 51  LEU A HA   3  
ATOM 4129  H HB2  . LEU A 1 51  ? 2.375   -12.406 -0.047  1.00 0.00 ? 51  LEU A HB2  3  
ATOM 4130  H HB3  . LEU A 1 51  ? 4.057   -12.612 -0.529  1.00 0.00 ? 51  LEU A HB3  3  
ATOM 4131  H HG   . LEU A 1 51  ? 4.206   -14.306 1.387   1.00 0.00 ? 51  LEU A HG   3  
ATOM 4132  H HD11 . LEU A 1 51  ? 1.663   -13.398 1.929   1.00 0.00 ? 51  LEU A HD11 3  
ATOM 4133  H HD12 . LEU A 1 51  ? 2.401   -14.869 2.562   1.00 0.00 ? 51  LEU A HD12 3  
ATOM 4134  H HD13 . LEU A 1 51  ? 1.384   -14.942 1.123   1.00 0.00 ? 51  LEU A HD13 3  
ATOM 4135  H HD21 . LEU A 1 51  ? 2.567   -15.822 -0.248  1.00 0.00 ? 51  LEU A HD21 3  
ATOM 4136  H HD22 . LEU A 1 51  ? 4.298   -15.557 -0.453  1.00 0.00 ? 51  LEU A HD22 3  
ATOM 4137  H HD23 . LEU A 1 51  ? 3.141   -14.529 -1.301  1.00 0.00 ? 51  LEU A HD23 3  
ATOM 4138  N N    . VAL A 1 52  ? 4.671   -11.989 3.558   1.00 0.00 ? 52  VAL A N    3  
ATOM 4139  C CA   . VAL A 1 52  ? 5.611   -12.497 4.550   1.00 0.00 ? 52  VAL A CA   3  
ATOM 4140  C C    . VAL A 1 52  ? 5.164   -13.851 5.089   1.00 0.00 ? 52  VAL A C    3  
ATOM 4141  O O    . VAL A 1 52  ? 4.220   -13.937 5.876   1.00 0.00 ? 52  VAL A O    3  
ATOM 4142  C CB   . VAL A 1 52  ? 5.770   -11.516 5.726   1.00 0.00 ? 52  VAL A CB   3  
ATOM 4143  C CG1  . VAL A 1 52  ? 6.683   -12.102 6.792   1.00 0.00 ? 52  VAL A CG1  3  
ATOM 4144  C CG2  . VAL A 1 52  ? 6.301   -10.177 5.235   1.00 0.00 ? 52  VAL A CG2  3  
ATOM 4145  H H    . VAL A 1 52  ? 3.888   -11.482 3.857   1.00 0.00 ? 52  VAL A H    3  
ATOM 4146  H HA   . VAL A 1 52  ? 6.573   -12.611 4.071   1.00 0.00 ? 52  VAL A HA   3  
ATOM 4147  H HB   . VAL A 1 52  ? 4.797   -11.353 6.167   1.00 0.00 ? 52  VAL A HB   3  
ATOM 4148  H HG11 . VAL A 1 52  ? 6.169   -12.110 7.742   1.00 0.00 ? 52  VAL A HG11 3  
ATOM 4149  H HG12 . VAL A 1 52  ? 6.953   -13.112 6.519   1.00 0.00 ? 52  VAL A HG12 3  
ATOM 4150  H HG13 . VAL A 1 52  ? 7.576   -11.500 6.872   1.00 0.00 ? 52  VAL A HG13 3  
ATOM 4151  H HG21 . VAL A 1 52  ? 7.380   -10.182 5.278   1.00 0.00 ? 52  VAL A HG21 3  
ATOM 4152  H HG22 . VAL A 1 52  ? 5.982   -10.015 4.216   1.00 0.00 ? 52  VAL A HG22 3  
ATOM 4153  H HG23 . VAL A 1 52  ? 5.919   -9.386  5.862   1.00 0.00 ? 52  VAL A HG23 3  
ATOM 4154  N N    . TYR A 1 53  ? 5.847   -14.907 4.661   1.00 0.00 ? 53  TYR A N    3  
ATOM 4155  C CA   . TYR A 1 53  ? 5.518   -16.258 5.099   1.00 0.00 ? 53  TYR A CA   3  
ATOM 4156  C C    . TYR A 1 53  ? 6.702   -16.901 5.817   1.00 0.00 ? 53  TYR A C    3  
ATOM 4157  O O    . TYR A 1 53  ? 7.851   -16.506 5.621   1.00 0.00 ? 53  TYR A O    3  
ATOM 4158  C CB   . TYR A 1 53  ? 5.105   -17.118 3.903   1.00 0.00 ? 53  TYR A CB   3  
ATOM 4159  C CG   . TYR A 1 53  ? 6.273   -17.735 3.168   1.00 0.00 ? 53  TYR A CG   3  
ATOM 4160  C CD1  . TYR A 1 53  ? 6.918   -17.047 2.147   1.00 0.00 ? 53  TYR A CD1  3  
ATOM 4161  C CD2  . TYR A 1 53  ? 6.733   -19.005 3.494   1.00 0.00 ? 53  TYR A CD2  3  
ATOM 4162  C CE1  . TYR A 1 53  ? 7.986   -17.607 1.472   1.00 0.00 ? 53  TYR A CE1  3  
ATOM 4163  C CE2  . TYR A 1 53  ? 7.801   -19.572 2.826   1.00 0.00 ? 53  TYR A CE2  3  
ATOM 4164  C CZ   . TYR A 1 53  ? 8.423   -18.869 1.815   1.00 0.00 ? 53  TYR A CZ   3  
ATOM 4165  O OH   . TYR A 1 53  ? 9.487   -19.430 1.146   1.00 0.00 ? 53  TYR A OH   3  
ATOM 4166  H H    . TYR A 1 53  ? 6.588   -14.775 4.034   1.00 0.00 ? 53  TYR A H    3  
ATOM 4167  H HA   . TYR A 1 53  ? 4.688   -16.192 5.786   1.00 0.00 ? 53  TYR A HA   3  
ATOM 4168  H HB2  . TYR A 1 53  ? 4.470   -17.920 4.248   1.00 0.00 ? 53  TYR A HB2  3  
ATOM 4169  H HB3  . TYR A 1 53  ? 4.556   -16.507 3.202   1.00 0.00 ? 53  TYR A HB3  3  
ATOM 4170  H HD1  . TYR A 1 53  ? 6.573   -16.058 1.881   1.00 0.00 ? 53  TYR A HD1  3  
ATOM 4171  H HD2  . TYR A 1 53  ? 6.243   -19.553 4.286   1.00 0.00 ? 53  TYR A HD2  3  
ATOM 4172  H HE1  . TYR A 1 53  ? 8.474   -17.057 0.681   1.00 0.00 ? 53  TYR A HE1  3  
ATOM 4173  H HE2  . TYR A 1 53  ? 8.144   -20.560 3.094   1.00 0.00 ? 53  TYR A HE2  3  
ATOM 4174  H HH   . TYR A 1 53  ? 10.083  -18.736 0.855   1.00 0.00 ? 53  TYR A HH   3  
ATOM 4175  N N    . LYS A 1 54  ? 6.411   -17.895 6.649   1.00 0.00 ? 54  LYS A N    3  
ATOM 4176  C CA   . LYS A 1 54  ? 7.449   -18.596 7.396   1.00 0.00 ? 54  LYS A CA   3  
ATOM 4177  C C    . LYS A 1 54  ? 7.027   -20.030 7.699   1.00 0.00 ? 54  LYS A C    3  
ATOM 4178  O O    . LYS A 1 54  ? 5.847   -20.307 7.918   1.00 0.00 ? 54  LYS A O    3  
ATOM 4179  C CB   . LYS A 1 54  ? 7.754   -17.857 8.701   1.00 0.00 ? 54  LYS A CB   3  
ATOM 4180  C CG   . LYS A 1 54  ? 6.529   -17.622 9.568   1.00 0.00 ? 54  LYS A CG   3  
ATOM 4181  C CD   . LYS A 1 54  ? 6.754   -16.491 10.557  1.00 0.00 ? 54  LYS A CD   3  
ATOM 4182  C CE   . LYS A 1 54  ? 5.436   -15.917 11.057  1.00 0.00 ? 54  LYS A CE   3  
ATOM 4183  N NZ   . LYS A 1 54  ? 4.876   -14.911 10.113  1.00 0.00 ? 54  LYS A NZ   3  
ATOM 4184  H H    . LYS A 1 54  ? 5.475   -18.165 6.763   1.00 0.00 ? 54  LYS A H    3  
ATOM 4185  H HA   . LYS A 1 54  ? 8.340   -18.616 6.787   1.00 0.00 ? 54  LYS A HA   3  
ATOM 4186  H HB2  . LYS A 1 54  ? 8.466   -18.435 9.270   1.00 0.00 ? 54  LYS A HB2  3  
ATOM 4187  H HB3  . LYS A 1 54  ? 8.190   -16.897 8.464   1.00 0.00 ? 54  LYS A HB3  3  
ATOM 4188  H HG2  . LYS A 1 54  ? 5.692   -17.370 8.933   1.00 0.00 ? 54  LYS A HG2  3  
ATOM 4189  H HG3  . LYS A 1 54  ? 6.308   -18.528 10.115  1.00 0.00 ? 54  LYS A HG3  3  
ATOM 4190  H HD2  . LYS A 1 54  ? 7.312   -16.867 11.401  1.00 0.00 ? 54  LYS A HD2  3  
ATOM 4191  H HD3  . LYS A 1 54  ? 7.316   -15.706 10.071  1.00 0.00 ? 54  LYS A HD3  3  
ATOM 4192  H HE2  . LYS A 1 54  ? 4.728   -16.724 11.172  1.00 0.00 ? 54  LYS A HE2  3  
ATOM 4193  H HE3  . LYS A 1 54  ? 5.604   -15.447 12.014  1.00 0.00 ? 54  LYS A HE3  3  
ATOM 4194  H HZ1  . LYS A 1 54  ? 4.101   -14.387 10.569  1.00 0.00 ? 54  LYS A HZ1  3  
ATOM 4195  H HZ2  . LYS A 1 54  ? 4.507   -15.384 9.264   1.00 0.00 ? 54  LYS A HZ2  3  
ATOM 4196  H HZ3  . LYS A 1 54  ? 5.615   -14.237 9.829   1.00 0.00 ? 54  LYS A HZ3  3  
ATOM 4197  N N    . ASP A 1 55  ? 7.997   -20.937 7.710   1.00 0.00 ? 55  ASP A N    3  
ATOM 4198  C CA   . ASP A 1 55  ? 7.726   -22.343 7.989   1.00 0.00 ? 55  ASP A CA   3  
ATOM 4199  C C    . ASP A 1 55  ? 7.261   -22.532 9.429   1.00 0.00 ? 55  ASP A C    3  
ATOM 4200  O O    . ASP A 1 55  ? 8.068   -22.531 10.358  1.00 0.00 ? 55  ASP A O    3  
ATOM 4201  C CB   . ASP A 1 55  ? 8.975   -23.186 7.728   1.00 0.00 ? 55  ASP A CB   3  
ATOM 4202  C CG   . ASP A 1 55  ? 9.042   -24.412 8.617   1.00 0.00 ? 55  ASP A CG   3  
ATOM 4203  O OD1  . ASP A 1 55  ? 8.392   -25.425 8.281   1.00 0.00 ? 55  ASP A OD1  3  
ATOM 4204  O OD2  . ASP A 1 55  ? 9.744   -24.360 9.648   1.00 0.00 ? 55  ASP A OD2  3  
ATOM 4205  H H    . ASP A 1 55  ? 8.918   -20.654 7.528   1.00 0.00 ? 55  ASP A H    3  
ATOM 4206  H HA   . ASP A 1 55  ? 6.939   -22.667 7.324   1.00 0.00 ? 55  ASP A HA   3  
ATOM 4207  H HB2  . ASP A 1 55  ? 8.974   -23.511 6.698   1.00 0.00 ? 55  ASP A HB2  3  
ATOM 4208  H HB3  . ASP A 1 55  ? 9.853   -22.584 7.909   1.00 0.00 ? 55  ASP A HB3  3  
ATOM 4209  N N    . GLY A 1 56  ? 5.953   -22.692 9.608   1.00 0.00 ? 56  GLY A N    3  
ATOM 4210  C CA   . GLY A 1 56  ? 5.404   -22.878 10.938  1.00 0.00 ? 56  GLY A CA   3  
ATOM 4211  C C    . GLY A 1 56  ? 5.399   -21.597 11.748  1.00 0.00 ? 56  GLY A C    3  
ATOM 4212  O O    . GLY A 1 56  ? 5.289   -20.505 11.193  1.00 0.00 ? 56  GLY A O    3  
ATOM 4213  H H    . GLY A 1 56  ? 5.357   -22.684 8.830   1.00 0.00 ? 56  GLY A H    3  
ATOM 4214  H HA2  . GLY A 1 56  ? 4.390   -23.239 10.849  1.00 0.00 ? 56  GLY A HA2  3  
ATOM 4215  H HA3  . GLY A 1 56  ? 5.994   -23.618 11.458  1.00 0.00 ? 56  GLY A HA3  3  
ATOM 4216  N N    . GLU A 1 57  ? 5.519   -21.732 13.065  1.00 0.00 ? 57  GLU A N    3  
ATOM 4217  C CA   . GLU A 1 57  ? 5.525   -20.575 13.953  1.00 0.00 ? 57  GLU A CA   3  
ATOM 4218  C C    . GLU A 1 57  ? 6.951   -20.095 14.210  1.00 0.00 ? 57  GLU A C    3  
ATOM 4219  O O    . GLU A 1 57  ? 7.202   -18.895 14.332  1.00 0.00 ? 57  GLU A O    3  
ATOM 4220  C CB   . GLU A 1 57  ? 4.844   -20.918 15.279  1.00 0.00 ? 57  GLU A CB   3  
ATOM 4221  C CG   . GLU A 1 57  ? 4.572   -19.706 16.155  1.00 0.00 ? 57  GLU A CG   3  
ATOM 4222  C CD   . GLU A 1 57  ? 3.463   -18.829 15.609  1.00 0.00 ? 57  GLU A CD   3  
ATOM 4223  O OE1  . GLU A 1 57  ? 3.664   -18.211 14.542  1.00 0.00 ? 57  GLU A OE1  3  
ATOM 4224  O OE2  . GLU A 1 57  ? 2.392   -18.760 16.248  1.00 0.00 ? 57  GLU A OE2  3  
ATOM 4225  H H    . GLU A 1 57  ? 5.603   -22.629 13.449  1.00 0.00 ? 57  GLU A H    3  
ATOM 4226  H HA   . GLU A 1 57  ? 4.973   -19.783 13.470  1.00 0.00 ? 57  GLU A HA   3  
ATOM 4227  H HB2  . GLU A 1 57  ? 3.903   -21.405 15.071  1.00 0.00 ? 57  GLU A HB2  3  
ATOM 4228  H HB3  . GLU A 1 57  ? 5.477   -21.598 15.829  1.00 0.00 ? 57  GLU A HB3  3  
ATOM 4229  H HG2  . GLU A 1 57  ? 4.289   -20.046 17.140  1.00 0.00 ? 57  GLU A HG2  3  
ATOM 4230  H HG3  . GLU A 1 57  ? 5.475   -19.118 16.224  1.00 0.00 ? 57  GLU A HG3  3  
ATOM 4231  N N    . HIS A 1 58  ? 7.882   -21.040 14.292  1.00 0.00 ? 58  HIS A N    3  
ATOM 4232  C CA   . HIS A 1 58  ? 9.283   -20.715 14.535  1.00 0.00 ? 58  HIS A CA   3  
ATOM 4233  C C    . HIS A 1 58  ? 10.072  -20.706 13.229  1.00 0.00 ? 58  HIS A C    3  
ATOM 4234  O O    . HIS A 1 58  ? 11.282  -20.933 13.222  1.00 0.00 ? 58  HIS A O    3  
ATOM 4235  C CB   . HIS A 1 58  ? 9.899   -21.717 15.511  1.00 0.00 ? 58  HIS A CB   3  
ATOM 4236  C CG   . HIS A 1 58  ? 9.671   -21.371 16.950  1.00 0.00 ? 58  HIS A CG   3  
ATOM 4237  N ND1  . HIS A 1 58  ? 10.488  -21.811 17.969  1.00 0.00 ? 58  HIS A ND1  3  
ATOM 4238  C CD2  . HIS A 1 58  ? 8.710   -20.619 17.538  1.00 0.00 ? 58  HIS A CD2  3  
ATOM 4239  C CE1  . HIS A 1 58  ? 10.040  -21.347 19.122  1.00 0.00 ? 58  HIS A CE1  3  
ATOM 4240  N NE2  . HIS A 1 58  ? 8.962   -20.621 18.888  1.00 0.00 ? 58  HIS A NE2  3  
ATOM 4241  H H    . HIS A 1 58  ? 7.620   -21.979 14.186  1.00 0.00 ? 58  HIS A H    3  
ATOM 4242  H HA   . HIS A 1 58  ? 9.323   -19.729 14.972  1.00 0.00 ? 58  HIS A HA   3  
ATOM 4243  H HB2  . HIS A 1 58  ? 9.471   -22.693 15.333  1.00 0.00 ? 58  HIS A HB2  3  
ATOM 4244  H HB3  . HIS A 1 58  ? 10.966  -21.762 15.345  1.00 0.00 ? 58  HIS A HB3  3  
ATOM 4245  H HD1  . HIS A 1 58  ? 11.279  -22.380 17.863  1.00 0.00 ? 58  HIS A HD1  3  
ATOM 4246  H HD2  . HIS A 1 58  ? 7.896   -20.113 17.038  1.00 0.00 ? 58  HIS A HD2  3  
ATOM 4247  H HE1  . HIS A 1 58  ? 10.479  -21.530 20.091  1.00 0.00 ? 58  HIS A HE1  3  
ATOM 4248  H HE2  . HIS A 1 58  ? 8.383   -20.231 19.576  1.00 0.00 ? 58  HIS A HE2  3  
ATOM 4249  N N    . GLY A 1 59  ? 9.379   -20.443 12.126  1.00 0.00 ? 59  GLY A N    3  
ATOM 4250  C CA   . GLY A 1 59  ? 10.032  -20.411 10.830  1.00 0.00 ? 59  GLY A CA   3  
ATOM 4251  C C    . GLY A 1 59  ? 10.564  -19.034 10.483  1.00 0.00 ? 59  GLY A C    3  
ATOM 4252  O O    . GLY A 1 59  ? 10.117  -18.032 11.039  1.00 0.00 ? 59  GLY A O    3  
ATOM 4253  H H    . GLY A 1 59  ? 8.417   -20.270 12.192  1.00 0.00 ? 59  GLY A H    3  
ATOM 4254  H HA2  . GLY A 1 59  ? 10.853  -21.112 10.835  1.00 0.00 ? 59  GLY A HA2  3  
ATOM 4255  H HA3  . GLY A 1 59  ? 9.321   -20.710 10.074  1.00 0.00 ? 59  GLY A HA3  3  
ATOM 4256  N N    . GLU A 1 60  ? 11.522  -18.987 9.563   1.00 0.00 ? 60  GLU A N    3  
ATOM 4257  C CA   . GLU A 1 60  ? 12.117  -17.723 9.145   1.00 0.00 ? 60  GLU A CA   3  
ATOM 4258  C C    . GLU A 1 60  ? 11.141  -16.917 8.293   1.00 0.00 ? 60  GLU A C    3  
ATOM 4259  O O    . GLU A 1 60  ? 10.426  -17.472 7.459   1.00 0.00 ? 60  GLU A O    3  
ATOM 4260  C CB   . GLU A 1 60  ? 13.407  -17.974 8.362   1.00 0.00 ? 60  GLU A CB   3  
ATOM 4261  C CG   . GLU A 1 60  ? 14.433  -16.862 8.505   1.00 0.00 ? 60  GLU A CG   3  
ATOM 4262  C CD   . GLU A 1 60  ? 15.436  -16.844 7.367   1.00 0.00 ? 60  GLU A CD   3  
ATOM 4263  O OE1  . GLU A 1 60  ? 16.182  -17.834 7.217   1.00 0.00 ? 60  GLU A OE1  3  
ATOM 4264  O OE2  . GLU A 1 60  ? 15.473  -15.839 6.627   1.00 0.00 ? 60  GLU A OE2  3  
ATOM 4265  H H    . GLU A 1 60  ? 11.837  -19.821 9.156   1.00 0.00 ? 60  GLU A H    3  
ATOM 4266  H HA   . GLU A 1 60  ? 12.352  -17.157 10.034  1.00 0.00 ? 60  GLU A HA   3  
ATOM 4267  H HB2  . GLU A 1 60  ? 13.853  -18.894 8.711   1.00 0.00 ? 60  GLU A HB2  3  
ATOM 4268  H HB3  . GLU A 1 60  ? 13.164  -18.078 7.315   1.00 0.00 ? 60  GLU A HB3  3  
ATOM 4269  H HG2  . GLU A 1 60  ? 13.917  -15.914 8.524   1.00 0.00 ? 60  GLU A HG2  3  
ATOM 4270  H HG3  . GLU A 1 60  ? 14.967  -16.999 9.434   1.00 0.00 ? 60  GLU A HG3  3  
ATOM 4271  N N    . GLU A 1 61  ? 11.118  -15.606 8.509   1.00 0.00 ? 61  GLU A N    3  
ATOM 4272  C CA   . GLU A 1 61  ? 10.228  -14.724 7.762   1.00 0.00 ? 61  GLU A CA   3  
ATOM 4273  C C    . GLU A 1 61  ? 10.816  -14.392 6.393   1.00 0.00 ? 61  GLU A C    3  
ATOM 4274  O O    . GLU A 1 61  ? 11.803  -13.665 6.291   1.00 0.00 ? 61  GLU A O    3  
ATOM 4275  C CB   . GLU A 1 61  ? 9.974   -13.435 8.546   1.00 0.00 ? 61  GLU A CB   3  
ATOM 4276  C CG   . GLU A 1 61  ? 9.226   -13.654 9.851   1.00 0.00 ? 61  GLU A CG   3  
ATOM 4277  C CD   . GLU A 1 61  ? 9.357   -12.481 10.802  1.00 0.00 ? 61  GLU A CD   3  
ATOM 4278  O OE1  . GLU A 1 61  ? 9.571   -11.349 10.323  1.00 0.00 ? 61  GLU A OE1  3  
ATOM 4279  O OE2  . GLU A 1 61  ? 9.244   -12.697 12.027  1.00 0.00 ? 61  GLU A OE2  3  
ATOM 4280  H H    . GLU A 1 61  ? 11.712  -15.222 9.187   1.00 0.00 ? 61  GLU A H    3  
ATOM 4281  H HA   . GLU A 1 61  ? 9.291   -15.240 7.622   1.00 0.00 ? 61  GLU A HA   3  
ATOM 4282  H HB2  . GLU A 1 61  ? 10.923  -12.973 8.773   1.00 0.00 ? 61  GLU A HB2  3  
ATOM 4283  H HB3  . GLU A 1 61  ? 9.394   -12.763 7.932   1.00 0.00 ? 61  GLU A HB3  3  
ATOM 4284  H HG2  . GLU A 1 61  ? 8.179   -13.804 9.630   1.00 0.00 ? 61  GLU A HG2  3  
ATOM 4285  H HG3  . GLU A 1 61  ? 9.620   -14.537 10.333  1.00 0.00 ? 61  GLU A HG3  3  
ATOM 4286  N N    . GLN A 1 62  ? 10.201  -14.930 5.345   1.00 0.00 ? 62  GLN A N    3  
ATOM 4287  C CA   . GLN A 1 62  ? 10.663  -14.692 3.983   1.00 0.00 ? 62  GLN A CA   3  
ATOM 4288  C C    . GLN A 1 62  ? 9.741   -13.718 3.258   1.00 0.00 ? 62  GLN A C    3  
ATOM 4289  O O    . GLN A 1 62  ? 8.546   -13.975 3.106   1.00 0.00 ? 62  GLN A O    3  
ATOM 4290  C CB   . GLN A 1 62  ? 10.741  -16.010 3.211   1.00 0.00 ? 62  GLN A CB   3  
ATOM 4291  C CG   . GLN A 1 62  ? 11.918  -16.883 3.615   1.00 0.00 ? 62  GLN A CG   3  
ATOM 4292  C CD   . GLN A 1 62  ? 13.252  -16.293 3.201   1.00 0.00 ? 62  GLN A CD   3  
ATOM 4293  O OE1  . GLN A 1 62  ? 13.768  -16.590 2.123   1.00 0.00 ? 62  GLN A OE1  3  
ATOM 4294  N NE2  . GLN A 1 62  ? 13.817  -15.450 4.057   1.00 0.00 ? 62  GLN A NE2  3  
ATOM 4295  H H    . GLN A 1 62  ? 9.418   -15.501 5.492   1.00 0.00 ? 62  GLN A H    3  
ATOM 4296  H HA   . GLN A 1 62  ? 11.650  -14.260 4.039   1.00 0.00 ? 62  GLN A HA   3  
ATOM 4297  H HB2  . GLN A 1 62  ? 9.832   -16.568 3.381   1.00 0.00 ? 62  GLN A HB2  3  
ATOM 4298  H HB3  . GLN A 1 62  ? 10.828  -15.792 2.157   1.00 0.00 ? 62  GLN A HB3  3  
ATOM 4299  H HG2  . GLN A 1 62  ? 11.912  -17.000 4.688   1.00 0.00 ? 62  GLN A HG2  3  
ATOM 4300  H HG3  . GLN A 1 62  ? 11.809  -17.851 3.148   1.00 0.00 ? 62  GLN A HG3  3  
ATOM 4301  H HE21 . GLN A 1 62  ? 13.349  -15.261 4.897   1.00 0.00 ? 62  GLN A HE21 3  
ATOM 4302  H HE22 . GLN A 1 62  ? 14.680  -15.054 3.816   1.00 0.00 ? 62  GLN A HE22 3  
ATOM 4303  N N    . ARG A 1 63  ? 10.303  -12.599 2.812   1.00 0.00 ? 63  ARG A N    3  
ATOM 4304  C CA   . ARG A 1 63  ? 9.531   -11.586 2.104   1.00 0.00 ? 63  ARG A CA   3  
ATOM 4305  C C    . ARG A 1 63  ? 9.538   -11.848 0.600   1.00 0.00 ? 63  ARG A C    3  
ATOM 4306  O O    . ARG A 1 63  ? 10.599  -11.952 -0.016  1.00 0.00 ? 63  ARG A O    3  
ATOM 4307  C CB   . ARG A 1 63  ? 10.093  -10.192 2.391   1.00 0.00 ? 63  ARG A CB   3  
ATOM 4308  C CG   . ARG A 1 63  ? 9.490   -9.535  3.622   1.00 0.00 ? 63  ARG A CG   3  
ATOM 4309  C CD   . ARG A 1 63  ? 9.990   -10.186 4.902   1.00 0.00 ? 63  ARG A CD   3  
ATOM 4310  N NE   . ARG A 1 63  ? 10.010  -9.248  6.022   1.00 0.00 ? 63  ARG A NE   3  
ATOM 4311  C CZ   . ARG A 1 63  ? 10.733  -9.431  7.121   1.00 0.00 ? 63  ARG A CZ   3  
ATOM 4312  N NH1  . ARG A 1 63  ? 11.491  -10.511 7.248   1.00 0.00 ? 63  ARG A NH1  3  
ATOM 4313  N NH2  . ARG A 1 63  ? 10.698  -8.532  8.097   1.00 0.00 ? 63  ARG A NH2  3  
ATOM 4314  H H    . ARG A 1 63  ? 11.260  -12.452 2.963   1.00 0.00 ? 63  ARG A H    3  
ATOM 4315  H HA   . ARG A 1 63  ? 8.513   -11.635 2.460   1.00 0.00 ? 63  ARG A HA   3  
ATOM 4316  H HB2  . ARG A 1 63  ? 11.160  -10.270 2.538   1.00 0.00 ? 63  ARG A HB2  3  
ATOM 4317  H HB3  . ARG A 1 63  ? 9.900   -9.557  1.540   1.00 0.00 ? 63  ARG A HB3  3  
ATOM 4318  H HG2  . ARG A 1 63  ? 9.764   -8.491  3.632   1.00 0.00 ? 63  ARG A HG2  3  
ATOM 4319  H HG3  . ARG A 1 63  ? 8.415   -9.627  3.578   1.00 0.00 ? 63  ARG A HG3  3  
ATOM 4320  H HD2  . ARG A 1 63  ? 9.340   -11.012 5.149   1.00 0.00 ? 63  ARG A HD2  3  
ATOM 4321  H HD3  . ARG A 1 63  ? 10.991  -10.554 4.736   1.00 0.00 ? 63  ARG A HD3  3  
ATOM 4322  H HE   . ARG A 1 63  ? 9.456   -8.443  5.949   1.00 0.00 ? 63  ARG A HE   3  
ATOM 4323  H HH11 . ARG A 1 63  ? 11.520  -11.189 6.514   1.00 0.00 ? 63  ARG A HH11 3  
ATOM 4324  H HH12 . ARG A 1 63  ? 12.036  -10.646 8.076   1.00 0.00 ? 63  ARG A HH12 3  
ATOM 4325  H HH21 . ARG A 1 63  ? 10.127  -7.717  8.005   1.00 0.00 ? 63  ARG A HH21 3  
ATOM 4326  H HH22 . ARG A 1 63  ? 11.242  -8.671  8.924   1.00 0.00 ? 63  ARG A HH22 3  
ATOM 4327  N N    . ILE A 1 64  ? 8.349   -11.955 0.018   1.00 0.00 ? 64  ILE A N    3  
ATOM 4328  C CA   . ILE A 1 64  ? 8.219   -12.205 -1.412  1.00 0.00 ? 64  ILE A CA   3  
ATOM 4329  C C    . ILE A 1 64  ? 7.635   -10.994 -2.131  1.00 0.00 ? 64  ILE A C    3  
ATOM 4330  O O    . ILE A 1 64  ? 6.683   -10.374 -1.656  1.00 0.00 ? 64  ILE A O    3  
ATOM 4331  C CB   . ILE A 1 64  ? 7.329   -13.431 -1.691  1.00 0.00 ? 64  ILE A CB   3  
ATOM 4332  C CG1  . ILE A 1 64  ? 7.743   -14.602 -0.797  1.00 0.00 ? 64  ILE A CG1  3  
ATOM 4333  C CG2  . ILE A 1 64  ? 7.412   -13.823 -3.159  1.00 0.00 ? 64  ILE A CG2  3  
ATOM 4334  C CD1  . ILE A 1 64  ? 7.073   -15.908 -1.164  1.00 0.00 ? 64  ILE A CD1  3  
ATOM 4335  H H    . ILE A 1 64  ? 7.540   -11.863 0.562   1.00 0.00 ? 64  ILE A H    3  
ATOM 4336  H HA   . ILE A 1 64  ? 9.205   -12.404 -1.807  1.00 0.00 ? 64  ILE A HA   3  
ATOM 4337  H HB   . ILE A 1 64  ? 6.307   -13.164 -1.472  1.00 0.00 ? 64  ILE A HB   3  
ATOM 4338  H HG12 . ILE A 1 64  ? 8.809   -14.745 -0.872  1.00 0.00 ? 64  ILE A HG12 3  
ATOM 4339  H HG13 . ILE A 1 64  ? 7.485   -14.372 0.227   1.00 0.00 ? 64  ILE A HG13 3  
ATOM 4340  H HG21 . ILE A 1 64  ? 6.430   -13.765 -3.603  1.00 0.00 ? 64  ILE A HG21 3  
ATOM 4341  H HG22 . ILE A 1 64  ? 8.080   -13.148 -3.674  1.00 0.00 ? 64  ILE A HG22 3  
ATOM 4342  H HG23 . ILE A 1 64  ? 7.786   -14.833 -3.242  1.00 0.00 ? 64  ILE A HG23 3  
ATOM 4343  H HD11 . ILE A 1 64  ? 6.237   -15.713 -1.819  1.00 0.00 ? 64  ILE A HD11 3  
ATOM 4344  H HD12 . ILE A 1 64  ? 7.782   -16.549 -1.665  1.00 0.00 ? 64  ILE A HD12 3  
ATOM 4345  H HD13 . ILE A 1 64  ? 6.719   -16.395 -0.266  1.00 0.00 ? 64  ILE A HD13 3  
ATOM 4346  N N    . THR A 1 65  ? 8.211   -10.661 -3.282  1.00 0.00 ? 65  THR A N    3  
ATOM 4347  C CA   . THR A 1 65  ? 7.748   -9.524  -4.068  1.00 0.00 ? 65  THR A CA   3  
ATOM 4348  C C    . THR A 1 65  ? 6.556   -9.906  -4.938  1.00 0.00 ? 65  THR A C    3  
ATOM 4349  O O    . THR A 1 65  ? 6.692   -10.675 -5.890  1.00 0.00 ? 65  THR A O    3  
ATOM 4350  C CB   . THR A 1 65  ? 8.869   -8.969  -4.968  1.00 0.00 ? 65  THR A CB   3  
ATOM 4351  O OG1  . THR A 1 65  ? 9.972   -8.535  -4.165  1.00 0.00 ? 65  THR A OG1  3  
ATOM 4352  C CG2  . THR A 1 65  ? 8.361   -7.810  -5.812  1.00 0.00 ? 65  THR A CG2  3  
ATOM 4353  H H    . THR A 1 65  ? 8.966   -11.193 -3.609  1.00 0.00 ? 65  THR A H    3  
ATOM 4354  H HA   . THR A 1 65  ? 7.447   -8.745  -3.383  1.00 0.00 ? 65  THR A HA   3  
ATOM 4355  H HB   . THR A 1 65  ? 9.203   -9.757  -5.628  1.00 0.00 ? 65  THR A HB   3  
ATOM 4356  H HG1  . THR A 1 65  ? 10.793  -8.693  -4.636  1.00 0.00 ? 65  THR A HG1  3  
ATOM 4357  H HG21 . THR A 1 65  ? 7.355   -7.559  -5.511  1.00 0.00 ? 65  THR A HG21 3  
ATOM 4358  H HG22 . THR A 1 65  ? 8.366   -8.094  -6.853  1.00 0.00 ? 65  THR A HG22 3  
ATOM 4359  H HG23 . THR A 1 65  ? 9.003   -6.954  -5.669  1.00 0.00 ? 65  THR A HG23 3  
ATOM 4360  N N    . ILE A 1 66  ? 5.390   -9.364  -4.606  1.00 0.00 ? 66  ILE A N    3  
ATOM 4361  C CA   . ILE A 1 66  ? 4.174   -9.647  -5.359  1.00 0.00 ? 66  ILE A CA   3  
ATOM 4362  C C    . ILE A 1 66  ? 3.828   -8.496  -6.298  1.00 0.00 ? 66  ILE A C    3  
ATOM 4363  O O    . ILE A 1 66  ? 4.588   -7.536  -6.424  1.00 0.00 ? 66  ILE A O    3  
ATOM 4364  C CB   . ILE A 1 66  ? 2.979   -9.907  -4.422  1.00 0.00 ? 66  ILE A CB   3  
ATOM 4365  C CG1  . ILE A 1 66  ? 3.465   -10.467 -3.084  1.00 0.00 ? 66  ILE A CG1  3  
ATOM 4366  C CG2  . ILE A 1 66  ? 1.992   -10.862 -5.076  1.00 0.00 ? 66  ILE A CG2  3  
ATOM 4367  C CD1  . ILE A 1 66  ? 2.351   -10.705 -2.088  1.00 0.00 ? 66  ILE A CD1  3  
ATOM 4368  H H    . ILE A 1 66  ? 5.345   -8.758  -3.837  1.00 0.00 ? 66  ILE A H    3  
ATOM 4369  H HA   . ILE A 1 66  ? 4.346   -10.537 -5.946  1.00 0.00 ? 66  ILE A HA   3  
ATOM 4370  H HB   . ILE A 1 66  ? 2.475   -8.969  -4.250  1.00 0.00 ? 66  ILE A HB   3  
ATOM 4371  H HG12 . ILE A 1 66  ? 3.963   -11.409 -3.254  1.00 0.00 ? 66  ILE A HG12 3  
ATOM 4372  H HG13 . ILE A 1 66  ? 4.163   -9.771  -2.643  1.00 0.00 ? 66  ILE A HG13 3  
ATOM 4373  H HG21 . ILE A 1 66  ? 1.668   -11.596 -4.352  1.00 0.00 ? 66  ILE A HG21 3  
ATOM 4374  H HG22 . ILE A 1 66  ? 1.137   -10.308 -5.432  1.00 0.00 ? 66  ILE A HG22 3  
ATOM 4375  H HG23 . ILE A 1 66  ? 2.470   -11.362 -5.906  1.00 0.00 ? 66  ILE A HG23 3  
ATOM 4376  H HD11 . ILE A 1 66  ? 1.573   -9.971  -2.237  1.00 0.00 ? 66  ILE A HD11 3  
ATOM 4377  H HD12 . ILE A 1 66  ? 1.946   -11.695 -2.230  1.00 0.00 ? 66  ILE A HD12 3  
ATOM 4378  H HD13 . ILE A 1 66  ? 2.742   -10.616 -1.084  1.00 0.00 ? 66  ILE A HD13 3  
ATOM 4379  N N    . GLU A 1 67  ? 2.676   -8.599  -6.953  1.00 0.00 ? 67  GLU A N    3  
ATOM 4380  C CA   . GLU A 1 67  ? 2.230   -7.566  -7.880  1.00 0.00 ? 67  GLU A CA   3  
ATOM 4381  C C    . GLU A 1 67  ? 0.974   -6.873  -7.358  1.00 0.00 ? 67  GLU A C    3  
ATOM 4382  O O    . GLU A 1 67  ? 0.157   -7.463  -6.651  1.00 0.00 ? 67  GLU A O    3  
ATOM 4383  C CB   . GLU A 1 67  ? 1.956   -8.170  -9.259  1.00 0.00 ? 67  GLU A CB   3  
ATOM 4384  C CG   . GLU A 1 67  ? 3.217   -8.546  -10.019 1.00 0.00 ? 67  GLU A CG   3  
ATOM 4385  C CD   . GLU A 1 67  ? 4.069   -7.341  -10.369 1.00 0.00 ? 67  GLU A CD   3  
ATOM 4386  O OE1  . GLU A 1 67  ? 3.570   -6.450  -11.086 1.00 0.00 ? 67  GLU A OE1  3  
ATOM 4387  O OE2  . GLU A 1 67  ? 5.235   -7.291  -9.924  1.00 0.00 ? 67  GLU A OE2  3  
ATOM 4388  H H    . GLU A 1 67  ? 2.114   -9.389  -6.810  1.00 0.00 ? 67  GLU A H    3  
ATOM 4389  H HA   . GLU A 1 67  ? 3.019   -6.835  -7.967  1.00 0.00 ? 67  GLU A HA   3  
ATOM 4390  H HB2  . GLU A 1 67  ? 1.355   -9.059  -9.136  1.00 0.00 ? 67  GLU A HB2  3  
ATOM 4391  H HB3  . GLU A 1 67  ? 1.406   -7.453  -9.849  1.00 0.00 ? 67  GLU A HB3  3  
ATOM 4392  H HG2  . GLU A 1 67  ? 3.803   -9.217  -9.409  1.00 0.00 ? 67  GLU A HG2  3  
ATOM 4393  H HG3  . GLU A 1 67  ? 2.935   -9.047  -10.933 1.00 0.00 ? 67  GLU A HG3  3  
ATOM 4394  N N    . PRO A 1 68  ? 0.816   -5.590  -7.714  1.00 0.00 ? 68  PRO A N    3  
ATOM 4395  C CA   . PRO A 1 68  ? -0.337  -4.788  -7.294  1.00 0.00 ? 68  PRO A CA   3  
ATOM 4396  C C    . PRO A 1 68  ? -1.631  -5.235  -7.965  1.00 0.00 ? 68  PRO A C    3  
ATOM 4397  O O    . PRO A 1 68  ? -2.082  -4.626  -8.934  1.00 0.00 ? 68  PRO A O    3  
ATOM 4398  C CB   . PRO A 1 68  ? 0.035   -3.371  -7.740  1.00 0.00 ? 68  PRO A CB   3  
ATOM 4399  C CG   . PRO A 1 68  ? 0.985   -3.567  -8.870  1.00 0.00 ? 68  PRO A CG   3  
ATOM 4400  C CD   . PRO A 1 68  ? 1.750   -4.823  -8.555  1.00 0.00 ? 68  PRO A CD   3  
ATOM 4401  H HA   . PRO A 1 68  ? -0.464  -4.807  -6.221  1.00 0.00 ? 68  PRO A HA   3  
ATOM 4402  H HB2  . PRO A 1 68  ? -0.855  -2.846  -8.057  1.00 0.00 ? 68  PRO A HB2  3  
ATOM 4403  H HB3  . PRO A 1 68  ? 0.499   -2.842  -6.921  1.00 0.00 ? 68  PRO A HB3  3  
ATOM 4404  H HG2  . PRO A 1 68  ? 0.438   -3.683  -9.794  1.00 0.00 ? 68  PRO A HG2  3  
ATOM 4405  H HG3  . PRO A 1 68  ? 1.658   -2.725  -8.934  1.00 0.00 ? 68  PRO A HG3  3  
ATOM 4406  H HD2  . PRO A 1 68  ? 1.983   -5.361  -9.463  1.00 0.00 ? 68  PRO A HD2  3  
ATOM 4407  H HD3  . PRO A 1 68  ? 2.653   -4.588  -8.012  1.00 0.00 ? 68  PRO A HD3  3  
ATOM 4408  N N    . GLY A 1 69  ? -2.223  -6.305  -7.443  1.00 0.00 ? 69  GLY A N    3  
ATOM 4409  C CA   . GLY A 1 69  ? -3.460  -6.816  -8.005  1.00 0.00 ? 69  GLY A CA   3  
ATOM 4410  C C    . GLY A 1 69  ? -4.523  -7.050  -6.951  1.00 0.00 ? 69  GLY A C    3  
ATOM 4411  O O    . GLY A 1 69  ? -4.804  -6.170  -6.135  1.00 0.00 ? 69  GLY A O    3  
ATOM 4412  H H    . GLY A 1 69  ? -1.818  -6.751  -6.671  1.00 0.00 ? 69  GLY A H    3  
ATOM 4413  H HA2  . GLY A 1 69  ? -3.834  -6.106  -8.728  1.00 0.00 ? 69  GLY A HA2  3  
ATOM 4414  H HA3  . GLY A 1 69  ? -3.255  -7.751  -8.506  1.00 0.00 ? 69  GLY A HA3  3  
ATOM 4415  N N    . THR A 1 70  ? -5.119  -8.238  -6.966  1.00 0.00 ? 70  THR A N    3  
ATOM 4416  C CA   . THR A 1 70  ? -6.159  -8.584  -6.005  1.00 0.00 ? 70  THR A CA   3  
ATOM 4417  C C    . THR A 1 70  ? -5.899  -9.950  -5.381  1.00 0.00 ? 70  THR A C    3  
ATOM 4418  O O    . THR A 1 70  ? -6.201  -10.175 -4.209  1.00 0.00 ? 70  THR A O    3  
ATOM 4419  C CB   . THR A 1 70  ? -7.552  -8.590  -6.664  1.00 0.00 ? 70  THR A CB   3  
ATOM 4420  O OG1  . THR A 1 70  ? -7.550  -9.456  -7.804  1.00 0.00 ? 70  THR A OG1  3  
ATOM 4421  C CG2  . THR A 1 70  ? -7.957  -7.186  -7.087  1.00 0.00 ? 70  THR A CG2  3  
ATOM 4422  H H    . THR A 1 70  ? -4.851  -8.897  -7.640  1.00 0.00 ? 70  THR A H    3  
ATOM 4423  H HA   . THR A 1 70  ? -6.156  -7.836  -5.226  1.00 0.00 ? 70  THR A HA   3  
ATOM 4424  H HB   . THR A 1 70  ? -8.271  -8.955  -5.945  1.00 0.00 ? 70  THR A HB   3  
ATOM 4425  H HG1  . THR A 1 70  ? -8.089  -10.229 -7.620  1.00 0.00 ? 70  THR A HG1  3  
ATOM 4426  H HG21 . THR A 1 70  ? -7.176  -6.490  -6.817  1.00 0.00 ? 70  THR A HG21 3  
ATOM 4427  H HG22 . THR A 1 70  ? -8.874  -6.910  -6.588  1.00 0.00 ? 70  THR A HG22 3  
ATOM 4428  H HG23 . THR A 1 70  ? -8.107  -7.162  -8.155  1.00 0.00 ? 70  THR A HG23 3  
ATOM 4429  N N    . SER A 1 71  ? -5.336  -10.859 -6.170  1.00 0.00 ? 71  SER A N    3  
ATOM 4430  C CA   . SER A 1 71  ? -5.038  -12.205 -5.695  1.00 0.00 ? 71  SER A CA   3  
ATOM 4431  C C    . SER A 1 71  ? -3.696  -12.687 -6.236  1.00 0.00 ? 71  SER A C    3  
ATOM 4432  O O    . SER A 1 71  ? -3.289  -12.318 -7.338  1.00 0.00 ? 71  SER A O    3  
ATOM 4433  C CB   . SER A 1 71  ? -6.147  -13.173 -6.112  1.00 0.00 ? 71  SER A CB   3  
ATOM 4434  O OG   . SER A 1 71  ? -7.427  -12.635 -5.831  1.00 0.00 ? 71  SER A OG   3  
ATOM 4435  H H    . SER A 1 71  ? -5.119  -10.619 -7.096  1.00 0.00 ? 71  SER A H    3  
ATOM 4436  H HA   . SER A 1 71  ? -4.987  -12.172 -4.617  1.00 0.00 ? 71  SER A HA   3  
ATOM 4437  H HB2  . SER A 1 71  ? -6.075  -13.364 -7.172  1.00 0.00 ? 71  SER A HB2  3  
ATOM 4438  H HB3  . SER A 1 71  ? -6.033  -14.101 -5.571  1.00 0.00 ? 71  SER A HB3  3  
ATOM 4439  H HG   . SER A 1 71  ? -7.509  -12.480 -4.887  1.00 0.00 ? 71  SER A HG   3  
ATOM 4440  N N    . TYR A 1 72  ? -3.012  -13.514 -5.453  1.00 0.00 ? 72  TYR A N    3  
ATOM 4441  C CA   . TYR A 1 72  ? -1.714  -14.046 -5.851  1.00 0.00 ? 72  TYR A CA   3  
ATOM 4442  C C    . TYR A 1 72  ? -1.644  -15.551 -5.609  1.00 0.00 ? 72  TYR A C    3  
ATOM 4443  O O    . TYR A 1 72  ? -2.143  -16.052 -4.601  1.00 0.00 ? 72  TYR A O    3  
ATOM 4444  C CB   . TYR A 1 72  ? -0.594  -13.342 -5.084  1.00 0.00 ? 72  TYR A CB   3  
ATOM 4445  C CG   . TYR A 1 72  ? 0.764   -13.980 -5.274  1.00 0.00 ? 72  TYR A CG   3  
ATOM 4446  C CD1  . TYR A 1 72  ? 1.472   -13.814 -6.457  1.00 0.00 ? 72  TYR A CD1  3  
ATOM 4447  C CD2  . TYR A 1 72  ? 1.338   -14.748 -4.268  1.00 0.00 ? 72  TYR A CD2  3  
ATOM 4448  C CE1  . TYR A 1 72  ? 2.713   -14.396 -6.635  1.00 0.00 ? 72  TYR A CE1  3  
ATOM 4449  C CE2  . TYR A 1 72  ? 2.579   -15.332 -4.437  1.00 0.00 ? 72  TYR A CE2  3  
ATOM 4450  C CZ   . TYR A 1 72  ? 3.262   -15.154 -5.622  1.00 0.00 ? 72  TYR A CZ   3  
ATOM 4451  O OH   . TYR A 1 72  ? 4.498   -15.734 -5.794  1.00 0.00 ? 72  TYR A OH   3  
ATOM 4452  H H    . TYR A 1 72  ? -3.388  -13.772 -4.586  1.00 0.00 ? 72  TYR A H    3  
ATOM 4453  H HA   . TYR A 1 72  ? -1.588  -13.857 -6.907  1.00 0.00 ? 72  TYR A HA   3  
ATOM 4454  H HB2  . TYR A 1 72  ? -0.527  -12.318 -5.417  1.00 0.00 ? 72  TYR A HB2  3  
ATOM 4455  H HB3  . TYR A 1 72  ? -0.824  -13.358 -4.029  1.00 0.00 ? 72  TYR A HB3  3  
ATOM 4456  H HD1  . TYR A 1 72  ? 1.040   -13.219 -7.249  1.00 0.00 ? 72  TYR A HD1  3  
ATOM 4457  H HD2  . TYR A 1 72  ? 0.801   -14.886 -3.341  1.00 0.00 ? 72  TYR A HD2  3  
ATOM 4458  H HE1  . TYR A 1 72  ? 3.248   -14.256 -7.562  1.00 0.00 ? 72  TYR A HE1  3  
ATOM 4459  H HE2  . TYR A 1 72  ? 3.009   -15.926 -3.644  1.00 0.00 ? 72  TYR A HE2  3  
ATOM 4460  H HH   . TYR A 1 72  ? 4.870   -15.954 -4.937  1.00 0.00 ? 72  TYR A HH   3  
ATOM 4461  N N    . ARG A 1 73  ? -1.021  -16.265 -6.540  1.00 0.00 ? 73  ARG A N    3  
ATOM 4462  C CA   . ARG A 1 73  ? -0.885  -17.712 -6.429  1.00 0.00 ? 73  ARG A CA   3  
ATOM 4463  C C    . ARG A 1 73  ? 0.540   -18.097 -6.040  1.00 0.00 ? 73  ARG A C    3  
ATOM 4464  O O    . ARG A 1 73  ? 1.455   -18.046 -6.864  1.00 0.00 ? 73  ARG A O    3  
ATOM 4465  C CB   . ARG A 1 73  ? -1.263  -18.385 -7.750  1.00 0.00 ? 73  ARG A CB   3  
ATOM 4466  C CG   . ARG A 1 73  ? -1.463  -19.887 -7.633  1.00 0.00 ? 73  ARG A CG   3  
ATOM 4467  C CD   . ARG A 1 73  ? -1.919  -20.492 -8.952  1.00 0.00 ? 73  ARG A CD   3  
ATOM 4468  N NE   . ARG A 1 73  ? -3.364  -20.385 -9.133  1.00 0.00 ? 73  ARG A NE   3  
ATOM 4469  C CZ   . ARG A 1 73  ? -3.974  -20.559 -10.300 1.00 0.00 ? 73  ARG A CZ   3  
ATOM 4470  N NH1  . ARG A 1 73  ? -3.267  -20.848 -11.384 1.00 0.00 ? 73  ARG A NH1  3  
ATOM 4471  N NH2  . ARG A 1 73  ? -5.293  -20.446 -10.385 1.00 0.00 ? 73  ARG A NH2  3  
ATOM 4472  H H    . ARG A 1 73  ? -0.643  -15.808 -7.321  1.00 0.00 ? 73  ARG A H    3  
ATOM 4473  H HA   . ARG A 1 73  ? -1.559  -18.051 -5.657  1.00 0.00 ? 73  ARG A HA   3  
ATOM 4474  H HB2  . ARG A 1 73  ? -2.182  -17.948 -8.112  1.00 0.00 ? 73  ARG A HB2  3  
ATOM 4475  H HB3  . ARG A 1 73  ? -0.480  -18.202 -8.470  1.00 0.00 ? 73  ARG A HB3  3  
ATOM 4476  H HG2  . ARG A 1 73  ? -0.529  -20.344 -7.344  1.00 0.00 ? 73  ARG A HG2  3  
ATOM 4477  H HG3  . ARG A 1 73  ? -2.211  -20.083 -6.879  1.00 0.00 ? 73  ARG A HG3  3  
ATOM 4478  H HD2  . ARG A 1 73  ? -1.426  -19.973 -9.760  1.00 0.00 ? 73  ARG A HD2  3  
ATOM 4479  H HD3  . ARG A 1 73  ? -1.639  -21.534 -8.970  1.00 0.00 ? 73  ARG A HD3  3  
ATOM 4480  H HE   . ARG A 1 73  ? -3.906  -20.172 -8.345  1.00 0.00 ? 73  ARG A HE   3  
ATOM 4481  H HH11 . ARG A 1 73  ? -2.273  -20.935 -11.323 1.00 0.00 ? 73  ARG A HH11 3  
ATOM 4482  H HH12 . ARG A 1 73  ? -3.729  -20.980 -12.262 1.00 0.00 ? 73  ARG A HH12 3  
ATOM 4483  H HH21 . ARG A 1 73  ? -5.829  -20.229 -9.569  1.00 0.00 ? 73  ARG A HH21 3  
ATOM 4484  H HH22 . ARG A 1 73  ? -5.751  -20.577 -11.263 1.00 0.00 ? 73  ARG A HH22 3  
ATOM 4485  N N    . LEU A 1 74  ? 0.721   -18.479 -4.781  1.00 0.00 ? 74  LEU A N    3  
ATOM 4486  C CA   . LEU A 1 74  ? 2.035   -18.872 -4.282  1.00 0.00 ? 74  LEU A CA   3  
ATOM 4487  C C    . LEU A 1 74  ? 2.288   -20.357 -4.523  1.00 0.00 ? 74  LEU A C    3  
ATOM 4488  O O    . LEU A 1 74  ? 1.409   -21.189 -4.301  1.00 0.00 ? 74  LEU A O    3  
ATOM 4489  C CB   . LEU A 1 74  ? 2.150   -18.559 -2.789  1.00 0.00 ? 74  LEU A CB   3  
ATOM 4490  C CG   . LEU A 1 74  ? 3.399   -19.091 -2.086  1.00 0.00 ? 74  LEU A CG   3  
ATOM 4491  C CD1  . LEU A 1 74  ? 4.645   -18.398 -2.614  1.00 0.00 ? 74  LEU A CD1  3  
ATOM 4492  C CD2  . LEU A 1 74  ? 3.282   -18.908 -0.580  1.00 0.00 ? 74  LEU A CD2  3  
ATOM 4493  H H    . LEU A 1 74  ? -0.045  -18.499 -4.171  1.00 0.00 ? 74  LEU A H    3  
ATOM 4494  H HA   . LEU A 1 74  ? 2.777   -18.301 -4.819  1.00 0.00 ? 74  LEU A HA   3  
ATOM 4495  H HB2  . LEU A 1 74  ? 2.138   -17.486 -2.674  1.00 0.00 ? 74  LEU A HB2  3  
ATOM 4496  H HB3  . LEU A 1 74  ? 1.286   -18.982 -2.296  1.00 0.00 ? 74  LEU A HB3  3  
ATOM 4497  H HG   . LEU A 1 74  ? 3.495   -20.149 -2.289  1.00 0.00 ? 74  LEU A HG   3  
ATOM 4498  H HD11 . LEU A 1 74  ? 5.498   -18.688 -2.019  1.00 0.00 ? 74  LEU A HD11 3  
ATOM 4499  H HD12 . LEU A 1 74  ? 4.513   -17.328 -2.556  1.00 0.00 ? 74  LEU A HD12 3  
ATOM 4500  H HD13 . LEU A 1 74  ? 4.808   -18.685 -3.643  1.00 0.00 ? 74  LEU A HD13 3  
ATOM 4501  H HD21 . LEU A 1 74  ? 4.255   -18.684 -0.168  1.00 0.00 ? 74  LEU A HD21 3  
ATOM 4502  H HD22 . LEU A 1 74  ? 2.904   -19.817 -0.135  1.00 0.00 ? 74  LEU A HD22 3  
ATOM 4503  H HD23 . LEU A 1 74  ? 2.605   -18.094 -0.368  1.00 0.00 ? 74  LEU A HD23 3  
ATOM 4504  N N    . GLN A 1 75  ? 3.494   -20.680 -4.977  1.00 0.00 ? 75  GLN A N    3  
ATOM 4505  C CA   . GLN A 1 75  ? 3.862   -22.065 -5.246  1.00 0.00 ? 75  GLN A CA   3  
ATOM 4506  C C    . GLN A 1 75  ? 5.215   -22.399 -4.626  1.00 0.00 ? 75  GLN A C    3  
ATOM 4507  O O    . GLN A 1 75  ? 5.989   -21.507 -4.282  1.00 0.00 ? 75  GLN A O    3  
ATOM 4508  C CB   . GLN A 1 75  ? 3.902   -22.320 -6.754  1.00 0.00 ? 75  GLN A CB   3  
ATOM 4509  C CG   . GLN A 1 75  ? 2.675   -21.808 -7.490  1.00 0.00 ? 75  GLN A CG   3  
ATOM 4510  C CD   . GLN A 1 75  ? 2.900   -21.685 -8.984  1.00 0.00 ? 75  GLN A CD   3  
ATOM 4511  O OE1  . GLN A 1 75  ? 3.942   -21.202 -9.429  1.00 0.00 ? 75  GLN A OE1  3  
ATOM 4512  N NE2  . GLN A 1 75  ? 1.922   -22.121 -9.769  1.00 0.00 ? 75  GLN A NE2  3  
ATOM 4513  H H    . GLN A 1 75  ? 4.152   -19.972 -5.134  1.00 0.00 ? 75  GLN A H    3  
ATOM 4514  H HA   . GLN A 1 75  ? 3.110   -22.700 -4.803  1.00 0.00 ? 75  GLN A HA   3  
ATOM 4515  H HB2  . GLN A 1 75  ? 4.773   -21.833 -7.167  1.00 0.00 ? 75  GLN A HB2  3  
ATOM 4516  H HB3  . GLN A 1 75  ? 3.980   -23.384 -6.925  1.00 0.00 ? 75  GLN A HB3  3  
ATOM 4517  H HG2  . GLN A 1 75  ? 1.857   -22.494 -7.321  1.00 0.00 ? 75  GLN A HG2  3  
ATOM 4518  H HG3  . GLN A 1 75  ? 2.415   -20.836 -7.098  1.00 0.00 ? 75  GLN A HG3  3  
ATOM 4519  H HE21 . GLN A 1 75  ? 1.119   -22.492 -9.345  1.00 0.00 ? 75  GLN A HE21 3  
ATOM 4520  H HE22 . GLN A 1 75  ? 2.040   -22.052 -10.738 1.00 0.00 ? 75  GLN A HE22 3  
ATOM 4521  N N    . GLY A 1 76  ? 5.493   -23.692 -4.486  1.00 0.00 ? 76  GLY A N    3  
ATOM 4522  C CA   . GLY A 1 76  ? 6.753   -24.121 -3.906  1.00 0.00 ? 76  GLY A CA   3  
ATOM 4523  C C    . GLY A 1 76  ? 6.656   -24.347 -2.410  1.00 0.00 ? 76  GLY A C    3  
ATOM 4524  O O    . GLY A 1 76  ? 7.374   -23.717 -1.632  1.00 0.00 ? 76  GLY A O    3  
ATOM 4525  H H    . GLY A 1 76  ? 4.838   -24.360 -4.778  1.00 0.00 ? 76  GLY A H    3  
ATOM 4526  H HA2  . GLY A 1 76  ? 7.059   -25.042 -4.380  1.00 0.00 ? 76  GLY A HA2  3  
ATOM 4527  H HA3  . GLY A 1 76  ? 7.500   -23.364 -4.096  1.00 0.00 ? 76  GLY A HA3  3  
ATOM 4528  N N    . LEU A 1 77  ? 5.765   -25.245 -2.006  1.00 0.00 ? 77  LEU A N    3  
ATOM 4529  C CA   . LEU A 1 77  ? 5.575   -25.552 -0.592  1.00 0.00 ? 77  LEU A CA   3  
ATOM 4530  C C    . LEU A 1 77  ? 5.471   -27.057 -0.371  1.00 0.00 ? 77  LEU A C    3  
ATOM 4531  O O    . LEU A 1 77  ? 5.421   -27.834 -1.324  1.00 0.00 ? 77  LEU A O    3  
ATOM 4532  C CB   . LEU A 1 77  ? 4.318   -24.859 -0.065  1.00 0.00 ? 77  LEU A CB   3  
ATOM 4533  C CG   . LEU A 1 77  ? 4.189   -23.369 -0.383  1.00 0.00 ? 77  LEU A CG   3  
ATOM 4534  C CD1  . LEU A 1 77  ? 2.732   -22.935 -0.324  1.00 0.00 ? 77  LEU A CD1  3  
ATOM 4535  C CD2  . LEU A 1 77  ? 5.032   -22.543 0.578   1.00 0.00 ? 77  LEU A CD2  3  
ATOM 4536  H H    . LEU A 1 77  ? 5.222   -25.715 -2.673  1.00 0.00 ? 77  LEU A H    3  
ATOM 4537  H HA   . LEU A 1 77  ? 6.434   -25.179 -0.054  1.00 0.00 ? 77  LEU A HA   3  
ATOM 4538  H HB2  . LEU A 1 77  ? 3.461   -25.362 -0.486  1.00 0.00 ? 77  LEU A HB2  3  
ATOM 4539  H HB3  . LEU A 1 77  ? 4.306   -24.971 1.010   1.00 0.00 ? 77  LEU A HB3  3  
ATOM 4540  H HG   . LEU A 1 77  ? 4.550   -23.189 -1.386  1.00 0.00 ? 77  LEU A HG   3  
ATOM 4541  H HD11 . LEU A 1 77  ? 2.678   -21.857 -0.308  1.00 0.00 ? 77  LEU A HD11 3  
ATOM 4542  H HD12 . LEU A 1 77  ? 2.274   -23.331 0.570   1.00 0.00 ? 77  LEU A HD12 3  
ATOM 4543  H HD13 . LEU A 1 77  ? 2.210   -23.309 -1.192  1.00 0.00 ? 77  LEU A HD13 3  
ATOM 4544  H HD21 . LEU A 1 77  ? 4.857   -21.493 0.398   1.00 0.00 ? 77  LEU A HD21 3  
ATOM 4545  H HD22 . LEU A 1 77  ? 6.078   -22.766 0.420   1.00 0.00 ? 77  LEU A HD22 3  
ATOM 4546  H HD23 . LEU A 1 77  ? 4.761   -22.786 1.594   1.00 0.00 ? 77  LEU A HD23 3  
ATOM 4547  N N    . LYS A 1 78  ? 5.437   -27.463 0.894   1.00 0.00 ? 78  LYS A N    3  
ATOM 4548  C CA   . LYS A 1 78  ? 5.335   -28.875 1.243   1.00 0.00 ? 78  LYS A CA   3  
ATOM 4549  C C    . LYS A 1 78  ? 3.915   -29.228 1.673   1.00 0.00 ? 78  LYS A C    3  
ATOM 4550  O O    . LYS A 1 78  ? 3.224   -28.442 2.322   1.00 0.00 ? 78  LYS A O    3  
ATOM 4551  C CB   . LYS A 1 78  ? 6.319   -29.217 2.364   1.00 0.00 ? 78  LYS A CB   3  
ATOM 4552  C CG   . LYS A 1 78  ? 7.776   -29.037 1.971   1.00 0.00 ? 78  LYS A CG   3  
ATOM 4553  C CD   . LYS A 1 78  ? 8.711   -29.639 3.006   1.00 0.00 ? 78  LYS A CD   3  
ATOM 4554  C CE   . LYS A 1 78  ? 10.145  -29.687 2.501   1.00 0.00 ? 78  LYS A CE   3  
ATOM 4555  N NZ   . LYS A 1 78  ? 10.365  -30.827 1.568   1.00 0.00 ? 78  LYS A NZ   3  
ATOM 4556  H H    . LYS A 1 78  ? 5.481   -26.795 1.611   1.00 0.00 ? 78  LYS A H    3  
ATOM 4557  H HA   . LYS A 1 78  ? 5.587   -29.452 0.366   1.00 0.00 ? 78  LYS A HA   3  
ATOM 4558  H HB2  . LYS A 1 78  ? 6.116   -28.580 3.212   1.00 0.00 ? 78  LYS A HB2  3  
ATOM 4559  H HB3  . LYS A 1 78  ? 6.172   -30.247 2.655   1.00 0.00 ? 78  LYS A HB3  3  
ATOM 4560  H HG2  . LYS A 1 78  ? 7.946   -29.523 1.022   1.00 0.00 ? 78  LYS A HG2  3  
ATOM 4561  H HG3  . LYS A 1 78  ? 7.986   -27.981 1.879   1.00 0.00 ? 78  LYS A HG3  3  
ATOM 4562  H HD2  . LYS A 1 78  ? 8.678   -29.037 3.902   1.00 0.00 ? 78  LYS A HD2  3  
ATOM 4563  H HD3  . LYS A 1 78  ? 8.384   -30.643 3.233   1.00 0.00 ? 78  LYS A HD3  3  
ATOM 4564  H HE2  . LYS A 1 78  ? 10.362  -28.764 1.986   1.00 0.00 ? 78  LYS A HE2  3  
ATOM 4565  H HE3  . LYS A 1 78  ? 10.807  -29.792 3.347   1.00 0.00 ? 78  LYS A HE3  3  
ATOM 4566  H HZ1  . LYS A 1 78  ? 10.367  -31.724 2.095   1.00 0.00 ? 78  LYS A HZ1  3  
ATOM 4567  H HZ2  . LYS A 1 78  ? 11.279  -30.721 1.084   1.00 0.00 ? 78  LYS A HZ2  3  
ATOM 4568  H HZ3  . LYS A 1 78  ? 9.609   -30.858 0.855   1.00 0.00 ? 78  LYS A HZ3  3  
ATOM 4569  N N    . PRO A 1 79  ? 3.468   -30.438 1.307   1.00 0.00 ? 79  PRO A N    3  
ATOM 4570  C CA   . PRO A 1 79  ? 2.127   -30.923 1.646   1.00 0.00 ? 79  PRO A CA   3  
ATOM 4571  C C    . PRO A 1 79  ? 1.975   -31.210 3.136   1.00 0.00 ? 79  PRO A C    3  
ATOM 4572  O O    . PRO A 1 79  ? 2.963   -31.336 3.858   1.00 0.00 ? 79  PRO A O    3  
ATOM 4573  C CB   . PRO A 1 79  ? 2.003   -32.217 0.837   1.00 0.00 ? 79  PRO A CB   3  
ATOM 4574  C CG   . PRO A 1 79  ? 3.406   -32.675 0.636   1.00 0.00 ? 79  PRO A CG   3  
ATOM 4575  C CD   . PRO A 1 79  ? 4.238   -31.427 0.533   1.00 0.00 ? 79  PRO A CD   3  
ATOM 4576  H HA   . PRO A 1 79  ? 1.363   -30.227 1.335   1.00 0.00 ? 79  PRO A HA   3  
ATOM 4577  H HB2  . PRO A 1 79  ? 1.426   -32.940 1.397   1.00 0.00 ? 79  PRO A HB2  3  
ATOM 4578  H HB3  . PRO A 1 79  ? 1.516   -32.011 -0.104  1.00 0.00 ? 79  PRO A HB3  3  
ATOM 4579  H HG2  . PRO A 1 79  ? 3.723   -33.268 1.480   1.00 0.00 ? 79  PRO A HG2  3  
ATOM 4580  H HG3  . PRO A 1 79  ? 3.477   -33.249 -0.276  1.00 0.00 ? 79  PRO A HG3  3  
ATOM 4581  H HD2  . PRO A 1 79  ? 5.212   -31.585 0.970   1.00 0.00 ? 79  PRO A HD2  3  
ATOM 4582  H HD3  . PRO A 1 79  ? 4.331   -31.120 -0.499  1.00 0.00 ? 79  PRO A HD3  3  
ATOM 4583  N N    . ASN A 1 80  ? 0.730   -31.314 3.590   1.00 0.00 ? 80  ASN A N    3  
ATOM 4584  C CA   . ASN A 1 80  ? 0.449   -31.586 4.995   1.00 0.00 ? 80  ASN A CA   3  
ATOM 4585  C C    . ASN A 1 80  ? 1.390   -30.799 5.901   1.00 0.00 ? 80  ASN A C    3  
ATOM 4586  O O    . ASN A 1 80  ? 2.031   -31.363 6.787   1.00 0.00 ? 80  ASN A O    3  
ATOM 4587  C CB   . ASN A 1 80  ? 0.579   -33.083 5.282   1.00 0.00 ? 80  ASN A CB   3  
ATOM 4588  C CG   . ASN A 1 80  ? 1.937   -33.631 4.887   1.00 0.00 ? 80  ASN A CG   3  
ATOM 4589  O OD1  . ASN A 1 80  ? 2.862   -33.672 5.699   1.00 0.00 ? 80  ASN A OD1  3  
ATOM 4590  N ND2  . ASN A 1 80  ? 2.063   -34.055 3.635   1.00 0.00 ? 80  ASN A ND2  3  
ATOM 4591  H H    . ASN A 1 80  ? -0.017  -31.203 2.965   1.00 0.00 ? 80  ASN A H    3  
ATOM 4592  H HA   . ASN A 1 80  ? -0.566  -31.277 5.195   1.00 0.00 ? 80  ASN A HA   3  
ATOM 4593  H HB2  . ASN A 1 80  ? 0.437   -33.255 6.339   1.00 0.00 ? 80  ASN A HB2  3  
ATOM 4594  H HB3  . ASN A 1 80  ? -0.179  -33.617 4.729   1.00 0.00 ? 80  ASN A HB3  3  
ATOM 4595  H HD21 . ASN A 1 80  ? 1.284   -33.991 3.044   1.00 0.00 ? 80  ASN A HD21 3  
ATOM 4596  H HD22 . ASN A 1 80  ? 2.930   -34.414 3.353   1.00 0.00 ? 80  ASN A HD22 3  
ATOM 4597  N N    . SER A 1 81  ? 1.469   -29.492 5.671   1.00 0.00 ? 81  SER A N    3  
ATOM 4598  C CA   . SER A 1 81  ? 2.334   -28.627 6.464   1.00 0.00 ? 81  SER A CA   3  
ATOM 4599  C C    . SER A 1 81  ? 1.735   -27.230 6.595   1.00 0.00 ? 81  SER A C    3  
ATOM 4600  O O    . SER A 1 81  ? 1.212   -26.674 5.628   1.00 0.00 ? 81  SER A O    3  
ATOM 4601  C CB   . SER A 1 81  ? 3.724   -28.541 5.830   1.00 0.00 ? 81  SER A CB   3  
ATOM 4602  O OG   . SER A 1 81  ? 4.435   -29.756 5.994   1.00 0.00 ? 81  SER A OG   3  
ATOM 4603  H H    . SER A 1 81  ? 0.933   -29.101 4.950   1.00 0.00 ? 81  SER A H    3  
ATOM 4604  H HA   . SER A 1 81  ? 2.424   -29.061 7.449   1.00 0.00 ? 81  SER A HA   3  
ATOM 4605  H HB2  . SER A 1 81  ? 3.623   -28.336 4.775   1.00 0.00 ? 81  SER A HB2  3  
ATOM 4606  H HB3  . SER A 1 81  ? 4.282   -27.744 6.300   1.00 0.00 ? 81  SER A HB3  3  
ATOM 4607  H HG   . SER A 1 81  ? 5.363   -29.565 6.153   1.00 0.00 ? 81  SER A HG   3  
ATOM 4608  N N    . LEU A 1 82  ? 1.814   -26.669 7.796   1.00 0.00 ? 82  LEU A N    3  
ATOM 4609  C CA   . LEU A 1 82  ? 1.280   -25.336 8.055   1.00 0.00 ? 82  LEU A CA   3  
ATOM 4610  C C    . LEU A 1 82  ? 2.238   -24.259 7.556   1.00 0.00 ? 82  LEU A C    3  
ATOM 4611  O O    . LEU A 1 82  ? 3.454   -24.453 7.542   1.00 0.00 ? 82  LEU A O    3  
ATOM 4612  C CB   . LEU A 1 82  ? 1.021   -25.151 9.551   1.00 0.00 ? 82  LEU A CB   3  
ATOM 4613  C CG   . LEU A 1 82  ? 0.194   -23.925 9.942   1.00 0.00 ? 82  LEU A CG   3  
ATOM 4614  C CD1  . LEU A 1 82  ? -1.267  -24.127 9.573   1.00 0.00 ? 82  LEU A CD1  3  
ATOM 4615  C CD2  . LEU A 1 82  ? 0.337   -23.639 11.430  1.00 0.00 ? 82  LEU A CD2  3  
ATOM 4616  H H    . LEU A 1 82  ? 2.242   -27.161 8.527   1.00 0.00 ? 82  LEU A H    3  
ATOM 4617  H HA   . LEU A 1 82  ? 0.345   -25.245 7.522   1.00 0.00 ? 82  LEU A HA   3  
ATOM 4618  H HB2  . LEU A 1 82  ? 0.501   -26.027 9.907   1.00 0.00 ? 82  LEU A HB2  3  
ATOM 4619  H HB3  . LEU A 1 82  ? 1.979   -25.077 10.045  1.00 0.00 ? 82  LEU A HB3  3  
ATOM 4620  H HG   . LEU A 1 82  ? 0.559   -23.065 9.399   1.00 0.00 ? 82  LEU A HG   3  
ATOM 4621  H HD11 . LEU A 1 82  ? -1.507  -23.525 8.711   1.00 0.00 ? 82  LEU A HD11 3  
ATOM 4622  H HD12 . LEU A 1 82  ? -1.892  -23.832 10.404  1.00 0.00 ? 82  LEU A HD12 3  
ATOM 4623  H HD13 . LEU A 1 82  ? -1.440  -25.169 9.346   1.00 0.00 ? 82  LEU A HD13 3  
ATOM 4624  H HD21 . LEU A 1 82  ? 0.424   -24.571 11.968  1.00 0.00 ? 82  LEU A HD21 3  
ATOM 4625  H HD22 . LEU A 1 82  ? -0.534  -23.102 11.778  1.00 0.00 ? 82  LEU A HD22 3  
ATOM 4626  H HD23 . LEU A 1 82  ? 1.220   -23.041 11.598  1.00 0.00 ? 82  LEU A HD23 3  
ATOM 4627  N N    . TYR A 1 83  ? 1.682   -23.124 7.148   1.00 0.00 ? 83  TYR A N    3  
ATOM 4628  C CA   . TYR A 1 83  ? 2.487   -22.015 6.648   1.00 0.00 ? 83  TYR A CA   3  
ATOM 4629  C C    . TYR A 1 83  ? 1.778   -20.683 6.872   1.00 0.00 ? 83  TYR A C    3  
ATOM 4630  O O    . TYR A 1 83  ? 0.657   -20.477 6.407   1.00 0.00 ? 83  TYR A O    3  
ATOM 4631  C CB   . TYR A 1 83  ? 2.783   -22.204 5.159   1.00 0.00 ? 83  TYR A CB   3  
ATOM 4632  C CG   . TYR A 1 83  ? 3.752   -23.328 4.873   1.00 0.00 ? 83  TYR A CG   3  
ATOM 4633  C CD1  . TYR A 1 83  ? 5.119   -23.159 5.060   1.00 0.00 ? 83  TYR A CD1  3  
ATOM 4634  C CD2  . TYR A 1 83  ? 3.302   -24.561 4.416   1.00 0.00 ? 83  TYR A CD2  3  
ATOM 4635  C CE1  . TYR A 1 83  ? 6.008   -24.184 4.799   1.00 0.00 ? 83  TYR A CE1  3  
ATOM 4636  C CE2  . TYR A 1 83  ? 4.183   -25.591 4.153   1.00 0.00 ? 83  TYR A CE2  3  
ATOM 4637  C CZ   . TYR A 1 83  ? 5.535   -25.398 4.346   1.00 0.00 ? 83  TYR A CZ   3  
ATOM 4638  O OH   . TYR A 1 83  ? 6.417   -26.421 4.085   1.00 0.00 ? 83  TYR A OH   3  
ATOM 4639  H H    . TYR A 1 83  ? 0.707   -23.028 7.183   1.00 0.00 ? 83  TYR A H    3  
ATOM 4640  H HA   . TYR A 1 83  ? 3.419   -22.010 7.193   1.00 0.00 ? 83  TYR A HA   3  
ATOM 4641  H HB2  . TYR A 1 83  ? 1.862   -22.420 4.640   1.00 0.00 ? 83  TYR A HB2  3  
ATOM 4642  H HB3  . TYR A 1 83  ? 3.207   -21.292 4.766   1.00 0.00 ? 83  TYR A HB3  3  
ATOM 4643  H HD1  . TYR A 1 83  ? 5.485   -22.207 5.415   1.00 0.00 ? 83  TYR A HD1  3  
ATOM 4644  H HD2  . TYR A 1 83  ? 2.242   -24.709 4.266   1.00 0.00 ? 83  TYR A HD2  3  
ATOM 4645  H HE1  . TYR A 1 83  ? 7.066   -24.033 4.950   1.00 0.00 ? 83  TYR A HE1  3  
ATOM 4646  H HE2  . TYR A 1 83  ? 3.814   -26.542 3.798   1.00 0.00 ? 83  TYR A HE2  3  
ATOM 4647  H HH   . TYR A 1 83  ? 6.271   -27.136 4.709   1.00 0.00 ? 83  TYR A HH   3  
ATOM 4648  N N    . TYR A 1 84  ? 2.441   -19.781 7.587   1.00 0.00 ? 84  TYR A N    3  
ATOM 4649  C CA   . TYR A 1 84  ? 1.875   -18.468 7.876   1.00 0.00 ? 84  TYR A CA   3  
ATOM 4650  C C    . TYR A 1 84  ? 1.995   -17.546 6.666   1.00 0.00 ? 84  TYR A C    3  
ATOM 4651  O O    . TYR A 1 84  ? 2.865   -17.729 5.815   1.00 0.00 ? 84  TYR A O    3  
ATOM 4652  C CB   . TYR A 1 84  ? 2.578   -17.841 9.081   1.00 0.00 ? 84  TYR A CB   3  
ATOM 4653  C CG   . TYR A 1 84  ? 2.218   -18.491 10.398  1.00 0.00 ? 84  TYR A CG   3  
ATOM 4654  C CD1  . TYR A 1 84  ? 2.629   -19.787 10.690  1.00 0.00 ? 84  TYR A CD1  3  
ATOM 4655  C CD2  . TYR A 1 84  ? 1.468   -17.812 11.349  1.00 0.00 ? 84  TYR A CD2  3  
ATOM 4656  C CE1  . TYR A 1 84  ? 2.302   -20.386 11.891  1.00 0.00 ? 84  TYR A CE1  3  
ATOM 4657  C CE2  . TYR A 1 84  ? 1.138   -18.402 12.554  1.00 0.00 ? 84  TYR A CE2  3  
ATOM 4658  C CZ   . TYR A 1 84  ? 1.557   -19.689 12.820  1.00 0.00 ? 84  TYR A CZ   3  
ATOM 4659  O OH   . TYR A 1 84  ? 1.230   -20.282 14.018  1.00 0.00 ? 84  TYR A OH   3  
ATOM 4660  H H    . TYR A 1 84  ? 3.331   -20.003 7.931   1.00 0.00 ? 84  TYR A H    3  
ATOM 4661  H HA   . TYR A 1 84  ? 0.829   -18.602 8.110   1.00 0.00 ? 84  TYR A HA   3  
ATOM 4662  H HB2  . TYR A 1 84  ? 3.645   -17.925 8.951   1.00 0.00 ? 84  TYR A HB2  3  
ATOM 4663  H HB3  . TYR A 1 84  ? 2.308   -16.796 9.142   1.00 0.00 ? 84  TYR A HB3  3  
ATOM 4664  H HD1  . TYR A 1 84  ? 3.212   -20.329 9.960   1.00 0.00 ? 84  TYR A HD1  3  
ATOM 4665  H HD2  . TYR A 1 84  ? 1.141   -16.804 11.137  1.00 0.00 ? 84  TYR A HD2  3  
ATOM 4666  H HE1  . TYR A 1 84  ? 2.630   -21.393 12.100  1.00 0.00 ? 84  TYR A HE1  3  
ATOM 4667  H HE2  . TYR A 1 84  ? 0.554   -17.858 13.281  1.00 0.00 ? 84  TYR A HE2  3  
ATOM 4668  H HH   . TYR A 1 84  ? 1.970   -20.809 14.327  1.00 0.00 ? 84  TYR A HH   3  
ATOM 4669  N N    . PHE A 1 85  ? 1.114   -16.553 6.599   1.00 0.00 ? 85  PHE A N    3  
ATOM 4670  C CA   . PHE A 1 85  ? 1.119   -15.601 5.494   1.00 0.00 ? 85  PHE A CA   3  
ATOM 4671  C C    . PHE A 1 85  ? 0.653   -14.225 5.960   1.00 0.00 ? 85  PHE A C    3  
ATOM 4672  O O    . PHE A 1 85  ? -0.213  -14.112 6.827   1.00 0.00 ? 85  PHE A O    3  
ATOM 4673  C CB   . PHE A 1 85  ? 0.221   -16.099 4.360   1.00 0.00 ? 85  PHE A CB   3  
ATOM 4674  C CG   . PHE A 1 85  ? 0.443   -17.542 4.009   1.00 0.00 ? 85  PHE A CG   3  
ATOM 4675  C CD1  . PHE A 1 85  ? 1.603   -17.942 3.365   1.00 0.00 ? 85  PHE A CD1  3  
ATOM 4676  C CD2  . PHE A 1 85  ? -0.509  -18.499 4.322   1.00 0.00 ? 85  PHE A CD2  3  
ATOM 4677  C CE1  . PHE A 1 85  ? 1.810   -19.269 3.041   1.00 0.00 ? 85  PHE A CE1  3  
ATOM 4678  C CE2  . PHE A 1 85  ? -0.307  -19.828 4.001   1.00 0.00 ? 85  PHE A CE2  3  
ATOM 4679  C CZ   . PHE A 1 85  ? 0.854   -20.214 3.359   1.00 0.00 ? 85  PHE A CZ   3  
ATOM 4680  H H    . PHE A 1 85  ? 0.444   -16.459 7.308   1.00 0.00 ? 85  PHE A H    3  
ATOM 4681  H HA   . PHE A 1 85  ? 2.132   -15.521 5.131   1.00 0.00 ? 85  PHE A HA   3  
ATOM 4682  H HB2  . PHE A 1 85  ? -0.812  -15.984 4.651   1.00 0.00 ? 85  PHE A HB2  3  
ATOM 4683  H HB3  . PHE A 1 85  ? 0.409   -15.508 3.476   1.00 0.00 ? 85  PHE A HB3  3  
ATOM 4684  H HD1  . PHE A 1 85  ? 2.352   -17.203 3.115   1.00 0.00 ? 85  PHE A HD1  3  
ATOM 4685  H HD2  . PHE A 1 85  ? -1.417  -18.199 4.824   1.00 0.00 ? 85  PHE A HD2  3  
ATOM 4686  H HE1  . PHE A 1 85  ? 2.719   -19.567 2.538   1.00 0.00 ? 85  PHE A HE1  3  
ATOM 4687  H HE2  . PHE A 1 85  ? -1.056  -20.564 4.250   1.00 0.00 ? 85  PHE A HE2  3  
ATOM 4688  H HZ   . PHE A 1 85  ? 1.014   -21.251 3.107   1.00 0.00 ? 85  PHE A HZ   3  
ATOM 4689  N N    . ARG A 1 86  ? 1.235   -13.181 5.378   1.00 0.00 ? 86  ARG A N    3  
ATOM 4690  C CA   . ARG A 1 86  ? 0.882   -11.812 5.735   1.00 0.00 ? 86  ARG A CA   3  
ATOM 4691  C C    . ARG A 1 86  ? 1.001   -10.888 4.527   1.00 0.00 ? 86  ARG A C    3  
ATOM 4692  O O    . ARG A 1 86  ? 2.081   -10.732 3.955   1.00 0.00 ? 86  ARG A O    3  
ATOM 4693  C CB   . ARG A 1 86  ? 1.780   -11.309 6.866   1.00 0.00 ? 86  ARG A CB   3  
ATOM 4694  C CG   . ARG A 1 86  ? 1.306   -11.723 8.250   1.00 0.00 ? 86  ARG A CG   3  
ATOM 4695  C CD   . ARG A 1 86  ? 0.353   -10.697 8.843   1.00 0.00 ? 86  ARG A CD   3  
ATOM 4696  N NE   . ARG A 1 86  ? 1.055   -9.506  9.312   1.00 0.00 ? 86  ARG A NE   3  
ATOM 4697  C CZ   . ARG A 1 86  ? 0.580   -8.695  10.251  1.00 0.00 ? 86  ARG A CZ   3  
ATOM 4698  N NH1  . ARG A 1 86  ? -0.592  -8.947  10.818  1.00 0.00 ? 86  ARG A NH1  3  
ATOM 4699  N NH2  . ARG A 1 86  ? 1.277   -7.630  10.624  1.00 0.00 ? 86  ARG A NH2  3  
ATOM 4700  H H    . ARG A 1 86  ? 1.919   -13.335 4.693   1.00 0.00 ? 86  ARG A H    3  
ATOM 4701  H HA   . ARG A 1 86  ? -0.144  -11.812 6.073   1.00 0.00 ? 86  ARG A HA   3  
ATOM 4702  H HB2  . ARG A 1 86  ? 2.777   -11.699 6.720   1.00 0.00 ? 86  ARG A HB2  3  
ATOM 4703  H HB3  . ARG A 1 86  ? 1.815   -10.231 6.829   1.00 0.00 ? 86  ARG A HB3  3  
ATOM 4704  H HG2  . ARG A 1 86  ? 0.795   -12.672 8.176   1.00 0.00 ? 86  ARG A HG2  3  
ATOM 4705  H HG3  . ARG A 1 86  ? 2.164   -11.823 8.898   1.00 0.00 ? 86  ARG A HG3  3  
ATOM 4706  H HD2  . ARG A 1 86  ? -0.360  -10.409 8.085   1.00 0.00 ? 86  ARG A HD2  3  
ATOM 4707  H HD3  . ARG A 1 86  ? -0.167  -11.148 9.674   1.00 0.00 ? 86  ARG A HD3  3  
ATOM 4708  H HE   . ARG A 1 86  ? 1.922   -9.300  8.906   1.00 0.00 ? 86  ARG A HE   3  
ATOM 4709  H HH11 . ARG A 1 86  ? -1.119  -9.749  10.539  1.00 0.00 ? 86  ARG A HH11 3  
ATOM 4710  H HH12 . ARG A 1 86  ? -0.947  -8.336  11.526  1.00 0.00 ? 86  ARG A HH12 3  
ATOM 4711  H HH21 . ARG A 1 86  ? 2.161   -7.436  10.199  1.00 0.00 ? 86  ARG A HH21 3  
ATOM 4712  H HH22 . ARG A 1 86  ? 0.919   -7.020  11.331  1.00 0.00 ? 86  ARG A HH22 3  
ATOM 4713  N N    . LEU A 1 87  ? -0.114  -10.277 4.143   1.00 0.00 ? 87  LEU A N    3  
ATOM 4714  C CA   . LEU A 1 87  ? -0.136  -9.368  3.002   1.00 0.00 ? 87  LEU A CA   3  
ATOM 4715  C C    . LEU A 1 87  ? -0.092  -7.915  3.463   1.00 0.00 ? 87  LEU A C    3  
ATOM 4716  O O    . LEU A 1 87  ? -0.750  -7.541  4.434   1.00 0.00 ? 87  LEU A O    3  
ATOM 4717  C CB   . LEU A 1 87  ? -1.387  -9.609  2.156   1.00 0.00 ? 87  LEU A CB   3  
ATOM 4718  C CG   . LEU A 1 87  ? -1.266  -9.275  0.669   1.00 0.00 ? 87  LEU A CG   3  
ATOM 4719  C CD1  . LEU A 1 87  ? -0.435  -10.327 -0.049  1.00 0.00 ? 87  LEU A CD1  3  
ATOM 4720  C CD2  . LEU A 1 87  ? -2.645  -9.158  0.035   1.00 0.00 ? 87  LEU A CD2  3  
ATOM 4721  H H    . LEU A 1 87  ? -0.944  -10.441 4.638   1.00 0.00 ? 87  LEU A H    3  
ATOM 4722  H HA   . LEU A 1 87  ? 0.739   -9.569  2.402   1.00 0.00 ? 87  LEU A HA   3  
ATOM 4723  H HB2  . LEU A 1 87  ? -1.647  -10.653 2.240   1.00 0.00 ? 87  LEU A HB2  3  
ATOM 4724  H HB3  . LEU A 1 87  ? -2.185  -9.007  2.568   1.00 0.00 ? 87  LEU A HB3  3  
ATOM 4725  H HG   . LEU A 1 87  ? -0.765  -8.323  0.560   1.00 0.00 ? 87  LEU A HG   3  
ATOM 4726  H HD11 . LEU A 1 87  ? 0.455   -10.536 0.525   1.00 0.00 ? 87  LEU A HD11 3  
ATOM 4727  H HD12 . LEU A 1 87  ? -0.155  -9.960  -1.025  1.00 0.00 ? 87  LEU A HD12 3  
ATOM 4728  H HD13 . LEU A 1 87  ? -1.015  -11.232 -0.158  1.00 0.00 ? 87  LEU A HD13 3  
ATOM 4729  H HD21 . LEU A 1 87  ? -2.539  -8.945  -1.019  1.00 0.00 ? 87  LEU A HD21 3  
ATOM 4730  H HD22 . LEU A 1 87  ? -3.192  -8.357  0.510   1.00 0.00 ? 87  LEU A HD22 3  
ATOM 4731  H HD23 . LEU A 1 87  ? -3.180  -10.087 0.163   1.00 0.00 ? 87  LEU A HD23 3  
ATOM 4732  N N    . ALA A 1 88  ? 0.686   -7.100  2.759   1.00 0.00 ? 88  ALA A N    3  
ATOM 4733  C CA   . ALA A 1 88  ? 0.813   -5.686  3.094   1.00 0.00 ? 88  ALA A CA   3  
ATOM 4734  C C    . ALA A 1 88  ? 1.116   -4.854  1.853   1.00 0.00 ? 88  ALA A C    3  
ATOM 4735  O O    . ALA A 1 88  ? 2.235   -4.871  1.340   1.00 0.00 ? 88  ALA A O    3  
ATOM 4736  C CB   . ALA A 1 88  ? 1.896   -5.487  4.143   1.00 0.00 ? 88  ALA A CB   3  
ATOM 4737  H H    . ALA A 1 88  ? 1.187   -7.457  1.996   1.00 0.00 ? 88  ALA A H    3  
ATOM 4738  H HA   . ALA A 1 88  ? -0.127  -5.358  3.515   1.00 0.00 ? 88  ALA A HA   3  
ATOM 4739  H HB1  . ALA A 1 88  ? 2.735   -6.131  3.921   1.00 0.00 ? 88  ALA A HB1  3  
ATOM 4740  H HB2  . ALA A 1 88  ? 2.220   -4.457  4.135   1.00 0.00 ? 88  ALA A HB2  3  
ATOM 4741  H HB3  . ALA A 1 88  ? 1.502   -5.733  5.118   1.00 0.00 ? 88  ALA A HB3  3  
ATOM 4742  N N    . ALA A 1 89  ? 0.112   -4.125  1.375   1.00 0.00 ? 89  ALA A N    3  
ATOM 4743  C CA   . ALA A 1 89  ? 0.273   -3.285  0.195   1.00 0.00 ? 89  ALA A CA   3  
ATOM 4744  C C    . ALA A 1 89  ? 1.547   -2.451  0.283   1.00 0.00 ? 89  ALA A C    3  
ATOM 4745  O O    . ALA A 1 89  ? 1.892   -1.940  1.349   1.00 0.00 ? 89  ALA A O    3  
ATOM 4746  C CB   . ALA A 1 89  ? -0.940  -2.383  0.020   1.00 0.00 ? 89  ALA A CB   3  
ATOM 4747  H H    . ALA A 1 89  ? -0.756  -4.153  1.827   1.00 0.00 ? 89  ALA A H    3  
ATOM 4748  H HA   . ALA A 1 89  ? 0.337   -3.931  -0.669  1.00 0.00 ? 89  ALA A HA   3  
ATOM 4749  H HB1  . ALA A 1 89  ? -0.890  -1.573  0.734   1.00 0.00 ? 89  ALA A HB1  3  
ATOM 4750  H HB2  . ALA A 1 89  ? -0.947  -1.980  -0.981  1.00 0.00 ? 89  ALA A HB2  3  
ATOM 4751  H HB3  . ALA A 1 89  ? -1.840  -2.955  0.186   1.00 0.00 ? 89  ALA A HB3  3  
ATOM 4752  N N    . ARG A 1 90  ? 2.241   -2.319  -0.842  1.00 0.00 ? 90  ARG A N    3  
ATOM 4753  C CA   . ARG A 1 90  ? 3.478   -1.549  -0.890  1.00 0.00 ? 90  ARG A CA   3  
ATOM 4754  C C    . ARG A 1 90  ? 3.354   -0.380  -1.864  1.00 0.00 ? 90  ARG A C    3  
ATOM 4755  O O    . ARG A 1 90  ? 2.755   -0.510  -2.932  1.00 0.00 ? 90  ARG A O    3  
ATOM 4756  C CB   . ARG A 1 90  ? 4.647   -2.446  -1.301  1.00 0.00 ? 90  ARG A CB   3  
ATOM 4757  C CG   . ARG A 1 90  ? 6.010   -1.811  -1.079  1.00 0.00 ? 90  ARG A CG   3  
ATOM 4758  C CD   . ARG A 1 90  ? 6.443   -0.988  -2.283  1.00 0.00 ? 90  ARG A CD   3  
ATOM 4759  N NE   . ARG A 1 90  ? 7.781   -0.429  -2.110  1.00 0.00 ? 90  ARG A NE   3  
ATOM 4760  C CZ   . ARG A 1 90  ? 8.891   -1.158  -2.134  1.00 0.00 ? 90  ARG A CZ   3  
ATOM 4761  N NH1  . ARG A 1 90  ? 8.823   -2.469  -2.322  1.00 0.00 ? 90  ARG A NH1  3  
ATOM 4762  N NH2  . ARG A 1 90  ? 10.072  -0.577  -1.970  1.00 0.00 ? 90  ARG A NH2  3  
ATOM 4763  H H    . ARG A 1 90  ? 1.915   -2.750  -1.659  1.00 0.00 ? 90  ARG A H    3  
ATOM 4764  H HA   . ARG A 1 90  ? 3.665   -1.159  0.099   1.00 0.00 ? 90  ARG A HA   3  
ATOM 4765  H HB2  . ARG A 1 90  ? 4.603   -3.360  -0.727  1.00 0.00 ? 90  ARG A HB2  3  
ATOM 4766  H HB3  . ARG A 1 90  ? 4.551   -2.684  -2.349  1.00 0.00 ? 90  ARG A HB3  3  
ATOM 4767  H HG2  . ARG A 1 90  ? 5.960   -1.165  -0.215  1.00 0.00 ? 90  ARG A HG2  3  
ATOM 4768  H HG3  . ARG A 1 90  ? 6.736   -2.591  -0.907  1.00 0.00 ? 90  ARG A HG3  3  
ATOM 4769  H HD2  . ARG A 1 90  ? 6.439   -1.623  -3.156  1.00 0.00 ? 90  ARG A HD2  3  
ATOM 4770  H HD3  . ARG A 1 90  ? 5.740   -0.180  -2.421  1.00 0.00 ? 90  ARG A HD3  3  
ATOM 4771  H HE   . ARG A 1 90  ? 7.855   0.538   -1.970  1.00 0.00 ? 90  ARG A HE   3  
ATOM 4772  H HH11 . ARG A 1 90  ? 7.935   -2.910  -2.448  1.00 0.00 ? 90  ARG A HH11 3  
ATOM 4773  H HH12 . ARG A 1 90  ? 9.661   -3.016  -2.341  1.00 0.00 ? 90  ARG A HH12 3  
ATOM 4774  H HH21 . ARG A 1 90  ? 10.128  0.411   -1.827  1.00 0.00 ? 90  ARG A HH21 3  
ATOM 4775  H HH22 . ARG A 1 90  ? 10.907  -1.126  -1.987  1.00 0.00 ? 90  ARG A HH22 3  
ATOM 4776  N N    . SER A 1 91  ? 3.922   0.760   -1.487  1.00 0.00 ? 91  SER A N    3  
ATOM 4777  C CA   . SER A 1 91  ? 3.871   1.953   -2.324  1.00 0.00 ? 91  SER A CA   3  
ATOM 4778  C C    . SER A 1 91  ? 5.253   2.588   -2.450  1.00 0.00 ? 91  SER A C    3  
ATOM 4779  O O    . SER A 1 91  ? 6.113   2.441   -1.582  1.00 0.00 ? 91  SER A O    3  
ATOM 4780  C CB   . SER A 1 91  ? 2.882   2.966   -1.746  1.00 0.00 ? 91  SER A CB   3  
ATOM 4781  O OG   . SER A 1 91  ? 3.517   3.822   -0.811  1.00 0.00 ? 91  SER A OG   3  
ATOM 4782  H H    . SER A 1 91  ? 4.385   0.801   -0.624  1.00 0.00 ? 91  SER A H    3  
ATOM 4783  H HA   . SER A 1 91  ? 3.535   1.655   -3.306  1.00 0.00 ? 91  SER A HA   3  
ATOM 4784  H HB2  . SER A 1 91  ? 2.475   3.566   -2.546  1.00 0.00 ? 91  SER A HB2  3  
ATOM 4785  H HB3  . SER A 1 91  ? 2.081   2.439   -1.247  1.00 0.00 ? 91  SER A HB3  3  
ATOM 4786  H HG   . SER A 1 91  ? 2.924   3.988   -0.075  1.00 0.00 ? 91  SER A HG   3  
ATOM 4787  N N    . PRO A 1 92  ? 5.472   3.313   -3.557  1.00 0.00 ? 92  PRO A N    3  
ATOM 4788  C CA   . PRO A 1 92  ? 6.746   3.986   -3.823  1.00 0.00 ? 92  PRO A CA   3  
ATOM 4789  C C    . PRO A 1 92  ? 6.986   5.165   -2.886  1.00 0.00 ? 92  PRO A C    3  
ATOM 4790  O O    . PRO A 1 92  ? 7.994   5.863   -2.998  1.00 0.00 ? 92  PRO A O    3  
ATOM 4791  C CB   . PRO A 1 92  ? 6.595   4.473   -5.267  1.00 0.00 ? 92  PRO A CB   3  
ATOM 4792  C CG   . PRO A 1 92  ? 5.126   4.609   -5.469  1.00 0.00 ? 92  PRO A CG   3  
ATOM 4793  C CD   . PRO A 1 92  ? 4.491   3.532   -4.634  1.00 0.00 ? 92  PRO A CD   3  
ATOM 4794  H HA   . PRO A 1 92  ? 7.578   3.301   -3.758  1.00 0.00 ? 92  PRO A HA   3  
ATOM 4795  H HB2  . PRO A 1 92  ? 7.101   5.422   -5.384  1.00 0.00 ? 92  PRO A HB2  3  
ATOM 4796  H HB3  . PRO A 1 92  ? 7.021   3.746   -5.942  1.00 0.00 ? 92  PRO A HB3  3  
ATOM 4797  H HG2  . PRO A 1 92  ? 4.798   5.583   -5.137  1.00 0.00 ? 92  PRO A HG2  3  
ATOM 4798  H HG3  . PRO A 1 92  ? 4.884   4.465   -6.512  1.00 0.00 ? 92  PRO A HG3  3  
ATOM 4799  H HD2  . PRO A 1 92  ? 3.548   3.871   -4.233  1.00 0.00 ? 92  PRO A HD2  3  
ATOM 4800  H HD3  . PRO A 1 92  ? 4.354   2.633   -5.218  1.00 0.00 ? 92  PRO A HD3  3  
ATOM 4801  N N    . GLN A 1 93  ? 6.054   5.380   -1.963  1.00 0.00 ? 93  GLN A N    3  
ATOM 4802  C CA   . GLN A 1 93  ? 6.166   6.476   -1.007  1.00 0.00 ? 93  GLN A CA   3  
ATOM 4803  C C    . GLN A 1 93  ? 6.474   5.948   0.391   1.00 0.00 ? 93  GLN A C    3  
ATOM 4804  O O    . GLN A 1 93  ? 7.120   6.623   1.191   1.00 0.00 ? 93  GLN A O    3  
ATOM 4805  C CB   . GLN A 1 93  ? 4.873   7.293   -0.983  1.00 0.00 ? 93  GLN A CB   3  
ATOM 4806  C CG   . GLN A 1 93  ? 4.855   8.432   -1.990  1.00 0.00 ? 93  GLN A CG   3  
ATOM 4807  C CD   . GLN A 1 93  ? 5.660   9.631   -1.530  1.00 0.00 ? 93  GLN A CD   3  
ATOM 4808  O OE1  . GLN A 1 93  ? 5.571   10.047  -0.374  1.00 0.00 ? 93  GLN A OE1  3  
ATOM 4809  N NE2  . GLN A 1 93  ? 6.453   10.195  -2.434  1.00 0.00 ? 93  GLN A NE2  3  
ATOM 4810  H H    . GLN A 1 93  ? 5.274   4.790   -1.925  1.00 0.00 ? 93  GLN A H    3  
ATOM 4811  H HA   . GLN A 1 93  ? 6.978   7.112   -1.325  1.00 0.00 ? 93  GLN A HA   3  
ATOM 4812  H HB2  . GLN A 1 93  ? 4.043   6.638   -1.197  1.00 0.00 ? 93  GLN A HB2  3  
ATOM 4813  H HB3  . GLN A 1 93  ? 4.745   7.713   0.004   1.00 0.00 ? 93  GLN A HB3  3  
ATOM 4814  H HG2  . GLN A 1 93  ? 5.269   8.077   -2.923  1.00 0.00 ? 93  GLN A HG2  3  
ATOM 4815  H HG3  . GLN A 1 93  ? 3.832   8.741   -2.145  1.00 0.00 ? 93  GLN A HG3  3  
ATOM 4816  H HE21 . GLN A 1 93  ? 6.472   9.810   -3.336  1.00 0.00 ? 93  GLN A HE21 3  
ATOM 4817  H HE22 . GLN A 1 93  ? 6.984   10.972  -2.164  1.00 0.00 ? 93  GLN A HE22 3  
ATOM 4818  N N    . GLY A 1 94  ? 6.006   4.737   0.678   1.00 0.00 ? 94  GLY A N    3  
ATOM 4819  C CA   . GLY A 1 94  ? 6.241   4.141   1.980   1.00 0.00 ? 94  GLY A CA   3  
ATOM 4820  C C    . GLY A 1 94  ? 5.368   2.926   2.227   1.00 0.00 ? 94  GLY A C    3  
ATOM 4821  O O    . GLY A 1 94  ? 4.235   2.859   1.749   1.00 0.00 ? 94  GLY A O    3  
ATOM 4822  H H    . GLY A 1 94  ? 5.497   4.245   0.000   1.00 0.00 ? 94  GLY A H    3  
ATOM 4823  H HA2  . GLY A 1 94  ? 7.278   3.846   2.046   1.00 0.00 ? 94  GLY A HA2  3  
ATOM 4824  H HA3  . GLY A 1 94  ? 6.037   4.877   2.743   1.00 0.00 ? 94  GLY A HA3  3  
ATOM 4825  N N    . LEU A 1 95  ? 5.896   1.963   2.974   1.00 0.00 ? 95  LEU A N    3  
ATOM 4826  C CA   . LEU A 1 95  ? 5.158   0.743   3.283   1.00 0.00 ? 95  LEU A CA   3  
ATOM 4827  C C    . LEU A 1 95  ? 3.943   1.047   4.153   1.00 0.00 ? 95  LEU A C    3  
ATOM 4828  O O    . LEU A 1 95  ? 3.982   1.936   5.002   1.00 0.00 ? 95  LEU A O    3  
ATOM 4829  C CB   . LEU A 1 95  ? 6.068   -0.262  3.991   1.00 0.00 ? 95  LEU A CB   3  
ATOM 4830  C CG   . LEU A 1 95  ? 5.510   -1.677  4.151   1.00 0.00 ? 95  LEU A CG   3  
ATOM 4831  C CD1  . LEU A 1 95  ? 5.451   -2.383  2.805   1.00 0.00 ? 95  LEU A CD1  3  
ATOM 4832  C CD2  . LEU A 1 95  ? 6.352   -2.474  5.137   1.00 0.00 ? 95  LEU A CD2  3  
ATOM 4833  H H    . LEU A 1 95  ? 6.803   2.073   3.326   1.00 0.00 ? 95  LEU A H    3  
ATOM 4834  H HA   . LEU A 1 95  ? 4.820   0.315   2.350   1.00 0.00 ? 95  LEU A HA   3  
ATOM 4835  H HB2  . LEU A 1 95  ? 6.986   -0.331  3.428   1.00 0.00 ? 95  LEU A HB2  3  
ATOM 4836  H HB3  . LEU A 1 95  ? 6.281   0.125   4.978   1.00 0.00 ? 95  LEU A HB3  3  
ATOM 4837  H HG   . LEU A 1 95  ? 4.503   -1.618  4.541   1.00 0.00 ? 95  LEU A HG   3  
ATOM 4838  H HD11 . LEU A 1 95  ? 4.866   -1.794  2.115   1.00 0.00 ? 95  LEU A HD11 3  
ATOM 4839  H HD12 . LEU A 1 95  ? 4.994   -3.353  2.928   1.00 0.00 ? 95  LEU A HD12 3  
ATOM 4840  H HD13 . LEU A 1 95  ? 6.452   -2.503  2.418   1.00 0.00 ? 95  LEU A HD13 3  
ATOM 4841  H HD21 . LEU A 1 95  ? 5.781   -2.649  6.037   1.00 0.00 ? 95  LEU A HD21 3  
ATOM 4842  H HD22 . LEU A 1 95  ? 7.245   -1.917  5.380   1.00 0.00 ? 95  LEU A HD22 3  
ATOM 4843  H HD23 . LEU A 1 95  ? 6.626   -3.420  4.694   1.00 0.00 ? 95  LEU A HD23 3  
ATOM 4844  N N    . GLY A 1 96  ? 2.864   0.300   3.936   1.00 0.00 ? 96  GLY A N    3  
ATOM 4845  C CA   . GLY A 1 96  ? 1.653   0.504   4.710   1.00 0.00 ? 96  GLY A CA   3  
ATOM 4846  C C    . GLY A 1 96  ? 1.511   -0.498  5.838   1.00 0.00 ? 96  GLY A C    3  
ATOM 4847  O O    . GLY A 1 96  ? 2.472   -0.778  6.553   1.00 0.00 ? 96  GLY A O    3  
ATOM 4848  H H    . GLY A 1 96  ? 2.891   -0.395  3.245   1.00 0.00 ? 96  GLY A H    3  
ATOM 4849  H HA2  . GLY A 1 96  ? 1.669   1.500   5.126   1.00 0.00 ? 96  GLY A HA2  3  
ATOM 4850  H HA3  . GLY A 1 96  ? 0.801   0.413   4.053   1.00 0.00 ? 96  GLY A HA3  3  
ATOM 4851  N N    . ALA A 1 97  ? 0.307   -1.038  5.999   1.00 0.00 ? 97  ALA A N    3  
ATOM 4852  C CA   . ALA A 1 97  ? 0.042   -2.015  7.048   1.00 0.00 ? 97  ALA A CA   3  
ATOM 4853  C C    . ALA A 1 97  ? -0.266  -3.386  6.456   1.00 0.00 ? 97  ALA A C    3  
ATOM 4854  O O    . ALA A 1 97  ? -0.593  -3.504  5.275   1.00 0.00 ? 97  ALA A O    3  
ATOM 4855  C CB   . ALA A 1 97  ? -1.109  -1.547  7.926   1.00 0.00 ? 97  ALA A CB   3  
ATOM 4856  H H    . ALA A 1 97  ? -0.420  -0.774  5.396   1.00 0.00 ? 97  ALA A H    3  
ATOM 4857  H HA   . ALA A 1 97  ? 0.926   -2.090  7.665   1.00 0.00 ? 97  ALA A HA   3  
ATOM 4858  H HB1  . ALA A 1 97  ? -1.438  -2.363  8.552   1.00 0.00 ? 97  ALA A HB1  3  
ATOM 4859  H HB2  . ALA A 1 97  ? -0.778  -0.727  8.546   1.00 0.00 ? 97  ALA A HB2  3  
ATOM 4860  H HB3  . ALA A 1 97  ? -1.927  -1.219  7.302   1.00 0.00 ? 97  ALA A HB3  3  
ATOM 4861  N N    . SER A 1 98  ? -0.158  -4.420  7.284   1.00 0.00 ? 98  SER A N    3  
ATOM 4862  C CA   . SER A 1 98  ? -0.420  -5.785  6.841   1.00 0.00 ? 98  SER A CA   3  
ATOM 4863  C C    . SER A 1 98  ? -1.706  -6.320  7.463   1.00 0.00 ? 98  SER A C    3  
ATOM 4864  O O    . SER A 1 98  ? -2.055  -5.973  8.592   1.00 0.00 ? 98  SER A O    3  
ATOM 4865  C CB   . SER A 1 98  ? 0.754   -6.696  7.204   1.00 0.00 ? 98  SER A CB   3  
ATOM 4866  O OG   . SER A 1 98  ? 0.771   -7.855  6.389   1.00 0.00 ? 98  SER A OG   3  
ATOM 4867  H H    . SER A 1 98  ? 0.107   -4.262  8.214   1.00 0.00 ? 98  SER A H    3  
ATOM 4868  H HA   . SER A 1 98  ? -0.533  -5.769  5.767   1.00 0.00 ? 98  SER A HA   3  
ATOM 4869  H HB2  . SER A 1 98  ? 1.680   -6.159  7.063   1.00 0.00 ? 98  SER A HB2  3  
ATOM 4870  H HB3  . SER A 1 98  ? 0.666   -6.998  8.238   1.00 0.00 ? 98  SER A HB3  3  
ATOM 4871  H HG   . SER A 1 98  ? 1.392   -7.731  5.668   1.00 0.00 ? 98  SER A HG   3  
ATOM 4872  N N    . THR A 1 99  ? -2.407  -7.170  6.719   1.00 0.00 ? 99  THR A N    3  
ATOM 4873  C CA   . THR A 1 99  ? -3.654  -7.754  7.196   1.00 0.00 ? 99  THR A CA   3  
ATOM 4874  C C    . THR A 1 99  ? -3.411  -8.675  8.386   1.00 0.00 ? 99  THR A C    3  
ATOM 4875  O O    . THR A 1 99  ? -2.275  -8.851  8.824   1.00 0.00 ? 99  THR A O    3  
ATOM 4876  C CB   . THR A 1 99  ? -4.364  -8.548  6.083   1.00 0.00 ? 99  THR A CB   3  
ATOM 4877  O OG1  . THR A 1 99  ? -3.517  -9.603  5.617   1.00 0.00 ? 99  THR A OG1  3  
ATOM 4878  C CG2  . THR A 1 99  ? -4.735  -7.638  4.922   1.00 0.00 ? 99  THR A CG2  3  
ATOM 4879  H H    . THR A 1 99  ? -2.076  -7.408  5.828   1.00 0.00 ? 99  THR A H    3  
ATOM 4880  H HA   . THR A 1 99  ? -4.304  -6.947  7.504   1.00 0.00 ? 99  THR A HA   3  
ATOM 4881  H HB   . THR A 1 99  ? -5.270  -8.976  6.489   1.00 0.00 ? 99  THR A HB   3  
ATOM 4882  H HG1  . THR A 1 99  ? -3.466  -10.292 6.285   1.00 0.00 ? 99  THR A HG1  3  
ATOM 4883  H HG21 . THR A 1 99  ? -4.401  -8.082  3.996   1.00 0.00 ? 99  THR A HG21 3  
ATOM 4884  H HG22 . THR A 1 99  ? -4.261  -6.677  5.052   1.00 0.00 ? 99  THR A HG22 3  
ATOM 4885  H HG23 . THR A 1 99  ? -5.807  -7.510  4.893   1.00 0.00 ? 99  THR A HG23 3  
ATOM 4886  N N    . ALA A 1 100 ? -4.485  -9.261  8.904   1.00 0.00 ? 100 ALA A N    3  
ATOM 4887  C CA   . ALA A 1 100 ? -4.388  -10.167 10.042  1.00 0.00 ? 100 ALA A CA   3  
ATOM 4888  C C    . ALA A 1 100 ? -3.577  -11.409 9.687   1.00 0.00 ? 100 ALA A C    3  
ATOM 4889  O O    . ALA A 1 100 ? -3.709  -11.954 8.592   1.00 0.00 ? 100 ALA A O    3  
ATOM 4890  C CB   . ALA A 1 100 ? -5.776  -10.561 10.523  1.00 0.00 ? 100 ALA A CB   3  
ATOM 4891  H H    . ALA A 1 100 ? -5.365  -9.081  8.511   1.00 0.00 ? 100 ALA A H    3  
ATOM 4892  H HA   . ALA A 1 100 ? -3.890  -9.642  10.845  1.00 0.00 ? 100 ALA A HA   3  
ATOM 4893  H HB1  . ALA A 1 100 ? -5.695  -11.386 11.216  1.00 0.00 ? 100 ALA A HB1  3  
ATOM 4894  H HB2  . ALA A 1 100 ? -6.238  -9.719  11.018  1.00 0.00 ? 100 ALA A HB2  3  
ATOM 4895  H HB3  . ALA A 1 100 ? -6.379  -10.858 9.679   1.00 0.00 ? 100 ALA A HB3  3  
ATOM 4896  N N    . GLU A 1 101 ? -2.737  -11.848 10.619  1.00 0.00 ? 101 GLU A N    3  
ATOM 4897  C CA   . GLU A 1 101 ? -1.904  -13.025 10.402  1.00 0.00 ? 101 GLU A CA   3  
ATOM 4898  C C    . GLU A 1 101 ? -2.763  -14.268 10.186  1.00 0.00 ? 101 GLU A C    3  
ATOM 4899  O O    . GLU A 1 101 ? -3.443  -14.733 11.101  1.00 0.00 ? 101 GLU A O    3  
ATOM 4900  C CB   . GLU A 1 101 ? -0.967  -13.241 11.593  1.00 0.00 ? 101 GLU A CB   3  
ATOM 4901  C CG   . GLU A 1 101 ? 0.234   -14.114 11.272  1.00 0.00 ? 101 GLU A CG   3  
ATOM 4902  C CD   . GLU A 1 101 ? 0.993   -14.541 12.513  1.00 0.00 ? 101 GLU A CD   3  
ATOM 4903  O OE1  . GLU A 1 101 ? 0.357   -15.076 13.444  1.00 0.00 ? 101 GLU A OE1  3  
ATOM 4904  O OE2  . GLU A 1 101 ? 2.225   -14.339 12.552  1.00 0.00 ? 101 GLU A OE2  3  
ATOM 4905  H H    . GLU A 1 101 ? -2.677  -11.370 11.472  1.00 0.00 ? 101 GLU A H    3  
ATOM 4906  H HA   . GLU A 1 101 ? -1.312  -12.853 9.516   1.00 0.00 ? 101 GLU A HA   3  
ATOM 4907  H HB2  . GLU A 1 101 ? -0.608  -12.280 11.931  1.00 0.00 ? 101 GLU A HB2  3  
ATOM 4908  H HB3  . GLU A 1 101 ? -1.523  -13.709 12.392  1.00 0.00 ? 101 GLU A HB3  3  
ATOM 4909  H HG2  . GLU A 1 101 ? -0.108  -14.999 10.756  1.00 0.00 ? 101 GLU A HG2  3  
ATOM 4910  H HG3  . GLU A 1 101 ? 0.904   -13.561 10.630  1.00 0.00 ? 101 GLU A HG3  3  
ATOM 4911  N N    . ILE A 1 102 ? -2.728  -14.800 8.969   1.00 0.00 ? 102 ILE A N    3  
ATOM 4912  C CA   . ILE A 1 102 ? -3.502  -15.988 8.632   1.00 0.00 ? 102 ILE A CA   3  
ATOM 4913  C C    . ILE A 1 102 ? -2.611  -17.075 8.040   1.00 0.00 ? 102 ILE A C    3  
ATOM 4914  O O    . ILE A 1 102 ? -1.565  -16.786 7.459   1.00 0.00 ? 102 ILE A O    3  
ATOM 4915  C CB   . ILE A 1 102 ? -4.628  -15.662 7.633   1.00 0.00 ? 102 ILE A CB   3  
ATOM 4916  C CG1  . ILE A 1 102 ? -4.042  -15.359 6.252   1.00 0.00 ? 102 ILE A CG1  3  
ATOM 4917  C CG2  . ILE A 1 102 ? -5.455  -14.487 8.132   1.00 0.00 ? 102 ILE A CG2  3  
ATOM 4918  C CD1  . ILE A 1 102 ? -5.088  -15.241 5.165   1.00 0.00 ? 102 ILE A CD1  3  
ATOM 4919  H H    . ILE A 1 102 ? -2.167  -14.384 8.281   1.00 0.00 ? 102 ILE A H    3  
ATOM 4920  H HA   . ILE A 1 102 ? -3.951  -16.361 9.541   1.00 0.00 ? 102 ILE A HA   3  
ATOM 4921  H HB   . ILE A 1 102 ? -5.275  -16.522 7.561   1.00 0.00 ? 102 ILE A HB   3  
ATOM 4922  H HG12 . ILE A 1 102 ? -3.501  -14.427 6.294   1.00 0.00 ? 102 ILE A HG12 3  
ATOM 4923  H HG13 . ILE A 1 102 ? -3.363  -16.153 5.976   1.00 0.00 ? 102 ILE A HG13 3  
ATOM 4924  H HG21 . ILE A 1 102 ? -5.680  -13.828 7.306   1.00 0.00 ? 102 ILE A HG21 3  
ATOM 4925  H HG22 . ILE A 1 102 ? -6.376  -14.852 8.561   1.00 0.00 ? 102 ILE A HG22 3  
ATOM 4926  H HG23 . ILE A 1 102 ? -4.897  -13.946 8.882   1.00 0.00 ? 102 ILE A HG23 3  
ATOM 4927  H HD11 . ILE A 1 102 ? -4.604  -15.049 4.219   1.00 0.00 ? 102 ILE A HD11 3  
ATOM 4928  H HD12 . ILE A 1 102 ? -5.649  -16.161 5.103   1.00 0.00 ? 102 ILE A HD12 3  
ATOM 4929  H HD13 . ILE A 1 102 ? -5.757  -14.425 5.397   1.00 0.00 ? 102 ILE A HD13 3  
ATOM 4930  N N    . SER A 1 103 ? -3.034  -18.326 8.190   1.00 0.00 ? 103 SER A N    3  
ATOM 4931  C CA   . SER A 1 103 ? -2.274  -19.457 7.671   1.00 0.00 ? 103 SER A CA   3  
ATOM 4932  C C    . SER A 1 103 ? -3.199  -20.477 7.013   1.00 0.00 ? 103 SER A C    3  
ATOM 4933  O O    . SER A 1 103 ? -4.397  -20.516 7.291   1.00 0.00 ? 103 SER A O    3  
ATOM 4934  C CB   . SER A 1 103 ? -1.481  -20.124 8.797   1.00 0.00 ? 103 SER A CB   3  
ATOM 4935  O OG   . SER A 1 103 ? -0.982  -19.161 9.709   1.00 0.00 ? 103 SER A OG   3  
ATOM 4936  H H    . SER A 1 103 ? -3.877  -18.492 8.663   1.00 0.00 ? 103 SER A H    3  
ATOM 4937  H HA   . SER A 1 103 ? -1.585  -19.082 6.930   1.00 0.00 ? 103 SER A HA   3  
ATOM 4938  H HB2  . SER A 1 103 ? -2.122  -20.809 9.330   1.00 0.00 ? 103 SER A HB2  3  
ATOM 4939  H HB3  . SER A 1 103 ? -0.648  -20.666 8.373   1.00 0.00 ? 103 SER A HB3  3  
ATOM 4940  H HG   . SER A 1 103 ? -0.870  -18.321 9.258   1.00 0.00 ? 103 SER A HG   3  
ATOM 4941  N N    . ALA A 1 104 ? -2.632  -21.301 6.137   1.00 0.00 ? 104 ALA A N    3  
ATOM 4942  C CA   . ALA A 1 104 ? -3.404  -22.322 5.439   1.00 0.00 ? 104 ALA A CA   3  
ATOM 4943  C C    . ALA A 1 104 ? -2.654  -23.649 5.407   1.00 0.00 ? 104 ALA A C    3  
ATOM 4944  O O    . ALA A 1 104 ? -1.426  -23.678 5.329   1.00 0.00 ? 104 ALA A O    3  
ATOM 4945  C CB   . ALA A 1 104 ? -3.729  -21.863 4.026   1.00 0.00 ? 104 ALA A CB   3  
ATOM 4946  H H    . ALA A 1 104 ? -1.673  -21.220 5.957   1.00 0.00 ? 104 ALA A H    3  
ATOM 4947  H HA   . ALA A 1 104 ? -4.335  -22.458 5.971   1.00 0.00 ? 104 ALA A HA   3  
ATOM 4948  H HB1  . ALA A 1 104 ? -2.824  -21.532 3.538   1.00 0.00 ? 104 ALA A HB1  3  
ATOM 4949  H HB2  . ALA A 1 104 ? -4.158  -22.685 3.471   1.00 0.00 ? 104 ALA A HB2  3  
ATOM 4950  H HB3  . ALA A 1 104 ? -4.436  -21.048 4.066   1.00 0.00 ? 104 ALA A HB3  3  
ATOM 4951  N N    . ARG A 1 105 ? -3.401  -24.747 5.469   1.00 0.00 ? 105 ARG A N    3  
ATOM 4952  C CA   . ARG A 1 105 ? -2.807  -26.078 5.450   1.00 0.00 ? 105 ARG A CA   3  
ATOM 4953  C C    . ARG A 1 105 ? -2.870  -26.681 4.049   1.00 0.00 ? 105 ARG A C    3  
ATOM 4954  O O    . ARG A 1 105 ? -3.949  -26.845 3.480   1.00 0.00 ? 105 ARG A O    3  
ATOM 4955  C CB   . ARG A 1 105 ? -3.523  -26.994 6.443   1.00 0.00 ? 105 ARG A CB   3  
ATOM 4956  C CG   . ARG A 1 105 ? -2.937  -28.396 6.511   1.00 0.00 ? 105 ARG A CG   3  
ATOM 4957  C CD   . ARG A 1 105 ? -3.439  -29.151 7.731   1.00 0.00 ? 105 ARG A CD   3  
ATOM 4958  N NE   . ARG A 1 105 ? -3.001  -28.530 8.978   1.00 0.00 ? 105 ARG A NE   3  
ATOM 4959  C CZ   . ARG A 1 105 ? -3.280  -29.019 10.181  1.00 0.00 ? 105 ARG A CZ   3  
ATOM 4960  N NH1  . ARG A 1 105 ? -3.993  -30.131 10.299  1.00 0.00 ? 105 ARG A NH1  3  
ATOM 4961  N NH2  . ARG A 1 105 ? -2.846  -28.397 11.269  1.00 0.00 ? 105 ARG A NH2  3  
ATOM 4962  H H    . ARG A 1 105 ? -4.376  -24.660 5.531   1.00 0.00 ? 105 ARG A H    3  
ATOM 4963  H HA   . ARG A 1 105 ? -1.772  -25.984 5.742   1.00 0.00 ? 105 ARG A HA   3  
ATOM 4964  H HB2  . ARG A 1 105 ? -3.462  -26.555 7.429   1.00 0.00 ? 105 ARG A HB2  3  
ATOM 4965  H HB3  . ARG A 1 105 ? -4.561  -27.075 6.157   1.00 0.00 ? 105 ARG A HB3  3  
ATOM 4966  H HG2  . ARG A 1 105 ? -3.224  -28.938 5.622   1.00 0.00 ? 105 ARG A HG2  3  
ATOM 4967  H HG3  . ARG A 1 105 ? -1.861  -28.324 6.559   1.00 0.00 ? 105 ARG A HG3  3  
ATOM 4968  H HD2  . ARG A 1 105 ? -4.519  -29.168 7.709   1.00 0.00 ? 105 ARG A HD2  3  
ATOM 4969  H HD3  . ARG A 1 105 ? -3.063  -30.162 7.691   1.00 0.00 ? 105 ARG A HD3  3  
ATOM 4970  H HE   . ARG A 1 105 ? -2.473  -27.707 8.914   1.00 0.00 ? 105 ARG A HE   3  
ATOM 4971  H HH11 . ARG A 1 105 ? -4.321  -30.603 9.480   1.00 0.00 ? 105 ARG A HH11 3  
ATOM 4972  H HH12 . ARG A 1 105 ? -4.201  -30.498 11.206  1.00 0.00 ? 105 ARG A HH12 3  
ATOM 4973  H HH21 . ARG A 1 105 ? -2.308  -27.558 11.184  1.00 0.00 ? 105 ARG A HH21 3  
ATOM 4974  H HH22 . ARG A 1 105 ? -3.056  -28.765 12.174  1.00 0.00 ? 105 ARG A HH22 3  
ATOM 4975  N N    . THR A 1 106 ? -1.705  -27.008 3.498   1.00 0.00 ? 106 THR A N    3  
ATOM 4976  C CA   . THR A 1 106 ? -1.627  -27.590 2.164   1.00 0.00 ? 106 THR A CA   3  
ATOM 4977  C C    . THR A 1 106 ? -2.422  -28.888 2.084   1.00 0.00 ? 106 THR A C    3  
ATOM 4978  O O    . THR A 1 106 ? -2.748  -29.491 3.106   1.00 0.00 ? 106 THR A O    3  
ATOM 4979  C CB   . THR A 1 106 ? -0.168  -27.869 1.758   1.00 0.00 ? 106 THR A CB   3  
ATOM 4980  O OG1  . THR A 1 106 ? 0.556   -28.409 2.869   1.00 0.00 ? 106 THR A OG1  3  
ATOM 4981  C CG2  . THR A 1 106 ? 0.512   -26.597 1.273   1.00 0.00 ? 106 THR A CG2  3  
ATOM 4982  H H    . THR A 1 106 ? -0.879  -26.852 4.002   1.00 0.00 ? 106 THR A H    3  
ATOM 4983  H HA   . THR A 1 106 ? -2.044  -26.880 1.465   1.00 0.00 ? 106 THR A HA   3  
ATOM 4984  H HB   . THR A 1 106 ? -0.166  -28.590 0.952   1.00 0.00 ? 106 THR A HB   3  
ATOM 4985  H HG1  . THR A 1 106 ? 1.487   -28.188 2.782   1.00 0.00 ? 106 THR A HG1  3  
ATOM 4986  H HG21 . THR A 1 106 ? 1.565   -26.641 1.505   1.00 0.00 ? 106 THR A HG21 3  
ATOM 4987  H HG22 . THR A 1 106 ? 0.069   -25.743 1.765   1.00 0.00 ? 106 THR A HG22 3  
ATOM 4988  H HG23 . THR A 1 106 ? 0.382   -26.505 0.205   1.00 0.00 ? 106 THR A HG23 3  
ATOM 4989  N N    . MET A 1 107 ? -2.730  -29.313 0.863   1.00 0.00 ? 107 MET A N    3  
ATOM 4990  C CA   . MET A 1 107 ? -3.486  -30.542 0.651   1.00 0.00 ? 107 MET A CA   3  
ATOM 4991  C C    . MET A 1 107 ? -2.627  -31.767 0.950   1.00 0.00 ? 107 MET A C    3  
ATOM 4992  O O    . MET A 1 107 ? -1.602  -31.989 0.306   1.00 0.00 ? 107 MET A O    3  
ATOM 4993  C CB   . MET A 1 107 ? -4.002  -30.606 -0.788  1.00 0.00 ? 107 MET A CB   3  
ATOM 4994  C CG   . MET A 1 107 ? -5.001  -29.511 -1.125  1.00 0.00 ? 107 MET A CG   3  
ATOM 4995  S SD   . MET A 1 107 ? -6.611  -29.780 -0.358  1.00 0.00 ? 107 MET A SD   3  
ATOM 4996  C CE   . MET A 1 107 ? -7.562  -28.451 -1.092  1.00 0.00 ? 107 MET A CE   3  
ATOM 4997  H H    . MET A 1 107 ? -2.442  -28.789 0.087   1.00 0.00 ? 107 MET A H    3  
ATOM 4998  H HA   . MET A 1 107 ? -4.328  -30.534 1.326   1.00 0.00 ? 107 MET A HA   3  
ATOM 4999  H HB2  . MET A 1 107 ? -3.164  -30.519 -1.463  1.00 0.00 ? 107 MET A HB2  3  
ATOM 5000  H HB3  . MET A 1 107 ? -4.482  -31.561 -0.944  1.00 0.00 ? 107 MET A HB3  3  
ATOM 5001  H HG2  . MET A 1 107 ? -4.609  -28.566 -0.781  1.00 0.00 ? 107 MET A HG2  3  
ATOM 5002  H HG3  . MET A 1 107 ? -5.129  -29.477 -2.196  1.00 0.00 ? 107 MET A HG3  3  
ATOM 5003  H HE1  . MET A 1 107 ? -7.855  -27.751 -0.324  1.00 0.00 ? 107 MET A HE1  3  
ATOM 5004  H HE2  . MET A 1 107 ? -6.959  -27.944 -1.831  1.00 0.00 ? 107 MET A HE2  3  
ATOM 5005  H HE3  . MET A 1 107 ? -8.444  -28.859 -1.564  1.00 0.00 ? 107 MET A HE3  3  
ATOM 5006  N N    . GLN A 1 108 ? -3.053  -32.557 1.930   1.00 0.00 ? 108 GLN A N    3  
ATOM 5007  C CA   . GLN A 1 108 ? -2.322  -33.759 2.314   1.00 0.00 ? 108 GLN A CA   3  
ATOM 5008  C C    . GLN A 1 108 ? -2.088  -34.663 1.109   1.00 0.00 ? 108 GLN A C    3  
ATOM 5009  O O    . GLN A 1 108 ? -3.034  -35.184 0.518   1.00 0.00 ? 108 GLN A O    3  
ATOM 5010  C CB   . GLN A 1 108 ? -3.085  -34.522 3.398   1.00 0.00 ? 108 GLN A CB   3  
ATOM 5011  C CG   . GLN A 1 108 ? -4.445  -35.027 2.943   1.00 0.00 ? 108 GLN A CG   3  
ATOM 5012  C CD   . GLN A 1 108 ? -5.303  -35.511 4.095   1.00 0.00 ? 108 GLN A CD   3  
ATOM 5013  O OE1  . GLN A 1 108 ? -4.809  -36.138 5.032   1.00 0.00 ? 108 GLN A OE1  3  
ATOM 5014  N NE2  . GLN A 1 108 ? -6.598  -35.221 4.032   1.00 0.00 ? 108 GLN A NE2  3  
ATOM 5015  H H    . GLN A 1 108 ? -3.878  -32.327 2.406   1.00 0.00 ? 108 GLN A H    3  
ATOM 5016  H HA   . GLN A 1 108 ? -1.365  -33.452 2.709   1.00 0.00 ? 108 GLN A HA   3  
ATOM 5017  H HB2  . GLN A 1 108 ? -2.495  -35.371 3.708   1.00 0.00 ? 108 GLN A HB2  3  
ATOM 5018  H HB3  . GLN A 1 108 ? -3.234  -33.868 4.245   1.00 0.00 ? 108 GLN A HB3  3  
ATOM 5019  H HG2  . GLN A 1 108 ? -4.964  -34.224 2.441   1.00 0.00 ? 108 GLN A HG2  3  
ATOM 5020  H HG3  . GLN A 1 108 ? -4.298  -35.845 2.254   1.00 0.00 ? 108 GLN A HG3  3  
ATOM 5021  H HE21 . GLN A 1 108 ? -6.922  -34.719 3.255   1.00 0.00 ? 108 GLN A HE21 3  
ATOM 5022  H HE22 . GLN A 1 108 ? -7.176  -35.522 4.763   1.00 0.00 ? 108 GLN A HE22 3  
ATOM 5023  N N    . SER A 1 109 ? -0.822  -34.844 0.748   1.00 0.00 ? 109 SER A N    3  
ATOM 5024  C CA   . SER A 1 109 ? -0.464  -35.682 -0.391  1.00 0.00 ? 109 SER A CA   3  
ATOM 5025  C C    . SER A 1 109 ? -0.340  -37.144 0.028   1.00 0.00 ? 109 SER A C    3  
ATOM 5026  O O    . SER A 1 109 ? 0.649   -37.543 0.643   1.00 0.00 ? 109 SER A O    3  
ATOM 5027  C CB   . SER A 1 109 ? 0.851   -35.204 -1.009  1.00 0.00 ? 109 SER A CB   3  
ATOM 5028  O OG   . SER A 1 109 ? 0.620   -34.213 -1.995  1.00 0.00 ? 109 SER A OG   3  
ATOM 5029  H H    . SER A 1 109 ? -0.111  -34.401 1.258   1.00 0.00 ? 109 SER A H    3  
ATOM 5030  H HA   . SER A 1 109 ? -1.250  -35.596 -1.126  1.00 0.00 ? 109 SER A HA   3  
ATOM 5031  H HB2  . SER A 1 109 ? 1.479   -34.786 -0.237  1.00 0.00 ? 109 SER A HB2  3  
ATOM 5032  H HB3  . SER A 1 109 ? 1.355   -36.042 -1.469  1.00 0.00 ? 109 SER A HB3  3  
ATOM 5033  H HG   . SER A 1 109 ? 1.414   -34.095 -2.523  1.00 0.00 ? 109 SER A HG   3  
ATOM 5034  N N    . SER A 1 110 ? -1.351  -37.937 -0.310  1.00 0.00 ? 110 SER A N    3  
ATOM 5035  C CA   . SER A 1 110 ? -1.359  -39.354 0.034   1.00 0.00 ? 110 SER A CA   3  
ATOM 5036  C C    . SER A 1 110 ? -1.342  -40.219 -1.223  1.00 0.00 ? 110 SER A C    3  
ATOM 5037  O O    . SER A 1 110 ? -2.388  -40.522 -1.796  1.00 0.00 ? 110 SER A O    3  
ATOM 5038  C CB   . SER A 1 110 ? -2.589  -39.689 0.880   1.00 0.00 ? 110 SER A CB   3  
ATOM 5039  O OG   . SER A 1 110 ? -2.381  -39.346 2.240   1.00 0.00 ? 110 SER A OG   3  
ATOM 5040  H H    . SER A 1 110 ? -2.112  -37.560 -0.800  1.00 0.00 ? 110 SER A H    3  
ATOM 5041  H HA   . SER A 1 110 ? -0.469  -39.560 0.610   1.00 0.00 ? 110 SER A HA   3  
ATOM 5042  H HB2  . SER A 1 110 ? -3.439  -39.138 0.509   1.00 0.00 ? 110 SER A HB2  3  
ATOM 5043  H HB3  . SER A 1 110 ? -2.790  -40.749 0.815   1.00 0.00 ? 110 SER A HB3  3  
ATOM 5044  H HG   . SER A 1 110 ? -1.446  -39.415 2.448   1.00 0.00 ? 110 SER A HG   3  
ATOM 5045  N N    . GLY A 1 111 ? -0.145  -40.612 -1.647  1.00 0.00 ? 111 GLY A N    3  
ATOM 5046  C CA   . GLY A 1 111 ? -0.013  -41.438 -2.834  1.00 0.00 ? 111 GLY A CA   3  
ATOM 5047  C C    . GLY A 1 111 ? 1.255   -42.268 -2.824  1.00 0.00 ? 111 GLY A C    3  
ATOM 5048  O O    . GLY A 1 111 ? 2.198   -42.009 -3.571  1.00 0.00 ? 111 GLY A O    3  
ATOM 5049  H H    . GLY A 1 111 ? 0.655   -40.340 -1.151  1.00 0.00 ? 111 GLY A H    3  
ATOM 5050  H HA2  . GLY A 1 111 ? -0.864  -42.099 -2.896  1.00 0.00 ? 111 GLY A HA2  3  
ATOM 5051  H HA3  . GLY A 1 111 ? -0.003  -40.798 -3.704  1.00 0.00 ? 111 GLY A HA3  3  
ATOM 5052  N N    . PRO A 1 112 ? 1.289   -43.293 -1.959  1.00 0.00 ? 112 PRO A N    3  
ATOM 5053  C CA   . PRO A 1 112 ? 2.446   -44.184 -1.833  1.00 0.00 ? 112 PRO A CA   3  
ATOM 5054  C C    . PRO A 1 112 ? 2.622   -45.081 -3.054  1.00 0.00 ? 112 PRO A C    3  
ATOM 5055  O O    . PRO A 1 112 ? 3.588   -45.839 -3.145  1.00 0.00 ? 112 PRO A O    3  
ATOM 5056  C CB   . PRO A 1 112 ? 2.114   -45.024 -0.597  1.00 0.00 ? 112 PRO A CB   3  
ATOM 5057  C CG   . PRO A 1 112 ? 0.627   -45.004 -0.513  1.00 0.00 ? 112 PRO A CG   3  
ATOM 5058  C CD   . PRO A 1 112 ? 0.201   -43.660 -1.038  1.00 0.00 ? 112 PRO A CD   3  
ATOM 5059  H HA   . PRO A 1 112 ? 3.357   -43.630 -1.660  1.00 0.00 ? 112 PRO A HA   3  
ATOM 5060  H HB2  . PRO A 1 112 ? 2.490   -46.029 -0.729  1.00 0.00 ? 112 PRO A HB2  3  
ATOM 5061  H HB3  . PRO A 1 112 ? 2.564   -44.577 0.277   1.00 0.00 ? 112 PRO A HB3  3  
ATOM 5062  H HG2  . PRO A 1 112 ? 0.214   -45.793 -1.123  1.00 0.00 ? 112 PRO A HG2  3  
ATOM 5063  H HG3  . PRO A 1 112 ? 0.315   -45.120 0.514   1.00 0.00 ? 112 PRO A HG3  3  
ATOM 5064  H HD2  . PRO A 1 112 ? -0.739  -43.741 -1.564  1.00 0.00 ? 112 PRO A HD2  3  
ATOM 5065  H HD3  . PRO A 1 112 ? 0.123   -42.947 -0.230  1.00 0.00 ? 112 PRO A HD3  3  
ATOM 5066  N N    . SER A 1 113 ? 1.684   -44.989 -3.991  1.00 0.00 ? 113 SER A N    3  
ATOM 5067  C CA   . SER A 1 113 ? 1.734   -45.795 -5.205  1.00 0.00 ? 113 SER A CA   3  
ATOM 5068  C C    . SER A 1 113 ? 3.053   -45.585 -5.942  1.00 0.00 ? 113 SER A C    3  
ATOM 5069  O O    . SER A 1 113 ? 3.631   -44.498 -5.905  1.00 0.00 ? 113 SER A O    3  
ATOM 5070  C CB   . SER A 1 113 ? 0.562   -45.445 -6.124  1.00 0.00 ? 113 SER A CB   3  
ATOM 5071  O OG   . SER A 1 113 ? 0.189   -46.556 -6.920  1.00 0.00 ? 113 SER A OG   3  
ATOM 5072  H H    . SER A 1 113 ? 0.938   -44.366 -3.860  1.00 0.00 ? 113 SER A H    3  
ATOM 5073  H HA   . SER A 1 113 ? 1.658   -46.833 -4.917  1.00 0.00 ? 113 SER A HA   3  
ATOM 5074  H HB2  . SER A 1 113 ? -0.285  -45.147 -5.524  1.00 0.00 ? 113 SER A HB2  3  
ATOM 5075  H HB3  . SER A 1 113 ? 0.848   -44.631 -6.773  1.00 0.00 ? 113 SER A HB3  3  
ATOM 5076  H HG   . SER A 1 113 ? 0.598   -46.482 -7.785  1.00 0.00 ? 113 SER A HG   3  
ATOM 5077  N N    . SER A 1 114 ? 3.523   -46.632 -6.612  1.00 0.00 ? 114 SER A N    3  
ATOM 5078  C CA   . SER A 1 114 ? 4.776   -46.565 -7.355  1.00 0.00 ? 114 SER A CA   3  
ATOM 5079  C C    . SER A 1 114 ? 4.808   -45.333 -8.255  1.00 0.00 ? 114 SER A C    3  
ATOM 5080  O O    . SER A 1 114 ? 3.915   -45.126 -9.076  1.00 0.00 ? 114 SER A O    3  
ATOM 5081  C CB   . SER A 1 114 ? 4.963   -47.829 -8.196  1.00 0.00 ? 114 SER A CB   3  
ATOM 5082  O OG   . SER A 1 114 ? 4.950   -48.989 -7.382  1.00 0.00 ? 114 SER A OG   3  
ATOM 5083  H H    . SER A 1 114 ? 3.016   -47.471 -6.603  1.00 0.00 ? 114 SER A H    3  
ATOM 5084  H HA   . SER A 1 114 ? 5.582   -46.495 -6.641  1.00 0.00 ? 114 SER A HA   3  
ATOM 5085  H HB2  . SER A 1 114 ? 4.163   -47.901 -8.917  1.00 0.00 ? 114 SER A HB2  3  
ATOM 5086  H HB3  . SER A 1 114 ? 5.911   -47.777 -8.713  1.00 0.00 ? 114 SER A HB3  3  
ATOM 5087  H HG   . SER A 1 114 ? 5.319   -48.780 -6.521  1.00 0.00 ? 114 SER A HG   3  
ATOM 5088  N N    . GLY A 1 115 ? 5.845   -44.516 -8.094  1.00 0.00 ? 115 GLY A N    3  
ATOM 5089  C CA   . GLY A 1 115 ? 5.975   -43.315 -8.897  1.00 0.00 ? 115 GLY A CA   3  
ATOM 5090  C C    . GLY A 1 115 ? 7.364   -43.157 -9.483  1.00 0.00 ? 115 GLY A C    3  
ATOM 5091  O O    . GLY A 1 115 ? 8.173   -42.377 -8.979  1.00 0.00 ? 115 GLY A O    3  
ATOM 5092  H H    . GLY A 1 115 ? 6.527   -44.732 -7.423  1.00 0.00 ? 115 GLY A H    3  
ATOM 5093  H HA2  . GLY A 1 115 ? 5.258   -43.355 -9.703  1.00 0.00 ? 115 GLY A HA2  3  
ATOM 5094  H HA3  . GLY A 1 115 ? 5.759   -42.457 -8.278  1.00 0.00 ? 115 GLY A HA3  3  
ATOM 5095  N N    . GLY A 1 1   ? -15.517 23.629  20.324  1.00 0.00 ? 1   GLY A N    4  
ATOM 5096  C CA   . GLY A 1 1   ? -14.298 22.858  20.159  1.00 0.00 ? 1   GLY A CA   4  
ATOM 5097  C C    . GLY A 1 1   ? -13.140 23.703  19.666  1.00 0.00 ? 1   GLY A C    4  
ATOM 5098  O O    . GLY A 1 1   ? -13.264 24.418  18.671  1.00 0.00 ? 1   GLY A O    4  
ATOM 5099  H H1   . GLY A 1 1   ? -15.612 24.495  19.875  1.00 0.00 ? 1   GLY A H1   4  
ATOM 5100  H HA2  . GLY A 1 1   ? -14.031 22.418  21.108  1.00 0.00 ? 1   GLY A HA2  4  
ATOM 5101  H HA3  . GLY A 1 1   ? -14.480 22.067  19.446  1.00 0.00 ? 1   GLY A HA3  4  
ATOM 5102  N N    . SER A 1 2   ? -12.012 23.623  20.363  1.00 0.00 ? 2   SER A N    4  
ATOM 5103  C CA   . SER A 1 2   ? -10.829 24.391  19.994  1.00 0.00 ? 2   SER A CA   4  
ATOM 5104  C C    . SER A 1 2   ? -9.714  23.470  19.505  1.00 0.00 ? 2   SER A C    4  
ATOM 5105  O O    . SER A 1 2   ? -9.192  23.641  18.404  1.00 0.00 ? 2   SER A O    4  
ATOM 5106  C CB   . SER A 1 2   ? -10.338 25.216  21.185  1.00 0.00 ? 2   SER A CB   4  
ATOM 5107  O OG   . SER A 1 2   ? -9.304  26.104  20.799  1.00 0.00 ? 2   SER A OG   4  
ATOM 5108  H H    . SER A 1 2   ? -11.976 23.035  21.147  1.00 0.00 ? 2   SER A H    4  
ATOM 5109  H HA   . SER A 1 2   ? -11.104 25.060  19.193  1.00 0.00 ? 2   SER A HA   4  
ATOM 5110  H HB2  . SER A 1 2   ? -11.160 25.791  21.584  1.00 0.00 ? 2   SER A HB2  4  
ATOM 5111  H HB3  . SER A 1 2   ? -9.960  24.551  21.949  1.00 0.00 ? 2   SER A HB3  4  
ATOM 5112  H HG   . SER A 1 2   ? -9.633  27.006  20.815  1.00 0.00 ? 2   SER A HG   4  
ATOM 5113  N N    . SER A 1 3   ? -9.356  22.494  20.333  1.00 0.00 ? 3   SER A N    4  
ATOM 5114  C CA   . SER A 1 3   ? -8.301  21.548  19.988  1.00 0.00 ? 3   SER A CA   4  
ATOM 5115  C C    . SER A 1 3   ? -8.889  20.275  19.386  1.00 0.00 ? 3   SER A C    4  
ATOM 5116  O O    . SER A 1 3   ? -10.014 19.888  19.699  1.00 0.00 ? 3   SER A O    4  
ATOM 5117  C CB   . SER A 1 3   ? -7.471  21.203  21.226  1.00 0.00 ? 3   SER A CB   4  
ATOM 5118  O OG   . SER A 1 3   ? -6.614  22.275  21.580  1.00 0.00 ? 3   SER A OG   4  
ATOM 5119  H H    . SER A 1 3   ? -9.811  22.410  21.198  1.00 0.00 ? 3   SER A H    4  
ATOM 5120  H HA   . SER A 1 3   ? -7.662  22.017  19.255  1.00 0.00 ? 3   SER A HA   4  
ATOM 5121  H HB2  . SER A 1 3   ? -8.132  20.999  22.054  1.00 0.00 ? 3   SER A HB2  4  
ATOM 5122  H HB3  . SER A 1 3   ? -6.870  20.330  21.021  1.00 0.00 ? 3   SER A HB3  4  
ATOM 5123  H HG   . SER A 1 3   ? -7.141  23.032  21.847  1.00 0.00 ? 3   SER A HG   4  
ATOM 5124  N N    . GLY A 1 4   ? -8.117  19.628  18.518  1.00 0.00 ? 4   GLY A N    4  
ATOM 5125  C CA   . GLY A 1 4   ? -8.577  18.406  17.884  1.00 0.00 ? 4   GLY A CA   4  
ATOM 5126  C C    . GLY A 1 4   ? -7.667  17.227  18.168  1.00 0.00 ? 4   GLY A C    4  
ATOM 5127  O O    . GLY A 1 4   ? -6.626  17.378  18.808  1.00 0.00 ? 4   GLY A O    4  
ATOM 5128  H H    . GLY A 1 4   ? -7.229  19.983  18.306  1.00 0.00 ? 4   GLY A H    4  
ATOM 5129  H HA2  . GLY A 1 4   ? -9.569  18.177  18.245  1.00 0.00 ? 4   GLY A HA2  4  
ATOM 5130  H HA3  . GLY A 1 4   ? -8.621  18.562  16.816  1.00 0.00 ? 4   GLY A HA3  4  
ATOM 5131  N N    . SER A 1 5   ? -8.061  16.050  17.694  1.00 0.00 ? 5   SER A N    4  
ATOM 5132  C CA   . SER A 1 5   ? -7.276  14.839  17.906  1.00 0.00 ? 5   SER A CA   4  
ATOM 5133  C C    . SER A 1 5   ? -7.103  14.069  16.601  1.00 0.00 ? 5   SER A C    4  
ATOM 5134  O O    . SER A 1 5   ? -8.032  13.966  15.800  1.00 0.00 ? 5   SER A O    4  
ATOM 5135  C CB   . SER A 1 5   ? -7.946  13.947  18.953  1.00 0.00 ? 5   SER A CB   4  
ATOM 5136  O OG   . SER A 1 5   ? -7.072  12.918  19.381  1.00 0.00 ? 5   SER A OG   4  
ATOM 5137  H H    . SER A 1 5   ? -8.901  15.993  17.192  1.00 0.00 ? 5   SER A H    4  
ATOM 5138  H HA   . SER A 1 5   ? -6.302  15.135  18.268  1.00 0.00 ? 5   SER A HA   4  
ATOM 5139  H HB2  . SER A 1 5   ? -8.224  14.546  19.807  1.00 0.00 ? 5   SER A HB2  4  
ATOM 5140  H HB3  . SER A 1 5   ? -8.831  13.498  18.525  1.00 0.00 ? 5   SER A HB3  4  
ATOM 5141  H HG   . SER A 1 5   ? -6.379  13.293  19.930  1.00 0.00 ? 5   SER A HG   4  
ATOM 5142  N N    . SER A 1 6   ? -5.906  13.529  16.394  1.00 0.00 ? 6   SER A N    4  
ATOM 5143  C CA   . SER A 1 6   ? -5.608  12.770  15.184  1.00 0.00 ? 6   SER A CA   4  
ATOM 5144  C C    . SER A 1 6   ? -5.505  11.279  15.490  1.00 0.00 ? 6   SER A C    4  
ATOM 5145  O O    . SER A 1 6   ? -6.147  10.455  14.839  1.00 0.00 ? 6   SER A O    4  
ATOM 5146  C CB   . SER A 1 6   ? -4.304  13.265  14.555  1.00 0.00 ? 6   SER A CB   4  
ATOM 5147  O OG   . SER A 1 6   ? -4.447  14.582  14.053  1.00 0.00 ? 6   SER A OG   4  
ATOM 5148  H H    . SER A 1 6   ? -5.206  13.645  17.070  1.00 0.00 ? 6   SER A H    4  
ATOM 5149  H HA   . SER A 1 6   ? -6.417  12.928  14.487  1.00 0.00 ? 6   SER A HA   4  
ATOM 5150  H HB2  . SER A 1 6   ? -3.523  13.260  15.300  1.00 0.00 ? 6   SER A HB2  4  
ATOM 5151  H HB3  . SER A 1 6   ? -4.029  12.609  13.741  1.00 0.00 ? 6   SER A HB3  4  
ATOM 5152  H HG   . SER A 1 6   ? -3.697  15.113  14.328  1.00 0.00 ? 6   SER A HG   4  
ATOM 5153  N N    . GLY A 1 7   ? -4.692  10.940  16.486  1.00 0.00 ? 7   GLY A N    4  
ATOM 5154  C CA   . GLY A 1 7   ? -4.519  9.549   16.861  1.00 0.00 ? 7   GLY A CA   4  
ATOM 5155  C C    . GLY A 1 7   ? -3.244  9.314   17.645  1.00 0.00 ? 7   GLY A C    4  
ATOM 5156  O O    . GLY A 1 7   ? -2.303  10.104  17.565  1.00 0.00 ? 7   GLY A O    4  
ATOM 5157  H H    . GLY A 1 7   ? -4.206  11.640  16.970  1.00 0.00 ? 7   GLY A H    4  
ATOM 5158  H HA2  . GLY A 1 7   ? -5.361  9.242   17.463  1.00 0.00 ? 7   GLY A HA2  4  
ATOM 5159  H HA3  . GLY A 1 7   ? -4.493  8.947   15.964  1.00 0.00 ? 7   GLY A HA3  4  
ATOM 5160  N N    . ASP A 1 8   ? -3.211  8.226   18.406  1.00 0.00 ? 8   ASP A N    4  
ATOM 5161  C CA   . ASP A 1 8   ? -2.041  7.889   19.209  1.00 0.00 ? 8   ASP A CA   4  
ATOM 5162  C C    . ASP A 1 8   ? -0.876  7.463   18.320  1.00 0.00 ? 8   ASP A C    4  
ATOM 5163  O O    . ASP A 1 8   ? -0.604  6.272   18.166  1.00 0.00 ? 8   ASP A O    4  
ATOM 5164  C CB   . ASP A 1 8   ? -2.379  6.773   20.198  1.00 0.00 ? 8   ASP A CB   4  
ATOM 5165  C CG   . ASP A 1 8   ? -1.329  6.623   21.282  1.00 0.00 ? 8   ASP A CG   4  
ATOM 5166  O OD1  . ASP A 1 8   ? -1.115  7.592   22.039  1.00 0.00 ? 8   ASP A OD1  4  
ATOM 5167  O OD2  . ASP A 1 8   ? -0.723  5.535   21.373  1.00 0.00 ? 8   ASP A OD2  4  
ATOM 5168  H H    . ASP A 1 8   ? -3.992  7.634   18.428  1.00 0.00 ? 8   ASP A H    4  
ATOM 5169  H HA   . ASP A 1 8   ? -1.752  8.771   19.760  1.00 0.00 ? 8   ASP A HA   4  
ATOM 5170  H HB2  . ASP A 1 8   ? -3.326  6.992   20.669  1.00 0.00 ? 8   ASP A HB2  4  
ATOM 5171  H HB3  . ASP A 1 8   ? -2.455  5.838   19.664  1.00 0.00 ? 8   ASP A HB3  4  
ATOM 5172  N N    . ILE A 1 9   ? -0.193  8.443   17.738  1.00 0.00 ? 9   ILE A N    4  
ATOM 5173  C CA   . ILE A 1 9   ? 0.941   8.169   16.866  1.00 0.00 ? 9   ILE A CA   4  
ATOM 5174  C C    . ILE A 1 9   ? 2.108   9.102   17.171  1.00 0.00 ? 9   ILE A C    4  
ATOM 5175  O O    . ILE A 1 9   ? 1.997   10.319  17.021  1.00 0.00 ? 9   ILE A O    4  
ATOM 5176  C CB   . ILE A 1 9   ? 0.558   8.313   15.381  1.00 0.00 ? 9   ILE A CB   4  
ATOM 5177  C CG1  . ILE A 1 9   ? -0.648  7.429   15.055  1.00 0.00 ? 9   ILE A CG1  4  
ATOM 5178  C CG2  . ILE A 1 9   ? 1.739   7.957   14.491  1.00 0.00 ? 9   ILE A CG2  4  
ATOM 5179  C CD1  . ILE A 1 9   ? -0.341  5.949   15.100  1.00 0.00 ? 9   ILE A CD1  4  
ATOM 5180  H H    . ILE A 1 9   ? -0.458  9.372   17.900  1.00 0.00 ? 9   ILE A H    4  
ATOM 5181  H HA   . ILE A 1 9   ? 1.255   7.149   17.038  1.00 0.00 ? 9   ILE A HA   4  
ATOM 5182  H HB   . ILE A 1 9   ? 0.299   9.345   15.198  1.00 0.00 ? 9   ILE A HB   4  
ATOM 5183  H HG12 . ILE A 1 9   ? -1.434  7.627   15.766  1.00 0.00 ? 9   ILE A HG12 4  
ATOM 5184  H HG13 . ILE A 1 9   ? -1.000  7.666   14.061  1.00 0.00 ? 9   ILE A HG13 4  
ATOM 5185  H HG21 . ILE A 1 9   ? 2.204   8.862   14.131  1.00 0.00 ? 9   ILE A HG21 4  
ATOM 5186  H HG22 . ILE A 1 9   ? 2.458   7.386   15.060  1.00 0.00 ? 9   ILE A HG22 4  
ATOM 5187  H HG23 . ILE A 1 9   ? 1.395   7.370   13.653  1.00 0.00 ? 9   ILE A HG23 4  
ATOM 5188  H HD11 . ILE A 1 9   ? 0.246   5.676   14.236  1.00 0.00 ? 9   ILE A HD11 4  
ATOM 5189  H HD12 . ILE A 1 9   ? 0.212   5.723   15.999  1.00 0.00 ? 9   ILE A HD12 4  
ATOM 5190  H HD13 . ILE A 1 9   ? -1.266  5.390   15.097  1.00 0.00 ? 9   ILE A HD13 4  
ATOM 5191  N N    . GLN A 1 10  ? 3.226   8.524   17.597  1.00 0.00 ? 10  GLN A N    4  
ATOM 5192  C CA   . GLN A 1 10  ? 4.414   9.305   17.922  1.00 0.00 ? 10  GLN A CA   4  
ATOM 5193  C C    . GLN A 1 10  ? 5.461   9.186   16.821  1.00 0.00 ? 10  GLN A C    4  
ATOM 5194  O O    . GLN A 1 10  ? 6.655   9.066   17.095  1.00 0.00 ? 10  GLN A O    4  
ATOM 5195  C CB   . GLN A 1 10  ? 5.004   8.843   19.256  1.00 0.00 ? 10  GLN A CB   4  
ATOM 5196  C CG   . GLN A 1 10  ? 4.189   9.275   20.464  1.00 0.00 ? 10  GLN A CG   4  
ATOM 5197  C CD   . GLN A 1 10  ? 3.760   10.728  20.390  1.00 0.00 ? 10  GLN A CD   4  
ATOM 5198  O OE1  . GLN A 1 10  ? 2.594   11.031  20.138  1.00 0.00 ? 10  GLN A OE1  4  
ATOM 5199  N NE2  . GLN A 1 10  ? 4.704   11.635  20.610  1.00 0.00 ? 10  GLN A NE2  4  
ATOM 5200  H H    . GLN A 1 10  ? 3.252   7.550   17.696  1.00 0.00 ? 10  GLN A H    4  
ATOM 5201  H HA   . GLN A 1 10  ? 4.117   10.339  18.009  1.00 0.00 ? 10  GLN A HA   4  
ATOM 5202  H HB2  . GLN A 1 10  ? 5.064   7.765   19.256  1.00 0.00 ? 10  GLN A HB2  4  
ATOM 5203  H HB3  . GLN A 1 10  ? 5.999   9.251   19.356  1.00 0.00 ? 10  GLN A HB3  4  
ATOM 5204  H HG2  . GLN A 1 10  ? 3.305   8.658   20.525  1.00 0.00 ? 10  GLN A HG2  4  
ATOM 5205  H HG3  . GLN A 1 10  ? 4.786   9.136   21.353  1.00 0.00 ? 10  GLN A HG3  4  
ATOM 5206  H HE21 . GLN A 1 10  ? 5.612   11.321  20.804  1.00 0.00 ? 10  GLN A HE21 4  
ATOM 5207  H HE22 . GLN A 1 10  ? 4.455   12.581  20.567  1.00 0.00 ? 10  GLN A HE22 4  
ATOM 5208  N N    . VAL A 1 11  ? 5.007   9.220   15.572  1.00 0.00 ? 11  VAL A N    4  
ATOM 5209  C CA   . VAL A 1 11  ? 5.905   9.117   14.428  1.00 0.00 ? 11  VAL A CA   4  
ATOM 5210  C C    . VAL A 1 11  ? 5.206   9.540   13.141  1.00 0.00 ? 11  VAL A C    4  
ATOM 5211  O O    . VAL A 1 11  ? 4.022   9.266   12.947  1.00 0.00 ? 11  VAL A O    4  
ATOM 5212  C CB   . VAL A 1 11  ? 6.439   7.682   14.261  1.00 0.00 ? 11  VAL A CB   4  
ATOM 5213  C CG1  . VAL A 1 11  ? 5.304   6.725   13.931  1.00 0.00 ? 11  VAL A CG1  4  
ATOM 5214  C CG2  . VAL A 1 11  ? 7.516   7.636   13.188  1.00 0.00 ? 11  VAL A CG2  4  
ATOM 5215  H H    . VAL A 1 11  ? 4.044   9.317   15.416  1.00 0.00 ? 11  VAL A H    4  
ATOM 5216  H HA   . VAL A 1 11  ? 6.745   9.773   14.603  1.00 0.00 ? 11  VAL A HA   4  
ATOM 5217  H HB   . VAL A 1 11  ? 6.880   7.372   15.197  1.00 0.00 ? 11  VAL A HB   4  
ATOM 5218  H HG11 . VAL A 1 11  ? 5.373   6.428   12.894  1.00 0.00 ? 11  VAL A HG11 4  
ATOM 5219  H HG12 . VAL A 1 11  ? 5.374   5.851   14.562  1.00 0.00 ? 11  VAL A HG12 4  
ATOM 5220  H HG13 . VAL A 1 11  ? 4.357   7.216   14.101  1.00 0.00 ? 11  VAL A HG13 4  
ATOM 5221  H HG21 . VAL A 1 11  ? 8.144   6.772   13.347  1.00 0.00 ? 11  VAL A HG21 4  
ATOM 5222  H HG22 . VAL A 1 11  ? 7.052   7.569   12.214  1.00 0.00 ? 11  VAL A HG22 4  
ATOM 5223  H HG23 . VAL A 1 11  ? 8.115   8.533   13.240  1.00 0.00 ? 11  VAL A HG23 4  
ATOM 5224  N N    . ILE A 1 12  ? 5.948   10.209  12.264  1.00 0.00 ? 12  ILE A N    4  
ATOM 5225  C CA   . ILE A 1 12  ? 5.399   10.669  10.994  1.00 0.00 ? 12  ILE A CA   4  
ATOM 5226  C C    . ILE A 1 12  ? 5.902   9.814   9.837   1.00 0.00 ? 12  ILE A C    4  
ATOM 5227  O O    . ILE A 1 12  ? 6.191   10.322  8.753   1.00 0.00 ? 12  ILE A O    4  
ATOM 5228  C CB   . ILE A 1 12  ? 5.762   12.142  10.725  1.00 0.00 ? 12  ILE A CB   4  
ATOM 5229  C CG1  . ILE A 1 12  ? 7.278   12.301  10.595  1.00 0.00 ? 12  ILE A CG1  4  
ATOM 5230  C CG2  . ILE A 1 12  ? 5.224   13.031  11.836  1.00 0.00 ? 12  ILE A CG2  4  
ATOM 5231  C CD1  . ILE A 1 12  ? 7.999   12.329  11.925  1.00 0.00 ? 12  ILE A CD1  4  
ATOM 5232  H H    . ILE A 1 12  ? 6.885   10.397  12.476  1.00 0.00 ? 12  ILE A H    4  
ATOM 5233  H HA   . ILE A 1 12  ? 4.323   10.588  11.047  1.00 0.00 ? 12  ILE A HA   4  
ATOM 5234  H HB   . ILE A 1 12  ? 5.295   12.440  9.799   1.00 0.00 ? 12  ILE A HB   4  
ATOM 5235  H HG12 . ILE A 1 12  ? 7.672   11.477  10.022  1.00 0.00 ? 12  ILE A HG12 4  
ATOM 5236  H HG13 . ILE A 1 12  ? 7.492   13.227  10.081  1.00 0.00 ? 12  ILE A HG13 4  
ATOM 5237  H HG21 . ILE A 1 12  ? 5.919   13.836  12.021  1.00 0.00 ? 12  ILE A HG21 4  
ATOM 5238  H HG22 . ILE A 1 12  ? 4.270   13.441  11.538  1.00 0.00 ? 12  ILE A HG22 4  
ATOM 5239  H HG23 . ILE A 1 12  ? 5.100   12.448  12.736  1.00 0.00 ? 12  ILE A HG23 4  
ATOM 5240  H HD11 . ILE A 1 12  ? 7.281   12.232  12.726  1.00 0.00 ? 12  ILE A HD11 4  
ATOM 5241  H HD12 . ILE A 1 12  ? 8.703   11.513  11.970  1.00 0.00 ? 12  ILE A HD12 4  
ATOM 5242  H HD13 . ILE A 1 12  ? 8.527   13.266  12.028  1.00 0.00 ? 12  ILE A HD13 4  
ATOM 5243  N N    . THR A 1 13  ? 6.004   8.509   10.072  1.00 0.00 ? 13  THR A N    4  
ATOM 5244  C CA   . THR A 1 13  ? 6.471   7.582   9.050   1.00 0.00 ? 13  THR A CA   4  
ATOM 5245  C C    . THR A 1 13  ? 5.333   7.162   8.127   1.00 0.00 ? 13  THR A C    4  
ATOM 5246  O O    . THR A 1 13  ? 5.322   6.046   7.608   1.00 0.00 ? 13  THR A O    4  
ATOM 5247  C CB   . THR A 1 13  ? 7.099   6.323   9.677   1.00 0.00 ? 13  THR A CB   4  
ATOM 5248  O OG1  . THR A 1 13  ? 7.603   5.462   8.649   1.00 0.00 ? 13  THR A OG1  4  
ATOM 5249  C CG2  . THR A 1 13  ? 6.079   5.572   10.519  1.00 0.00 ? 13  THR A CG2  4  
ATOM 5250  H H    . THR A 1 13  ? 5.759   8.164   10.956  1.00 0.00 ? 13  THR A H    4  
ATOM 5251  H HA   . THR A 1 13  ? 7.229   8.084   8.466   1.00 0.00 ? 13  THR A HA   4  
ATOM 5252  H HB   . THR A 1 13  ? 7.917   6.627   10.315  1.00 0.00 ? 13  THR A HB   4  
ATOM 5253  H HG1  . THR A 1 13  ? 7.701   4.572   8.997   1.00 0.00 ? 13  THR A HG1  4  
ATOM 5254  H HG21 . THR A 1 13  ? 5.684   4.742   9.952   1.00 0.00 ? 13  THR A HG21 4  
ATOM 5255  H HG22 . THR A 1 13  ? 5.273   6.239   10.789  1.00 0.00 ? 13  THR A HG22 4  
ATOM 5256  H HG23 . THR A 1 13  ? 6.554   5.202   11.415  1.00 0.00 ? 13  THR A HG23 4  
ATOM 5257  N N    . GLN A 1 14  ? 4.377   8.064   7.926   1.00 0.00 ? 14  GLN A N    4  
ATOM 5258  C CA   . GLN A 1 14  ? 3.234   7.785   7.065   1.00 0.00 ? 14  GLN A CA   4  
ATOM 5259  C C    . GLN A 1 14  ? 2.992   8.935   6.092   1.00 0.00 ? 14  GLN A C    4  
ATOM 5260  O O    . GLN A 1 14  ? 2.544   10.012  6.486   1.00 0.00 ? 14  GLN A O    4  
ATOM 5261  C CB   . GLN A 1 14  ? 1.981   7.543   7.908   1.00 0.00 ? 14  GLN A CB   4  
ATOM 5262  C CG   . GLN A 1 14  ? 1.943   6.171   8.562   1.00 0.00 ? 14  GLN A CG   4  
ATOM 5263  C CD   . GLN A 1 14  ? 0.864   6.058   9.621   1.00 0.00 ? 14  GLN A CD   4  
ATOM 5264  O OE1  . GLN A 1 14  ? 0.006   5.177   9.558   1.00 0.00 ? 14  GLN A OE1  4  
ATOM 5265  N NE2  . GLN A 1 14  ? 0.903   6.952   10.602  1.00 0.00 ? 14  GLN A NE2  4  
ATOM 5266  H H    . GLN A 1 14  ? 4.442   8.935   8.368   1.00 0.00 ? 14  GLN A H    4  
ATOM 5267  H HA   . GLN A 1 14  ? 3.454   6.893   6.500   1.00 0.00 ? 14  GLN A HA   4  
ATOM 5268  H HB2  . GLN A 1 14  ? 1.934   8.290   8.686   1.00 0.00 ? 14  GLN A HB2  4  
ATOM 5269  H HB3  . GLN A 1 14  ? 1.111   7.639   7.274   1.00 0.00 ? 14  GLN A HB3  4  
ATOM 5270  H HG2  . GLN A 1 14  ? 1.757   5.428   7.800   1.00 0.00 ? 14  GLN A HG2  4  
ATOM 5271  H HG3  . GLN A 1 14  ? 2.901   5.980   9.022   1.00 0.00 ? 14  GLN A HG3  4  
ATOM 5272  H HE21 . GLN A 1 14  ? 1.615   7.626   10.587  1.00 0.00 ? 14  GLN A HE21 4  
ATOM 5273  H HE22 . GLN A 1 14  ? 0.217   6.903   11.300  1.00 0.00 ? 14  GLN A HE22 4  
ATOM 5274  N N    . THR A 1 15  ? 3.292   8.700   4.819   1.00 0.00 ? 15  THR A N    4  
ATOM 5275  C CA   . THR A 1 15  ? 3.110   9.715   3.790   1.00 0.00 ? 15  THR A CA   4  
ATOM 5276  C C    . THR A 1 15  ? 2.202   9.211   2.674   1.00 0.00 ? 15  THR A C    4  
ATOM 5277  O O    . THR A 1 15  ? 2.675   8.722   1.649   1.00 0.00 ? 15  THR A O    4  
ATOM 5278  C CB   . THR A 1 15  ? 4.457   10.150  3.183   1.00 0.00 ? 15  THR A CB   4  
ATOM 5279  O OG1  . THR A 1 15  ? 5.357   10.550  4.223   1.00 0.00 ? 15  THR A OG1  4  
ATOM 5280  C CG2  . THR A 1 15  ? 4.265   11.297  2.203   1.00 0.00 ? 15  THR A CG2  4  
ATOM 5281  H H    . THR A 1 15  ? 3.646   7.821   4.567   1.00 0.00 ? 15  THR A H    4  
ATOM 5282  H HA   . THR A 1 15  ? 2.652   10.579  4.251   1.00 0.00 ? 15  THR A HA   4  
ATOM 5283  H HB   . THR A 1 15  ? 4.883   9.310   2.653   1.00 0.00 ? 15  THR A HB   4  
ATOM 5284  H HG1  . THR A 1 15  ? 4.955   11.252  4.741   1.00 0.00 ? 15  THR A HG1  4  
ATOM 5285  H HG21 . THR A 1 15  ? 3.595   10.988  1.414   1.00 0.00 ? 15  THR A HG21 4  
ATOM 5286  H HG22 . THR A 1 15  ? 5.219   11.571  1.779   1.00 0.00 ? 15  THR A HG22 4  
ATOM 5287  H HG23 . THR A 1 15  ? 3.843   12.145  2.721   1.00 0.00 ? 15  THR A HG23 4  
ATOM 5288  N N    . GLY A 1 16  ? 0.894   9.334   2.880   1.00 0.00 ? 16  GLY A N    4  
ATOM 5289  C CA   . GLY A 1 16  ? -0.059  8.886   1.882   1.00 0.00 ? 16  GLY A CA   4  
ATOM 5290  C C    . GLY A 1 16  ? 0.039   7.397   1.613   1.00 0.00 ? 16  GLY A C    4  
ATOM 5291  O O    . GLY A 1 16  ? -0.307  6.931   0.527   1.00 0.00 ? 16  GLY A O    4  
ATOM 5292  H H    . GLY A 1 16  ? 0.574   9.732   3.717   1.00 0.00 ? 16  GLY A H    4  
ATOM 5293  H HA2  . GLY A 1 16  ? -1.057  9.114   2.225   1.00 0.00 ? 16  GLY A HA2  4  
ATOM 5294  H HA3  . GLY A 1 16  ? 0.124   9.419   0.961   1.00 0.00 ? 16  GLY A HA3  4  
ATOM 5295  N N    . VAL A 1 17  ? 0.514   6.648   2.603   1.00 0.00 ? 17  VAL A N    4  
ATOM 5296  C CA   . VAL A 1 17  ? 0.658   5.204   2.468   1.00 0.00 ? 17  VAL A CA   4  
ATOM 5297  C C    . VAL A 1 17  ? -0.700  4.528   2.320   1.00 0.00 ? 17  VAL A C    4  
ATOM 5298  O O    . VAL A 1 17  ? -1.696  4.943   2.912   1.00 0.00 ? 17  VAL A O    4  
ATOM 5299  C CB   . VAL A 1 17  ? 1.391   4.597   3.679   1.00 0.00 ? 17  VAL A CB   4  
ATOM 5300  C CG1  . VAL A 1 17  ? 2.749   5.258   3.868   1.00 0.00 ? 17  VAL A CG1  4  
ATOM 5301  C CG2  . VAL A 1 17  ? 0.545   4.731   4.936   1.00 0.00 ? 17  VAL A CG2  4  
ATOM 5302  H H    . VAL A 1 17  ? 0.773   7.078   3.445   1.00 0.00 ? 17  VAL A H    4  
ATOM 5303  H HA   . VAL A 1 17  ? 1.246   5.008   1.583   1.00 0.00 ? 17  VAL A HA   4  
ATOM 5304  H HB   . VAL A 1 17  ? 1.551   3.546   3.489   1.00 0.00 ? 17  VAL A HB   4  
ATOM 5305  H HG11 . VAL A 1 17  ? 3.520   4.616   3.467   1.00 0.00 ? 17  VAL A HG11 4  
ATOM 5306  H HG12 . VAL A 1 17  ? 2.763   6.206   3.351   1.00 0.00 ? 17  VAL A HG12 4  
ATOM 5307  H HG13 . VAL A 1 17  ? 2.927   5.419   4.921   1.00 0.00 ? 17  VAL A HG13 4  
ATOM 5308  H HG21 . VAL A 1 17  ? 0.352   3.751   5.345   1.00 0.00 ? 17  VAL A HG21 4  
ATOM 5309  H HG22 . VAL A 1 17  ? 1.074   5.327   5.665   1.00 0.00 ? 17  VAL A HG22 4  
ATOM 5310  H HG23 . VAL A 1 17  ? -0.391  5.211   4.691   1.00 0.00 ? 17  VAL A HG23 4  
ATOM 5311  N N    . PRO A 1 18  ? -0.744  3.460   1.510   1.00 0.00 ? 18  PRO A N    4  
ATOM 5312  C CA   . PRO A 1 18  ? -1.975  2.702   1.265   1.00 0.00 ? 18  PRO A CA   4  
ATOM 5313  C C    . PRO A 1 18  ? -2.424  1.913   2.490   1.00 0.00 ? 18  PRO A C    4  
ATOM 5314  O O    . PRO A 1 18  ? -1.609  1.539   3.332   1.00 0.00 ? 18  PRO A O    4  
ATOM 5315  C CB   . PRO A 1 18  ? -1.586  1.751   0.130   1.00 0.00 ? 18  PRO A CB   4  
ATOM 5316  C CG   . PRO A 1 18  ? -0.110  1.593   0.258   1.00 0.00 ? 18  PRO A CG   4  
ATOM 5317  C CD   . PRO A 1 18  ? 0.405   2.909   0.771   1.00 0.00 ? 18  PRO A CD   4  
ATOM 5318  H HA   . PRO A 1 18  ? -2.778  3.345   0.938   1.00 0.00 ? 18  PRO A HA   4  
ATOM 5319  H HB2  . PRO A 1 18  ? -2.097  0.807   0.257   1.00 0.00 ? 18  PRO A HB2  4  
ATOM 5320  H HB3  . PRO A 1 18  ? -1.855  2.188   -0.819  1.00 0.00 ? 18  PRO A HB3  4  
ATOM 5321  H HG2  . PRO A 1 18  ? 0.116   0.803   0.958   1.00 0.00 ? 18  PRO A HG2  4  
ATOM 5322  H HG3  . PRO A 1 18  ? 0.320   1.374   -0.709  1.00 0.00 ? 18  PRO A HG3  4  
ATOM 5323  H HD2  . PRO A 1 18  ? 1.247   2.754   1.428   1.00 0.00 ? 18  PRO A HD2  4  
ATOM 5324  H HD3  . PRO A 1 18  ? 0.678   3.554   -0.051  1.00 0.00 ? 18  PRO A HD3  4  
ATOM 5325  N N    . GLY A 1 19  ? -3.726  1.664   2.584   1.00 0.00 ? 19  GLY A N    4  
ATOM 5326  C CA   . GLY A 1 19  ? -4.261  0.921   3.710   1.00 0.00 ? 19  GLY A CA   4  
ATOM 5327  C C    . GLY A 1 19  ? -4.458  -0.548  3.394   1.00 0.00 ? 19  GLY A C    4  
ATOM 5328  O O    . GLY A 1 19  ? -4.989  -0.896  2.340   1.00 0.00 ? 19  GLY A O    4  
ATOM 5329  H H    . GLY A 1 19  ? -4.330  1.987   1.882   1.00 0.00 ? 19  GLY A H    4  
ATOM 5330  H HA2  . GLY A 1 19  ? -3.579  1.011   4.543   1.00 0.00 ? 19  GLY A HA2  4  
ATOM 5331  H HA3  . GLY A 1 19  ? -5.213  1.348   3.989   1.00 0.00 ? 19  GLY A HA3  4  
ATOM 5332  N N    . GLN A 1 20  ? -4.029  -1.412  4.308   1.00 0.00 ? 20  GLN A N    4  
ATOM 5333  C CA   . GLN A 1 20  ? -4.159  -2.852  4.120   1.00 0.00 ? 20  GLN A CA   4  
ATOM 5334  C C    . GLN A 1 20  ? -5.442  -3.188  3.366   1.00 0.00 ? 20  GLN A C    4  
ATOM 5335  O O    . GLN A 1 20  ? -6.456  -2.499  3.480   1.00 0.00 ? 20  GLN A O    4  
ATOM 5336  C CB   . GLN A 1 20  ? -4.146  -3.568  5.471   1.00 0.00 ? 20  GLN A CB   4  
ATOM 5337  C CG   . GLN A 1 20  ? -5.383  -3.302  6.313   1.00 0.00 ? 20  GLN A CG   4  
ATOM 5338  C CD   . GLN A 1 20  ? -5.192  -3.682  7.768   1.00 0.00 ? 20  GLN A CD   4  
ATOM 5339  O OE1  . GLN A 1 20  ? -4.374  -3.091  8.474   1.00 0.00 ? 20  GLN A OE1  4  
ATOM 5340  N NE2  . GLN A 1 20  ? -5.947  -4.674  8.226   1.00 0.00 ? 20  GLN A NE2  4  
ATOM 5341  H H    . GLN A 1 20  ? -3.614  -1.073  5.128   1.00 0.00 ? 20  GLN A H    4  
ATOM 5342  H HA   . GLN A 1 20  ? -3.316  -3.187  3.536   1.00 0.00 ? 20  GLN A HA   4  
ATOM 5343  H HB2  . GLN A 1 20  ? -4.073  -4.632  5.301   1.00 0.00 ? 20  GLN A HB2  4  
ATOM 5344  H HB3  . GLN A 1 20  ? -3.281  -3.241  6.030   1.00 0.00 ? 20  GLN A HB3  4  
ATOM 5345  H HG2  . GLN A 1 20  ? -5.620  -2.250  6.261   1.00 0.00 ? 20  GLN A HG2  4  
ATOM 5346  H HG3  . GLN A 1 20  ? -6.205  -3.876  5.911   1.00 0.00 ? 20  GLN A HG3  4  
ATOM 5347  H HE21 . GLN A 1 20  ? -6.577  -5.100  7.606   1.00 0.00 ? 20  GLN A HE21 4  
ATOM 5348  H HE22 . GLN A 1 20  ? -5.844  -4.941  9.162   1.00 0.00 ? 20  GLN A HE22 4  
ATOM 5349  N N    . PRO A 1 21  ? -5.398  -4.271  2.576   1.00 0.00 ? 21  PRO A N    4  
ATOM 5350  C CA   . PRO A 1 21  ? -6.549  -4.723  1.789   1.00 0.00 ? 21  PRO A CA   4  
ATOM 5351  C C    . PRO A 1 21  ? -7.666  -5.284  2.662   1.00 0.00 ? 21  PRO A C    4  
ATOM 5352  O O    . PRO A 1 21  ? -7.493  -5.464  3.869   1.00 0.00 ? 21  PRO A O    4  
ATOM 5353  C CB   . PRO A 1 21  ? -5.961  -5.823  0.901   1.00 0.00 ? 21  PRO A CB   4  
ATOM 5354  C CG   . PRO A 1 21  ? -4.777  -6.325  1.654   1.00 0.00 ? 21  PRO A CG   4  
ATOM 5355  C CD   . PRO A 1 21  ? -4.223  -5.139  2.393   1.00 0.00 ? 21  PRO A CD   4  
ATOM 5356  H HA   . PRO A 1 21  ? -6.942  -3.930  1.169   1.00 0.00 ? 21  PRO A HA   4  
ATOM 5357  H HB2  . PRO A 1 21  ? -6.696  -6.602  0.754   1.00 0.00 ? 21  PRO A HB2  4  
ATOM 5358  H HB3  . PRO A 1 21  ? -5.674  -5.406  -0.053  1.00 0.00 ? 21  PRO A HB3  4  
ATOM 5359  H HG2  . PRO A 1 21  ? -5.083  -7.091  2.350   1.00 0.00 ? 21  PRO A HG2  4  
ATOM 5360  H HG3  . PRO A 1 21  ? -4.042  -6.714  0.965   1.00 0.00 ? 21  PRO A HG3  4  
ATOM 5361  H HD2  . PRO A 1 21  ? -3.816  -5.444  3.345   1.00 0.00 ? 21  PRO A HD2  4  
ATOM 5362  H HD3  . PRO A 1 21  ? -3.468  -4.643  1.799   1.00 0.00 ? 21  PRO A HD3  4  
ATOM 5363  N N    . LEU A 1 22  ? -8.810  -5.560  2.047   1.00 0.00 ? 22  LEU A N    4  
ATOM 5364  C CA   . LEU A 1 22  ? -9.956  -6.102  2.769   1.00 0.00 ? 22  LEU A CA   4  
ATOM 5365  C C    . LEU A 1 22  ? -10.311 -7.495  2.261   1.00 0.00 ? 22  LEU A C    4  
ATOM 5366  O O    . LEU A 1 22  ? -9.836  -7.923  1.210   1.00 0.00 ? 22  LEU A O    4  
ATOM 5367  C CB   . LEU A 1 22  ? -11.162 -5.171  2.624   1.00 0.00 ? 22  LEU A CB   4  
ATOM 5368  C CG   . LEU A 1 22  ? -10.969 -3.740  3.127   1.00 0.00 ? 22  LEU A CG   4  
ATOM 5369  C CD1  . LEU A 1 22  ? -11.992 -2.810  2.492   1.00 0.00 ? 22  LEU A CD1  4  
ATOM 5370  C CD2  . LEU A 1 22  ? -11.069 -3.690  4.644   1.00 0.00 ? 22  LEU A CD2  4  
ATOM 5371  H H    . LEU A 1 22  ? -8.888  -5.395  1.084   1.00 0.00 ? 22  LEU A H    4  
ATOM 5372  H HA   . LEU A 1 22  ? -9.688  -6.170  3.813   1.00 0.00 ? 22  LEU A HA   4  
ATOM 5373  H HB2  . LEU A 1 22  ? -11.417 -5.122  1.577   1.00 0.00 ? 22  LEU A HB2  4  
ATOM 5374  H HB3  . LEU A 1 22  ? -11.983 -5.608  3.173   1.00 0.00 ? 22  LEU A HB3  4  
ATOM 5375  H HG   . LEU A 1 22  ? -9.984  -3.395  2.844   1.00 0.00 ? 22  LEU A HG   4  
ATOM 5376  H HD11 . LEU A 1 22  ? -11.647 -1.790  2.570   1.00 0.00 ? 22  LEU A HD11 4  
ATOM 5377  H HD12 . LEU A 1 22  ? -12.937 -2.911  3.005   1.00 0.00 ? 22  LEU A HD12 4  
ATOM 5378  H HD13 . LEU A 1 22  ? -12.118 -3.070  1.452   1.00 0.00 ? 22  LEU A HD13 4  
ATOM 5379  H HD21 . LEU A 1 22  ? -10.582 -4.557  5.065   1.00 0.00 ? 22  LEU A HD21 4  
ATOM 5380  H HD22 . LEU A 1 22  ? -12.109 -3.684  4.937   1.00 0.00 ? 22  LEU A HD22 4  
ATOM 5381  H HD23 . LEU A 1 22  ? -10.587 -2.794  5.007   1.00 0.00 ? 22  LEU A HD23 4  
ATOM 5382  N N    . ASN A 1 23  ? -11.150 -8.198  3.014   1.00 0.00 ? 23  ASN A N    4  
ATOM 5383  C CA   . ASN A 1 23  ? -11.570 -9.544  2.639   1.00 0.00 ? 23  ASN A CA   4  
ATOM 5384  C C    . ASN A 1 23  ? -10.363 -10.456 2.444   1.00 0.00 ? 23  ASN A C    4  
ATOM 5385  O O    . ASN A 1 23  ? -10.343 -11.292 1.541   1.00 0.00 ? 23  ASN A O    4  
ATOM 5386  C CB   . ASN A 1 23  ? -12.404 -9.501  1.357   1.00 0.00 ? 23  ASN A CB   4  
ATOM 5387  C CG   . ASN A 1 23  ? -13.831 -9.054  1.610   1.00 0.00 ? 23  ASN A CG   4  
ATOM 5388  O OD1  . ASN A 1 23  ? -14.621 -9.776  2.219   1.00 0.00 ? 23  ASN A OD1  4  
ATOM 5389  N ND2  . ASN A 1 23  ? -14.167 -7.858  1.142   1.00 0.00 ? 23  ASN A ND2  4  
ATOM 5390  H H    . ASN A 1 23  ? -11.495 -7.804  3.842   1.00 0.00 ? 23  ASN A H    4  
ATOM 5391  H HA   . ASN A 1 23  ? -12.178 -9.937  3.440   1.00 0.00 ? 23  ASN A HA   4  
ATOM 5392  H HB2  . ASN A 1 23  ? -11.949 -8.811  0.662   1.00 0.00 ? 23  ASN A HB2  4  
ATOM 5393  H HB3  . ASN A 1 23  ? -12.427 -10.487 0.917   1.00 0.00 ? 23  ASN A HB3  4  
ATOM 5394  H HD21 . ASN A 1 23  ? -13.486 -7.338  0.666   1.00 0.00 ? 23  ASN A HD21 4  
ATOM 5395  H HD22 . ASN A 1 23  ? -15.083 -7.543  1.292   1.00 0.00 ? 23  ASN A HD22 4  
ATOM 5396  N N    . PHE A 1 24  ? -9.358  -10.289 3.297   1.00 0.00 ? 24  PHE A N    4  
ATOM 5397  C CA   . PHE A 1 24  ? -8.146  -11.097 3.219   1.00 0.00 ? 24  PHE A CA   4  
ATOM 5398  C C    . PHE A 1 24  ? -8.377  -12.483 3.813   1.00 0.00 ? 24  PHE A C    4  
ATOM 5399  O O    . PHE A 1 24  ? -8.787  -12.617 4.966   1.00 0.00 ? 24  PHE A O    4  
ATOM 5400  C CB   . PHE A 1 24  ? -6.996  -10.401 3.950   1.00 0.00 ? 24  PHE A CB   4  
ATOM 5401  C CG   . PHE A 1 24  ? -5.674  -11.096 3.787   1.00 0.00 ? 24  PHE A CG   4  
ATOM 5402  C CD1  . PHE A 1 24  ? -5.269  -11.559 2.546   1.00 0.00 ? 24  PHE A CD1  4  
ATOM 5403  C CD2  . PHE A 1 24  ? -4.838  -11.286 4.875   1.00 0.00 ? 24  PHE A CD2  4  
ATOM 5404  C CE1  . PHE A 1 24  ? -4.054  -12.200 2.393   1.00 0.00 ? 24  PHE A CE1  4  
ATOM 5405  C CE2  . PHE A 1 24  ? -3.621  -11.926 4.728   1.00 0.00 ? 24  PHE A CE2  4  
ATOM 5406  C CZ   . PHE A 1 24  ? -3.228  -12.382 3.485   1.00 0.00 ? 24  PHE A CZ   4  
ATOM 5407  H H    . PHE A 1 24  ? -9.433  -9.606  3.996   1.00 0.00 ? 24  PHE A H    4  
ATOM 5408  H HA   . PHE A 1 24  ? -7.887  -11.203 2.177   1.00 0.00 ? 24  PHE A HA   4  
ATOM 5409  H HB2  . PHE A 1 24  ? -6.891  -9.397  3.568   1.00 0.00 ? 24  PHE A HB2  4  
ATOM 5410  H HB3  . PHE A 1 24  ? -7.223  -10.359 5.005   1.00 0.00 ? 24  PHE A HB3  4  
ATOM 5411  H HD1  . PHE A 1 24  ? -5.912  -11.416 1.690   1.00 0.00 ? 24  PHE A HD1  4  
ATOM 5412  H HD2  . PHE A 1 24  ? -5.144  -10.929 5.848   1.00 0.00 ? 24  PHE A HD2  4  
ATOM 5413  H HE1  . PHE A 1 24  ? -3.749  -12.555 1.420   1.00 0.00 ? 24  PHE A HE1  4  
ATOM 5414  H HE2  . PHE A 1 24  ? -2.979  -12.067 5.585   1.00 0.00 ? 24  PHE A HE2  4  
ATOM 5415  H HZ   . PHE A 1 24  ? -2.279  -12.883 3.369   1.00 0.00 ? 24  PHE A HZ   4  
ATOM 5416  N N    . LYS A 1 25  ? -8.112  -13.513 3.017   1.00 0.00 ? 25  LYS A N    4  
ATOM 5417  C CA   . LYS A 1 25  ? -8.289  -14.890 3.462   1.00 0.00 ? 25  LYS A CA   4  
ATOM 5418  C C    . LYS A 1 25  ? -7.262  -15.810 2.808   1.00 0.00 ? 25  LYS A C    4  
ATOM 5419  O O    . LYS A 1 25  ? -6.995  -15.705 1.612   1.00 0.00 ? 25  LYS A O    4  
ATOM 5420  C CB   . LYS A 1 25  ? -9.704  -15.375 3.137   1.00 0.00 ? 25  LYS A CB   4  
ATOM 5421  C CG   . LYS A 1 25  ? -9.943  -15.600 1.654   1.00 0.00 ? 25  LYS A CG   4  
ATOM 5422  C CD   . LYS A 1 25  ? -11.361 -16.075 1.384   1.00 0.00 ? 25  LYS A CD   4  
ATOM 5423  C CE   . LYS A 1 25  ? -11.601 -17.466 1.950   1.00 0.00 ? 25  LYS A CE   4  
ATOM 5424  N NZ   . LYS A 1 25  ? -12.999 -17.925 1.721   1.00 0.00 ? 25  LYS A NZ   4  
ATOM 5425  H H    . LYS A 1 25  ? -7.787  -13.343 2.107   1.00 0.00 ? 25  LYS A H    4  
ATOM 5426  H HA   . LYS A 1 25  ? -8.147  -14.914 4.532   1.00 0.00 ? 25  LYS A HA   4  
ATOM 5427  H HB2  . LYS A 1 25  ? -9.880  -16.306 3.654   1.00 0.00 ? 25  LYS A HB2  4  
ATOM 5428  H HB3  . LYS A 1 25  ? -10.413 -14.638 3.487   1.00 0.00 ? 25  LYS A HB3  4  
ATOM 5429  H HG2  . LYS A 1 25  ? -9.780  -14.672 1.127   1.00 0.00 ? 25  LYS A HG2  4  
ATOM 5430  H HG3  . LYS A 1 25  ? -9.249  -16.347 1.296   1.00 0.00 ? 25  LYS A HG3  4  
ATOM 5431  H HD2  . LYS A 1 25  ? -12.056 -15.387 1.844   1.00 0.00 ? 25  LYS A HD2  4  
ATOM 5432  H HD3  . LYS A 1 25  ? -11.527 -16.097 0.316   1.00 0.00 ? 25  LYS A HD3  4  
ATOM 5433  H HE2  . LYS A 1 25  ? -10.922 -18.156 1.473   1.00 0.00 ? 25  LYS A HE2  4  
ATOM 5434  H HE3  . LYS A 1 25  ? -11.406 -17.447 3.012   1.00 0.00 ? 25  LYS A HE3  4  
ATOM 5435  H HZ1  . LYS A 1 25  ? -13.026 -18.962 1.645   1.00 0.00 ? 25  LYS A HZ1  4  
ATOM 5436  H HZ2  . LYS A 1 25  ? -13.370 -17.515 0.841   1.00 0.00 ? 25  LYS A HZ2  4  
ATOM 5437  H HZ3  . LYS A 1 25  ? -13.606 -17.630 2.512   1.00 0.00 ? 25  LYS A HZ3  4  
ATOM 5438  N N    . ALA A 1 26  ? -6.692  -16.710 3.601   1.00 0.00 ? 26  ALA A N    4  
ATOM 5439  C CA   . ALA A 1 26  ? -5.698  -17.650 3.099   1.00 0.00 ? 26  ALA A CA   4  
ATOM 5440  C C    . ALA A 1 26  ? -6.272  -19.060 3.008   1.00 0.00 ? 26  ALA A C    4  
ATOM 5441  O O    . ALA A 1 26  ? -6.806  -19.586 3.983   1.00 0.00 ? 26  ALA A O    4  
ATOM 5442  C CB   . ALA A 1 26  ? -4.462  -17.638 3.987   1.00 0.00 ? 26  ALA A CB   4  
ATOM 5443  H H    . ALA A 1 26  ? -6.947  -16.744 4.547   1.00 0.00 ? 26  ALA A H    4  
ATOM 5444  H HA   . ALA A 1 26  ? -5.403  -17.328 2.110   1.00 0.00 ? 26  ALA A HA   4  
ATOM 5445  H HB1  . ALA A 1 26  ? -3.773  -18.400 3.655   1.00 0.00 ? 26  ALA A HB1  4  
ATOM 5446  H HB2  . ALA A 1 26  ? -3.986  -16.670 3.927   1.00 0.00 ? 26  ALA A HB2  4  
ATOM 5447  H HB3  . ALA A 1 26  ? -4.752  -17.834 5.008   1.00 0.00 ? 26  ALA A HB3  4  
ATOM 5448  N N    . GLU A 1 27  ? -6.157  -19.666 1.830   1.00 0.00 ? 27  GLU A N    4  
ATOM 5449  C CA   . GLU A 1 27  ? -6.667  -21.014 1.612   1.00 0.00 ? 27  GLU A CA   4  
ATOM 5450  C C    . GLU A 1 27  ? -5.748  -21.800 0.682   1.00 0.00 ? 27  GLU A C    4  
ATOM 5451  O O    . GLU A 1 27  ? -5.086  -21.243 -0.194  1.00 0.00 ? 27  GLU A O    4  
ATOM 5452  C CB   . GLU A 1 27  ? -8.080  -20.961 1.026   1.00 0.00 ? 27  GLU A CB   4  
ATOM 5453  C CG   . GLU A 1 27  ? -9.135  -20.508 2.021   1.00 0.00 ? 27  GLU A CG   4  
ATOM 5454  C CD   . GLU A 1 27  ? -9.709  -21.656 2.827   1.00 0.00 ? 27  GLU A CD   4  
ATOM 5455  O OE1  . GLU A 1 27  ? -8.925  -22.369 3.488   1.00 0.00 ? 27  GLU A OE1  4  
ATOM 5456  O OE2  . GLU A 1 27  ? -10.944 -21.843 2.797   1.00 0.00 ? 27  GLU A OE2  4  
ATOM 5457  H H    . GLU A 1 27  ? -5.721  -19.194 1.090   1.00 0.00 ? 27  GLU A H    4  
ATOM 5458  H HA   . GLU A 1 27  ? -6.703  -21.514 2.569   1.00 0.00 ? 27  GLU A HA   4  
ATOM 5459  H HB2  . GLU A 1 27  ? -8.084  -20.278 0.191   1.00 0.00 ? 27  GLU A HB2  4  
ATOM 5460  H HB3  . GLU A 1 27  ? -8.347  -21.947 0.675   1.00 0.00 ? 27  GLU A HB3  4  
ATOM 5461  H HG2  . GLU A 1 27  ? -8.688  -19.799 2.702   1.00 0.00 ? 27  GLU A HG2  4  
ATOM 5462  H HG3  . GLU A 1 27  ? -9.938  -20.029 1.481   1.00 0.00 ? 27  GLU A HG3  4  
ATOM 5463  N N    . PRO A 1 28  ? -5.705  -23.127 0.875   1.00 0.00 ? 28  PRO A N    4  
ATOM 5464  C CA   . PRO A 1 28  ? -4.871  -24.018 0.063   1.00 0.00 ? 28  PRO A CA   4  
ATOM 5465  C C    . PRO A 1 28  ? -5.380  -24.144 -1.369  1.00 0.00 ? 28  PRO A C    4  
ATOM 5466  O O    . PRO A 1 28  ? -6.586  -24.204 -1.605  1.00 0.00 ? 28  PRO A O    4  
ATOM 5467  C CB   . PRO A 1 28  ? -4.977  -25.362 0.789   1.00 0.00 ? 28  PRO A CB   4  
ATOM 5468  C CG   . PRO A 1 28  ? -6.278  -25.299 1.512   1.00 0.00 ? 28  PRO A CG   4  
ATOM 5469  C CD   . PRO A 1 28  ? -6.468  -23.859 1.900   1.00 0.00 ? 28  PRO A CD   4  
ATOM 5470  H HA   . PRO A 1 28  ? -3.840  -23.695 0.050   1.00 0.00 ? 28  PRO A HA   4  
ATOM 5471  H HB2  . PRO A 1 28  ? -4.964  -26.166 0.066   1.00 0.00 ? 28  PRO A HB2  4  
ATOM 5472  H HB3  . PRO A 1 28  ? -4.150  -25.472 1.473   1.00 0.00 ? 28  PRO A HB3  4  
ATOM 5473  H HG2  . PRO A 1 28  ? -7.076  -25.621 0.861   1.00 0.00 ? 28  PRO A HG2  4  
ATOM 5474  H HG3  . PRO A 1 28  ? -6.237  -25.922 2.394   1.00 0.00 ? 28  PRO A HG3  4  
ATOM 5475  H HD2  . PRO A 1 28  ? -7.514  -23.593 1.865   1.00 0.00 ? 28  PRO A HD2  4  
ATOM 5476  H HD3  . PRO A 1 28  ? -6.063  -23.676 2.884   1.00 0.00 ? 28  PRO A HD3  4  
ATOM 5477  N N    . GLU A 1 29  ? -4.452  -24.185 -2.320  1.00 0.00 ? 29  GLU A N    4  
ATOM 5478  C CA   . GLU A 1 29  ? -4.809  -24.304 -3.729  1.00 0.00 ? 29  GLU A CA   4  
ATOM 5479  C C    . GLU A 1 29  ? -4.215  -25.571 -4.336  1.00 0.00 ? 29  GLU A C    4  
ATOM 5480  O O    . GLU A 1 29  ? -4.708  -26.081 -5.342  1.00 0.00 ? 29  GLU A O    4  
ATOM 5481  C CB   . GLU A 1 29  ? -4.325  -23.078 -4.506  1.00 0.00 ? 29  GLU A CB   4  
ATOM 5482  C CG   . GLU A 1 29  ? -4.153  -23.329 -5.995  1.00 0.00 ? 29  GLU A CG   4  
ATOM 5483  C CD   . GLU A 1 29  ? -5.477  -23.516 -6.711  1.00 0.00 ? 29  GLU A CD   4  
ATOM 5484  O OE1  . GLU A 1 29  ? -6.316  -22.592 -6.660  1.00 0.00 ? 29  GLU A OE1  4  
ATOM 5485  O OE2  . GLU A 1 29  ? -5.674  -24.586 -7.323  1.00 0.00 ? 29  GLU A OE2  4  
ATOM 5486  H H    . GLU A 1 29  ? -3.507  -24.133 -2.069  1.00 0.00 ? 29  GLU A H    4  
ATOM 5487  H HA   . GLU A 1 29  ? -5.885  -24.358 -3.795  1.00 0.00 ? 29  GLU A HA   4  
ATOM 5488  H HB2  . GLU A 1 29  ? -5.040  -22.278 -4.376  1.00 0.00 ? 29  GLU A HB2  4  
ATOM 5489  H HB3  . GLU A 1 29  ? -3.372  -22.765 -4.103  1.00 0.00 ? 29  GLU A HB3  4  
ATOM 5490  H HG2  . GLU A 1 29  ? -3.641  -22.486 -6.433  1.00 0.00 ? 29  GLU A HG2  4  
ATOM 5491  H HG3  . GLU A 1 29  ? -3.559  -24.220 -6.130  1.00 0.00 ? 29  GLU A HG3  4  
ATOM 5492  N N    . SER A 1 30  ? -3.152  -26.074 -3.717  1.00 0.00 ? 30  SER A N    4  
ATOM 5493  C CA   . SER A 1 30  ? -2.486  -27.280 -4.198  1.00 0.00 ? 30  SER A CA   4  
ATOM 5494  C C    . SER A 1 30  ? -1.589  -27.873 -3.116  1.00 0.00 ? 30  SER A C    4  
ATOM 5495  O O    . SER A 1 30  ? -1.354  -27.251 -2.080  1.00 0.00 ? 30  SER A O    4  
ATOM 5496  C CB   . SER A 1 30  ? -1.660  -26.968 -5.447  1.00 0.00 ? 30  SER A CB   4  
ATOM 5497  O OG   . SER A 1 30  ? -1.589  -28.093 -6.305  1.00 0.00 ? 30  SER A OG   4  
ATOM 5498  H H    . SER A 1 30  ? -2.805  -25.622 -2.919  1.00 0.00 ? 30  SER A H    4  
ATOM 5499  H HA   . SER A 1 30  ? -3.249  -28.000 -4.452  1.00 0.00 ? 30  SER A HA   4  
ATOM 5500  H HB2  . SER A 1 30  ? -2.117  -26.150 -5.983  1.00 0.00 ? 30  SER A HB2  4  
ATOM 5501  H HB3  . SER A 1 30  ? -0.658  -26.691 -5.152  1.00 0.00 ? 30  SER A HB3  4  
ATOM 5502  H HG   . SER A 1 30  ? -0.675  -28.375 -6.389  1.00 0.00 ? 30  SER A HG   4  
ATOM 5503  N N    . GLU A 1 31  ? -1.092  -29.081 -3.365  1.00 0.00 ? 31  GLU A N    4  
ATOM 5504  C CA   . GLU A 1 31  ? -0.222  -29.759 -2.412  1.00 0.00 ? 31  GLU A CA   4  
ATOM 5505  C C    . GLU A 1 31  ? 1.015   -28.918 -2.109  1.00 0.00 ? 31  GLU A C    4  
ATOM 5506  O O    . GLU A 1 31  ? 1.558   -28.965 -1.005  1.00 0.00 ? 31  GLU A O    4  
ATOM 5507  C CB   . GLU A 1 31  ? 0.199   -31.127 -2.955  1.00 0.00 ? 31  GLU A CB   4  
ATOM 5508  C CG   . GLU A 1 31  ? 1.274   -31.052 -4.026  1.00 0.00 ? 31  GLU A CG   4  
ATOM 5509  C CD   . GLU A 1 31  ? 2.006   -32.366 -4.211  1.00 0.00 ? 31  GLU A CD   4  
ATOM 5510  O OE1  . GLU A 1 31  ? 2.985   -32.609 -3.476  1.00 0.00 ? 31  GLU A OE1  4  
ATOM 5511  O OE2  . GLU A 1 31  ? 1.598   -33.153 -5.092  1.00 0.00 ? 31  GLU A OE2  4  
ATOM 5512  H H    . GLU A 1 31  ? -1.316  -29.526 -4.209  1.00 0.00 ? 31  GLU A H    4  
ATOM 5513  H HA   . GLU A 1 31  ? -0.778  -29.901 -1.497  1.00 0.00 ? 31  GLU A HA   4  
ATOM 5514  H HB2  . GLU A 1 31  ? 0.574   -31.725 -2.138  1.00 0.00 ? 31  GLU A HB2  4  
ATOM 5515  H HB3  . GLU A 1 31  ? -0.667  -31.614 -3.378  1.00 0.00 ? 31  GLU A HB3  4  
ATOM 5516  H HG2  . GLU A 1 31  ? 0.812   -30.780 -4.963  1.00 0.00 ? 31  GLU A HG2  4  
ATOM 5517  H HG3  . GLU A 1 31  ? 1.990   -30.293 -3.746  1.00 0.00 ? 31  GLU A HG3  4  
ATOM 5518  N N    . THR A 1 32  ? 1.455   -28.147 -3.099  1.00 0.00 ? 32  THR A N    4  
ATOM 5519  C CA   . THR A 1 32  ? 2.628   -27.296 -2.941  1.00 0.00 ? 32  THR A CA   4  
ATOM 5520  C C    . THR A 1 32  ? 2.340   -25.872 -3.403  1.00 0.00 ? 32  THR A C    4  
ATOM 5521  O O    . THR A 1 32  ? 3.259   -25.092 -3.653  1.00 0.00 ? 32  THR A O    4  
ATOM 5522  C CB   . THR A 1 32  ? 3.831   -27.846 -3.730  1.00 0.00 ? 32  THR A CB   4  
ATOM 5523  O OG1  . THR A 1 32  ? 3.530   -27.870 -5.129  1.00 0.00 ? 32  THR A OG1  4  
ATOM 5524  C CG2  . THR A 1 32  ? 4.192   -29.246 -3.259  1.00 0.00 ? 32  THR A CG2  4  
ATOM 5525  H H    . THR A 1 32  ? 0.979   -28.152 -3.956  1.00 0.00 ? 32  THR A H    4  
ATOM 5526  H HA   . THR A 1 32  ? 2.888   -27.278 -1.893  1.00 0.00 ? 32  THR A HA   4  
ATOM 5527  H HB   . THR A 1 32  ? 4.679   -27.196 -3.562  1.00 0.00 ? 32  THR A HB   4  
ATOM 5528  H HG1  . THR A 1 32  ? 4.331   -27.704 -5.632  1.00 0.00 ? 32  THR A HG1  4  
ATOM 5529  H HG21 . THR A 1 32  ? 5.161   -29.228 -2.783  1.00 0.00 ? 32  THR A HG21 4  
ATOM 5530  H HG22 . THR A 1 32  ? 4.219   -29.915 -4.107  1.00 0.00 ? 32  THR A HG22 4  
ATOM 5531  H HG23 . THR A 1 32  ? 3.451   -29.590 -2.553  1.00 0.00 ? 32  THR A HG23 4  
ATOM 5532  N N    . SER A 1 33  ? 1.058   -25.538 -3.513  1.00 0.00 ? 33  SER A N    4  
ATOM 5533  C CA   . SER A 1 33  ? 0.649   -24.208 -3.949  1.00 0.00 ? 33  SER A CA   4  
ATOM 5534  C C    . SER A 1 33  ? -0.538  -23.709 -3.130  1.00 0.00 ? 33  SER A C    4  
ATOM 5535  O O    . SER A 1 33  ? -1.308  -24.502 -2.586  1.00 0.00 ? 33  SER A O    4  
ATOM 5536  C CB   . SER A 1 33  ? 0.288   -24.223 -5.435  1.00 0.00 ? 33  SER A CB   4  
ATOM 5537  O OG   . SER A 1 33  ? 1.284   -24.884 -6.196  1.00 0.00 ? 33  SER A OG   4  
ATOM 5538  H H    . SER A 1 33  ? 0.371   -26.204 -3.300  1.00 0.00 ? 33  SER A H    4  
ATOM 5539  H HA   . SER A 1 33  ? 1.483   -23.538 -3.796  1.00 0.00 ? 33  SER A HA   4  
ATOM 5540  H HB2  . SER A 1 33  ? -0.651  -24.738 -5.569  1.00 0.00 ? 33  SER A HB2  4  
ATOM 5541  H HB3  . SER A 1 33  ? 0.195   -23.207 -5.790  1.00 0.00 ? 33  SER A HB3  4  
ATOM 5542  H HG   . SER A 1 33  ? 1.104   -25.827 -6.209  1.00 0.00 ? 33  SER A HG   4  
ATOM 5543  N N    . ILE A 1 34  ? -0.679  -22.391 -3.047  1.00 0.00 ? 34  ILE A N    4  
ATOM 5544  C CA   . ILE A 1 34  ? -1.773  -21.786 -2.296  1.00 0.00 ? 34  ILE A CA   4  
ATOM 5545  C C    . ILE A 1 34  ? -2.241  -20.492 -2.953  1.00 0.00 ? 34  ILE A C    4  
ATOM 5546  O O    . ILE A 1 34  ? -1.429  -19.671 -3.382  1.00 0.00 ? 34  ILE A O    4  
ATOM 5547  C CB   . ILE A 1 34  ? -1.360  -21.490 -0.842  1.00 0.00 ? 34  ILE A CB   4  
ATOM 5548  C CG1  . ILE A 1 34  ? -0.959  -22.783 -0.129  1.00 0.00 ? 34  ILE A CG1  4  
ATOM 5549  C CG2  . ILE A 1 34  ? -2.495  -20.800 -0.100  1.00 0.00 ? 34  ILE A CG2  4  
ATOM 5550  C CD1  . ILE A 1 34  ? -0.607  -22.585 1.329   1.00 0.00 ? 34  ILE A CD1  4  
ATOM 5551  H H    . ILE A 1 34  ? -0.034  -21.811 -3.502  1.00 0.00 ? 34  ILE A H    4  
ATOM 5552  H HA   . ILE A 1 34  ? -2.594  -22.488 -2.281  1.00 0.00 ? 34  ILE A HA   4  
ATOM 5553  H HB   . ILE A 1 34  ? -0.515  -20.820 -0.860  1.00 0.00 ? 34  ILE A HB   4  
ATOM 5554  H HG12 . ILE A 1 34  ? -1.777  -23.484 -0.180  1.00 0.00 ? 34  ILE A HG12 4  
ATOM 5555  H HG13 . ILE A 1 34  ? -0.097  -23.205 -0.625  1.00 0.00 ? 34  ILE A HG13 4  
ATOM 5556  H HG21 . ILE A 1 34  ? -3.177  -20.360 -0.813  1.00 0.00 ? 34  ILE A HG21 4  
ATOM 5557  H HG22 . ILE A 1 34  ? -3.024  -21.524 0.502   1.00 0.00 ? 34  ILE A HG22 4  
ATOM 5558  H HG23 . ILE A 1 34  ? -2.092  -20.027 0.537   1.00 0.00 ? 34  ILE A HG23 4  
ATOM 5559  H HD11 . ILE A 1 34  ? -0.495  -21.530 1.532   1.00 0.00 ? 34  ILE A HD11 4  
ATOM 5560  H HD12 . ILE A 1 34  ? -1.393  -22.991 1.948   1.00 0.00 ? 34  ILE A HD12 4  
ATOM 5561  H HD13 . ILE A 1 34  ? 0.321   -23.093 1.547   1.00 0.00 ? 34  ILE A HD13 4  
ATOM 5562  N N    . LEU A 1 35  ? -3.556  -20.316 -3.028  1.00 0.00 ? 35  LEU A N    4  
ATOM 5563  C CA   . LEU A 1 35  ? -4.134  -19.120 -3.632  1.00 0.00 ? 35  LEU A CA   4  
ATOM 5564  C C    . LEU A 1 35  ? -4.739  -18.211 -2.567  1.00 0.00 ? 35  LEU A C    4  
ATOM 5565  O O    . LEU A 1 35  ? -5.461  -18.670 -1.680  1.00 0.00 ? 35  LEU A O    4  
ATOM 5566  C CB   . LEU A 1 35  ? -5.203  -19.508 -4.655  1.00 0.00 ? 35  LEU A CB   4  
ATOM 5567  C CG   . LEU A 1 35  ? -5.726  -18.376 -5.541  1.00 0.00 ? 35  LEU A CG   4  
ATOM 5568  C CD1  . LEU A 1 35  ? -4.688  -17.990 -6.583  1.00 0.00 ? 35  LEU A CD1  4  
ATOM 5569  C CD2  . LEU A 1 35  ? -7.031  -18.782 -6.210  1.00 0.00 ? 35  LEU A CD2  4  
ATOM 5570  H H    . LEU A 1 35  ? -4.152  -21.005 -2.669  1.00 0.00 ? 35  LEU A H    4  
ATOM 5571  H HA   . LEU A 1 35  ? -3.342  -18.587 -4.135  1.00 0.00 ? 35  LEU A HA   4  
ATOM 5572  H HB2  . LEU A 1 35  ? -4.784  -20.265 -5.300  1.00 0.00 ? 35  LEU A HB2  4  
ATOM 5573  H HB3  . LEU A 1 35  ? -6.043  -19.921 -4.114  1.00 0.00 ? 35  LEU A HB3  4  
ATOM 5574  H HG   . LEU A 1 35  ? -5.920  -17.507 -4.926  1.00 0.00 ? 35  LEU A HG   4  
ATOM 5575  H HD11 . LEU A 1 35  ? -3.904  -17.415 -6.114  1.00 0.00 ? 35  LEU A HD11 4  
ATOM 5576  H HD12 . LEU A 1 35  ? -5.156  -17.399 -7.355  1.00 0.00 ? 35  LEU A HD12 4  
ATOM 5577  H HD13 . LEU A 1 35  ? -4.267  -18.884 -7.019  1.00 0.00 ? 35  LEU A HD13 4  
ATOM 5578  H HD21 . LEU A 1 35  ? -7.188  -18.174 -7.088  1.00 0.00 ? 35  LEU A HD21 4  
ATOM 5579  H HD22 . LEU A 1 35  ? -7.850  -18.636 -5.520  1.00 0.00 ? 35  LEU A HD22 4  
ATOM 5580  H HD23 . LEU A 1 35  ? -6.980  -19.822 -6.495  1.00 0.00 ? 35  LEU A HD23 4  
ATOM 5581  N N    . LEU A 1 36  ? -4.442  -16.920 -2.661  1.00 0.00 ? 36  LEU A N    4  
ATOM 5582  C CA   . LEU A 1 36  ? -4.959  -15.944 -1.707  1.00 0.00 ? 36  LEU A CA   4  
ATOM 5583  C C    . LEU A 1 36  ? -5.991  -15.033 -2.364  1.00 0.00 ? 36  LEU A C    4  
ATOM 5584  O O    . LEU A 1 36  ? -5.906  -14.742 -3.557  1.00 0.00 ? 36  LEU A O    4  
ATOM 5585  C CB   . LEU A 1 36  ? -3.814  -15.107 -1.133  1.00 0.00 ? 36  LEU A CB   4  
ATOM 5586  C CG   . LEU A 1 36  ? -2.590  -15.885 -0.649  1.00 0.00 ? 36  LEU A CG   4  
ATOM 5587  C CD1  . LEU A 1 36  ? -1.337  -15.030 -0.756  1.00 0.00 ? 36  LEU A CD1  4  
ATOM 5588  C CD2  . LEU A 1 36  ? -2.793  -16.361 0.782   1.00 0.00 ? 36  LEU A CD2  4  
ATOM 5589  H H    . LEU A 1 36  ? -3.862  -16.614 -3.389  1.00 0.00 ? 36  LEU A H    4  
ATOM 5590  H HA   . LEU A 1 36  ? -5.435  -16.487 -0.904  1.00 0.00 ? 36  LEU A HA   4  
ATOM 5591  H HB2  . LEU A 1 36  ? -3.488  -14.423 -1.901  1.00 0.00 ? 36  LEU A HB2  4  
ATOM 5592  H HB3  . LEU A 1 36  ? -4.204  -14.546 -0.296  1.00 0.00 ? 36  LEU A HB3  4  
ATOM 5593  H HG   . LEU A 1 36  ? -2.454  -16.756 -1.276  1.00 0.00 ? 36  LEU A HG   4  
ATOM 5594  H HD11 . LEU A 1 36  ? -0.807  -15.281 -1.663  1.00 0.00 ? 36  LEU A HD11 4  
ATOM 5595  H HD12 . LEU A 1 36  ? -0.701  -15.216 0.096   1.00 0.00 ? 36  LEU A HD12 4  
ATOM 5596  H HD13 . LEU A 1 36  ? -1.615  -13.986 -0.777  1.00 0.00 ? 36  LEU A HD13 4  
ATOM 5597  H HD21 . LEU A 1 36  ? -3.621  -17.053 0.817   1.00 0.00 ? 36  LEU A HD21 4  
ATOM 5598  H HD22 . LEU A 1 36  ? -3.006  -15.513 1.417   1.00 0.00 ? 36  LEU A HD22 4  
ATOM 5599  H HD23 . LEU A 1 36  ? -1.897  -16.854 1.128   1.00 0.00 ? 36  LEU A HD23 4  
ATOM 5600  N N    . SER A 1 37  ? -6.964  -14.585 -1.577  1.00 0.00 ? 37  SER A N    4  
ATOM 5601  C CA   . SER A 1 37  ? -8.013  -13.708 -2.083  1.00 0.00 ? 37  SER A CA   4  
ATOM 5602  C C    . SER A 1 37  ? -8.125  -12.447 -1.231  1.00 0.00 ? 37  SER A C    4  
ATOM 5603  O O    . SER A 1 37  ? -8.503  -12.507 -0.061  1.00 0.00 ? 37  SER A O    4  
ATOM 5604  C CB   . SER A 1 37  ? -9.355  -14.443 -2.105  1.00 0.00 ? 37  SER A CB   4  
ATOM 5605  O OG   . SER A 1 37  ? -9.283  -15.612 -2.902  1.00 0.00 ? 37  SER A OG   4  
ATOM 5606  H H    . SER A 1 37  ? -6.977  -14.853 -0.634  1.00 0.00 ? 37  SER A H    4  
ATOM 5607  H HA   . SER A 1 37  ? -7.751  -13.425 -3.091  1.00 0.00 ? 37  SER A HA   4  
ATOM 5608  H HB2  . SER A 1 37  ? -9.624  -14.725 -1.098  1.00 0.00 ? 37  SER A HB2  4  
ATOM 5609  H HB3  . SER A 1 37  ? -10.113 -13.790 -2.511  1.00 0.00 ? 37  SER A HB3  4  
ATOM 5610  H HG   . SER A 1 37  ? -10.143 -15.788 -3.291  1.00 0.00 ? 37  SER A HG   4  
ATOM 5611  N N    . TRP A 1 38  ? -7.793  -11.308 -1.827  1.00 0.00 ? 38  TRP A N    4  
ATOM 5612  C CA   . TRP A 1 38  ? -7.855  -10.032 -1.123  1.00 0.00 ? 38  TRP A CA   4  
ATOM 5613  C C    . TRP A 1 38  ? -8.475  -8.954  -2.005  1.00 0.00 ? 38  TRP A C    4  
ATOM 5614  O O    . TRP A 1 38  ? -8.515  -9.085  -3.229  1.00 0.00 ? 38  TRP A O    4  
ATOM 5615  C CB   . TRP A 1 38  ? -6.456  -9.602  -0.679  1.00 0.00 ? 38  TRP A CB   4  
ATOM 5616  C CG   . TRP A 1 38  ? -5.625  -9.041  -1.793  1.00 0.00 ? 38  TRP A CG   4  
ATOM 5617  C CD1  . TRP A 1 38  ? -5.809  -7.848  -2.432  1.00 0.00 ? 38  TRP A CD1  4  
ATOM 5618  C CD2  . TRP A 1 38  ? -4.481  -9.652  -2.400  1.00 0.00 ? 38  TRP A CD2  4  
ATOM 5619  N NE1  . TRP A 1 38  ? -4.848  -7.680  -3.400  1.00 0.00 ? 38  TRP A NE1  4  
ATOM 5620  C CE2  . TRP A 1 38  ? -4.021  -8.772  -3.400  1.00 0.00 ? 38  TRP A CE2  4  
ATOM 5621  C CE3  . TRP A 1 38  ? -3.800  -10.854 -2.195  1.00 0.00 ? 38  TRP A CE3  4  
ATOM 5622  C CZ2  . TRP A 1 38  ? -2.912  -9.061  -4.191  1.00 0.00 ? 38  TRP A CZ2  4  
ATOM 5623  C CZ3  . TRP A 1 38  ? -2.700  -11.139 -2.982  1.00 0.00 ? 38  TRP A CZ3  4  
ATOM 5624  C CH2  . TRP A 1 38  ? -2.265  -10.245 -3.969  1.00 0.00 ? 38  TRP A CH2  4  
ATOM 5625  H H    . TRP A 1 38  ? -7.498  -11.324 -2.761  1.00 0.00 ? 38  TRP A H    4  
ATOM 5626  H HA   . TRP A 1 38  ? -8.475  -10.166 -0.249  1.00 0.00 ? 38  TRP A HA   4  
ATOM 5627  H HB2  . TRP A 1 38  ? -6.545  -8.844  0.085   1.00 0.00 ? 38  TRP A HB2  4  
ATOM 5628  H HB3  . TRP A 1 38  ? -5.937  -10.458 -0.273  1.00 0.00 ? 38  TRP A HB3  4  
ATOM 5629  H HD1  . TRP A 1 38  ? -6.599  -7.150  -2.201  1.00 0.00 ? 38  TRP A HD1  4  
ATOM 5630  H HE1  . TRP A 1 38  ? -4.767  -6.904  -3.992  1.00 0.00 ? 38  TRP A HE1  4  
ATOM 5631  H HE3  . TRP A 1 38  ? -4.121  -11.556 -1.439  1.00 0.00 ? 38  TRP A HE3  4  
ATOM 5632  H HZ2  . TRP A 1 38  ? -2.564  -8.382  -4.956  1.00 0.00 ? 38  TRP A HZ2  4  
ATOM 5633  H HZ3  . TRP A 1 38  ? -2.161  -12.064 -2.838  1.00 0.00 ? 38  TRP A HZ3  4  
ATOM 5634  H HH2  . TRP A 1 38  ? -1.401  -10.509 -4.560  1.00 0.00 ? 38  TRP A HH2  4  
ATOM 5635  N N    . THR A 1 39  ? -8.959  -7.887  -1.377  1.00 0.00 ? 39  THR A N    4  
ATOM 5636  C CA   . THR A 1 39  ? -9.578  -6.786  -2.105  1.00 0.00 ? 39  THR A CA   4  
ATOM 5637  C C    . THR A 1 39  ? -8.789  -5.495  -1.926  1.00 0.00 ? 39  THR A C    4  
ATOM 5638  O O    . THR A 1 39  ? -8.581  -5.016  -0.811  1.00 0.00 ? 39  THR A O    4  
ATOM 5639  C CB   . THR A 1 39  ? -11.030 -6.555  -1.646  1.00 0.00 ? 39  THR A CB   4  
ATOM 5640  O OG1  . THR A 1 39  ? -11.885 -7.565  -2.195  1.00 0.00 ? 39  THR A OG1  4  
ATOM 5641  C CG2  . THR A 1 39  ? -11.521 -5.180  -2.074  1.00 0.00 ? 39  THR A CG2  4  
ATOM 5642  H H    . THR A 1 39  ? -8.898  -7.840  -0.400  1.00 0.00 ? 39  THR A H    4  
ATOM 5643  H HA   . THR A 1 39  ? -9.592  -7.046  -3.154  1.00 0.00 ? 39  THR A HA   4  
ATOM 5644  H HB   . THR A 1 39  ? -11.064 -6.614  -0.567  1.00 0.00 ? 39  THR A HB   4  
ATOM 5645  H HG1  . THR A 1 39  ? -11.936 -8.306  -1.588  1.00 0.00 ? 39  THR A HG1  4  
ATOM 5646  H HG21 . THR A 1 39  ? -11.363 -4.476  -1.271  1.00 0.00 ? 39  THR A HG21 4  
ATOM 5647  H HG22 . THR A 1 39  ? -12.574 -5.231  -2.307  1.00 0.00 ? 39  THR A HG22 4  
ATOM 5648  H HG23 . THR A 1 39  ? -10.974 -4.859  -2.947  1.00 0.00 ? 39  THR A HG23 4  
ATOM 5649  N N    . PRO A 1 40  ? -8.338  -4.915  -3.048  1.00 0.00 ? 40  PRO A N    4  
ATOM 5650  C CA   . PRO A 1 40  ? -7.565  -3.670  -3.040  1.00 0.00 ? 40  PRO A CA   4  
ATOM 5651  C C    . PRO A 1 40  ? -8.410  -2.465  -2.641  1.00 0.00 ? 40  PRO A C    4  
ATOM 5652  O O    . PRO A 1 40  ? -9.581  -2.350  -3.004  1.00 0.00 ? 40  PRO A O    4  
ATOM 5653  C CB   . PRO A 1 40  ? -7.093  -3.535  -4.490  1.00 0.00 ? 40  PRO A CB   4  
ATOM 5654  C CG   . PRO A 1 40  ? -8.098  -4.294  -5.287  1.00 0.00 ? 40  PRO A CG   4  
ATOM 5655  C CD   . PRO A 1 40  ? -8.548  -5.430  -4.411  1.00 0.00 ? 40  PRO A CD   4  
ATOM 5656  H HA   . PRO A 1 40  ? -6.708  -3.739  -2.386  1.00 0.00 ? 40  PRO A HA   4  
ATOM 5657  H HB2  . PRO A 1 40  ? -7.073  -2.491  -4.769  1.00 0.00 ? 40  PRO A HB2  4  
ATOM 5658  H HB3  . PRO A 1 40  ? -6.106  -3.960  -4.592  1.00 0.00 ? 40  PRO A HB3  4  
ATOM 5659  H HG2  . PRO A 1 40  ? -8.933  -3.654  -5.529  1.00 0.00 ? 40  PRO A HG2  4  
ATOM 5660  H HG3  . PRO A 1 40  ? -7.640  -4.674  -6.188  1.00 0.00 ? 40  PRO A HG3  4  
ATOM 5661  H HD2  . PRO A 1 40  ? -9.592  -5.650  -4.584  1.00 0.00 ? 40  PRO A HD2  4  
ATOM 5662  H HD3  . PRO A 1 40  ? -7.942  -6.307  -4.589  1.00 0.00 ? 40  PRO A HD3  4  
ATOM 5663  N N    . PRO A 1 41  ? -7.806  -1.544  -1.875  1.00 0.00 ? 41  PRO A N    4  
ATOM 5664  C CA   . PRO A 1 41  ? -8.485  -0.331  -1.411  1.00 0.00 ? 41  PRO A CA   4  
ATOM 5665  C C    . PRO A 1 41  ? -8.759  0.650   -2.546  1.00 0.00 ? 41  PRO A C    4  
ATOM 5666  O O    . PRO A 1 41  ? -8.676  0.293   -3.721  1.00 0.00 ? 41  PRO A O    4  
ATOM 5667  C CB   . PRO A 1 41  ? -7.494  0.271   -0.412  1.00 0.00 ? 41  PRO A CB   4  
ATOM 5668  C CG   . PRO A 1 41  ? -6.164  -0.244  -0.842  1.00 0.00 ? 41  PRO A CG   4  
ATOM 5669  C CD   . PRO A 1 41  ? -6.413  -1.616  -1.405  1.00 0.00 ? 41  PRO A CD   4  
ATOM 5670  H HA   . PRO A 1 41  ? -9.411  -0.563  -0.906  1.00 0.00 ? 41  PRO A HA   4  
ATOM 5671  H HB2  . PRO A 1 41  ? -7.537  1.350   -0.464  1.00 0.00 ? 41  PRO A HB2  4  
ATOM 5672  H HB3  . PRO A 1 41  ? -7.740  -0.057  0.586   1.00 0.00 ? 41  PRO A HB3  4  
ATOM 5673  H HG2  . PRO A 1 41  ? -5.747  0.402   -1.600  1.00 0.00 ? 41  PRO A HG2  4  
ATOM 5674  H HG3  . PRO A 1 41  ? -5.501  -0.303  0.009   1.00 0.00 ? 41  PRO A HG3  4  
ATOM 5675  H HD2  . PRO A 1 41  ? -5.738  -1.816  -2.224  1.00 0.00 ? 41  PRO A HD2  4  
ATOM 5676  H HD3  . PRO A 1 41  ? -6.305  -2.365  -0.634  1.00 0.00 ? 41  PRO A HD3  4  
ATOM 5677  N N    . ARG A 1 42  ? -9.086  1.887   -2.187  1.00 0.00 ? 42  ARG A N    4  
ATOM 5678  C CA   . ARG A 1 42  ? -9.373  2.919   -3.176  1.00 0.00 ? 42  ARG A CA   4  
ATOM 5679  C C    . ARG A 1 42  ? -8.093  3.383   -3.865  1.00 0.00 ? 42  ARG A C    4  
ATOM 5680  O O    . ARG A 1 42  ? -8.099  3.716   -5.050  1.00 0.00 ? 42  ARG A O    4  
ATOM 5681  C CB   . ARG A 1 42  ? -10.069 4.110   -2.514  1.00 0.00 ? 42  ARG A CB   4  
ATOM 5682  C CG   . ARG A 1 42  ? -9.185  4.866   -1.536  1.00 0.00 ? 42  ARG A CG   4  
ATOM 5683  C CD   . ARG A 1 42  ? -8.421  5.986   -2.227  1.00 0.00 ? 42  ARG A CD   4  
ATOM 5684  N NE   . ARG A 1 42  ? -9.317  6.995   -2.785  1.00 0.00 ? 42  ARG A NE   4  
ATOM 5685  C CZ   . ARG A 1 42  ? -8.944  8.243   -3.050  1.00 0.00 ? 42  ARG A CZ   4  
ATOM 5686  N NH1  . ARG A 1 42  ? -7.700  8.632   -2.809  1.00 0.00 ? 42  ARG A NH1  4  
ATOM 5687  N NH2  . ARG A 1 42  ? -9.817  9.104   -3.557  1.00 0.00 ? 42  ARG A NH2  4  
ATOM 5688  H H    . ARG A 1 42  ? -9.136  2.111   -1.234  1.00 0.00 ? 42  ARG A H    4  
ATOM 5689  H HA   . ARG A 1 42  ? -10.033 2.494   -3.917  1.00 0.00 ? 42  ARG A HA   4  
ATOM 5690  H HB2  . ARG A 1 42  ? -10.389 4.798   -3.283  1.00 0.00 ? 42  ARG A HB2  4  
ATOM 5691  H HB3  . ARG A 1 42  ? -10.936 3.753   -1.979  1.00 0.00 ? 42  ARG A HB3  4  
ATOM 5692  H HG2  . ARG A 1 42  ? -9.803  5.293   -0.761  1.00 0.00 ? 42  ARG A HG2  4  
ATOM 5693  H HG3  . ARG A 1 42  ? -8.478  4.177   -1.098  1.00 0.00 ? 42  ARG A HG3  4  
ATOM 5694  H HD2  . ARG A 1 42  ? -7.769  6.456   -1.506  1.00 0.00 ? 42  ARG A HD2  4  
ATOM 5695  H HD3  . ARG A 1 42  ? -7.830  5.561   -3.024  1.00 0.00 ? 42  ARG A HD3  4  
ATOM 5696  H HE   . ARG A 1 42  ? -10.241 6.729   -2.971  1.00 0.00 ? 42  ARG A HE   4  
ATOM 5697  H HH11 . ARG A 1 42  ? -7.040  7.985   -2.427  1.00 0.00 ? 42  ARG A HH11 4  
ATOM 5698  H HH12 . ARG A 1 42  ? -7.421  9.571   -3.010  1.00 0.00 ? 42  ARG A HH12 4  
ATOM 5699  H HH21 . ARG A 1 42  ? -10.756 8.814   -3.741  1.00 0.00 ? 42  ARG A HH21 4  
ATOM 5700  H HH22 . ARG A 1 42  ? -9.536  10.042  -3.756  1.00 0.00 ? 42  ARG A HH22 4  
ATOM 5701  N N    . SER A 1 43  ? -6.997  3.403   -3.113  1.00 0.00 ? 43  SER A N    4  
ATOM 5702  C CA   . SER A 1 43  ? -5.710  3.831   -3.650  1.00 0.00 ? 43  SER A CA   4  
ATOM 5703  C C    . SER A 1 43  ? -5.449  3.190   -5.009  1.00 0.00 ? 43  SER A C    4  
ATOM 5704  O O    . SER A 1 43  ? -5.073  2.020   -5.095  1.00 0.00 ? 43  SER A O    4  
ATOM 5705  C CB   . SER A 1 43  ? -4.584  3.471   -2.679  1.00 0.00 ? 43  SER A CB   4  
ATOM 5706  O OG   . SER A 1 43  ? -4.665  4.246   -1.495  1.00 0.00 ? 43  SER A OG   4  
ATOM 5707  H H    . SER A 1 43  ? -7.056  3.127   -2.175  1.00 0.00 ? 43  SER A H    4  
ATOM 5708  H HA   . SER A 1 43  ? -5.741  4.903   -3.771  1.00 0.00 ? 43  SER A HA   4  
ATOM 5709  H HB2  . SER A 1 43  ? -4.657  2.427   -2.417  1.00 0.00 ? 43  SER A HB2  4  
ATOM 5710  H HB3  . SER A 1 43  ? -3.631  3.657   -3.153  1.00 0.00 ? 43  SER A HB3  4  
ATOM 5711  H HG   . SER A 1 43  ? -4.393  5.147   -1.683  1.00 0.00 ? 43  SER A HG   4  
ATOM 5712  N N    . ASP A 1 44  ? -5.650  3.964   -6.070  1.00 0.00 ? 44  ASP A N    4  
ATOM 5713  C CA   . ASP A 1 44  ? -5.436  3.473   -7.426  1.00 0.00 ? 44  ASP A CA   4  
ATOM 5714  C C    . ASP A 1 44  ? -3.951  3.245   -7.693  1.00 0.00 ? 44  ASP A C    4  
ATOM 5715  O O    . ASP A 1 44  ? -3.580  2.474   -8.579  1.00 0.00 ? 44  ASP A O    4  
ATOM 5716  C CB   . ASP A 1 44  ? -6.003  4.463   -8.445  1.00 0.00 ? 44  ASP A CB   4  
ATOM 5717  C CG   . ASP A 1 44  ? -7.485  4.255   -8.691  1.00 0.00 ? 44  ASP A CG   4  
ATOM 5718  O OD1  . ASP A 1 44  ? -8.289  4.610   -7.805  1.00 0.00 ? 44  ASP A OD1  4  
ATOM 5719  O OD2  . ASP A 1 44  ? -7.840  3.737   -9.771  1.00 0.00 ? 44  ASP A OD2  4  
ATOM 5720  H H    . ASP A 1 44  ? -5.950  4.888   -5.937  1.00 0.00 ? 44  ASP A H    4  
ATOM 5721  H HA   . ASP A 1 44  ? -5.956  2.532   -7.525  1.00 0.00 ? 44  ASP A HA   4  
ATOM 5722  H HB2  . ASP A 1 44  ? -5.856  5.469   -8.080  1.00 0.00 ? 44  ASP A HB2  4  
ATOM 5723  H HB3  . ASP A 1 44  ? -5.480  4.344   -9.383  1.00 0.00 ? 44  ASP A HB3  4  
ATOM 5724  N N    . THR A 1 45  ? -3.105  3.920   -6.921  1.00 0.00 ? 45  THR A N    4  
ATOM 5725  C CA   . THR A 1 45  ? -1.662  3.792   -7.076  1.00 0.00 ? 45  THR A CA   4  
ATOM 5726  C C    . THR A 1 45  ? -1.094  2.765   -6.103  1.00 0.00 ? 45  THR A C    4  
ATOM 5727  O O    . THR A 1 45  ? -1.122  2.964   -4.889  1.00 0.00 ? 45  THR A O    4  
ATOM 5728  C CB   . THR A 1 45  ? -0.952  5.141   -6.852  1.00 0.00 ? 45  THR A CB   4  
ATOM 5729  O OG1  . THR A 1 45  ? -1.485  5.789   -5.692  1.00 0.00 ? 45  THR A OG1  4  
ATOM 5730  C CG2  . THR A 1 45  ? -1.115  6.046   -8.064  1.00 0.00 ? 45  THR A CG2  4  
ATOM 5731  H H    . THR A 1 45  ? -3.463  4.519   -6.233  1.00 0.00 ? 45  THR A H    4  
ATOM 5732  H HA   . THR A 1 45  ? -1.462  3.467   -8.086  1.00 0.00 ? 45  THR A HA   4  
ATOM 5733  H HB   . THR A 1 45  ? 0.102   4.955   -6.699  1.00 0.00 ? 45  THR A HB   4  
ATOM 5734  H HG1  . THR A 1 45  ? -0.867  6.458   -5.386  1.00 0.00 ? 45  THR A HG1  4  
ATOM 5735  H HG21 . THR A 1 45  ? -1.667  6.930   -7.782  1.00 0.00 ? 45  THR A HG21 4  
ATOM 5736  H HG22 . THR A 1 45  ? -1.652  5.517   -8.838  1.00 0.00 ? 45  THR A HG22 4  
ATOM 5737  H HG23 . THR A 1 45  ? -0.141  6.332   -8.433  1.00 0.00 ? 45  THR A HG23 4  
ATOM 5738  N N    . ILE A 1 46  ? -0.579  1.666   -6.645  1.00 0.00 ? 46  ILE A N    4  
ATOM 5739  C CA   . ILE A 1 46  ? -0.002  0.609   -5.825  1.00 0.00 ? 46  ILE A CA   4  
ATOM 5740  C C    . ILE A 1 46  ? 1.148   -0.084  -6.548  1.00 0.00 ? 46  ILE A C    4  
ATOM 5741  O O    . ILE A 1 46  ? 0.957   -0.686  -7.604  1.00 0.00 ? 46  ILE A O    4  
ATOM 5742  C CB   . ILE A 1 46  ? -1.059  -0.443  -5.439  1.00 0.00 ? 46  ILE A CB   4  
ATOM 5743  C CG1  . ILE A 1 46  ? -2.206  0.213   -4.668  1.00 0.00 ? 46  ILE A CG1  4  
ATOM 5744  C CG2  . ILE A 1 46  ? -0.425  -1.552  -4.612  1.00 0.00 ? 46  ILE A CG2  4  
ATOM 5745  C CD1  . ILE A 1 46  ? -3.430  -0.667  -4.541  1.00 0.00 ? 46  ILE A CD1  4  
ATOM 5746  H H    . ILE A 1 46  ? -0.586  1.565   -7.620  1.00 0.00 ? 46  ILE A H    4  
ATOM 5747  H HA   . ILE A 1 46  ? 0.376   1.059   -4.918  1.00 0.00 ? 46  ILE A HA   4  
ATOM 5748  H HB   . ILE A 1 46  ? -1.447  -0.881  -6.346  1.00 0.00 ? 46  ILE A HB   4  
ATOM 5749  H HG12 . ILE A 1 46  ? -1.870  0.459   -3.673  1.00 0.00 ? 46  ILE A HG12 4  
ATOM 5750  H HG13 . ILE A 1 46  ? -2.500  1.119   -5.178  1.00 0.00 ? 46  ILE A HG13 4  
ATOM 5751  H HG21 . ILE A 1 46  ? 0.618   -1.647  -4.876  1.00 0.00 ? 46  ILE A HG21 4  
ATOM 5752  H HG22 . ILE A 1 46  ? -0.509  -1.311  -3.563  1.00 0.00 ? 46  ILE A HG22 4  
ATOM 5753  H HG23 . ILE A 1 46  ? -0.932  -2.484  -4.810  1.00 0.00 ? 46  ILE A HG23 4  
ATOM 5754  H HD11 . ILE A 1 46  ? -4.294  -0.140  -4.917  1.00 0.00 ? 46  ILE A HD11 4  
ATOM 5755  H HD12 . ILE A 1 46  ? -3.283  -1.573  -5.110  1.00 0.00 ? 46  ILE A HD12 4  
ATOM 5756  H HD13 . ILE A 1 46  ? -3.587  -0.917  -3.501  1.00 0.00 ? 46  ILE A HD13 4  
ATOM 5757  N N    . ALA A 1 47  ? 2.342   0.005   -5.971  1.00 0.00 ? 47  ALA A N    4  
ATOM 5758  C CA   . ALA A 1 47  ? 3.522   -0.616  -6.559  1.00 0.00 ? 47  ALA A CA   4  
ATOM 5759  C C    . ALA A 1 47  ? 3.378   -2.134  -6.606  1.00 0.00 ? 47  ALA A C    4  
ATOM 5760  O O    . ALA A 1 47  ? 3.517   -2.747  -7.664  1.00 0.00 ? 47  ALA A O    4  
ATOM 5761  C CB   . ALA A 1 47  ? 4.768   -0.227  -5.777  1.00 0.00 ? 47  ALA A CB   4  
ATOM 5762  H H    . ALA A 1 47  ? 2.430   0.499   -5.130  1.00 0.00 ? 47  ALA A H    4  
ATOM 5763  H HA   . ALA A 1 47  ? 3.628   -0.243  -7.568  1.00 0.00 ? 47  ALA A HA   4  
ATOM 5764  H HB1  . ALA A 1 47  ? 4.495   0.002   -4.757  1.00 0.00 ? 47  ALA A HB1  4  
ATOM 5765  H HB2  . ALA A 1 47  ? 5.470   -1.047  -5.787  1.00 0.00 ? 47  ALA A HB2  4  
ATOM 5766  H HB3  . ALA A 1 47  ? 5.221   0.641   -6.232  1.00 0.00 ? 47  ALA A HB3  4  
ATOM 5767  N N    . ASN A 1 48  ? 3.099   -2.733  -5.454  1.00 0.00 ? 48  ASN A N    4  
ATOM 5768  C CA   . ASN A 1 48  ? 2.938   -4.180  -5.364  1.00 0.00 ? 48  ASN A CA   4  
ATOM 5769  C C    . ASN A 1 48  ? 2.541   -4.596  -3.951  1.00 0.00 ? 48  ASN A C    4  
ATOM 5770  O O    . ASN A 1 48  ? 2.309   -3.752  -3.086  1.00 0.00 ? 48  ASN A O    4  
ATOM 5771  C CB   . ASN A 1 48  ? 4.233   -4.885  -5.771  1.00 0.00 ? 48  ASN A CB   4  
ATOM 5772  C CG   . ASN A 1 48  ? 5.451   -3.996  -5.608  1.00 0.00 ? 48  ASN A CG   4  
ATOM 5773  O OD1  . ASN A 1 48  ? 5.901   -3.361  -6.562  1.00 0.00 ? 48  ASN A OD1  4  
ATOM 5774  N ND2  . ASN A 1 48  ? 5.990   -3.947  -4.396  1.00 0.00 ? 48  ASN A ND2  4  
ATOM 5775  H H    . ASN A 1 48  ? 3.000   -2.190  -4.644  1.00 0.00 ? 48  ASN A H    4  
ATOM 5776  H HA   . ASN A 1 48  ? 2.152   -4.468  -6.046  1.00 0.00 ? 48  ASN A HA   4  
ATOM 5777  H HB2  . ASN A 1 48  ? 4.368   -5.762  -5.154  1.00 0.00 ? 48  ASN A HB2  4  
ATOM 5778  H HB3  . ASN A 1 48  ? 4.164   -5.184  -6.806  1.00 0.00 ? 48  ASN A HB3  4  
ATOM 5779  H HD21 . ASN A 1 48  ? 5.578   -4.479  -3.684  1.00 0.00 ? 48  ASN A HD21 4  
ATOM 5780  H HD22 . ASN A 1 48  ? 6.778   -3.379  -4.262  1.00 0.00 ? 48  ASN A HD22 4  
ATOM 5781  N N    . TYR A 1 49  ? 2.466   -5.903  -3.725  1.00 0.00 ? 49  TYR A N    4  
ATOM 5782  C CA   . TYR A 1 49  ? 2.096   -6.432  -2.417  1.00 0.00 ? 49  TYR A CA   4  
ATOM 5783  C C    . TYR A 1 49  ? 3.241   -7.237  -1.811  1.00 0.00 ? 49  TYR A C    4  
ATOM 5784  O O    . TYR A 1 49  ? 4.078   -7.783  -2.529  1.00 0.00 ? 49  TYR A O    4  
ATOM 5785  C CB   . TYR A 1 49  ? 0.848   -7.309  -2.534  1.00 0.00 ? 49  TYR A CB   4  
ATOM 5786  C CG   . TYR A 1 49  ? -0.428  -6.523  -2.733  1.00 0.00 ? 49  TYR A CG   4  
ATOM 5787  C CD1  . TYR A 1 49  ? -0.808  -6.086  -3.996  1.00 0.00 ? 49  TYR A CD1  4  
ATOM 5788  C CD2  . TYR A 1 49  ? -1.254  -6.218  -1.658  1.00 0.00 ? 49  TYR A CD2  4  
ATOM 5789  C CE1  . TYR A 1 49  ? -1.973  -5.367  -4.182  1.00 0.00 ? 49  TYR A CE1  4  
ATOM 5790  C CE2  . TYR A 1 49  ? -2.422  -5.500  -1.835  1.00 0.00 ? 49  TYR A CE2  4  
ATOM 5791  C CZ   . TYR A 1 49  ? -2.776  -5.077  -3.099  1.00 0.00 ? 49  TYR A CZ   4  
ATOM 5792  O OH   . TYR A 1 49  ? -3.938  -4.362  -3.280  1.00 0.00 ? 49  TYR A OH   4  
ATOM 5793  H H    . TYR A 1 49  ? 2.663   -6.527  -4.454  1.00 0.00 ? 49  TYR A H    4  
ATOM 5794  H HA   . TYR A 1 49  ? 1.877   -5.595  -1.771  1.00 0.00 ? 49  TYR A HA   4  
ATOM 5795  H HB2  . TYR A 1 49  ? 0.961   -7.975  -3.375  1.00 0.00 ? 49  TYR A HB2  4  
ATOM 5796  H HB3  . TYR A 1 49  ? 0.741   -7.893  -1.631  1.00 0.00 ? 49  TYR A HB3  4  
ATOM 5797  H HD1  . TYR A 1 49  ? -0.177  -6.315  -4.842  1.00 0.00 ? 49  TYR A HD1  4  
ATOM 5798  H HD2  . TYR A 1 49  ? -0.974  -6.551  -0.669  1.00 0.00 ? 49  TYR A HD2  4  
ATOM 5799  H HE1  . TYR A 1 49  ? -2.251  -5.035  -5.171  1.00 0.00 ? 49  TYR A HE1  4  
ATOM 5800  H HE2  . TYR A 1 49  ? -3.051  -5.273  -0.987  1.00 0.00 ? 49  TYR A HE2  4  
ATOM 5801  H HH   . TYR A 1 49  ? -4.196  -4.400  -4.204  1.00 0.00 ? 49  TYR A HH   4  
ATOM 5802  N N    . GLU A 1 50  ? 3.270   -7.305  -0.484  1.00 0.00 ? 50  GLU A N    4  
ATOM 5803  C CA   . GLU A 1 50  ? 4.313   -8.042  0.220   1.00 0.00 ? 50  GLU A CA   4  
ATOM 5804  C C    . GLU A 1 50  ? 3.718   -9.202  1.014   1.00 0.00 ? 50  GLU A C    4  
ATOM 5805  O O    . GLU A 1 50  ? 2.798   -9.016  1.812   1.00 0.00 ? 50  GLU A O    4  
ATOM 5806  C CB   . GLU A 1 50  ? 5.084   -7.110  1.158   1.00 0.00 ? 50  GLU A CB   4  
ATOM 5807  C CG   . GLU A 1 50  ? 6.529   -7.526  1.376   1.00 0.00 ? 50  GLU A CG   4  
ATOM 5808  C CD   . GLU A 1 50  ? 7.458   -6.988  0.305   1.00 0.00 ? 50  GLU A CD   4  
ATOM 5809  O OE1  . GLU A 1 50  ? 7.207   -7.259  -0.888  1.00 0.00 ? 50  GLU A OE1  4  
ATOM 5810  O OE2  . GLU A 1 50  ? 8.436   -6.298  0.659   1.00 0.00 ? 50  GLU A OE2  4  
ATOM 5811  H H    . GLU A 1 50  ? 2.575   -6.848  0.034   1.00 0.00 ? 50  GLU A H    4  
ATOM 5812  H HA   . GLU A 1 50  ? 4.994   -8.439  -0.517  1.00 0.00 ? 50  GLU A HA   4  
ATOM 5813  H HB2  . GLU A 1 50  ? 5.075   -6.114  0.742   1.00 0.00 ? 50  GLU A HB2  4  
ATOM 5814  H HB3  . GLU A 1 50  ? 4.587   -7.094  2.117   1.00 0.00 ? 50  GLU A HB3  4  
ATOM 5815  H HG2  . GLU A 1 50  ? 6.856   -7.153  2.335   1.00 0.00 ? 50  GLU A HG2  4  
ATOM 5816  H HG3  . GLU A 1 50  ? 6.585   -8.604  1.372   1.00 0.00 ? 50  GLU A HG3  4  
ATOM 5817  N N    . LEU A 1 51  ? 4.249   -10.399 0.790   1.00 0.00 ? 51  LEU A N    4  
ATOM 5818  C CA   . LEU A 1 51  ? 3.771   -11.590 1.483   1.00 0.00 ? 51  LEU A CA   4  
ATOM 5819  C C    . LEU A 1 51  ? 4.860   -12.174 2.377   1.00 0.00 ? 51  LEU A C    4  
ATOM 5820  O O    . LEU A 1 51  ? 5.837   -12.745 1.891   1.00 0.00 ? 51  LEU A O    4  
ATOM 5821  C CB   . LEU A 1 51  ? 3.307   -12.640 0.473   1.00 0.00 ? 51  LEU A CB   4  
ATOM 5822  C CG   . LEU A 1 51  ? 3.230   -14.078 0.987   1.00 0.00 ? 51  LEU A CG   4  
ATOM 5823  C CD1  . LEU A 1 51  ? 2.018   -14.258 1.889   1.00 0.00 ? 51  LEU A CD1  4  
ATOM 5824  C CD2  . LEU A 1 51  ? 3.181   -15.059 -0.176  1.00 0.00 ? 51  LEU A CD2  4  
ATOM 5825  H H    . LEU A 1 51  ? 4.979   -10.484 0.143   1.00 0.00 ? 51  LEU A H    4  
ATOM 5826  H HA   . LEU A 1 51  ? 2.933   -11.300 2.100   1.00 0.00 ? 51  LEU A HA   4  
ATOM 5827  H HB2  . LEU A 1 51  ? 2.323   -12.358 0.131   1.00 0.00 ? 51  LEU A HB2  4  
ATOM 5828  H HB3  . LEU A 1 51  ? 3.995   -12.623 -0.361  1.00 0.00 ? 51  LEU A HB3  4  
ATOM 5829  H HG   . LEU A 1 51  ? 4.114   -14.294 1.570   1.00 0.00 ? 51  LEU A HG   4  
ATOM 5830  H HD11 . LEU A 1 51  ? 1.673   -13.292 2.225   1.00 0.00 ? 51  LEU A HD11 4  
ATOM 5831  H HD12 . LEU A 1 51  ? 2.292   -14.859 2.744   1.00 0.00 ? 51  LEU A HD12 4  
ATOM 5832  H HD13 . LEU A 1 51  ? 1.231   -14.752 1.340   1.00 0.00 ? 51  LEU A HD13 4  
ATOM 5833  H HD21 . LEU A 1 51  ? 3.485   -14.557 -1.082  1.00 0.00 ? 51  LEU A HD21 4  
ATOM 5834  H HD22 . LEU A 1 51  ? 2.173   -15.430 -0.291  1.00 0.00 ? 51  LEU A HD22 4  
ATOM 5835  H HD23 . LEU A 1 51  ? 3.849   -15.884 0.021   1.00 0.00 ? 51  LEU A HD23 4  
ATOM 5836  N N    . VAL A 1 52  ? 4.686   -12.028 3.687   1.00 0.00 ? 52  VAL A N    4  
ATOM 5837  C CA   . VAL A 1 52  ? 5.652   -12.543 4.649   1.00 0.00 ? 52  VAL A CA   4  
ATOM 5838  C C    . VAL A 1 52  ? 5.260   -13.936 5.129   1.00 0.00 ? 52  VAL A C    4  
ATOM 5839  O O    . VAL A 1 52  ? 4.443   -14.084 6.038   1.00 0.00 ? 52  VAL A O    4  
ATOM 5840  C CB   . VAL A 1 52  ? 5.783   -11.610 5.867   1.00 0.00 ? 52  VAL A CB   4  
ATOM 5841  C CG1  . VAL A 1 52  ? 6.776   -12.178 6.870   1.00 0.00 ? 52  VAL A CG1  4  
ATOM 5842  C CG2  . VAL A 1 52  ? 6.197   -10.214 5.427   1.00 0.00 ? 52  VAL A CG2  4  
ATOM 5843  H H    . VAL A 1 52  ? 3.887   -11.563 4.013   1.00 0.00 ? 52  VAL A H    4  
ATOM 5844  H HA   . VAL A 1 52  ? 6.614   -12.599 4.159   1.00 0.00 ? 52  VAL A HA   4  
ATOM 5845  H HB   . VAL A 1 52  ? 4.819   -11.542 6.349   1.00 0.00 ? 52  VAL A HB   4  
ATOM 5846  H HG11 . VAL A 1 52  ? 7.578   -12.672 6.342   1.00 0.00 ? 52  VAL A HG11 4  
ATOM 5847  H HG12 . VAL A 1 52  ? 7.180   -11.376 7.471   1.00 0.00 ? 52  VAL A HG12 4  
ATOM 5848  H HG13 . VAL A 1 52  ? 6.275   -12.890 7.509   1.00 0.00 ? 52  VAL A HG13 4  
ATOM 5849  H HG21 . VAL A 1 52  ? 7.216   -10.238 5.069   1.00 0.00 ? 52  VAL A HG21 4  
ATOM 5850  H HG22 . VAL A 1 52  ? 5.545   -9.878  4.633   1.00 0.00 ? 52  VAL A HG22 4  
ATOM 5851  H HG23 . VAL A 1 52  ? 6.124   -9.536  6.263   1.00 0.00 ? 52  VAL A HG23 4  
ATOM 5852  N N    . TYR A 1 53  ? 5.848   -14.955 4.513   1.00 0.00 ? 53  TYR A N    4  
ATOM 5853  C CA   . TYR A 1 53  ? 5.559   -16.338 4.876   1.00 0.00 ? 53  TYR A CA   4  
ATOM 5854  C C    . TYR A 1 53  ? 6.743   -16.970 5.600   1.00 0.00 ? 53  TYR A C    4  
ATOM 5855  O O    . TYR A 1 53  ? 7.895   -16.598 5.374   1.00 0.00 ? 53  TYR A O    4  
ATOM 5856  C CB   . TYR A 1 53  ? 5.215   -17.153 3.628   1.00 0.00 ? 53  TYR A CB   4  
ATOM 5857  C CG   . TYR A 1 53  ? 6.426   -17.719 2.922   1.00 0.00 ? 53  TYR A CG   4  
ATOM 5858  C CD1  . TYR A 1 53  ? 7.233   -16.912 2.129   1.00 0.00 ? 53  TYR A CD1  4  
ATOM 5859  C CD2  . TYR A 1 53  ? 6.764   -19.061 3.048   1.00 0.00 ? 53  TYR A CD2  4  
ATOM 5860  C CE1  . TYR A 1 53  ? 8.340   -17.426 1.482   1.00 0.00 ? 53  TYR A CE1  4  
ATOM 5861  C CE2  . TYR A 1 53  ? 7.870   -19.583 2.405   1.00 0.00 ? 53  TYR A CE2  4  
ATOM 5862  C CZ   . TYR A 1 53  ? 8.654   -18.761 1.623   1.00 0.00 ? 53  TYR A CZ   4  
ATOM 5863  O OH   . TYR A 1 53  ? 9.757   -19.276 0.980   1.00 0.00 ? 53  TYR A OH   4  
ATOM 5864  H H    . TYR A 1 53  ? 6.490   -14.774 3.795   1.00 0.00 ? 53  TYR A H    4  
ATOM 5865  H HA   . TYR A 1 53  ? 4.706   -16.335 5.538   1.00 0.00 ? 53  TYR A HA   4  
ATOM 5866  H HB2  . TYR A 1 53  ? 4.580   -17.979 3.910   1.00 0.00 ? 53  TYR A HB2  4  
ATOM 5867  H HB3  . TYR A 1 53  ? 4.687   -16.522 2.928   1.00 0.00 ? 53  TYR A HB3  4  
ATOM 5868  H HD1  . TYR A 1 53  ? 6.984   -15.867 2.021   1.00 0.00 ? 53  TYR A HD1  4  
ATOM 5869  H HD2  . TYR A 1 53  ? 6.148   -19.702 3.662   1.00 0.00 ? 53  TYR A HD2  4  
ATOM 5870  H HE1  . TYR A 1 53  ? 8.954   -16.782 0.869   1.00 0.00 ? 53  TYR A HE1  4  
ATOM 5871  H HE2  . TYR A 1 53  ? 8.117   -20.628 2.515   1.00 0.00 ? 53  TYR A HE2  4  
ATOM 5872  H HH   . TYR A 1 53  ? 9.786   -20.227 1.108   1.00 0.00 ? 53  TYR A HH   4  
ATOM 5873  N N    . LYS A 1 54  ? 6.452   -17.929 6.472   1.00 0.00 ? 54  LYS A N    4  
ATOM 5874  C CA   . LYS A 1 54  ? 7.490   -18.617 7.229   1.00 0.00 ? 54  LYS A CA   4  
ATOM 5875  C C    . LYS A 1 54  ? 7.092   -20.062 7.512   1.00 0.00 ? 54  LYS A C    4  
ATOM 5876  O O    . LYS A 1 54  ? 5.952   -20.339 7.888   1.00 0.00 ? 54  LYS A O    4  
ATOM 5877  C CB   . LYS A 1 54  ? 7.760   -17.884 8.546   1.00 0.00 ? 54  LYS A CB   4  
ATOM 5878  C CG   . LYS A 1 54  ? 6.560   -17.843 9.476   1.00 0.00 ? 54  LYS A CG   4  
ATOM 5879  C CD   . LYS A 1 54  ? 6.822   -16.962 10.686  1.00 0.00 ? 54  LYS A CD   4  
ATOM 5880  C CE   . LYS A 1 54  ? 5.640   -16.962 11.642  1.00 0.00 ? 54  LYS A CE   4  
ATOM 5881  N NZ   . LYS A 1 54  ? 5.906   -16.138 12.854  1.00 0.00 ? 54  LYS A NZ   4  
ATOM 5882  H H    . LYS A 1 54  ? 5.514   -18.182 6.608   1.00 0.00 ? 54  LYS A H    4  
ATOM 5883  H HA   . LYS A 1 54  ? 8.391   -18.614 6.635   1.00 0.00 ? 54  LYS A HA   4  
ATOM 5884  H HB2  . LYS A 1 54  ? 8.571   -18.379 9.060   1.00 0.00 ? 54  LYS A HB2  4  
ATOM 5885  H HB3  . LYS A 1 54  ? 8.053   -16.868 8.324   1.00 0.00 ? 54  LYS A HB3  4  
ATOM 5886  H HG2  . LYS A 1 54  ? 5.711   -17.451 8.936   1.00 0.00 ? 54  LYS A HG2  4  
ATOM 5887  H HG3  . LYS A 1 54  ? 6.343   -18.847 9.813   1.00 0.00 ? 54  LYS A HG3  4  
ATOM 5888  H HD2  . LYS A 1 54  ? 7.693   -17.332 11.208  1.00 0.00 ? 54  LYS A HD2  4  
ATOM 5889  H HD3  . LYS A 1 54  ? 7.004   -15.950 10.351  1.00 0.00 ? 54  LYS A HD3  4  
ATOM 5890  H HE2  . LYS A 1 54  ? 4.778   -16.563 11.129  1.00 0.00 ? 54  LYS A HE2  4  
ATOM 5891  H HE3  . LYS A 1 54  ? 5.439   -17.979 11.945  1.00 0.00 ? 54  LYS A HE3  4  
ATOM 5892  H HZ1  . LYS A 1 54  ? 6.859   -16.338 13.219  1.00 0.00 ? 54  LYS A HZ1  4  
ATOM 5893  H HZ2  . LYS A 1 54  ? 5.210   -16.357 13.595  1.00 0.00 ? 54  LYS A HZ2  4  
ATOM 5894  H HZ3  . LYS A 1 54  ? 5.841   -15.127 12.620  1.00 0.00 ? 54  LYS A HZ3  4  
ATOM 5895  N N    . ASP A 1 55  ? 8.036   -20.978 7.331   1.00 0.00 ? 55  ASP A N    4  
ATOM 5896  C CA   . ASP A 1 55  ? 7.784   -22.394 7.569   1.00 0.00 ? 55  ASP A CA   4  
ATOM 5897  C C    . ASP A 1 55  ? 7.267   -22.623 8.986   1.00 0.00 ? 55  ASP A C    4  
ATOM 5898  O O    . ASP A 1 55  ? 8.040   -22.647 9.943   1.00 0.00 ? 55  ASP A O    4  
ATOM 5899  C CB   . ASP A 1 55  ? 9.059   -23.207 7.340   1.00 0.00 ? 55  ASP A CB   4  
ATOM 5900  C CG   . ASP A 1 55  ? 9.117   -24.450 8.206   1.00 0.00 ? 55  ASP A CG   4  
ATOM 5901  O OD1  . ASP A 1 55  ? 8.073   -25.119 8.355   1.00 0.00 ? 55  ASP A OD1  4  
ATOM 5902  O OD2  . ASP A 1 55  ? 10.206  -24.753 8.735   1.00 0.00 ? 55  ASP A OD2  4  
ATOM 5903  H H    . ASP A 1 55  ? 8.925   -20.694 7.030   1.00 0.00 ? 55  ASP A H    4  
ATOM 5904  H HA   . ASP A 1 55  ? 7.030   -22.719 6.868   1.00 0.00 ? 55  ASP A HA   4  
ATOM 5905  H HB2  . ASP A 1 55  ? 9.103   -23.511 6.304   1.00 0.00 ? 55  ASP A HB2  4  
ATOM 5906  H HB3  . ASP A 1 55  ? 9.916   -22.591 7.567   1.00 0.00 ? 55  ASP A HB3  4  
ATOM 5907  N N    . GLY A 1 56  ? 5.954   -22.790 9.112   1.00 0.00 ? 56  GLY A N    4  
ATOM 5908  C CA   . GLY A 1 56  ? 5.357   -23.013 10.416  1.00 0.00 ? 56  GLY A CA   4  
ATOM 5909  C C    . GLY A 1 56  ? 5.523   -21.825 11.341  1.00 0.00 ? 56  GLY A C    4  
ATOM 5910  O O    . GLY A 1 56  ? 5.426   -20.676 10.910  1.00 0.00 ? 56  GLY A O    4  
ATOM 5911  H H    . GLY A 1 56  ? 5.387   -22.761 8.314   1.00 0.00 ? 56  GLY A H    4  
ATOM 5912  H HA2  . GLY A 1 56  ? 4.303   -23.212 10.288  1.00 0.00 ? 56  GLY A HA2  4  
ATOM 5913  H HA3  . GLY A 1 56  ? 5.823   -23.876 10.869  1.00 0.00 ? 56  GLY A HA3  4  
ATOM 5914  N N    . GLU A 1 57  ? 5.773   -22.100 12.618  1.00 0.00 ? 57  GLU A N    4  
ATOM 5915  C CA   . GLU A 1 57  ? 5.951   -21.044 13.606  1.00 0.00 ? 57  GLU A CA   4  
ATOM 5916  C C    . GLU A 1 57  ? 7.425   -20.676 13.752  1.00 0.00 ? 57  GLU A C    4  
ATOM 5917  O O    . GLU A 1 57  ? 7.775   -19.502 13.875  1.00 0.00 ? 57  GLU A O    4  
ATOM 5918  C CB   . GLU A 1 57  ? 5.387   -21.481 14.960  1.00 0.00 ? 57  GLU A CB   4  
ATOM 5919  C CG   . GLU A 1 57  ? 3.883   -21.693 14.953  1.00 0.00 ? 57  GLU A CG   4  
ATOM 5920  C CD   . GLU A 1 57  ? 3.399   -22.483 16.153  1.00 0.00 ? 57  GLU A CD   4  
ATOM 5921  O OE1  . GLU A 1 57  ? 3.421   -23.730 16.091  1.00 0.00 ? 57  GLU A OE1  4  
ATOM 5922  O OE2  . GLU A 1 57  ? 2.999   -21.854 17.155  1.00 0.00 ? 57  GLU A OE2  4  
ATOM 5923  H H    . GLU A 1 57  ? 5.840   -23.036 12.901  1.00 0.00 ? 57  GLU A H    4  
ATOM 5924  H HA   . GLU A 1 57  ? 5.408   -20.175 13.265  1.00 0.00 ? 57  GLU A HA   4  
ATOM 5925  H HB2  . GLU A 1 57  ? 5.860   -22.407 15.251  1.00 0.00 ? 57  GLU A HB2  4  
ATOM 5926  H HB3  . GLU A 1 57  ? 5.619   -20.723 15.694  1.00 0.00 ? 57  GLU A HB3  4  
ATOM 5927  H HG2  . GLU A 1 57  ? 3.396   -20.729 14.956  1.00 0.00 ? 57  GLU A HG2  4  
ATOM 5928  H HG3  . GLU A 1 57  ? 3.612   -22.229 14.055  1.00 0.00 ? 57  GLU A HG3  4  
ATOM 5929  N N    . HIS A 1 58  ? 8.285   -21.690 13.737  1.00 0.00 ? 58  HIS A N    4  
ATOM 5930  C CA   . HIS A 1 58  ? 9.722   -21.475 13.867  1.00 0.00 ? 58  HIS A CA   4  
ATOM 5931  C C    . HIS A 1 58  ? 10.333  -21.060 12.531  1.00 0.00 ? 58  HIS A C    4  
ATOM 5932  O O    . HIS A 1 58  ? 11.505  -20.694 12.460  1.00 0.00 ? 58  HIS A O    4  
ATOM 5933  C CB   . HIS A 1 58  ? 10.405  -22.743 14.381  1.00 0.00 ? 58  HIS A CB   4  
ATOM 5934  C CG   . HIS A 1 58  ? 10.350  -22.890 15.871  1.00 0.00 ? 58  HIS A CG   4  
ATOM 5935  N ND1  . HIS A 1 58  ? 11.469  -22.838 16.674  1.00 0.00 ? 58  HIS A ND1  4  
ATOM 5936  C CD2  . HIS A 1 58  ? 9.300   -23.088 16.703  1.00 0.00 ? 58  HIS A CD2  4  
ATOM 5937  C CE1  . HIS A 1 58  ? 11.111  -22.999 17.935  1.00 0.00 ? 58  HIS A CE1  4  
ATOM 5938  N NE2  . HIS A 1 58  ? 9.800   -23.152 17.980  1.00 0.00 ? 58  HIS A NE2  4  
ATOM 5939  H H    . HIS A 1 58  ? 7.946   -22.603 13.635  1.00 0.00 ? 58  HIS A H    4  
ATOM 5940  H HA   . HIS A 1 58  ? 9.875   -20.679 14.580  1.00 0.00 ? 58  HIS A HA   4  
ATOM 5941  H HB2  . HIS A 1 58  ? 9.922   -23.605 13.945  1.00 0.00 ? 58  HIS A HB2  4  
ATOM 5942  H HB3  . HIS A 1 58  ? 11.444  -22.729 14.086  1.00 0.00 ? 58  HIS A HB3  4  
ATOM 5943  H HD1  . HIS A 1 58  ? 12.389  -22.704 16.365  1.00 0.00 ? 58  HIS A HD1  4  
ATOM 5944  H HD2  . HIS A 1 58  ? 8.262   -23.179 16.416  1.00 0.00 ? 58  HIS A HD2  4  
ATOM 5945  H HE1  . HIS A 1 58  ? 11.777  -23.003 18.786  1.00 0.00 ? 58  HIS A HE1  4  
ATOM 5946  H HE2  . HIS A 1 58  ? 9.285   -23.374 18.783  1.00 0.00 ? 58  HIS A HE2  4  
ATOM 5947  N N    . GLY A 1 59  ? 9.529   -21.121 11.474  1.00 0.00 ? 59  GLY A N    4  
ATOM 5948  C CA   . GLY A 1 59  ? 10.008  -20.750 10.155  1.00 0.00 ? 59  GLY A CA   4  
ATOM 5949  C C    . GLY A 1 59  ? 10.599  -19.355 10.124  1.00 0.00 ? 59  GLY A C    4  
ATOM 5950  O O    . GLY A 1 59  ? 10.279  -18.520 10.971  1.00 0.00 ? 59  GLY A O    4  
ATOM 5951  H H    . GLY A 1 59  ? 8.603   -21.421 11.590  1.00 0.00 ? 59  GLY A H    4  
ATOM 5952  H HA2  . GLY A 1 59  ? 10.764  -21.457 9.847   1.00 0.00 ? 59  GLY A HA2  4  
ATOM 5953  H HA3  . GLY A 1 59  ? 9.183   -20.795 9.460   1.00 0.00 ? 59  GLY A HA3  4  
ATOM 5954  N N    . GLU A 1 60  ? 11.464  -19.101 9.147   1.00 0.00 ? 60  GLU A N    4  
ATOM 5955  C CA   . GLU A 1 60  ? 12.102  -17.797 9.012   1.00 0.00 ? 60  GLU A CA   4  
ATOM 5956  C C    . GLU A 1 60  ? 11.266  -16.870 8.135   1.00 0.00 ? 60  GLU A C    4  
ATOM 5957  O O    . GLU A 1 60  ? 10.838  -17.250 7.045   1.00 0.00 ? 60  GLU A O    4  
ATOM 5958  C CB   . GLU A 1 60  ? 13.505  -17.950 8.420   1.00 0.00 ? 60  GLU A CB   4  
ATOM 5959  C CG   . GLU A 1 60  ? 14.080  -16.654 7.874   1.00 0.00 ? 60  GLU A CG   4  
ATOM 5960  C CD   . GLU A 1 60  ? 15.592  -16.602 7.967   1.00 0.00 ? 60  GLU A CD   4  
ATOM 5961  O OE1  . GLU A 1 60  ? 16.123  -16.730 9.090   1.00 0.00 ? 60  GLU A OE1  4  
ATOM 5962  O OE2  . GLU A 1 60  ? 16.245  -16.433 6.916   1.00 0.00 ? 60  GLU A OE2  4  
ATOM 5963  H H    . GLU A 1 60  ? 11.678  -19.808 8.503   1.00 0.00 ? 60  GLU A H    4  
ATOM 5964  H HA   . GLU A 1 60  ? 12.183  -17.364 9.998   1.00 0.00 ? 60  GLU A HA   4  
ATOM 5965  H HB2  . GLU A 1 60  ? 14.168  -18.320 9.187   1.00 0.00 ? 60  GLU A HB2  4  
ATOM 5966  H HB3  . GLU A 1 60  ? 13.465  -18.669 7.614   1.00 0.00 ? 60  GLU A HB3  4  
ATOM 5967  H HG2  . GLU A 1 60  ? 13.795  -16.557 6.838   1.00 0.00 ? 60  GLU A HG2  4  
ATOM 5968  H HG3  . GLU A 1 60  ? 13.670  -15.828 8.438   1.00 0.00 ? 60  GLU A HG3  4  
ATOM 5969  N N    . GLU A 1 61  ? 11.036  -15.654 8.620   1.00 0.00 ? 61  GLU A N    4  
ATOM 5970  C CA   . GLU A 1 61  ? 10.250  -14.674 7.880   1.00 0.00 ? 61  GLU A CA   4  
ATOM 5971  C C    . GLU A 1 61  ? 10.813  -14.471 6.477   1.00 0.00 ? 61  GLU A C    4  
ATOM 5972  O O    . GLU A 1 61  ? 11.913  -13.947 6.309   1.00 0.00 ? 61  GLU A O    4  
ATOM 5973  C CB   . GLU A 1 61  ? 10.224  -13.339 8.628   1.00 0.00 ? 61  GLU A CB   4  
ATOM 5974  C CG   . GLU A 1 61  ? 9.115   -13.242 9.663   1.00 0.00 ? 61  GLU A CG   4  
ATOM 5975  C CD   . GLU A 1 61  ? 9.542   -13.752 11.025  1.00 0.00 ? 61  GLU A CD   4  
ATOM 5976  O OE1  . GLU A 1 61  ? 9.628   -14.986 11.197  1.00 0.00 ? 61  GLU A OE1  4  
ATOM 5977  O OE2  . GLU A 1 61  ? 9.790   -12.917 11.921  1.00 0.00 ? 61  GLU A OE2  4  
ATOM 5978  H H    . GLU A 1 61  ? 11.404  -15.411 9.495   1.00 0.00 ? 61  GLU A H    4  
ATOM 5979  H HA   . GLU A 1 61  ? 9.242   -15.050 7.800   1.00 0.00 ? 61  GLU A HA   4  
ATOM 5980  H HB2  . GLU A 1 61  ? 11.170  -13.203 9.131   1.00 0.00 ? 61  GLU A HB2  4  
ATOM 5981  H HB3  . GLU A 1 61  ? 10.090  -12.542 7.912   1.00 0.00 ? 61  GLU A HB3  4  
ATOM 5982  H HG2  . GLU A 1 61  ? 8.818   -12.209 9.759   1.00 0.00 ? 61  GLU A HG2  4  
ATOM 5983  H HG3  . GLU A 1 61  ? 8.272   -13.827 9.324   1.00 0.00 ? 61  GLU A HG3  4  
ATOM 5984  N N    . GLN A 1 62  ? 10.050  -14.892 5.473   1.00 0.00 ? 62  GLN A N    4  
ATOM 5985  C CA   . GLN A 1 62  ? 10.473  -14.759 4.084   1.00 0.00 ? 62  GLN A CA   4  
ATOM 5986  C C    . GLN A 1 62  ? 9.576   -13.780 3.333   1.00 0.00 ? 62  GLN A C    4  
ATOM 5987  O O    . GLN A 1 62  ? 8.422   -14.086 3.034   1.00 0.00 ? 62  GLN A O    4  
ATOM 5988  C CB   . GLN A 1 62  ? 10.455  -16.122 3.390   1.00 0.00 ? 62  GLN A CB   4  
ATOM 5989  C CG   . GLN A 1 62  ? 11.305  -17.171 4.087   1.00 0.00 ? 62  GLN A CG   4  
ATOM 5990  C CD   . GLN A 1 62  ? 11.848  -18.213 3.128   1.00 0.00 ? 62  GLN A CD   4  
ATOM 5991  O OE1  . GLN A 1 62  ? 12.275  -17.891 2.019   1.00 0.00 ? 62  GLN A OE1  4  
ATOM 5992  N NE2  . GLN A 1 62  ? 11.833  -19.472 3.552   1.00 0.00 ? 62  GLN A NE2  4  
ATOM 5993  H H    . GLN A 1 62  ? 9.183   -15.303 5.671   1.00 0.00 ? 62  GLN A H    4  
ATOM 5994  H HA   . GLN A 1 62  ? 11.483  -14.377 4.081   1.00 0.00 ? 62  GLN A HA   4  
ATOM 5995  H HB2  . GLN A 1 62  ? 9.437   -16.480 3.354   1.00 0.00 ? 62  GLN A HB2  4  
ATOM 5996  H HB3  . GLN A 1 62  ? 10.822  -16.004 2.381   1.00 0.00 ? 62  GLN A HB3  4  
ATOM 5997  H HG2  . GLN A 1 62  ? 12.138  -16.680 4.568   1.00 0.00 ? 62  GLN A HG2  4  
ATOM 5998  H HG3  . GLN A 1 62  ? 10.702  -17.668 4.832   1.00 0.00 ? 62  GLN A HG3  4  
ATOM 5999  H HE21 . GLN A 1 62  ? 11.477  -19.655 4.447   1.00 0.00 ? 62  GLN A HE21 4  
ATOM 6000  H HE22 . GLN A 1 62  ? 12.177  -20.166 2.953   1.00 0.00 ? 62  GLN A HE22 4  
ATOM 6001  N N    . ARG A 1 63  ? 10.115  -12.603 3.033   1.00 0.00 ? 63  ARG A N    4  
ATOM 6002  C CA   . ARG A 1 63  ? 9.362   -11.578 2.319   1.00 0.00 ? 63  ARG A CA   4  
ATOM 6003  C C    . ARG A 1 63  ? 9.371   -11.846 0.817   1.00 0.00 ? 63  ARG A C    4  
ATOM 6004  O O    . ARG A 1 63  ? 10.432  -11.939 0.199   1.00 0.00 ? 63  ARG A O    4  
ATOM 6005  C CB   . ARG A 1 63  ? 9.946   -10.194 2.605   1.00 0.00 ? 63  ARG A CB   4  
ATOM 6006  C CG   . ARG A 1 63  ? 9.937   -9.821  4.078   1.00 0.00 ? 63  ARG A CG   4  
ATOM 6007  C CD   . ARG A 1 63  ? 11.088  -8.889  4.425   1.00 0.00 ? 63  ARG A CD   4  
ATOM 6008  N NE   . ARG A 1 63  ? 10.727  -7.485  4.250   1.00 0.00 ? 63  ARG A NE   4  
ATOM 6009  C CZ   . ARG A 1 63  ? 9.904   -6.831  5.061   1.00 0.00 ? 63  ARG A CZ   4  
ATOM 6010  N NH1  . ARG A 1 63  ? 9.360   -7.451  6.099   1.00 0.00 ? 63  ARG A NH1  4  
ATOM 6011  N NH2  . ARG A 1 63  ? 9.624   -5.554  4.836   1.00 0.00 ? 63  ARG A NH2  4  
ATOM 6012  H H    . ARG A 1 63  ? 11.040  -12.418 3.299   1.00 0.00 ? 63  ARG A H    4  
ATOM 6013  H HA   . ARG A 1 63  ? 8.342   -11.609 2.672   1.00 0.00 ? 63  ARG A HA   4  
ATOM 6014  H HB2  . ARG A 1 63  ? 10.969  -10.168 2.257   1.00 0.00 ? 63  ARG A HB2  4  
ATOM 6015  H HB3  . ARG A 1 63  ? 9.372   -9.456  2.066   1.00 0.00 ? 63  ARG A HB3  4  
ATOM 6016  H HG2  . ARG A 1 63  ? 9.005   -9.325  4.309   1.00 0.00 ? 63  ARG A HG2  4  
ATOM 6017  H HG3  . ARG A 1 63  ? 10.024  -10.721 4.668   1.00 0.00 ? 63  ARG A HG3  4  
ATOM 6018  H HD2  . ARG A 1 63  ? 11.368  -9.053  5.455   1.00 0.00 ? 63  ARG A HD2  4  
ATOM 6019  H HD3  . ARG A 1 63  ? 11.925  -9.119  3.783   1.00 0.00 ? 63  ARG A HD3  4  
ATOM 6020  H HE   . ARG A 1 63  ? 11.118  -7.008  3.489   1.00 0.00 ? 63  ARG A HE   4  
ATOM 6021  H HH11 . ARG A 1 63  ? 9.569   -8.413  6.272   1.00 0.00 ? 63  ARG A HH11 4  
ATOM 6022  H HH12 . ARG A 1 63  ? 8.741   -6.956  6.710   1.00 0.00 ? 63  ARG A HH12 4  
ATOM 6023  H HH21 . ARG A 1 63  ? 10.032  -5.083  4.055   1.00 0.00 ? 63  ARG A HH21 4  
ATOM 6024  H HH22 . ARG A 1 63  ? 9.004   -5.062  5.447   1.00 0.00 ? 63  ARG A HH22 4  
ATOM 6025  N N    . ILE A 1 64  ? 8.182   -11.968 0.236   1.00 0.00 ? 64  ILE A N    4  
ATOM 6026  C CA   . ILE A 1 64  ? 8.054   -12.224 -1.193  1.00 0.00 ? 64  ILE A CA   4  
ATOM 6027  C C    . ILE A 1 64  ? 7.494   -11.007 -1.921  1.00 0.00 ? 64  ILE A C    4  
ATOM 6028  O O    . ILE A 1 64  ? 6.575   -10.347 -1.436  1.00 0.00 ? 64  ILE A O    4  
ATOM 6029  C CB   . ILE A 1 64  ? 7.144   -13.436 -1.468  1.00 0.00 ? 64  ILE A CB   4  
ATOM 6030  C CG1  . ILE A 1 64  ? 7.437   -14.558 -0.471  1.00 0.00 ? 64  ILE A CG1  4  
ATOM 6031  C CG2  . ILE A 1 64  ? 7.333   -13.927 -2.896  1.00 0.00 ? 64  ILE A CG2  4  
ATOM 6032  C CD1  . ILE A 1 64  ? 6.613   -15.805 -0.704  1.00 0.00 ? 64  ILE A CD1  4  
ATOM 6033  H H    . ILE A 1 64  ? 7.373   -11.884 0.781   1.00 0.00 ? 64  ILE A H    4  
ATOM 6034  H HA   . ILE A 1 64  ? 9.038   -12.442 -1.582  1.00 0.00 ? 64  ILE A HA   4  
ATOM 6035  H HB   . ILE A 1 64  ? 6.118   -13.121 -1.354  1.00 0.00 ? 64  ILE A HB   4  
ATOM 6036  H HG12 . ILE A 1 64  ? 8.478   -14.831 -0.541  1.00 0.00 ? 64  ILE A HG12 4  
ATOM 6037  H HG13 . ILE A 1 64  ? 7.229   -14.204 0.529   1.00 0.00 ? 64  ILE A HG13 4  
ATOM 6038  H HG21 . ILE A 1 64  ? 7.586   -14.977 -2.885  1.00 0.00 ? 64  ILE A HG21 4  
ATOM 6039  H HG22 . ILE A 1 64  ? 6.417   -13.784 -3.449  1.00 0.00 ? 64  ILE A HG22 4  
ATOM 6040  H HG23 . ILE A 1 64  ? 8.129   -13.369 -3.366  1.00 0.00 ? 64  ILE A HG23 4  
ATOM 6041  H HD11 . ILE A 1 64  ? 5.864   -15.606 -1.456  1.00 0.00 ? 64  ILE A HD11 4  
ATOM 6042  H HD12 . ILE A 1 64  ? 7.257   -16.605 -1.038  1.00 0.00 ? 64  ILE A HD12 4  
ATOM 6043  H HD13 . ILE A 1 64  ? 6.129   -16.094 0.217   1.00 0.00 ? 64  ILE A HD13 4  
ATOM 6044  N N    . THR A 1 65  ? 8.053   -10.715 -3.092  1.00 0.00 ? 65  THR A N    4  
ATOM 6045  C CA   . THR A 1 65  ? 7.610   -9.578  -3.888  1.00 0.00 ? 65  THR A CA   4  
ATOM 6046  C C    . THR A 1 65  ? 6.459   -9.966  -4.808  1.00 0.00 ? 65  THR A C    4  
ATOM 6047  O O    . THR A 1 65  ? 6.646   -10.706 -5.775  1.00 0.00 ? 65  THR A O    4  
ATOM 6048  C CB   . THR A 1 65  ? 8.760   -9.005  -4.738  1.00 0.00 ? 65  THR A CB   4  
ATOM 6049  O OG1  . THR A 1 65  ? 9.866   -8.658  -3.896  1.00 0.00 ? 65  THR A OG1  4  
ATOM 6050  C CG2  . THR A 1 65  ? 8.302   -7.779  -5.513  1.00 0.00 ? 65  THR A CG2  4  
ATOM 6051  H H    . THR A 1 65  ? 8.782   -11.279 -3.426  1.00 0.00 ? 65  THR A H    4  
ATOM 6052  H HA   . THR A 1 65  ? 7.273   -8.807  -3.211  1.00 0.00 ? 65  THR A HA   4  
ATOM 6053  H HB   . THR A 1 65  ? 9.077   -9.760  -5.443  1.00 0.00 ? 65  THR A HB   4  
ATOM 6054  H HG1  . THR A 1 65  ? 9.545   -8.452  -3.015  1.00 0.00 ? 65  THR A HG1  4  
ATOM 6055  H HG21 . THR A 1 65  ? 8.957   -6.949  -5.294  1.00 0.00 ? 65  THR A HG21 4  
ATOM 6056  H HG22 . THR A 1 65  ? 7.292   -7.527  -5.223  1.00 0.00 ? 65  THR A HG22 4  
ATOM 6057  H HG23 . THR A 1 65  ? 8.331   -7.990  -6.571  1.00 0.00 ? 65  THR A HG23 4  
ATOM 6058  N N    . ILE A 1 66  ? 5.267   -9.463  -4.502  1.00 0.00 ? 66  ILE A N    4  
ATOM 6059  C CA   . ILE A 1 66  ? 4.086   -9.757  -5.303  1.00 0.00 ? 66  ILE A CA   4  
ATOM 6060  C C    . ILE A 1 66  ? 3.749   -8.595  -6.232  1.00 0.00 ? 66  ILE A C    4  
ATOM 6061  O O    . ILE A 1 66  ? 4.490   -7.616  -6.311  1.00 0.00 ? 66  ILE A O    4  
ATOM 6062  C CB   . ILE A 1 66  ? 2.865   -10.061 -4.416  1.00 0.00 ? 66  ILE A CB   4  
ATOM 6063  C CG1  . ILE A 1 66  ? 3.315   -10.633 -3.070  1.00 0.00 ? 66  ILE A CG1  4  
ATOM 6064  C CG2  . ILE A 1 66  ? 1.925   -11.027 -5.121  1.00 0.00 ? 66  ILE A CG2  4  
ATOM 6065  C CD1  . ILE A 1 66  ? 2.190   -10.783 -2.070  1.00 0.00 ? 66  ILE A CD1  4  
ATOM 6066  H H    . ILE A 1 66  ? 5.182   -8.880  -3.720  1.00 0.00 ? 66  ILE A H    4  
ATOM 6067  H HA   . ILE A 1 66  ? 4.298   -10.631 -5.901  1.00 0.00 ? 66  ILE A HA   4  
ATOM 6068  H HB   . ILE A 1 66  ? 2.332   -9.138  -4.246  1.00 0.00 ? 66  ILE A HB   4  
ATOM 6069  H HG12 . ILE A 1 66  ? 3.750   -11.607 -3.228  1.00 0.00 ? 66  ILE A HG12 4  
ATOM 6070  H HG13 . ILE A 1 66  ? 4.058   -9.977  -2.639  1.00 0.00 ? 66  ILE A HG13 4  
ATOM 6071  H HG21 . ILE A 1 66  ? 0.961   -10.559 -5.255  1.00 0.00 ? 66  ILE A HG21 4  
ATOM 6072  H HG22 . ILE A 1 66  ? 2.334   -11.288 -6.085  1.00 0.00 ? 66  ILE A HG22 4  
ATOM 6073  H HG23 . ILE A 1 66  ? 1.811   -11.920 -4.523  1.00 0.00 ? 66  ILE A HG23 4  
ATOM 6074  H HD11 . ILE A 1 66  ? 2.591   -10.741 -1.068  1.00 0.00 ? 66  ILE A HD11 4  
ATOM 6075  H HD12 . ILE A 1 66  ? 1.477   -9.985  -2.207  1.00 0.00 ? 66  ILE A HD12 4  
ATOM 6076  H HD13 . ILE A 1 66  ? 1.699   -11.734 -2.221  1.00 0.00 ? 66  ILE A HD13 4  
ATOM 6077  N N    . GLU A 1 67  ? 2.624   -8.710  -6.931  1.00 0.00 ? 67  GLU A N    4  
ATOM 6078  C CA   . GLU A 1 67  ? 2.188   -7.668  -7.853  1.00 0.00 ? 67  GLU A CA   4  
ATOM 6079  C C    . GLU A 1 67  ? 0.917   -6.992  -7.348  1.00 0.00 ? 67  GLU A C    4  
ATOM 6080  O O    . GLU A 1 67  ? 0.104   -7.589  -6.642  1.00 0.00 ? 67  GLU A O    4  
ATOM 6081  C CB   . GLU A 1 67  ? 1.947   -8.256  -9.245  1.00 0.00 ? 67  GLU A CB   4  
ATOM 6082  C CG   . GLU A 1 67  ? 0.811   -9.264  -9.292  1.00 0.00 ? 67  GLU A CG   4  
ATOM 6083  C CD   . GLU A 1 67  ? 0.923   -10.216 -10.466 1.00 0.00 ? 67  GLU A CD   4  
ATOM 6084  O OE1  . GLU A 1 67  ? 0.403   -9.885  -11.552 1.00 0.00 ? 67  GLU A OE1  4  
ATOM 6085  O OE2  . GLU A 1 67  ? 1.533   -11.293 -10.299 1.00 0.00 ? 67  GLU A OE2  4  
ATOM 6086  H H    . GLU A 1 67  ? 2.075   -9.515  -6.825  1.00 0.00 ? 67  GLU A H    4  
ATOM 6087  H HA   . GLU A 1 67  ? 2.974   -6.931  -7.915  1.00 0.00 ? 67  GLU A HA   4  
ATOM 6088  H HB2  . GLU A 1 67  ? 1.717   -7.452  -9.928  1.00 0.00 ? 67  GLU A HB2  4  
ATOM 6089  H HB3  . GLU A 1 67  ? 2.850   -8.749  -9.575  1.00 0.00 ? 67  GLU A HB3  4  
ATOM 6090  H HG2  . GLU A 1 67  ? 0.819   -9.840  -8.379  1.00 0.00 ? 67  GLU A HG2  4  
ATOM 6091  H HG3  . GLU A 1 67  ? -0.124  -8.729  -9.370  1.00 0.00 ? 67  GLU A HG3  4  
ATOM 6092  N N    . PRO A 1 68  ? 0.740   -5.714  -7.718  1.00 0.00 ? 68  PRO A N    4  
ATOM 6093  C CA   . PRO A 1 68  ? -0.429  -4.928  -7.314  1.00 0.00 ? 68  PRO A CA   4  
ATOM 6094  C C    . PRO A 1 68  ? -1.710  -5.404  -7.992  1.00 0.00 ? 68  PRO A C    4  
ATOM 6095  O O    . PRO A 1 68  ? -2.158  -4.816  -8.975  1.00 0.00 ? 68  PRO A O    4  
ATOM 6096  C CB   . PRO A 1 68  ? -0.077  -3.510  -7.771  1.00 0.00 ? 68  PRO A CB   4  
ATOM 6097  C CG   . PRO A 1 68  ? 0.885   -3.700  -8.892  1.00 0.00 ? 68  PRO A CG   4  
ATOM 6098  C CD   . PRO A 1 68  ? 1.668   -4.940  -8.559  1.00 0.00 ? 68  PRO A CD   4  
ATOM 6099  H HA   . PRO A 1 68  ? -0.564  -4.940  -6.242  1.00 0.00 ? 68  PRO A HA   4  
ATOM 6100  H HB2  . PRO A 1 68  ? -0.973  -3.002  -8.100  1.00 0.00 ? 68  PRO A HB2  4  
ATOM 6101  H HB3  . PRO A 1 68  ? 0.372   -2.966  -6.954  1.00 0.00 ? 68  PRO A HB3  4  
ATOM 6102  H HG2  . PRO A 1 68  ? 0.347   -3.834  -9.818  1.00 0.00 ? 68  PRO A HG2  4  
ATOM 6103  H HG3  . PRO A 1 68  ? 1.544   -2.847  -8.958  1.00 0.00 ? 68  PRO A HG3  4  
ATOM 6104  H HD2  . PRO A 1 68  ? 1.917   -5.482  -9.459  1.00 0.00 ? 68  PRO A HD2  4  
ATOM 6105  H HD3  . PRO A 1 68  ? 2.563   -4.685  -8.011  1.00 0.00 ? 68  PRO A HD3  4  
ATOM 6106  N N    . GLY A 1 69  ? -2.294  -6.472  -7.458  1.00 0.00 ? 69  GLY A N    4  
ATOM 6107  C CA   . GLY A 1 69  ? -3.518  -7.008  -8.024  1.00 0.00 ? 69  GLY A CA   4  
ATOM 6108  C C    . GLY A 1 69  ? -4.585  -7.251  -6.975  1.00 0.00 ? 69  GLY A C    4  
ATOM 6109  O O    . GLY A 1 69  ? -4.756  -6.450  -6.055  1.00 0.00 ? 69  GLY A O    4  
ATOM 6110  H H    . GLY A 1 69  ? -1.891  -6.900  -6.674  1.00 0.00 ? 69  GLY A H    4  
ATOM 6111  H HA2  . GLY A 1 69  ? -3.899  -6.311  -8.756  1.00 0.00 ? 69  GLY A HA2  4  
ATOM 6112  H HA3  . GLY A 1 69  ? -3.294  -7.943  -8.516  1.00 0.00 ? 69  GLY A HA3  4  
ATOM 6113  N N    . THR A 1 70  ? -5.307  -8.359  -7.112  1.00 0.00 ? 70  THR A N    4  
ATOM 6114  C CA   . THR A 1 70  ? -6.364  -8.703  -6.171  1.00 0.00 ? 70  THR A CA   4  
ATOM 6115  C C    . THR A 1 70  ? -6.198  -10.128 -5.654  1.00 0.00 ? 70  THR A C    4  
ATOM 6116  O O    . THR A 1 70  ? -6.920  -10.561 -4.756  1.00 0.00 ? 70  THR A O    4  
ATOM 6117  C CB   . THR A 1 70  ? -7.757  -8.562  -6.813  1.00 0.00 ? 70  THR A CB   4  
ATOM 6118  O OG1  . THR A 1 70  ? -7.813  -9.311  -8.032  1.00 0.00 ? 70  THR A OG1  4  
ATOM 6119  C CG2  . THR A 1 70  ? -8.077  -7.101  -7.095  1.00 0.00 ? 70  THR A CG2  4  
ATOM 6120  H H    . THR A 1 70  ? -5.123  -8.957  -7.866  1.00 0.00 ? 70  THR A H    4  
ATOM 6121  H HA   . THR A 1 70  ? -6.305  -8.019  -5.337  1.00 0.00 ? 70  THR A HA   4  
ATOM 6122  H HB   . THR A 1 70  ? -8.495  -8.950  -6.126  1.00 0.00 ? 70  THR A HB   4  
ATOM 6123  H HG1  . THR A 1 70  ? -7.702  -10.246 -7.839  1.00 0.00 ? 70  THR A HG1  4  
ATOM 6124  H HG21 . THR A 1 70  ? -8.895  -6.784  -6.466  1.00 0.00 ? 70  THR A HG21 4  
ATOM 6125  H HG22 . THR A 1 70  ? -8.355  -6.988  -8.132  1.00 0.00 ? 70  THR A HG22 4  
ATOM 6126  H HG23 . THR A 1 70  ? -7.207  -6.496  -6.888  1.00 0.00 ? 70  THR A HG23 4  
ATOM 6127  N N    . SER A 1 71  ? -5.242  -10.852 -6.227  1.00 0.00 ? 71  SER A N    4  
ATOM 6128  C CA   . SER A 1 71  ? -4.983  -12.230 -5.826  1.00 0.00 ? 71  SER A CA   4  
ATOM 6129  C C    . SER A 1 71  ? -3.590  -12.671 -6.265  1.00 0.00 ? 71  SER A C    4  
ATOM 6130  O O    . SER A 1 71  ? -2.994  -12.080 -7.166  1.00 0.00 ? 71  SER A O    4  
ATOM 6131  C CB   . SER A 1 71  ? -6.037  -13.164 -6.424  1.00 0.00 ? 71  SER A CB   4  
ATOM 6132  O OG   . SER A 1 71  ? -7.270  -13.049 -5.735  1.00 0.00 ? 71  SER A OG   4  
ATOM 6133  H H    . SER A 1 71  ? -4.700  -10.451 -6.938  1.00 0.00 ? 71  SER A H    4  
ATOM 6134  H HA   . SER A 1 71  ? -5.041  -12.279 -4.749  1.00 0.00 ? 71  SER A HA   4  
ATOM 6135  H HB2  . SER A 1 71  ? -6.193  -12.910 -7.462  1.00 0.00 ? 71  SER A HB2  4  
ATOM 6136  H HB3  . SER A 1 71  ? -5.692  -14.185 -6.352  1.00 0.00 ? 71  SER A HB3  4  
ATOM 6137  H HG   . SER A 1 71  ? -7.743  -12.275 -6.051  1.00 0.00 ? 71  SER A HG   4  
ATOM 6138  N N    . TYR A 1 72  ? -3.076  -13.712 -5.620  1.00 0.00 ? 72  TYR A N    4  
ATOM 6139  C CA   . TYR A 1 72  ? -1.752  -14.232 -5.940  1.00 0.00 ? 72  TYR A CA   4  
ATOM 6140  C C    . TYR A 1 72  ? -1.678  -15.733 -5.681  1.00 0.00 ? 72  TYR A C    4  
ATOM 6141  O O    . TYR A 1 72  ? -2.326  -16.250 -4.771  1.00 0.00 ? 72  TYR A O    4  
ATOM 6142  C CB   . TYR A 1 72  ? -0.684  -13.508 -5.118  1.00 0.00 ? 72  TYR A CB   4  
ATOM 6143  C CG   . TYR A 1 72  ? 0.702   -14.088 -5.281  1.00 0.00 ? 72  TYR A CG   4  
ATOM 6144  C CD1  . TYR A 1 72  ? 1.474   -13.790 -6.397  1.00 0.00 ? 72  TYR A CD1  4  
ATOM 6145  C CD2  . TYR A 1 72  ? 1.241   -14.932 -4.318  1.00 0.00 ? 72  TYR A CD2  4  
ATOM 6146  C CE1  . TYR A 1 72  ? 2.742   -14.318 -6.551  1.00 0.00 ? 72  TYR A CE1  4  
ATOM 6147  C CE2  . TYR A 1 72  ? 2.508   -15.464 -4.463  1.00 0.00 ? 72  TYR A CE2  4  
ATOM 6148  C CZ   . TYR A 1 72  ? 3.254   -15.154 -5.581  1.00 0.00 ? 72  TYR A CZ   4  
ATOM 6149  O OH   . TYR A 1 72  ? 4.517   -15.681 -5.729  1.00 0.00 ? 72  TYR A OH   4  
ATOM 6150  H H    . TYR A 1 72  ? -3.599  -14.142 -4.911  1.00 0.00 ? 72  TYR A H    4  
ATOM 6151  H HA   . TYR A 1 72  ? -1.569  -14.049 -6.989  1.00 0.00 ? 72  TYR A HA   4  
ATOM 6152  H HB2  . TYR A 1 72  ? -0.648  -12.473 -5.419  1.00 0.00 ? 72  TYR A HB2  4  
ATOM 6153  H HB3  . TYR A 1 72  ? -0.947  -13.565 -4.071  1.00 0.00 ? 72  TYR A HB3  4  
ATOM 6154  H HD1  . TYR A 1 72  ? 1.070   -13.135 -7.155  1.00 0.00 ? 72  TYR A HD1  4  
ATOM 6155  H HD2  . TYR A 1 72  ? 0.655   -15.173 -3.443  1.00 0.00 ? 72  TYR A HD2  4  
ATOM 6156  H HE1  . TYR A 1 72  ? 3.326   -14.076 -7.426  1.00 0.00 ? 72  TYR A HE1  4  
ATOM 6157  H HE2  . TYR A 1 72  ? 2.910   -16.119 -3.704  1.00 0.00 ? 72  TYR A HE2  4  
ATOM 6158  H HH   . TYR A 1 72  ? 4.835   -15.994 -4.879  1.00 0.00 ? 72  TYR A HH   4  
ATOM 6159  N N    . ARG A 1 73  ? -0.884  -16.428 -6.489  1.00 0.00 ? 73  ARG A N    4  
ATOM 6160  C CA   . ARG A 1 73  ? -0.725  -17.871 -6.349  1.00 0.00 ? 73  ARG A CA   4  
ATOM 6161  C C    . ARG A 1 73  ? 0.693   -18.221 -5.904  1.00 0.00 ? 73  ARG A C    4  
ATOM 6162  O O    . ARG A 1 73  ? 1.638   -18.145 -6.690  1.00 0.00 ? 73  ARG A O    4  
ATOM 6163  C CB   . ARG A 1 73  ? -1.044  -18.571 -7.670  1.00 0.00 ? 73  ARG A CB   4  
ATOM 6164  C CG   . ARG A 1 73  ? -1.238  -20.072 -7.533  1.00 0.00 ? 73  ARG A CG   4  
ATOM 6165  C CD   . ARG A 1 73  ? -2.211  -20.606 -8.573  1.00 0.00 ? 73  ARG A CD   4  
ATOM 6166  N NE   . ARG A 1 73  ? -1.539  -20.960 -9.820  1.00 0.00 ? 73  ARG A NE   4  
ATOM 6167  C CZ   . ARG A 1 73  ? -0.940  -22.127 -10.027 1.00 0.00 ? 73  ARG A CZ   4  
ATOM 6168  N NH1  . ARG A 1 73  ? -0.930  -23.049 -9.073  1.00 0.00 ? 73  ARG A NH1  4  
ATOM 6169  N NH2  . ARG A 1 73  ? -0.350  -22.375 -11.189 1.00 0.00 ? 73  ARG A NH2  4  
ATOM 6170  H H    . ARG A 1 73  ? -0.393  -15.960 -7.196  1.00 0.00 ? 73  ARG A H    4  
ATOM 6171  H HA   . ARG A 1 73  ? -1.419  -18.209 -5.595  1.00 0.00 ? 73  ARG A HA   4  
ATOM 6172  H HB2  . ARG A 1 73  ? -1.950  -18.149 -8.079  1.00 0.00 ? 73  ARG A HB2  4  
ATOM 6173  H HB3  . ARG A 1 73  ? -0.233  -18.397 -8.361  1.00 0.00 ? 73  ARG A HB3  4  
ATOM 6174  H HG2  . ARG A 1 73  ? -0.285  -20.563 -7.663  1.00 0.00 ? 73  ARG A HG2  4  
ATOM 6175  H HG3  . ARG A 1 73  ? -1.625  -20.287 -6.547  1.00 0.00 ? 73  ARG A HG3  4  
ATOM 6176  H HD2  . ARG A 1 73  ? -2.697  -21.484 -8.175  1.00 0.00 ? 73  ARG A HD2  4  
ATOM 6177  H HD3  . ARG A 1 73  ? -2.952  -19.847 -8.776  1.00 0.00 ? 73  ARG A HD3  4  
ATOM 6178  H HE   . ARG A 1 73  ? -1.535  -20.293 -10.538 1.00 0.00 ? 73  ARG A HE   4  
ATOM 6179  H HH11 . ARG A 1 73  ? -1.375  -22.865 -8.197  1.00 0.00 ? 73  ARG A HH11 4  
ATOM 6180  H HH12 . ARG A 1 73  ? -0.480  -23.928 -9.232  1.00 0.00 ? 73  ARG A HH12 4  
ATOM 6181  H HH21 . ARG A 1 73  ? -0.356  -21.683 -11.910 1.00 0.00 ? 73  ARG A HH21 4  
ATOM 6182  H HH22 . ARG A 1 73  ? 0.100   -23.254 -11.343 1.00 0.00 ? 73  ARG A HH22 4  
ATOM 6183  N N    . LEU A 1 74  ? 0.833   -18.603 -4.640  1.00 0.00 ? 74  LEU A N    4  
ATOM 6184  C CA   . LEU A 1 74  ? 2.135   -18.965 -4.090  1.00 0.00 ? 74  LEU A CA   4  
ATOM 6185  C C    . LEU A 1 74  ? 2.459   -20.428 -4.375  1.00 0.00 ? 74  LEU A C    4  
ATOM 6186  O O    . LEU A 1 74  ? 1.676   -21.321 -4.054  1.00 0.00 ? 74  LEU A O    4  
ATOM 6187  C CB   . LEU A 1 74  ? 2.163   -18.709 -2.582  1.00 0.00 ? 74  LEU A CB   4  
ATOM 6188  C CG   . LEU A 1 74  ? 3.420   -19.173 -1.846  1.00 0.00 ? 74  LEU A CG   4  
ATOM 6189  C CD1  . LEU A 1 74  ? 4.657   -18.516 -2.437  1.00 0.00 ? 74  LEU A CD1  4  
ATOM 6190  C CD2  . LEU A 1 74  ? 3.310   -18.867 -0.359  1.00 0.00 ? 74  LEU A CD2  4  
ATOM 6191  H H    . LEU A 1 74  ? 0.043   -18.644 -4.062  1.00 0.00 ? 74  LEU A H    4  
ATOM 6192  H HA   . LEU A 1 74  ? 2.879   -18.344 -4.566  1.00 0.00 ? 74  LEU A HA   4  
ATOM 6193  H HB2  . LEU A 1 74  ? 2.060   -17.647 -2.425  1.00 0.00 ? 74  LEU A HB2  4  
ATOM 6194  H HB3  . LEU A 1 74  ? 1.315   -19.219 -2.146  1.00 0.00 ? 74  LEU A HB3  4  
ATOM 6195  H HG   . LEU A 1 74  ? 3.523   -20.243 -1.961  1.00 0.00 ? 74  LEU A HG   4  
ATOM 6196  H HD11 . LEU A 1 74  ? 5.470   -18.575 -1.729  1.00 0.00 ? 74  LEU A HD11 4  
ATOM 6197  H HD12 . LEU A 1 74  ? 4.445   -17.480 -2.656  1.00 0.00 ? 74  LEU A HD12 4  
ATOM 6198  H HD13 . LEU A 1 74  ? 4.935   -19.026 -3.348  1.00 0.00 ? 74  LEU A HD13 4  
ATOM 6199  H HD21 . LEU A 1 74  ? 4.300   -18.775 0.063   1.00 0.00 ? 74  LEU A HD21 4  
ATOM 6200  H HD22 . LEU A 1 74  ? 2.782   -19.669 0.136   1.00 0.00 ? 74  LEU A HD22 4  
ATOM 6201  H HD23 . LEU A 1 74  ? 2.772   -17.941 -0.221  1.00 0.00 ? 74  LEU A HD23 4  
ATOM 6202  N N    . GLN A 1 75  ? 3.620   -20.664 -4.979  1.00 0.00 ? 75  GLN A N    4  
ATOM 6203  C CA   . GLN A 1 75  ? 4.048   -22.019 -5.305  1.00 0.00 ? 75  GLN A CA   4  
ATOM 6204  C C    . GLN A 1 75  ? 5.397   -22.333 -4.668  1.00 0.00 ? 75  GLN A C    4  
ATOM 6205  O O    . GLN A 1 75  ? 6.153   -21.429 -4.314  1.00 0.00 ? 75  GLN A O    4  
ATOM 6206  C CB   . GLN A 1 75  ? 4.134   -22.198 -6.822  1.00 0.00 ? 75  GLN A CB   4  
ATOM 6207  C CG   . GLN A 1 75  ? 2.925   -21.656 -7.568  1.00 0.00 ? 75  GLN A CG   4  
ATOM 6208  C CD   . GLN A 1 75  ? 3.059   -21.791 -9.072  1.00 0.00 ? 75  GLN A CD   4  
ATOM 6209  O OE1  . GLN A 1 75  ? 4.109   -21.495 -9.643  1.00 0.00 ? 75  GLN A OE1  4  
ATOM 6210  N NE2  . GLN A 1 75  ? 1.992   -22.239 -9.724  1.00 0.00 ? 75  GLN A NE2  4  
ATOM 6211  H H    . GLN A 1 75  ? 4.201   -19.911 -5.210  1.00 0.00 ? 75  GLN A H    4  
ATOM 6212  H HA   . GLN A 1 75  ? 3.311   -22.703 -4.913  1.00 0.00 ? 75  GLN A HA   4  
ATOM 6213  H HB2  . GLN A 1 75  ? 5.013   -21.686 -7.184  1.00 0.00 ? 75  GLN A HB2  4  
ATOM 6214  H HB3  . GLN A 1 75  ? 4.224   -23.251 -7.044  1.00 0.00 ? 75  GLN A HB3  4  
ATOM 6215  H HG2  . GLN A 1 75  ? 2.048   -22.200 -7.250  1.00 0.00 ? 75  GLN A HG2  4  
ATOM 6216  H HG3  . GLN A 1 75  ? 2.807   -20.611 -7.324  1.00 0.00 ? 75  GLN A HG3  4  
ATOM 6217  H HE21 . GLN A 1 75  ? 1.189   -22.453 -9.204  1.00 0.00 ? 75  GLN A HE21 4  
ATOM 6218  H HE22 . GLN A 1 75  ? 2.051   -22.335 -10.696 1.00 0.00 ? 75  GLN A HE22 4  
ATOM 6219  N N    . GLY A 1 76  ? 5.693   -23.621 -4.523  1.00 0.00 ? 76  GLY A N    4  
ATOM 6220  C CA   . GLY A 1 76  ? 6.952   -24.030 -3.927  1.00 0.00 ? 76  GLY A CA   4  
ATOM 6221  C C    . GLY A 1 76  ? 6.851   -24.208 -2.425  1.00 0.00 ? 76  GLY A C    4  
ATOM 6222  O O    . GLY A 1 76  ? 7.435   -23.439 -1.660  1.00 0.00 ? 76  GLY A O    4  
ATOM 6223  H H    . GLY A 1 76  ? 5.052   -24.299 -4.823  1.00 0.00 ? 76  GLY A H    4  
ATOM 6224  H HA2  . GLY A 1 76  ? 7.260   -24.966 -4.370  1.00 0.00 ? 76  GLY A HA2  4  
ATOM 6225  H HA3  . GLY A 1 76  ? 7.699   -23.280 -4.139  1.00 0.00 ? 76  GLY A HA3  4  
ATOM 6226  N N    . LEU A 1 77  ? 6.108   -25.224 -1.999  1.00 0.00 ? 77  LEU A N    4  
ATOM 6227  C CA   . LEU A 1 77  ? 5.931   -25.500 -0.578  1.00 0.00 ? 77  LEU A CA   4  
ATOM 6228  C C    . LEU A 1 77  ? 5.837   -27.001 -0.322  1.00 0.00 ? 77  LEU A C    4  
ATOM 6229  O O    . LEU A 1 77  ? 5.898   -27.805 -1.252  1.00 0.00 ? 77  LEU A O    4  
ATOM 6230  C CB   . LEU A 1 77  ? 4.673   -24.803 -0.056  1.00 0.00 ? 77  LEU A CB   4  
ATOM 6231  C CG   . LEU A 1 77  ? 4.456   -23.365 -0.531  1.00 0.00 ? 77  LEU A CG   4  
ATOM 6232  C CD1  . LEU A 1 77  ? 2.972   -23.037 -0.576  1.00 0.00 ? 77  LEU A CD1  4  
ATOM 6233  C CD2  . LEU A 1 77  ? 5.193   -22.388 0.373   1.00 0.00 ? 77  LEU A CD2  4  
ATOM 6234  H H    . LEU A 1 77  ? 5.667   -25.802 -2.656  1.00 0.00 ? 77  LEU A H    4  
ATOM 6235  H HA   . LEU A 1 77  ? 6.792   -25.110 -0.055  1.00 0.00 ? 77  LEU A HA   4  
ATOM 6236  H HB2  . LEU A 1 77  ? 3.819   -25.385 -0.365  1.00 0.00 ? 77  LEU A HB2  4  
ATOM 6237  H HB3  . LEU A 1 77  ? 4.727   -24.791 1.024   1.00 0.00 ? 77  LEU A HB3  4  
ATOM 6238  H HG   . LEU A 1 77  ? 4.852   -23.260 -1.532  1.00 0.00 ? 77  LEU A HG   4  
ATOM 6239  H HD11 . LEU A 1 77  ? 2.578   -23.009 0.428   1.00 0.00 ? 77  LEU A HD11 4  
ATOM 6240  H HD12 . LEU A 1 77  ? 2.453   -23.793 -1.146  1.00 0.00 ? 77  LEU A HD12 4  
ATOM 6241  H HD13 . LEU A 1 77  ? 2.831   -22.074 -1.045  1.00 0.00 ? 77  LEU A HD13 4  
ATOM 6242  H HD21 . LEU A 1 77  ? 5.045   -22.671 1.405   1.00 0.00 ? 77  LEU A HD21 4  
ATOM 6243  H HD22 . LEU A 1 77  ? 4.808   -21.391 0.215   1.00 0.00 ? 77  LEU A HD22 4  
ATOM 6244  H HD23 . LEU A 1 77  ? 6.248   -22.408 0.142   1.00 0.00 ? 77  LEU A HD23 4  
ATOM 6245  N N    . LYS A 1 78  ? 5.687   -27.371 0.945   1.00 0.00 ? 78  LYS A N    4  
ATOM 6246  C CA   . LYS A 1 78  ? 5.581   -28.775 1.325   1.00 0.00 ? 78  LYS A CA   4  
ATOM 6247  C C    . LYS A 1 78  ? 4.133   -29.150 1.623   1.00 0.00 ? 78  LYS A C    4  
ATOM 6248  O O    . LYS A 1 78  ? 3.364   -28.363 2.174   1.00 0.00 ? 78  LYS A O    4  
ATOM 6249  C CB   . LYS A 1 78  ? 6.456   -29.061 2.548   1.00 0.00 ? 78  LYS A CB   4  
ATOM 6250  C CG   . LYS A 1 78  ? 7.940   -28.868 2.292   1.00 0.00 ? 78  LYS A CG   4  
ATOM 6251  C CD   . LYS A 1 78  ? 8.491   -29.939 1.366   1.00 0.00 ? 78  LYS A CD   4  
ATOM 6252  C CE   . LYS A 1 78  ? 10.012  -29.965 1.385   1.00 0.00 ? 78  LYS A CE   4  
ATOM 6253  N NZ   . LYS A 1 78  ? 10.561  -30.994 0.459   1.00 0.00 ? 78  LYS A NZ   4  
ATOM 6254  H H    . LYS A 1 78  ? 5.645   -26.683 1.642   1.00 0.00 ? 78  LYS A H    4  
ATOM 6255  H HA   . LYS A 1 78  ? 5.931   -29.370 0.495   1.00 0.00 ? 78  LYS A HA   4  
ATOM 6256  H HB2  . LYS A 1 78  ? 6.160   -28.400 3.349   1.00 0.00 ? 78  LYS A HB2  4  
ATOM 6257  H HB3  . LYS A 1 78  ? 6.295   -30.084 2.859   1.00 0.00 ? 78  LYS A HB3  4  
ATOM 6258  H HG2  . LYS A 1 78  ? 8.096   -27.901 1.839   1.00 0.00 ? 78  LYS A HG2  4  
ATOM 6259  H HG3  . LYS A 1 78  ? 8.467   -28.914 3.235   1.00 0.00 ? 78  LYS A HG3  4  
ATOM 6260  H HD2  . LYS A 1 78  ? 8.122   -30.903 1.684   1.00 0.00 ? 78  LYS A HD2  4  
ATOM 6261  H HD3  . LYS A 1 78  ? 8.156   -29.738 0.358   1.00 0.00 ? 78  LYS A HD3  4  
ATOM 6262  H HE2  . LYS A 1 78  ? 10.379  -28.995 1.091   1.00 0.00 ? 78  LYS A HE2  4  
ATOM 6263  H HE3  . LYS A 1 78  ? 10.342  -30.185 2.390   1.00 0.00 ? 78  LYS A HE3  4  
ATOM 6264  H HZ1  . LYS A 1 78  ? 10.256  -30.795 -0.516  1.00 0.00 ? 78  LYS A HZ1  4  
ATOM 6265  H HZ2  . LYS A 1 78  ? 10.220  -31.938 0.731   1.00 0.00 ? 78  LYS A HZ2  4  
ATOM 6266  H HZ3  . LYS A 1 78  ? 11.600  -30.988 0.494   1.00 0.00 ? 78  LYS A HZ3  4  
ATOM 6267  N N    . PRO A 1 79  ? 3.752   -30.382 1.252   1.00 0.00 ? 79  PRO A N    4  
ATOM 6268  C CA   . PRO A 1 79  ? 2.395   -30.890 1.472   1.00 0.00 ? 79  PRO A CA   4  
ATOM 6269  C C    . PRO A 1 79  ? 2.100   -31.137 2.948   1.00 0.00 ? 79  PRO A C    4  
ATOM 6270  O O    . PRO A 1 79  ? 3.013   -31.332 3.748   1.00 0.00 ? 79  PRO A O    4  
ATOM 6271  C CB   . PRO A 1 79  ? 2.380   -32.209 0.696   1.00 0.00 ? 79  PRO A CB   4  
ATOM 6272  C CG   . PRO A 1 79  ? 3.806   -32.638 0.650   1.00 0.00 ? 79  PRO A CG   4  
ATOM 6273  C CD   . PRO A 1 79  ? 4.617   -31.373 0.590   1.00 0.00 ? 79  PRO A CD   4  
ATOM 6274  H HA   . PRO A 1 79  ? 1.650   -30.222 1.064   1.00 0.00 ? 79  PRO A HA   4  
ATOM 6275  H HB2  . PRO A 1 79  ? 1.766   -32.930 1.218   1.00 0.00 ? 79  PRO A HB2  4  
ATOM 6276  H HB3  . PRO A 1 79  ? 1.985   -32.043 -0.296  1.00 0.00 ? 79  PRO A HB3  4  
ATOM 6277  H HG2  . PRO A 1 79  ? 4.049   -33.198 1.540   1.00 0.00 ? 79  PRO A HG2  4  
ATOM 6278  H HG3  . PRO A 1 79  ? 3.980   -33.236 -0.232  1.00 0.00 ? 79  PRO A HG3  4  
ATOM 6279  H HD2  . PRO A 1 79  ? 5.545   -31.494 1.127   1.00 0.00 ? 79  PRO A HD2  4  
ATOM 6280  H HD3  . PRO A 1 79  ? 4.806   -31.094 -0.436  1.00 0.00 ? 79  PRO A HD3  4  
ATOM 6281  N N    . ASN A 1 80  ? 0.818   -31.127 3.300   1.00 0.00 ? 80  ASN A N    4  
ATOM 6282  C CA   . ASN A 1 80  ? 0.404   -31.350 4.680   1.00 0.00 ? 80  ASN A CA   4  
ATOM 6283  C C    . ASN A 1 80  ? 1.304   -30.588 5.648   1.00 0.00 ? 80  ASN A C    4  
ATOM 6284  O O    . ASN A 1 80  ? 1.749   -31.134 6.658   1.00 0.00 ? 80  ASN A O    4  
ATOM 6285  C CB   . ASN A 1 80  ? 0.432   -32.844 5.008   1.00 0.00 ? 80  ASN A CB   4  
ATOM 6286  C CG   . ASN A 1 80  ? -0.040  -33.135 6.420   1.00 0.00 ? 80  ASN A CG   4  
ATOM 6287  O OD1  . ASN A 1 80  ? 0.766   -33.249 7.344   1.00 0.00 ? 80  ASN A OD1  4  
ATOM 6288  N ND2  . ASN A 1 80  ? -1.351  -33.258 6.592   1.00 0.00 ? 80  ASN A ND2  4  
ATOM 6289  H H    . ASN A 1 80  ? 0.135   -30.966 2.616   1.00 0.00 ? 80  ASN A H    4  
ATOM 6290  H HA   . ASN A 1 80  ? -0.607  -30.987 4.785   1.00 0.00 ? 80  ASN A HA   4  
ATOM 6291  H HB2  . ASN A 1 80  ? -0.213  -33.370 4.319   1.00 0.00 ? 80  ASN A HB2  4  
ATOM 6292  H HB3  . ASN A 1 80  ? 1.442   -33.211 4.902   1.00 0.00 ? 80  ASN A HB3  4  
ATOM 6293  H HD21 . ASN A 1 80  ? -1.932  -33.155 5.810   1.00 0.00 ? 80  ASN A HD21 4  
ATOM 6294  H HD22 . ASN A 1 80  ? -1.683  -33.446 7.495   1.00 0.00 ? 80  ASN A HD22 4  
ATOM 6295  N N    . SER A 1 81  ? 1.567   -29.324 5.333   1.00 0.00 ? 81  SER A N    4  
ATOM 6296  C CA   . SER A 1 81  ? 2.417   -28.488 6.173   1.00 0.00 ? 81  SER A CA   4  
ATOM 6297  C C    . SER A 1 81  ? 1.817   -27.095 6.336   1.00 0.00 ? 81  SER A C    4  
ATOM 6298  O O    . SER A 1 81  ? 1.324   -26.502 5.375   1.00 0.00 ? 81  SER A O    4  
ATOM 6299  C CB   . SER A 1 81  ? 3.820   -28.384 5.573   1.00 0.00 ? 81  SER A CB   4  
ATOM 6300  O OG   . SER A 1 81  ? 4.581   -29.547 5.850   1.00 0.00 ? 81  SER A OG   4  
ATOM 6301  H H    . SER A 1 81  ? 1.183   -28.946 4.515   1.00 0.00 ? 81  SER A H    4  
ATOM 6302  H HA   . SER A 1 81  ? 2.484   -28.954 7.145   1.00 0.00 ? 81  SER A HA   4  
ATOM 6303  H HB2  . SER A 1 81  ? 3.743   -28.266 4.502   1.00 0.00 ? 81  SER A HB2  4  
ATOM 6304  H HB3  . SER A 1 81  ? 4.326   -27.528 5.994   1.00 0.00 ? 81  SER A HB3  4  
ATOM 6305  H HG   . SER A 1 81  ? 4.260   -29.955 6.658   1.00 0.00 ? 81  SER A HG   4  
ATOM 6306  N N    . LEU A 1 82  ? 1.861   -26.578 7.559   1.00 0.00 ? 82  LEU A N    4  
ATOM 6307  C CA   . LEU A 1 82  ? 1.322   -25.254 7.850   1.00 0.00 ? 82  LEU A CA   4  
ATOM 6308  C C    . LEU A 1 82  ? 2.293   -24.162 7.411   1.00 0.00 ? 82  LEU A C    4  
ATOM 6309  O O    . LEU A 1 82  ? 3.502   -24.276 7.611   1.00 0.00 ? 82  LEU A O    4  
ATOM 6310  C CB   . LEU A 1 82  ? 1.027   -25.119 9.345   1.00 0.00 ? 82  LEU A CB   4  
ATOM 6311  C CG   . LEU A 1 82  ? 0.165   -23.925 9.754   1.00 0.00 ? 82  LEU A CG   4  
ATOM 6312  C CD1  . LEU A 1 82  ? -1.270  -24.117 9.286   1.00 0.00 ? 82  LEU A CD1  4  
ATOM 6313  C CD2  . LEU A 1 82  ? 0.213   -23.723 11.262  1.00 0.00 ? 82  LEU A CD2  4  
ATOM 6314  H H    . LEU A 1 82  ? 2.265   -27.098 8.284   1.00 0.00 ? 82  LEU A H    4  
ATOM 6315  H HA   . LEU A 1 82  ? 0.401   -25.143 7.298   1.00 0.00 ? 82  LEU A HA   4  
ATOM 6316  H HB2  . LEU A 1 82  ? 0.521   -26.017 9.664   1.00 0.00 ? 82  LEU A HB2  4  
ATOM 6317  H HB3  . LEU A 1 82  ? 1.973   -25.038 9.862   1.00 0.00 ? 82  LEU A HB3  4  
ATOM 6318  H HG   . LEU A 1 82  ? 0.552   -23.031 9.283   1.00 0.00 ? 82  LEU A HG   4  
ATOM 6319  H HD11 . LEU A 1 82  ? -1.271  -24.514 8.282   1.00 0.00 ? 82  LEU A HD11 4  
ATOM 6320  H HD12 . LEU A 1 82  ? -1.783  -23.167 9.299   1.00 0.00 ? 82  LEU A HD12 4  
ATOM 6321  H HD13 . LEU A 1 82  ? -1.774  -24.807 9.947   1.00 0.00 ? 82  LEU A HD13 4  
ATOM 6322  H HD21 . LEU A 1 82  ? -0.614  -24.243 11.721  1.00 0.00 ? 82  LEU A HD21 4  
ATOM 6323  H HD22 . LEU A 1 82  ? 0.144   -22.668 11.486  1.00 0.00 ? 82  LEU A HD22 4  
ATOM 6324  H HD23 . LEU A 1 82  ? 1.143   -24.114 11.647  1.00 0.00 ? 82  LEU A HD23 4  
ATOM 6325  N N    . TYR A 1 83  ? 1.755   -23.105 6.814   1.00 0.00 ? 83  TYR A N    4  
ATOM 6326  C CA   . TYR A 1 83  ? 2.573   -21.992 6.347   1.00 0.00 ? 83  TYR A CA   4  
ATOM 6327  C C    . TYR A 1 83  ? 1.870   -20.660 6.588   1.00 0.00 ? 83  TYR A C    4  
ATOM 6328  O O    . TYR A 1 83  ? 0.842   -20.368 5.978   1.00 0.00 ? 83  TYR A O    4  
ATOM 6329  C CB   . TYR A 1 83  ? 2.887   -22.153 4.858   1.00 0.00 ? 83  TYR A CB   4  
ATOM 6330  C CG   . TYR A 1 83  ? 3.905   -23.233 4.568   1.00 0.00 ? 83  TYR A CG   4  
ATOM 6331  C CD1  . TYR A 1 83  ? 5.263   -23.000 4.742   1.00 0.00 ? 83  TYR A CD1  4  
ATOM 6332  C CD2  . TYR A 1 83  ? 3.508   -24.487 4.120   1.00 0.00 ? 83  TYR A CD2  4  
ATOM 6333  C CE1  . TYR A 1 83  ? 6.197   -23.984 4.477   1.00 0.00 ? 83  TYR A CE1  4  
ATOM 6334  C CE2  . TYR A 1 83  ? 4.434   -25.477 3.853   1.00 0.00 ? 83  TYR A CE2  4  
ATOM 6335  C CZ   . TYR A 1 83  ? 5.777   -25.220 4.033   1.00 0.00 ? 83  TYR A CZ   4  
ATOM 6336  O OH   . TYR A 1 83  ? 6.703   -26.203 3.769   1.00 0.00 ? 83  TYR A OH   4  
ATOM 6337  H H    . TYR A 1 83  ? 0.784   -23.072 6.683   1.00 0.00 ? 83  TYR A H    4  
ATOM 6338  H HA   . TYR A 1 83  ? 3.499   -22.005 6.903   1.00 0.00 ? 83  TYR A HA   4  
ATOM 6339  H HB2  . TYR A 1 83  ? 1.980   -22.403 4.331   1.00 0.00 ? 83  TYR A HB2  4  
ATOM 6340  H HB3  . TYR A 1 83  ? 3.275   -21.220 4.476   1.00 0.00 ? 83  TYR A HB3  4  
ATOM 6341  H HD1  . TYR A 1 83  ? 5.589   -22.030 5.090   1.00 0.00 ? 83  TYR A HD1  4  
ATOM 6342  H HD2  . TYR A 1 83  ? 2.455   -24.685 3.980   1.00 0.00 ? 83  TYR A HD2  4  
ATOM 6343  H HE1  . TYR A 1 83  ? 7.248   -23.783 4.618   1.00 0.00 ? 83  TYR A HE1  4  
ATOM 6344  H HE2  . TYR A 1 83  ? 4.106   -26.446 3.506   1.00 0.00 ? 83  TYR A HE2  4  
ATOM 6345  H HH   . TYR A 1 83  ? 7.032   -26.101 2.873   1.00 0.00 ? 83  TYR A HH   4  
ATOM 6346  N N    . TYR A 1 84  ? 2.434   -19.855 7.482   1.00 0.00 ? 84  TYR A N    4  
ATOM 6347  C CA   . TYR A 1 84  ? 1.862   -18.554 7.807   1.00 0.00 ? 84  TYR A CA   4  
ATOM 6348  C C    . TYR A 1 84  ? 1.977   -17.597 6.625   1.00 0.00 ? 84  TYR A C    4  
ATOM 6349  O O    . TYR A 1 84  ? 2.895   -17.706 5.810   1.00 0.00 ? 84  TYR A O    4  
ATOM 6350  C CB   . TYR A 1 84  ? 2.560   -17.958 9.031   1.00 0.00 ? 84  TYR A CB   4  
ATOM 6351  C CG   . TYR A 1 84  ? 2.225   -18.665 10.324  1.00 0.00 ? 84  TYR A CG   4  
ATOM 6352  C CD1  . TYR A 1 84  ? 2.753   -19.917 10.611  1.00 0.00 ? 84  TYR A CD1  4  
ATOM 6353  C CD2  . TYR A 1 84  ? 1.379   -18.081 11.259  1.00 0.00 ? 84  TYR A CD2  4  
ATOM 6354  C CE1  . TYR A 1 84  ? 2.449   -20.568 11.792  1.00 0.00 ? 84  TYR A CE1  4  
ATOM 6355  C CE2  . TYR A 1 84  ? 1.071   -18.723 12.442  1.00 0.00 ? 84  TYR A CE2  4  
ATOM 6356  C CZ   . TYR A 1 84  ? 1.608   -19.966 12.704  1.00 0.00 ? 84  TYR A CZ   4  
ATOM 6357  O OH   . TYR A 1 84  ? 1.302   -20.610 13.881  1.00 0.00 ? 84  TYR A OH   4  
ATOM 6358  H H    . TYR A 1 84  ? 3.253   -20.144 7.936   1.00 0.00 ? 84  TYR A H    4  
ATOM 6359  H HA   . TYR A 1 84  ? 0.816   -18.699 8.037   1.00 0.00 ? 84  TYR A HA   4  
ATOM 6360  H HB2  . TYR A 1 84  ? 3.629   -18.015 8.890   1.00 0.00 ? 84  TYR A HB2  4  
ATOM 6361  H HB3  . TYR A 1 84  ? 2.270   -16.922 9.133   1.00 0.00 ? 84  TYR A HB3  4  
ATOM 6362  H HD1  . TYR A 1 84  ? 3.412   -20.386 9.894   1.00 0.00 ? 84  TYR A HD1  4  
ATOM 6363  H HD2  . TYR A 1 84  ? 0.960   -17.107 11.051  1.00 0.00 ? 84  TYR A HD2  4  
ATOM 6364  H HE1  . TYR A 1 84  ? 2.870   -21.541 11.997  1.00 0.00 ? 84  TYR A HE1  4  
ATOM 6365  H HE2  . TYR A 1 84  ? 0.411   -18.252 13.157  1.00 0.00 ? 84  TYR A HE2  4  
ATOM 6366  H HH   . TYR A 1 84  ? 1.362   -19.988 14.611  1.00 0.00 ? 84  TYR A HH   4  
ATOM 6367  N N    . PHE A 1 85  ? 1.041   -16.659 6.537   1.00 0.00 ? 85  PHE A N    4  
ATOM 6368  C CA   . PHE A 1 85  ? 1.036   -15.682 5.455   1.00 0.00 ? 85  PHE A CA   4  
ATOM 6369  C C    . PHE A 1 85  ? 0.592   -14.312 5.960   1.00 0.00 ? 85  PHE A C    4  
ATOM 6370  O O    . PHE A 1 85  ? -0.302  -14.209 6.800   1.00 0.00 ? 85  PHE A O    4  
ATOM 6371  C CB   . PHE A 1 85  ? 0.113   -16.145 4.326   1.00 0.00 ? 85  PHE A CB   4  
ATOM 6372  C CG   . PHE A 1 85  ? 0.391   -17.546 3.860   1.00 0.00 ? 85  PHE A CG   4  
ATOM 6373  C CD1  . PHE A 1 85  ? 1.554   -17.842 3.167   1.00 0.00 ? 85  PHE A CD1  4  
ATOM 6374  C CD2  . PHE A 1 85  ? -0.511  -18.567 4.115   1.00 0.00 ? 85  PHE A CD2  4  
ATOM 6375  C CE1  . PHE A 1 85  ? 1.813   -19.129 2.738   1.00 0.00 ? 85  PHE A CE1  4  
ATOM 6376  C CE2  . PHE A 1 85  ? -0.256  -19.856 3.689   1.00 0.00 ? 85  PHE A CE2  4  
ATOM 6377  C CZ   . PHE A 1 85  ? 0.906   -20.138 2.998   1.00 0.00 ? 85  PHE A CZ   4  
ATOM 6378  H H    . PHE A 1 85  ? 0.335   -16.623 7.217   1.00 0.00 ? 85  PHE A H    4  
ATOM 6379  H HA   . PHE A 1 85  ? 2.043   -15.604 5.076   1.00 0.00 ? 85  PHE A HA   4  
ATOM 6380  H HB2  . PHE A 1 85  ? -0.910  -16.107 4.668   1.00 0.00 ? 85  PHE A HB2  4  
ATOM 6381  H HB3  . PHE A 1 85  ? 0.230   -15.484 3.481   1.00 0.00 ? 85  PHE A HB3  4  
ATOM 6382  H HD1  . PHE A 1 85  ? 2.264   -17.053 2.963   1.00 0.00 ? 85  PHE A HD1  4  
ATOM 6383  H HD2  . PHE A 1 85  ? -1.421  -18.348 4.654   1.00 0.00 ? 85  PHE A HD2  4  
ATOM 6384  H HE1  . PHE A 1 85  ? 2.723   -19.346 2.198   1.00 0.00 ? 85  PHE A HE1  4  
ATOM 6385  H HE2  . PHE A 1 85  ? -0.967  -20.643 3.893   1.00 0.00 ? 85  PHE A HE2  4  
ATOM 6386  H HZ   . PHE A 1 85  ? 1.107   -21.145 2.664   1.00 0.00 ? 85  PHE A HZ   4  
ATOM 6387  N N    . ARG A 1 86  ? 1.224   -13.264 5.443   1.00 0.00 ? 86  ARG A N    4  
ATOM 6388  C CA   . ARG A 1 86  ? 0.897   -11.901 5.842   1.00 0.00 ? 86  ARG A CA   4  
ATOM 6389  C C    . ARG A 1 86  ? 0.980   -10.950 4.651   1.00 0.00 ? 86  ARG A C    4  
ATOM 6390  O O    . ARG A 1 86  ? 2.040   -10.790 4.045   1.00 0.00 ? 86  ARG A O    4  
ATOM 6391  C CB   . ARG A 1 86  ? 1.840   -11.431 6.951   1.00 0.00 ? 86  ARG A CB   4  
ATOM 6392  C CG   . ARG A 1 86  ? 1.483   -11.974 8.325   1.00 0.00 ? 86  ARG A CG   4  
ATOM 6393  C CD   . ARG A 1 86  ? 0.516   -11.054 9.054   1.00 0.00 ? 86  ARG A CD   4  
ATOM 6394  N NE   . ARG A 1 86  ? 1.157   -9.814  9.481   1.00 0.00 ? 86  ARG A NE   4  
ATOM 6395  C CZ   . ARG A 1 86  ? 0.699   -9.052  10.468  1.00 0.00 ? 86  ARG A CZ   4  
ATOM 6396  N NH1  . ARG A 1 86  ? -0.397  -9.402  11.126  1.00 0.00 ? 86  ARG A NH1  4  
ATOM 6397  N NH2  . ARG A 1 86  ? 1.339   -7.937  10.799  1.00 0.00 ? 86  ARG A NH2  4  
ATOM 6398  H H    . ARG A 1 86  ? 1.928   -13.411 4.777   1.00 0.00 ? 86  ARG A H    4  
ATOM 6399  H HA   . ARG A 1 86  ? -0.116  -11.899 6.218   1.00 0.00 ? 86  ARG A HA   4  
ATOM 6400  H HB2  . ARG A 1 86  ? 2.844   -11.749 6.712   1.00 0.00 ? 86  ARG A HB2  4  
ATOM 6401  H HB3  . ARG A 1 86  ? 1.814   -10.353 6.996   1.00 0.00 ? 86  ARG A HB3  4  
ATOM 6402  H HG2  . ARG A 1 86  ? 1.022   -12.944 8.210   1.00 0.00 ? 86  ARG A HG2  4  
ATOM 6403  H HG3  . ARG A 1 86  ? 2.386   -12.069 8.910   1.00 0.00 ? 86  ARG A HG3  4  
ATOM 6404  H HD2  . ARG A 1 86  ? -0.302  -10.815 8.390   1.00 0.00 ? 86  ARG A HD2  4  
ATOM 6405  H HD3  . ARG A 1 86  ? 0.135   -11.570 9.922   1.00 0.00 ? 86  ARG A HD3  4  
ATOM 6406  H HE   . ARG A 1 86  ? 1.969   -9.536  9.008   1.00 0.00 ? 86  ARG A HE   4  
ATOM 6407  H HH11 . ARG A 1 86  ? -0.880  -10.242 10.880  1.00 0.00 ? 86  ARG A HH11 4  
ATOM 6408  H HH12 . ARG A 1 86  ? -0.739  -8.827  11.870  1.00 0.00 ? 86  ARG A HH12 4  
ATOM 6409  H HH21 . ARG A 1 86  ? 2.166   -7.670  10.305  1.00 0.00 ? 86  ARG A HH21 4  
ATOM 6410  H HH22 . ARG A 1 86  ? 0.993   -7.364  11.542  1.00 0.00 ? 86  ARG A HH22 4  
ATOM 6411  N N    . LEU A 1 87  ? -0.143  -10.323 4.322   1.00 0.00 ? 87  LEU A N    4  
ATOM 6412  C CA   . LEU A 1 87  ? -0.197  -9.388  3.204   1.00 0.00 ? 87  LEU A CA   4  
ATOM 6413  C C    . LEU A 1 87  ? -0.005  -7.953  3.683   1.00 0.00 ? 87  LEU A C    4  
ATOM 6414  O O    . LEU A 1 87  ? -0.384  -7.606  4.802   1.00 0.00 ? 87  LEU A O    4  
ATOM 6415  C CB   . LEU A 1 87  ? -1.533  -9.518  2.469   1.00 0.00 ? 87  LEU A CB   4  
ATOM 6416  C CG   . LEU A 1 87  ? -1.513  -9.186  0.977   1.00 0.00 ? 87  LEU A CG   4  
ATOM 6417  C CD1  . LEU A 1 87  ? -0.825  -10.292 0.193   1.00 0.00 ? 87  LEU A CD1  4  
ATOM 6418  C CD2  . LEU A 1 87  ? -2.928  -8.965  0.461   1.00 0.00 ? 87  LEU A CD2  4  
ATOM 6419  H H    . LEU A 1 87  ? -0.956  -10.491 4.843   1.00 0.00 ? 87  LEU A H    4  
ATOM 6420  H HA   . LEU A 1 87  ? 0.604   -9.638  2.524   1.00 0.00 ? 87  LEU A HA   4  
ATOM 6421  H HB2  . LEU A 1 87  ? -1.871  -10.537 2.576   1.00 0.00 ? 87  LEU A HB2  4  
ATOM 6422  H HB3  . LEU A 1 87  ? -2.238  -8.853  2.948   1.00 0.00 ? 87  LEU A HB3  4  
ATOM 6423  H HG   . LEU A 1 87  ? -0.954  -8.272  0.825   1.00 0.00 ? 87  LEU A HG   4  
ATOM 6424  H HD11 . LEU A 1 87  ? -0.517  -9.913  -0.770  1.00 0.00 ? 87  LEU A HD11 4  
ATOM 6425  H HD12 . LEU A 1 87  ? -1.511  -11.115 0.053   1.00 0.00 ? 87  LEU A HD12 4  
ATOM 6426  H HD13 . LEU A 1 87  ? 0.041   -10.635 0.740   1.00 0.00 ? 87  LEU A HD13 4  
ATOM 6427  H HD21 . LEU A 1 87  ? -2.963  -8.049  -0.110  1.00 0.00 ? 87  LEU A HD21 4  
ATOM 6428  H HD22 . LEU A 1 87  ? -3.609  -8.894  1.297   1.00 0.00 ? 87  LEU A HD22 4  
ATOM 6429  H HD23 . LEU A 1 87  ? -3.215  -9.793  -0.169  1.00 0.00 ? 87  LEU A HD23 4  
ATOM 6430  N N    . ALA A 1 88  ? 0.583   -7.122  2.829   1.00 0.00 ? 88  ALA A N    4  
ATOM 6431  C CA   . ALA A 1 88  ? 0.822   -5.724  3.164   1.00 0.00 ? 88  ALA A CA   4  
ATOM 6432  C C    . ALA A 1 88  ? 1.151   -4.909  1.917   1.00 0.00 ? 88  ALA A C    4  
ATOM 6433  O O    . ALA A 1 88  ? 2.250   -5.007  1.373   1.00 0.00 ? 88  ALA A O    4  
ATOM 6434  C CB   . ALA A 1 88  ? 1.945   -5.609  4.183   1.00 0.00 ? 88  ALA A CB   4  
ATOM 6435  H H    . ALA A 1 88  ? 0.863   -7.458  1.952   1.00 0.00 ? 88  ALA A H    4  
ATOM 6436  H HA   . ALA A 1 88  ? -0.079  -5.330  3.611   1.00 0.00 ? 88  ALA A HA   4  
ATOM 6437  H HB1  . ALA A 1 88  ? 2.368   -6.587  4.362   1.00 0.00 ? 88  ALA A HB1  4  
ATOM 6438  H HB2  . ALA A 1 88  ? 2.710   -4.949  3.803   1.00 0.00 ? 88  ALA A HB2  4  
ATOM 6439  H HB3  . ALA A 1 88  ? 1.553   -5.212  5.108   1.00 0.00 ? 88  ALA A HB3  4  
ATOM 6440  N N    . ALA A 1 89  ? 0.191   -4.107  1.470   1.00 0.00 ? 89  ALA A N    4  
ATOM 6441  C CA   . ALA A 1 89  ? 0.379   -3.274  0.288   1.00 0.00 ? 89  ALA A CA   4  
ATOM 6442  C C    . ALA A 1 89  ? 1.690   -2.499  0.367   1.00 0.00 ? 89  ALA A C    4  
ATOM 6443  O O    . ALA A 1 89  ? 2.068   -2.005  1.430   1.00 0.00 ? 89  ALA A O    4  
ATOM 6444  C CB   . ALA A 1 89  ? -0.792  -2.318  0.123   1.00 0.00 ? 89  ALA A CB   4  
ATOM 6445  H H    . ALA A 1 89  ? -0.665  -4.073  1.947   1.00 0.00 ? 89  ALA A H    4  
ATOM 6446  H HA   . ALA A 1 89  ? 0.408   -3.923  -0.576  1.00 0.00 ? 89  ALA A HA   4  
ATOM 6447  H HB1  . ALA A 1 89  ? -1.718  -2.858  0.262   1.00 0.00 ? 89  ALA A HB1  4  
ATOM 6448  H HB2  . ALA A 1 89  ? -0.721  -1.531  0.859   1.00 0.00 ? 89  ALA A HB2  4  
ATOM 6449  H HB3  . ALA A 1 89  ? -0.770  -1.889  -0.867  1.00 0.00 ? 89  ALA A HB3  4  
ATOM 6450  N N    . ARG A 1 90  ? 2.380   -2.397  -0.764  1.00 0.00 ? 90  ARG A N    4  
ATOM 6451  C CA   . ARG A 1 90  ? 3.650   -1.683  -0.823  1.00 0.00 ? 90  ARG A CA   4  
ATOM 6452  C C    . ARG A 1 90  ? 3.557   -0.484  -1.762  1.00 0.00 ? 90  ARG A C    4  
ATOM 6453  O O    . ARG A 1 90  ? 3.198   -0.624  -2.931  1.00 0.00 ? 90  ARG A O    4  
ATOM 6454  C CB   . ARG A 1 90  ? 4.766   -2.621  -1.285  1.00 0.00 ? 90  ARG A CB   4  
ATOM 6455  C CG   . ARG A 1 90  ? 6.163   -2.076  -1.036  1.00 0.00 ? 90  ARG A CG   4  
ATOM 6456  C CD   . ARG A 1 90  ? 7.190   -3.194  -0.949  1.00 0.00 ? 90  ARG A CD   4  
ATOM 6457  N NE   . ARG A 1 90  ? 8.557   -2.680  -0.909  1.00 0.00 ? 90  ARG A NE   4  
ATOM 6458  C CZ   . ARG A 1 90  ? 9.624   -3.406  -1.221  1.00 0.00 ? 90  ARG A CZ   4  
ATOM 6459  N NH1  . ARG A 1 90  ? 9.484   -4.670  -1.595  1.00 0.00 ? 90  ARG A NH1  4  
ATOM 6460  N NH2  . ARG A 1 90  ? 10.835  -2.867  -1.160  1.00 0.00 ? 90  ARG A NH2  4  
ATOM 6461  H H    . ARG A 1 90  ? 2.028   -2.812  -1.579  1.00 0.00 ? 90  ARG A H    4  
ATOM 6462  H HA   . ARG A 1 90  ? 3.878   -1.330  0.172   1.00 0.00 ? 90  ARG A HA   4  
ATOM 6463  H HB2  . ARG A 1 90  ? 4.672   -3.561  -0.760  1.00 0.00 ? 90  ARG A HB2  4  
ATOM 6464  H HB3  . ARG A 1 90  ? 4.656   -2.797  -2.345  1.00 0.00 ? 90  ARG A HB3  4  
ATOM 6465  H HG2  . ARG A 1 90  ? 6.433   -1.417  -1.848  1.00 0.00 ? 90  ARG A HG2  4  
ATOM 6466  H HG3  . ARG A 1 90  ? 6.164   -1.525  -0.107  1.00 0.00 ? 90  ARG A HG3  4  
ATOM 6467  H HD2  . ARG A 1 90  ? 7.005   -3.766  -0.052  1.00 0.00 ? 90  ARG A HD2  4  
ATOM 6468  H HD3  . ARG A 1 90  ? 7.081   -3.833  -1.813  1.00 0.00 ? 90  ARG A HD3  4  
ATOM 6469  H HE   . ARG A 1 90  ? 8.683   -1.748  -0.636  1.00 0.00 ? 90  ARG A HE   4  
ATOM 6470  H HH11 . ARG A 1 90  ? 8.573   -5.078  -1.643  1.00 0.00 ? 90  ARG A HH11 4  
ATOM 6471  H HH12 . ARG A 1 90  ? 10.290  -5.214  -1.831  1.00 0.00 ? 90  ARG A HH12 4  
ATOM 6472  H HH21 . ARG A 1 90  ? 10.945  -1.914  -0.879  1.00 0.00 ? 90  ARG A HH21 4  
ATOM 6473  H HH22 . ARG A 1 90  ? 11.638  -3.414  -1.395  1.00 0.00 ? 90  ARG A HH22 4  
ATOM 6474  N N    . SER A 1 91  ? 3.883   0.695   -1.241  1.00 0.00 ? 91  SER A N    4  
ATOM 6475  C CA   . SER A 1 91  ? 3.832   1.920   -2.032  1.00 0.00 ? 91  SER A CA   4  
ATOM 6476  C C    . SER A 1 91  ? 5.238   2.437   -2.324  1.00 0.00 ? 91  SER A C    4  
ATOM 6477  O O    . SER A 1 91  ? 6.205   2.099   -1.641  1.00 0.00 ? 91  SER A O    4  
ATOM 6478  C CB   . SER A 1 91  ? 3.024   2.992   -1.298  1.00 0.00 ? 91  SER A CB   4  
ATOM 6479  O OG   . SER A 1 91  ? 3.150   2.853   0.106   1.00 0.00 ? 91  SER A OG   4  
ATOM 6480  H H    . SER A 1 91  ? 4.162   0.743   -0.303  1.00 0.00 ? 91  SER A H    4  
ATOM 6481  H HA   . SER A 1 91  ? 3.344   1.690   -2.967  1.00 0.00 ? 91  SER A HA   4  
ATOM 6482  H HB2  . SER A 1 91  ? 3.384   3.969   -1.585  1.00 0.00 ? 91  SER A HB2  4  
ATOM 6483  H HB3  . SER A 1 91  ? 1.982   2.899   -1.566  1.00 0.00 ? 91  SER A HB3  4  
ATOM 6484  H HG   . SER A 1 91  ? 3.121   3.720   0.518   1.00 0.00 ? 91  SER A HG   4  
ATOM 6485  N N    . PRO A 1 92  ? 5.354   3.276   -3.363  1.00 0.00 ? 92  PRO A N    4  
ATOM 6486  C CA   . PRO A 1 92  ? 6.637   3.858   -3.770  1.00 0.00 ? 92  PRO A CA   4  
ATOM 6487  C C    . PRO A 1 92  ? 7.156   4.878   -2.763  1.00 0.00 ? 92  PRO A C    4  
ATOM 6488  O O    . PRO A 1 92  ? 8.350   5.172   -2.724  1.00 0.00 ? 92  PRO A O    4  
ATOM 6489  C CB   . PRO A 1 92  ? 6.310   4.540   -5.101  1.00 0.00 ? 92  PRO A CB   4  
ATOM 6490  C CG   . PRO A 1 92  ? 4.851   4.836   -5.028  1.00 0.00 ? 92  PRO A CG   4  
ATOM 6491  C CD   . PRO A 1 92  ? 4.244   3.722   -4.221  1.00 0.00 ? 92  PRO A CD   4  
ATOM 6492  H HA   . PRO A 1 92  ? 7.386   3.097   -3.929  1.00 0.00 ? 92  PRO A HA   4  
ATOM 6493  H HB2  . PRO A 1 92  ? 6.893   5.446   -5.197  1.00 0.00 ? 92  PRO A HB2  4  
ATOM 6494  H HB3  . PRO A 1 92  ? 6.536   3.871   -5.918  1.00 0.00 ? 92  PRO A HB3  4  
ATOM 6495  H HG2  . PRO A 1 92  ? 4.693   5.784   -4.537  1.00 0.00 ? 92  PRO A HG2  4  
ATOM 6496  H HG3  . PRO A 1 92  ? 4.430   4.851   -6.022  1.00 0.00 ? 92  PRO A HG3  4  
ATOM 6497  H HD2  . PRO A 1 92  ? 3.421   4.091   -3.626  1.00 0.00 ? 92  PRO A HD2  4  
ATOM 6498  H HD3  . PRO A 1 92  ? 3.914   2.923   -4.869  1.00 0.00 ? 92  PRO A HD3  4  
ATOM 6499  N N    . GLN A 1 93  ? 6.251   5.414   -1.950  1.00 0.00 ? 93  GLN A N    4  
ATOM 6500  C CA   . GLN A 1 93  ? 6.619   6.401   -0.942  1.00 0.00 ? 93  GLN A CA   4  
ATOM 6501  C C    . GLN A 1 93  ? 7.056   5.722   0.351   1.00 0.00 ? 93  GLN A C    4  
ATOM 6502  O O    . GLN A 1 93  ? 7.806   6.293   1.142   1.00 0.00 ? 93  GLN A O    4  
ATOM 6503  C CB   . GLN A 1 93  ? 5.446   7.343   -0.667  1.00 0.00 ? 93  GLN A CB   4  
ATOM 6504  C CG   . GLN A 1 93  ? 5.133   8.280   -1.823  1.00 0.00 ? 93  GLN A CG   4  
ATOM 6505  C CD   . GLN A 1 93  ? 3.757   8.905   -1.711  1.00 0.00 ? 93  GLN A CD   4  
ATOM 6506  O OE1  . GLN A 1 93  ? 3.292   9.219   -0.615  1.00 0.00 ? 93  GLN A OE1  4  
ATOM 6507  N NE2  . GLN A 1 93  ? 3.097   9.090   -2.849  1.00 0.00 ? 93  GLN A NE2  4  
ATOM 6508  H H    . GLN A 1 93  ? 5.314   5.139   -2.030  1.00 0.00 ? 93  GLN A H    4  
ATOM 6509  H HA   . GLN A 1 93  ? 7.447   6.977   -1.329  1.00 0.00 ? 93  GLN A HA   4  
ATOM 6510  H HB2  . GLN A 1 93  ? 4.565   6.751   -0.463  1.00 0.00 ? 93  GLN A HB2  4  
ATOM 6511  H HB3  . GLN A 1 93  ? 5.676   7.942   0.201   1.00 0.00 ? 93  GLN A HB3  4  
ATOM 6512  H HG2  . GLN A 1 93  ? 5.870   9.070   -1.838  1.00 0.00 ? 93  GLN A HG2  4  
ATOM 6513  H HG3  . GLN A 1 93  ? 5.186   7.722   -2.746  1.00 0.00 ? 93  GLN A HG3  4  
ATOM 6514  H HE21 . GLN A 1 93  ? 3.529   8.815   -3.684  1.00 0.00 ? 93  GLN A HE21 4  
ATOM 6515  H HE22 . GLN A 1 93  ? 2.205   9.491   -2.806  1.00 0.00 ? 93  GLN A HE22 4  
ATOM 6516  N N    . GLY A 1 94  ? 6.580   4.498   0.561   1.00 0.00 ? 94  GLY A N    4  
ATOM 6517  C CA   . GLY A 1 94  ? 6.932   3.762   1.761   1.00 0.00 ? 94  GLY A CA   4  
ATOM 6518  C C    . GLY A 1 94  ? 6.171   2.456   1.884   1.00 0.00 ? 94  GLY A C    4  
ATOM 6519  O O    . GLY A 1 94  ? 5.962   1.755   0.893   1.00 0.00 ? 94  GLY A O    4  
ATOM 6520  H H    . GLY A 1 94  ? 5.986   4.093   -0.104  1.00 0.00 ? 94  GLY A H    4  
ATOM 6521  H HA2  . GLY A 1 94  ? 7.991   3.549   1.743   1.00 0.00 ? 94  GLY A HA2  4  
ATOM 6522  H HA3  . GLY A 1 94  ? 6.714   4.375   2.623   1.00 0.00 ? 94  GLY A HA3  4  
ATOM 6523  N N    . LEU A 1 95  ? 5.757   2.127   3.103   1.00 0.00 ? 95  LEU A N    4  
ATOM 6524  C CA   . LEU A 1 95  ? 5.016   0.896   3.352   1.00 0.00 ? 95  LEU A CA   4  
ATOM 6525  C C    . LEU A 1 95  ? 3.731   1.180   4.122   1.00 0.00 ? 95  LEU A C    4  
ATOM 6526  O O    . LEU A 1 95  ? 3.688   2.069   4.972   1.00 0.00 ? 95  LEU A O    4  
ATOM 6527  C CB   . LEU A 1 95  ? 5.883   -0.095  4.132   1.00 0.00 ? 95  LEU A CB   4  
ATOM 6528  C CG   . LEU A 1 95  ? 5.604   -1.577  3.877   1.00 0.00 ? 95  LEU A CG   4  
ATOM 6529  C CD1  . LEU A 1 95  ? 4.326   -2.008  4.579   1.00 0.00 ? 95  LEU A CD1  4  
ATOM 6530  C CD2  . LEU A 1 95  ? 5.512   -1.852  2.383   1.00 0.00 ? 95  LEU A CD2  4  
ATOM 6531  H H    . LEU A 1 95  ? 5.954   2.726   3.853   1.00 0.00 ? 95  LEU A H    4  
ATOM 6532  H HA   . LEU A 1 95  ? 4.761   0.463   2.396   1.00 0.00 ? 95  LEU A HA   4  
ATOM 6533  H HB2  . LEU A 1 95  ? 6.914   0.096   3.877   1.00 0.00 ? 95  LEU A HB2  4  
ATOM 6534  H HB3  . LEU A 1 95  ? 5.733   0.094   5.186   1.00 0.00 ? 95  LEU A HB3  4  
ATOM 6535  H HG   . LEU A 1 95  ? 6.419   -2.164  4.276   1.00 0.00 ? 95  LEU A HG   4  
ATOM 6536  H HD11 . LEU A 1 95  ? 4.428   -3.028  4.918   1.00 0.00 ? 95  LEU A HD11 4  
ATOM 6537  H HD12 . LEU A 1 95  ? 3.496   -1.938  3.892   1.00 0.00 ? 95  LEU A HD12 4  
ATOM 6538  H HD13 . LEU A 1 95  ? 4.146   -1.363  5.427   1.00 0.00 ? 95  LEU A HD13 4  
ATOM 6539  H HD21 . LEU A 1 95  ? 4.476   -1.835  2.077   1.00 0.00 ? 95  LEU A HD21 4  
ATOM 6540  H HD22 . LEU A 1 95  ? 5.934   -2.824  2.169   1.00 0.00 ? 95  LEU A HD22 4  
ATOM 6541  H HD23 . LEU A 1 95  ? 6.060   -1.095  1.843   1.00 0.00 ? 95  LEU A HD23 4  
ATOM 6542  N N    . GLY A 1 96  ? 2.684   0.418   3.820   1.00 0.00 ? 96  GLY A N    4  
ATOM 6543  C CA   . GLY A 1 96  ? 1.413   0.602   4.494   1.00 0.00 ? 96  GLY A CA   4  
ATOM 6544  C C    . GLY A 1 96  ? 1.268   -0.288  5.713   1.00 0.00 ? 96  GLY A C    4  
ATOM 6545  O O    . GLY A 1 96  ? 2.197   -0.417  6.509   1.00 0.00 ? 96  GLY A O    4  
ATOM 6546  H H    . GLY A 1 96  ? 2.777   -0.276  3.134   1.00 0.00 ? 96  GLY A H    4  
ATOM 6547  H HA2  . GLY A 1 96  ? 1.327   1.634   4.802   1.00 0.00 ? 96  GLY A HA2  4  
ATOM 6548  H HA3  . GLY A 1 96  ? 0.615   0.377   3.802   1.00 0.00 ? 96  GLY A HA3  4  
ATOM 6549  N N    . ALA A 1 97  ? 0.098   -0.902  5.859   1.00 0.00 ? 97  ALA A N    4  
ATOM 6550  C CA   . ALA A 1 97  ? -0.165  -1.784  6.989   1.00 0.00 ? 97  ALA A CA   4  
ATOM 6551  C C    . ALA A 1 97  ? -0.354  -3.225  6.528   1.00 0.00 ? 97  ALA A C    4  
ATOM 6552  O O    . ALA A 1 97  ? -0.768  -3.476  5.397   1.00 0.00 ? 97  ALA A O    4  
ATOM 6553  C CB   . ALA A 1 97  ? -1.389  -1.309  7.757   1.00 0.00 ? 97  ALA A CB   4  
ATOM 6554  H H    . ALA A 1 97  ? -0.604  -0.759  5.191   1.00 0.00 ? 97  ALA A H    4  
ATOM 6555  H HA   . ALA A 1 97  ? 0.686   -1.738  7.654   1.00 0.00 ? 97  ALA A HA   4  
ATOM 6556  H HB1  . ALA A 1 97  ? -1.645  -0.308  7.440   1.00 0.00 ? 97  ALA A HB1  4  
ATOM 6557  H HB2  . ALA A 1 97  ? -2.218  -1.972  7.559   1.00 0.00 ? 97  ALA A HB2  4  
ATOM 6558  H HB3  . ALA A 1 97  ? -1.173  -1.307  8.815   1.00 0.00 ? 97  ALA A HB3  4  
ATOM 6559  N N    . SER A 1 98  ? -0.047  -4.170  7.412   1.00 0.00 ? 98  SER A N    4  
ATOM 6560  C CA   . SER A 1 98  ? -0.179  -5.587  7.093   1.00 0.00 ? 98  SER A CA   4  
ATOM 6561  C C    . SER A 1 98  ? -1.483  -6.150  7.650   1.00 0.00 ? 98  SER A C    4  
ATOM 6562  O O    . SER A 1 98  ? -1.957  -5.724  8.704   1.00 0.00 ? 98  SER A O    4  
ATOM 6563  C CB   . SER A 1 98  ? 1.009   -6.370  7.655   1.00 0.00 ? 98  SER A CB   4  
ATOM 6564  O OG   . SER A 1 98  ? 2.235   -5.868  7.151   1.00 0.00 ? 98  SER A OG   4  
ATOM 6565  H H    . SER A 1 98  ? 0.279   -3.907  8.298   1.00 0.00 ? 98  SER A H    4  
ATOM 6566  H HA   . SER A 1 98  ? -0.188  -5.685  6.018   1.00 0.00 ? 98  SER A HA   4  
ATOM 6567  H HB2  . SER A 1 98  ? 1.015   -6.288  8.731   1.00 0.00 ? 98  SER A HB2  4  
ATOM 6568  H HB3  . SER A 1 98  ? 0.917   -7.409  7.374   1.00 0.00 ? 98  SER A HB3  4  
ATOM 6569  H HG   . SER A 1 98  ? 2.924   -5.984  7.810   1.00 0.00 ? 98  SER A HG   4  
ATOM 6570  N N    . THR A 1 99  ? -2.059  -7.110  6.934   1.00 0.00 ? 99  THR A N    4  
ATOM 6571  C CA   . THR A 1 99  ? -3.309  -7.731  7.355   1.00 0.00 ? 99  THR A CA   4  
ATOM 6572  C C    . THR A 1 99  ? -3.076  -8.719  8.492   1.00 0.00 ? 99  THR A C    4  
ATOM 6573  O O    . THR A 1 99  ? -1.936  -9.061  8.806   1.00 0.00 ? 99  THR A O    4  
ATOM 6574  C CB   . THR A 1 99  ? -3.993  -8.465  6.185   1.00 0.00 ? 99  THR A CB   4  
ATOM 6575  O OG1  . THR A 1 99  ? -3.077  -9.384  5.581   1.00 0.00 ? 99  THR A OG1  4  
ATOM 6576  C CG2  . THR A 1 99  ? -4.488  -7.475  5.142   1.00 0.00 ? 99  THR A CG2  4  
ATOM 6577  H H    . THR A 1 99  ? -1.633  -7.406  6.103   1.00 0.00 ? 99  THR A H    4  
ATOM 6578  H HA   . THR A 1 99  ? -3.970  -6.950  7.699   1.00 0.00 ? 99  THR A HA   4  
ATOM 6579  H HB   . THR A 1 99  ? -4.840  -9.013  6.571   1.00 0.00 ? 99  THR A HB   4  
ATOM 6580  H HG1  . THR A 1 99  ? -2.454  -9.696  6.242   1.00 0.00 ? 99  THR A HG1  4  
ATOM 6581  H HG21 . THR A 1 99  ? -3.695  -7.265  4.439   1.00 0.00 ? 99  THR A HG21 4  
ATOM 6582  H HG22 . THR A 1 99  ? -4.789  -6.559  5.629   1.00 0.00 ? 99  THR A HG22 4  
ATOM 6583  H HG23 . THR A 1 99  ? -5.331  -7.898  4.617   1.00 0.00 ? 99  THR A HG23 4  
ATOM 6584  N N    . ALA A 1 100 ? -4.163  -9.174  9.106   1.00 0.00 ? 100 ALA A N    4  
ATOM 6585  C CA   . ALA A 1 100 ? -4.077  -10.125 10.208  1.00 0.00 ? 100 ALA A CA   4  
ATOM 6586  C C    . ALA A 1 100 ? -3.255  -11.348 9.814   1.00 0.00 ? 100 ALA A C    4  
ATOM 6587  O O    . ALA A 1 100 ? -3.127  -11.666 8.633   1.00 0.00 ? 100 ALA A O    4  
ATOM 6588  C CB   . ALA A 1 100 ? -5.470  -10.545 10.653  1.00 0.00 ? 100 ALA A CB   4  
ATOM 6589  H H    . ALA A 1 100 ? -5.044  -8.864  8.810   1.00 0.00 ? 100 ALA A H    4  
ATOM 6590  H HA   . ALA A 1 100 ? -3.594  -9.631  11.038  1.00 0.00 ? 100 ALA A HA   4  
ATOM 6591  H HB1  . ALA A 1 100 ? -5.803  -9.895  11.449  1.00 0.00 ? 100 ALA A HB1  4  
ATOM 6592  H HB2  . ALA A 1 100 ? -6.152  -10.471 9.819   1.00 0.00 ? 100 ALA A HB2  4  
ATOM 6593  H HB3  . ALA A 1 100 ? -5.443  -11.564 11.007  1.00 0.00 ? 100 ALA A HB3  4  
ATOM 6594  N N    . GLU A 1 101 ? -2.700  -12.028 10.812  1.00 0.00 ? 101 GLU A N    4  
ATOM 6595  C CA   . GLU A 1 101 ? -1.888  -13.215 10.569  1.00 0.00 ? 101 GLU A CA   4  
ATOM 6596  C C    . GLU A 1 101 ? -2.768  -14.415 10.230  1.00 0.00 ? 101 GLU A C    4  
ATOM 6597  O O    . GLU A 1 101 ? -3.430  -14.978 11.103  1.00 0.00 ? 101 GLU A O    4  
ATOM 6598  C CB   . GLU A 1 101 ? -1.025  -13.530 11.792  1.00 0.00 ? 101 GLU A CB   4  
ATOM 6599  C CG   . GLU A 1 101 ? 0.067   -14.551 11.520  1.00 0.00 ? 101 GLU A CG   4  
ATOM 6600  C CD   . GLU A 1 101 ? 1.228   -13.969 10.738  1.00 0.00 ? 101 GLU A CD   4  
ATOM 6601  O OE1  . GLU A 1 101 ? 1.793   -12.949 11.184  1.00 0.00 ? 101 GLU A OE1  4  
ATOM 6602  O OE2  . GLU A 1 101 ? 1.572   -14.535 9.679   1.00 0.00 ? 101 GLU A OE2  4  
ATOM 6603  H H    . GLU A 1 101 ? -2.838  -11.724 11.734  1.00 0.00 ? 101 GLU A H    4  
ATOM 6604  H HA   . GLU A 1 101 ? -1.243  -13.009 9.728   1.00 0.00 ? 101 GLU A HA   4  
ATOM 6605  H HB2  . GLU A 1 101 ? -0.560  -12.617 12.134  1.00 0.00 ? 101 GLU A HB2  4  
ATOM 6606  H HB3  . GLU A 1 101 ? -1.661  -13.914 12.576  1.00 0.00 ? 101 GLU A HB3  4  
ATOM 6607  H HG2  . GLU A 1 101 ? 0.438   -14.922 12.464  1.00 0.00 ? 101 GLU A HG2  4  
ATOM 6608  H HG3  . GLU A 1 101 ? -0.356  -15.369 10.955  1.00 0.00 ? 101 GLU A HG3  4  
ATOM 6609  N N    . ILE A 1 102 ? -2.769  -14.800 8.959   1.00 0.00 ? 102 ILE A N    4  
ATOM 6610  C CA   . ILE A 1 102 ? -3.566  -15.933 8.505   1.00 0.00 ? 102 ILE A CA   4  
ATOM 6611  C C    . ILE A 1 102 ? -2.677  -17.061 7.992   1.00 0.00 ? 102 ILE A C    4  
ATOM 6612  O O    . ILE A 1 102 ? -1.564  -16.823 7.524   1.00 0.00 ? 102 ILE A O    4  
ATOM 6613  C CB   . ILE A 1 102 ? -4.548  -15.521 7.392   1.00 0.00 ? 102 ILE A CB   4  
ATOM 6614  C CG1  . ILE A 1 102 ? -3.791  -14.880 6.226   1.00 0.00 ? 102 ILE A CG1  4  
ATOM 6615  C CG2  . ILE A 1 102 ? -5.598  -14.566 7.938   1.00 0.00 ? 102 ILE A CG2  4  
ATOM 6616  C CD1  . ILE A 1 102 ? -4.653  -14.635 5.008   1.00 0.00 ? 102 ILE A CD1  4  
ATOM 6617  H H    . ILE A 1 102 ? -2.221  -14.312 8.310   1.00 0.00 ? 102 ILE A H    4  
ATOM 6618  H HA   . ILE A 1 102 ? -4.139  -16.295 9.346   1.00 0.00 ? 102 ILE A HA   4  
ATOM 6619  H HB   . ILE A 1 102 ? -5.051  -16.409 7.040   1.00 0.00 ? 102 ILE A HB   4  
ATOM 6620  H HG12 . ILE A 1 102 ? -3.391  -13.930 6.544   1.00 0.00 ? 102 ILE A HG12 4  
ATOM 6621  H HG13 . ILE A 1 102 ? -2.978  -15.529 5.934   1.00 0.00 ? 102 ILE A HG13 4  
ATOM 6622  H HG21 . ILE A 1 102 ? -5.303  -13.548 7.727   1.00 0.00 ? 102 ILE A HG21 4  
ATOM 6623  H HG22 . ILE A 1 102 ? -6.548  -14.769 7.468   1.00 0.00 ? 102 ILE A HG22 4  
ATOM 6624  H HG23 . ILE A 1 102 ? -5.688  -14.701 9.005   1.00 0.00 ? 102 ILE A HG23 4  
ATOM 6625  H HD11 . ILE A 1 102 ? -4.027  -14.579 4.129   1.00 0.00 ? 102 ILE A HD11 4  
ATOM 6626  H HD12 . ILE A 1 102 ? -5.359  -15.445 4.897   1.00 0.00 ? 102 ILE A HD12 4  
ATOM 6627  H HD13 . ILE A 1 102 ? -5.189  -13.705 5.127   1.00 0.00 ? 102 ILE A HD13 4  
ATOM 6628  N N    . SER A 1 103 ? -3.177  -18.289 8.081   1.00 0.00 ? 103 SER A N    4  
ATOM 6629  C CA   . SER A 1 103 ? -2.427  -19.454 7.628   1.00 0.00 ? 103 SER A CA   4  
ATOM 6630  C C    . SER A 1 103 ? -3.344  -20.449 6.923   1.00 0.00 ? 103 SER A C    4  
ATOM 6631  O O    . SER A 1 103 ? -4.557  -20.450 7.133   1.00 0.00 ? 103 SER A O    4  
ATOM 6632  C CB   . SER A 1 103 ? -1.734  -20.133 8.811   1.00 0.00 ? 103 SER A CB   4  
ATOM 6633  O OG   . SER A 1 103 ? -2.592  -20.197 9.937   1.00 0.00 ? 103 SER A OG   4  
ATOM 6634  H H    . SER A 1 103 ? -4.071  -18.414 8.464   1.00 0.00 ? 103 SER A H    4  
ATOM 6635  H HA   . SER A 1 103 ? -1.678  -19.115 6.928   1.00 0.00 ? 103 SER A HA   4  
ATOM 6636  H HB2  . SER A 1 103 ? -1.450  -21.136 8.532   1.00 0.00 ? 103 SER A HB2  4  
ATOM 6637  H HB3  . SER A 1 103 ? -0.851  -19.570 9.077   1.00 0.00 ? 103 SER A HB3  4  
ATOM 6638  H HG   . SER A 1 103 ? -3.358  -20.735 9.725   1.00 0.00 ? 103 SER A HG   4  
ATOM 6639  N N    . ALA A 1 104 ? -2.755  -21.296 6.085   1.00 0.00 ? 104 ALA A N    4  
ATOM 6640  C CA   . ALA A 1 104 ? -3.517  -22.298 5.349   1.00 0.00 ? 104 ALA A CA   4  
ATOM 6641  C C    . ALA A 1 104 ? -2.740  -23.605 5.236   1.00 0.00 ? 104 ALA A C    4  
ATOM 6642  O O    . ALA A 1 104 ? -1.521  -23.600 5.061   1.00 0.00 ? 104 ALA A O    4  
ATOM 6643  C CB   . ALA A 1 104 ? -3.880  -21.775 3.967   1.00 0.00 ? 104 ALA A CB   4  
ATOM 6644  H H    . ALA A 1 104 ? -1.785  -21.246 5.959   1.00 0.00 ? 104 ALA A H    4  
ATOM 6645  H HA   . ALA A 1 104 ? -4.435  -22.482 5.890   1.00 0.00 ? 104 ALA A HA   4  
ATOM 6646  H HB1  . ALA A 1 104 ? -4.446  -22.527 3.437   1.00 0.00 ? 104 ALA A HB1  4  
ATOM 6647  H HB2  . ALA A 1 104 ? -4.473  -20.879 4.066   1.00 0.00 ? 104 ALA A HB2  4  
ATOM 6648  H HB3  . ALA A 1 104 ? -2.977  -21.551 3.419   1.00 0.00 ? 104 ALA A HB3  4  
ATOM 6649  N N    . ARG A 1 105 ? -3.452  -24.722 5.337   1.00 0.00 ? 105 ARG A N    4  
ATOM 6650  C CA   . ARG A 1 105 ? -2.828  -26.037 5.247   1.00 0.00 ? 105 ARG A CA   4  
ATOM 6651  C C    . ARG A 1 105 ? -2.923  -26.588 3.828   1.00 0.00 ? 105 ARG A C    4  
ATOM 6652  O O    . ARG A 1 105 ? -4.015  -26.725 3.275   1.00 0.00 ? 105 ARG A O    4  
ATOM 6653  C CB   . ARG A 1 105 ? -3.489  -27.006 6.228   1.00 0.00 ? 105 ARG A CB   4  
ATOM 6654  C CG   . ARG A 1 105 ? -2.898  -28.406 6.192   1.00 0.00 ? 105 ARG A CG   4  
ATOM 6655  C CD   . ARG A 1 105 ? -3.516  -29.299 7.256   1.00 0.00 ? 105 ARG A CD   4  
ATOM 6656  N NE   . ARG A 1 105 ? -3.317  -28.767 8.602   1.00 0.00 ? 105 ARG A NE   4  
ATOM 6657  C CZ   . ARG A 1 105 ? -4.119  -27.869 9.163   1.00 0.00 ? 105 ARG A CZ   4  
ATOM 6658  N NH1  . ARG A 1 105 ? -5.170  -27.407 8.499   1.00 0.00 ? 105 ARG A NH1  4  
ATOM 6659  N NH2  . ARG A 1 105 ? -3.872  -27.433 10.392  1.00 0.00 ? 105 ARG A NH2  4  
ATOM 6660  H H    . ARG A 1 105 ? -4.420  -24.661 5.475   1.00 0.00 ? 105 ARG A H    4  
ATOM 6661  H HA   . ARG A 1 105 ? -1.786  -25.928 5.509   1.00 0.00 ? 105 ARG A HA   4  
ATOM 6662  H HB2  . ARG A 1 105 ? -3.378  -26.618 7.230   1.00 0.00 ? 105 ARG A HB2  4  
ATOM 6663  H HB3  . ARG A 1 105 ? -4.540  -27.077 5.993   1.00 0.00 ? 105 ARG A HB3  4  
ATOM 6664  H HG2  . ARG A 1 105 ? -3.083  -28.841 5.221   1.00 0.00 ? 105 ARG A HG2  4  
ATOM 6665  H HG3  . ARG A 1 105 ? -1.833  -28.342 6.363   1.00 0.00 ? 105 ARG A HG3  4  
ATOM 6666  H HD2  . ARG A 1 105 ? -4.576  -29.383 7.066   1.00 0.00 ? 105 ARG A HD2  4  
ATOM 6667  H HD3  . ARG A 1 105 ? -3.062  -30.277 7.195   1.00 0.00 ? 105 ARG A HD3  4  
ATOM 6668  H HE   . ARG A 1 105 ? -2.547  -29.095 9.110   1.00 0.00 ? 105 ARG A HE   4  
ATOM 6669  H HH11 . ARG A 1 105 ? -5.359  -27.735 7.574   1.00 0.00 ? 105 ARG A HH11 4  
ATOM 6670  H HH12 . ARG A 1 105 ? -5.773  -26.732 8.925   1.00 0.00 ? 105 ARG A HH12 4  
ATOM 6671  H HH21 . ARG A 1 105 ? -3.081  -27.779 10.895  1.00 0.00 ? 105 ARG A HH21 4  
ATOM 6672  H HH22 . ARG A 1 105 ? -4.476  -26.758 10.813  1.00 0.00 ? 105 ARG A HH22 4  
ATOM 6673  N N    . THR A 1 106 ? -1.772  -26.903 3.242   1.00 0.00 ? 106 THR A N    4  
ATOM 6674  C CA   . THR A 1 106 ? -1.726  -27.438 1.887   1.00 0.00 ? 106 THR A CA   4  
ATOM 6675  C C    . THR A 1 106 ? -2.510  -28.741 1.783   1.00 0.00 ? 106 THR A C    4  
ATOM 6676  O O    . THR A 1 106 ? -3.022  -29.249 2.780   1.00 0.00 ? 106 THR A O    4  
ATOM 6677  C CB   . THR A 1 106 ? -0.275  -27.687 1.431   1.00 0.00 ? 106 THR A CB   4  
ATOM 6678  O OG1  . THR A 1 106 ? 0.528   -28.082 2.548   1.00 0.00 ? 106 THR A OG1  4  
ATOM 6679  C CG2  . THR A 1 106 ? 0.313   -26.438 0.793   1.00 0.00 ? 106 THR A CG2  4  
ATOM 6680  H H    . THR A 1 106 ? -0.935  -26.771 3.734   1.00 0.00 ? 106 THR A H    4  
ATOM 6681  H HA   . THR A 1 106 ? -2.169  -26.708 1.225   1.00 0.00 ? 106 THR A HA   4  
ATOM 6682  H HB   . THR A 1 106 ? -0.276  -28.482 0.699   1.00 0.00 ? 106 THR A HB   4  
ATOM 6683  H HG1  . THR A 1 106 ? 1.457   -27.981 2.327   1.00 0.00 ? 106 THR A HG1  4  
ATOM 6684  H HG21 . THR A 1 106 ? 0.382   -26.578 -0.276  1.00 0.00 ? 106 THR A HG21 4  
ATOM 6685  H HG22 . THR A 1 106 ? 1.298   -26.258 1.197   1.00 0.00 ? 106 THR A HG22 4  
ATOM 6686  H HG23 . THR A 1 106 ? -0.323  -25.592 1.004   1.00 0.00 ? 106 THR A HG23 4  
ATOM 6687  N N    . MET A 1 107 ? -2.599  -29.277 0.570   1.00 0.00 ? 107 MET A N    4  
ATOM 6688  C CA   . MET A 1 107 ? -3.320  -30.523 0.337   1.00 0.00 ? 107 MET A CA   4  
ATOM 6689  C C    . MET A 1 107 ? -2.469  -31.726 0.731   1.00 0.00 ? 107 MET A C    4  
ATOM 6690  O O    . MET A 1 107 ? -1.403  -31.956 0.161   1.00 0.00 ? 107 MET A O    4  
ATOM 6691  C CB   . MET A 1 107 ? -3.730  -30.633 -1.133  1.00 0.00 ? 107 MET A CB   4  
ATOM 6692  C CG   . MET A 1 107 ? -4.624  -29.497 -1.602  1.00 0.00 ? 107 MET A CG   4  
ATOM 6693  S SD   . MET A 1 107 ? -6.304  -29.625 -0.961  1.00 0.00 ? 107 MET A SD   4  
ATOM 6694  C CE   . MET A 1 107 ? -6.946  -28.003 -1.366  1.00 0.00 ? 107 MET A CE   4  
ATOM 6695  H H    . MET A 1 107 ? -2.170  -28.825 -0.186  1.00 0.00 ? 107 MET A H    4  
ATOM 6696  H HA   . MET A 1 107 ? -4.210  -30.510 0.949   1.00 0.00 ? 107 MET A HA   4  
ATOM 6697  H HB2  . MET A 1 107 ? -2.839  -30.637 -1.743  1.00 0.00 ? 107 MET A HB2  4  
ATOM 6698  H HB3  . MET A 1 107 ? -4.260  -31.563 -1.279  1.00 0.00 ? 107 MET A HB3  4  
ATOM 6699  H HG2  . MET A 1 107 ? -4.198  -28.561 -1.270  1.00 0.00 ? 107 MET A HG2  4  
ATOM 6700  H HG3  . MET A 1 107 ? -4.662  -29.510 -2.681  1.00 0.00 ? 107 MET A HG3  4  
ATOM 6701  H HE1  . MET A 1 107 ? -7.563  -27.646 -0.554  1.00 0.00 ? 107 MET A HE1  4  
ATOM 6702  H HE2  . MET A 1 107 ? -6.124  -27.319 -1.521  1.00 0.00 ? 107 MET A HE2  4  
ATOM 6703  H HE3  . MET A 1 107 ? -7.538  -28.065 -2.267  1.00 0.00 ? 107 MET A HE3  4  
ATOM 6704  N N    . GLN A 1 108 ? -2.947  -32.488 1.710   1.00 0.00 ? 108 GLN A N    4  
ATOM 6705  C CA   . GLN A 1 108 ? -2.228  -33.666 2.180   1.00 0.00 ? 108 GLN A CA   4  
ATOM 6706  C C    . GLN A 1 108 ? -1.868  -34.585 1.017   1.00 0.00 ? 108 GLN A C    4  
ATOM 6707  O O    . GLN A 1 108 ? -2.603  -35.521 0.703   1.00 0.00 ? 108 GLN A O    4  
ATOM 6708  C CB   . GLN A 1 108 ? -3.069  -34.427 3.206   1.00 0.00 ? 108 GLN A CB   4  
ATOM 6709  C CG   . GLN A 1 108 ? -4.473  -34.752 2.721   1.00 0.00 ? 108 GLN A CG   4  
ATOM 6710  C CD   . GLN A 1 108 ? -5.374  -35.251 3.833   1.00 0.00 ? 108 GLN A CD   4  
ATOM 6711  O OE1  . GLN A 1 108 ? -5.085  -35.061 5.015   1.00 0.00 ? 108 GLN A OE1  4  
ATOM 6712  N NE2  . GLN A 1 108 ? -6.475  -35.893 3.460   1.00 0.00 ? 108 GLN A NE2  4  
ATOM 6713  H H    . GLN A 1 108 ? -3.802  -32.252 2.125   1.00 0.00 ? 108 GLN A H    4  
ATOM 6714  H HA   . GLN A 1 108 ? -1.317  -33.331 2.653   1.00 0.00 ? 108 GLN A HA   4  
ATOM 6715  H HB2  . GLN A 1 108 ? -2.571  -35.355 3.445   1.00 0.00 ? 108 GLN A HB2  4  
ATOM 6716  H HB3  . GLN A 1 108 ? -3.151  -33.830 4.102   1.00 0.00 ? 108 GLN A HB3  4  
ATOM 6717  H HG2  . GLN A 1 108 ? -4.910  -33.859 2.298   1.00 0.00 ? 108 GLN A HG2  4  
ATOM 6718  H HG3  . GLN A 1 108 ? -4.409  -35.515 1.959   1.00 0.00 ? 108 GLN A HG3  4  
ATOM 6719  H HE21 . GLN A 1 108 ? -6.641  -36.008 2.500   1.00 0.00 ? 108 GLN A HE21 4  
ATOM 6720  H HE22 . GLN A 1 108 ? -7.075  -36.226 4.158   1.00 0.00 ? 108 GLN A HE22 4  
ATOM 6721  N N    . SER A 1 109 ? -0.734  -34.310 0.381   1.00 0.00 ? 109 SER A N    4  
ATOM 6722  C CA   . SER A 1 109 ? -0.279  -35.110 -0.750  1.00 0.00 ? 109 SER A CA   4  
ATOM 6723  C C    . SER A 1 109 ? -0.405  -36.600 -0.448  1.00 0.00 ? 109 SER A C    4  
ATOM 6724  O O    . SER A 1 109 ? -0.182  -37.037 0.680   1.00 0.00 ? 109 SER A O    4  
ATOM 6725  C CB   . SER A 1 109 ? 1.173   -34.768 -1.092  1.00 0.00 ? 109 SER A CB   4  
ATOM 6726  O OG   . SER A 1 109 ? 2.057   -35.242 -0.091  1.00 0.00 ? 109 SER A OG   4  
ATOM 6727  H H    . SER A 1 109 ? -0.191  -33.550 0.679   1.00 0.00 ? 109 SER A H    4  
ATOM 6728  H HA   . SER A 1 109 ? -0.905  -34.871 -1.597  1.00 0.00 ? 109 SER A HA   4  
ATOM 6729  H HB2  . SER A 1 109 ? 1.435   -35.226 -2.034  1.00 0.00 ? 109 SER A HB2  4  
ATOM 6730  H HB3  . SER A 1 109 ? 1.278   -33.696 -1.171  1.00 0.00 ? 109 SER A HB3  4  
ATOM 6731  H HG   . SER A 1 109 ? 1.687   -35.061 0.775   1.00 0.00 ? 109 SER A HG   4  
ATOM 6732  N N    . SER A 1 110 ? -0.766  -37.375 -1.466  1.00 0.00 ? 110 SER A N    4  
ATOM 6733  C CA   . SER A 1 110 ? -0.926  -38.816 -1.311  1.00 0.00 ? 110 SER A CA   4  
ATOM 6734  C C    . SER A 1 110 ? 0.023   -39.571 -2.236  1.00 0.00 ? 110 SER A C    4  
ATOM 6735  O O    . SER A 1 110 ? 0.038   -39.347 -3.446  1.00 0.00 ? 110 SER A O    4  
ATOM 6736  C CB   . SER A 1 110 ? -2.372  -39.223 -1.601  1.00 0.00 ? 110 SER A CB   4  
ATOM 6737  O OG   . SER A 1 110 ? -2.737  -40.373 -0.857  1.00 0.00 ? 110 SER A OG   4  
ATOM 6738  H H    . SER A 1 110 ? -0.930  -36.967 -2.343  1.00 0.00 ? 110 SER A H    4  
ATOM 6739  H HA   . SER A 1 110 ? -0.688  -39.067 -0.288  1.00 0.00 ? 110 SER A HA   4  
ATOM 6740  H HB2  . SER A 1 110 ? -3.032  -38.413 -1.334  1.00 0.00 ? 110 SER A HB2  4  
ATOM 6741  H HB3  . SER A 1 110 ? -2.477  -39.442 -2.653  1.00 0.00 ? 110 SER A HB3  4  
ATOM 6742  H HG   . SER A 1 110 ? -3.587  -40.697 -1.163  1.00 0.00 ? 110 SER A HG   4  
ATOM 6743  N N    . GLY A 1 111 ? 0.814   -40.469 -1.657  1.00 0.00 ? 111 GLY A N    4  
ATOM 6744  C CA   . GLY A 1 111 ? 1.756   -41.244 -2.443  1.00 0.00 ? 111 GLY A CA   4  
ATOM 6745  C C    . GLY A 1 111 ? 2.884   -41.810 -1.604  1.00 0.00 ? 111 GLY A C    4  
ATOM 6746  O O    . GLY A 1 111 ? 3.018   -41.505 -0.419  1.00 0.00 ? 111 GLY A O    4  
ATOM 6747  H H    . GLY A 1 111 ? 0.759   -40.606 -0.688  1.00 0.00 ? 111 GLY A H    4  
ATOM 6748  H HA2  . GLY A 1 111 ? 1.228   -42.060 -2.915  1.00 0.00 ? 111 GLY A HA2  4  
ATOM 6749  H HA3  . GLY A 1 111 ? 2.176   -40.610 -3.210  1.00 0.00 ? 111 GLY A HA3  4  
ATOM 6750  N N    . PRO A 1 112 ? 3.720   -42.657 -2.223  1.00 0.00 ? 112 PRO A N    4  
ATOM 6751  C CA   . PRO A 1 112 ? 4.857   -43.285 -1.544  1.00 0.00 ? 112 PRO A CA   4  
ATOM 6752  C C    . PRO A 1 112 ? 5.959   -42.285 -1.212  1.00 0.00 ? 112 PRO A C    4  
ATOM 6753  O O    . PRO A 1 112 ? 5.900   -41.125 -1.618  1.00 0.00 ? 112 PRO A O    4  
ATOM 6754  C CB   . PRO A 1 112 ? 5.356   -44.313 -2.563  1.00 0.00 ? 112 PRO A CB   4  
ATOM 6755  C CG   . PRO A 1 112 ? 4.921   -43.777 -3.884  1.00 0.00 ? 112 PRO A CG   4  
ATOM 6756  C CD   . PRO A 1 112 ? 3.620   -43.066 -3.635  1.00 0.00 ? 112 PRO A CD   4  
ATOM 6757  H HA   . PRO A 1 112 ? 4.549   -43.792 -0.641  1.00 0.00 ? 112 PRO A HA   4  
ATOM 6758  H HB2  . PRO A 1 112 ? 6.432   -44.390 -2.502  1.00 0.00 ? 112 PRO A HB2  4  
ATOM 6759  H HB3  . PRO A 1 112 ? 4.908   -45.274 -2.360  1.00 0.00 ? 112 PRO A HB3  4  
ATOM 6760  H HG2  . PRO A 1 112 ? 5.660   -43.087 -4.262  1.00 0.00 ? 112 PRO A HG2  4  
ATOM 6761  H HG3  . PRO A 1 112 ? 4.776   -44.591 -4.579  1.00 0.00 ? 112 PRO A HG3  4  
ATOM 6762  H HD2  . PRO A 1 112 ? 3.532   -42.205 -4.280  1.00 0.00 ? 112 PRO A HD2  4  
ATOM 6763  H HD3  . PRO A 1 112 ? 2.788   -43.738 -3.782  1.00 0.00 ? 112 PRO A HD3  4  
ATOM 6764  N N    . SER A 1 113 ? 6.964   -42.743 -0.472  1.00 0.00 ? 113 SER A N    4  
ATOM 6765  C CA   . SER A 1 113 ? 8.079   -41.887 -0.083  1.00 0.00 ? 113 SER A CA   4  
ATOM 6766  C C    . SER A 1 113 ? 9.032   -41.670 -1.255  1.00 0.00 ? 113 SER A C    4  
ATOM 6767  O O    . SER A 1 113 ? 9.846   -42.536 -1.576  1.00 0.00 ? 113 SER A O    4  
ATOM 6768  C CB   . SER A 1 113 ? 8.834   -42.502 1.096   1.00 0.00 ? 113 SER A CB   4  
ATOM 6769  O OG   . SER A 1 113 ? 7.966   -42.738 2.191   1.00 0.00 ? 113 SER A OG   4  
ATOM 6770  H H    . SER A 1 113 ? 6.954   -43.678 -0.179  1.00 0.00 ? 113 SER A H    4  
ATOM 6771  H HA   . SER A 1 113 ? 7.674   -40.932 0.218   1.00 0.00 ? 113 SER A HA   4  
ATOM 6772  H HB2  . SER A 1 113 ? 9.272   -43.440 0.790   1.00 0.00 ? 113 SER A HB2  4  
ATOM 6773  H HB3  . SER A 1 113 ? 9.616   -41.825 1.411   1.00 0.00 ? 113 SER A HB3  4  
ATOM 6774  H HG   . SER A 1 113 ? 7.076   -42.896 1.866   1.00 0.00 ? 113 SER A HG   4  
ATOM 6775  N N    . SER A 1 114 ? 8.923   -40.507 -1.890  1.00 0.00 ? 114 SER A N    4  
ATOM 6776  C CA   . SER A 1 114 ? 9.772   -40.176 -3.029  1.00 0.00 ? 114 SER A CA   4  
ATOM 6777  C C    . SER A 1 114 ? 10.991  -39.375 -2.583  1.00 0.00 ? 114 SER A C    4  
ATOM 6778  O O    . SER A 1 114 ? 10.988  -38.146 -2.621  1.00 0.00 ? 114 SER A O    4  
ATOM 6779  C CB   . SER A 1 114 ? 8.979   -39.383 -4.069  1.00 0.00 ? 114 SER A CB   4  
ATOM 6780  O OG   . SER A 1 114 ? 9.517   -39.565 -5.368  1.00 0.00 ? 114 SER A OG   4  
ATOM 6781  H H    . SER A 1 114 ? 8.255   -39.858 -1.587  1.00 0.00 ? 114 SER A H    4  
ATOM 6782  H HA   . SER A 1 114 ? 10.107  -41.102 -3.473  1.00 0.00 ? 114 SER A HA   4  
ATOM 6783  H HB2  . SER A 1 114 ? 7.953   -39.718 -4.068  1.00 0.00 ? 114 SER A HB2  4  
ATOM 6784  H HB3  . SER A 1 114 ? 9.016   -38.332 -3.821  1.00 0.00 ? 114 SER A HB3  4  
ATOM 6785  H HG   . SER A 1 114 ? 10.454  -39.764 -5.301  1.00 0.00 ? 114 SER A HG   4  
ATOM 6786  N N    . GLY A 1 115 ? 12.035  -40.083 -2.160  1.00 0.00 ? 115 GLY A N    4  
ATOM 6787  C CA   . GLY A 1 115 ? 13.247  -39.422 -1.712  1.00 0.00 ? 115 GLY A CA   4  
ATOM 6788  C C    . GLY A 1 115 ? 13.492  -39.605 -0.228  1.00 0.00 ? 115 GLY A C    4  
ATOM 6789  O O    . GLY A 1 115 ? 14.638  -39.702 0.212   1.00 0.00 ? 115 GLY A O    4  
ATOM 6790  H H    . GLY A 1 115 ? 11.981  -41.061 -2.151  1.00 0.00 ? 115 GLY A H    4  
ATOM 6791  H HA2  . GLY A 1 115 ? 14.086  -39.826 -2.258  1.00 0.00 ? 115 GLY A HA2  4  
ATOM 6792  H HA3  . GLY A 1 115 ? 13.167  -38.366 -1.925  1.00 0.00 ? 115 GLY A HA3  4  
ATOM 6793  N N    . GLY A 1 1   ? 9.872   38.758  28.844  1.00 0.00 ? 1   GLY A N    5  
ATOM 6794  C CA   . GLY A 1 1   ? 9.971   38.205  27.505  1.00 0.00 ? 1   GLY A CA   5  
ATOM 6795  C C    . GLY A 1 1   ? 8.791   37.321  27.155  1.00 0.00 ? 1   GLY A C    5  
ATOM 6796  O O    . GLY A 1 1   ? 8.472   36.382  27.885  1.00 0.00 ? 1   GLY A O    5  
ATOM 6797  H H1   . GLY A 1 1   ? 10.334  38.319  29.588  1.00 0.00 ? 1   GLY A H1   5  
ATOM 6798  H HA2  . GLY A 1 1   ? 10.022  39.017  26.795  1.00 0.00 ? 1   GLY A HA2  5  
ATOM 6799  H HA3  . GLY A 1 1   ? 10.877  37.621  27.435  1.00 0.00 ? 1   GLY A HA3  5  
ATOM 6800  N N    . SER A 1 2   ? 8.139   37.621  26.037  1.00 0.00 ? 2   SER A N    5  
ATOM 6801  C CA   . SER A 1 2   ? 6.984   36.850  25.594  1.00 0.00 ? 2   SER A CA   5  
ATOM 6802  C C    . SER A 1 2   ? 6.582   37.238  24.174  1.00 0.00 ? 2   SER A C    5  
ATOM 6803  O O    . SER A 1 2   ? 6.993   38.280  23.664  1.00 0.00 ? 2   SER A O    5  
ATOM 6804  C CB   . SER A 1 2   ? 5.805   37.065  26.546  1.00 0.00 ? 2   SER A CB   5  
ATOM 6805  O OG   . SER A 1 2   ? 5.217   38.339  26.350  1.00 0.00 ? 2   SER A OG   5  
ATOM 6806  H H    . SER A 1 2   ? 8.441   38.382  25.497  1.00 0.00 ? 2   SER A H    5  
ATOM 6807  H HA   . SER A 1 2   ? 7.258   35.805  25.605  1.00 0.00 ? 2   SER A HA   5  
ATOM 6808  H HB2  . SER A 1 2   ? 5.058   36.306  26.367  1.00 0.00 ? 2   SER A HB2  5  
ATOM 6809  H HB3  . SER A 1 2   ? 6.153   36.994  27.567  1.00 0.00 ? 2   SER A HB3  5  
ATOM 6810  H HG   . SER A 1 2   ? 5.023   38.736  27.202  1.00 0.00 ? 2   SER A HG   5  
ATOM 6811  N N    . SER A 1 3   ? 5.777   36.391  23.541  1.00 0.00 ? 3   SER A N    5  
ATOM 6812  C CA   . SER A 1 3   ? 5.322   36.642  22.179  1.00 0.00 ? 3   SER A CA   5  
ATOM 6813  C C    . SER A 1 3   ? 6.499   36.658  21.208  1.00 0.00 ? 3   SER A C    5  
ATOM 6814  O O    . SER A 1 3   ? 6.597   37.532  20.348  1.00 0.00 ? 3   SER A O    5  
ATOM 6815  C CB   . SER A 1 3   ? 4.569   37.972  22.107  1.00 0.00 ? 3   SER A CB   5  
ATOM 6816  O OG   . SER A 1 3   ? 3.866   38.095  20.882  1.00 0.00 ? 3   SER A OG   5  
ATOM 6817  H H    . SER A 1 3   ? 5.483   35.577  24.001  1.00 0.00 ? 3   SER A H    5  
ATOM 6818  H HA   . SER A 1 3   ? 4.651   35.843  21.900  1.00 0.00 ? 3   SER A HA   5  
ATOM 6819  H HB2  . SER A 1 3   ? 3.863   38.028  22.921  1.00 0.00 ? 3   SER A HB2  5  
ATOM 6820  H HB3  . SER A 1 3   ? 5.275   38.787  22.186  1.00 0.00 ? 3   SER A HB3  5  
ATOM 6821  H HG   . SER A 1 3   ? 2.924   38.004  21.043  1.00 0.00 ? 3   SER A HG   5  
ATOM 6822  N N    . GLY A 1 4   ? 7.390   35.682  21.352  1.00 0.00 ? 4   GLY A N    5  
ATOM 6823  C CA   . GLY A 1 4   ? 8.549   35.600  20.482  1.00 0.00 ? 4   GLY A CA   5  
ATOM 6824  C C    . GLY A 1 4   ? 8.426   34.493  19.454  1.00 0.00 ? 4   GLY A C    5  
ATOM 6825  O O    . GLY A 1 4   ? 8.048   33.369  19.785  1.00 0.00 ? 4   GLY A O    5  
ATOM 6826  H H    . GLY A 1 4   ? 7.260   35.011  22.055  1.00 0.00 ? 4   GLY A H    5  
ATOM 6827  H HA2  . GLY A 1 4   ? 8.666   36.543  19.968  1.00 0.00 ? 4   GLY A HA2  5  
ATOM 6828  H HA3  . GLY A 1 4   ? 9.426   35.419  21.086  1.00 0.00 ? 4   GLY A HA3  5  
ATOM 6829  N N    . SER A 1 5   ? 8.744   34.811  18.204  1.00 0.00 ? 5   SER A N    5  
ATOM 6830  C CA   . SER A 1 5   ? 8.662   33.835  17.123  1.00 0.00 ? 5   SER A CA   5  
ATOM 6831  C C    . SER A 1 5   ? 9.255   34.399  15.835  1.00 0.00 ? 5   SER A C    5  
ATOM 6832  O O    . SER A 1 5   ? 9.296   35.614  15.638  1.00 0.00 ? 5   SER A O    5  
ATOM 6833  C CB   . SER A 1 5   ? 7.207   33.423  16.889  1.00 0.00 ? 5   SER A CB   5  
ATOM 6834  O OG   . SER A 1 5   ? 7.131   32.225  16.136  1.00 0.00 ? 5   SER A OG   5  
ATOM 6835  H H    . SER A 1 5   ? 9.039   35.724  18.003  1.00 0.00 ? 5   SER A H    5  
ATOM 6836  H HA   . SER A 1 5   ? 9.231   32.966  17.417  1.00 0.00 ? 5   SER A HA   5  
ATOM 6837  H HB2  . SER A 1 5   ? 6.723   33.266  17.841  1.00 0.00 ? 5   SER A HB2  5  
ATOM 6838  H HB3  . SER A 1 5   ? 6.696   34.207  16.349  1.00 0.00 ? 5   SER A HB3  5  
ATOM 6839  H HG   . SER A 1 5   ? 6.327   31.753  16.364  1.00 0.00 ? 5   SER A HG   5  
ATOM 6840  N N    . SER A 1 6   ? 9.714   33.508  14.963  1.00 0.00 ? 6   SER A N    5  
ATOM 6841  C CA   . SER A 1 6   ? 10.309  33.916  13.695  1.00 0.00 ? 6   SER A CA   5  
ATOM 6842  C C    . SER A 1 6   ? 10.414  32.732  12.738  1.00 0.00 ? 6   SER A C    5  
ATOM 6843  O O    . SER A 1 6   ? 10.802  31.633  13.133  1.00 0.00 ? 6   SER A O    5  
ATOM 6844  C CB   . SER A 1 6   ? 11.695  34.521  13.929  1.00 0.00 ? 6   SER A CB   5  
ATOM 6845  O OG   . SER A 1 6   ? 12.080  35.347  12.845  1.00 0.00 ? 6   SER A OG   5  
ATOM 6846  H H    . SER A 1 6   ? 9.653   32.554  15.177  1.00 0.00 ? 6   SER A H    5  
ATOM 6847  H HA   . SER A 1 6   ? 9.669   34.665  13.254  1.00 0.00 ? 6   SER A HA   5  
ATOM 6848  H HB2  . SER A 1 6   ? 11.678  35.114  14.831  1.00 0.00 ? 6   SER A HB2  5  
ATOM 6849  H HB3  . SER A 1 6   ? 12.418  33.725  14.036  1.00 0.00 ? 6   SER A HB3  5  
ATOM 6850  H HG   . SER A 1 6   ? 11.631  35.059  12.047  1.00 0.00 ? 6   SER A HG   5  
ATOM 6851  N N    . GLY A 1 7   ? 10.063  32.966  11.477  1.00 0.00 ? 7   GLY A N    5  
ATOM 6852  C CA   . GLY A 1 7   ? 10.124  31.910  10.483  1.00 0.00 ? 7   GLY A CA   5  
ATOM 6853  C C    . GLY A 1 7   ? 8.791   31.212  10.297  1.00 0.00 ? 7   GLY A C    5  
ATOM 6854  O O    . GLY A 1 7   ? 8.165   30.785  11.267  1.00 0.00 ? 7   GLY A O    5  
ATOM 6855  H H    . GLY A 1 7   ? 9.761   33.862  11.220  1.00 0.00 ? 7   GLY A H    5  
ATOM 6856  H HA2  . GLY A 1 7   ? 10.430  32.337  9.539   1.00 0.00 ? 7   GLY A HA2  5  
ATOM 6857  H HA3  . GLY A 1 7   ? 10.859  31.182  10.792  1.00 0.00 ? 7   GLY A HA3  5  
ATOM 6858  N N    . ASP A 1 8   ? 8.356   31.096  9.047   1.00 0.00 ? 8   ASP A N    5  
ATOM 6859  C CA   . ASP A 1 8   ? 7.088   30.445  8.736   1.00 0.00 ? 8   ASP A CA   5  
ATOM 6860  C C    . ASP A 1 8   ? 7.123   29.825  7.343   1.00 0.00 ? 8   ASP A C    5  
ATOM 6861  O O    . ASP A 1 8   ? 7.098   30.535  6.337   1.00 0.00 ? 8   ASP A O    5  
ATOM 6862  C CB   . ASP A 1 8   ? 5.938   31.448  8.834   1.00 0.00 ? 8   ASP A CB   5  
ATOM 6863  C CG   . ASP A 1 8   ? 5.478   31.665  10.262  1.00 0.00 ? 8   ASP A CG   5  
ATOM 6864  O OD1  . ASP A 1 8   ? 6.216   32.317  11.030  1.00 0.00 ? 8   ASP A OD1  5  
ATOM 6865  O OD2  . ASP A 1 8   ? 4.380   31.184  10.611  1.00 0.00 ? 8   ASP A OD2  5  
ATOM 6866  H H    . ASP A 1 8   ? 8.900   31.456  8.316   1.00 0.00 ? 8   ASP A H    5  
ATOM 6867  H HA   . ASP A 1 8   ? 6.932   29.661  9.462   1.00 0.00 ? 8   ASP A HA   5  
ATOM 6868  H HB2  . ASP A 1 8   ? 6.261   32.397  8.431   1.00 0.00 ? 8   ASP A HB2  5  
ATOM 6869  H HB3  . ASP A 1 8   ? 5.101   31.083  8.256   1.00 0.00 ? 8   ASP A HB3  5  
ATOM 6870  N N    . ILE A 1 9   ? 7.182   28.499  7.292   1.00 0.00 ? 9   ILE A N    5  
ATOM 6871  C CA   . ILE A 1 9   ? 7.220   27.784  6.022   1.00 0.00 ? 9   ILE A CA   5  
ATOM 6872  C C    . ILE A 1 9   ? 6.005   26.875  5.866   1.00 0.00 ? 9   ILE A C    5  
ATOM 6873  O O    . ILE A 1 9   ? 5.255   26.658  6.817   1.00 0.00 ? 9   ILE A O    5  
ATOM 6874  C CB   . ILE A 1 9   ? 8.500   26.938  5.891   1.00 0.00 ? 9   ILE A CB   5  
ATOM 6875  C CG1  . ILE A 1 9   ? 8.580   25.915  7.025   1.00 0.00 ? 9   ILE A CG1  5  
ATOM 6876  C CG2  . ILE A 1 9   ? 9.729   27.834  5.890   1.00 0.00 ? 9   ILE A CG2  5  
ATOM 6877  C CD1  . ILE A 1 9   ? 9.397   24.690  6.678   1.00 0.00 ? 9   ILE A CD1  5  
ATOM 6878  H H    . ILE A 1 9   ? 7.199   27.989  8.128   1.00 0.00 ? 9   ILE A H    5  
ATOM 6879  H HA   . ILE A 1 9   ? 7.213   28.516  5.228   1.00 0.00 ? 9   ILE A HA   5  
ATOM 6880  H HB   . ILE A 1 9   ? 8.464   26.416  4.947   1.00 0.00 ? 9   ILE A HB   5  
ATOM 6881  H HG12 . ILE A 1 9   ? 9.030   26.379  7.889   1.00 0.00 ? 9   ILE A HG12 5  
ATOM 6882  H HG13 . ILE A 1 9   ? 7.581   25.588  7.276   1.00 0.00 ? 9   ILE A HG13 5  
ATOM 6883  H HG21 . ILE A 1 9   ? 9.475   28.794  6.315   1.00 0.00 ? 9   ILE A HG21 5  
ATOM 6884  H HG22 . ILE A 1 9   ? 10.508  27.376  6.481   1.00 0.00 ? 9   ILE A HG22 5  
ATOM 6885  H HG23 . ILE A 1 9   ? 10.077  27.969  4.877   1.00 0.00 ? 9   ILE A HG23 5  
ATOM 6886  H HD11 . ILE A 1 9   ? 9.914   24.855  5.744   1.00 0.00 ? 9   ILE A HD11 5  
ATOM 6887  H HD12 . ILE A 1 9   ? 10.117  24.503  7.460   1.00 0.00 ? 9   ILE A HD12 5  
ATOM 6888  H HD13 . ILE A 1 9   ? 8.742   23.836  6.580   1.00 0.00 ? 9   ILE A HD13 5  
ATOM 6889  N N    . GLN A 1 10  ? 5.820   26.346  4.661   1.00 0.00 ? 10  GLN A N    5  
ATOM 6890  C CA   . GLN A 1 10  ? 4.697   25.460  4.381   1.00 0.00 ? 10  GLN A CA   5  
ATOM 6891  C C    . GLN A 1 10  ? 5.177   24.032  4.143   1.00 0.00 ? 10  GLN A C    5  
ATOM 6892  O O    . GLN A 1 10  ? 5.869   23.754  3.164   1.00 0.00 ? 10  GLN A O    5  
ATOM 6893  C CB   . GLN A 1 10  ? 3.917   25.959  3.163   1.00 0.00 ? 10  GLN A CB   5  
ATOM 6894  C CG   . GLN A 1 10  ? 2.501   25.412  3.082   1.00 0.00 ? 10  GLN A CG   5  
ATOM 6895  C CD   . GLN A 1 10  ? 1.607   26.239  2.179   1.00 0.00 ? 10  GLN A CD   5  
ATOM 6896  O OE1  . GLN A 1 10  ? 2.008   27.294  1.687   1.00 0.00 ? 10  GLN A OE1  5  
ATOM 6897  N NE2  . GLN A 1 10  ? 0.388   25.763  1.955   1.00 0.00 ? 10  GLN A NE2  5  
ATOM 6898  H H    . GLN A 1 10  ? 6.453   26.557  3.944   1.00 0.00 ? 10  GLN A H    5  
ATOM 6899  H HA   . GLN A 1 10  ? 4.045   25.468  5.242   1.00 0.00 ? 10  GLN A HA   5  
ATOM 6900  H HB2  . GLN A 1 10  ? 3.862   27.036  3.202   1.00 0.00 ? 10  GLN A HB2  5  
ATOM 6901  H HB3  . GLN A 1 10  ? 4.445   25.665  2.268   1.00 0.00 ? 10  GLN A HB3  5  
ATOM 6902  H HG2  . GLN A 1 10  ? 2.540   24.403  2.697   1.00 0.00 ? 10  GLN A HG2  5  
ATOM 6903  H HG3  . GLN A 1 10  ? 2.075   25.402  4.074   1.00 0.00 ? 10  GLN A HG3  5  
ATOM 6904  H HE21 . GLN A 1 10  ? 0.137   24.916  2.381   1.00 0.00 ? 10  GLN A HE21 5  
ATOM 6905  H HE22 . GLN A 1 10  ? -0.211  26.278  1.376   1.00 0.00 ? 10  GLN A HE22 5  
ATOM 6906  N N    . VAL A 1 11  ? 4.804   23.129  5.044   1.00 0.00 ? 11  VAL A N    5  
ATOM 6907  C CA   . VAL A 1 11  ? 5.195   21.729  4.931   1.00 0.00 ? 11  VAL A CA   5  
ATOM 6908  C C    . VAL A 1 11  ? 4.019   20.863  4.494   1.00 0.00 ? 11  VAL A C    5  
ATOM 6909  O O    . VAL A 1 11  ? 3.116   20.583  5.282   1.00 0.00 ? 11  VAL A O    5  
ATOM 6910  C CB   . VAL A 1 11  ? 5.747   21.191  6.265   1.00 0.00 ? 11  VAL A CB   5  
ATOM 6911  C CG1  . VAL A 1 11  ? 6.136   19.727  6.131   1.00 0.00 ? 11  VAL A CG1  5  
ATOM 6912  C CG2  . VAL A 1 11  ? 6.932   22.026  6.726   1.00 0.00 ? 11  VAL A CG2  5  
ATOM 6913  H H    . VAL A 1 11  ? 4.251   23.411  5.803   1.00 0.00 ? 11  VAL A H    5  
ATOM 6914  H HA   . VAL A 1 11  ? 5.977   21.660  4.188   1.00 0.00 ? 11  VAL A HA   5  
ATOM 6915  H HB   . VAL A 1 11  ? 4.969   21.267  7.010   1.00 0.00 ? 11  VAL A HB   5  
ATOM 6916  H HG11 . VAL A 1 11  ? 7.203   19.625  6.266   1.00 0.00 ? 11  VAL A HG11 5  
ATOM 6917  H HG12 . VAL A 1 11  ? 5.619   19.147  6.881   1.00 0.00 ? 11  VAL A HG12 5  
ATOM 6918  H HG13 . VAL A 1 11  ? 5.863   19.371  5.148   1.00 0.00 ? 11  VAL A HG13 5  
ATOM 6919  H HG21 . VAL A 1 11  ? 7.695   22.021  5.962   1.00 0.00 ? 11  VAL A HG21 5  
ATOM 6920  H HG22 . VAL A 1 11  ? 6.610   23.042  6.905   1.00 0.00 ? 11  VAL A HG22 5  
ATOM 6921  H HG23 . VAL A 1 11  ? 7.333   21.610  7.638   1.00 0.00 ? 11  VAL A HG23 5  
ATOM 6922  N N    . ILE A 1 12  ? 4.038   20.442  3.234   1.00 0.00 ? 12  ILE A N    5  
ATOM 6923  C CA   . ILE A 1 12  ? 2.974   19.605  2.693   1.00 0.00 ? 12  ILE A CA   5  
ATOM 6924  C C    . ILE A 1 12  ? 3.084   18.174  3.208   1.00 0.00 ? 12  ILE A C    5  
ATOM 6925  O O    . ILE A 1 12  ? 4.182   17.635  3.350   1.00 0.00 ? 12  ILE A O    5  
ATOM 6926  C CB   . ILE A 1 12  ? 2.999   19.589  1.153   1.00 0.00 ? 12  ILE A CB   5  
ATOM 6927  C CG1  . ILE A 1 12  ? 2.844   21.008  0.603   1.00 0.00 ? 12  ILE A CG1  5  
ATOM 6928  C CG2  . ILE A 1 12  ? 1.901   18.683  0.615   1.00 0.00 ? 12  ILE A CG2  5  
ATOM 6929  C CD1  . ILE A 1 12  ? 4.153   21.757  0.485   1.00 0.00 ? 12  ILE A CD1  5  
ATOM 6930  H H    . ILE A 1 12  ? 4.786   20.698  2.655   1.00 0.00 ? 12  ILE A H    5  
ATOM 6931  H HA   . ILE A 1 12  ? 2.029   20.020  3.013   1.00 0.00 ? 12  ILE A HA   5  
ATOM 6932  H HB   . ILE A 1 12  ? 3.950   19.189  0.835   1.00 0.00 ? 12  ILE A HB   5  
ATOM 6933  H HG12 . ILE A 1 12  ? 2.401   20.961  -0.379  1.00 0.00 ? 12  ILE A HG12 5  
ATOM 6934  H HG13 . ILE A 1 12  ? 2.197   21.571  1.260   1.00 0.00 ? 12  ILE A HG13 5  
ATOM 6935  H HG21 . ILE A 1 12  ? 0.955   19.202  0.657   1.00 0.00 ? 12  ILE A HG21 5  
ATOM 6936  H HG22 . ILE A 1 12  ? 2.122   18.420  -0.408  1.00 0.00 ? 12  ILE A HG22 5  
ATOM 6937  H HG23 . ILE A 1 12  ? 1.848   17.787  1.214   1.00 0.00 ? 12  ILE A HG23 5  
ATOM 6938  H HD11 . ILE A 1 12  ? 4.382   22.234  1.427   1.00 0.00 ? 12  ILE A HD11 5  
ATOM 6939  H HD12 . ILE A 1 12  ? 4.942   21.066  0.230   1.00 0.00 ? 12  ILE A HD12 5  
ATOM 6940  H HD13 . ILE A 1 12  ? 4.070   22.508  -0.287  1.00 0.00 ? 12  ILE A HD13 5  
ATOM 6941  N N    . THR A 1 13  ? 1.937   17.561  3.485   1.00 0.00 ? 13  THR A N    5  
ATOM 6942  C CA   . THR A 1 13  ? 1.903   16.192  3.983   1.00 0.00 ? 13  THR A CA   5  
ATOM 6943  C C    . THR A 1 13  ? 2.073   15.189  2.848   1.00 0.00 ? 13  THR A C    5  
ATOM 6944  O O    . THR A 1 13  ? 1.272   14.268  2.697   1.00 0.00 ? 13  THR A O    5  
ATOM 6945  C CB   . THR A 1 13  ? 0.584   15.895  4.722   1.00 0.00 ? 13  THR A CB   5  
ATOM 6946  O OG1  . THR A 1 13  ? 0.191   17.032  5.498   1.00 0.00 ? 13  THR A OG1  5  
ATOM 6947  C CG2  . THR A 1 13  ? 0.732   14.682  5.628   1.00 0.00 ? 13  THR A CG2  5  
ATOM 6948  H H    . THR A 1 13  ? 1.094   18.043  3.351   1.00 0.00 ? 13  THR A H    5  
ATOM 6949  H HA   . THR A 1 13  ? 2.718   16.071  4.682   1.00 0.00 ? 13  THR A HA   5  
ATOM 6950  H HB   . THR A 1 13  ? -0.182  15.687  3.988   1.00 0.00 ? 13  THR A HB   5  
ATOM 6951  H HG1  . THR A 1 13  ? 0.947   17.359  5.993   1.00 0.00 ? 13  THR A HG1  5  
ATOM 6952  H HG21 . THR A 1 13  ? -0.184  14.111  5.617   1.00 0.00 ? 13  THR A HG21 5  
ATOM 6953  H HG22 . THR A 1 13  ? 0.942   15.009  6.635   1.00 0.00 ? 13  THR A HG22 5  
ATOM 6954  H HG23 . THR A 1 13  ? 1.544   14.066  5.273   1.00 0.00 ? 13  THR A HG23 5  
ATOM 6955  N N    . GLN A 1 14  ? 3.122   15.375  2.052   1.00 0.00 ? 14  GLN A N    5  
ATOM 6956  C CA   . GLN A 1 14  ? 3.396   14.485  0.930   1.00 0.00 ? 14  GLN A CA   5  
ATOM 6957  C C    . GLN A 1 14  ? 3.343   13.025  1.367   1.00 0.00 ? 14  GLN A C    5  
ATOM 6958  O O    . GLN A 1 14  ? 2.597   12.224  0.804   1.00 0.00 ? 14  GLN A O    5  
ATOM 6959  C CB   . GLN A 1 14  ? 4.766   14.799  0.326   1.00 0.00 ? 14  GLN A CB   5  
ATOM 6960  C CG   . GLN A 1 14  ? 4.884   16.217  -0.210  1.00 0.00 ? 14  GLN A CG   5  
ATOM 6961  C CD   . GLN A 1 14  ? 6.016   16.372  -1.206  1.00 0.00 ? 14  GLN A CD   5  
ATOM 6962  O OE1  . GLN A 1 14  ? 7.171   16.073  -0.902  1.00 0.00 ? 14  GLN A OE1  5  
ATOM 6963  N NE2  . GLN A 1 14  ? 5.691   16.842  -2.404  1.00 0.00 ? 14  GLN A NE2  5  
ATOM 6964  H H    . GLN A 1 14  ? 3.725   16.128  2.224   1.00 0.00 ? 14  GLN A H    5  
ATOM 6965  H HA   . GLN A 1 14  ? 2.636   14.652  0.182   1.00 0.00 ? 14  GLN A HA   5  
ATOM 6966  H HB2  . GLN A 1 14  ? 5.521   14.660  1.085   1.00 0.00 ? 14  GLN A HB2  5  
ATOM 6967  H HB3  . GLN A 1 14  ? 4.953   14.114  -0.487  1.00 0.00 ? 14  GLN A HB3  5  
ATOM 6968  H HG2  . GLN A 1 14  ? 3.958   16.482  -0.698  1.00 0.00 ? 14  GLN A HG2  5  
ATOM 6969  H HG3  . GLN A 1 14  ? 5.058   16.888  0.619   1.00 0.00 ? 14  GLN A HG3  5  
ATOM 6970  H HE21 . GLN A 1 14  ? 4.750   17.060  -2.576  1.00 0.00 ? 14  GLN A HE21 5  
ATOM 6971  H HE22 . GLN A 1 14  ? 6.403   16.953  -3.067  1.00 0.00 ? 14  GLN A HE22 5  
ATOM 6972  N N    . THR A 1 15  ? 4.139   12.685  2.376   1.00 0.00 ? 15  THR A N    5  
ATOM 6973  C CA   . THR A 1 15  ? 4.184   11.321  2.888   1.00 0.00 ? 15  THR A CA   5  
ATOM 6974  C C    . THR A 1 15  ? 2.792   10.699  2.918   1.00 0.00 ? 15  THR A C    5  
ATOM 6975  O O    . THR A 1 15  ? 1.861   11.265  3.489   1.00 0.00 ? 15  THR A O    5  
ATOM 6976  C CB   . THR A 1 15  ? 4.786   11.273  4.305   1.00 0.00 ? 15  THR A CB   5  
ATOM 6977  O OG1  . THR A 1 15  ? 6.033   11.976  4.331   1.00 0.00 ? 15  THR A OG1  5  
ATOM 6978  C CG2  . THR A 1 15  ? 4.999   9.835   4.753   1.00 0.00 ? 15  THR A CG2  5  
ATOM 6979  H H    . THR A 1 15  ? 4.711   13.369  2.784   1.00 0.00 ? 15  THR A H    5  
ATOM 6980  H HA   . THR A 1 15  ? 4.814   10.739  2.231   1.00 0.00 ? 15  THR A HA   5  
ATOM 6981  H HB   . THR A 1 15  ? 4.098   11.749  4.989   1.00 0.00 ? 15  THR A HB   5  
ATOM 6982  H HG1  . THR A 1 15  ? 6.594   11.607  5.018   1.00 0.00 ? 15  THR A HG1  5  
ATOM 6983  H HG21 . THR A 1 15  ? 4.081   9.279   4.631   1.00 0.00 ? 15  THR A HG21 5  
ATOM 6984  H HG22 . THR A 1 15  ? 5.293   9.821   5.792   1.00 0.00 ? 15  THR A HG22 5  
ATOM 6985  H HG23 . THR A 1 15  ? 5.775   9.383   4.154   1.00 0.00 ? 15  THR A HG23 5  
ATOM 6986  N N    . GLY A 1 16  ? 2.658   9.530   2.299   1.00 0.00 ? 16  GLY A N    5  
ATOM 6987  C CA   . GLY A 1 16  ? 1.376   8.850   2.268   1.00 0.00 ? 16  GLY A CA   5  
ATOM 6988  C C    . GLY A 1 16  ? 1.517   7.358   2.044   1.00 0.00 ? 16  GLY A C    5  
ATOM 6989  O O    . GLY A 1 16  ? 2.397   6.913   1.306   1.00 0.00 ? 16  GLY A O    5  
ATOM 6990  H H    . GLY A 1 16  ? 3.436   9.126   1.860   1.00 0.00 ? 16  GLY A H    5  
ATOM 6991  H HA2  . GLY A 1 16  ? 0.870   9.017   3.206   1.00 0.00 ? 16  GLY A HA2  5  
ATOM 6992  H HA3  . GLY A 1 16  ? 0.780   9.268   1.469   1.00 0.00 ? 16  GLY A HA3  5  
ATOM 6993  N N    . VAL A 1 17  ? 0.649   6.581   2.683   1.00 0.00 ? 17  VAL A N    5  
ATOM 6994  C CA   . VAL A 1 17  ? 0.680   5.129   2.551   1.00 0.00 ? 17  VAL A CA   5  
ATOM 6995  C C    . VAL A 1 17  ? -0.724  4.563   2.369   1.00 0.00 ? 17  VAL A C    5  
ATOM 6996  O O    . VAL A 1 17  ? -1.706  5.092   2.891   1.00 0.00 ? 17  VAL A O    5  
ATOM 6997  C CB   . VAL A 1 17  ? 1.333   4.468   3.779   1.00 0.00 ? 17  VAL A CB   5  
ATOM 6998  C CG1  . VAL A 1 17  ? 2.691   5.092   4.063   1.00 0.00 ? 17  VAL A CG1  5  
ATOM 6999  C CG2  . VAL A 1 17  ? 0.421   4.579   4.992   1.00 0.00 ? 17  VAL A CG2  5  
ATOM 7000  H H    . VAL A 1 17  ? -0.030  6.994   3.257   1.00 0.00 ? 17  VAL A H    5  
ATOM 7001  H HA   . VAL A 1 17  ? 1.271   4.886   1.680   1.00 0.00 ? 17  VAL A HA   5  
ATOM 7002  H HB   . VAL A 1 17  ? 1.482   3.420   3.562   1.00 0.00 ? 17  VAL A HB   5  
ATOM 7003  H HG11 . VAL A 1 17  ? 2.767   6.038   3.547   1.00 0.00 ? 17  VAL A HG11 5  
ATOM 7004  H HG12 . VAL A 1 17  ? 2.799   5.251   5.126   1.00 0.00 ? 17  VAL A HG12 5  
ATOM 7005  H HG13 . VAL A 1 17  ? 3.471   4.430   3.716   1.00 0.00 ? 17  VAL A HG13 5  
ATOM 7006  H HG21 . VAL A 1 17  ? 0.782   3.928   5.773   1.00 0.00 ? 17  VAL A HG21 5  
ATOM 7007  H HG22 . VAL A 1 17  ? 0.417   5.599   5.347   1.00 0.00 ? 17  VAL A HG22 5  
ATOM 7008  H HG23 . VAL A 1 17  ? -0.582  4.290   4.716   1.00 0.00 ? 17  VAL A HG23 5  
ATOM 7009  N N    . PRO A 1 18  ? -0.824  3.461   1.612   1.00 0.00 ? 18  PRO A N    5  
ATOM 7010  C CA   . PRO A 1 18  ? -2.104  2.798   1.344   1.00 0.00 ? 18  PRO A CA   5  
ATOM 7011  C C    . PRO A 1 18  ? -2.674  2.117   2.583   1.00 0.00 ? 18  PRO A C    5  
ATOM 7012  O O    . PRO A 1 18  ? -1.997  1.995   3.603   1.00 0.00 ? 18  PRO A O    5  
ATOM 7013  C CB   . PRO A 1 18  ? -1.748  1.758   0.278   1.00 0.00 ? 18  PRO A CB   5  
ATOM 7014  C CG   . PRO A 1 18  ? -0.299  1.483   0.486   1.00 0.00 ? 18  PRO A CG   5  
ATOM 7015  C CD   . PRO A 1 18  ? 0.304   2.776   0.958   1.00 0.00 ? 18  PRO A CD   5  
ATOM 7016  H HA   . PRO A 1 18  ? -2.833  3.489   0.946   1.00 0.00 ? 18  PRO A HA   5  
ATOM 7017  H HB2  . PRO A 1 18  ? -2.345  0.869   0.426   1.00 0.00 ? 18  PRO A HB2  5  
ATOM 7018  H HB3  . PRO A 1 18  ? -1.936  2.165   -0.704  1.00 0.00 ? 18  PRO A HB3  5  
ATOM 7019  H HG2  . PRO A 1 18  ? -0.175  0.715   1.234   1.00 0.00 ? 18  PRO A HG2  5  
ATOM 7020  H HG3  . PRO A 1 18  ? 0.153   1.177   -0.446  1.00 0.00 ? 18  PRO A HG3  5  
ATOM 7021  H HD2  . PRO A 1 18  ? 1.100   2.586   1.663   1.00 0.00 ? 18  PRO A HD2  5  
ATOM 7022  H HD3  . PRO A 1 18  ? 0.670   3.351   0.120   1.00 0.00 ? 18  PRO A HD3  5  
ATOM 7023  N N    . GLY A 1 19  ? -3.924  1.674   2.487   1.00 0.00 ? 19  GLY A N    5  
ATOM 7024  C CA   . GLY A 1 19  ? -4.564  1.010   3.608   1.00 0.00 ? 19  GLY A CA   5  
ATOM 7025  C C    . GLY A 1 19  ? -4.685  -0.487  3.403   1.00 0.00 ? 19  GLY A C    5  
ATOM 7026  O O    . GLY A 1 19  ? -5.165  -0.940  2.364   1.00 0.00 ? 19  GLY A O    5  
ATOM 7027  H H    . GLY A 1 19  ? -4.416  1.799   1.649   1.00 0.00 ? 19  GLY A H    5  
ATOM 7028  H HA2  . GLY A 1 19  ? -3.985  1.195   4.500   1.00 0.00 ? 19  GLY A HA2  5  
ATOM 7029  H HA3  . GLY A 1 19  ? -5.553  1.425   3.740   1.00 0.00 ? 19  GLY A HA3  5  
ATOM 7030  N N    . GLN A 1 20  ? -4.248  -1.256  4.395   1.00 0.00 ? 20  GLN A N    5  
ATOM 7031  C CA   . GLN A 1 20  ? -4.308  -2.711  4.316   1.00 0.00 ? 20  GLN A CA   5  
ATOM 7032  C C    . GLN A 1 20  ? -5.558  -3.164  3.570   1.00 0.00 ? 20  GLN A C    5  
ATOM 7033  O O    . GLN A 1 20  ? -6.627  -2.562  3.676   1.00 0.00 ? 20  GLN A O    5  
ATOM 7034  C CB   . GLN A 1 20  ? -4.288  -3.319  5.720   1.00 0.00 ? 20  GLN A CB   5  
ATOM 7035  C CG   . GLN A 1 20  ? -5.482  -2.922  6.572   1.00 0.00 ? 20  GLN A CG   5  
ATOM 7036  C CD   . GLN A 1 20  ? -5.450  -3.551  7.951   1.00 0.00 ? 20  GLN A CD   5  
ATOM 7037  O OE1  . GLN A 1 20  ? -5.222  -2.870  8.951   1.00 0.00 ? 20  GLN A OE1  5  
ATOM 7038  N NE2  . GLN A 1 20  ? -5.678  -4.858  8.012   1.00 0.00 ? 20  GLN A NE2  5  
ATOM 7039  H H    . GLN A 1 20  ? -3.876  -0.835  5.197   1.00 0.00 ? 20  GLN A H    5  
ATOM 7040  H HA   . GLN A 1 20  ? -3.438  -3.049  3.775   1.00 0.00 ? 20  GLN A HA   5  
ATOM 7041  H HB2  . GLN A 1 20  ? -4.277  -4.395  5.632   1.00 0.00 ? 20  GLN A HB2  5  
ATOM 7042  H HB3  . GLN A 1 20  ? -3.390  -2.998  6.226   1.00 0.00 ? 20  GLN A HB3  5  
ATOM 7043  H HG2  . GLN A 1 20  ? -5.488  -1.848  6.684   1.00 0.00 ? 20  GLN A HG2  5  
ATOM 7044  H HG3  . GLN A 1 20  ? -6.386  -3.236  6.070   1.00 0.00 ? 20  GLN A HG3  5  
ATOM 7045  H HE21 . GLN A 1 20  ? -5.851  -5.337  7.173   1.00 0.00 ? 20  GLN A HE21 5  
ATOM 7046  H HE22 . GLN A 1 20  ? -5.662  -5.290  8.890   1.00 0.00 ? 20  GLN A HE22 5  
ATOM 7047  N N    . PRO A 1 21  ? -5.424  -4.252  2.796   1.00 0.00 ? 21  PRO A N    5  
ATOM 7048  C CA   . PRO A 1 21  ? -6.533  -4.810  2.017   1.00 0.00 ? 21  PRO A CA   5  
ATOM 7049  C C    . PRO A 1 21  ? -7.598  -5.451  2.901   1.00 0.00 ? 21  PRO A C    5  
ATOM 7050  O O    . PRO A 1 21  ? -7.343  -5.776  4.062   1.00 0.00 ? 21  PRO A O    5  
ATOM 7051  C CB   . PRO A 1 21  ? -5.855  -5.869  1.144   1.00 0.00 ? 21  PRO A CB   5  
ATOM 7052  C CG   . PRO A 1 21  ? -4.633  -6.259  1.902   1.00 0.00 ? 21  PRO A CG   5  
ATOM 7053  C CD   . PRO A 1 21  ? -4.180  -5.019  2.622   1.00 0.00 ? 21  PRO A CD   5  
ATOM 7054  H HA   . PRO A 1 21  ? -6.992  -4.062  1.387   1.00 0.00 ? 21  PRO A HA   5  
ATOM 7055  H HB2  . PRO A 1 21  ? -6.522  -6.709  1.010   1.00 0.00 ? 21  PRO A HB2  5  
ATOM 7056  H HB3  . PRO A 1 21  ? -5.605  -5.444  0.184   1.00 0.00 ? 21  PRO A HB3  5  
ATOM 7057  H HG2  . PRO A 1 21  ? -4.872  -7.038  2.610   1.00 0.00 ? 21  PRO A HG2  5  
ATOM 7058  H HG3  . PRO A 1 21  ? -3.868  -6.595  1.217   1.00 0.00 ? 21  PRO A HG3  5  
ATOM 7059  H HD2  . PRO A 1 21  ? -3.748  -5.275  3.579   1.00 0.00 ? 21  PRO A HD2  5  
ATOM 7060  H HD3  . PRO A 1 21  ? -3.470  -4.471  2.020   1.00 0.00 ? 21  PRO A HD3  5  
ATOM 7061  N N    . LEU A 1 22  ? -8.791  -5.630  2.346   1.00 0.00 ? 22  LEU A N    5  
ATOM 7062  C CA   . LEU A 1 22  ? -9.896  -6.233  3.084   1.00 0.00 ? 22  LEU A CA   5  
ATOM 7063  C C    . LEU A 1 22  ? -10.229 -7.616  2.533   1.00 0.00 ? 22  LEU A C    5  
ATOM 7064  O O    . LEU A 1 22  ? -9.730  -8.012  1.481   1.00 0.00 ? 22  LEU A O    5  
ATOM 7065  C CB   . LEU A 1 22  ? -11.131 -5.333  3.017   1.00 0.00 ? 22  LEU A CB   5  
ATOM 7066  C CG   . LEU A 1 22  ? -10.912 -3.865  3.382   1.00 0.00 ? 22  LEU A CG   5  
ATOM 7067  C CD1  . LEU A 1 22  ? -11.917 -2.980  2.660   1.00 0.00 ? 22  LEU A CD1  5  
ATOM 7068  C CD2  . LEU A 1 22  ? -11.012 -3.668  4.888   1.00 0.00 ? 22  LEU A CD2  5  
ATOM 7069  H H    . LEU A 1 22  ? -8.934  -5.351  1.418   1.00 0.00 ? 22  LEU A H    5  
ATOM 7070  H HA   . LEU A 1 22  ? -9.589  -6.334  4.115   1.00 0.00 ? 22  LEU A HA   5  
ATOM 7071  H HB2  . LEU A 1 22  ? -11.512 -5.370  2.009   1.00 0.00 ? 22  LEU A HB2  5  
ATOM 7072  H HB3  . LEU A 1 22  ? -11.870 -5.737  3.695   1.00 0.00 ? 22  LEU A HB3  5  
ATOM 7073  H HG   . LEU A 1 22  ? -9.921  -3.567  3.070   1.00 0.00 ? 22  LEU A HG   5  
ATOM 7074  H HD11 . LEU A 1 22  ? -12.499 -3.580  1.977   1.00 0.00 ? 22  LEU A HD11 5  
ATOM 7075  H HD12 . LEU A 1 22  ? -11.391 -2.215  2.108   1.00 0.00 ? 22  LEU A HD12 5  
ATOM 7076  H HD13 . LEU A 1 22  ? -12.572 -2.516  3.382   1.00 0.00 ? 22  LEU A HD13 5  
ATOM 7077  H HD21 . LEU A 1 22  ? -10.020 -3.655  5.315   1.00 0.00 ? 22  LEU A HD21 5  
ATOM 7078  H HD22 . LEU A 1 22  ? -11.579 -4.480  5.320   1.00 0.00 ? 22  LEU A HD22 5  
ATOM 7079  H HD23 . LEU A 1 22  ? -11.506 -2.731  5.097   1.00 0.00 ? 22  LEU A HD23 5  
ATOM 7080  N N    . ASN A 1 23  ? -11.078 -8.344  3.251   1.00 0.00 ? 23  ASN A N    5  
ATOM 7081  C CA   . ASN A 1 23  ? -11.479 -9.682  2.832   1.00 0.00 ? 23  ASN A CA   5  
ATOM 7082  C C    . ASN A 1 23  ? -10.261 -10.533 2.487   1.00 0.00 ? 23  ASN A C    5  
ATOM 7083  O O    . ASN A 1 23  ? -10.261 -11.263 1.495   1.00 0.00 ? 23  ASN A O    5  
ATOM 7084  C CB   . ASN A 1 23  ? -12.418 -9.602  1.627   1.00 0.00 ? 23  ASN A CB   5  
ATOM 7085  C CG   . ASN A 1 23  ? -13.763 -8.998  1.981   1.00 0.00 ? 23  ASN A CG   5  
ATOM 7086  O OD1  . ASN A 1 23  ? -14.679 -9.702  2.409   1.00 0.00 ? 23  ASN A OD1  5  
ATOM 7087  N ND2  . ASN A 1 23  ? -13.889 -7.688  1.803   1.00 0.00 ? 23  ASN A ND2  5  
ATOM 7088  H H    . ASN A 1 23  ? -11.442 -7.974  4.081   1.00 0.00 ? 23  ASN A H    5  
ATOM 7089  H HA   . ASN A 1 23  ? -12.004 -10.144 3.656   1.00 0.00 ? 23  ASN A HA   5  
ATOM 7090  H HB2  . ASN A 1 23  ? -11.961 -8.991  0.862   1.00 0.00 ? 23  ASN A HB2  5  
ATOM 7091  H HB3  . ASN A 1 23  ? -12.581 -10.596 1.237   1.00 0.00 ? 23  ASN A HB3  5  
ATOM 7092  H HD21 . ASN A 1 23  ? -13.118 -7.192  1.458   1.00 0.00 ? 23  ASN A HD21 5  
ATOM 7093  H HD22 . ASN A 1 23  ? -14.748 -7.272  2.024   1.00 0.00 ? 23  ASN A HD22 5  
ATOM 7094  N N    . PHE A 1 24  ? -9.224  -10.434 3.311   1.00 0.00 ? 24  PHE A N    5  
ATOM 7095  C CA   . PHE A 1 24  ? -7.998  -11.193 3.093   1.00 0.00 ? 24  PHE A CA   5  
ATOM 7096  C C    . PHE A 1 24  ? -8.126  -12.605 3.658   1.00 0.00 ? 24  PHE A C    5  
ATOM 7097  O O    . PHE A 1 24  ? -8.399  -12.790 4.844   1.00 0.00 ? 24  PHE A O    5  
ATOM 7098  C CB   . PHE A 1 24  ? -6.809  -10.479 3.739   1.00 0.00 ? 24  PHE A CB   5  
ATOM 7099  C CG   . PHE A 1 24  ? -5.503  -11.197 3.548   1.00 0.00 ? 24  PHE A CG   5  
ATOM 7100  C CD1  . PHE A 1 24  ? -5.099  -11.605 2.287   1.00 0.00 ? 24  PHE A CD1  5  
ATOM 7101  C CD2  . PHE A 1 24  ? -4.680  -11.464 4.630   1.00 0.00 ? 24  PHE A CD2  5  
ATOM 7102  C CE1  . PHE A 1 24  ? -3.899  -12.267 2.110   1.00 0.00 ? 24  PHE A CE1  5  
ATOM 7103  C CE2  . PHE A 1 24  ? -3.478  -12.125 4.459   1.00 0.00 ? 24  PHE A CE2  5  
ATOM 7104  C CZ   . PHE A 1 24  ? -3.087  -12.526 3.197   1.00 0.00 ? 24  PHE A CZ   5  
ATOM 7105  H H    . PHE A 1 24  ? -9.284  -9.834  4.085   1.00 0.00 ? 24  PHE A H    5  
ATOM 7106  H HA   . PHE A 1 24  ? -7.834  -11.257 2.029   1.00 0.00 ? 24  PHE A HA   5  
ATOM 7107  H HB2  . PHE A 1 24  ? -6.711  -9.495  3.306   1.00 0.00 ? 24  PHE A HB2  5  
ATOM 7108  H HB3  . PHE A 1 24  ? -6.986  -10.386 4.799   1.00 0.00 ? 24  PHE A HB3  5  
ATOM 7109  H HD1  . PHE A 1 24  ? -5.732  -11.402 1.436   1.00 0.00 ? 24  PHE A HD1  5  
ATOM 7110  H HD2  . PHE A 1 24  ? -4.986  -11.151 5.619   1.00 0.00 ? 24  PHE A HD2  5  
ATOM 7111  H HE1  . PHE A 1 24  ? -3.595  -12.579 1.122   1.00 0.00 ? 24  PHE A HE1  5  
ATOM 7112  H HE2  . PHE A 1 24  ? -2.846  -12.326 5.311   1.00 0.00 ? 24  PHE A HE2  5  
ATOM 7113  H HZ   . PHE A 1 24  ? -2.149  -13.043 3.061   1.00 0.00 ? 24  PHE A HZ   5  
ATOM 7114  N N    . LYS A 1 25  ? -7.926  -13.599 2.799   1.00 0.00 ? 25  LYS A N    5  
ATOM 7115  C CA   . LYS A 1 25  ? -8.017  -14.995 3.209   1.00 0.00 ? 25  LYS A CA   5  
ATOM 7116  C C    . LYS A 1 25  ? -7.031  -15.858 2.429   1.00 0.00 ? 25  LYS A C    5  
ATOM 7117  O O    . LYS A 1 25  ? -6.602  -15.491 1.335   1.00 0.00 ? 25  LYS A O    5  
ATOM 7118  C CB   . LYS A 1 25  ? -9.441  -15.517 3.003   1.00 0.00 ? 25  LYS A CB   5  
ATOM 7119  C CG   . LYS A 1 25  ? -9.719  -15.983 1.584   1.00 0.00 ? 25  LYS A CG   5  
ATOM 7120  C CD   . LYS A 1 25  ? -11.168 -16.403 1.409   1.00 0.00 ? 25  LYS A CD   5  
ATOM 7121  C CE   . LYS A 1 25  ? -12.094 -15.198 1.342   1.00 0.00 ? 25  LYS A CE   5  
ATOM 7122  N NZ   . LYS A 1 25  ? -13.486 -15.545 1.742   1.00 0.00 ? 25  LYS A NZ   5  
ATOM 7123  H H    . LYS A 1 25  ? -7.711  -13.389 1.866   1.00 0.00 ? 25  LYS A H    5  
ATOM 7124  H HA   . LYS A 1 25  ? -7.772  -15.049 4.259   1.00 0.00 ? 25  LYS A HA   5  
ATOM 7125  H HB2  . LYS A 1 25  ? -9.608  -16.349 3.672   1.00 0.00 ? 25  LYS A HB2  5  
ATOM 7126  H HB3  . LYS A 1 25  ? -10.139 -14.728 3.243   1.00 0.00 ? 25  LYS A HB3  5  
ATOM 7127  H HG2  . LYS A 1 25  ? -9.505  -15.174 0.901   1.00 0.00 ? 25  LYS A HG2  5  
ATOM 7128  H HG3  . LYS A 1 25  ? -9.079  -16.825 1.360   1.00 0.00 ? 25  LYS A HG3  5  
ATOM 7129  H HD2  . LYS A 1 25  ? -11.263 -16.967 0.493   1.00 0.00 ? 25  LYS A HD2  5  
ATOM 7130  H HD3  . LYS A 1 25  ? -11.458 -17.023 2.246   1.00 0.00 ? 25  LYS A HD3  5  
ATOM 7131  H HE2  . LYS A 1 25  ? -11.718 -14.434 2.004   1.00 0.00 ? 25  LYS A HE2  5  
ATOM 7132  H HE3  . LYS A 1 25  ? -12.102 -14.824 0.329   1.00 0.00 ? 25  LYS A HE3  5  
ATOM 7133  H HZ1  . LYS A 1 25  ? -14.067 -15.721 0.897   1.00 0.00 ? 25  LYS A HZ1  5  
ATOM 7134  H HZ2  . LYS A 1 25  ? -13.908 -14.763 2.281   1.00 0.00 ? 25  LYS A HZ2  5  
ATOM 7135  H HZ3  . LYS A 1 25  ? -13.486 -16.400 2.334   1.00 0.00 ? 25  LYS A HZ3  5  
ATOM 7136  N N    . ALA A 1 26  ? -6.676  -17.006 2.997   1.00 0.00 ? 26  ALA A N    5  
ATOM 7137  C CA   . ALA A 1 26  ? -5.743  -17.921 2.352   1.00 0.00 ? 26  ALA A CA   5  
ATOM 7138  C C    . ALA A 1 26  ? -6.334  -19.323 2.247   1.00 0.00 ? 26  ALA A C    5  
ATOM 7139  O O    . ALA A 1 26  ? -6.804  -19.884 3.237   1.00 0.00 ? 26  ALA A O    5  
ATOM 7140  C CB   . ALA A 1 26  ? -4.427  -17.957 3.115   1.00 0.00 ? 26  ALA A CB   5  
ATOM 7141  H H    . ALA A 1 26  ? -7.052  -17.243 3.870   1.00 0.00 ? 26  ALA A H    5  
ATOM 7142  H HA   . ALA A 1 26  ? -5.545  -17.550 1.357   1.00 0.00 ? 26  ALA A HA   5  
ATOM 7143  H HB1  . ALA A 1 26  ? -3.838  -17.090 2.855   1.00 0.00 ? 26  ALA A HB1  5  
ATOM 7144  H HB2  . ALA A 1 26  ? -4.626  -17.953 4.176   1.00 0.00 ? 26  ALA A HB2  5  
ATOM 7145  H HB3  . ALA A 1 26  ? -3.884  -18.853 2.853   1.00 0.00 ? 26  ALA A HB3  5  
ATOM 7146  N N    . GLU A 1 27  ? -6.308  -19.882 1.041   1.00 0.00 ? 27  GLU A N    5  
ATOM 7147  C CA   . GLU A 1 27  ? -6.843  -21.219 0.808   1.00 0.00 ? 27  GLU A CA   5  
ATOM 7148  C C    . GLU A 1 27  ? -5.859  -22.067 0.009   1.00 0.00 ? 27  GLU A C    5  
ATOM 7149  O O    . GLU A 1 27  ? -5.295  -21.630 -0.995  1.00 0.00 ? 27  GLU A O    5  
ATOM 7150  C CB   . GLU A 1 27  ? -8.180  -21.135 0.068   1.00 0.00 ? 27  GLU A CB   5  
ATOM 7151  C CG   . GLU A 1 27  ? -9.196  -20.232 0.747   1.00 0.00 ? 27  GLU A CG   5  
ATOM 7152  C CD   . GLU A 1 27  ? -10.506 -20.153 -0.013  1.00 0.00 ? 27  GLU A CD   5  
ATOM 7153  O OE1  . GLU A 1 27  ? -11.204 -21.184 -0.102  1.00 0.00 ? 27  GLU A OE1  5  
ATOM 7154  O OE2  . GLU A 1 27  ? -10.832 -19.059 -0.519  1.00 0.00 ? 27  GLU A OE2  5  
ATOM 7155  H H    . GLU A 1 27  ? -5.921  -19.385 0.292   1.00 0.00 ? 27  GLU A H    5  
ATOM 7156  H HA   . GLU A 1 27  ? -7.003  -21.684 1.769   1.00 0.00 ? 27  GLU A HA   5  
ATOM 7157  H HB2  . GLU A 1 27  ? -8.003  -20.758 -0.929  1.00 0.00 ? 27  GLU A HB2  5  
ATOM 7158  H HB3  . GLU A 1 27  ? -8.601  -22.127 -0.002  1.00 0.00 ? 27  GLU A HB3  5  
ATOM 7159  H HG2  . GLU A 1 27  ? -9.395  -20.616 1.736   1.00 0.00 ? 27  GLU A HG2  5  
ATOM 7160  H HG3  . GLU A 1 27  ? -8.781  -19.238 0.824   1.00 0.00 ? 27  GLU A HG3  5  
ATOM 7161  N N    . PRO A 1 28  ? -5.645  -23.311 0.463   1.00 0.00 ? 28  PRO A N    5  
ATOM 7162  C CA   . PRO A 1 28  ? -4.729  -24.248 -0.194  1.00 0.00 ? 28  PRO A CA   5  
ATOM 7163  C C    . PRO A 1 28  ? -5.257  -24.725 -1.543  1.00 0.00 ? 28  PRO A C    5  
ATOM 7164  O O    . PRO A 1 28  ? -6.006  -25.699 -1.616  1.00 0.00 ? 28  PRO A O    5  
ATOM 7165  C CB   . PRO A 1 28  ? -4.647  -25.415 0.792   1.00 0.00 ? 28  PRO A CB   5  
ATOM 7166  C CG   . PRO A 1 28  ? -5.926  -25.357 1.555   1.00 0.00 ? 28  PRO A CG   5  
ATOM 7167  C CD   . PRO A 1 28  ? -6.283  -23.899 1.653   1.00 0.00 ? 28  PRO A CD   5  
ATOM 7168  H HA   . PRO A 1 28  ? -3.748  -23.816 -0.326  1.00 0.00 ? 28  PRO A HA   5  
ATOM 7169  H HB2  . PRO A 1 28  ? -4.554  -26.344 0.247   1.00 0.00 ? 28  PRO A HB2  5  
ATOM 7170  H HB3  . PRO A 1 28  ? -3.794  -25.284 1.441   1.00 0.00 ? 28  PRO A HB3  5  
ATOM 7171  H HG2  . PRO A 1 28  ? -6.695  -25.897 1.025   1.00 0.00 ? 28  PRO A HG2  5  
ATOM 7172  H HG3  . PRO A 1 28  ? -5.783  -25.774 2.541   1.00 0.00 ? 28  PRO A HG3  5  
ATOM 7173  H HD2  . PRO A 1 28  ? -7.355  -23.770 1.620   1.00 0.00 ? 28  PRO A HD2  5  
ATOM 7174  H HD3  . PRO A 1 28  ? -5.877  -23.471 2.558   1.00 0.00 ? 28  PRO A HD3  5  
ATOM 7175  N N    . GLU A 1 29  ? -4.861  -24.034 -2.607  1.00 0.00 ? 29  GLU A N    5  
ATOM 7176  C CA   . GLU A 1 29  ? -5.295  -24.389 -3.953  1.00 0.00 ? 29  GLU A CA   5  
ATOM 7177  C C    . GLU A 1 29  ? -4.628  -25.681 -4.417  1.00 0.00 ? 29  GLU A C    5  
ATOM 7178  O O    . GLU A 1 29  ? -5.047  -26.290 -5.401  1.00 0.00 ? 29  GLU A O    5  
ATOM 7179  C CB   . GLU A 1 29  ? -4.976  -23.257 -4.931  1.00 0.00 ? 29  GLU A CB   5  
ATOM 7180  C CG   . GLU A 1 29  ? -3.493  -22.942 -5.035  1.00 0.00 ? 29  GLU A CG   5  
ATOM 7181  C CD   . GLU A 1 29  ? -3.127  -22.285 -6.351  1.00 0.00 ? 29  GLU A CD   5  
ATOM 7182  O OE1  . GLU A 1 29  ? -3.950  -21.505 -6.875  1.00 0.00 ? 29  GLU A OE1  5  
ATOM 7183  O OE2  . GLU A 1 29  ? -2.016  -22.550 -6.857  1.00 0.00 ? 29  GLU A OE2  5  
ATOM 7184  H H    . GLU A 1 29  ? -4.262  -23.268 -2.484  1.00 0.00 ? 29  GLU A H    5  
ATOM 7185  H HA   . GLU A 1 29  ? -6.364  -24.540 -3.927  1.00 0.00 ? 29  GLU A HA   5  
ATOM 7186  H HB2  . GLU A 1 29  ? -5.334  -23.533 -5.912  1.00 0.00 ? 29  GLU A HB2  5  
ATOM 7187  H HB3  . GLU A 1 29  ? -5.490  -22.364 -4.609  1.00 0.00 ? 29  GLU A HB3  5  
ATOM 7188  H HG2  . GLU A 1 29  ? -3.223  -22.276 -4.230  1.00 0.00 ? 29  GLU A HG2  5  
ATOM 7189  H HG3  . GLU A 1 29  ? -2.935  -23.862 -4.941  1.00 0.00 ? 29  GLU A HG3  5  
ATOM 7190  N N    . SER A 1 30  ? -3.586  -26.092 -3.701  1.00 0.00 ? 30  SER A N    5  
ATOM 7191  C CA   . SER A 1 30  ? -2.857  -27.308 -4.042  1.00 0.00 ? 30  SER A CA   5  
ATOM 7192  C C    . SER A 1 30  ? -1.953  -27.740 -2.891  1.00 0.00 ? 30  SER A C    5  
ATOM 7193  O O    . SER A 1 30  ? -1.778  -27.008 -1.918  1.00 0.00 ? 30  SER A O    5  
ATOM 7194  C CB   . SER A 1 30  ? -2.024  -27.092 -5.306  1.00 0.00 ? 30  SER A CB   5  
ATOM 7195  O OG   . SER A 1 30  ? -1.910  -28.291 -6.053  1.00 0.00 ? 30  SER A OG   5  
ATOM 7196  H H    . SER A 1 30  ? -3.300  -25.563 -2.927  1.00 0.00 ? 30  SER A H    5  
ATOM 7197  H HA   . SER A 1 30  ? -3.581  -28.088 -4.227  1.00 0.00 ? 30  SER A HA   5  
ATOM 7198  H HB2  . SER A 1 30  ? -2.497  -26.342 -5.922  1.00 0.00 ? 30  SER A HB2  5  
ATOM 7199  H HB3  . SER A 1 30  ? -1.034  -26.758 -5.029  1.00 0.00 ? 30  SER A HB3  5  
ATOM 7200  H HG   . SER A 1 30  ? -2.256  -29.023 -5.538  1.00 0.00 ? 30  SER A HG   5  
ATOM 7201  N N    . GLU A 1 31  ? -1.382  -28.934 -3.011  1.00 0.00 ? 31  GLU A N    5  
ATOM 7202  C CA   . GLU A 1 31  ? -0.497  -29.464 -1.981  1.00 0.00 ? 31  GLU A CA   5  
ATOM 7203  C C    . GLU A 1 31  ? 0.825   -28.702 -1.955  1.00 0.00 ? 31  GLU A C    5  
ATOM 7204  O O    . GLU A 1 31  ? 1.494   -28.631 -0.924  1.00 0.00 ? 31  GLU A O    5  
ATOM 7205  C CB   . GLU A 1 31  ? -0.235  -30.953 -2.218  1.00 0.00 ? 31  GLU A CB   5  
ATOM 7206  C CG   . GLU A 1 31  ? 0.788   -31.225 -3.308  1.00 0.00 ? 31  GLU A CG   5  
ATOM 7207  C CD   . GLU A 1 31  ? 1.321   -32.644 -3.267  1.00 0.00 ? 31  GLU A CD   5  
ATOM 7208  O OE1  . GLU A 1 31  ? 0.552   -33.576 -3.584  1.00 0.00 ? 31  GLU A OE1  5  
ATOM 7209  O OE2  . GLU A 1 31  ? 2.506   -32.823 -2.917  1.00 0.00 ? 31  GLU A OE2  5  
ATOM 7210  H H    . GLU A 1 31  ? -1.561  -29.472 -3.811  1.00 0.00 ? 31  GLU A H    5  
ATOM 7211  H HA   . GLU A 1 31  ? -0.987  -29.342 -1.027  1.00 0.00 ? 31  GLU A HA   5  
ATOM 7212  H HB2  . GLU A 1 31  ? 0.122   -31.394 -1.299  1.00 0.00 ? 31  GLU A HB2  5  
ATOM 7213  H HB3  . GLU A 1 31  ? -1.164  -31.429 -2.498  1.00 0.00 ? 31  GLU A HB3  5  
ATOM 7214  H HG2  . GLU A 1 31  ? 0.324   -31.059 -4.269  1.00 0.00 ? 31  GLU A HG2  5  
ATOM 7215  H HG3  . GLU A 1 31  ? 1.615   -30.541 -3.187  1.00 0.00 ? 31  GLU A HG3  5  
ATOM 7216  N N    . THR A 1 32  ? 1.196   -28.133 -3.098  1.00 0.00 ? 32  THR A N    5  
ATOM 7217  C CA   . THR A 1 32  ? 2.438   -27.378 -3.208  1.00 0.00 ? 32  THR A CA   5  
ATOM 7218  C C    . THR A 1 32  ? 2.173   -25.948 -3.663  1.00 0.00 ? 32  THR A C    5  
ATOM 7219  O O    . THR A 1 32  ? 3.099   -25.216 -4.014  1.00 0.00 ? 32  THR A O    5  
ATOM 7220  C CB   . THR A 1 32  ? 3.416   -28.046 -4.193  1.00 0.00 ? 32  THR A CB   5  
ATOM 7221  O OG1  . THR A 1 32  ? 2.752   -28.320 -5.432  1.00 0.00 ? 32  THR A OG1  5  
ATOM 7222  C CG2  . THR A 1 32  ? 3.971   -29.338 -3.613  1.00 0.00 ? 32  THR A CG2  5  
ATOM 7223  H H    . THR A 1 32  ? 0.620   -28.226 -3.885  1.00 0.00 ? 32  THR A H    5  
ATOM 7224  H HA   . THR A 1 32  ? 2.902   -27.356 -2.233  1.00 0.00 ? 32  THR A HA   5  
ATOM 7225  H HB   . THR A 1 32  ? 4.237   -27.368 -4.376  1.00 0.00 ? 32  THR A HB   5  
ATOM 7226  H HG1  . THR A 1 32  ? 3.406   -28.468 -6.120  1.00 0.00 ? 32  THR A HG1  5  
ATOM 7227  H HG21 . THR A 1 32  ? 3.463   -29.565 -2.688  1.00 0.00 ? 32  THR A HG21 5  
ATOM 7228  H HG22 . THR A 1 32  ? 5.028   -29.222 -3.424  1.00 0.00 ? 32  THR A HG22 5  
ATOM 7229  H HG23 . THR A 1 32  ? 3.817   -30.143 -4.316  1.00 0.00 ? 32  THR A HG23 5  
ATOM 7230  N N    . SER A 1 33  ? 0.903   -25.554 -3.654  1.00 0.00 ? 33  SER A N    5  
ATOM 7231  C CA   . SER A 1 33  ? 0.516   -24.211 -4.069  1.00 0.00 ? 33  SER A CA   5  
ATOM 7232  C C    . SER A 1 33  ? -0.628  -23.685 -3.208  1.00 0.00 ? 33  SER A C    5  
ATOM 7233  O O    . SER A 1 33  ? -1.422  -24.459 -2.672  1.00 0.00 ? 33  SER A O    5  
ATOM 7234  C CB   . SER A 1 33  ? 0.104   -24.209 -5.542  1.00 0.00 ? 33  SER A CB   5  
ATOM 7235  O OG   . SER A 1 33  ? 1.175   -24.624 -6.372  1.00 0.00 ? 33  SER A OG   5  
ATOM 7236  H H    . SER A 1 33  ? 0.210   -26.184 -3.363  1.00 0.00 ? 33  SER A H    5  
ATOM 7237  H HA   . SER A 1 33  ? 1.373   -23.566 -3.942  1.00 0.00 ? 33  SER A HA   5  
ATOM 7238  H HB2  . SER A 1 33  ? -0.727  -24.883 -5.682  1.00 0.00 ? 33  SER A HB2  5  
ATOM 7239  H HB3  . SER A 1 33  ? -0.191  -23.210 -5.829  1.00 0.00 ? 33  SER A HB3  5  
ATOM 7240  H HG   . SER A 1 33  ? 1.228   -25.583 -6.370  1.00 0.00 ? 33  SER A HG   5  
ATOM 7241  N N    . ILE A 1 34  ? -0.705  -22.365 -3.080  1.00 0.00 ? 34  ILE A N    5  
ATOM 7242  C CA   . ILE A 1 34  ? -1.752  -21.735 -2.286  1.00 0.00 ? 34  ILE A CA   5  
ATOM 7243  C C    . ILE A 1 34  ? -2.248  -20.453 -2.947  1.00 0.00 ? 34  ILE A C    5  
ATOM 7244  O O    . ILE A 1 34  ? -1.454  -19.608 -3.361  1.00 0.00 ? 34  ILE A O    5  
ATOM 7245  C CB   . ILE A 1 34  ? -1.260  -21.408 -0.864  1.00 0.00 ? 34  ILE A CB   5  
ATOM 7246  C CG1  . ILE A 1 34  ? -0.860  -22.691 -0.132  1.00 0.00 ? 34  ILE A CG1  5  
ATOM 7247  C CG2  . ILE A 1 34  ? -2.337  -20.663 -0.089  1.00 0.00 ? 34  ILE A CG2  5  
ATOM 7248  C CD1  . ILE A 1 34  ? -0.303  -22.447 1.253   1.00 0.00 ? 34  ILE A CD1  5  
ATOM 7249  H H    . ILE A 1 34  ? -0.043  -21.801 -3.532  1.00 0.00 ? 34  ILE A H    5  
ATOM 7250  H HA   . ILE A 1 34  ? -2.576  -22.430 -2.210  1.00 0.00 ? 34  ILE A HA   5  
ATOM 7251  H HB   . ILE A 1 34  ? -0.398  -20.764 -0.944  1.00 0.00 ? 34  ILE A HB   5  
ATOM 7252  H HG12 . ILE A 1 34  ? -1.726  -23.326 -0.033  1.00 0.00 ? 34  ILE A HG12 5  
ATOM 7253  H HG13 . ILE A 1 34  ? -0.105  -23.205 -0.709  1.00 0.00 ? 34  ILE A HG13 5  
ATOM 7254  H HG21 . ILE A 1 34  ? -1.909  -20.242 0.809   1.00 0.00 ? 34  ILE A HG21 5  
ATOM 7255  H HG22 . ILE A 1 34  ? -2.737  -19.870 -0.702  1.00 0.00 ? 34  ILE A HG22 5  
ATOM 7256  H HG23 . ILE A 1 34  ? -3.129  -21.348 0.177   1.00 0.00 ? 34  ILE A HG23 5  
ATOM 7257  H HD11 . ILE A 1 34  ? -0.444  -21.410 1.522   1.00 0.00 ? 34  ILE A HD11 5  
ATOM 7258  H HD12 . ILE A 1 34  ? -0.815  -23.077 1.964   1.00 0.00 ? 34  ILE A HD12 5  
ATOM 7259  H HD13 . ILE A 1 34  ? 0.753   -22.679 1.262   1.00 0.00 ? 34  ILE A HD13 5  
ATOM 7260  N N    . LEU A 1 35  ? -3.566  -20.314 -3.042  1.00 0.00 ? 35  LEU A N    5  
ATOM 7261  C CA   . LEU A 1 35  ? -4.169  -19.134 -3.651  1.00 0.00 ? 35  LEU A CA   5  
ATOM 7262  C C    . LEU A 1 35  ? -4.688  -18.176 -2.584  1.00 0.00 ? 35  LEU A C    5  
ATOM 7263  O O    . LEU A 1 35  ? -5.543  -18.536 -1.774  1.00 0.00 ? 35  LEU A O    5  
ATOM 7264  C CB   . LEU A 1 35  ? -5.310  -19.544 -4.583  1.00 0.00 ? 35  LEU A CB   5  
ATOM 7265  C CG   . LEU A 1 35  ? -5.712  -18.519 -5.644  1.00 0.00 ? 35  LEU A CG   5  
ATOM 7266  C CD1  . LEU A 1 35  ? -4.567  -18.278 -6.615  1.00 0.00 ? 35  LEU A CD1  5  
ATOM 7267  C CD2  . LEU A 1 35  ? -6.957  -18.980 -6.388  1.00 0.00 ? 35  LEU A CD2  5  
ATOM 7268  H H    . LEU A 1 35  ? -4.148  -21.021 -2.694  1.00 0.00 ? 35  LEU A H    5  
ATOM 7269  H HA   . LEU A 1 35  ? -3.406  -18.633 -4.228  1.00 0.00 ? 35  LEU A HA   5  
ATOM 7270  H HB2  . LEU A 1 35  ? -5.012  -20.447 -5.093  1.00 0.00 ? 35  LEU A HB2  5  
ATOM 7271  H HB3  . LEU A 1 35  ? -6.178  -19.748 -3.973  1.00 0.00 ? 35  LEU A HB3  5  
ATOM 7272  H HG   . LEU A 1 35  ? -5.941  -17.579 -5.159  1.00 0.00 ? 35  LEU A HG   5  
ATOM 7273  H HD11 . LEU A 1 35  ? -3.667  -18.734 -6.231  1.00 0.00 ? 35  LEU A HD11 5  
ATOM 7274  H HD12 . LEU A 1 35  ? -4.411  -17.216 -6.731  1.00 0.00 ? 35  LEU A HD12 5  
ATOM 7275  H HD13 . LEU A 1 35  ? -4.811  -18.713 -7.574  1.00 0.00 ? 35  LEU A HD13 5  
ATOM 7276  H HD21 . LEU A 1 35  ? -7.041  -18.439 -7.318  1.00 0.00 ? 35  LEU A HD21 5  
ATOM 7277  H HD22 . LEU A 1 35  ? -7.830  -18.790 -5.781  1.00 0.00 ? 35  LEU A HD22 5  
ATOM 7278  H HD23 . LEU A 1 35  ? -6.882  -20.038 -6.592  1.00 0.00 ? 35  LEU A HD23 5  
ATOM 7279  N N    . LEU A 1 36  ? -4.168  -16.953 -2.591  1.00 0.00 ? 36  LEU A N    5  
ATOM 7280  C CA   . LEU A 1 36  ? -4.581  -15.941 -1.625  1.00 0.00 ? 36  LEU A CA   5  
ATOM 7281  C C    . LEU A 1 36  ? -5.459  -14.883 -2.286  1.00 0.00 ? 36  LEU A C    5  
ATOM 7282  O O    . LEU A 1 36  ? -5.165  -14.418 -3.387  1.00 0.00 ? 36  LEU A O    5  
ATOM 7283  C CB   . LEU A 1 36  ? -3.354  -15.280 -0.994  1.00 0.00 ? 36  LEU A CB   5  
ATOM 7284  C CG   . LEU A 1 36  ? -2.245  -16.226 -0.533  1.00 0.00 ? 36  LEU A CG   5  
ATOM 7285  C CD1  . LEU A 1 36  ? -0.923  -15.483 -0.418  1.00 0.00 ? 36  LEU A CD1  5  
ATOM 7286  C CD2  . LEU A 1 36  ? -2.612  -16.873 0.795   1.00 0.00 ? 36  LEU A CD2  5  
ATOM 7287  H H    . LEU A 1 36  ? -3.491  -16.725 -3.261  1.00 0.00 ? 36  LEU A H    5  
ATOM 7288  H HA   . LEU A 1 36  ? -5.152  -16.434 -0.852  1.00 0.00 ? 36  LEU A HA   5  
ATOM 7289  H HB2  . LEU A 1 36  ? -2.931  -14.605 -1.722  1.00 0.00 ? 36  LEU A HB2  5  
ATOM 7290  H HB3  . LEU A 1 36  ? -3.689  -14.717 -0.134  1.00 0.00 ? 36  LEU A HB3  5  
ATOM 7291  H HG   . LEU A 1 36  ? -2.122  -17.012 -1.266  1.00 0.00 ? 36  LEU A HG   5  
ATOM 7292  H HD11 . LEU A 1 36  ? -1.102  -14.420 -0.471  1.00 0.00 ? 36  LEU A HD11 5  
ATOM 7293  H HD12 . LEU A 1 36  ? -0.272  -15.779 -1.227  1.00 0.00 ? 36  LEU A HD12 5  
ATOM 7294  H HD13 . LEU A 1 36  ? -0.456  -15.723 0.526   1.00 0.00 ? 36  LEU A HD13 5  
ATOM 7295  H HD21 . LEU A 1 36  ? -2.050  -17.786 0.917   1.00 0.00 ? 36  LEU A HD21 5  
ATOM 7296  H HD22 . LEU A 1 36  ? -3.669  -17.096 0.805   1.00 0.00 ? 36  LEU A HD22 5  
ATOM 7297  H HD23 . LEU A 1 36  ? -2.379  -16.195 1.602   1.00 0.00 ? 36  LEU A HD23 5  
ATOM 7298  N N    . SER A 1 37  ? -6.536  -14.506 -1.606  1.00 0.00 ? 37  SER A N    5  
ATOM 7299  C CA   . SER A 1 37  ? -7.458  -13.504 -2.128  1.00 0.00 ? 37  SER A CA   5  
ATOM 7300  C C    . SER A 1 37  ? -7.553  -12.309 -1.184  1.00 0.00 ? 37  SER A C    5  
ATOM 7301  O O    . SER A 1 37  ? -7.678  -12.472 0.030   1.00 0.00 ? 37  SER A O    5  
ATOM 7302  C CB   . SER A 1 37  ? -8.845  -14.116 -2.336  1.00 0.00 ? 37  SER A CB   5  
ATOM 7303  O OG   . SER A 1 37  ? -9.856  -13.126 -2.254  1.00 0.00 ? 37  SER A OG   5  
ATOM 7304  H H    . SER A 1 37  ? -6.717  -14.914 -0.733  1.00 0.00 ? 37  SER A H    5  
ATOM 7305  H HA   . SER A 1 37  ? -7.077  -13.167 -3.080  1.00 0.00 ? 37  SER A HA   5  
ATOM 7306  H HB2  . SER A 1 37  ? -8.889  -14.578 -3.310  1.00 0.00 ? 37  SER A HB2  5  
ATOM 7307  H HB3  . SER A 1 37  ? -9.025  -14.861 -1.575  1.00 0.00 ? 37  SER A HB3  5  
ATOM 7308  H HG   . SER A 1 37  ? -9.801  -12.547 -3.017  1.00 0.00 ? 37  SER A HG   5  
ATOM 7309  N N    . TRP A 1 38  ? -7.493  -11.110 -1.751  1.00 0.00 ? 38  TRP A N    5  
ATOM 7310  C CA   . TRP A 1 38  ? -7.572  -9.886  -0.960  1.00 0.00 ? 38  TRP A CA   5  
ATOM 7311  C C    . TRP A 1 38  ? -8.322  -8.797  -1.718  1.00 0.00 ? 38  TRP A C    5  
ATOM 7312  O O    . TRP A 1 38  ? -8.462  -8.859  -2.940  1.00 0.00 ? 38  TRP A O    5  
ATOM 7313  C CB   . TRP A 1 38  ? -6.168  -9.398  -0.597  1.00 0.00 ? 38  TRP A CB   5  
ATOM 7314  C CG   . TRP A 1 38  ? -5.400  -8.873  -1.771  1.00 0.00 ? 38  TRP A CG   5  
ATOM 7315  C CD1  . TRP A 1 38  ? -5.547  -7.653  -2.368  1.00 0.00 ? 38  TRP A CD1  5  
ATOM 7316  C CD2  . TRP A 1 38  ? -4.365  -9.552  -2.492  1.00 0.00 ? 38  TRP A CD2  5  
ATOM 7317  N NE1  . TRP A 1 38  ? -4.666  -7.533  -3.416  1.00 0.00 ? 38  TRP A NE1  5  
ATOM 7318  C CE2  . TRP A 1 38  ? -3.930  -8.684  -3.512  1.00 0.00 ? 38  TRP A CE2  5  
ATOM 7319  C CE3  . TRP A 1 38  ? -3.764  -10.807 -2.373  1.00 0.00 ? 38  TRP A CE3  5  
ATOM 7320  C CZ2  . TRP A 1 38  ? -2.922  -9.033  -4.407  1.00 0.00 ? 38  TRP A CZ2  5  
ATOM 7321  C CZ3  . TRP A 1 38  ? -2.764  -11.153 -3.262  1.00 0.00 ? 38  TRP A CZ3  5  
ATOM 7322  C CH2  . TRP A 1 38  ? -2.350  -10.269 -4.268  1.00 0.00 ? 38  TRP A CH2  5  
ATOM 7323  H H    . TRP A 1 38  ? -7.393  -11.045 -2.724  1.00 0.00 ? 38  TRP A H    5  
ATOM 7324  H HA   . TRP A 1 38  ? -8.110  -10.114 -0.052  1.00 0.00 ? 38  TRP A HA   5  
ATOM 7325  H HB2  . TRP A 1 38  ? -6.247  -8.605  0.132   1.00 0.00 ? 38  TRP A HB2  5  
ATOM 7326  H HB3  . TRP A 1 38  ? -5.609  -10.219 -0.171  1.00 0.00 ? 38  TRP A HB3  5  
ATOM 7327  H HD1  . TRP A 1 38  ? -6.257  -6.904  -2.052  1.00 0.00 ? 38  TRP A HD1  5  
ATOM 7328  H HE1  . TRP A 1 38  ? -4.579  -6.749  -3.998  1.00 0.00 ? 38  TRP A HE1  5  
ATOM 7329  H HE3  . TRP A 1 38  ? -4.068  -11.502 -1.605  1.00 0.00 ? 38  TRP A HE3  5  
ATOM 7330  H HZ2  . TRP A 1 38  ? -2.592  -8.363  -5.187  1.00 0.00 ? 38  TRP A HZ2  5  
ATOM 7331  H HZ3  . TRP A 1 38  ? -2.287  -12.119 -3.186  1.00 0.00 ? 38  TRP A HZ3  5  
ATOM 7332  H HH2  . TRP A 1 38  ? -1.566  -10.581 -4.940  1.00 0.00 ? 38  TRP A HH2  5  
ATOM 7333  N N    . THR A 1 39  ? -8.804  -7.797  -0.985  1.00 0.00 ? 39  THR A N    5  
ATOM 7334  C CA   . THR A 1 39  ? -9.541  -6.694  -1.589  1.00 0.00 ? 39  THR A CA   5  
ATOM 7335  C C    . THR A 1 39  ? -8.720  -5.409  -1.570  1.00 0.00 ? 39  THR A C    5  
ATOM 7336  O O    . THR A 1 39  ? -8.544  -4.771  -0.532  1.00 0.00 ? 39  THR A O    5  
ATOM 7337  C CB   . THR A 1 39  ? -10.876 -6.447  -0.862  1.00 0.00 ? 39  THR A CB   5  
ATOM 7338  O OG1  . THR A 1 39  ? -11.700 -7.615  -0.940  1.00 0.00 ? 39  THR A OG1  5  
ATOM 7339  C CG2  . THR A 1 39  ? -11.611 -5.260  -1.468  1.00 0.00 ? 39  THR A CG2  5  
ATOM 7340  H H    . THR A 1 39  ? -8.660  -7.804  -0.016  1.00 0.00 ? 39  THR A H    5  
ATOM 7341  H HA   . THR A 1 39  ? -9.756  -6.958  -2.614  1.00 0.00 ? 39  THR A HA   5  
ATOM 7342  H HB   . THR A 1 39  ? -10.669 -6.231  0.177   1.00 0.00 ? 39  THR A HB   5  
ATOM 7343  H HG1  . THR A 1 39  ? -11.145 -8.393  -1.027  1.00 0.00 ? 39  THR A HG1  5  
ATOM 7344  H HG21 . THR A 1 39  ? -10.909 -4.461  -1.656  1.00 0.00 ? 39  THR A HG21 5  
ATOM 7345  H HG22 . THR A 1 39  ? -12.370 -4.918  -0.781  1.00 0.00 ? 39  THR A HG22 5  
ATOM 7346  H HG23 . THR A 1 39  ? -12.073 -5.560  -2.396  1.00 0.00 ? 39  THR A HG23 5  
ATOM 7347  N N    . PRO A 1 40  ? -8.206  -5.018  -2.746  1.00 0.00 ? 40  PRO A N    5  
ATOM 7348  C CA   . PRO A 1 40  ? -7.396  -3.805  -2.891  1.00 0.00 ? 40  PRO A CA   5  
ATOM 7349  C C    . PRO A 1 40  ? -8.220  -2.534  -2.717  1.00 0.00 ? 40  PRO A C    5  
ATOM 7350  O O    . PRO A 1 40  ? -9.315  -2.395  -3.263  1.00 0.00 ? 40  PRO A O    5  
ATOM 7351  C CB   . PRO A 1 40  ? -6.862  -3.904  -4.322  1.00 0.00 ? 40  PRO A CB   5  
ATOM 7352  C CG   . PRO A 1 40  ? -7.856  -4.751  -5.040  1.00 0.00 ? 40  PRO A CG   5  
ATOM 7353  C CD   . PRO A 1 40  ? -8.376  -5.730  -4.024  1.00 0.00 ? 40  PRO A CD   5  
ATOM 7354  H HA   . PRO A 1 40  ? -6.569  -3.794  -2.196  1.00 0.00 ? 40  PRO A HA   5  
ATOM 7355  H HB2  . PRO A 1 40  ? -6.798  -2.916  -4.755  1.00 0.00 ? 40  PRO A HB2  5  
ATOM 7356  H HB3  . PRO A 1 40  ? -5.885  -4.364  -4.314  1.00 0.00 ? 40  PRO A HB3  5  
ATOM 7357  H HG2  . PRO A 1 40  ? -8.660  -4.136  -5.414  1.00 0.00 ? 40  PRO A HG2  5  
ATOM 7358  H HG3  . PRO A 1 40  ? -7.373  -5.275  -5.851  1.00 0.00 ? 40  PRO A HG3  5  
ATOM 7359  H HD2  . PRO A 1 40  ? -9.417  -5.948  -4.208  1.00 0.00 ? 40  PRO A HD2  5  
ATOM 7360  H HD3  . PRO A 1 40  ? -7.790  -6.637  -4.040  1.00 0.00 ? 40  PRO A HD3  5  
ATOM 7361  N N    . PRO A 1 41  ? -7.683  -1.582  -1.939  1.00 0.00 ? 41  PRO A N    5  
ATOM 7362  C CA   . PRO A 1 41  ? -8.352  -0.304  -1.677  1.00 0.00 ? 41  PRO A CA   5  
ATOM 7363  C C    . PRO A 1 41  ? -8.397  0.591   -2.910  1.00 0.00 ? 41  PRO A C    5  
ATOM 7364  O O    . PRO A 1 41  ? -7.727  0.324   -3.907  1.00 0.00 ? 41  PRO A O    5  
ATOM 7365  C CB   . PRO A 1 41  ? -7.487  0.332   -0.586  1.00 0.00 ? 41  PRO A CB   5  
ATOM 7366  C CG   . PRO A 1 41  ? -6.140  -0.278  -0.767  1.00 0.00 ? 41  PRO A CG   5  
ATOM 7367  C CD   . PRO A 1 41  ? -6.382  -1.679  -1.257  1.00 0.00 ? 41  PRO A CD   5  
ATOM 7368  H HA   . PRO A 1 41  ? -9.355  -0.451  -1.303  1.00 0.00 ? 41  PRO A HA   5  
ATOM 7369  H HB2  . PRO A 1 41  ? -7.459  1.403   -0.724  1.00 0.00 ? 41  PRO A HB2  5  
ATOM 7370  H HB3  . PRO A 1 41  ? -7.898  0.099   0.385   1.00 0.00 ? 41  PRO A HB3  5  
ATOM 7371  H HG2  . PRO A 1 41  ? -5.579  0.283   -1.499  1.00 0.00 ? 41  PRO A HG2  5  
ATOM 7372  H HG3  . PRO A 1 41  ? -5.616  -0.297  0.176   1.00 0.00 ? 41  PRO A HG3  5  
ATOM 7373  H HD2  . PRO A 1 41  ? -5.606  -1.977  -1.947  1.00 0.00 ? 41  PRO A HD2  5  
ATOM 7374  H HD3  . PRO A 1 41  ? -6.434  -2.366  -0.425  1.00 0.00 ? 41  PRO A HD3  5  
ATOM 7375  N N    . ARG A 1 42  ? -9.191  1.655   -2.835  1.00 0.00 ? 42  ARG A N    5  
ATOM 7376  C CA   . ARG A 1 42  ? -9.323  2.589   -3.947  1.00 0.00 ? 42  ARG A CA   5  
ATOM 7377  C C    . ARG A 1 42  ? -7.953  2.998   -4.479  1.00 0.00 ? 42  ARG A C    5  
ATOM 7378  O O    . ARG A 1 42  ? -7.822  3.413   -5.631  1.00 0.00 ? 42  ARG A O    5  
ATOM 7379  C CB   . ARG A 1 42  ? -10.103 3.830   -3.508  1.00 0.00 ? 42  ARG A CB   5  
ATOM 7380  C CG   . ARG A 1 42  ? -10.243 4.879   -4.599  1.00 0.00 ? 42  ARG A CG   5  
ATOM 7381  C CD   . ARG A 1 42  ? -11.056 6.072   -4.123  1.00 0.00 ? 42  ARG A CD   5  
ATOM 7382  N NE   . ARG A 1 42  ? -12.466 5.737   -3.942  1.00 0.00 ? 42  ARG A NE   5  
ATOM 7383  C CZ   . ARG A 1 42  ? -12.961 5.222   -2.822  1.00 0.00 ? 42  ARG A CZ   5  
ATOM 7384  N NH1  . ARG A 1 42  ? -12.165 4.985   -1.789  1.00 0.00 ? 42  ARG A NH1  5  
ATOM 7385  N NH2  . ARG A 1 42  ? -14.256 4.944   -2.734  1.00 0.00 ? 42  ARG A NH2  5  
ATOM 7386  H H    . ARG A 1 42  ? -9.700  1.814   -2.014  1.00 0.00 ? 42  ARG A H    5  
ATOM 7387  H HA   . ARG A 1 42  ? -9.869  2.092   -4.735  1.00 0.00 ? 42  ARG A HA   5  
ATOM 7388  H HB2  . ARG A 1 42  ? -11.093 3.528   -3.199  1.00 0.00 ? 42  ARG A HB2  5  
ATOM 7389  H HB3  . ARG A 1 42  ? -9.595  4.280   -2.669  1.00 0.00 ? 42  ARG A HB3  5  
ATOM 7390  H HG2  . ARG A 1 42  ? -9.260  5.219   -4.887  1.00 0.00 ? 42  ARG A HG2  5  
ATOM 7391  H HG3  . ARG A 1 42  ? -10.736 4.434   -5.451  1.00 0.00 ? 42  ARG A HG3  5  
ATOM 7392  H HD2  . ARG A 1 42  ? -10.654 6.413   -3.181  1.00 0.00 ? 42  ARG A HD2  5  
ATOM 7393  H HD3  . ARG A 1 42  ? -10.974 6.861   -4.855  1.00 0.00 ? 42  ARG A HD3  5  
ATOM 7394  H HE   . ARG A 1 42  ? -13.072 5.904   -4.693  1.00 0.00 ? 42  ARG A HE   5  
ATOM 7395  H HH11 . ARG A 1 42  ? -11.190 5.194   -1.852  1.00 0.00 ? 42  ARG A HH11 5  
ATOM 7396  H HH12 . ARG A 1 42  ? -12.541 4.598   -0.946  1.00 0.00 ? 42  ARG A HH12 5  
ATOM 7397  H HH21 . ARG A 1 42  ? -14.859 5.121   -3.511  1.00 0.00 ? 42  ARG A HH21 5  
ATOM 7398  H HH22 . ARG A 1 42  ? -14.627 4.556   -1.891  1.00 0.00 ? 42  ARG A HH22 5  
ATOM 7399  N N    . SER A 1 43  ? -6.935  2.878   -3.633  1.00 0.00 ? 43  SER A N    5  
ATOM 7400  C CA   . SER A 1 43  ? -5.576  3.239   -4.017  1.00 0.00 ? 43  SER A CA   5  
ATOM 7401  C C    . SER A 1 43  ? -5.206  2.616   -5.359  1.00 0.00 ? 43  SER A C    5  
ATOM 7402  O O    . SER A 1 43  ? -4.915  1.422   -5.443  1.00 0.00 ? 43  SER A O    5  
ATOM 7403  C CB   . SER A 1 43  ? -4.583  2.790   -2.943  1.00 0.00 ? 43  SER A CB   5  
ATOM 7404  O OG   . SER A 1 43  ? -3.306  3.366   -3.155  1.00 0.00 ? 43  SER A OG   5  
ATOM 7405  H H    . SER A 1 43  ? -7.103  2.541   -2.728  1.00 0.00 ? 43  SER A H    5  
ATOM 7406  H HA   . SER A 1 43  ? -5.532  4.314   -4.109  1.00 0.00 ? 43  SER A HA   5  
ATOM 7407  H HB2  . SER A 1 43  ? -4.945  3.095   -1.972  1.00 0.00 ? 43  SER A HB2  5  
ATOM 7408  H HB3  . SER A 1 43  ? -4.490  1.714   -2.971  1.00 0.00 ? 43  SER A HB3  5  
ATOM 7409  H HG   . SER A 1 43  ? -3.311  4.277   -2.855  1.00 0.00 ? 43  SER A HG   5  
ATOM 7410  N N    . ASP A 1 44  ? -5.221  3.431   -6.408  1.00 0.00 ? 44  ASP A N    5  
ATOM 7411  C CA   . ASP A 1 44  ? -4.887  2.961   -7.747  1.00 0.00 ? 44  ASP A CA   5  
ATOM 7412  C C    . ASP A 1 44  ? -3.382  2.759   -7.892  1.00 0.00 ? 44  ASP A C    5  
ATOM 7413  O O    . ASP A 1 44  ? -2.930  1.848   -8.587  1.00 0.00 ? 44  ASP A O    5  
ATOM 7414  C CB   . ASP A 1 44  ? -5.384  3.955   -8.798  1.00 0.00 ? 44  ASP A CB   5  
ATOM 7415  C CG   . ASP A 1 44  ? -4.645  3.823   -10.115 1.00 0.00 ? 44  ASP A CG   5  
ATOM 7416  O OD1  . ASP A 1 44  ? -4.913  2.851   -10.851 1.00 0.00 ? 44  ASP A OD1  5  
ATOM 7417  O OD2  . ASP A 1 44  ? -3.797  4.692   -10.410 1.00 0.00 ? 44  ASP A OD2  5  
ATOM 7418  H H    . ASP A 1 44  ? -5.462  4.373   -6.277  1.00 0.00 ? 44  ASP A H    5  
ATOM 7419  H HA   . ASP A 1 44  ? -5.381  2.014   -7.899  1.00 0.00 ? 44  ASP A HA   5  
ATOM 7420  H HB2  . ASP A 1 44  ? -6.435  3.783   -8.978  1.00 0.00 ? 44  ASP A HB2  5  
ATOM 7421  H HB3  . ASP A 1 44  ? -5.246  4.960   -8.427  1.00 0.00 ? 44  ASP A HB3  5  
ATOM 7422  N N    . THR A 1 45  ? -2.608  3.616   -7.232  1.00 0.00 ? 45  THR A N    5  
ATOM 7423  C CA   . THR A 1 45  ? -1.154  3.533   -7.289  1.00 0.00 ? 45  THR A CA   5  
ATOM 7424  C C    . THR A 1 45  ? -0.629  2.440   -6.365  1.00 0.00 ? 45  THR A C    5  
ATOM 7425  O O    . THR A 1 45  ? -0.483  2.650   -5.160  1.00 0.00 ? 45  THR A O    5  
ATOM 7426  C CB   . THR A 1 45  ? -0.500  4.873   -6.904  1.00 0.00 ? 45  THR A CB   5  
ATOM 7427  O OG1  . THR A 1 45  ? -1.024  5.333   -5.654  1.00 0.00 ? 45  THR A OG1  5  
ATOM 7428  C CG2  . THR A 1 45  ? -0.743  5.922   -7.979  1.00 0.00 ? 45  THR A CG2  5  
ATOM 7429  H H    . THR A 1 45  ? -3.027  4.320   -6.695  1.00 0.00 ? 45  THR A H    5  
ATOM 7430  H HA   . THR A 1 45  ? -0.873  3.297   -8.305  1.00 0.00 ? 45  THR A HA   5  
ATOM 7431  H HB   . THR A 1 45  ? 0.566   4.720   -6.806  1.00 0.00 ? 45  THR A HB   5  
ATOM 7432  H HG1  . THR A 1 45  ? -1.851  5.796   -5.805  1.00 0.00 ? 45  THR A HG1  5  
ATOM 7433  H HG21 . THR A 1 45  ? -1.503  5.570   -8.660  1.00 0.00 ? 45  THR A HG21 5  
ATOM 7434  H HG22 . THR A 1 45  ? 0.173   6.100   -8.522  1.00 0.00 ? 45  THR A HG22 5  
ATOM 7435  H HG23 . THR A 1 45  ? -1.072  6.840   -7.517  1.00 0.00 ? 45  THR A HG23 5  
ATOM 7436  N N    . ILE A 1 46  ? -0.346  1.274   -6.936  1.00 0.00 ? 46  ILE A N    5  
ATOM 7437  C CA   . ILE A 1 46  ? 0.165   0.149   -6.162  1.00 0.00 ? 46  ILE A CA   5  
ATOM 7438  C C    . ILE A 1 46  ? 1.289   -0.564  -6.906  1.00 0.00 ? 46  ILE A C    5  
ATOM 7439  O O    . ILE A 1 46  ? 1.078   -1.123  -7.982  1.00 0.00 ? 46  ILE A O    5  
ATOM 7440  C CB   . ILE A 1 46  ? -0.949  -0.866  -5.842  1.00 0.00 ? 46  ILE A CB   5  
ATOM 7441  C CG1  . ILE A 1 46  ? -2.061  -0.197  -5.033  1.00 0.00 ? 46  ILE A CG1  5  
ATOM 7442  C CG2  . ILE A 1 46  ? -0.378  -2.056  -5.086  1.00 0.00 ? 46  ILE A CG2  5  
ATOM 7443  C CD1  . ILE A 1 46  ? -3.310  -1.042  -4.909  1.00 0.00 ? 46  ILE A CD1  5  
ATOM 7444  H H    . ILE A 1 46  ? -0.484  1.168   -7.900  1.00 0.00 ? 46  ILE A H    5  
ATOM 7445  H HA   . ILE A 1 46  ? 0.552   0.535   -5.230  1.00 0.00 ? 46  ILE A HA   5  
ATOM 7446  H HB   . ILE A 1 46  ? -1.357  -1.224  -6.775  1.00 0.00 ? 46  ILE A HB   5  
ATOM 7447  H HG12 . ILE A 1 46  ? -1.700  0.009   -4.037  1.00 0.00 ? 46  ILE A HG12 5  
ATOM 7448  H HG13 . ILE A 1 46  ? -2.335  0.733   -5.511  1.00 0.00 ? 46  ILE A HG13 5  
ATOM 7449  H HG21 . ILE A 1 46  ? -0.593  -1.950  -4.033  1.00 0.00 ? 46  ILE A HG21 5  
ATOM 7450  H HG22 . ILE A 1 46  ? -0.830  -2.966  -5.454  1.00 0.00 ? 46  ILE A HG22 5  
ATOM 7451  H HG23 . ILE A 1 46  ? 0.690   -2.099  -5.233  1.00 0.00 ? 46  ILE A HG23 5  
ATOM 7452  H HD11 . ILE A 1 46  ? -4.007  -0.559  -4.240  1.00 0.00 ? 46  ILE A HD11 5  
ATOM 7453  H HD12 . ILE A 1 46  ? -3.764  -1.158  -5.881  1.00 0.00 ? 46  ILE A HD12 5  
ATOM 7454  H HD13 . ILE A 1 46  ? -3.049  -2.013  -4.514  1.00 0.00 ? 46  ILE A HD13 5  
ATOM 7455  N N    . ALA A 1 47  ? 2.483   -0.542  -6.324  1.00 0.00 ? 47  ALA A N    5  
ATOM 7456  C CA   . ALA A 1 47  ? 3.640   -1.189  -6.929  1.00 0.00 ? 47  ALA A CA   5  
ATOM 7457  C C    . ALA A 1 47  ? 3.569   -2.704  -6.767  1.00 0.00 ? 47  ALA A C    5  
ATOM 7458  O O    . ALA A 1 47  ? 3.774   -3.450  -7.724  1.00 0.00 ? 47  ALA A O    5  
ATOM 7459  C CB   . ALA A 1 47  ? 4.926   -0.652  -6.318  1.00 0.00 ? 47  ALA A CB   5  
ATOM 7460  H H    . ALA A 1 47  ? 2.588   -0.080  -5.466  1.00 0.00 ? 47  ALA A H    5  
ATOM 7461  H HA   . ALA A 1 47  ? 3.644   -0.950  -7.983  1.00 0.00 ? 47  ALA A HA   5  
ATOM 7462  H HB1  . ALA A 1 47  ? 5.765   -1.226  -6.684  1.00 0.00 ? 47  ALA A HB1  5  
ATOM 7463  H HB2  . ALA A 1 47  ? 5.050   0.385   -6.596  1.00 0.00 ? 47  ALA A HB2  5  
ATOM 7464  H HB3  . ALA A 1 47  ? 4.875   -0.733  -5.243  1.00 0.00 ? 47  ALA A HB3  5  
ATOM 7465  N N    . ASN A 1 48  ? 3.277   -3.151  -5.550  1.00 0.00 ? 48  ASN A N    5  
ATOM 7466  C CA   . ASN A 1 48  ? 3.180   -4.578  -5.263  1.00 0.00 ? 48  ASN A CA   5  
ATOM 7467  C C    . ASN A 1 48  ? 2.720   -4.814  -3.827  1.00 0.00 ? 48  ASN A C    5  
ATOM 7468  O O    . ASN A 1 48  ? 2.499   -3.867  -3.072  1.00 0.00 ? 48  ASN A O    5  
ATOM 7469  C CB   . ASN A 1 48  ? 4.530   -5.259  -5.497  1.00 0.00 ? 48  ASN A CB   5  
ATOM 7470  C CG   . ASN A 1 48  ? 5.699   -4.366  -5.131  1.00 0.00 ? 48  ASN A CG   5  
ATOM 7471  O OD1  . ASN A 1 48  ? 5.651   -3.634  -4.143  1.00 0.00 ? 48  ASN A OD1  5  
ATOM 7472  N ND2  . ASN A 1 48  ? 6.759   -4.423  -5.930  1.00 0.00 ? 48  ASN A ND2  5  
ATOM 7473  H H    . ASN A 1 48  ? 3.124   -2.507  -4.828  1.00 0.00 ? 48  ASN A H    5  
ATOM 7474  H HA   . ASN A 1 48  ? 2.451   -5.002  -5.936  1.00 0.00 ? 48  ASN A HA   5  
ATOM 7475  H HB2  . ASN A 1 48  ? 4.583   -6.154  -4.894  1.00 0.00 ? 48  ASN A HB2  5  
ATOM 7476  H HB3  . ASN A 1 48  ? 4.616   -5.527  -6.539  1.00 0.00 ? 48  ASN A HB3  5  
ATOM 7477  H HD21 . ASN A 1 48  ? 6.727   -5.029  -6.700  1.00 0.00 ? 48  ASN A HD21 5  
ATOM 7478  H HD22 . ASN A 1 48  ? 7.530   -3.856  -5.717  1.00 0.00 ? 48  ASN A HD22 5  
ATOM 7479  N N    . TYR A 1 49  ? 2.580   -6.082  -3.458  1.00 0.00 ? 49  TYR A N    5  
ATOM 7480  C CA   . TYR A 1 49  ? 2.145   -6.443  -2.114  1.00 0.00 ? 49  TYR A CA   5  
ATOM 7481  C C    . TYR A 1 49  ? 3.216   -7.258  -1.396  1.00 0.00 ? 49  TYR A C    5  
ATOM 7482  O O    . TYR A 1 49  ? 4.010   -7.953  -2.028  1.00 0.00 ? 49  TYR A O    5  
ATOM 7483  C CB   . TYR A 1 49  ? 0.839   -7.236  -2.174  1.00 0.00 ? 49  TYR A CB   5  
ATOM 7484  C CG   . TYR A 1 49  ? -0.357  -6.404  -2.577  1.00 0.00 ? 49  TYR A CG   5  
ATOM 7485  C CD1  . TYR A 1 49  ? -0.621  -6.134  -3.914  1.00 0.00 ? 49  TYR A CD1  5  
ATOM 7486  C CD2  . TYR A 1 49  ? -1.224  -5.889  -1.622  1.00 0.00 ? 49  TYR A CD2  5  
ATOM 7487  C CE1  . TYR A 1 49  ? -1.713  -5.374  -4.288  1.00 0.00 ? 49  TYR A CE1  5  
ATOM 7488  C CE2  . TYR A 1 49  ? -2.319  -5.129  -1.986  1.00 0.00 ? 49  TYR A CE2  5  
ATOM 7489  C CZ   . TYR A 1 49  ? -2.559  -4.873  -3.320  1.00 0.00 ? 49  TYR A CZ   5  
ATOM 7490  O OH   . TYR A 1 49  ? -3.647  -4.117  -3.688  1.00 0.00 ? 49  TYR A OH   5  
ATOM 7491  H H    . TYR A 1 49  ? 2.771   -6.793  -4.105  1.00 0.00 ? 49  TYR A H    5  
ATOM 7492  H HA   . TYR A 1 49  ? 1.975   -5.529  -1.564  1.00 0.00 ? 49  TYR A HA   5  
ATOM 7493  H HB2  . TYR A 1 49  ? 0.943   -8.035  -2.891  1.00 0.00 ? 49  TYR A HB2  5  
ATOM 7494  H HB3  . TYR A 1 49  ? 0.637   -7.658  -1.200  1.00 0.00 ? 49  TYR A HB3  5  
ATOM 7495  H HD1  . TYR A 1 49  ? 0.043   -6.528  -4.670  1.00 0.00 ? 49  TYR A HD1  5  
ATOM 7496  H HD2  . TYR A 1 49  ? -1.034  -6.090  -0.577  1.00 0.00 ? 49  TYR A HD2  5  
ATOM 7497  H HE1  . TYR A 1 49  ? -1.901  -5.174  -5.332  1.00 0.00 ? 49  TYR A HE1  5  
ATOM 7498  H HE2  . TYR A 1 49  ? -2.982  -4.736  -1.228  1.00 0.00 ? 49  TYR A HE2  5  
ATOM 7499  H HH   . TYR A 1 49  ? -3.903  -4.340  -4.586  1.00 0.00 ? 49  TYR A HH   5  
ATOM 7500  N N    . GLU A 1 50  ? 3.229   -7.167  -0.069  1.00 0.00 ? 50  GLU A N    5  
ATOM 7501  C CA   . GLU A 1 50  ? 4.202   -7.895  0.736   1.00 0.00 ? 50  GLU A CA   5  
ATOM 7502  C C    . GLU A 1 50  ? 3.572   -9.137  1.360   1.00 0.00 ? 50  GLU A C    5  
ATOM 7503  O O    . GLU A 1 50  ? 2.563   -9.049  2.062   1.00 0.00 ? 50  GLU A O    5  
ATOM 7504  C CB   . GLU A 1 50  ? 4.769   -6.991  1.833   1.00 0.00 ? 50  GLU A CB   5  
ATOM 7505  C CG   . GLU A 1 50  ? 6.183   -7.355  2.251   1.00 0.00 ? 50  GLU A CG   5  
ATOM 7506  C CD   . GLU A 1 50  ? 7.237   -6.675  1.399   1.00 0.00 ? 50  GLU A CD   5  
ATOM 7507  O OE1  . GLU A 1 50  ? 7.267   -6.932  0.177   1.00 0.00 ? 50  GLU A OE1  5  
ATOM 7508  O OE2  . GLU A 1 50  ? 8.032   -5.888  1.953   1.00 0.00 ? 50  GLU A OE2  5  
ATOM 7509  H H    . GLU A 1 50  ? 2.570   -6.596  0.378   1.00 0.00 ? 50  GLU A H    5  
ATOM 7510  H HA   . GLU A 1 50  ? 5.007   -8.203  0.086   1.00 0.00 ? 50  GLU A HA   5  
ATOM 7511  H HB2  . GLU A 1 50  ? 4.772   -5.972  1.477   1.00 0.00 ? 50  GLU A HB2  5  
ATOM 7512  H HB3  . GLU A 1 50  ? 4.131   -7.058  2.702   1.00 0.00 ? 50  GLU A HB3  5  
ATOM 7513  H HG2  . GLU A 1 50  ? 6.329   -7.059  3.280   1.00 0.00 ? 50  GLU A HG2  5  
ATOM 7514  H HG3  . GLU A 1 50  ? 6.307   -8.425  2.165   1.00 0.00 ? 50  GLU A HG3  5  
ATOM 7515  N N    . LEU A 1 51  ? 4.172   -10.293 1.100   1.00 0.00 ? 51  LEU A N    5  
ATOM 7516  C CA   . LEU A 1 51  ? 3.670   -11.553 1.635   1.00 0.00 ? 51  LEU A CA   5  
ATOM 7517  C C    . LEU A 1 51  ? 4.678   -12.178 2.594   1.00 0.00 ? 51  LEU A C    5  
ATOM 7518  O O    . LEU A 1 51  ? 5.511   -12.991 2.193   1.00 0.00 ? 51  LEU A O    5  
ATOM 7519  C CB   . LEU A 1 51  ? 3.361   -12.527 0.496   1.00 0.00 ? 51  LEU A CB   5  
ATOM 7520  C CG   . LEU A 1 51  ? 3.081   -13.973 0.906   1.00 0.00 ? 51  LEU A CG   5  
ATOM 7521  C CD1  . LEU A 1 51  ? 1.889   -14.039 1.848   1.00 0.00 ? 51  LEU A CD1  5  
ATOM 7522  C CD2  . LEU A 1 51  ? 2.841   -14.839 -0.322  1.00 0.00 ? 51  LEU A CD2  5  
ATOM 7523  H H    . LEU A 1 51  ? 4.972   -10.300 0.534   1.00 0.00 ? 51  LEU A H    5  
ATOM 7524  H HA   . LEU A 1 51  ? 2.759   -11.344 2.176   1.00 0.00 ? 51  LEU A HA   5  
ATOM 7525  H HB2  . LEU A 1 51  ? 2.493   -12.158 -0.028  1.00 0.00 ? 51  LEU A HB2  5  
ATOM 7526  H HB3  . LEU A 1 51  ? 4.210   -12.530 -0.174  1.00 0.00 ? 51  LEU A HB3  5  
ATOM 7527  H HG   . LEU A 1 51  ? 3.942   -14.365 1.430   1.00 0.00 ? 51  LEU A HG   5  
ATOM 7528  H HD11 . LEU A 1 51  ? 1.087   -13.432 1.456   1.00 0.00 ? 51  LEU A HD11 5  
ATOM 7529  H HD12 . LEU A 1 51  ? 2.178   -13.669 2.821   1.00 0.00 ? 51  LEU A HD12 5  
ATOM 7530  H HD13 . LEU A 1 51  ? 1.556   -15.063 1.937   1.00 0.00 ? 51  LEU A HD13 5  
ATOM 7531  H HD21 . LEU A 1 51  ? 1.786   -14.850 -0.553  1.00 0.00 ? 51  LEU A HD21 5  
ATOM 7532  H HD22 . LEU A 1 51  ? 3.177   -15.846 -0.123  1.00 0.00 ? 51  LEU A HD22 5  
ATOM 7533  H HD23 . LEU A 1 51  ? 3.390   -14.435 -1.160  1.00 0.00 ? 51  LEU A HD23 5  
ATOM 7534  N N    . VAL A 1 52  ? 4.596   -11.794 3.864   1.00 0.00 ? 52  VAL A N    5  
ATOM 7535  C CA   . VAL A 1 52  ? 5.498   -12.319 4.881   1.00 0.00 ? 52  VAL A CA   5  
ATOM 7536  C C    . VAL A 1 52  ? 5.100   -13.732 5.294   1.00 0.00 ? 52  VAL A C    5  
ATOM 7537  O O    . VAL A 1 52  ? 4.180   -13.921 6.090   1.00 0.00 ? 52  VAL A O    5  
ATOM 7538  C CB   . VAL A 1 52  ? 5.521   -11.418 6.131   1.00 0.00 ? 52  VAL A CB   5  
ATOM 7539  C CG1  . VAL A 1 52  ? 6.362   -12.049 7.229   1.00 0.00 ? 52  VAL A CG1  5  
ATOM 7540  C CG2  . VAL A 1 52  ? 6.040   -10.033 5.779   1.00 0.00 ? 52  VAL A CG2  5  
ATOM 7541  H H    . VAL A 1 52  ? 3.910   -11.144 4.123   1.00 0.00 ? 52  VAL A H    5  
ATOM 7542  H HA   . VAL A 1 52  ? 6.494   -12.344 4.463   1.00 0.00 ? 52  VAL A HA   5  
ATOM 7543  H HB   . VAL A 1 52  ? 4.509   -11.318 6.495   1.00 0.00 ? 52  VAL A HB   5  
ATOM 7544  H HG11 . VAL A 1 52  ? 5.749   -12.723 7.809   1.00 0.00 ? 52  VAL A HG11 5  
ATOM 7545  H HG12 . VAL A 1 52  ? 7.182   -12.596 6.786   1.00 0.00 ? 52  VAL A HG12 5  
ATOM 7546  H HG13 . VAL A 1 52  ? 6.753   -11.275 7.873   1.00 0.00 ? 52  VAL A HG13 5  
ATOM 7547  H HG21 . VAL A 1 52  ? 5.972   -9.392  6.645   1.00 0.00 ? 52  VAL A HG21 5  
ATOM 7548  H HG22 . VAL A 1 52  ? 7.072   -10.104 5.464   1.00 0.00 ? 52  VAL A HG22 5  
ATOM 7549  H HG23 . VAL A 1 52  ? 5.448   -9.618  4.976   1.00 0.00 ? 52  VAL A HG23 5  
ATOM 7550  N N    . TYR A 1 53  ? 5.798   -14.721 4.747   1.00 0.00 ? 53  TYR A N    5  
ATOM 7551  C CA   . TYR A 1 53  ? 5.516   -16.117 5.057   1.00 0.00 ? 53  TYR A CA   5  
ATOM 7552  C C    . TYR A 1 53  ? 6.715   -16.779 5.729   1.00 0.00 ? 53  TYR A C    5  
ATOM 7553  O O    . TYR A 1 53  ? 7.866   -16.488 5.401   1.00 0.00 ? 53  TYR A O    5  
ATOM 7554  C CB   . TYR A 1 53  ? 5.147   -16.879 3.783   1.00 0.00 ? 53  TYR A CB   5  
ATOM 7555  C CG   . TYR A 1 53  ? 6.345   -17.381 3.009   1.00 0.00 ? 53  TYR A CG   5  
ATOM 7556  C CD1  . TYR A 1 53  ? 6.959   -18.582 3.343   1.00 0.00 ? 53  TYR A CD1  5  
ATOM 7557  C CD2  . TYR A 1 53  ? 6.864   -16.654 1.944   1.00 0.00 ? 53  TYR A CD2  5  
ATOM 7558  C CE1  . TYR A 1 53  ? 8.055   -19.044 2.639   1.00 0.00 ? 53  TYR A CE1  5  
ATOM 7559  C CE2  . TYR A 1 53  ? 7.958   -17.109 1.234   1.00 0.00 ? 53  TYR A CE2  5  
ATOM 7560  C CZ   . TYR A 1 53  ? 8.550   -18.304 1.585   1.00 0.00 ? 53  TYR A CZ   5  
ATOM 7561  O OH   . TYR A 1 53  ? 9.640   -18.760 0.881   1.00 0.00 ? 53  TYR A OH   5  
ATOM 7562  H H    . TYR A 1 53  ? 6.520   -14.507 4.119   1.00 0.00 ? 53  TYR A H    5  
ATOM 7563  H HA   . TYR A 1 53  ? 4.677   -16.144 5.736   1.00 0.00 ? 53  TYR A HA   5  
ATOM 7564  H HB2  . TYR A 1 53  ? 4.542   -17.733 4.045   1.00 0.00 ? 53  TYR A HB2  5  
ATOM 7565  H HB3  . TYR A 1 53  ? 4.581   -16.228 3.133   1.00 0.00 ? 53  TYR A HB3  5  
ATOM 7566  H HD1  . TYR A 1 53  ? 6.569   -19.159 4.169   1.00 0.00 ? 53  TYR A HD1  5  
ATOM 7567  H HD2  . TYR A 1 53  ? 6.398   -15.718 1.672   1.00 0.00 ? 53  TYR A HD2  5  
ATOM 7568  H HE1  . TYR A 1 53  ? 8.519   -19.980 2.913   1.00 0.00 ? 53  TYR A HE1  5  
ATOM 7569  H HE2  . TYR A 1 53  ? 8.346   -16.530 0.409   1.00 0.00 ? 53  TYR A HE2  5  
ATOM 7570  H HH   . TYR A 1 53  ? 9.505   -19.681 0.642   1.00 0.00 ? 53  TYR A HH   5  
ATOM 7571  N N    . LYS A 1 54  ? 6.438   -17.673 6.672   1.00 0.00 ? 54  LYS A N    5  
ATOM 7572  C CA   . LYS A 1 54  ? 7.491   -18.379 7.392   1.00 0.00 ? 54  LYS A CA   5  
ATOM 7573  C C    . LYS A 1 54  ? 7.130   -19.849 7.580   1.00 0.00 ? 54  LYS A C    5  
ATOM 7574  O O    . LYS A 1 54  ? 5.958   -20.222 7.527   1.00 0.00 ? 54  LYS A O    5  
ATOM 7575  C CB   . LYS A 1 54  ? 7.734   -17.725 8.754   1.00 0.00 ? 54  LYS A CB   5  
ATOM 7576  C CG   . LYS A 1 54  ? 6.464   -17.497 9.555   1.00 0.00 ? 54  LYS A CG   5  
ATOM 7577  C CD   . LYS A 1 54  ? 6.716   -16.606 10.759  1.00 0.00 ? 54  LYS A CD   5  
ATOM 7578  C CE   . LYS A 1 54  ? 5.416   -16.079 11.345  1.00 0.00 ? 54  LYS A CE   5  
ATOM 7579  N NZ   . LYS A 1 54  ? 5.651   -15.235 12.550  1.00 0.00 ? 54  LYS A NZ   5  
ATOM 7580  H H    . LYS A 1 54  ? 5.500   -17.862 6.890   1.00 0.00 ? 54  LYS A H    5  
ATOM 7581  H HA   . LYS A 1 54  ? 8.394   -18.315 6.805   1.00 0.00 ? 54  LYS A HA   5  
ATOM 7582  H HB2  . LYS A 1 54  ? 8.391   -18.358 9.332   1.00 0.00 ? 54  LYS A HB2  5  
ATOM 7583  H HB3  . LYS A 1 54  ? 8.214   -16.769 8.600   1.00 0.00 ? 54  LYS A HB3  5  
ATOM 7584  H HG2  . LYS A 1 54  ? 5.728   -17.026 8.920   1.00 0.00 ? 54  LYS A HG2  5  
ATOM 7585  H HG3  . LYS A 1 54  ? 6.089   -18.451 9.896   1.00 0.00 ? 54  LYS A HG3  5  
ATOM 7586  H HD2  . LYS A 1 54  ? 7.233   -17.177 11.517  1.00 0.00 ? 54  LYS A HD2  5  
ATOM 7587  H HD3  . LYS A 1 54  ? 7.330   -15.770 10.455  1.00 0.00 ? 54  LYS A HD3  5  
ATOM 7588  H HE2  . LYS A 1 54  ? 4.912   -15.488 10.595  1.00 0.00 ? 54  LYS A HE2  5  
ATOM 7589  H HE3  . LYS A 1 54  ? 4.793   -16.918 11.619  1.00 0.00 ? 54  LYS A HE3  5  
ATOM 7590  H HZ1  . LYS A 1 54  ? 5.529   -14.230 12.311  1.00 0.00 ? 54  LYS A HZ1  5  
ATOM 7591  H HZ2  . LYS A 1 54  ? 6.618   -15.381 12.904  1.00 0.00 ? 54  LYS A HZ2  5  
ATOM 7592  H HZ3  . LYS A 1 54  ? 4.977   -15.487 13.300  1.00 0.00 ? 54  LYS A HZ3  5  
ATOM 7593  N N    . ASP A 1 55  ? 8.143   -20.679 7.800   1.00 0.00 ? 55  ASP A N    5  
ATOM 7594  C CA   . ASP A 1 55  ? 7.932   -22.108 7.998   1.00 0.00 ? 55  ASP A CA   5  
ATOM 7595  C C    . ASP A 1 55  ? 7.433   -22.393 9.411   1.00 0.00 ? 55  ASP A C    5  
ATOM 7596  O O    . ASP A 1 55  ? 8.213   -22.421 10.362  1.00 0.00 ? 55  ASP A O    5  
ATOM 7597  C CB   . ASP A 1 55  ? 9.228   -22.878 7.737   1.00 0.00 ? 55  ASP A CB   5  
ATOM 7598  C CG   . ASP A 1 55  ? 9.326   -24.144 8.566   1.00 0.00 ? 55  ASP A CG   5  
ATOM 7599  O OD1  . ASP A 1 55  ? 8.342   -24.912 8.596   1.00 0.00 ? 55  ASP A OD1  5  
ATOM 7600  O OD2  . ASP A 1 55  ? 10.388  -24.367 9.183   1.00 0.00 ? 55  ASP A OD2  5  
ATOM 7601  H H    . ASP A 1 55  ? 9.056   -20.322 7.831   1.00 0.00 ? 55  ASP A H    5  
ATOM 7602  H HA   . ASP A 1 55  ? 7.182   -22.434 7.293   1.00 0.00 ? 55  ASP A HA   5  
ATOM 7603  H HB2  . ASP A 1 55  ? 9.273   -23.150 6.692   1.00 0.00 ? 55  ASP A HB2  5  
ATOM 7604  H HB3  . ASP A 1 55  ? 10.069  -22.245 7.977   1.00 0.00 ? 55  ASP A HB3  5  
ATOM 7605  N N    . GLY A 1 56  ? 6.126   -22.602 9.541   1.00 0.00 ? 56  GLY A N    5  
ATOM 7606  C CA   . GLY A 1 56  ? 5.545   -22.881 10.842  1.00 0.00 ? 56  GLY A CA   5  
ATOM 7607  C C    . GLY A 1 56  ? 5.531   -21.662 11.743  1.00 0.00 ? 56  GLY A C    5  
ATOM 7608  O O    . GLY A 1 56  ? 5.440   -20.531 11.267  1.00 0.00 ? 56  GLY A O    5  
ATOM 7609  H H    . GLY A 1 56  ? 5.552   -22.568 8.748   1.00 0.00 ? 56  GLY A H    5  
ATOM 7610  H HA2  . GLY A 1 56  ? 4.531   -23.226 10.704  1.00 0.00 ? 56  GLY A HA2  5  
ATOM 7611  H HA3  . GLY A 1 56  ? 6.119   -23.661 11.320  1.00 0.00 ? 56  GLY A HA3  5  
ATOM 7612  N N    . GLU A 1 57  ? 5.621   -21.893 13.049  1.00 0.00 ? 57  GLU A N    5  
ATOM 7613  C CA   . GLU A 1 57  ? 5.615   -20.804 14.019  1.00 0.00 ? 57  GLU A CA   5  
ATOM 7614  C C    . GLU A 1 57  ? 7.002   -20.178 14.142  1.00 0.00 ? 57  GLU A C    5  
ATOM 7615  O O    . GLU A 1 57  ? 7.166   -18.969 13.975  1.00 0.00 ? 57  GLU A O    5  
ATOM 7616  C CB   . GLU A 1 57  ? 5.150   -21.311 15.386  1.00 0.00 ? 57  GLU A CB   5  
ATOM 7617  C CG   . GLU A 1 57  ? 4.738   -20.201 16.338  1.00 0.00 ? 57  GLU A CG   5  
ATOM 7618  C CD   . GLU A 1 57  ? 4.178   -20.731 17.644  1.00 0.00 ? 57  GLU A CD   5  
ATOM 7619  O OE1  . GLU A 1 57  ? 4.508   -21.880 18.007  1.00 0.00 ? 57  GLU A OE1  5  
ATOM 7620  O OE2  . GLU A 1 57  ? 3.411   -19.998 18.303  1.00 0.00 ? 57  GLU A OE2  5  
ATOM 7621  H H    . GLU A 1 57  ? 5.691   -22.817 13.368  1.00 0.00 ? 57  GLU A H    5  
ATOM 7622  H HA   . GLU A 1 57  ? 4.924   -20.052 13.670  1.00 0.00 ? 57  GLU A HA   5  
ATOM 7623  H HB2  . GLU A 1 57  ? 4.304   -21.968 15.244  1.00 0.00 ? 57  GLU A HB2  5  
ATOM 7624  H HB3  . GLU A 1 57  ? 5.954   -21.868 15.842  1.00 0.00 ? 57  GLU A HB3  5  
ATOM 7625  H HG2  . GLU A 1 57  ? 5.602   -19.591 16.556  1.00 0.00 ? 57  GLU A HG2  5  
ATOM 7626  H HG3  . GLU A 1 57  ? 3.982   -19.595 15.860  1.00 0.00 ? 57  GLU A HG3  5  
ATOM 7627  N N    . HIS A 1 58  ? 7.996   -21.010 14.435  1.00 0.00 ? 58  HIS A N    5  
ATOM 7628  C CA   . HIS A 1 58  ? 9.369   -20.539 14.581  1.00 0.00 ? 58  HIS A CA   5  
ATOM 7629  C C    . HIS A 1 58  ? 10.078  -20.505 13.230  1.00 0.00 ? 58  HIS A C    5  
ATOM 7630  O O    . HIS A 1 58  ? 11.290  -20.696 13.149  1.00 0.00 ? 58  HIS A O    5  
ATOM 7631  C CB   . HIS A 1 58  ? 10.138  -21.436 15.551  1.00 0.00 ? 58  HIS A CB   5  
ATOM 7632  C CG   . HIS A 1 58  ? 10.208  -22.867 15.116  1.00 0.00 ? 58  HIS A CG   5  
ATOM 7633  N ND1  . HIS A 1 58  ? 11.378  -23.474 14.710  1.00 0.00 ? 58  HIS A ND1  5  
ATOM 7634  C CD2  . HIS A 1 58  ? 9.244   -23.814 15.028  1.00 0.00 ? 58  HIS A CD2  5  
ATOM 7635  C CE1  . HIS A 1 58  ? 11.130  -24.731 14.388  1.00 0.00 ? 58  HIS A CE1  5  
ATOM 7636  N NE2  . HIS A 1 58  ? 9.843   -24.963 14.573  1.00 0.00 ? 58  HIS A NE2  5  
ATOM 7637  H H    . HIS A 1 58  ? 7.802   -21.963 14.556  1.00 0.00 ? 58  HIS A H    5  
ATOM 7638  H HA   . HIS A 1 58  ? 9.335   -19.537 14.980  1.00 0.00 ? 58  HIS A HA   5  
ATOM 7639  H HB2  . HIS A 1 58  ? 11.149  -21.069 15.646  1.00 0.00 ? 58  HIS A HB2  5  
ATOM 7640  H HB3  . HIS A 1 58  ? 9.657   -21.405 16.518  1.00 0.00 ? 58  HIS A HB3  5  
ATOM 7641  H HD1  . HIS A 1 58  ? 12.258  -23.047 14.662  1.00 0.00 ? 58  HIS A HD1  5  
ATOM 7642  H HD2  . HIS A 1 58  ? 8.198   -23.689 15.269  1.00 0.00 ? 58  HIS A HD2  5  
ATOM 7643  H HE1  . HIS A 1 58  ? 11.856  -25.449 14.035  1.00 0.00 ? 58  HIS A HE1  5  
ATOM 7644  H HE2  . HIS A 1 58  ? 9.378   -25.790 14.329  1.00 0.00 ? 58  HIS A HE2  5  
ATOM 7645  N N    . GLY A 1 59  ? 9.312   -20.262 12.171  1.00 0.00 ? 59  GLY A N    5  
ATOM 7646  C CA   . GLY A 1 59  ? 9.884   -20.208 10.838  1.00 0.00 ? 59  GLY A CA   5  
ATOM 7647  C C    . GLY A 1 59  ? 10.646  -18.923 10.585  1.00 0.00 ? 59  GLY A C    5  
ATOM 7648  O O    . GLY A 1 59  ? 11.121  -18.281 11.522  1.00 0.00 ? 59  GLY A O    5  
ATOM 7649  H H    . GLY A 1 59  ? 8.350   -20.117 12.295  1.00 0.00 ? 59  GLY A H    5  
ATOM 7650  H HA2  . GLY A 1 59  ? 10.556  -21.044 10.713  1.00 0.00 ? 59  GLY A HA2  5  
ATOM 7651  H HA3  . GLY A 1 59  ? 9.087   -20.289 10.113  1.00 0.00 ? 59  GLY A HA3  5  
ATOM 7652  N N    . GLU A 1 60  ? 10.764  -18.547 9.316   1.00 0.00 ? 60  GLU A N    5  
ATOM 7653  C CA   . GLU A 1 60  ? 11.477  -17.330 8.943   1.00 0.00 ? 60  GLU A CA   5  
ATOM 7654  C C    . GLU A 1 60  ? 10.587  -16.411 8.112   1.00 0.00 ? 60  GLU A C    5  
ATOM 7655  O O    . GLU A 1 60  ? 9.998   -16.834 7.118   1.00 0.00 ? 60  GLU A O    5  
ATOM 7656  C CB   . GLU A 1 60  ? 12.745  -17.675 8.160   1.00 0.00 ? 60  GLU A CB   5  
ATOM 7657  C CG   . GLU A 1 60  ? 13.966  -17.883 9.040   1.00 0.00 ? 60  GLU A CG   5  
ATOM 7658  C CD   . GLU A 1 60  ? 15.258  -17.922 8.247   1.00 0.00 ? 60  GLU A CD   5  
ATOM 7659  O OE1  . GLU A 1 60  ? 15.329  -17.249 7.197   1.00 0.00 ? 60  GLU A OE1  5  
ATOM 7660  O OE2  . GLU A 1 60  ? 16.197  -18.625 8.674   1.00 0.00 ? 60  GLU A OE2  5  
ATOM 7661  H H    . GLU A 1 60  ? 10.364  -19.100 8.613   1.00 0.00 ? 60  GLU A H    5  
ATOM 7662  H HA   . GLU A 1 60  ? 11.754  -16.817 9.852   1.00 0.00 ? 60  GLU A HA   5  
ATOM 7663  H HB2  . GLU A 1 60  ? 12.572  -18.581 7.599   1.00 0.00 ? 60  GLU A HB2  5  
ATOM 7664  H HB3  . GLU A 1 60  ? 12.957  -16.871 7.471   1.00 0.00 ? 60  GLU A HB3  5  
ATOM 7665  H HG2  . GLU A 1 60  ? 14.024  -17.073 9.752   1.00 0.00 ? 60  GLU A HG2  5  
ATOM 7666  H HG3  . GLU A 1 60  ? 13.858  -18.818 9.570   1.00 0.00 ? 60  GLU A HG3  5  
ATOM 7667  N N    . GLU A 1 61  ? 10.494  -15.152 8.527   1.00 0.00 ? 61  GLU A N    5  
ATOM 7668  C CA   . GLU A 1 61  ? 9.675   -14.173 7.822   1.00 0.00 ? 61  GLU A CA   5  
ATOM 7669  C C    . GLU A 1 61  ? 10.323  -13.773 6.499   1.00 0.00 ? 61  GLU A C    5  
ATOM 7670  O O    . GLU A 1 61  ? 11.300  -13.026 6.477   1.00 0.00 ? 61  GLU A O    5  
ATOM 7671  C CB   . GLU A 1 61  ? 9.459   -12.933 8.692   1.00 0.00 ? 61  GLU A CB   5  
ATOM 7672  C CG   . GLU A 1 61  ? 8.601   -13.193 9.919   1.00 0.00 ? 61  GLU A CG   5  
ATOM 7673  C CD   . GLU A 1 61  ? 8.666   -12.060 10.926  1.00 0.00 ? 61  GLU A CD   5  
ATOM 7674  O OE1  . GLU A 1 61  ? 8.163   -10.961 10.616  1.00 0.00 ? 61  GLU A OE1  5  
ATOM 7675  O OE2  . GLU A 1 61  ? 9.220   -12.275 12.024  1.00 0.00 ? 61  GLU A OE2  5  
ATOM 7676  H H    . GLU A 1 61  ? 10.988  -14.874 9.327   1.00 0.00 ? 61  GLU A H    5  
ATOM 7677  H HA   . GLU A 1 61  ? 8.718   -14.628 7.617   1.00 0.00 ? 61  GLU A HA   5  
ATOM 7678  H HB2  . GLU A 1 61  ? 10.420  -12.567 9.021   1.00 0.00 ? 61  GLU A HB2  5  
ATOM 7679  H HB3  . GLU A 1 61  ? 8.978   -12.171 8.097   1.00 0.00 ? 61  GLU A HB3  5  
ATOM 7680  H HG2  . GLU A 1 61  ? 7.576   -13.317 9.606   1.00 0.00 ? 61  GLU A HG2  5  
ATOM 7681  H HG3  . GLU A 1 61  ? 8.943   -14.099 10.397  1.00 0.00 ? 61  GLU A HG3  5  
ATOM 7682  N N    . GLN A 1 62  ? 9.771   -14.278 5.401   1.00 0.00 ? 62  GLN A N    5  
ATOM 7683  C CA   . GLN A 1 62  ? 10.296  -13.975 4.074   1.00 0.00 ? 62  GLN A CA   5  
ATOM 7684  C C    . GLN A 1 62  ? 9.255   -13.246 3.231   1.00 0.00 ? 62  GLN A C    5  
ATOM 7685  O O    . GLN A 1 62  ? 8.099   -13.663 3.158   1.00 0.00 ? 62  GLN A O    5  
ATOM 7686  C CB   . GLN A 1 62  ? 10.732  -15.260 3.369   1.00 0.00 ? 62  GLN A CB   5  
ATOM 7687  C CG   . GLN A 1 62  ? 11.873  -15.981 4.070   1.00 0.00 ? 62  GLN A CG   5  
ATOM 7688  C CD   . GLN A 1 62  ? 13.207  -15.288 3.876   1.00 0.00 ? 62  GLN A CD   5  
ATOM 7689  O OE1  . GLN A 1 62  ? 13.790  -15.330 2.792   1.00 0.00 ? 62  GLN A OE1  5  
ATOM 7690  N NE2  . GLN A 1 62  ? 13.699  -14.645 4.929   1.00 0.00 ? 62  GLN A NE2  5  
ATOM 7691  H H    . GLN A 1 62  ? 8.993   -14.868 5.484   1.00 0.00 ? 62  GLN A H    5  
ATOM 7692  H HA   . GLN A 1 62  ? 11.155  -13.333 4.197   1.00 0.00 ? 62  GLN A HA   5  
ATOM 7693  H HB2  . GLN A 1 62  ? 9.888   -15.932 3.316   1.00 0.00 ? 62  GLN A HB2  5  
ATOM 7694  H HB3  . GLN A 1 62  ? 11.051  -15.016 2.367   1.00 0.00 ? 62  GLN A HB3  5  
ATOM 7695  H HG2  . GLN A 1 62  ? 11.658  -16.025 5.127   1.00 0.00 ? 62  GLN A HG2  5  
ATOM 7696  H HG3  . GLN A 1 62  ? 11.943  -16.984 3.675   1.00 0.00 ? 62  GLN A HG3  5  
ATOM 7697  H HE21 . GLN A 1 62  ? 13.180  -14.655 5.761   1.00 0.00 ? 62  GLN A HE21 5  
ATOM 7698  H HE22 . GLN A 1 62  ? 14.560  -14.189 4.832   1.00 0.00 ? 62  GLN A HE22 5  
ATOM 7699  N N    . ARG A 1 63  ? 9.673   -12.156 2.595   1.00 0.00 ? 63  ARG A N    5  
ATOM 7700  C CA   . ARG A 1 63  ? 8.776   -11.369 1.758   1.00 0.00 ? 63  ARG A CA   5  
ATOM 7701  C C    . ARG A 1 63  ? 8.899   -11.780 0.293   1.00 0.00 ? 63  ARG A C    5  
ATOM 7702  O O    . ARG A 1 63  ? 9.997   -12.039 -0.199  1.00 0.00 ? 63  ARG A O    5  
ATOM 7703  C CB   . ARG A 1 63  ? 9.083   -9.877  1.907   1.00 0.00 ? 63  ARG A CB   5  
ATOM 7704  C CG   . ARG A 1 63  ? 8.687   -9.307  3.259   1.00 0.00 ? 63  ARG A CG   5  
ATOM 7705  C CD   . ARG A 1 63  ? 9.766   -9.551  4.304   1.00 0.00 ? 63  ARG A CD   5  
ATOM 7706  N NE   . ARG A 1 63  ? 10.943  -8.717  4.080   1.00 0.00 ? 63  ARG A NE   5  
ATOM 7707  C CZ   . ARG A 1 63  ? 12.096  -8.887  4.718   1.00 0.00 ? 63  ARG A CZ   5  
ATOM 7708  N NH1  . ARG A 1 63  ? 12.225  -9.855  5.613   1.00 0.00 ? 63  ARG A NH1  5  
ATOM 7709  N NH2  . ARG A 1 63  ? 13.123  -8.087  4.459   1.00 0.00 ? 63  ARG A NH2  5  
ATOM 7710  H H    . ARG A 1 63  ? 10.606  -11.874 2.692   1.00 0.00 ? 63  ARG A H    5  
ATOM 7711  H HA   . ARG A 1 63  ? 7.765   -11.554 2.088   1.00 0.00 ? 63  ARG A HA   5  
ATOM 7712  H HB2  . ARG A 1 63  ? 10.143  -9.724  1.773   1.00 0.00 ? 63  ARG A HB2  5  
ATOM 7713  H HB3  . ARG A 1 63  ? 8.549   -9.334  1.142   1.00 0.00 ? 63  ARG A HB3  5  
ATOM 7714  H HG2  . ARG A 1 63  ? 8.533   -8.243  3.160   1.00 0.00 ? 63  ARG A HG2  5  
ATOM 7715  H HG3  . ARG A 1 63  ? 7.771   -9.777  3.584   1.00 0.00 ? 63  ARG A HG3  5  
ATOM 7716  H HD2  . ARG A 1 63  ? 9.360   -9.330  5.279   1.00 0.00 ? 63  ARG A HD2  5  
ATOM 7717  H HD3  . ARG A 1 63  ? 10.058  -10.590 4.263   1.00 0.00 ? 63  ARG A HD3  5  
ATOM 7718  H HE   . ARG A 1 63  ? 10.869  -7.995  3.422   1.00 0.00 ? 63  ARG A HE   5  
ATOM 7719  H HH11 . ARG A 1 63  ? 11.454  -10.461 5.809   1.00 0.00 ? 63  ARG A HH11 5  
ATOM 7720  H HH12 . ARG A 1 63  ? 13.095  -9.982  6.091   1.00 0.00 ? 63  ARG A HH12 5  
ATOM 7721  H HH21 . ARG A 1 63  ? 13.029  -7.355  3.785   1.00 0.00 ? 63  ARG A HH21 5  
ATOM 7722  H HH22 . ARG A 1 63  ? 13.989  -8.215  4.940   1.00 0.00 ? 63  ARG A HH22 5  
ATOM 7723  N N    . ILE A 1 64  ? 7.765   -11.837 -0.397  1.00 0.00 ? 64  ILE A N    5  
ATOM 7724  C CA   . ILE A 1 64  ? 7.746   -12.216 -1.804  1.00 0.00 ? 64  ILE A CA   5  
ATOM 7725  C C    . ILE A 1 64  ? 7.262   -11.063 -2.677  1.00 0.00 ? 64  ILE A C    5  
ATOM 7726  O O    . ILE A 1 64  ? 6.429   -10.259 -2.258  1.00 0.00 ? 64  ILE A O    5  
ATOM 7727  C CB   . ILE A 1 64  ? 6.844   -13.441 -2.045  1.00 0.00 ? 64  ILE A CB   5  
ATOM 7728  C CG1  . ILE A 1 64  ? 7.206   -14.567 -1.074  1.00 0.00 ? 64  ILE A CG1  5  
ATOM 7729  C CG2  . ILE A 1 64  ? 6.968   -13.915 -3.485  1.00 0.00 ? 64  ILE A CG2  5  
ATOM 7730  C CD1  . ILE A 1 64  ? 6.196   -15.694 -1.052  1.00 0.00 ? 64  ILE A CD1  5  
ATOM 7731  H H    . ILE A 1 64  ? 6.921   -11.619 0.051   1.00 0.00 ? 64  ILE A H    5  
ATOM 7732  H HA   . ILE A 1 64  ? 8.754   -12.475 -2.093  1.00 0.00 ? 64  ILE A HA   5  
ATOM 7733  H HB   . ILE A 1 64  ? 5.820   -13.145 -1.876  1.00 0.00 ? 64  ILE A HB   5  
ATOM 7734  H HG12 . ILE A 1 64  ? 8.160   -14.984 -1.355  1.00 0.00 ? 64  ILE A HG12 5  
ATOM 7735  H HG13 . ILE A 1 64  ? 7.275   -14.162 -0.075  1.00 0.00 ? 64  ILE A HG13 5  
ATOM 7736  H HG21 . ILE A 1 64  ? 6.147   -14.576 -3.719  1.00 0.00 ? 64  ILE A HG21 5  
ATOM 7737  H HG22 . ILE A 1 64  ? 6.943   -13.063 -4.148  1.00 0.00 ? 64  ILE A HG22 5  
ATOM 7738  H HG23 . ILE A 1 64  ? 7.902   -14.443 -3.611  1.00 0.00 ? 64  ILE A HG23 5  
ATOM 7739  H HD11 . ILE A 1 64  ? 5.734   -15.783 -2.024  1.00 0.00 ? 64  ILE A HD11 5  
ATOM 7740  H HD12 . ILE A 1 64  ? 6.693   -16.619 -0.803  1.00 0.00 ? 64  ILE A HD12 5  
ATOM 7741  H HD13 . ILE A 1 64  ? 5.438   -15.482 -0.312  1.00 0.00 ? 64  ILE A HD13 5  
ATOM 7742  N N    . THR A 1 65  ? 7.790   -10.990 -3.895  1.00 0.00 ? 65  THR A N    5  
ATOM 7743  C CA   . THR A 1 65  ? 7.412   -9.936  -4.829  1.00 0.00 ? 65  THR A CA   5  
ATOM 7744  C C    . THR A 1 65  ? 6.109   -10.275 -5.543  1.00 0.00 ? 65  THR A C    5  
ATOM 7745  O O    . THR A 1 65  ? 6.109   -10.978 -6.554  1.00 0.00 ? 65  THR A O    5  
ATOM 7746  C CB   . THR A 1 65  ? 8.512   -9.695  -5.880  1.00 0.00 ? 65  THR A CB   5  
ATOM 7747  O OG1  . THR A 1 65  ? 9.778   -9.523  -5.233  1.00 0.00 ? 65  THR A OG1  5  
ATOM 7748  C CG2  . THR A 1 65  ? 8.197   -8.469  -6.723  1.00 0.00 ? 65  THR A CG2  5  
ATOM 7749  H H    . THR A 1 65  ? 8.449   -11.660 -4.171  1.00 0.00 ? 65  THR A H    5  
ATOM 7750  H HA   . THR A 1 65  ? 7.276   -9.024  -4.266  1.00 0.00 ? 65  THR A HA   5  
ATOM 7751  H HB   . THR A 1 65  ? 8.563   -10.558 -6.529  1.00 0.00 ? 65  THR A HB   5  
ATOM 7752  H HG1  . THR A 1 65  ? 10.483  -9.614  -5.879  1.00 0.00 ? 65  THR A HG1  5  
ATOM 7753  H HG21 . THR A 1 65  ? 7.718   -7.722  -6.107  1.00 0.00 ? 65  THR A HG21 5  
ATOM 7754  H HG22 . THR A 1 65  ? 7.536   -8.748  -7.530  1.00 0.00 ? 65  THR A HG22 5  
ATOM 7755  H HG23 . THR A 1 65  ? 9.112   -8.067  -7.130  1.00 0.00 ? 65  THR A HG23 5  
ATOM 7756  N N    . ILE A 1 66  ? 5.000   -9.771  -5.012  1.00 0.00 ? 66  ILE A N    5  
ATOM 7757  C CA   . ILE A 1 66  ? 3.690   -10.020 -5.601  1.00 0.00 ? 66  ILE A CA   5  
ATOM 7758  C C    . ILE A 1 66  ? 3.277   -8.879  -6.524  1.00 0.00 ? 66  ILE A C    5  
ATOM 7759  O O    . ILE A 1 66  ? 3.593   -7.717  -6.271  1.00 0.00 ? 66  ILE A O    5  
ATOM 7760  C CB   . ILE A 1 66  ? 2.611   -10.204 -4.517  1.00 0.00 ? 66  ILE A CB   5  
ATOM 7761  C CG1  . ILE A 1 66  ? 3.184   -10.968 -3.321  1.00 0.00 ? 66  ILE A CG1  5  
ATOM 7762  C CG2  . ILE A 1 66  ? 1.404   -10.932 -5.089  1.00 0.00 ? 66  ILE A CG2  5  
ATOM 7763  C CD1  . ILE A 1 66  ? 2.146   -11.332 -2.283  1.00 0.00 ? 66  ILE A CD1  5  
ATOM 7764  H H    . ILE A 1 66  ? 5.065   -9.218  -4.206  1.00 0.00 ? 66  ILE A H    5  
ATOM 7765  H HA   . ILE A 1 66  ? 3.752   -10.932 -6.177  1.00 0.00 ? 66  ILE A HA   5  
ATOM 7766  H HB   . ILE A 1 66  ? 2.290   -9.227  -4.190  1.00 0.00 ? 66  ILE A HB   5  
ATOM 7767  H HG12 . ILE A 1 66  ? 3.638   -11.882 -3.670  1.00 0.00 ? 66  ILE A HG12 5  
ATOM 7768  H HG13 . ILE A 1 66  ? 3.936   -10.358 -2.841  1.00 0.00 ? 66  ILE A HG13 5  
ATOM 7769  H HG21 . ILE A 1 66  ? 1.363   -11.933 -4.684  1.00 0.00 ? 66  ILE A HG21 5  
ATOM 7770  H HG22 . ILE A 1 66  ? 0.504   -10.400 -4.823  1.00 0.00 ? 66  ILE A HG22 5  
ATOM 7771  H HG23 . ILE A 1 66  ? 1.490   -10.982 -6.164  1.00 0.00 ? 66  ILE A HG23 5  
ATOM 7772  H HD11 . ILE A 1 66  ? 2.264   -12.367 -2.002  1.00 0.00 ? 66  ILE A HD11 5  
ATOM 7773  H HD12 . ILE A 1 66  ? 2.271   -10.705 -1.413  1.00 0.00 ? 66  ILE A HD12 5  
ATOM 7774  H HD13 . ILE A 1 66  ? 1.158   -11.182 -2.695  1.00 0.00 ? 66  ILE A HD13 5  
ATOM 7775  N N    . GLU A 1 67  ? 2.567   -9.220  -7.595  1.00 0.00 ? 67  GLU A N    5  
ATOM 7776  C CA   . GLU A 1 67  ? 2.109   -8.223  -8.557  1.00 0.00 ? 67  GLU A CA   5  
ATOM 7777  C C    . GLU A 1 67  ? 0.928   -7.433  -8.001  1.00 0.00 ? 67  GLU A C    5  
ATOM 7778  O O    . GLU A 1 67  ? 0.073   -7.964  -7.291  1.00 0.00 ? 67  GLU A O    5  
ATOM 7779  C CB   . GLU A 1 67  ? 1.713   -8.896  -9.873  1.00 0.00 ? 67  GLU A CB   5  
ATOM 7780  C CG   . GLU A 1 67  ? 2.879   -9.106  -10.824 1.00 0.00 ? 67  GLU A CG   5  
ATOM 7781  C CD   . GLU A 1 67  ? 2.545   -10.058 -11.955 1.00 0.00 ? 67  GLU A CD   5  
ATOM 7782  O OE1  . GLU A 1 67  ? 2.195   -11.222 -11.669 1.00 0.00 ? 67  GLU A OE1  5  
ATOM 7783  O OE2  . GLU A 1 67  ? 2.633   -9.639  -13.128 1.00 0.00 ? 67  GLU A OE2  5  
ATOM 7784  H H    . GLU A 1 67  ? 2.346   -10.163 -7.743  1.00 0.00 ? 67  GLU A H    5  
ATOM 7785  H HA   . GLU A 1 67  ? 2.926   -7.543  -8.743  1.00 0.00 ? 67  GLU A HA   5  
ATOM 7786  H HB2  . GLU A 1 67  ? 1.275   -9.858  -9.654  1.00 0.00 ? 67  GLU A HB2  5  
ATOM 7787  H HB3  . GLU A 1 67  ? 0.978   -8.281  -10.370 1.00 0.00 ? 67  GLU A HB3  5  
ATOM 7788  H HG2  . GLU A 1 67  ? 3.159   -8.153  -11.247 1.00 0.00 ? 67  GLU A HG2  5  
ATOM 7789  H HG3  . GLU A 1 67  ? 3.713   -9.510  -10.267 1.00 0.00 ? 67  GLU A HG3  5  
ATOM 7790  N N    . PRO A 1 68  ? 0.879   -6.134  -8.329  1.00 0.00 ? 68  PRO A N    5  
ATOM 7791  C CA   . PRO A 1 68  ? -0.192  -5.242  -7.874  1.00 0.00 ? 68  PRO A CA   5  
ATOM 7792  C C    . PRO A 1 68  ? -1.530  -5.560  -8.532  1.00 0.00 ? 68  PRO A C    5  
ATOM 7793  O O    . PRO A 1 68  ? -1.920  -4.921  -9.508  1.00 0.00 ? 68  PRO A O    5  
ATOM 7794  C CB   . PRO A 1 68  ? 0.296   -3.855  -8.298  1.00 0.00 ? 68  PRO A CB   5  
ATOM 7795  C CG   . PRO A 1 68  ? 1.208   -4.111  -9.448  1.00 0.00 ? 68  PRO A CG   5  
ATOM 7796  C CD   . PRO A 1 68  ? 1.864   -5.435  -9.171  1.00 0.00 ? 68  PRO A CD   5  
ATOM 7797  H HA   . PRO A 1 68  ? -0.305  -5.273  -6.800  1.00 0.00 ? 68  PRO A HA   5  
ATOM 7798  H HB2  . PRO A 1 68  ? -0.548  -3.247  -8.590  1.00 0.00 ? 68  PRO A HB2  5  
ATOM 7799  H HB3  . PRO A 1 68  ? 0.818   -3.387  -7.478  1.00 0.00 ? 68  PRO A HB3  5  
ATOM 7800  H HG2  . PRO A 1 68  ? 0.640   -4.158  -10.364 1.00 0.00 ? 68  PRO A HG2  5  
ATOM 7801  H HG3  . PRO A 1 68  ? 1.952   -3.329  -9.507  1.00 0.00 ? 68  PRO A HG3  5  
ATOM 7802  H HD2  . PRO A 1 68  ? 2.035   -5.972  -10.092 1.00 0.00 ? 68  PRO A HD2  5  
ATOM 7803  H HD3  . PRO A 1 68  ? 2.793   -5.292  -8.638  1.00 0.00 ? 68  PRO A HD3  5  
ATOM 7804  N N    . GLY A 1 69  ? -2.231  -6.553  -7.991  1.00 0.00 ? 69  GLY A N    5  
ATOM 7805  C CA   . GLY A 1 69  ? -3.518  -6.937  -8.539  1.00 0.00 ? 69  GLY A CA   5  
ATOM 7806  C C    . GLY A 1 69  ? -4.569  -7.138  -7.465  1.00 0.00 ? 69  GLY A C    5  
ATOM 7807  O O    . GLY A 1 69  ? -4.799  -6.256  -6.637  1.00 0.00 ? 69  GLY A O    5  
ATOM 7808  H H    . GLY A 1 69  ? -1.870  -7.027  -7.212  1.00 0.00 ? 69  GLY A H    5  
ATOM 7809  H HA2  . GLY A 1 69  ? -3.853  -6.167  -9.216  1.00 0.00 ? 69  GLY A HA2  5  
ATOM 7810  H HA3  . GLY A 1 69  ? -3.401  -7.860  -9.088  1.00 0.00 ? 69  GLY A HA3  5  
ATOM 7811  N N    . THR A 1 70  ? -5.211  -8.302  -7.477  1.00 0.00 ? 70  THR A N    5  
ATOM 7812  C CA   . THR A 1 70  ? -6.245  -8.615  -6.500  1.00 0.00 ? 70  THR A CA   5  
ATOM 7813  C C    . THR A 1 70  ? -5.958  -9.939  -5.800  1.00 0.00 ? 70  THR A C    5  
ATOM 7814  O O    . THR A 1 70  ? -6.232  -10.095 -4.610  1.00 0.00 ? 70  THR A O    5  
ATOM 7815  C CB   . THR A 1 70  ? -7.637  -8.686  -7.156  1.00 0.00 ? 70  THR A CB   5  
ATOM 7816  O OG1  . THR A 1 70  ? -7.632  -9.657  -8.209  1.00 0.00 ? 70  THR A OG1  5  
ATOM 7817  C CG2  . THR A 1 70  ? -8.042  -7.330  -7.713  1.00 0.00 ? 70  THR A CG2  5  
ATOM 7818  H H    . THR A 1 70  ? -4.983  -8.965  -8.162  1.00 0.00 ? 70  THR A H    5  
ATOM 7819  H HA   . THR A 1 70  ? -6.258  -7.825  -5.763  1.00 0.00 ? 70  THR A HA   5  
ATOM 7820  H HB   . THR A 1 70  ? -8.357  -8.982  -6.407  1.00 0.00 ? 70  THR A HB   5  
ATOM 7821  H HG1  . THR A 1 70  ? -8.482  -9.647  -8.658  1.00 0.00 ? 70  THR A HG1  5  
ATOM 7822  H HG21 . THR A 1 70  ? -8.666  -7.469  -8.583  1.00 0.00 ? 70  THR A HG21 5  
ATOM 7823  H HG22 . THR A 1 70  ? -7.158  -6.774  -7.988  1.00 0.00 ? 70  THR A HG22 5  
ATOM 7824  H HG23 . THR A 1 70  ? -8.592  -6.783  -6.961  1.00 0.00 ? 70  THR A HG23 5  
ATOM 7825  N N    . SER A 1 71  ? -5.404  -10.889 -6.546  1.00 0.00 ? 71  SER A N    5  
ATOM 7826  C CA   . SER A 1 71  ? -5.082  -12.201 -5.997  1.00 0.00 ? 71  SER A CA   5  
ATOM 7827  C C    . SER A 1 71  ? -3.731  -12.688 -6.511  1.00 0.00 ? 71  SER A C    5  
ATOM 7828  O O    . SER A 1 71  ? -3.250  -12.238 -7.551  1.00 0.00 ? 71  SER A O    5  
ATOM 7829  C CB   . SER A 1 71  ? -6.173  -13.211 -6.361  1.00 0.00 ? 71  SER A CB   5  
ATOM 7830  O OG   . SER A 1 71  ? -6.102  -13.567 -7.731  1.00 0.00 ? 71  SER A OG   5  
ATOM 7831  H H    . SER A 1 71  ? -5.210  -10.704 -7.489  1.00 0.00 ? 71  SER A H    5  
ATOM 7832  H HA   . SER A 1 71  ? -5.034  -12.108 -4.923  1.00 0.00 ? 71  SER A HA   5  
ATOM 7833  H HB2  . SER A 1 71  ? -6.050  -14.101 -5.763  1.00 0.00 ? 71  SER A HB2  5  
ATOM 7834  H HB3  . SER A 1 71  ? -7.142  -12.776 -6.164  1.00 0.00 ? 71  SER A HB3  5  
ATOM 7835  H HG   . SER A 1 71  ? -6.070  -12.772 -8.268  1.00 0.00 ? 71  SER A HG   5  
ATOM 7836  N N    . TYR A 1 72  ? -3.123  -13.611 -5.774  1.00 0.00 ? 72  TYR A N    5  
ATOM 7837  C CA   . TYR A 1 72  ? -1.825  -14.159 -6.152  1.00 0.00 ? 72  TYR A CA   5  
ATOM 7838  C C    . TYR A 1 72  ? -1.776  -15.663 -5.904  1.00 0.00 ? 72  TYR A C    5  
ATOM 7839  O O    . TYR A 1 72  ? -2.401  -16.171 -4.973  1.00 0.00 ? 72  TYR A O    5  
ATOM 7840  C CB   . TYR A 1 72  ? -0.708  -13.464 -5.371  1.00 0.00 ? 72  TYR A CB   5  
ATOM 7841  C CG   . TYR A 1 72  ? 0.659   -14.064 -5.608  1.00 0.00 ? 72  TYR A CG   5  
ATOM 7842  C CD1  . TYR A 1 72  ? 1.410   -13.713 -6.723  1.00 0.00 ? 72  TYR A CD1  5  
ATOM 7843  C CD2  . TYR A 1 72  ? 1.201   -14.982 -4.716  1.00 0.00 ? 72  TYR A CD2  5  
ATOM 7844  C CE1  . TYR A 1 72  ? 2.660   -14.259 -6.944  1.00 0.00 ? 72  TYR A CE1  5  
ATOM 7845  C CE2  . TYR A 1 72  ? 2.450   -15.532 -4.928  1.00 0.00 ? 72  TYR A CE2  5  
ATOM 7846  C CZ   . TYR A 1 72  ? 3.175   -15.168 -6.043  1.00 0.00 ? 72  TYR A CZ   5  
ATOM 7847  O OH   . TYR A 1 72  ? 4.420   -15.713 -6.259  1.00 0.00 ? 72  TYR A OH   5  
ATOM 7848  H H    . TYR A 1 72  ? -3.556  -13.931 -4.955  1.00 0.00 ? 72  TYR A H    5  
ATOM 7849  H HA   . TYR A 1 72  ? -1.682  -13.974 -7.207  1.00 0.00 ? 72  TYR A HA   5  
ATOM 7850  H HB2  . TYR A 1 72  ? -0.668  -12.425 -5.660  1.00 0.00 ? 72  TYR A HB2  5  
ATOM 7851  H HB3  . TYR A 1 72  ? -0.922  -13.531 -4.315  1.00 0.00 ? 72  TYR A HB3  5  
ATOM 7852  H HD1  . TYR A 1 72  ? 1.003   -13.000 -7.426  1.00 0.00 ? 72  TYR A HD1  5  
ATOM 7853  H HD2  . TYR A 1 72  ? 0.630   -15.265 -3.844  1.00 0.00 ? 72  TYR A HD2  5  
ATOM 7854  H HE1  . TYR A 1 72  ? 3.228   -13.974 -7.817  1.00 0.00 ? 72  TYR A HE1  5  
ATOM 7855  H HE2  . TYR A 1 72  ? 2.854   -16.244 -4.224  1.00 0.00 ? 72  TYR A HE2  5  
ATOM 7856  H HH   . TYR A 1 72  ? 5.064   -15.009 -6.362  1.00 0.00 ? 72  TYR A HH   5  
ATOM 7857  N N    . ARG A 1 73  ? -1.026  -16.370 -6.743  1.00 0.00 ? 73  ARG A N    5  
ATOM 7858  C CA   . ARG A 1 73  ? -0.894  -17.816 -6.617  1.00 0.00 ? 73  ARG A CA   5  
ATOM 7859  C C    . ARG A 1 73  ? 0.522   -18.198 -6.196  1.00 0.00 ? 73  ARG A C    5  
ATOM 7860  O O    . ARG A 1 73  ? 1.432   -18.260 -7.024  1.00 0.00 ? 73  ARG A O    5  
ATOM 7861  C CB   . ARG A 1 73  ? -1.246  -18.500 -7.939  1.00 0.00 ? 73  ARG A CB   5  
ATOM 7862  C CG   . ARG A 1 73  ? -1.350  -20.012 -7.834  1.00 0.00 ? 73  ARG A CG   5  
ATOM 7863  C CD   . ARG A 1 73  ? -1.622  -20.648 -9.189  1.00 0.00 ? 73  ARG A CD   5  
ATOM 7864  N NE   . ARG A 1 73  ? -2.987  -20.399 -9.646  1.00 0.00 ? 73  ARG A NE   5  
ATOM 7865  C CZ   . ARG A 1 73  ? -3.356  -19.299 -10.293 1.00 0.00 ? 73  ARG A CZ   5  
ATOM 7866  N NH1  . ARG A 1 73  ? -2.467  -18.352 -10.559 1.00 0.00 ? 73  ARG A NH1  5  
ATOM 7867  N NH2  . ARG A 1 73  ? -4.617  -19.145 -10.677 1.00 0.00 ? 73  ARG A NH2  5  
ATOM 7868  H H    . ARG A 1 73  ? -0.551  -15.908 -7.466  1.00 0.00 ? 73  ARG A H    5  
ATOM 7869  H HA   . ARG A 1 73  ? -1.584  -18.147 -5.856  1.00 0.00 ? 73  ARG A HA   5  
ATOM 7870  H HB2  . ARG A 1 73  ? -2.195  -18.119 -8.287  1.00 0.00 ? 73  ARG A HB2  5  
ATOM 7871  H HB3  . ARG A 1 73  ? -0.484  -18.263 -8.667  1.00 0.00 ? 73  ARG A HB3  5  
ATOM 7872  H HG2  . ARG A 1 73  ? -0.420  -20.402 -7.447  1.00 0.00 ? 73  ARG A HG2  5  
ATOM 7873  H HG3  . ARG A 1 73  ? -2.156  -20.262 -7.161  1.00 0.00 ? 73  ARG A HG3  5  
ATOM 7874  H HD2  . ARG A 1 73  ? -0.931  -20.236 -9.910  1.00 0.00 ? 73  ARG A HD2  5  
ATOM 7875  H HD3  . ARG A 1 73  ? -1.468  -21.713 -9.110  1.00 0.00 ? 73  ARG A HD3  5  
ATOM 7876  H HE   . ARG A 1 73  ? -3.660  -21.086 -9.460  1.00 0.00 ? 73  ARG A HE   5  
ATOM 7877  H HH11 . ARG A 1 73  ? -1.516  -18.465 -10.272 1.00 0.00 ? 73  ARG A HH11 5  
ATOM 7878  H HH12 . ARG A 1 73  ? -2.748  -17.525 -11.047 1.00 0.00 ? 73  ARG A HH12 5  
ATOM 7879  H HH21 . ARG A 1 73  ? -5.290  -19.857 -10.478 1.00 0.00 ? 73  ARG A HH21 5  
ATOM 7880  H HH22 . ARG A 1 73  ? -4.894  -18.318 -11.163 1.00 0.00 ? 73  ARG A HH22 5  
ATOM 7881  N N    . LEU A 1 74  ? 0.702   -18.452 -4.904  1.00 0.00 ? 74  LEU A N    5  
ATOM 7882  C CA   . LEU A 1 74  ? 2.007   -18.827 -4.373  1.00 0.00 ? 74  LEU A CA   5  
ATOM 7883  C C    . LEU A 1 74  ? 2.287   -20.308 -4.610  1.00 0.00 ? 74  LEU A C    5  
ATOM 7884  O O    . LEU A 1 74  ? 1.411   -21.152 -4.423  1.00 0.00 ? 74  LEU A O    5  
ATOM 7885  C CB   . LEU A 1 74  ? 2.079   -18.517 -2.876  1.00 0.00 ? 74  LEU A CB   5  
ATOM 7886  C CG   . LEU A 1 74  ? 3.325   -19.019 -2.146  1.00 0.00 ? 74  LEU A CG   5  
ATOM 7887  C CD1  . LEU A 1 74  ? 4.565   -18.297 -2.648  1.00 0.00 ? 74  LEU A CD1  5  
ATOM 7888  C CD2  . LEU A 1 74  ? 3.171   -18.836 -0.643  1.00 0.00 ? 74  LEU A CD2  5  
ATOM 7889  H H    . LEU A 1 74  ? -0.061  -18.386 -4.293  1.00 0.00 ? 74  LEU A H    5  
ATOM 7890  H HA   . LEU A 1 74  ? 2.755   -18.245 -4.889  1.00 0.00 ? 74  LEU A HA   5  
ATOM 7891  H HB2  . LEU A 1 74  ? 2.036   -17.445 -2.759  1.00 0.00 ? 74  LEU A HB2  5  
ATOM 7892  H HB3  . LEU A 1 74  ? 1.215   -18.964 -2.405  1.00 0.00 ? 74  LEU A HB3  5  
ATOM 7893  H HG   . LEU A 1 74  ? 3.450   -20.074 -2.344  1.00 0.00 ? 74  LEU A HG   5  
ATOM 7894  H HD11 . LEU A 1 74  ? 5.081   -18.923 -3.362  1.00 0.00 ? 74  LEU A HD11 5  
ATOM 7895  H HD12 . LEU A 1 74  ? 5.220   -18.085 -1.816  1.00 0.00 ? 74  LEU A HD12 5  
ATOM 7896  H HD13 . LEU A 1 74  ? 4.276   -17.372 -3.124  1.00 0.00 ? 74  LEU A HD13 5  
ATOM 7897  H HD21 . LEU A 1 74  ? 2.807   -19.753 -0.204  1.00 0.00 ? 74  LEU A HD21 5  
ATOM 7898  H HD22 . LEU A 1 74  ? 2.469   -18.039 -0.447  1.00 0.00 ? 74  LEU A HD22 5  
ATOM 7899  H HD23 . LEU A 1 74  ? 4.129   -18.586 -0.211  1.00 0.00 ? 74  LEU A HD23 5  
ATOM 7900  N N    . GLN A 1 75  ? 3.513   -20.615 -5.022  1.00 0.00 ? 75  GLN A N    5  
ATOM 7901  C CA   . GLN A 1 75  ? 3.908   -21.994 -5.283  1.00 0.00 ? 75  GLN A CA   5  
ATOM 7902  C C    . GLN A 1 75  ? 5.243   -22.313 -4.618  1.00 0.00 ? 75  GLN A C    5  
ATOM 7903  O O    . GLN A 1 75  ? 5.951   -21.416 -4.164  1.00 0.00 ? 75  GLN A O    5  
ATOM 7904  C CB   . GLN A 1 75  ? 4.002   -22.243 -6.789  1.00 0.00 ? 75  GLN A CB   5  
ATOM 7905  C CG   . GLN A 1 75  ? 2.738   -21.872 -7.548  1.00 0.00 ? 75  GLN A CG   5  
ATOM 7906  C CD   . GLN A 1 75  ? 3.018   -21.445 -8.975  1.00 0.00 ? 75  GLN A CD   5  
ATOM 7907  O OE1  . GLN A 1 75  ? 3.785   -22.091 -9.690  1.00 0.00 ? 75  GLN A OE1  5  
ATOM 7908  N NE2  . GLN A 1 75  ? 2.396   -20.351 -9.399  1.00 0.00 ? 75  GLN A NE2  5  
ATOM 7909  H H    . GLN A 1 75  ? 4.167   -19.897 -5.153  1.00 0.00 ? 75  GLN A H    5  
ATOM 7910  H HA   . GLN A 1 75  ? 3.149   -22.640 -4.868  1.00 0.00 ? 75  GLN A HA   5  
ATOM 7911  H HB2  . GLN A 1 75  ? 4.820   -21.660 -7.188  1.00 0.00 ? 75  GLN A HB2  5  
ATOM 7912  H HB3  . GLN A 1 75  ? 4.202   -23.291 -6.957  1.00 0.00 ? 75  GLN A HB3  5  
ATOM 7913  H HG2  . GLN A 1 75  ? 2.081   -22.729 -7.567  1.00 0.00 ? 75  GLN A HG2  5  
ATOM 7914  H HG3  . GLN A 1 75  ? 2.251   -21.058 -7.033  1.00 0.00 ? 75  GLN A HG3  5  
ATOM 7915  H HE21 . GLN A 1 75  ? 1.800   -19.887 -8.774  1.00 0.00 ? 75  GLN A HE21 5  
ATOM 7916  H HE22 . GLN A 1 75  ? 2.559   -20.052 -10.317 1.00 0.00 ? 75  GLN A HE22 5  
ATOM 7917  N N    . GLY A 1 76  ? 5.579   -23.598 -4.564  1.00 0.00 ? 76  GLY A N    5  
ATOM 7918  C CA   . GLY A 1 76  ? 6.828   -24.013 -3.953  1.00 0.00 ? 76  GLY A CA   5  
ATOM 7919  C C    . GLY A 1 76  ? 6.703   -24.207 -2.454  1.00 0.00 ? 76  GLY A C    5  
ATOM 7920  O O    . GLY A 1 76  ? 7.308   -23.472 -1.673  1.00 0.00 ? 76  GLY A O    5  
ATOM 7921  H H    . GLY A 1 76  ? 4.974   -24.270 -4.943  1.00 0.00 ? 76  GLY A H    5  
ATOM 7922  H HA2  . GLY A 1 76  ? 7.144   -24.944 -4.401  1.00 0.00 ? 76  GLY A HA2  5  
ATOM 7923  H HA3  . GLY A 1 76  ? 7.577   -23.260 -4.145  1.00 0.00 ? 76  GLY A HA3  5  
ATOM 7924  N N    . LEU A 1 77  ? 5.916   -25.199 -2.051  1.00 0.00 ? 77  LEU A N    5  
ATOM 7925  C CA   . LEU A 1 77  ? 5.712   -25.487 -0.636  1.00 0.00 ? 77  LEU A CA   5  
ATOM 7926  C C    . LEU A 1 77  ? 5.645   -26.991 -0.390  1.00 0.00 ? 77  LEU A C    5  
ATOM 7927  O O    . LEU A 1 77  ? 5.575   -27.782 -1.331  1.00 0.00 ? 77  LEU A O    5  
ATOM 7928  C CB   . LEU A 1 77  ? 4.428   -24.820 -0.139  1.00 0.00 ? 77  LEU A CB   5  
ATOM 7929  C CG   . LEU A 1 77  ? 4.260   -23.341 -0.492  1.00 0.00 ? 77  LEU A CG   5  
ATOM 7930  C CD1  . LEU A 1 77  ? 2.803   -22.925 -0.368  1.00 0.00 ? 77  LEU A CD1  5  
ATOM 7931  C CD2  . LEU A 1 77  ? 5.141   -22.477 0.398   1.00 0.00 ? 77  LEU A CD2  5  
ATOM 7932  H H    . LEU A 1 77  ? 5.461   -25.751 -2.721  1.00 0.00 ? 77  LEU A H    5  
ATOM 7933  H HA   . LEU A 1 77  ? 6.552   -25.082 -0.091  1.00 0.00 ? 77  LEU A HA   5  
ATOM 7934  H HB2  . LEU A 1 77  ? 3.593   -25.357 -0.560  1.00 0.00 ? 77  LEU A HB2  5  
ATOM 7935  H HB3  . LEU A 1 77  ? 4.406   -24.908 0.938   1.00 0.00 ? 77  LEU A HB3  5  
ATOM 7936  H HG   . LEU A 1 77  ? 4.565   -23.186 -1.518  1.00 0.00 ? 77  LEU A HG   5  
ATOM 7937  H HD11 . LEU A 1 77  ? 2.311   -23.549 0.363   1.00 0.00 ? 77  LEU A HD11 5  
ATOM 7938  H HD12 . LEU A 1 77  ? 2.314   -23.037 -1.325  1.00 0.00 ? 77  LEU A HD12 5  
ATOM 7939  H HD13 . LEU A 1 77  ? 2.749   -21.893 -0.056  1.00 0.00 ? 77  LEU A HD13 5  
ATOM 7940  H HD21 . LEU A 1 77  ? 5.169   -22.896 1.392   1.00 0.00 ? 77  LEU A HD21 5  
ATOM 7941  H HD22 . LEU A 1 77  ? 4.737   -21.476 0.440   1.00 0.00 ? 77  LEU A HD22 5  
ATOM 7942  H HD23 . LEU A 1 77  ? 6.142   -22.445 -0.008  1.00 0.00 ? 77  LEU A HD23 5  
ATOM 7943  N N    . LYS A 1 78  ? 5.665   -27.379 0.880   1.00 0.00 ? 78  LYS A N    5  
ATOM 7944  C CA   . LYS A 1 78  ? 5.602   -28.788 1.251   1.00 0.00 ? 78  LYS A CA   5  
ATOM 7945  C C    . LYS A 1 78  ? 4.193   -29.173 1.689   1.00 0.00 ? 78  LYS A C    5  
ATOM 7946  O O    . LYS A 1 78  ? 3.487   -28.403 2.340   1.00 0.00 ? 78  LYS A O    5  
ATOM 7947  C CB   . LYS A 1 78  ? 6.597   -29.084 2.377   1.00 0.00 ? 78  LYS A CB   5  
ATOM 7948  C CG   . LYS A 1 78  ? 8.050   -28.972 1.950   1.00 0.00 ? 78  LYS A CG   5  
ATOM 7949  C CD   . LYS A 1 78  ? 8.961   -28.710 3.137   1.00 0.00 ? 78  LYS A CD   5  
ATOM 7950  C CE   . LYS A 1 78  ? 9.314   -29.999 3.864   1.00 0.00 ? 78  LYS A CE   5  
ATOM 7951  N NZ   . LYS A 1 78  ? 8.217   -30.444 4.768   1.00 0.00 ? 78  LYS A NZ   5  
ATOM 7952  H H    . LYS A 1 78  ? 5.722   -26.701 1.586   1.00 0.00 ? 78  LYS A H    5  
ATOM 7953  H HA   . LYS A 1 78  ? 5.869   -29.371 0.384   1.00 0.00 ? 78  LYS A HA   5  
ATOM 7954  H HB2  . LYS A 1 78  ? 6.425   -28.388 3.185   1.00 0.00 ? 78  LYS A HB2  5  
ATOM 7955  H HB3  . LYS A 1 78  ? 6.426   -30.089 2.736   1.00 0.00 ? 78  LYS A HB3  5  
ATOM 7956  H HG2  . LYS A 1 78  ? 8.349   -29.895 1.476   1.00 0.00 ? 78  LYS A HG2  5  
ATOM 7957  H HG3  . LYS A 1 78  ? 8.147   -28.157 1.247   1.00 0.00 ? 78  LYS A HG3  5  
ATOM 7958  H HD2  . LYS A 1 78  ? 9.872   -28.248 2.786   1.00 0.00 ? 78  LYS A HD2  5  
ATOM 7959  H HD3  . LYS A 1 78  ? 8.459   -28.045 3.825   1.00 0.00 ? 78  LYS A HD3  5  
ATOM 7960  H HE2  . LYS A 1 78  ? 9.500   -30.770 3.132   1.00 0.00 ? 78  LYS A HE2  5  
ATOM 7961  H HE3  . LYS A 1 78  ? 10.207  -29.835 4.448   1.00 0.00 ? 78  LYS A HE3  5  
ATOM 7962  H HZ1  . LYS A 1 78  ? 7.880   -29.643 5.341   1.00 0.00 ? 78  LYS A HZ1  5  
ATOM 7963  H HZ2  . LYS A 1 78  ? 8.560   -31.191 5.405   1.00 0.00 ? 78  LYS A HZ2  5  
ATOM 7964  H HZ3  . LYS A 1 78  ? 7.422   -30.816 4.210   1.00 0.00 ? 78  LYS A HZ3  5  
ATOM 7965  N N    . PRO A 1 79  ? 3.773   -30.394 1.326   1.00 0.00 ? 79  PRO A N    5  
ATOM 7966  C CA   . PRO A 1 79  ? 2.446   -30.910 1.673   1.00 0.00 ? 79  PRO A CA   5  
ATOM 7967  C C    . PRO A 1 79  ? 2.307   -31.198 3.164   1.00 0.00 ? 79  PRO A C    5  
ATOM 7968  O O    . PRO A 1 79  ? 3.301   -31.290 3.883   1.00 0.00 ? 79  PRO A O    5  
ATOM 7969  C CB   . PRO A 1 79  ? 2.347   -32.208 0.867   1.00 0.00 ? 79  PRO A CB   5  
ATOM 7970  C CG   . PRO A 1 79  ? 3.760   -32.633 0.660   1.00 0.00 ? 79  PRO A CG   5  
ATOM 7971  C CD   . PRO A 1 79  ? 4.562   -31.366 0.550   1.00 0.00 ? 79  PRO A CD   5  
ATOM 7972  H HA   . PRO A 1 79  ? 1.663   -30.232 1.364   1.00 0.00 ? 79  PRO A HA   5  
ATOM 7973  H HB2  . PRO A 1 79  ? 1.791   -32.943 1.430   1.00 0.00 ? 79  PRO A HB2  5  
ATOM 7974  H HB3  . PRO A 1 79  ? 1.852   -32.015 -0.073  1.00 0.00 ? 79  PRO A HB3  5  
ATOM 7975  H HG2  . PRO A 1 79  ? 4.095   -33.217 1.504   1.00 0.00 ? 79  PRO A HG2  5  
ATOM 7976  H HG3  . PRO A 1 79  ? 3.841   -33.207 -0.251  1.00 0.00 ? 79  PRO A HG3  5  
ATOM 7977  H HD2  . PRO A 1 79  ? 5.542   -31.501 0.984   1.00 0.00 ? 79  PRO A HD2  5  
ATOM 7978  H HD3  . PRO A 1 79  ? 4.643   -31.058 -0.482  1.00 0.00 ? 79  PRO A HD3  5  
ATOM 7979  N N    . ASN A 1 80  ? 1.067   -31.340 3.622   1.00 0.00 ? 80  ASN A N    5  
ATOM 7980  C CA   . ASN A 1 80  ? 0.799   -31.617 5.028   1.00 0.00 ? 80  ASN A CA   5  
ATOM 7981  C C    . ASN A 1 80  ? 1.688   -30.767 5.930   1.00 0.00 ? 80  ASN A C    5  
ATOM 7982  O O    . ASN A 1 80  ? 2.369   -31.285 6.815   1.00 0.00 ? 80  ASN A O    5  
ATOM 7983  C CB   . ASN A 1 80  ? 1.020   -33.101 5.328   1.00 0.00 ? 80  ASN A CB   5  
ATOM 7984  C CG   . ASN A 1 80  ? -0.149  -33.960 4.887   1.00 0.00 ? 80  ASN A CG   5  
ATOM 7985  O OD1  . ASN A 1 80  ? 0.017   -34.910 4.121   1.00 0.00 ? 80  ASN A OD1  5  
ATOM 7986  N ND2  . ASN A 1 80  ? -1.342  -33.630 5.370   1.00 0.00 ? 80  ASN A ND2  5  
ATOM 7987  H H    . ASN A 1 80  ? 0.315   -31.255 3.000   1.00 0.00 ? 80  ASN A H    5  
ATOM 7988  H HA   . ASN A 1 80  ? -0.234  -31.369 5.224   1.00 0.00 ? 80  ASN A HA   5  
ATOM 7989  H HB2  . ASN A 1 80  ? 1.905   -33.439 4.809   1.00 0.00 ? 80  ASN A HB2  5  
ATOM 7990  H HB3  . ASN A 1 80  ? 1.158   -33.231 6.391   1.00 0.00 ? 80  ASN A HB3  5  
ATOM 7991  H HD21 . ASN A 1 80  ? -1.399  -32.861 5.976   1.00 0.00 ? 80  ASN A HD21 5  
ATOM 7992  H HD22 . ASN A 1 80  ? -2.115  -34.169 5.102   1.00 0.00 ? 80  ASN A HD22 5  
ATOM 7993  N N    . SER A 1 81  ? 1.676   -29.458 5.699   1.00 0.00 ? 81  SER A N    5  
ATOM 7994  C CA   . SER A 1 81  ? 2.484   -28.535 6.488   1.00 0.00 ? 81  SER A CA   5  
ATOM 7995  C C    . SER A 1 81  ? 1.807   -27.172 6.591   1.00 0.00 ? 81  SER A C    5  
ATOM 7996  O O    . SER A 1 81  ? 1.161   -26.714 5.648   1.00 0.00 ? 81  SER A O    5  
ATOM 7997  C CB   . SER A 1 81  ? 3.874   -28.381 5.867   1.00 0.00 ? 81  SER A CB   5  
ATOM 7998  O OG   . SER A 1 81  ? 4.721   -29.454 6.241   1.00 0.00 ? 81  SER A OG   5  
ATOM 7999  H H    . SER A 1 81  ? 1.113   -29.105 4.979   1.00 0.00 ? 81  SER A H    5  
ATOM 8000  H HA   . SER A 1 81  ? 2.586   -28.949 7.480   1.00 0.00 ? 81  SER A HA   5  
ATOM 8001  H HB2  . SER A 1 81  ? 3.785   -28.367 4.792   1.00 0.00 ? 81  SER A HB2  5  
ATOM 8002  H HB3  . SER A 1 81  ? 4.316   -27.455 6.205   1.00 0.00 ? 81  SER A HB3  5  
ATOM 8003  H HG   . SER A 1 81  ? 4.514   -29.728 7.137   1.00 0.00 ? 81  SER A HG   5  
ATOM 8004  N N    . LEU A 1 82  ? 1.960   -26.528 7.743   1.00 0.00 ? 82  LEU A N    5  
ATOM 8005  C CA   . LEU A 1 82  ? 1.364   -25.216 7.971   1.00 0.00 ? 82  LEU A CA   5  
ATOM 8006  C C    . LEU A 1 82  ? 2.326   -24.103 7.567   1.00 0.00 ? 82  LEU A C    5  
ATOM 8007  O O    . LEU A 1 82  ? 3.538   -24.217 7.755   1.00 0.00 ? 82  LEU A O    5  
ATOM 8008  C CB   . LEU A 1 82  ? 0.975   -25.060 9.442   1.00 0.00 ? 82  LEU A CB   5  
ATOM 8009  C CG   . LEU A 1 82  ? 0.171   -23.808 9.794   1.00 0.00 ? 82  LEU A CG   5  
ATOM 8010  C CD1  . LEU A 1 82  ? -1.259  -23.933 9.292   1.00 0.00 ? 82  LEU A CD1  5  
ATOM 8011  C CD2  . LEU A 1 82  ? 0.191   -23.566 11.297  1.00 0.00 ? 82  LEU A CD2  5  
ATOM 8012  H H    . LEU A 1 82  ? 2.486   -26.943 8.457   1.00 0.00 ? 82  LEU A H    5  
ATOM 8013  H HA   . LEU A 1 82  ? 0.475   -25.145 7.362   1.00 0.00 ? 82  LEU A HA   5  
ATOM 8014  H HB2  . LEU A 1 82  ? 0.386   -25.920 9.721   1.00 0.00 ? 82  LEU A HB2  5  
ATOM 8015  H HB3  . LEU A 1 82  ? 1.885   -25.044 10.024  1.00 0.00 ? 82  LEU A HB3  5  
ATOM 8016  H HG   . LEU A 1 82  ? 0.621   -22.951 9.311   1.00 0.00 ? 82  LEU A HG   5  
ATOM 8017  H HD11 . LEU A 1 82  ? -1.916  -23.361 9.930   1.00 0.00 ? 82  LEU A HD11 5  
ATOM 8018  H HD12 . LEU A 1 82  ? -1.556  -24.971 9.306   1.00 0.00 ? 82  LEU A HD12 5  
ATOM 8019  H HD13 . LEU A 1 82  ? -1.319  -23.555 8.281   1.00 0.00 ? 82  LEU A HD13 5  
ATOM 8020  H HD21 . LEU A 1 82  ? 0.498   -22.549 11.493  1.00 0.00 ? 82  LEU A HD21 5  
ATOM 8021  H HD22 . LEU A 1 82  ? 0.888   -24.249 11.762  1.00 0.00 ? 82  LEU A HD22 5  
ATOM 8022  H HD23 . LEU A 1 82  ? -0.797  -23.729 11.701  1.00 0.00 ? 82  LEU A HD23 5  
ATOM 8023  N N    . TYR A 1 83  ? 1.779   -23.027 7.013   1.00 0.00 ? 83  TYR A N    5  
ATOM 8024  C CA   . TYR A 1 83  ? 2.588   -21.894 6.582   1.00 0.00 ? 83  TYR A CA   5  
ATOM 8025  C C    . TYR A 1 83  ? 1.855   -20.578 6.826   1.00 0.00 ? 83  TYR A C    5  
ATOM 8026  O O    . TYR A 1 83  ? 0.781   -20.340 6.273   1.00 0.00 ? 83  TYR A O    5  
ATOM 8027  C CB   . TYR A 1 83  ? 2.941   -22.026 5.099   1.00 0.00 ? 83  TYR A CB   5  
ATOM 8028  C CG   . TYR A 1 83  ? 3.966   -23.101 4.815   1.00 0.00 ? 83  TYR A CG   5  
ATOM 8029  C CD1  . TYR A 1 83  ? 5.304   -22.916 5.141   1.00 0.00 ? 83  TYR A CD1  5  
ATOM 8030  C CD2  . TYR A 1 83  ? 3.596   -24.301 4.221   1.00 0.00 ? 83  TYR A CD2  5  
ATOM 8031  C CE1  . TYR A 1 83  ? 6.244   -23.895 4.883   1.00 0.00 ? 83  TYR A CE1  5  
ATOM 8032  C CE2  . TYR A 1 83  ? 4.529   -25.286 3.960   1.00 0.00 ? 83  TYR A CE2  5  
ATOM 8033  C CZ   . TYR A 1 83  ? 5.852   -25.078 4.292   1.00 0.00 ? 83  TYR A CZ   5  
ATOM 8034  O OH   . TYR A 1 83  ? 6.785   -26.056 4.034   1.00 0.00 ? 83  TYR A OH   5  
ATOM 8035  H H    . TYR A 1 83  ? 0.807   -22.995 6.888   1.00 0.00 ? 83  TYR A H    5  
ATOM 8036  H HA   . TYR A 1 83  ? 3.500   -21.898 7.161   1.00 0.00 ? 83  TYR A HA   5  
ATOM 8037  H HB2  . TYR A 1 83  ? 2.048   -22.266 4.543   1.00 0.00 ? 83  TYR A HB2  5  
ATOM 8038  H HB3  . TYR A 1 83  ? 3.339   -21.086 4.746   1.00 0.00 ? 83  TYR A HB3  5  
ATOM 8039  H HD1  . TYR A 1 83  ? 5.608   -21.988 5.604   1.00 0.00 ? 83  TYR A HD1  5  
ATOM 8040  H HD2  . TYR A 1 83  ? 2.560   -24.461 3.962   1.00 0.00 ? 83  TYR A HD2  5  
ATOM 8041  H HE1  . TYR A 1 83  ? 7.279   -23.733 5.143   1.00 0.00 ? 83  TYR A HE1  5  
ATOM 8042  H HE2  . TYR A 1 83  ? 4.223   -26.213 3.497   1.00 0.00 ? 83  TYR A HE2  5  
ATOM 8043  H HH   . TYR A 1 83  ? 6.797   -26.246 3.093   1.00 0.00 ? 83  TYR A HH   5  
ATOM 8044  N N    . TYR A 1 84  ? 2.445   -19.726 7.657   1.00 0.00 ? 84  TYR A N    5  
ATOM 8045  C CA   . TYR A 1 84  ? 1.849   -18.434 7.977   1.00 0.00 ? 84  TYR A CA   5  
ATOM 8046  C C    . TYR A 1 84  ? 1.931   -17.486 6.784   1.00 0.00 ? 84  TYR A C    5  
ATOM 8047  O O    . TYR A 1 84  ? 2.853   -17.568 5.973   1.00 0.00 ? 84  TYR A O    5  
ATOM 8048  C CB   . TYR A 1 84  ? 2.549   -17.811 9.186   1.00 0.00 ? 84  TYR A CB   5  
ATOM 8049  C CG   . TYR A 1 84  ? 2.224   -18.498 10.493  1.00 0.00 ? 84  TYR A CG   5  
ATOM 8050  C CD1  . TYR A 1 84  ? 2.615   -19.810 10.727  1.00 0.00 ? 84  TYR A CD1  5  
ATOM 8051  C CD2  . TYR A 1 84  ? 1.526   -17.834 11.494  1.00 0.00 ? 84  TYR A CD2  5  
ATOM 8052  C CE1  . TYR A 1 84  ? 2.319   -20.442 11.920  1.00 0.00 ? 84  TYR A CE1  5  
ATOM 8053  C CE2  . TYR A 1 84  ? 1.227   -18.457 12.691  1.00 0.00 ? 84  TYR A CE2  5  
ATOM 8054  C CZ   . TYR A 1 84  ? 1.626   -19.761 12.899  1.00 0.00 ? 84  TYR A CZ   5  
ATOM 8055  O OH   . TYR A 1 84  ? 1.329   -20.386 14.088  1.00 0.00 ? 84  TYR A OH   5  
ATOM 8056  H H    . TYR A 1 84  ? 3.300   -19.972 8.067   1.00 0.00 ? 84  TYR A H    5  
ATOM 8057  H HA   . TYR A 1 84  ? 0.810   -18.599 8.220   1.00 0.00 ? 84  TYR A HA   5  
ATOM 8058  H HB2  . TYR A 1 84  ? 3.617   -17.863 9.042   1.00 0.00 ? 84  TYR A HB2  5  
ATOM 8059  H HB3  . TYR A 1 84  ? 2.252   -16.776 9.272   1.00 0.00 ? 84  TYR A HB3  5  
ATOM 8060  H HD1  . TYR A 1 84  ? 3.158   -20.341 9.959   1.00 0.00 ? 84  TYR A HD1  5  
ATOM 8061  H HD2  . TYR A 1 84  ? 1.214   -16.813 11.328  1.00 0.00 ? 84  TYR A HD2  5  
ATOM 8062  H HE1  . TYR A 1 84  ? 2.632   -21.463 12.083  1.00 0.00 ? 84  TYR A HE1  5  
ATOM 8063  H HE2  . TYR A 1 84  ? 0.684   -17.924 13.457  1.00 0.00 ? 84  TYR A HE2  5  
ATOM 8064  H HH   . TYR A 1 84  ? 1.155   -19.724 14.762  1.00 0.00 ? 84  TYR A HH   5  
ATOM 8065  N N    . PHE A 1 85  ? 0.959   -16.585 6.685   1.00 0.00 ? 85  PHE A N    5  
ATOM 8066  C CA   . PHE A 1 85  ? 0.919   -15.621 5.592   1.00 0.00 ? 85  PHE A CA   5  
ATOM 8067  C C    . PHE A 1 85  ? 0.449   -14.256 6.087   1.00 0.00 ? 85  PHE A C    5  
ATOM 8068  O O    . PHE A 1 85  ? -0.414  -14.165 6.961   1.00 0.00 ? 85  PHE A O    5  
ATOM 8069  C CB   . PHE A 1 85  ? -0.005  -16.118 4.478   1.00 0.00 ? 85  PHE A CB   5  
ATOM 8070  C CG   . PHE A 1 85  ? 0.365   -17.476 3.953   1.00 0.00 ? 85  PHE A CG   5  
ATOM 8071  C CD1  . PHE A 1 85  ? 1.547   -17.664 3.254   1.00 0.00 ? 85  PHE A CD1  5  
ATOM 8072  C CD2  . PHE A 1 85  ? -0.468  -18.563 4.159   1.00 0.00 ? 85  PHE A CD2  5  
ATOM 8073  C CE1  . PHE A 1 85  ? 1.891   -18.912 2.770   1.00 0.00 ? 85  PHE A CE1  5  
ATOM 8074  C CE2  . PHE A 1 85  ? -0.129  -19.814 3.677   1.00 0.00 ? 85  PHE A CE2  5  
ATOM 8075  C CZ   . PHE A 1 85  ? 1.051   -19.988 2.981   1.00 0.00 ? 85  PHE A CZ   5  
ATOM 8076  H H    . PHE A 1 85  ? 0.251   -16.569 7.363   1.00 0.00 ? 85  PHE A H    5  
ATOM 8077  H HA   . PHE A 1 85  ? 1.920   -15.523 5.201   1.00 0.00 ? 85  PHE A HA   5  
ATOM 8078  H HB2  . PHE A 1 85  ? -1.015  -16.173 4.856   1.00 0.00 ? 85  PHE A HB2  5  
ATOM 8079  H HB3  . PHE A 1 85  ? 0.029   -15.421 3.654   1.00 0.00 ? 85  PHE A HB3  5  
ATOM 8080  H HD1  . PHE A 1 85  ? 2.204   -16.822 3.088   1.00 0.00 ? 85  PHE A HD1  5  
ATOM 8081  H HD2  . PHE A 1 85  ? -1.392  -18.428 4.702   1.00 0.00 ? 85  PHE A HD2  5  
ATOM 8082  H HE1  . PHE A 1 85  ? 2.814   -19.045 2.226   1.00 0.00 ? 85  PHE A HE1  5  
ATOM 8083  H HE2  . PHE A 1 85  ? -0.788  -20.653 3.843   1.00 0.00 ? 85  PHE A HE2  5  
ATOM 8084  H HZ   . PHE A 1 85  ? 1.318   -20.964 2.604   1.00 0.00 ? 85  PHE A HZ   5  
ATOM 8085  N N    . ARG A 1 86  ? 1.023   -13.199 5.523   1.00 0.00 ? 86  ARG A N    5  
ATOM 8086  C CA   . ARG A 1 86  ? 0.664   -11.839 5.908   1.00 0.00 ? 86  ARG A CA   5  
ATOM 8087  C C    . ARG A 1 86  ? 0.798   -10.885 4.724   1.00 0.00 ? 86  ARG A C    5  
ATOM 8088  O O    . ARG A 1 86  ? 1.884   -10.719 4.167   1.00 0.00 ? 86  ARG A O    5  
ATOM 8089  C CB   . ARG A 1 86  ? 1.548   -11.363 7.063   1.00 0.00 ? 86  ARG A CB   5  
ATOM 8090  C CG   . ARG A 1 86  ? 1.149   -11.937 8.412   1.00 0.00 ? 86  ARG A CG   5  
ATOM 8091  C CD   . ARG A 1 86  ? 1.716   -11.113 9.558   1.00 0.00 ? 86  ARG A CD   5  
ATOM 8092  N NE   . ARG A 1 86  ? 3.153   -11.318 9.720   1.00 0.00 ? 86  ARG A NE   5  
ATOM 8093  C CZ   . ARG A 1 86  ? 3.838   -10.915 10.784  1.00 0.00 ? 86  ARG A CZ   5  
ATOM 8094  N NH1  . ARG A 1 86  ? 3.220   -10.288 11.775  1.00 0.00 ? 86  ARG A NH1  5  
ATOM 8095  N NH2  . ARG A 1 86  ? 5.144   -11.138 10.858  1.00 0.00 ? 86  ARG A NH2  5  
ATOM 8096  H H    . ARG A 1 86  ? 1.704   -13.336 4.832   1.00 0.00 ? 86  ARG A H    5  
ATOM 8097  H HA   . ARG A 1 86  ? -0.365  -11.847 6.234   1.00 0.00 ? 86  ARG A HA   5  
ATOM 8098  H HB2  . ARG A 1 86  ? 2.570   -11.652 6.862   1.00 0.00 ? 86  ARG A HB2  5  
ATOM 8099  H HB3  . ARG A 1 86  ? 1.492   -10.287 7.123   1.00 0.00 ? 86  ARG A HB3  5  
ATOM 8100  H HG2  . ARG A 1 86  ? 0.071   -11.941 8.486   1.00 0.00 ? 86  ARG A HG2  5  
ATOM 8101  H HG3  . ARG A 1 86  ? 1.521   -12.948 8.487   1.00 0.00 ? 86  ARG A HG3  5  
ATOM 8102  H HD2  . ARG A 1 86  ? 1.532   -10.068 9.358   1.00 0.00 ? 86  ARG A HD2  5  
ATOM 8103  H HD3  . ARG A 1 86  ? 1.216   -11.399 10.471  1.00 0.00 ? 86  ARG A HD3  5  
ATOM 8104  H HE   . ARG A 1 86  ? 3.630   -11.779 8.999   1.00 0.00 ? 86  ARG A HE   5  
ATOM 8105  H HH11 . ARG A 1 86  ? 2.236   -10.119 11.723  1.00 0.00 ? 86  ARG A HH11 5  
ATOM 8106  H HH12 . ARG A 1 86  ? 3.737   -9.986  12.576  1.00 0.00 ? 86  ARG A HH12 5  
ATOM 8107  H HH21 . ARG A 1 86  ? 5.613   -11.610 10.113  1.00 0.00 ? 86  ARG A HH21 5  
ATOM 8108  H HH22 . ARG A 1 86  ? 5.658   -10.834 11.659  1.00 0.00 ? 86  ARG A HH22 5  
ATOM 8109  N N    . LEU A 1 87  ? -0.312  -10.262 4.345   1.00 0.00 ? 87  LEU A N    5  
ATOM 8110  C CA   . LEU A 1 87  ? -0.319  -9.325  3.227   1.00 0.00 ? 87  LEU A CA   5  
ATOM 8111  C C    . LEU A 1 87  ? -0.107  -7.895  3.713   1.00 0.00 ? 87  LEU A C    5  
ATOM 8112  O O    . LEU A 1 87  ? -0.466  -7.552  4.839   1.00 0.00 ? 87  LEU A O    5  
ATOM 8113  C CB   . LEU A 1 87  ? -1.639  -9.425  2.461   1.00 0.00 ? 87  LEU A CB   5  
ATOM 8114  C CG   . LEU A 1 87  ? -1.575  -9.104  0.968   1.00 0.00 ? 87  LEU A CG   5  
ATOM 8115  C CD1  . LEU A 1 87  ? -0.804  -10.182 0.222   1.00 0.00 ? 87  LEU A CD1  5  
ATOM 8116  C CD2  . LEU A 1 87  ? -2.976  -8.954  0.393   1.00 0.00 ? 87  LEU A CD2  5  
ATOM 8117  H H    . LEU A 1 87  ? -1.146  -10.435 4.828   1.00 0.00 ? 87  LEU A H    5  
ATOM 8118  H HA   . LEU A 1 87  ? 0.492   -9.592  2.566   1.00 0.00 ? 87  LEU A HA   5  
ATOM 8119  H HB2  . LEU A 1 87  ? -2.007  -10.434 2.567   1.00 0.00 ? 87  LEU A HB2  5  
ATOM 8120  H HB3  . LEU A 1 87  ? -2.338  -8.739  2.918   1.00 0.00 ? 87  LEU A HB3  5  
ATOM 8121  H HG   . LEU A 1 87  ? -1.054  -8.166  0.829   1.00 0.00 ? 87  LEU A HG   5  
ATOM 8122  H HD11 . LEU A 1 87  ? -0.359  -9.759  -0.665  1.00 0.00 ? 87  LEU A HD11 5  
ATOM 8123  H HD12 . LEU A 1 87  ? -1.479  -10.978 -0.058  1.00 0.00 ? 87  LEU A HD12 5  
ATOM 8124  H HD13 . LEU A 1 87  ? -0.029  -10.577 0.862   1.00 0.00 ? 87  LEU A HD13 5  
ATOM 8125  H HD21 . LEU A 1 87  ? -3.134  -9.702  -0.369  1.00 0.00 ? 87  LEU A HD21 5  
ATOM 8126  H HD22 . LEU A 1 87  ? -3.084  -7.970  -0.040  1.00 0.00 ? 87  LEU A HD22 5  
ATOM 8127  H HD23 . LEU A 1 87  ? -3.704  -9.083  1.181   1.00 0.00 ? 87  LEU A HD23 5  
ATOM 8128  N N    . ALA A 1 88  ? 0.478   -7.065  2.856   1.00 0.00 ? 88  ALA A N    5  
ATOM 8129  C CA   . ALA A 1 88  ? 0.734   -5.671  3.197   1.00 0.00 ? 88  ALA A CA   5  
ATOM 8130  C C    . ALA A 1 88  ? 1.083   -4.857  1.955   1.00 0.00 ? 88  ALA A C    5  
ATOM 8131  O O    . ALA A 1 88  ? 2.186   -4.966  1.420   1.00 0.00 ? 88  ALA A O    5  
ATOM 8132  C CB   . ALA A 1 88  ? 1.853   -5.576  4.224   1.00 0.00 ? 88  ALA A CB   5  
ATOM 8133  H H    . ALA A 1 88  ? 0.742   -7.397  1.973   1.00 0.00 ? 88  ALA A H    5  
ATOM 8134  H HA   . ALA A 1 88  ? -0.164  -5.265  3.640   1.00 0.00 ? 88  ALA A HA   5  
ATOM 8135  H HB1  . ALA A 1 88  ? 2.139   -6.570  4.537   1.00 0.00 ? 88  ALA A HB1  5  
ATOM 8136  H HB2  . ALA A 1 88  ? 2.704   -5.077  3.784   1.00 0.00 ? 88  ALA A HB2  5  
ATOM 8137  H HB3  . ALA A 1 88  ? 1.509   -5.014  5.079   1.00 0.00 ? 88  ALA A HB3  5  
ATOM 8138  N N    . ALA A 1 89  ? 0.136   -4.043  1.501   1.00 0.00 ? 89  ALA A N    5  
ATOM 8139  C CA   . ALA A 1 89  ? 0.344   -3.211  0.323   1.00 0.00 ? 89  ALA A CA   5  
ATOM 8140  C C    . ALA A 1 89  ? 1.669   -2.462  0.407   1.00 0.00 ? 89  ALA A C    5  
ATOM 8141  O O    . ALA A 1 89  ? 1.987   -1.856  1.431   1.00 0.00 ? 89  ALA A O    5  
ATOM 8142  C CB   . ALA A 1 89  ? -0.809  -2.231  0.159   1.00 0.00 ? 89  ALA A CB   5  
ATOM 8143  H H    . ALA A 1 89  ? -0.723  -4.001  1.971   1.00 0.00 ? 89  ALA A H    5  
ATOM 8144  H HA   . ALA A 1 89  ? 0.361   -3.856  -0.543  1.00 0.00 ? 89  ALA A HA   5  
ATOM 8145  H HB1  . ALA A 1 89  ? -0.858  -1.586  1.025   1.00 0.00 ? 89  ALA A HB1  5  
ATOM 8146  H HB2  . ALA A 1 89  ? -0.650  -1.634  -0.726  1.00 0.00 ? 89  ALA A HB2  5  
ATOM 8147  H HB3  . ALA A 1 89  ? -1.735  -2.778  0.064   1.00 0.00 ? 89  ALA A HB3  5  
ATOM 8148  N N    . ARG A 1 90  ? 2.440   -2.508  -0.675  1.00 0.00 ? 90  ARG A N    5  
ATOM 8149  C CA   . ARG A 1 90  ? 3.732   -1.835  -0.722  1.00 0.00 ? 90  ARG A CA   5  
ATOM 8150  C C    . ARG A 1 90  ? 3.680   -0.622  -1.646  1.00 0.00 ? 90  ARG A C    5  
ATOM 8151  O O    . ARG A 1 90  ? 3.413   -0.750  -2.840  1.00 0.00 ? 90  ARG A O    5  
ATOM 8152  C CB   . ARG A 1 90  ? 4.818   -2.803  -1.194  1.00 0.00 ? 90  ARG A CB   5  
ATOM 8153  C CG   . ARG A 1 90  ? 6.216   -2.423  -0.734  1.00 0.00 ? 90  ARG A CG   5  
ATOM 8154  C CD   . ARG A 1 90  ? 7.277   -3.273  -1.414  1.00 0.00 ? 90  ARG A CD   5  
ATOM 8155  N NE   . ARG A 1 90  ? 8.618   -2.721  -1.236  1.00 0.00 ? 90  ARG A NE   5  
ATOM 8156  C CZ   . ARG A 1 90  ? 9.694   -3.192  -1.855  1.00 0.00 ? 90  ARG A CZ   5  
ATOM 8157  N NH1  . ARG A 1 90  ? 9.588   -4.218  -2.688  1.00 0.00 ? 90  ARG A NH1  5  
ATOM 8158  N NH2  . ARG A 1 90  ? 10.880  -2.636  -1.642  1.00 0.00 ? 90  ARG A NH2  5  
ATOM 8159  H H    . ARG A 1 90  ? 2.132   -3.007  -1.460  1.00 0.00 ? 90  ARG A H    5  
ATOM 8160  H HA   . ARG A 1 90  ? 3.969   -1.502  0.277   1.00 0.00 ? 90  ARG A HA   5  
ATOM 8161  H HB2  . ARG A 1 90  ? 4.595   -3.790  -0.815  1.00 0.00 ? 90  ARG A HB2  5  
ATOM 8162  H HB3  . ARG A 1 90  ? 4.813   -2.832  -2.273  1.00 0.00 ? 90  ARG A HB3  5  
ATOM 8163  H HG2  . ARG A 1 90  ? 6.394   -1.385  -0.975  1.00 0.00 ? 90  ARG A HG2  5  
ATOM 8164  H HG3  . ARG A 1 90  ? 6.284   -2.563  0.334   1.00 0.00 ? 90  ARG A HG3  5  
ATOM 8165  H HD2  . ARG A 1 90  ? 7.249   -4.267  -0.991  1.00 0.00 ? 90  ARG A HD2  5  
ATOM 8166  H HD3  . ARG A 1 90  ? 7.056   -3.325  -2.469  1.00 0.00 ? 90  ARG A HD3  5  
ATOM 8167  H HE   . ARG A 1 90  ? 8.719   -1.962  -0.625  1.00 0.00 ? 90  ARG A HE   5  
ATOM 8168  H HH11 . ARG A 1 90  ? 8.696   -4.639  -2.852  1.00 0.00 ? 90  ARG A HH11 5  
ATOM 8169  H HH12 . ARG A 1 90  ? 10.401  -4.571  -3.154  1.00 0.00 ? 90  ARG A HH12 5  
ATOM 8170  H HH21 . ARG A 1 90  ? 10.964  -1.863  -1.015  1.00 0.00 ? 90  ARG A HH21 5  
ATOM 8171  H HH22 . ARG A 1 90  ? 11.690  -2.992  -2.108  1.00 0.00 ? 90  ARG A HH22 5  
ATOM 8172  N N    . SER A 1 91  ? 3.937   0.555   -1.084  1.00 0.00 ? 91  SER A N    5  
ATOM 8173  C CA   . SER A 1 91  ? 3.916   1.792   -1.856  1.00 0.00 ? 91  SER A CA   5  
ATOM 8174  C C    . SER A 1 91  ? 5.328   2.330   -2.059  1.00 0.00 ? 91  SER A C    5  
ATOM 8175  O O    . SER A 1 91  ? 6.191   2.226   -1.187  1.00 0.00 ? 91  SER A O    5  
ATOM 8176  C CB   . SER A 1 91  ? 3.053   2.842   -1.153  1.00 0.00 ? 91  SER A CB   5  
ATOM 8177  O OG   . SER A 1 91  ? 2.449   3.716   -2.090  1.00 0.00 ? 91  SER A OG   5  
ATOM 8178  H H    . SER A 1 91  ? 4.144   0.592   -0.126  1.00 0.00 ? 91  SER A H    5  
ATOM 8179  H HA   . SER A 1 91  ? 3.484   1.572   -2.822  1.00 0.00 ? 91  SER A HA   5  
ATOM 8180  H HB2  . SER A 1 91  ? 2.278   2.347   -0.588  1.00 0.00 ? 91  SER A HB2  5  
ATOM 8181  H HB3  . SER A 1 91  ? 3.672   3.422   -0.484  1.00 0.00 ? 91  SER A HB3  5  
ATOM 8182  H HG   . SER A 1 91  ? 2.301   4.572   -1.681  1.00 0.00 ? 91  SER A HG   5  
ATOM 8183  N N    . PRO A 1 92  ? 5.572   2.921   -3.238  1.00 0.00 ? 92  PRO A N    5  
ATOM 8184  C CA   . PRO A 1 92  ? 6.878   3.488   -3.585  1.00 0.00 ? 92  PRO A CA   5  
ATOM 8185  C C    . PRO A 1 92  ? 7.197   4.744   -2.780  1.00 0.00 ? 92  PRO A C    5  
ATOM 8186  O O    . PRO A 1 92  ? 8.239   5.369   -2.975  1.00 0.00 ? 92  PRO A O    5  
ATOM 8187  C CB   . PRO A 1 92  ? 6.735   3.828   -5.070  1.00 0.00 ? 92  PRO A CB   5  
ATOM 8188  C CG   . PRO A 1 92  ? 5.273   4.025   -5.275  1.00 0.00 ? 92  PRO A CG   5  
ATOM 8189  C CD   . PRO A 1 92  ? 4.591   3.080   -4.325  1.00 0.00 ? 92  PRO A CD   5  
ATOM 8190  H HA   . PRO A 1 92  ? 7.672   2.767   -3.453  1.00 0.00 ? 92  PRO A HA   5  
ATOM 8191  H HB2  . PRO A 1 92  ? 7.291   4.728   -5.292  1.00 0.00 ? 92  PRO A HB2  5  
ATOM 8192  H HB3  . PRO A 1 92  ? 7.110   3.010   -5.668  1.00 0.00 ? 92  PRO A HB3  5  
ATOM 8193  H HG2  . PRO A 1 92  ? 5.004   5.045   -5.046  1.00 0.00 ? 92  PRO A HG2  5  
ATOM 8194  H HG3  . PRO A 1 92  ? 5.009   3.786   -6.294  1.00 0.00 ? 92  PRO A HG3  5  
ATOM 8195  H HD2  . PRO A 1 92  ? 3.673   3.513   -3.955  1.00 0.00 ? 92  PRO A HD2  5  
ATOM 8196  H HD3  . PRO A 1 92  ? 4.396   2.134   -4.809  1.00 0.00 ? 92  PRO A HD3  5  
ATOM 8197  N N    . GLN A 1 93  ? 6.293   5.106   -1.875  1.00 0.00 ? 93  GLN A N    5  
ATOM 8198  C CA   . GLN A 1 93  ? 6.479   6.287   -1.041  1.00 0.00 ? 93  GLN A CA   5  
ATOM 8199  C C    . GLN A 1 93  ? 6.547   5.907   0.435   1.00 0.00 ? 93  GLN A C    5  
ATOM 8200  O O    . GLN A 1 93  ? 6.952   6.709   1.275   1.00 0.00 ? 93  GLN A O    5  
ATOM 8201  C CB   . GLN A 1 93  ? 5.342   7.284   -1.271  1.00 0.00 ? 93  GLN A CB   5  
ATOM 8202  C CG   . GLN A 1 93  ? 5.501   8.107   -2.539  1.00 0.00 ? 93  GLN A CG   5  
ATOM 8203  C CD   . GLN A 1 93  ? 4.866   7.447   -3.747  1.00 0.00 ? 93  GLN A CD   5  
ATOM 8204  O OE1  . GLN A 1 93  ? 3.894   6.701   -3.621  1.00 0.00 ? 93  GLN A OE1  5  
ATOM 8205  N NE2  . GLN A 1 93  ? 5.413   7.718   -4.926  1.00 0.00 ? 93  GLN A NE2  5  
ATOM 8206  H H    . GLN A 1 93  ? 5.483   4.566   -1.766  1.00 0.00 ? 93  GLN A H    5  
ATOM 8207  H HA   . GLN A 1 93  ? 7.413   6.749   -1.324  1.00 0.00 ? 93  GLN A HA   5  
ATOM 8208  H HB2  . GLN A 1 93  ? 4.411   6.741   -1.334  1.00 0.00 ? 93  GLN A HB2  5  
ATOM 8209  H HB3  . GLN A 1 93  ? 5.298   7.962   -0.431  1.00 0.00 ? 93  GLN A HB3  5  
ATOM 8210  H HG2  . GLN A 1 93  ? 5.036   9.070   -2.389  1.00 0.00 ? 93  GLN A HG2  5  
ATOM 8211  H HG3  . GLN A 1 93  ? 6.554   8.244   -2.734  1.00 0.00 ? 93  GLN A HG3  5  
ATOM 8212  H HE21 . GLN A 1 93  ? 6.186   8.320   -4.949  1.00 0.00 ? 93  GLN A HE21 5  
ATOM 8213  H HE22 . GLN A 1 93  ? 5.023   7.304   -5.723  1.00 0.00 ? 93  GLN A HE22 5  
ATOM 8214  N N    . GLY A 1 94  ? 6.149   4.676   0.743   1.00 0.00 ? 94  GLY A N    5  
ATOM 8215  C CA   . GLY A 1 94  ? 6.172   4.211   2.117   1.00 0.00 ? 94  GLY A CA   5  
ATOM 8216  C C    . GLY A 1 94  ? 5.255   3.025   2.343   1.00 0.00 ? 94  GLY A C    5  
ATOM 8217  O O    . GLY A 1 94  ? 4.080   3.061   1.977   1.00 0.00 ? 94  GLY A O    5  
ATOM 8218  H H    . GLY A 1 94  ? 5.836   4.079   0.031   1.00 0.00 ? 94  GLY A H    5  
ATOM 8219  H HA2  . GLY A 1 94  ? 7.182   3.927   2.372   1.00 0.00 ? 94  GLY A HA2  5  
ATOM 8220  H HA3  . GLY A 1 94  ? 5.862   5.019   2.764   1.00 0.00 ? 94  GLY A HA3  5  
ATOM 8221  N N    . LEU A 1 95  ? 5.793   1.971   2.947   1.00 0.00 ? 95  LEU A N    5  
ATOM 8222  C CA   . LEU A 1 95  ? 5.016   0.767   3.220   1.00 0.00 ? 95  LEU A CA   5  
ATOM 8223  C C    . LEU A 1 95  ? 3.740   1.105   3.985   1.00 0.00 ? 95  LEU A C    5  
ATOM 8224  O O    . LEU A 1 95  ? 3.731   1.992   4.837   1.00 0.00 ? 95  LEU A O    5  
ATOM 8225  C CB   . LEU A 1 95  ? 5.853   -0.233  4.019   1.00 0.00 ? 95  LEU A CB   5  
ATOM 8226  C CG   . LEU A 1 95  ? 5.486   -1.707  3.842   1.00 0.00 ? 95  LEU A CG   5  
ATOM 8227  C CD1  . LEU A 1 95  ? 6.453   -2.594  4.612   1.00 0.00 ? 95  LEU A CD1  5  
ATOM 8228  C CD2  . LEU A 1 95  ? 4.055   -1.959  4.293   1.00 0.00 ? 95  LEU A CD2  5  
ATOM 8229  H H    . LEU A 1 95  ? 6.735   2.002   3.216   1.00 0.00 ? 95  LEU A H    5  
ATOM 8230  H HA   . LEU A 1 95  ? 4.747   0.324   2.273   1.00 0.00 ? 95  LEU A HA   5  
ATOM 8231  H HB2  . LEU A 1 95  ? 6.884   -0.112  3.725   1.00 0.00 ? 95  LEU A HB2  5  
ATOM 8232  H HB3  . LEU A 1 95  ? 5.748   0.011   5.067   1.00 0.00 ? 95  LEU A HB3  5  
ATOM 8233  H HG   . LEU A 1 95  ? 5.559   -1.966  2.795   1.00 0.00 ? 95  LEU A HG   5  
ATOM 8234  H HD11 . LEU A 1 95  ? 6.739   -3.433  3.997   1.00 0.00 ? 95  LEU A HD11 5  
ATOM 8235  H HD12 . LEU A 1 95  ? 5.974   -2.953  5.511   1.00 0.00 ? 95  LEU A HD12 5  
ATOM 8236  H HD13 . LEU A 1 95  ? 7.332   -2.024  4.876   1.00 0.00 ? 95  LEU A HD13 5  
ATOM 8237  H HD21 . LEU A 1 95  ? 3.729   -1.146  4.925   1.00 0.00 ? 95  LEU A HD21 5  
ATOM 8238  H HD22 . LEU A 1 95  ? 4.010   -2.886  4.847   1.00 0.00 ? 95  LEU A HD22 5  
ATOM 8239  H HD23 . LEU A 1 95  ? 3.412   -2.024  3.428   1.00 0.00 ? 95  LEU A HD23 5  
ATOM 8240  N N    . GLY A 1 96  ? 2.663   0.389   3.674   1.00 0.00 ? 96  GLY A N    5  
ATOM 8241  C CA   . GLY A 1 96  ? 1.397   0.626   4.342   1.00 0.00 ? 96  GLY A CA   5  
ATOM 8242  C C    . GLY A 1 96  ? 1.219   -0.240  5.574   1.00 0.00 ? 96  GLY A C    5  
ATOM 8243  O O    . GLY A 1 96  ? 2.126   -0.351  6.398   1.00 0.00 ? 96  GLY A O    5  
ATOM 8244  H H    . GLY A 1 96  ? 2.729   -0.306  2.986   1.00 0.00 ? 96  GLY A H    5  
ATOM 8245  H HA2  . GLY A 1 96  ? 1.345   1.664   4.635   1.00 0.00 ? 96  GLY A HA2  5  
ATOM 8246  H HA3  . GLY A 1 96  ? 0.593   0.417   3.651   1.00 0.00 ? 96  GLY A HA3  5  
ATOM 8247  N N    . ALA A 1 97  ? 0.048   -0.855  5.699   1.00 0.00 ? 97  ALA A N    5  
ATOM 8248  C CA   . ALA A 1 97  ? -0.245  -1.716  6.838   1.00 0.00 ? 97  ALA A CA   5  
ATOM 8249  C C    . ALA A 1 97  ? -0.361  -3.174  6.408   1.00 0.00 ? 97  ALA A C    5  
ATOM 8250  O O    . ALA A 1 97  ? -0.497  -3.473  5.222   1.00 0.00 ? 97  ALA A O    5  
ATOM 8251  C CB   . ALA A 1 97  ? -1.524  -1.263  7.527   1.00 0.00 ? 97  ALA A CB   5  
ATOM 8252  H H    . ALA A 1 97  ? -0.635  -0.727  5.008   1.00 0.00 ? 97  ALA A H    5  
ATOM 8253  H HA   . ALA A 1 97  ? 0.567   -1.622  7.545   1.00 0.00 ? 97  ALA A HA   5  
ATOM 8254  H HB1  . ALA A 1 97  ? -1.443  -0.217  7.783   1.00 0.00 ? 97  ALA A HB1  5  
ATOM 8255  H HB2  . ALA A 1 97  ? -2.362  -1.407  6.860   1.00 0.00 ? 97  ALA A HB2  5  
ATOM 8256  H HB3  . ALA A 1 97  ? -1.674  -1.843  8.425   1.00 0.00 ? 97  ALA A HB3  5  
ATOM 8257  N N    . SER A 1 98  ? -0.306  -4.079  7.381   1.00 0.00 ? 98  SER A N    5  
ATOM 8258  C CA   . SER A 1 98  ? -0.400  -5.507  7.102   1.00 0.00 ? 98  SER A CA   5  
ATOM 8259  C C    . SER A 1 98  ? -1.709  -6.080  7.638   1.00 0.00 ? 98  SER A C    5  
ATOM 8260  O O    . SER A 1 98  ? -2.214  -5.645  8.673   1.00 0.00 ? 98  SER A O    5  
ATOM 8261  C CB   . SER A 1 98  ? 0.786   -6.248  7.722   1.00 0.00 ? 98  SER A CB   5  
ATOM 8262  O OG   . SER A 1 98  ? 2.015   -5.753  7.221   1.00 0.00 ? 98  SER A OG   5  
ATOM 8263  H H    . SER A 1 98  ? -0.197  -3.778  8.307   1.00 0.00 ? 98  SER A H    5  
ATOM 8264  H HA   . SER A 1 98  ? -0.375  -5.638  6.030   1.00 0.00 ? 98  SER A HA   5  
ATOM 8265  H HB2  . SER A 1 98  ? 0.769   -6.118  8.793   1.00 0.00 ? 98  SER A HB2  5  
ATOM 8266  H HB3  . SER A 1 98  ? 0.712   -7.300  7.486   1.00 0.00 ? 98  SER A HB3  5  
ATOM 8267  H HG   . SER A 1 98  ? 1.936   -4.812  7.050   1.00 0.00 ? 98  SER A HG   5  
ATOM 8268  N N    . THR A 1 99  ? -2.254  -7.060  6.924   1.00 0.00 ? 99  THR A N    5  
ATOM 8269  C CA   . THR A 1 99  ? -3.505  -7.693  7.325   1.00 0.00 ? 99  THR A CA   5  
ATOM 8270  C C    . THR A 1 99  ? -3.282  -8.672  8.472   1.00 0.00 ? 99  THR A C    5  
ATOM 8271  O O    . THR A 1 99  ? -2.144  -8.982  8.824   1.00 0.00 ? 99  THR A O    5  
ATOM 8272  C CB   . THR A 1 99  ? -4.159  -8.440  6.148   1.00 0.00 ? 99  THR A CB   5  
ATOM 8273  O OG1  . THR A 1 99  ? -3.304  -9.499  5.704   1.00 0.00 ? 99  THR A OG1  5  
ATOM 8274  C CG2  . THR A 1 99  ? -4.440  -7.490  4.993   1.00 0.00 ? 99  THR A CG2  5  
ATOM 8275  H H    . THR A 1 99  ? -1.804  -7.364  6.108   1.00 0.00 ? 99  THR A H    5  
ATOM 8276  H HA   . THR A 1 99  ? -4.181  -6.917  7.653   1.00 0.00 ? 99  THR A HA   5  
ATOM 8277  H HB   . THR A 1 99  ? -5.096  -8.860  6.484   1.00 0.00 ? 99  THR A HB   5  
ATOM 8278  H HG1  . THR A 1 99  ? -3.242  -10.169 6.389   1.00 0.00 ? 99  THR A HG1  5  
ATOM 8279  H HG21 . THR A 1 99  ? -4.242  -6.475  5.306   1.00 0.00 ? 99  THR A HG21 5  
ATOM 8280  H HG22 . THR A 1 99  ? -5.474  -7.580  4.696   1.00 0.00 ? 99  THR A HG22 5  
ATOM 8281  H HG23 . THR A 1 99  ? -3.802  -7.740  4.159   1.00 0.00 ? 99  THR A HG23 5  
ATOM 8282  N N    . ALA A 1 100 ? -4.376  -9.156  9.052   1.00 0.00 ? 100 ALA A N    5  
ATOM 8283  C CA   . ALA A 1 100 ? -4.299  -10.102 10.158  1.00 0.00 ? 100 ALA A CA   5  
ATOM 8284  C C    . ALA A 1 100 ? -3.447  -11.311 9.788   1.00 0.00 ? 100 ALA A C    5  
ATOM 8285  O O    . ALA A 1 100 ? -3.322  -11.658 8.614   1.00 0.00 ? 100 ALA A O    5  
ATOM 8286  C CB   . ALA A 1 100 ? -5.695  -10.545 10.571  1.00 0.00 ? 100 ALA A CB   5  
ATOM 8287  H H    . ALA A 1 100 ? -5.255  -8.871  8.726   1.00 0.00 ? 100 ALA A H    5  
ATOM 8288  H HA   . ALA A 1 100 ? -3.845  -9.597  10.998  1.00 0.00 ? 100 ALA A HA   5  
ATOM 8289  H HB1  . ALA A 1 100 ? -5.678  -11.594 10.827  1.00 0.00 ? 100 ALA A HB1  5  
ATOM 8290  H HB2  . ALA A 1 100 ? -6.017  -9.970  11.426  1.00 0.00 ? 100 ALA A HB2  5  
ATOM 8291  H HB3  . ALA A 1 100 ? -6.380  -10.386 9.751   1.00 0.00 ? 100 ALA A HB3  5  
ATOM 8292  N N    . GLU A 1 101 ? -2.861  -11.947 10.798  1.00 0.00 ? 101 GLU A N    5  
ATOM 8293  C CA   . GLU A 1 101 ? -2.018  -13.116 10.577  1.00 0.00 ? 101 GLU A CA   5  
ATOM 8294  C C    . GLU A 1 101 ? -2.866  -14.348 10.271  1.00 0.00 ? 101 GLU A C    5  
ATOM 8295  O O    . GLU A 1 101 ? -3.469  -14.937 11.168  1.00 0.00 ? 101 GLU A O    5  
ATOM 8296  C CB   . GLU A 1 101 ? -1.141  -13.379 11.803  1.00 0.00 ? 101 GLU A CB   5  
ATOM 8297  C CG   . GLU A 1 101 ? 0.064   -14.259 11.512  1.00 0.00 ? 101 GLU A CG   5  
ATOM 8298  C CD   . GLU A 1 101 ? 0.613   -14.926 12.757  1.00 0.00 ? 101 GLU A CD   5  
ATOM 8299  O OE1  . GLU A 1 101 ? -0.177  -15.553 13.493  1.00 0.00 ? 101 GLU A OE1  5  
ATOM 8300  O OE2  . GLU A 1 101 ? 1.835   -14.822 12.996  1.00 0.00 ? 101 GLU A OE2  5  
ATOM 8301  H H    . GLU A 1 101 ? -2.998  -11.622 11.712  1.00 0.00 ? 101 GLU A H    5  
ATOM 8302  H HA   . GLU A 1 101 ? -1.383  -12.912 9.728   1.00 0.00 ? 101 GLU A HA   5  
ATOM 8303  H HB2  . GLU A 1 101 ? -0.786  -12.434 12.186  1.00 0.00 ? 101 GLU A HB2  5  
ATOM 8304  H HB3  . GLU A 1 101 ? -1.738  -13.864 12.560  1.00 0.00 ? 101 GLU A HB3  5  
ATOM 8305  H HG2  . GLU A 1 101 ? -0.227  -15.026 10.810  1.00 0.00 ? 101 GLU A HG2  5  
ATOM 8306  H HG3  . GLU A 1 101 ? 0.841   -13.649 11.075  1.00 0.00 ? 101 GLU A HG3  5  
ATOM 8307  N N    . ILE A 1 102 ? -2.906  -14.730 8.999   1.00 0.00 ? 102 ILE A N    5  
ATOM 8308  C CA   . ILE A 1 102 ? -3.679  -15.891 8.575   1.00 0.00 ? 102 ILE A CA   5  
ATOM 8309  C C    . ILE A 1 102 ? -2.764  -17.046 8.181   1.00 0.00 ? 102 ILE A C    5  
ATOM 8310  O O    . ILE A 1 102 ? -1.582  -16.848 7.902   1.00 0.00 ? 102 ILE A O    5  
ATOM 8311  C CB   . ILE A 1 102 ? -4.598  -15.551 7.387   1.00 0.00 ? 102 ILE A CB   5  
ATOM 8312  C CG1  . ILE A 1 102 ? -3.767  -15.124 6.176   1.00 0.00 ? 102 ILE A CG1  5  
ATOM 8313  C CG2  . ILE A 1 102 ? -5.582  -14.457 7.774   1.00 0.00 ? 102 ILE A CG2  5  
ATOM 8314  C CD1  . ILE A 1 102 ? -4.540  -15.139 4.876   1.00 0.00 ? 102 ILE A CD1  5  
ATOM 8315  H H    . ILE A 1 102 ? -2.404  -14.219 8.330   1.00 0.00 ? 102 ILE A H    5  
ATOM 8316  H HA   . ILE A 1 102 ? -4.297  -16.201 9.405   1.00 0.00 ? 102 ILE A HA   5  
ATOM 8317  H HB   . ILE A 1 102 ? -5.163  -16.435 7.133   1.00 0.00 ? 102 ILE A HB   5  
ATOM 8318  H HG12 . ILE A 1 102 ? -3.403  -14.120 6.332   1.00 0.00 ? 102 ILE A HG12 5  
ATOM 8319  H HG13 . ILE A 1 102 ? -2.926  -15.794 6.071   1.00 0.00 ? 102 ILE A HG13 5  
ATOM 8320  H HG21 . ILE A 1 102 ? -5.556  -13.672 7.033   1.00 0.00 ? 102 ILE A HG21 5  
ATOM 8321  H HG22 . ILE A 1 102 ? -6.578  -14.870 7.825   1.00 0.00 ? 102 ILE A HG22 5  
ATOM 8322  H HG23 . ILE A 1 102 ? -5.309  -14.052 8.737   1.00 0.00 ? 102 ILE A HG23 5  
ATOM 8323  H HD11 . ILE A 1 102 ? -5.330  -15.874 4.935   1.00 0.00 ? 102 ILE A HD11 5  
ATOM 8324  H HD12 . ILE A 1 102 ? -4.967  -14.164 4.698   1.00 0.00 ? 102 ILE A HD12 5  
ATOM 8325  H HD13 . ILE A 1 102 ? -3.874  -15.394 4.064   1.00 0.00 ? 102 ILE A HD13 5  
ATOM 8326  N N    . SER A 1 103 ? -3.321  -18.253 8.160   1.00 0.00 ? 103 SER A N    5  
ATOM 8327  C CA   . SER A 1 103 ? -2.555  -19.441 7.802   1.00 0.00 ? 103 SER A CA   5  
ATOM 8328  C C    . SER A 1 103 ? -3.395  -20.395 6.959   1.00 0.00 ? 103 SER A C    5  
ATOM 8329  O O    . SER A 1 103 ? -4.625  -20.349 6.989   1.00 0.00 ? 103 SER A O    5  
ATOM 8330  C CB   . SER A 1 103 ? -2.063  -20.155 9.062   1.00 0.00 ? 103 SER A CB   5  
ATOM 8331  O OG   . SER A 1 103 ? -3.078  -20.205 10.049  1.00 0.00 ? 103 SER A OG   5  
ATOM 8332  H H    . SER A 1 103 ? -4.269  -18.346 8.392   1.00 0.00 ? 103 SER A H    5  
ATOM 8333  H HA   . SER A 1 103 ? -1.701  -19.123 7.222   1.00 0.00 ? 103 SER A HA   5  
ATOM 8334  H HB2  . SER A 1 103 ? -1.771  -21.163 8.811   1.00 0.00 ? 103 SER A HB2  5  
ATOM 8335  H HB3  . SER A 1 103 ? -1.212  -19.623 9.464   1.00 0.00 ? 103 SER A HB3  5  
ATOM 8336  H HG   . SER A 1 103 ? -3.939  -20.181 9.625   1.00 0.00 ? 103 SER A HG   5  
ATOM 8337  N N    . ALA A 1 104 ? -2.722  -21.261 6.208   1.00 0.00 ? 104 ALA A N    5  
ATOM 8338  C CA   . ALA A 1 104 ? -3.405  -22.228 5.358   1.00 0.00 ? 104 ALA A CA   5  
ATOM 8339  C C    . ALA A 1 104 ? -2.665  -23.561 5.338   1.00 0.00 ? 104 ALA A C    5  
ATOM 8340  O O    . ALA A 1 104 ? -1.445  -23.602 5.175   1.00 0.00 ? 104 ALA A O    5  
ATOM 8341  C CB   . ALA A 1 104 ? -3.548  -21.680 3.945   1.00 0.00 ? 104 ALA A CB   5  
ATOM 8342  H H    . ALA A 1 104 ? -1.742  -21.249 6.227   1.00 0.00 ? 104 ALA A H    5  
ATOM 8343  H HA   . ALA A 1 104 ? -4.396  -22.383 5.759   1.00 0.00 ? 104 ALA A HA   5  
ATOM 8344  H HB1  . ALA A 1 104 ? -2.802  -20.917 3.778   1.00 0.00 ? 104 ALA A HB1  5  
ATOM 8345  H HB2  . ALA A 1 104 ? -3.410  -22.481 3.233   1.00 0.00 ? 104 ALA A HB2  5  
ATOM 8346  H HB3  . ALA A 1 104 ? -4.533  -21.255 3.822   1.00 0.00 ? 104 ALA A HB3  5  
ATOM 8347  N N    . ARG A 1 105 ? -3.410  -24.648 5.506   1.00 0.00 ? 105 ARG A N    5  
ATOM 8348  C CA   . ARG A 1 105 ? -2.823  -25.983 5.510   1.00 0.00 ? 105 ARG A CA   5  
ATOM 8349  C C    . ARG A 1 105 ? -2.953  -26.638 4.137   1.00 0.00 ? 105 ARG A C    5  
ATOM 8350  O O    . ARG A 1 105 ? -4.057  -26.791 3.612   1.00 0.00 ? 105 ARG A O    5  
ATOM 8351  C CB   . ARG A 1 105 ? -3.497  -26.857 6.569   1.00 0.00 ? 105 ARG A CB   5  
ATOM 8352  C CG   . ARG A 1 105 ? -3.059  -28.312 6.527   1.00 0.00 ? 105 ARG A CG   5  
ATOM 8353  C CD   . ARG A 1 105 ? -3.929  -29.181 7.422   1.00 0.00 ? 105 ARG A CD   5  
ATOM 8354  N NE   . ARG A 1 105 ? -5.232  -29.454 6.821   1.00 0.00 ? 105 ARG A NE   5  
ATOM 8355  C CZ   . ARG A 1 105 ? -6.272  -29.921 7.502   1.00 0.00 ? 105 ARG A CZ   5  
ATOM 8356  N NH1  . ARG A 1 105 ? -6.163  -30.165 8.801   1.00 0.00 ? 105 ARG A NH1  5  
ATOM 8357  N NH2  . ARG A 1 105 ? -7.425  -30.144 6.885   1.00 0.00 ? 105 ARG A NH2  5  
ATOM 8358  H H    . ARG A 1 105 ? -4.377  -24.551 5.631   1.00 0.00 ? 105 ARG A H    5  
ATOM 8359  H HA   . ARG A 1 105 ? -1.775  -25.884 5.750   1.00 0.00 ? 105 ARG A HA   5  
ATOM 8360  H HB2  . ARG A 1 105 ? -3.263  -26.462 7.547   1.00 0.00 ? 105 ARG A HB2  5  
ATOM 8361  H HB3  . ARG A 1 105 ? -4.566  -26.820 6.422   1.00 0.00 ? 105 ARG A HB3  5  
ATOM 8362  H HG2  . ARG A 1 105 ? -3.135  -28.672 5.512   1.00 0.00 ? 105 ARG A HG2  5  
ATOM 8363  H HG3  . ARG A 1 105 ? -2.035  -28.379 6.860   1.00 0.00 ? 105 ARG A HG3  5  
ATOM 8364  H HD2  . ARG A 1 105 ? -3.420  -30.117 7.596   1.00 0.00 ? 105 ARG A HD2  5  
ATOM 8365  H HD3  . ARG A 1 105 ? -4.076  -28.672 8.363   1.00 0.00 ? 105 ARG A HD3  5  
ATOM 8366  H HE   . ARG A 1 105 ? -5.335  -29.280 5.862   1.00 0.00 ? 105 ARG A HE   5  
ATOM 8367  H HH11 . ARG A 1 105 ? -5.296  -29.997 9.269   1.00 0.00 ? 105 ARG A HH11 5  
ATOM 8368  H HH12 . ARG A 1 105 ? -6.948  -30.516 9.312   1.00 0.00 ? 105 ARG A HH12 5  
ATOM 8369  H HH21 . ARG A 1 105 ? -7.511  -29.961 5.906   1.00 0.00 ? 105 ARG A HH21 5  
ATOM 8370  H HH22 . ARG A 1 105 ? -8.207  -30.495 7.398   1.00 0.00 ? 105 ARG A HH22 5  
ATOM 8371  N N    . THR A 1 106 ? -1.819  -27.022 3.561   1.00 0.00 ? 106 THR A N    5  
ATOM 8372  C CA   . THR A 1 106 ? -1.805  -27.658 2.250   1.00 0.00 ? 106 THR A CA   5  
ATOM 8373  C C    . THR A 1 106 ? -2.539  -28.994 2.279   1.00 0.00 ? 106 THR A C    5  
ATOM 8374  O O    . THR A 1 106 ? -2.943  -29.467 3.341   1.00 0.00 ? 106 THR A O    5  
ATOM 8375  C CB   . THR A 1 106 ? -0.366  -27.887 1.751   1.00 0.00 ? 106 THR A CB   5  
ATOM 8376  O OG1  . THR A 1 106 ? 0.420   -28.493 2.784   1.00 0.00 ? 106 THR A OG1  5  
ATOM 8377  C CG2  . THR A 1 106 ? 0.274   -26.575 1.324   1.00 0.00 ? 106 THR A CG2  5  
ATOM 8378  H H    . THR A 1 106 ? -0.971  -26.873 4.029   1.00 0.00 ? 106 THR A H    5  
ATOM 8379  H HA   . THR A 1 106 ? -2.304  -27.000 1.554   1.00 0.00 ? 106 THR A HA   5  
ATOM 8380  H HB   . THR A 1 106 ? -0.398  -28.550 0.898   1.00 0.00 ? 106 THR A HB   5  
ATOM 8381  H HG1  . THR A 1 106 ? 1.349   -28.303 2.633   1.00 0.00 ? 106 THR A HG1  5  
ATOM 8382  H HG21 . THR A 1 106 ? -0.081  -25.778 1.960   1.00 0.00 ? 106 THR A HG21 5  
ATOM 8383  H HG22 . THR A 1 106 ? 0.010   -26.363 0.299   1.00 0.00 ? 106 THR A HG22 5  
ATOM 8384  H HG23 . THR A 1 106 ? 1.347   -26.653 1.411   1.00 0.00 ? 106 THR A HG23 5  
ATOM 8385  N N    . MET A 1 107 ? -2.708  -29.597 1.107   1.00 0.00 ? 107 MET A N    5  
ATOM 8386  C CA   . MET A 1 107 ? -3.392  -30.881 1.000   1.00 0.00 ? 107 MET A CA   5  
ATOM 8387  C C    . MET A 1 107 ? -2.511  -32.012 1.522   1.00 0.00 ? 107 MET A C    5  
ATOM 8388  O O    . MET A 1 107 ? -1.289  -31.881 1.580   1.00 0.00 ? 107 MET A O    5  
ATOM 8389  C CB   . MET A 1 107 ? -3.784  -31.154 -0.453  1.00 0.00 ? 107 MET A CB   5  
ATOM 8390  C CG   . MET A 1 107 ? -4.623  -30.048 -1.074  1.00 0.00 ? 107 MET A CG   5  
ATOM 8391  S SD   . MET A 1 107 ? -6.354  -30.126 -0.575  1.00 0.00 ? 107 MET A SD   5  
ATOM 8392  C CE   . MET A 1 107 ? -6.938  -28.526 -1.129  1.00 0.00 ? 107 MET A CE   5  
ATOM 8393  H H    . MET A 1 107 ? -2.363  -29.171 0.295   1.00 0.00 ? 107 MET A H    5  
ATOM 8394  H HA   . MET A 1 107 ? -4.287  -30.830 1.602   1.00 0.00 ? 107 MET A HA   5  
ATOM 8395  H HB2  . MET A 1 107 ? -2.886  -31.268 -1.041  1.00 0.00 ? 107 MET A HB2  5  
ATOM 8396  H HB3  . MET A 1 107 ? -4.351  -32.072 -0.495  1.00 0.00 ? 107 MET A HB3  5  
ATOM 8397  H HG2  . MET A 1 107 ? -4.219  -29.094 -0.771  1.00 0.00 ? 107 MET A HG2  5  
ATOM 8398  H HG3  . MET A 1 107 ? -4.568  -30.135 -2.149  1.00 0.00 ? 107 MET A HG3  5  
ATOM 8399  H HE1  . MET A 1 107 ? -6.613  -28.356 -2.145  1.00 0.00 ? 107 MET A HE1  5  
ATOM 8400  H HE2  . MET A 1 107 ? -8.017  -28.504 -1.088  1.00 0.00 ? 107 MET A HE2  5  
ATOM 8401  H HE3  . MET A 1 107 ? -6.536  -27.755 -0.489  1.00 0.00 ? 107 MET A HE3  5  
ATOM 8402  N N    . GLN A 1 108 ? -3.141  -33.119 1.900   1.00 0.00 ? 108 GLN A N    5  
ATOM 8403  C CA   . GLN A 1 108 ? -2.413  -34.272 2.418   1.00 0.00 ? 108 GLN A CA   5  
ATOM 8404  C C    . GLN A 1 108 ? -1.812  -35.092 1.282   1.00 0.00 ? 108 GLN A C    5  
ATOM 8405  O O    . GLN A 1 108 ? -2.458  -35.991 0.743   1.00 0.00 ? 108 GLN A O    5  
ATOM 8406  C CB   . GLN A 1 108 ? -3.339  -35.149 3.262   1.00 0.00 ? 108 GLN A CB   5  
ATOM 8407  C CG   . GLN A 1 108 ? -2.674  -36.414 3.781   1.00 0.00 ? 108 GLN A CG   5  
ATOM 8408  C CD   . GLN A 1 108 ? -3.674  -37.436 4.283   1.00 0.00 ? 108 GLN A CD   5  
ATOM 8409  O OE1  . GLN A 1 108 ? -4.881  -37.194 4.280   1.00 0.00 ? 108 GLN A OE1  5  
ATOM 8410  N NE2  . GLN A 1 108 ? -3.177  -38.588 4.717   1.00 0.00 ? 108 GLN A NE2  5  
ATOM 8411  H H    . GLN A 1 108 ? -4.116  -33.162 1.830   1.00 0.00 ? 108 GLN A H    5  
ATOM 8412  H HA   . GLN A 1 108 ? -1.613  -33.905 3.043   1.00 0.00 ? 108 GLN A HA   5  
ATOM 8413  H HB2  . GLN A 1 108 ? -3.685  -34.577 4.109   1.00 0.00 ? 108 GLN A HB2  5  
ATOM 8414  H HB3  . GLN A 1 108 ? -4.189  -35.437 2.661   1.00 0.00 ? 108 GLN A HB3  5  
ATOM 8415  H HG2  . GLN A 1 108 ? -2.100  -36.858 2.980   1.00 0.00 ? 108 GLN A HG2  5  
ATOM 8416  H HG3  . GLN A 1 108 ? -2.012  -36.150 4.592   1.00 0.00 ? 108 GLN A HG3  5  
ATOM 8417  H HE21 . GLN A 1 108 ? -2.204  -38.711 4.690   1.00 0.00 ? 108 GLN A HE21 5  
ATOM 8418  H HE22 . GLN A 1 108 ? -3.800  -39.266 5.048   1.00 0.00 ? 108 GLN A HE22 5  
ATOM 8419  N N    . SER A 1 109 ? -0.572  -34.776 0.922   1.00 0.00 ? 109 SER A N    5  
ATOM 8420  C CA   . SER A 1 109 ? 0.115   -35.481 -0.154  1.00 0.00 ? 109 SER A CA   5  
ATOM 8421  C C    . SER A 1 109 ? 0.241   -36.968 0.165   1.00 0.00 ? 109 SER A C    5  
ATOM 8422  O O    . SER A 1 109 ? 0.890   -37.353 1.137   1.00 0.00 ? 109 SER A O    5  
ATOM 8423  C CB   . SER A 1 109 ? 1.502   -34.878 -0.384  1.00 0.00 ? 109 SER A CB   5  
ATOM 8424  O OG   . SER A 1 109 ? 2.239   -35.638 -1.325  1.00 0.00 ? 109 SER A OG   5  
ATOM 8425  H H    . SER A 1 109 ? -0.109  -34.050 1.390   1.00 0.00 ? 109 SER A H    5  
ATOM 8426  H HA   . SER A 1 109 ? -0.472  -35.367 -1.053  1.00 0.00 ? 109 SER A HA   5  
ATOM 8427  H HB2  . SER A 1 109 ? 1.396   -33.871 -0.757  1.00 0.00 ? 109 SER A HB2  5  
ATOM 8428  H HB3  . SER A 1 109 ? 2.043   -34.861 0.551   1.00 0.00 ? 109 SER A HB3  5  
ATOM 8429  H HG   . SER A 1 109 ? 3.081   -35.895 -0.941  1.00 0.00 ? 109 SER A HG   5  
ATOM 8430  N N    . SER A 1 110 ? -0.384  -37.799 -0.663  1.00 0.00 ? 110 SER A N    5  
ATOM 8431  C CA   . SER A 1 110 ? -0.346  -39.244 -0.468  1.00 0.00 ? 110 SER A CA   5  
ATOM 8432  C C    . SER A 1 110 ? 0.097   -39.953 -1.745  1.00 0.00 ? 110 SER A C    5  
ATOM 8433  O O    . SER A 1 110 ? 0.161   -39.347 -2.814  1.00 0.00 ? 110 SER A O    5  
ATOM 8434  C CB   . SER A 1 110 ? -1.721  -39.758 -0.036  1.00 0.00 ? 110 SER A CB   5  
ATOM 8435  O OG   . SER A 1 110 ? -2.654  -39.674 -1.099  1.00 0.00 ? 110 SER A OG   5  
ATOM 8436  H H    . SER A 1 110 ? -0.886  -37.432 -1.421  1.00 0.00 ? 110 SER A H    5  
ATOM 8437  H HA   . SER A 1 110 ? 0.369   -39.454 0.313   1.00 0.00 ? 110 SER A HA   5  
ATOM 8438  H HB2  . SER A 1 110 ? -1.636  -40.789 0.272   1.00 0.00 ? 110 SER A HB2  5  
ATOM 8439  H HB3  . SER A 1 110 ? -2.081  -39.164 0.791   1.00 0.00 ? 110 SER A HB3  5  
ATOM 8440  H HG   . SER A 1 110 ? -3.422  -39.175 -0.813  1.00 0.00 ? 110 SER A HG   5  
ATOM 8441  N N    . GLY A 1 111 ? 0.401   -41.241 -1.624  1.00 0.00 ? 111 GLY A N    5  
ATOM 8442  C CA   . GLY A 1 111 ? 0.834   -42.012 -2.774  1.00 0.00 ? 111 GLY A CA   5  
ATOM 8443  C C    . GLY A 1 111 ? 0.392   -43.460 -2.702  1.00 0.00 ? 111 GLY A C    5  
ATOM 8444  O O    . GLY A 1 111 ? 0.139   -44.001 -1.625  1.00 0.00 ? 111 GLY A O    5  
ATOM 8445  H H    . GLY A 1 111 ? 0.331   -41.672 -0.746  1.00 0.00 ? 111 GLY A H    5  
ATOM 8446  H HA2  . GLY A 1 111 ? 0.424   -41.566 -3.668  1.00 0.00 ? 111 GLY A HA2  5  
ATOM 8447  H HA3  . GLY A 1 111 ? 1.912   -41.980 -2.830  1.00 0.00 ? 111 GLY A HA3  5  
ATOM 8448  N N    . PRO A 1 112 ? 0.291   -44.112 -3.870  1.00 0.00 ? 112 PRO A N    5  
ATOM 8449  C CA   . PRO A 1 112 ? -0.126  -45.514 -3.961  1.00 0.00 ? 112 PRO A CA   5  
ATOM 8450  C C    . PRO A 1 112 ? 0.927   -46.469 -3.408  1.00 0.00 ? 112 PRO A C    5  
ATOM 8451  O O    . PRO A 1 112 ? 2.042   -46.059 -3.087  1.00 0.00 ? 112 PRO A O    5  
ATOM 8452  C CB   . PRO A 1 112 ? -0.308  -45.733 -5.465  1.00 0.00 ? 112 PRO A CB   5  
ATOM 8453  C CG   . PRO A 1 112 ? 0.581   -44.724 -6.105  1.00 0.00 ? 112 PRO A CG   5  
ATOM 8454  C CD   . PRO A 1 112 ? 0.576   -43.529 -5.192  1.00 0.00 ? 112 PRO A CD   5  
ATOM 8455  H HA   . PRO A 1 112 ? -1.065  -45.683 -3.454  1.00 0.00 ? 112 PRO A HA   5  
ATOM 8456  H HB2  . PRO A 1 112 ? -0.014  -46.741 -5.723  1.00 0.00 ? 112 PRO A HB2  5  
ATOM 8457  H HB3  . PRO A 1 112 ? -1.342  -45.575 -5.733  1.00 0.00 ? 112 PRO A HB3  5  
ATOM 8458  H HG2  . PRO A 1 112 ? 1.580   -45.121 -6.199  1.00 0.00 ? 112 PRO A HG2  5  
ATOM 8459  H HG3  . PRO A 1 112 ? 0.190   -44.454 -7.076  1.00 0.00 ? 112 PRO A HG3  5  
ATOM 8460  H HD2  . PRO A 1 112 ? 1.541   -43.045 -5.200  1.00 0.00 ? 112 PRO A HD2  5  
ATOM 8461  H HD3  . PRO A 1 112 ? -0.199  -42.835 -5.482  1.00 0.00 ? 112 PRO A HD3  5  
ATOM 8462  N N    . SER A 1 113 ? 0.565   -47.743 -3.299  1.00 0.00 ? 113 SER A N    5  
ATOM 8463  C CA   . SER A 1 113 ? 1.478   -48.755 -2.781  1.00 0.00 ? 113 SER A CA   5  
ATOM 8464  C C    . SER A 1 113 ? 2.746   -48.826 -3.626  1.00 0.00 ? 113 SER A C    5  
ATOM 8465  O O    . SER A 1 113 ? 2.750   -48.437 -4.794  1.00 0.00 ? 113 SER A O    5  
ATOM 8466  C CB   . SER A 1 113 ? 0.793   -50.123 -2.753  1.00 0.00 ? 113 SER A CB   5  
ATOM 8467  O OG   . SER A 1 113 ? -0.450  -50.058 -2.075  1.00 0.00 ? 113 SER A OG   5  
ATOM 8468  H H    . SER A 1 113 ? -0.339  -48.008 -3.572  1.00 0.00 ? 113 SER A H    5  
ATOM 8469  H HA   . SER A 1 113 ? 1.745   -48.476 -1.773  1.00 0.00 ? 113 SER A HA   5  
ATOM 8470  H HB2  . SER A 1 113 ? 0.620   -50.457 -3.765  1.00 0.00 ? 113 SER A HB2  5  
ATOM 8471  H HB3  . SER A 1 113 ? 1.431   -50.832 -2.245  1.00 0.00 ? 113 SER A HB3  5  
ATOM 8472  H HG   . SER A 1 113 ? -0.800  -50.945 -1.961  1.00 0.00 ? 113 SER A HG   5  
ATOM 8473  N N    . SER A 1 114 ? 3.822   -49.326 -3.026  1.00 0.00 ? 114 SER A N    5  
ATOM 8474  C CA   . SER A 1 114 ? 5.098   -49.445 -3.721  1.00 0.00 ? 114 SER A CA   5  
ATOM 8475  C C    . SER A 1 114 ? 5.461   -50.910 -3.944  1.00 0.00 ? 114 SER A C    5  
ATOM 8476  O O    . SER A 1 114 ? 5.860   -51.611 -3.015  1.00 0.00 ? 114 SER A O    5  
ATOM 8477  C CB   . SER A 1 114 ? 6.204   -48.750 -2.923  1.00 0.00 ? 114 SER A CB   5  
ATOM 8478  O OG   . SER A 1 114 ? 5.992   -47.350 -2.872  1.00 0.00 ? 114 SER A OG   5  
ATOM 8479  H H    . SER A 1 114 ? 3.755   -49.619 -2.093  1.00 0.00 ? 114 SER A H    5  
ATOM 8480  H HA   . SER A 1 114 ? 5.000   -48.960 -4.681  1.00 0.00 ? 114 SER A HA   5  
ATOM 8481  H HB2  . SER A 1 114 ? 6.215   -49.137 -1.916  1.00 0.00 ? 114 SER A HB2  5  
ATOM 8482  H HB3  . SER A 1 114 ? 7.158   -48.942 -3.393  1.00 0.00 ? 114 SER A HB3  5  
ATOM 8483  H HG   . SER A 1 114 ? 5.399   -47.142 -2.146  1.00 0.00 ? 114 SER A HG   5  
ATOM 8484  N N    . GLY A 1 115 ? 5.319   -51.366 -5.185  1.00 0.00 ? 115 GLY A N    5  
ATOM 8485  C CA   . GLY A 1 115 ? 5.635   -52.745 -5.510  1.00 0.00 ? 115 GLY A CA   5  
ATOM 8486  C C    . GLY A 1 115 ? 5.593   -53.014 -7.001  1.00 0.00 ? 115 GLY A C    5  
ATOM 8487  O O    . GLY A 1 115 ? 4.671   -52.578 -7.691  1.00 0.00 ? 115 GLY A O    5  
ATOM 8488  H H    . GLY A 1 115 ? 4.996   -50.761 -5.886  1.00 0.00 ? 115 GLY A H    5  
ATOM 8489  H HA2  . GLY A 1 115 ? 6.624   -52.972 -5.141  1.00 0.00 ? 115 GLY A HA2  5  
ATOM 8490  H HA3  . GLY A 1 115 ? 4.921   -53.390 -5.019  1.00 0.00 ? 115 GLY A HA3  5  
ATOM 8491  N N    . GLY A 1 1   ? 5.347   54.481  -5.844  1.00 0.00 ? 1   GLY A N    6  
ATOM 8492  C CA   . GLY A 1 1   ? 5.689   53.746  -4.640  1.00 0.00 ? 1   GLY A CA   6  
ATOM 8493  C C    . GLY A 1 1   ? 5.769   52.251  -4.877  1.00 0.00 ? 1   GLY A C    6  
ATOM 8494  O O    . GLY A 1 1   ? 5.137   51.726  -5.794  1.00 0.00 ? 1   GLY A O    6  
ATOM 8495  H H1   . GLY A 1 1   ? 5.801   54.273  -6.688  1.00 0.00 ? 1   GLY A H1   6  
ATOM 8496  H HA2  . GLY A 1 1   ? 6.644   54.094  -4.277  1.00 0.00 ? 1   GLY A HA2  6  
ATOM 8497  H HA3  . GLY A 1 1   ? 4.937   53.939  -3.889  1.00 0.00 ? 1   GLY A HA3  6  
ATOM 8498  N N    . SER A 1 2   ? 6.549   51.563  -4.050  1.00 0.00 ? 2   SER A N    6  
ATOM 8499  C CA   . SER A 1 2   ? 6.714   50.119  -4.178  1.00 0.00 ? 2   SER A CA   6  
ATOM 8500  C C    . SER A 1 2   ? 6.037   49.391  -3.021  1.00 0.00 ? 2   SER A C    6  
ATOM 8501  O O    . SER A 1 2   ? 6.290   49.688  -1.853  1.00 0.00 ? 2   SER A O    6  
ATOM 8502  C CB   . SER A 1 2   ? 8.200   49.757  -4.225  1.00 0.00 ? 2   SER A CB   6  
ATOM 8503  O OG   . SER A 1 2   ? 8.865   50.180  -3.048  1.00 0.00 ? 2   SER A OG   6  
ATOM 8504  H H    . SER A 1 2   ? 7.027   52.038  -3.338  1.00 0.00 ? 2   SER A H    6  
ATOM 8505  H HA   . SER A 1 2   ? 6.248   49.813  -5.102  1.00 0.00 ? 2   SER A HA   6  
ATOM 8506  H HB2  . SER A 1 2   ? 8.303   48.686  -4.318  1.00 0.00 ? 2   SER A HB2  6  
ATOM 8507  H HB3  . SER A 1 2   ? 8.658   50.238  -5.077  1.00 0.00 ? 2   SER A HB3  6  
ATOM 8508  H HG   . SER A 1 2   ? 8.243   50.201  -2.317  1.00 0.00 ? 2   SER A HG   6  
ATOM 8509  N N    . SER A 1 3   ? 5.176   48.435  -3.354  1.00 0.00 ? 3   SER A N    6  
ATOM 8510  C CA   . SER A 1 3   ? 4.460   47.665  -2.344  1.00 0.00 ? 3   SER A CA   6  
ATOM 8511  C C    . SER A 1 3   ? 5.391   46.672  -1.656  1.00 0.00 ? 3   SER A C    6  
ATOM 8512  O O    . SER A 1 3   ? 5.390   46.548  -0.432  1.00 0.00 ? 3   SER A O    6  
ATOM 8513  C CB   . SER A 1 3   ? 3.282   46.923  -2.978  1.00 0.00 ? 3   SER A CB   6  
ATOM 8514  O OG   . SER A 1 3   ? 3.734   45.907  -3.858  1.00 0.00 ? 3   SER A OG   6  
ATOM 8515  H H    . SER A 1 3   ? 5.018   48.244  -4.302  1.00 0.00 ? 3   SER A H    6  
ATOM 8516  H HA   . SER A 1 3   ? 4.082   48.358  -1.606  1.00 0.00 ? 3   SER A HA   6  
ATOM 8517  H HB2  . SER A 1 3   ? 2.684   46.470  -2.202  1.00 0.00 ? 3   SER A HB2  6  
ATOM 8518  H HB3  . SER A 1 3   ? 2.677   47.623  -3.536  1.00 0.00 ? 3   SER A HB3  6  
ATOM 8519  H HG   . SER A 1 3   ? 3.068   45.747  -4.531  1.00 0.00 ? 3   SER A HG   6  
ATOM 8520  N N    . GLY A 1 4   ? 6.185   45.964  -2.454  1.00 0.00 ? 4   GLY A N    6  
ATOM 8521  C CA   . GLY A 1 4   ? 7.110   44.990  -1.905  1.00 0.00 ? 4   GLY A CA   6  
ATOM 8522  C C    . GLY A 1 4   ? 6.765   43.571  -2.310  1.00 0.00 ? 4   GLY A C    6  
ATOM 8523  O O    . GLY A 1 4   ? 5.611   43.154  -2.215  1.00 0.00 ? 4   GLY A O    6  
ATOM 8524  H H    . GLY A 1 4   ? 6.142   46.105  -3.423  1.00 0.00 ? 4   GLY A H    6  
ATOM 8525  H HA2  . GLY A 1 4   ? 8.106   45.221  -2.252  1.00 0.00 ? 4   GLY A HA2  6  
ATOM 8526  H HA3  . GLY A 1 4   ? 7.091   45.060  -0.827  1.00 0.00 ? 4   GLY A HA3  6  
ATOM 8527  N N    . SER A 1 5   ? 7.768   42.826  -2.764  1.00 0.00 ? 5   SER A N    6  
ATOM 8528  C CA   . SER A 1 5   ? 7.564   41.447  -3.190  1.00 0.00 ? 5   SER A CA   6  
ATOM 8529  C C    . SER A 1 5   ? 8.900   40.750  -3.434  1.00 0.00 ? 5   SER A C    6  
ATOM 8530  O O    . SER A 1 5   ? 9.958   41.377  -3.380  1.00 0.00 ? 5   SER A O    6  
ATOM 8531  C CB   . SER A 1 5   ? 6.714   41.404  -4.461  1.00 0.00 ? 5   SER A CB   6  
ATOM 8532  O OG   . SER A 1 5   ? 7.410   41.968  -5.559  1.00 0.00 ? 5   SER A OG   6  
ATOM 8533  H H    . SER A 1 5   ? 8.667   43.215  -2.816  1.00 0.00 ? 5   SER A H    6  
ATOM 8534  H HA   . SER A 1 5   ? 7.041   40.930  -2.399  1.00 0.00 ? 5   SER A HA   6  
ATOM 8535  H HB2  . SER A 1 5   ? 6.470   40.378  -4.694  1.00 0.00 ? 5   SER A HB2  6  
ATOM 8536  H HB3  . SER A 1 5   ? 5.804   41.963  -4.301  1.00 0.00 ? 5   SER A HB3  6  
ATOM 8537  H HG   . SER A 1 5   ? 7.352   42.925  -5.518  1.00 0.00 ? 5   SER A HG   6  
ATOM 8538  N N    . SER A 1 6   ? 8.841   39.450  -3.701  1.00 0.00 ? 6   SER A N    6  
ATOM 8539  C CA   . SER A 1 6   ? 10.045  38.665  -3.950  1.00 0.00 ? 6   SER A CA   6  
ATOM 8540  C C    . SER A 1 6   ? 9.690   37.238  -4.353  1.00 0.00 ? 6   SER A C    6  
ATOM 8541  O O    . SER A 1 6   ? 9.147   36.473  -3.557  1.00 0.00 ? 6   SER A O    6  
ATOM 8542  C CB   . SER A 1 6   ? 10.935  38.650  -2.705  1.00 0.00 ? 6   SER A CB   6  
ATOM 8543  O OG   . SER A 1 6   ? 10.222  38.178  -1.575  1.00 0.00 ? 6   SER A OG   6  
ATOM 8544  H H    . SER A 1 6   ? 7.967   39.006  -3.730  1.00 0.00 ? 6   SER A H    6  
ATOM 8545  H HA   . SER A 1 6   ? 10.584  39.133  -4.760  1.00 0.00 ? 6   SER A HA   6  
ATOM 8546  H HB2  . SER A 1 6   ? 11.781  38.002  -2.878  1.00 0.00 ? 6   SER A HB2  6  
ATOM 8547  H HB3  . SER A 1 6   ? 11.284  39.652  -2.503  1.00 0.00 ? 6   SER A HB3  6  
ATOM 8548  H HG   . SER A 1 6   ? 9.291   38.389  -1.672  1.00 0.00 ? 6   SER A HG   6  
ATOM 8549  N N    . GLY A 1 7   ? 10.002  36.886  -5.597  1.00 0.00 ? 7   GLY A N    6  
ATOM 8550  C CA   . GLY A 1 7   ? 9.709   35.551  -6.086  1.00 0.00 ? 7   GLY A CA   6  
ATOM 8551  C C    . GLY A 1 7   ? 8.318   35.086  -5.702  1.00 0.00 ? 7   GLY A C    6  
ATOM 8552  O O    . GLY A 1 7   ? 7.385   35.885  -5.637  1.00 0.00 ? 7   GLY A O    6  
ATOM 8553  H H    . GLY A 1 7   ? 10.435  37.538  -6.187  1.00 0.00 ? 7   GLY A H    6  
ATOM 8554  H HA2  . GLY A 1 7   ? 9.795   35.547  -7.162  1.00 0.00 ? 7   GLY A HA2  6  
ATOM 8555  H HA3  . GLY A 1 7   ? 10.432  34.863  -5.674  1.00 0.00 ? 7   GLY A HA3  6  
ATOM 8556  N N    . ASP A 1 8   ? 8.179   33.789  -5.449  1.00 0.00 ? 8   ASP A N    6  
ATOM 8557  C CA   . ASP A 1 8   ? 6.892   33.218  -5.071  1.00 0.00 ? 8   ASP A CA   6  
ATOM 8558  C C    . ASP A 1 8   ? 7.072   32.110  -4.037  1.00 0.00 ? 8   ASP A C    6  
ATOM 8559  O O    . ASP A 1 8   ? 8.195   31.703  -3.738  1.00 0.00 ? 8   ASP A O    6  
ATOM 8560  C CB   . ASP A 1 8   ? 6.171   32.670  -6.304  1.00 0.00 ? 8   ASP A CB   6  
ATOM 8561  C CG   . ASP A 1 8   ? 6.730   31.335  -6.756  1.00 0.00 ? 8   ASP A CG   6  
ATOM 8562  O OD1  . ASP A 1 8   ? 7.699   31.335  -7.543  1.00 0.00 ? 8   ASP A OD1  6  
ATOM 8563  O OD2  . ASP A 1 8   ? 6.197   30.291  -6.324  1.00 0.00 ? 8   ASP A OD2  6  
ATOM 8564  H H    . ASP A 1 8   ? 8.961   33.202  -5.518  1.00 0.00 ? 8   ASP A H    6  
ATOM 8565  H HA   . ASP A 1 8   ? 6.295   34.005  -4.636  1.00 0.00 ? 8   ASP A HA   6  
ATOM 8566  H HB2  . ASP A 1 8   ? 5.123   32.540  -6.072  1.00 0.00 ? 8   ASP A HB2  6  
ATOM 8567  H HB3  . ASP A 1 8   ? 6.271   33.376  -7.115  1.00 0.00 ? 8   ASP A HB3  6  
ATOM 8568  N N    . ILE A 1 9   ? 5.959   31.628  -3.495  1.00 0.00 ? 9   ILE A N    6  
ATOM 8569  C CA   . ILE A 1 9   ? 5.994   30.568  -2.495  1.00 0.00 ? 9   ILE A CA   6  
ATOM 8570  C C    . ILE A 1 9   ? 6.070   29.194  -3.153  1.00 0.00 ? 9   ILE A C    6  
ATOM 8571  O O    . ILE A 1 9   ? 5.550   28.991  -4.250  1.00 0.00 ? 9   ILE A O    6  
ATOM 8572  C CB   . ILE A 1 9   ? 4.758   30.617  -1.578  1.00 0.00 ? 9   ILE A CB   6  
ATOM 8573  C CG1  . ILE A 1 9   ? 4.910   29.622  -0.426  1.00 0.00 ? 9   ILE A CG1  6  
ATOM 8574  C CG2  . ILE A 1 9   ? 3.495   30.324  -2.375  1.00 0.00 ? 9   ILE A CG2  6  
ATOM 8575  C CD1  . ILE A 1 9   ? 4.190   30.043  0.836   1.00 0.00 ? 9   ILE A CD1  6  
ATOM 8576  H H    . ILE A 1 9   ? 5.093   31.993  -3.774  1.00 0.00 ? 9   ILE A H    6  
ATOM 8577  H HA   . ILE A 1 9   ? 6.875   30.713  -1.887  1.00 0.00 ? 9   ILE A HA   6  
ATOM 8578  H HB   . ILE A 1 9   ? 4.676   31.615  -1.175  1.00 0.00 ? 9   ILE A HB   6  
ATOM 8579  H HG12 . ILE A 1 9   ? 4.514   28.666  -0.730  1.00 0.00 ? 9   ILE A HG12 6  
ATOM 8580  H HG13 . ILE A 1 9   ? 5.959   29.514  -0.190  1.00 0.00 ? 9   ILE A HG13 6  
ATOM 8581  H HG21 . ILE A 1 9   ? 2.633   30.417  -1.731  1.00 0.00 ? 9   ILE A HG21 6  
ATOM 8582  H HG22 . ILE A 1 9   ? 3.412   31.029  -3.189  1.00 0.00 ? 9   ILE A HG22 6  
ATOM 8583  H HG23 . ILE A 1 9   ? 3.543   29.321  -2.770  1.00 0.00 ? 9   ILE A HG23 6  
ATOM 8584  H HD11 . ILE A 1 9   ? 3.327   29.412  0.986   1.00 0.00 ? 9   ILE A HD11 6  
ATOM 8585  H HD12 . ILE A 1 9   ? 4.857   29.950  1.679   1.00 0.00 ? 9   ILE A HD12 6  
ATOM 8586  H HD13 . ILE A 1 9   ? 3.870   31.072  0.741   1.00 0.00 ? 9   ILE A HD13 6  
ATOM 8587  N N    . GLN A 1 10  ? 6.720   28.254  -2.475  1.00 0.00 ? 10  GLN A N    6  
ATOM 8588  C CA   . GLN A 1 10  ? 6.863   26.899  -2.993  1.00 0.00 ? 10  GLN A CA   6  
ATOM 8589  C C    . GLN A 1 10  ? 5.891   25.947  -2.304  1.00 0.00 ? 10  GLN A C    6  
ATOM 8590  O O    . GLN A 1 10  ? 6.057   25.618  -1.129  1.00 0.00 ? 10  GLN A O    6  
ATOM 8591  C CB   . GLN A 1 10  ? 8.299   26.406  -2.803  1.00 0.00 ? 10  GLN A CB   6  
ATOM 8592  C CG   . GLN A 1 10  ? 8.730   25.376  -3.834  1.00 0.00 ? 10  GLN A CG   6  
ATOM 8593  C CD   . GLN A 1 10  ? 9.841   24.475  -3.330  1.00 0.00 ? 10  GLN A CD   6  
ATOM 8594  O OE1  . GLN A 1 10  ? 10.534  24.805  -2.368  1.00 0.00 ? 10  GLN A OE1  6  
ATOM 8595  N NE2  . GLN A 1 10  ? 10.015  23.330  -3.980  1.00 0.00 ? 10  GLN A NE2  6  
ATOM 8596  H H    . GLN A 1 10  ? 7.113   28.477  -1.606  1.00 0.00 ? 10  GLN A H    6  
ATOM 8597  H HA   . GLN A 1 10  ? 6.637   26.922  -4.048  1.00 0.00 ? 10  GLN A HA   6  
ATOM 8598  H HB2  . GLN A 1 10  ? 8.968   27.251  -2.868  1.00 0.00 ? 10  GLN A HB2  6  
ATOM 8599  H HB3  . GLN A 1 10  ? 8.388   25.962  -1.823  1.00 0.00 ? 10  GLN A HB3  6  
ATOM 8600  H HG2  . GLN A 1 10  ? 7.878   24.762  -4.089  1.00 0.00 ? 10  GLN A HG2  6  
ATOM 8601  H HG3  . GLN A 1 10  ? 9.077   25.892  -4.717  1.00 0.00 ? 10  GLN A HG3  6  
ATOM 8602  H HE21 . GLN A 1 10  ? 9.426   23.134  -4.739  1.00 0.00 ? 10  GLN A HE21 6  
ATOM 8603  H HE22 . GLN A 1 10  ? 10.726  22.729  -3.676  1.00 0.00 ? 10  GLN A HE22 6  
ATOM 8604  N N    . VAL A 1 11  ? 4.877   25.508  -3.042  1.00 0.00 ? 11  VAL A N    6  
ATOM 8605  C CA   . VAL A 1 11  ? 3.878   24.593  -2.502  1.00 0.00 ? 11  VAL A CA   6  
ATOM 8606  C C    . VAL A 1 11  ? 4.241   23.143  -2.805  1.00 0.00 ? 11  VAL A C    6  
ATOM 8607  O O    . VAL A 1 11  ? 4.676   22.819  -3.910  1.00 0.00 ? 11  VAL A O    6  
ATOM 8608  C CB   . VAL A 1 11  ? 2.479   24.890  -3.072  1.00 0.00 ? 11  VAL A CB   6  
ATOM 8609  C CG1  . VAL A 1 11  ? 2.478   24.754  -4.587  1.00 0.00 ? 11  VAL A CG1  6  
ATOM 8610  C CG2  . VAL A 1 11  ? 1.442   23.969  -2.445  1.00 0.00 ? 11  VAL A CG2  6  
ATOM 8611  H H    . VAL A 1 11  ? 4.799   25.806  -3.972  1.00 0.00 ? 11  VAL A H    6  
ATOM 8612  H HA   . VAL A 1 11  ? 3.845   24.729  -1.431  1.00 0.00 ? 11  VAL A HA   6  
ATOM 8613  H HB   . VAL A 1 11  ? 2.220   25.909  -2.824  1.00 0.00 ? 11  VAL A HB   6  
ATOM 8614  H HG11 . VAL A 1 11  ? 3.221   25.416  -5.007  1.00 0.00 ? 11  VAL A HG11 6  
ATOM 8615  H HG12 . VAL A 1 11  ? 2.708   23.734  -4.857  1.00 0.00 ? 11  VAL A HG12 6  
ATOM 8616  H HG13 . VAL A 1 11  ? 1.504   25.018  -4.971  1.00 0.00 ? 11  VAL A HG13 6  
ATOM 8617  H HG21 . VAL A 1 11  ? 1.019   23.333  -3.208  1.00 0.00 ? 11  VAL A HG21 6  
ATOM 8618  H HG22 . VAL A 1 11  ? 1.913   23.358  -1.689  1.00 0.00 ? 11  VAL A HG22 6  
ATOM 8619  H HG23 . VAL A 1 11  ? 0.660   24.561  -1.994  1.00 0.00 ? 11  VAL A HG23 6  
ATOM 8620  N N    . ILE A 1 12  ? 4.058   22.275  -1.816  1.00 0.00 ? 12  ILE A N    6  
ATOM 8621  C CA   . ILE A 1 12  ? 4.364   20.859  -1.977  1.00 0.00 ? 12  ILE A CA   6  
ATOM 8622  C C    . ILE A 1 12  ? 3.372   19.991  -1.211  1.00 0.00 ? 12  ILE A C    6  
ATOM 8623  O O    . ILE A 1 12  ? 2.595   20.489  -0.394  1.00 0.00 ? 12  ILE A O    6  
ATOM 8624  C CB   . ILE A 1 12  ? 5.791   20.533  -1.497  1.00 0.00 ? 12  ILE A CB   6  
ATOM 8625  C CG1  . ILE A 1 12  ? 5.900   20.727  0.017   1.00 0.00 ? 12  ILE A CG1  6  
ATOM 8626  C CG2  . ILE A 1 12  ? 6.806   21.405  -2.222  1.00 0.00 ? 12  ILE A CG2  6  
ATOM 8627  C CD1  . ILE A 1 12  ? 5.683   22.156  0.461   1.00 0.00 ? 12  ILE A CD1  6  
ATOM 8628  H H    . ILE A 1 12  ? 3.709   22.594  -0.958  1.00 0.00 ? 12  ILE A H    6  
ATOM 8629  H HA   . ILE A 1 12  ? 4.297   20.621  -3.029  1.00 0.00 ? 12  ILE A HA   6  
ATOM 8630  H HB   . ILE A 1 12  ? 6.001   19.502  -1.737  1.00 0.00 ? 12  ILE A HB   6  
ATOM 8631  H HG12 . ILE A 1 12  ? 5.161   20.112  0.506   1.00 0.00 ? 12  ILE A HG12 6  
ATOM 8632  H HG13 . ILE A 1 12  ? 6.885   20.424  0.341   1.00 0.00 ? 12  ILE A HG13 6  
ATOM 8633  H HG21 . ILE A 1 12  ? 7.754   21.358  -1.707  1.00 0.00 ? 12  ILE A HG21 6  
ATOM 8634  H HG22 . ILE A 1 12  ? 6.929   21.048  -3.233  1.00 0.00 ? 12  ILE A HG22 6  
ATOM 8635  H HG23 . ILE A 1 12  ? 6.456   22.426  -2.240  1.00 0.00 ? 12  ILE A HG23 6  
ATOM 8636  H HD11 . ILE A 1 12  ? 6.439   22.429  1.182   1.00 0.00 ? 12  ILE A HD11 6  
ATOM 8637  H HD12 . ILE A 1 12  ? 5.746   22.813  -0.394  1.00 0.00 ? 12  ILE A HD12 6  
ATOM 8638  H HD13 . ILE A 1 12  ? 4.706   22.248  0.914   1.00 0.00 ? 12  ILE A HD13 6  
ATOM 8639  N N    . THR A 1 13  ? 3.403   18.689  -1.477  1.00 0.00 ? 13  THR A N    6  
ATOM 8640  C CA   . THR A 1 13  ? 2.507   17.751  -0.813  1.00 0.00 ? 13  THR A CA   6  
ATOM 8641  C C    . THR A 1 13  ? 3.147   16.373  -0.690  1.00 0.00 ? 13  THR A C    6  
ATOM 8642  O O    . THR A 1 13  ? 3.917   15.957  -1.555  1.00 0.00 ? 13  THR A O    6  
ATOM 8643  C CB   . THR A 1 13  ? 1.172   17.618  -1.569  1.00 0.00 ? 13  THR A CB   6  
ATOM 8644  O OG1  . THR A 1 13  ? 0.274   16.779  -0.834  1.00 0.00 ? 13  THR A OG1  6  
ATOM 8645  C CG2  . THR A 1 13  ? 1.392   17.040  -2.959  1.00 0.00 ? 13  THR A CG2  6  
ATOM 8646  H H    . THR A 1 13  ? 4.044   18.353  -2.138  1.00 0.00 ? 13  THR A H    6  
ATOM 8647  H HA   . THR A 1 13  ? 2.300   18.131  0.177   1.00 0.00 ? 13  THR A HA   6  
ATOM 8648  H HB   . THR A 1 13  ? 0.733   18.601  -1.669  1.00 0.00 ? 13  THR A HB   6  
ATOM 8649  H HG1  . THR A 1 13  ? 0.778   16.128  -0.338  1.00 0.00 ? 13  THR A HG1  6  
ATOM 8650  H HG21 . THR A 1 13  ? 2.209   16.335  -2.930  1.00 0.00 ? 13  THR A HG21 6  
ATOM 8651  H HG22 . THR A 1 13  ? 1.628   17.838  -3.647  1.00 0.00 ? 13  THR A HG22 6  
ATOM 8652  H HG23 . THR A 1 13  ? 0.494   16.538  -3.285  1.00 0.00 ? 13  THR A HG23 6  
ATOM 8653  N N    . GLN A 1 14  ? 2.823   15.670  0.391   1.00 0.00 ? 14  GLN A N    6  
ATOM 8654  C CA   . GLN A 1 14  ? 3.368   14.338  0.626   1.00 0.00 ? 14  GLN A CA   6  
ATOM 8655  C C    . GLN A 1 14  ? 2.283   13.274  0.488   1.00 0.00 ? 14  GLN A C    6  
ATOM 8656  O O    . GLN A 1 14  ? 1.098   13.551  0.676   1.00 0.00 ? 14  GLN A O    6  
ATOM 8657  C CB   . GLN A 1 14  ? 4.000   14.261  2.017   1.00 0.00 ? 14  GLN A CB   6  
ATOM 8658  C CG   . GLN A 1 14  ? 3.192   14.968  3.092   1.00 0.00 ? 14  GLN A CG   6  
ATOM 8659  C CD   . GLN A 1 14  ? 3.566   14.522  4.492   1.00 0.00 ? 14  GLN A CD   6  
ATOM 8660  O OE1  . GLN A 1 14  ? 4.387   13.621  4.670   1.00 0.00 ? 14  GLN A OE1  6  
ATOM 8661  N NE2  . GLN A 1 14  ? 2.964   15.150  5.495   1.00 0.00 ? 14  GLN A NE2  6  
ATOM 8662  H H    . GLN A 1 14  ? 2.204   16.055  1.044   1.00 0.00 ? 14  GLN A H    6  
ATOM 8663  H HA   . GLN A 1 14  ? 4.130   14.155  -0.117  1.00 0.00 ? 14  GLN A HA   6  
ATOM 8664  H HB2  . GLN A 1 14  ? 4.100   13.222  2.296   1.00 0.00 ? 14  GLN A HB2  6  
ATOM 8665  H HB3  . GLN A 1 14  ? 4.981   14.711  1.979   1.00 0.00 ? 14  GLN A HB3  6  
ATOM 8666  H HG2  . GLN A 1 14  ? 3.365   16.032  3.013   1.00 0.00 ? 14  GLN A HG2  6  
ATOM 8667  H HG3  . GLN A 1 14  ? 2.144   14.762  2.932   1.00 0.00 ? 14  GLN A HG3  6  
ATOM 8668  H HE21 . GLN A 1 14  ? 2.320   15.856  5.278   1.00 0.00 ? 14  GLN A HE21 6  
ATOM 8669  H HE22 . GLN A 1 14  ? 3.186   14.881  6.410   1.00 0.00 ? 14  GLN A HE22 6  
ATOM 8670  N N    . THR A 1 15  ? 2.696   12.054  0.157   1.00 0.00 ? 15  THR A N    6  
ATOM 8671  C CA   . THR A 1 15  ? 1.760   10.949  -0.008  1.00 0.00 ? 15  THR A CA   6  
ATOM 8672  C C    . THR A 1 15  ? 1.823   9.994   1.178   1.00 0.00 ? 15  THR A C    6  
ATOM 8673  O O    . THR A 1 15  ? 2.905   9.614   1.624   1.00 0.00 ? 15  THR A O    6  
ATOM 8674  C CB   . THR A 1 15  ? 2.042   10.163  -1.302  1.00 0.00 ? 15  THR A CB   6  
ATOM 8675  O OG1  . THR A 1 15  ? 1.949   11.034  -2.435  1.00 0.00 ? 15  THR A OG1  6  
ATOM 8676  C CG2  . THR A 1 15  ? 1.062   9.011   -1.460  1.00 0.00 ? 15  THR A CG2  6  
ATOM 8677  H H    . THR A 1 15  ? 3.653   11.896  0.020   1.00 0.00 ? 15  THR A H    6  
ATOM 8678  H HA   . THR A 1 15  ? 0.764   11.363  -0.073  1.00 0.00 ? 15  THR A HA   6  
ATOM 8679  H HB   . THR A 1 15  ? 3.043   9.759   -1.249  1.00 0.00 ? 15  THR A HB   6  
ATOM 8680  H HG1  . THR A 1 15  ? 2.771   11.004  -2.931  1.00 0.00 ? 15  THR A HG1  6  
ATOM 8681  H HG21 . THR A 1 15  ? 0.091   9.311   -1.093  1.00 0.00 ? 15  THR A HG21 6  
ATOM 8682  H HG22 . THR A 1 15  ? 1.413   8.159   -0.896  1.00 0.00 ? 15  THR A HG22 6  
ATOM 8683  H HG23 . THR A 1 15  ? 0.984   8.744   -2.503  1.00 0.00 ? 15  THR A HG23 6  
ATOM 8684  N N    . GLY A 1 16  ? 0.656   9.608   1.684   1.00 0.00 ? 16  GLY A N    6  
ATOM 8685  C CA   . GLY A 1 16  ? 0.601   8.699   2.814   1.00 0.00 ? 16  GLY A CA   6  
ATOM 8686  C C    . GLY A 1 16  ? 0.653   7.244   2.390   1.00 0.00 ? 16  GLY A C    6  
ATOM 8687  O O    . GLY A 1 16  ? 0.225   6.894   1.290   1.00 0.00 ? 16  GLY A O    6  
ATOM 8688  H H    . GLY A 1 16  ? -0.175  9.943   1.287   1.00 0.00 ? 16  GLY A H    6  
ATOM 8689  H HA2  . GLY A 1 16  ? 1.436   8.903   3.467   1.00 0.00 ? 16  GLY A HA2  6  
ATOM 8690  H HA3  . GLY A 1 16  ? -0.317  8.871   3.355   1.00 0.00 ? 16  GLY A HA3  6  
ATOM 8691  N N    . VAL A 1 17  ? 1.180   6.393   3.265   1.00 0.00 ? 17  VAL A N    6  
ATOM 8692  C CA   . VAL A 1 17  ? 1.287   4.968   2.976   1.00 0.00 ? 17  VAL A CA   6  
ATOM 8693  C C    . VAL A 1 17  ? -0.088  4.345   2.765   1.00 0.00 ? 17  VAL A C    6  
ATOM 8694  O O    . VAL A 1 17  ? -1.092  4.795   3.318   1.00 0.00 ? 17  VAL A O    6  
ATOM 8695  C CB   . VAL A 1 17  ? 2.010   4.218   4.111   1.00 0.00 ? 17  VAL A CB   6  
ATOM 8696  C CG1  . VAL A 1 17  ? 3.359   4.859   4.400   1.00 0.00 ? 17  VAL A CG1  6  
ATOM 8697  C CG2  . VAL A 1 17  ? 1.146   4.186   5.362   1.00 0.00 ? 17  VAL A CG2  6  
ATOM 8698  H H    . VAL A 1 17  ? 1.504   6.732   4.126   1.00 0.00 ? 17  VAL A H    6  
ATOM 8699  H HA   . VAL A 1 17  ? 1.866   4.854   2.071   1.00 0.00 ? 17  VAL A HA   6  
ATOM 8700  H HB   . VAL A 1 17  ? 2.181   3.201   3.791   1.00 0.00 ? 17  VAL A HB   6  
ATOM 8701  H HG11 . VAL A 1 17  ? 3.536   4.859   5.466   1.00 0.00 ? 17  VAL A HG11 6  
ATOM 8702  H HG12 . VAL A 1 17  ? 4.138   4.299   3.905   1.00 0.00 ? 17  VAL A HG12 6  
ATOM 8703  H HG13 . VAL A 1 17  ? 3.359   5.876   4.037   1.00 0.00 ? 17  VAL A HG13 6  
ATOM 8704  H HG21 . VAL A 1 17  ? 0.984   3.161   5.661   1.00 0.00 ? 17  VAL A HG21 6  
ATOM 8705  H HG22 . VAL A 1 17  ? 1.646   4.718   6.159   1.00 0.00 ? 17  VAL A HG22 6  
ATOM 8706  H HG23 . VAL A 1 17  ? 0.196   4.656   5.157   1.00 0.00 ? 17  VAL A HG23 6  
ATOM 8707  N N    . PRO A 1 18  ? -0.137  3.283   1.948   1.00 0.00 ? 18  PRO A N    6  
ATOM 8708  C CA   . PRO A 1 18  ? -1.384  2.574   1.645   1.00 0.00 ? 18  PRO A CA   6  
ATOM 8709  C C    . PRO A 1 18  ? -1.915  1.798   2.846   1.00 0.00 ? 18  PRO A C    6  
ATOM 8710  O O    . PRO A 1 18  ? -1.145  1.302   3.667   1.00 0.00 ? 18  PRO A O    6  
ATOM 8711  C CB   . PRO A 1 18  ? -0.983  1.614   0.523   1.00 0.00 ? 18  PRO A CB   6  
ATOM 8712  C CG   . PRO A 1 18  ? 0.479   1.399   0.712   1.00 0.00 ? 18  PRO A CG   6  
ATOM 8713  C CD   . PRO A 1 18  ? 1.020   2.693   1.255   1.00 0.00 ? 18  PRO A CD   6  
ATOM 8714  H HA   . PRO A 1 18  ? -2.148  3.249   1.289   1.00 0.00 ? 18  PRO A HA   6  
ATOM 8715  H HB2  . PRO A 1 18  ? -1.536  0.690   0.621   1.00 0.00 ? 18  PRO A HB2  6  
ATOM 8716  H HB3  . PRO A 1 18  ? -1.195  2.066   -0.435  1.00 0.00 ? 18  PRO A HB3  6  
ATOM 8717  H HG2  . PRO A 1 18  ? 0.644   0.598   1.416   1.00 0.00 ? 18  PRO A HG2  6  
ATOM 8718  H HG3  . PRO A 1 18  ? 0.941   1.169   -0.236  1.00 0.00 ? 18  PRO A HG3  6  
ATOM 8719  H HD2  . PRO A 1 18  ? 1.828   2.503   1.947   1.00 0.00 ? 18  PRO A HD2  6  
ATOM 8720  H HD3  . PRO A 1 18  ? 1.353   3.330   0.450   1.00 0.00 ? 18  PRO A HD3  6  
ATOM 8721  N N    . GLY A 1 19  ? -3.237  1.696   2.941   1.00 0.00 ? 19  GLY A N    6  
ATOM 8722  C CA   . GLY A 1 19  ? -3.848  0.978   4.045   1.00 0.00 ? 19  GLY A CA   6  
ATOM 8723  C C    . GLY A 1 19  ? -4.081  -0.486  3.726   1.00 0.00 ? 19  GLY A C    6  
ATOM 8724  O O    . GLY A 1 19  ? -4.657  -0.817  2.690   1.00 0.00 ? 19  GLY A O    6  
ATOM 8725  H H    . GLY A 1 19  ? -3.803  2.112   2.257   1.00 0.00 ? 19  GLY A H    6  
ATOM 8726  H HA2  . GLY A 1 19  ? -3.203  1.049   4.908   1.00 0.00 ? 19  GLY A HA2  6  
ATOM 8727  H HA3  . GLY A 1 19  ? -4.797  1.439   4.278   1.00 0.00 ? 19  GLY A HA3  6  
ATOM 8728  N N    . GLN A 1 20  ? -3.631  -1.363  4.618   1.00 0.00 ? 20  GLN A N    6  
ATOM 8729  C CA   . GLN A 1 20  ? -3.792  -2.799  4.424   1.00 0.00 ? 20  GLN A CA   6  
ATOM 8730  C C    . GLN A 1 20  ? -5.107  -3.109  3.716   1.00 0.00 ? 20  GLN A C    6  
ATOM 8731  O O    . GLN A 1 20  ? -6.116  -2.429  3.904   1.00 0.00 ? 20  GLN A O    6  
ATOM 8732  C CB   . GLN A 1 20  ? -3.740  -3.525  5.769   1.00 0.00 ? 20  GLN A CB   6  
ATOM 8733  C CG   . GLN A 1 20  ? -4.927  -3.225  6.670   1.00 0.00 ? 20  GLN A CG   6  
ATOM 8734  C CD   . GLN A 1 20  ? -4.644  -3.525  8.128   1.00 0.00 ? 20  GLN A CD   6  
ATOM 8735  O OE1  . GLN A 1 20  ? -3.803  -2.880  8.755   1.00 0.00 ? 20  GLN A OE1  6  
ATOM 8736  N NE2  . GLN A 1 20  ? -5.346  -4.509  8.678   1.00 0.00 ? 20  GLN A NE2  6  
ATOM 8737  H H    . GLN A 1 20  ? -3.180  -1.037  5.424   1.00 0.00 ? 20  GLN A H    6  
ATOM 8738  H HA   . GLN A 1 20  ? -2.976  -3.144  3.807   1.00 0.00 ? 20  GLN A HA   6  
ATOM 8739  H HB2  . GLN A 1 20  ? -3.712  -4.590  5.589   1.00 0.00 ? 20  GLN A HB2  6  
ATOM 8740  H HB3  . GLN A 1 20  ? -2.839  -3.232  6.288   1.00 0.00 ? 20  GLN A HB3  6  
ATOM 8741  H HG2  . GLN A 1 20  ? -5.178  -2.178  6.576   1.00 0.00 ? 20  GLN A HG2  6  
ATOM 8742  H HG3  . GLN A 1 20  ? -5.766  -3.825  6.350   1.00 0.00 ? 20  GLN A HG3  6  
ATOM 8743  H HE21 . GLN A 1 20  ? -5.998  -4.981  8.117   1.00 0.00 ? 20  GLN A HE21 6  
ATOM 8744  H HE22 . GLN A 1 20  ? -5.183  -4.725  9.618   1.00 0.00 ? 20  GLN A HE22 6  
ATOM 8745  N N    . PRO A 1 21  ? -5.098  -4.159  2.883   1.00 0.00 ? 21  PRO A N    6  
ATOM 8746  C CA   . PRO A 1 21  ? -6.282  -4.583  2.130   1.00 0.00 ? 21  PRO A CA   6  
ATOM 8747  C C    . PRO A 1 21  ? -7.357  -5.183  3.030   1.00 0.00 ? 21  PRO A C    6  
ATOM 8748  O O    . PRO A 1 21  ? -7.209  -5.218  4.253   1.00 0.00 ? 21  PRO A O    6  
ATOM 8749  C CB   . PRO A 1 21  ? -5.733  -5.645  1.173   1.00 0.00 ? 21  PRO A CB   6  
ATOM 8750  C CG   . PRO A 1 21  ? -4.516  -6.172  1.851   1.00 0.00 ? 21  PRO A CG   6  
ATOM 8751  C CD   . PRO A 1 21  ? -3.930  -5.015  2.611   1.00 0.00 ? 21  PRO A CD   6  
ATOM 8752  H HA   . PRO A 1 21  ? -6.704  -3.768  1.562   1.00 0.00 ? 21  PRO A HA   6  
ATOM 8753  H HB2  . PRO A 1 21  ? -6.473  -6.419  1.028   1.00 0.00 ? 21  PRO A HB2  6  
ATOM 8754  H HB3  . PRO A 1 21  ? -5.491  -5.189  0.225   1.00 0.00 ? 21  PRO A HB3  6  
ATOM 8755  H HG2  . PRO A 1 21  ? -4.788  -6.967  2.529   1.00 0.00 ? 21  PRO A HG2  6  
ATOM 8756  H HG3  . PRO A 1 21  ? -3.812  -6.531  1.114   1.00 0.00 ? 21  PRO A HG3  6  
ATOM 8757  H HD2  . PRO A 1 21  ? -3.480  -5.357  3.531   1.00 0.00 ? 21  PRO A HD2  6  
ATOM 8758  H HD3  . PRO A 1 21  ? -3.204  -4.494  2.004   1.00 0.00 ? 21  PRO A HD3  6  
ATOM 8759  N N    . LEU A 1 22  ? -8.438  -5.654  2.419   1.00 0.00 ? 22  LEU A N    6  
ATOM 8760  C CA   . LEU A 1 22  ? -9.539  -6.253  3.166   1.00 0.00 ? 22  LEU A CA   6  
ATOM 8761  C C    . LEU A 1 22  ? -9.867  -7.644  2.631   1.00 0.00 ? 22  LEU A C    6  
ATOM 8762  O O    . LEU A 1 22  ? -9.275  -8.099  1.653   1.00 0.00 ? 22  LEU A O    6  
ATOM 8763  C CB   . LEU A 1 22  ? -10.778 -5.360  3.091   1.00 0.00 ? 22  LEU A CB   6  
ATOM 8764  C CG   . LEU A 1 22  ? -10.624 -3.948  3.656   1.00 0.00 ? 22  LEU A CG   6  
ATOM 8765  C CD1  . LEU A 1 22  ? -11.745 -3.048  3.160   1.00 0.00 ? 22  LEU A CD1  6  
ATOM 8766  C CD2  . LEU A 1 22  ? -10.599 -3.982  5.177   1.00 0.00 ? 22  LEU A CD2  6  
ATOM 8767  H H    . LEU A 1 22  ? -8.499  -5.598  1.443   1.00 0.00 ? 22  LEU A H    6  
ATOM 8768  H HA   . LEU A 1 22  ? -9.231  -6.341  4.197   1.00 0.00 ? 22  LEU A HA   6  
ATOM 8769  H HB2  . LEU A 1 22  ? -11.059 -5.271  2.053   1.00 0.00 ? 22  LEU A HB2  6  
ATOM 8770  H HB3  . LEU A 1 22  ? -11.572 -5.851  3.636   1.00 0.00 ? 22  LEU A HB3  6  
ATOM 8771  H HG   . LEU A 1 22  ? -9.686  -3.531  3.315   1.00 0.00 ? 22  LEU A HG   6  
ATOM 8772  H HD11 . LEU A 1 22  ? -12.671 -3.602  3.145   1.00 0.00 ? 22  LEU A HD11 6  
ATOM 8773  H HD12 . LEU A 1 22  ? -11.515 -2.703  2.163   1.00 0.00 ? 22  LEU A HD12 6  
ATOM 8774  H HD13 . LEU A 1 22  ? -11.843 -2.199  3.820   1.00 0.00 ? 22  LEU A HD13 6  
ATOM 8775  H HD21 . LEU A 1 22  ? -11.503 -4.447  5.541   1.00 0.00 ? 22  LEU A HD21 6  
ATOM 8776  H HD22 . LEU A 1 22  ? -10.533 -2.974  5.559   1.00 0.00 ? 22  LEU A HD22 6  
ATOM 8777  H HD23 . LEU A 1 22  ? -9.743  -4.550  5.511   1.00 0.00 ? 22  LEU A HD23 6  
ATOM 8778  N N    . ASN A 1 23  ? -10.816 -8.313  3.278   1.00 0.00 ? 23  ASN A N    6  
ATOM 8779  C CA   . ASN A 1 23  ? -11.224 -9.651  2.866   1.00 0.00 ? 23  ASN A CA   6  
ATOM 8780  C C    . ASN A 1 23  ? -10.008 -10.532 2.597   1.00 0.00 ? 23  ASN A C    6  
ATOM 8781  O O    . ASN A 1 23  ? -9.954  -11.245 1.595   1.00 0.00 ? 23  ASN A O    6  
ATOM 8782  C CB   . ASN A 1 23  ? -12.101 -9.576  1.615   1.00 0.00 ? 23  ASN A CB   6  
ATOM 8783  C CG   . ASN A 1 23  ? -13.428 -8.893  1.879   1.00 0.00 ? 23  ASN A CG   6  
ATOM 8784  O OD1  . ASN A 1 23  ? -14.410 -9.539  2.247   1.00 0.00 ? 23  ASN A OD1  6  
ATOM 8785  N ND2  . ASN A 1 23  ? -13.465 -7.579  1.691   1.00 0.00 ? 23  ASN A ND2  6  
ATOM 8786  H H    . ASN A 1 23  ? -11.252 -7.897  4.051   1.00 0.00 ? 23  ASN A H    6  
ATOM 8787  H HA   . ASN A 1 23  ? -11.797 -10.085 3.671   1.00 0.00 ? 23  ASN A HA   6  
ATOM 8788  H HB2  . ASN A 1 23  ? -11.578 -9.021  0.849   1.00 0.00 ? 23  ASN A HB2  6  
ATOM 8789  H HB3  . ASN A 1 23  ? -12.296 -10.577 1.259   1.00 0.00 ? 23  ASN A HB3  6  
ATOM 8790  H HD21 . ASN A 1 23  ? -12.645 -7.130  1.396   1.00 0.00 ? 23  ASN A HD21 6  
ATOM 8791  H HD22 . ASN A 1 23  ? -14.310 -7.111  1.855   1.00 0.00 ? 23  ASN A HD22 6  
ATOM 8792  N N    . PHE A 1 24  ? -9.033  -10.477 3.499   1.00 0.00 ? 24  PHE A N    6  
ATOM 8793  C CA   . PHE A 1 24  ? -7.817  -11.269 3.359   1.00 0.00 ? 24  PHE A CA   6  
ATOM 8794  C C    . PHE A 1 24  ? -8.011  -12.669 3.934   1.00 0.00 ? 24  PHE A C    6  
ATOM 8795  O O    . PHE A 1 24  ? -8.218  -12.836 5.136   1.00 0.00 ? 24  PHE A O    6  
ATOM 8796  C CB   . PHE A 1 24  ? -6.647  -10.575 4.060   1.00 0.00 ? 24  PHE A CB   6  
ATOM 8797  C CG   . PHE A 1 24  ? -5.328  -11.261 3.846   1.00 0.00 ? 24  PHE A CG   6  
ATOM 8798  C CD1  . PHE A 1 24  ? -4.886  -11.557 2.566   1.00 0.00 ? 24  PHE A CD1  6  
ATOM 8799  C CD2  . PHE A 1 24  ? -4.530  -11.608 4.924   1.00 0.00 ? 24  PHE A CD2  6  
ATOM 8800  C CE1  . PHE A 1 24  ? -3.673  -12.188 2.367   1.00 0.00 ? 24  PHE A CE1  6  
ATOM 8801  C CE2  . PHE A 1 24  ? -3.316  -12.239 4.730   1.00 0.00 ? 24  PHE A CE2  6  
ATOM 8802  C CZ   . PHE A 1 24  ? -2.886  -12.529 3.450   1.00 0.00 ? 24  PHE A CZ   6  
ATOM 8803  H H    . PHE A 1 24  ? -9.134  -9.889  4.277   1.00 0.00 ? 24  PHE A H    6  
ATOM 8804  H HA   . PHE A 1 24  ? -7.596  -11.353 2.306   1.00 0.00 ? 24  PHE A HA   6  
ATOM 8805  H HB2  . PHE A 1 24  ? -6.561  -9.566  3.686   1.00 0.00 ? 24  PHE A HB2  6  
ATOM 8806  H HB3  . PHE A 1 24  ? -6.839  -10.546 5.122   1.00 0.00 ? 24  PHE A HB3  6  
ATOM 8807  H HD1  . PHE A 1 24  ? -5.499  -11.290 1.718   1.00 0.00 ? 24  PHE A HD1  6  
ATOM 8808  H HD2  . PHE A 1 24  ? -4.865  -11.382 5.926   1.00 0.00 ? 24  PHE A HD2  6  
ATOM 8809  H HE1  . PHE A 1 24  ? -3.339  -12.413 1.365   1.00 0.00 ? 24  PHE A HE1  6  
ATOM 8810  H HE2  . PHE A 1 24  ? -2.703  -12.504 5.579   1.00 0.00 ? 24  PHE A HE2  6  
ATOM 8811  H HZ   . PHE A 1 24  ? -1.938  -13.022 3.296   1.00 0.00 ? 24  PHE A HZ   6  
ATOM 8812  N N    . LYS A 1 25  ? -7.942  -13.674 3.067   1.00 0.00 ? 25  LYS A N    6  
ATOM 8813  C CA   . LYS A 1 25  ? -8.109  -15.060 3.486   1.00 0.00 ? 25  LYS A CA   6  
ATOM 8814  C C    . LYS A 1 25  ? -7.091  -15.963 2.797   1.00 0.00 ? 25  LYS A C    6  
ATOM 8815  O O    . LYS A 1 25  ? -6.383  -15.534 1.887   1.00 0.00 ? 25  LYS A O    6  
ATOM 8816  C CB   . LYS A 1 25  ? -9.528  -15.542 3.174   1.00 0.00 ? 25  LYS A CB   6  
ATOM 8817  C CG   . LYS A 1 25  ? -9.755  -15.852 1.705   1.00 0.00 ? 25  LYS A CG   6  
ATOM 8818  C CD   . LYS A 1 25  ? -11.231 -16.038 1.396   1.00 0.00 ? 25  LYS A CD   6  
ATOM 8819  C CE   . LYS A 1 25  ? -11.976 -14.712 1.417   1.00 0.00 ? 25  LYS A CE   6  
ATOM 8820  N NZ   . LYS A 1 25  ? -13.440 -14.895 1.215   1.00 0.00 ? 25  LYS A NZ   6  
ATOM 8821  H H    . LYS A 1 25  ? -7.774  -13.477 2.121   1.00 0.00 ? 25  LYS A H    6  
ATOM 8822  H HA   . LYS A 1 25  ? -7.949  -15.106 4.553   1.00 0.00 ? 25  LYS A HA   6  
ATOM 8823  H HB2  . LYS A 1 25  ? -9.725  -16.437 3.745   1.00 0.00 ? 25  LYS A HB2  6  
ATOM 8824  H HB3  . LYS A 1 25  ? -10.229 -14.775 3.471   1.00 0.00 ? 25  LYS A HB3  6  
ATOM 8825  H HG2  . LYS A 1 25  ? -9.374  -15.036 1.110   1.00 0.00 ? 25  LYS A HG2  6  
ATOM 8826  H HG3  . LYS A 1 25  ? -9.227  -16.761 1.453   1.00 0.00 ? 25  LYS A HG3  6  
ATOM 8827  H HD2  . LYS A 1 25  ? -11.332 -16.479 0.416   1.00 0.00 ? 25  LYS A HD2  6  
ATOM 8828  H HD3  . LYS A 1 25  ? -11.665 -16.696 2.136   1.00 0.00 ? 25  LYS A HD3  6  
ATOM 8829  H HE2  . LYS A 1 25  ? -11.810 -14.236 2.371   1.00 0.00 ? 25  LYS A HE2  6  
ATOM 8830  H HE3  . LYS A 1 25  ? -11.588 -14.084 0.629   1.00 0.00 ? 25  LYS A HE3  6  
ATOM 8831  H HZ1  . LYS A 1 25  ? -13.826 -15.522 1.949   1.00 0.00 ? 25  LYS A HZ1  6  
ATOM 8832  H HZ2  . LYS A 1 25  ? -13.621 -15.318 0.283   1.00 0.00 ? 25  LYS A HZ2  6  
ATOM 8833  H HZ3  . LYS A 1 25  ? -13.925 -13.977 1.267   1.00 0.00 ? 25  LYS A HZ3  6  
ATOM 8834  N N    . ALA A 1 26  ? -7.025  -17.216 3.237   1.00 0.00 ? 26  ALA A N    6  
ATOM 8835  C CA   . ALA A 1 26  ? -6.096  -18.180 2.659   1.00 0.00 ? 26  ALA A CA   6  
ATOM 8836  C C    . ALA A 1 26  ? -6.820  -19.452 2.234   1.00 0.00 ? 26  ALA A C    6  
ATOM 8837  O O    . ALA A 1 26  ? -7.666  -19.969 2.964   1.00 0.00 ? 26  ALA A O    6  
ATOM 8838  C CB   . ALA A 1 26  ? -4.990  -18.506 3.652   1.00 0.00 ? 26  ALA A CB   6  
ATOM 8839  H H    . ALA A 1 26  ? -7.616  -17.498 3.965   1.00 0.00 ? 26  ALA A H    6  
ATOM 8840  H HA   . ALA A 1 26  ? -5.644  -17.727 1.789   1.00 0.00 ? 26  ALA A HA   6  
ATOM 8841  H HB1  . ALA A 1 26  ? -4.693  -17.604 4.167   1.00 0.00 ? 26  ALA A HB1  6  
ATOM 8842  H HB2  . ALA A 1 26  ? -5.351  -19.229 4.368   1.00 0.00 ? 26  ALA A HB2  6  
ATOM 8843  H HB3  . ALA A 1 26  ? -4.142  -18.915 3.123   1.00 0.00 ? 26  ALA A HB3  6  
ATOM 8844  N N    . GLU A 1 27  ? -6.483  -19.952 1.049   1.00 0.00 ? 27  GLU A N    6  
ATOM 8845  C CA   . GLU A 1 27  ? -7.104  -21.164 0.527   1.00 0.00 ? 27  GLU A CA   6  
ATOM 8846  C C    . GLU A 1 27  ? -6.107  -21.973 -0.299  1.00 0.00 ? 27  GLU A C    6  
ATOM 8847  O O    . GLU A 1 27  ? -5.601  -21.520 -1.326  1.00 0.00 ? 27  GLU A O    6  
ATOM 8848  C CB   . GLU A 1 27  ? -8.323  -20.812 -0.327  1.00 0.00 ? 27  GLU A CB   6  
ATOM 8849  C CG   . GLU A 1 27  ? -9.356  -19.970 0.404   1.00 0.00 ? 27  GLU A CG   6  
ATOM 8850  C CD   . GLU A 1 27  ? -10.542 -19.613 -0.471  1.00 0.00 ? 27  GLU A CD   6  
ATOM 8851  O OE1  . GLU A 1 27  ? -11.472 -20.440 -0.577  1.00 0.00 ? 27  GLU A OE1  6  
ATOM 8852  O OE2  . GLU A 1 27  ? -10.541 -18.506 -1.049  1.00 0.00 ? 27  GLU A OE2  6  
ATOM 8853  H H    . GLU A 1 27  ? -5.802  -19.494 0.513   1.00 0.00 ? 27  GLU A H    6  
ATOM 8854  H HA   . GLU A 1 27  ? -7.425  -21.760 1.367   1.00 0.00 ? 27  GLU A HA   6  
ATOM 8855  H HB2  . GLU A 1 27  ? -7.993  -20.264 -1.197  1.00 0.00 ? 27  GLU A HB2  6  
ATOM 8856  H HB3  . GLU A 1 27  ? -8.798  -21.727 -0.649  1.00 0.00 ? 27  GLU A HB3  6  
ATOM 8857  H HG2  . GLU A 1 27  ? -9.713  -20.524 1.259   1.00 0.00 ? 27  GLU A HG2  6  
ATOM 8858  H HG3  . GLU A 1 27  ? -8.886  -19.057 0.738   1.00 0.00 ? 27  GLU A HG3  6  
ATOM 8859  N N    . PRO A 1 28  ? -5.818  -23.199 0.160   1.00 0.00 ? 28  PRO A N    6  
ATOM 8860  C CA   . PRO A 1 28  ? -4.880  -24.098 -0.520  1.00 0.00 ? 28  PRO A CA   6  
ATOM 8861  C C    . PRO A 1 28  ? -5.431  -24.616 -1.844  1.00 0.00 ? 28  PRO A C    6  
ATOM 8862  O O    . PRO A 1 28  ? -6.279  -25.507 -1.867  1.00 0.00 ? 28  PRO A O    6  
ATOM 8863  C CB   . PRO A 1 28  ? -4.707  -25.249 0.475   1.00 0.00 ? 28  PRO A CB   6  
ATOM 8864  C CG   . PRO A 1 28  ? -5.959  -25.243 1.282   1.00 0.00 ? 28  PRO A CG   6  
ATOM 8865  C CD   . PRO A 1 28  ? -6.384  -23.804 1.378   1.00 0.00 ? 28  PRO A CD   6  
ATOM 8866  H HA   . PRO A 1 28  ? -3.926  -23.621 -0.690  1.00 0.00 ? 28  PRO A HA   6  
ATOM 8867  H HB2  . PRO A 1 28  ? -4.587  -26.178 -0.064  1.00 0.00 ? 28  PRO A HB2  6  
ATOM 8868  H HB3  . PRO A 1 28  ? -3.839  -25.069 1.091   1.00 0.00 ? 28  PRO A HB3  6  
ATOM 8869  H HG2  . PRO A 1 28  ? -6.719  -25.826 0.785   1.00 0.00 ? 28  PRO A HG2  6  
ATOM 8870  H HG3  . PRO A 1 28  ? -5.762  -25.642 2.266   1.00 0.00 ? 28  PRO A HG3  6  
ATOM 8871  H HD2  . PRO A 1 28  ? -7.461  -23.728 1.381   1.00 0.00 ? 28  PRO A HD2  6  
ATOM 8872  H HD3  . PRO A 1 28  ? -5.968  -23.346 2.264   1.00 0.00 ? 28  PRO A HD3  6  
ATOM 8873  N N    . GLU A 1 29  ? -4.942  -24.053 -2.944  1.00 0.00 ? 29  GLU A N    6  
ATOM 8874  C CA   . GLU A 1 29  ? -5.387  -24.459 -4.272  1.00 0.00 ? 29  GLU A CA   6  
ATOM 8875  C C    . GLU A 1 29  ? -4.806  -25.820 -4.648  1.00 0.00 ? 29  GLU A C    6  
ATOM 8876  O O    . GLU A 1 29  ? -5.335  -26.515 -5.515  1.00 0.00 ? 29  GLU A O    6  
ATOM 8877  C CB   . GLU A 1 29  ? -4.981  -23.414 -5.313  1.00 0.00 ? 29  GLU A CB   6  
ATOM 8878  C CG   . GLU A 1 29  ? -3.487  -23.138 -5.347  1.00 0.00 ? 29  GLU A CG   6  
ATOM 8879  C CD   . GLU A 1 29  ? -3.074  -22.309 -6.548  1.00 0.00 ? 29  GLU A CD   6  
ATOM 8880  O OE1  . GLU A 1 29  ? -3.916  -21.538 -7.055  1.00 0.00 ? 29  GLU A OE1  6  
ATOM 8881  O OE2  . GLU A 1 29  ? -1.909  -22.430 -6.980  1.00 0.00 ? 29  GLU A OE2  6  
ATOM 8882  H H    . GLU A 1 29  ? -4.267  -23.347 -2.861  1.00 0.00 ? 29  GLU A H    6  
ATOM 8883  H HA   . GLU A 1 29  ? -6.464  -24.535 -4.252  1.00 0.00 ? 29  GLU A HA   6  
ATOM 8884  H HB2  . GLU A 1 29  ? -5.285  -23.759 -6.290  1.00 0.00 ? 29  GLU A HB2  6  
ATOM 8885  H HB3  . GLU A 1 29  ? -5.491  -22.488 -5.093  1.00 0.00 ? 29  GLU A HB3  6  
ATOM 8886  H HG2  . GLU A 1 29  ? -3.211  -22.605 -4.449  1.00 0.00 ? 29  GLU A HG2  6  
ATOM 8887  H HG3  . GLU A 1 29  ? -2.960  -24.081 -5.381  1.00 0.00 ? 29  GLU A HG3  6  
ATOM 8888  N N    . SER A 1 30  ? -3.714  -26.192 -3.989  1.00 0.00 ? 30  SER A N    6  
ATOM 8889  C CA   . SER A 1 30  ? -3.057  -27.467 -4.256  1.00 0.00 ? 30  SER A CA   6  
ATOM 8890  C C    . SER A 1 30  ? -2.200  -27.895 -3.069  1.00 0.00 ? 30  SER A C    6  
ATOM 8891  O O    . SER A 1 30  ? -2.160  -27.219 -2.042  1.00 0.00 ? 30  SER A O    6  
ATOM 8892  C CB   . SER A 1 30  ? -2.193  -27.366 -5.514  1.00 0.00 ? 30  SER A CB   6  
ATOM 8893  O OG   . SER A 1 30  ? -2.904  -26.747 -6.573  1.00 0.00 ? 30  SER A OG   6  
ATOM 8894  H H    . SER A 1 30  ? -3.339  -25.594 -3.308  1.00 0.00 ? 30  SER A H    6  
ATOM 8895  H HA   . SER A 1 30  ? -3.826  -28.208 -4.416  1.00 0.00 ? 30  SER A HA   6  
ATOM 8896  H HB2  . SER A 1 30  ? -1.313  -26.779 -5.297  1.00 0.00 ? 30  SER A HB2  6  
ATOM 8897  H HB3  . SER A 1 30  ? -1.897  -28.357 -5.825  1.00 0.00 ? 30  SER A HB3  6  
ATOM 8898  H HG   . SER A 1 30  ? -3.635  -27.310 -6.839  1.00 0.00 ? 30  SER A HG   6  
ATOM 8899  N N    . GLU A 1 31  ? -1.515  -29.025 -3.219  1.00 0.00 ? 31  GLU A N    6  
ATOM 8900  C CA   . GLU A 1 31  ? -0.659  -29.545 -2.159  1.00 0.00 ? 31  GLU A CA   6  
ATOM 8901  C C    . GLU A 1 31  ? 0.666   -28.789 -2.110  1.00 0.00 ? 31  GLU A C    6  
ATOM 8902  O O    . GLU A 1 31  ? 1.297   -28.685 -1.058  1.00 0.00 ? 31  GLU A O    6  
ATOM 8903  C CB   . GLU A 1 31  ? -0.399  -31.038 -2.369  1.00 0.00 ? 31  GLU A CB   6  
ATOM 8904  C CG   . GLU A 1 31  ? 0.628   -31.331 -3.450  1.00 0.00 ? 31  GLU A CG   6  
ATOM 8905  C CD   . GLU A 1 31  ? 0.138   -30.962 -4.836  1.00 0.00 ? 31  GLU A CD   6  
ATOM 8906  O OE1  . GLU A 1 31  ? -0.877  -31.538 -5.280  1.00 0.00 ? 31  GLU A OE1  6  
ATOM 8907  O OE2  . GLU A 1 31  ? 0.770   -30.096 -5.477  1.00 0.00 ? 31  GLU A OE2  6  
ATOM 8908  H H    . GLU A 1 31  ? -1.588  -29.520 -4.061  1.00 0.00 ? 31  GLU A H    6  
ATOM 8909  H HA   . GLU A 1 31  ? -1.173  -29.407 -1.220  1.00 0.00 ? 31  GLU A HA   6  
ATOM 8910  H HB2  . GLU A 1 31  ? -0.048  -31.464 -1.441  1.00 0.00 ? 31  GLU A HB2  6  
ATOM 8911  H HB3  . GLU A 1 31  ? -1.327  -31.517 -2.645  1.00 0.00 ? 31  GLU A HB3  6  
ATOM 8912  H HG2  . GLU A 1 31  ? 1.524   -30.767 -3.239  1.00 0.00 ? 31  GLU A HG2  6  
ATOM 8913  H HG3  . GLU A 1 31  ? 0.857   -32.387 -3.434  1.00 0.00 ? 31  GLU A HG3  6  
ATOM 8914  N N    . THR A 1 32  ? 1.084   -28.263 -3.258  1.00 0.00 ? 32  THR A N    6  
ATOM 8915  C CA   . THR A 1 32  ? 2.333   -27.519 -3.348  1.00 0.00 ? 32  THR A CA   6  
ATOM 8916  C C    . THR A 1 32  ? 2.086   -26.079 -3.782  1.00 0.00 ? 32  THR A C    6  
ATOM 8917  O O    . THR A 1 32  ? 3.025   -25.336 -4.067  1.00 0.00 ? 32  THR A O    6  
ATOM 8918  C CB   . THR A 1 32  ? 3.311   -28.181 -4.337  1.00 0.00 ? 32  THR A CB   6  
ATOM 8919  O OG1  . THR A 1 32  ? 2.679   -28.353 -5.610  1.00 0.00 ? 32  THR A OG1  6  
ATOM 8920  C CG2  . THR A 1 32  ? 3.782   -29.529 -3.812  1.00 0.00 ? 32  THR A CG2  6  
ATOM 8921  H H    . THR A 1 32  ? 0.537   -28.381 -4.063  1.00 0.00 ? 32  THR A H    6  
ATOM 8922  H HA   . THR A 1 32  ? 2.791   -27.516 -2.369  1.00 0.00 ? 32  THR A HA   6  
ATOM 8923  H HB   . THR A 1 32  ? 4.172   -27.537 -4.454  1.00 0.00 ? 32  THR A HB   6  
ATOM 8924  H HG1  . THR A 1 32  ? 2.057   -27.636 -5.758  1.00 0.00 ? 32  THR A HG1  6  
ATOM 8925  H HG21 . THR A 1 32  ? 3.320   -29.724 -2.855  1.00 0.00 ? 32  THR A HG21 6  
ATOM 8926  H HG22 . THR A 1 32  ? 4.855   -29.517 -3.699  1.00 0.00 ? 32  THR A HG22 6  
ATOM 8927  H HG23 . THR A 1 32  ? 3.502   -30.304 -4.511  1.00 0.00 ? 32  THR A HG23 6  
ATOM 8928  N N    . SER A 1 33  ? 0.816   -25.691 -3.831  1.00 0.00 ? 33  SER A N    6  
ATOM 8929  C CA   . SER A 1 33  ? 0.444   -24.340 -4.235  1.00 0.00 ? 33  SER A CA   6  
ATOM 8930  C C    . SER A 1 33  ? -0.691  -23.806 -3.367  1.00 0.00 ? 33  SER A C    6  
ATOM 8931  O O    . SER A 1 33  ? -1.498  -24.573 -2.841  1.00 0.00 ? 33  SER A O    6  
ATOM 8932  C CB   . SER A 1 33  ? 0.028   -24.320 -5.707  1.00 0.00 ? 33  SER A CB   6  
ATOM 8933  O OG   . SER A 1 33  ? 1.029   -24.897 -6.527  1.00 0.00 ? 33  SER A OG   6  
ATOM 8934  H H    . SER A 1 33  ? 0.111   -26.330 -3.593  1.00 0.00 ? 33  SER A H    6  
ATOM 8935  H HA   . SER A 1 33  ? 1.309   -23.706 -4.105  1.00 0.00 ? 33  SER A HA   6  
ATOM 8936  H HB2  . SER A 1 33  ? -0.886  -24.880 -5.827  1.00 0.00 ? 33  SER A HB2  6  
ATOM 8937  H HB3  . SER A 1 33  ? -0.131  -23.298 -6.019  1.00 0.00 ? 33  SER A HB3  6  
ATOM 8938  H HG   . SER A 1 33  ? 0.619   -25.311 -7.290  1.00 0.00 ? 33  SER A HG   6  
ATOM 8939  N N    . ILE A 1 34  ? -0.747  -22.487 -3.221  1.00 0.00 ? 34  ILE A N    6  
ATOM 8940  C CA   . ILE A 1 34  ? -1.783  -21.850 -2.418  1.00 0.00 ? 34  ILE A CA   6  
ATOM 8941  C C    . ILE A 1 34  ? -2.223  -20.527 -3.037  1.00 0.00 ? 34  ILE A C    6  
ATOM 8942  O O    . ILE A 1 34  ? -1.393  -19.719 -3.456  1.00 0.00 ? 34  ILE A O    6  
ATOM 8943  C CB   . ILE A 1 34  ? -1.302  -21.595 -0.978  1.00 0.00 ? 34  ILE A CB   6  
ATOM 8944  C CG1  . ILE A 1 34  ? -0.895  -22.912 -0.313  1.00 0.00 ? 34  ILE A CG1  6  
ATOM 8945  C CG2  . ILE A 1 34  ? -2.390  -20.903 -0.171  1.00 0.00 ? 34  ILE A CG2  6  
ATOM 8946  C CD1  . ILE A 1 34  ? -0.352  -22.738 1.088   1.00 0.00 ? 34  ILE A CD1  6  
ATOM 8947  H H    . ILE A 1 34  ? -0.075  -21.928 -3.665  1.00 0.00 ? 34  ILE A H    6  
ATOM 8948  H HA   . ILE A 1 34  ? -2.632  -22.517 -2.381  1.00 0.00 ? 34  ILE A HA   6  
ATOM 8949  H HB   . ILE A 1 34  ? -0.446  -20.940 -1.018  1.00 0.00 ? 34  ILE A HB   6  
ATOM 8950  H HG12 . ILE A 1 34  ? -1.754  -23.561 -0.257  1.00 0.00 ? 34  ILE A HG12 6  
ATOM 8951  H HG13 . ILE A 1 34  ? -0.129  -23.386 -0.910  1.00 0.00 ? 34  ILE A HG13 6  
ATOM 8952  H HG21 . ILE A 1 34  ? -3.303  -20.874 -0.748  1.00 0.00 ? 34  ILE A HG21 6  
ATOM 8953  H HG22 . ILE A 1 34  ? -2.561  -21.448 0.745   1.00 0.00 ? 34  ILE A HG22 6  
ATOM 8954  H HG23 . ILE A 1 34  ? -2.080  -19.895 0.063   1.00 0.00 ? 34  ILE A HG23 6  
ATOM 8955  H HD11 . ILE A 1 34  ? -0.794  -23.477 1.740   1.00 0.00 ? 34  ILE A HD11 6  
ATOM 8956  H HD12 . ILE A 1 34  ? 0.720   -22.861 1.077   1.00 0.00 ? 34  ILE A HD12 6  
ATOM 8957  H HD13 . ILE A 1 34  ? -0.597  -21.749 1.449   1.00 0.00 ? 34  ILE A HD13 6  
ATOM 8958  N N    . LEU A 1 35  ? -3.532  -20.311 -3.089  1.00 0.00 ? 35  LEU A N    6  
ATOM 8959  C CA   . LEU A 1 35  ? -4.083  -19.084 -3.655  1.00 0.00 ? 35  LEU A CA   6  
ATOM 8960  C C    . LEU A 1 35  ? -4.597  -18.161 -2.555  1.00 0.00 ? 35  LEU A C    6  
ATOM 8961  O O    . LEU A 1 35  ? -5.218  -18.611 -1.591  1.00 0.00 ? 35  LEU A O    6  
ATOM 8962  C CB   . LEU A 1 35  ? -5.215  -19.413 -4.630  1.00 0.00 ? 35  LEU A CB   6  
ATOM 8963  C CG   . LEU A 1 35  ? -5.418  -18.425 -5.779  1.00 0.00 ? 35  LEU A CG   6  
ATOM 8964  C CD1  . LEU A 1 35  ? -4.168  -18.344 -6.641  1.00 0.00 ? 35  LEU A CD1  6  
ATOM 8965  C CD2  . LEU A 1 35  ? -6.623  -18.824 -6.619  1.00 0.00 ? 35  LEU A CD2  6  
ATOM 8966  H H    . LEU A 1 35  ? -4.144  -20.992 -2.739  1.00 0.00 ? 35  LEU A H    6  
ATOM 8967  H HA   . LEU A 1 35  ? -3.292  -18.582 -4.190  1.00 0.00 ? 35  LEU A HA   6  
ATOM 8968  H HB2  . LEU A 1 35  ? -5.010  -20.381 -5.060  1.00 0.00 ? 35  LEU A HB2  6  
ATOM 8969  H HB3  . LEU A 1 35  ? -6.135  -19.459 -4.065  1.00 0.00 ? 35  LEU A HB3  6  
ATOM 8970  H HG   . LEU A 1 35  ? -5.605  -17.441 -5.371  1.00 0.00 ? 35  LEU A HG   6  
ATOM 8971  H HD11 . LEU A 1 35  ? -4.380  -18.743 -7.622  1.00 0.00 ? 35  LEU A HD11 6  
ATOM 8972  H HD12 . LEU A 1 35  ? -3.377  -18.918 -6.183  1.00 0.00 ? 35  LEU A HD12 6  
ATOM 8973  H HD13 . LEU A 1 35  ? -3.859  -17.312 -6.731  1.00 0.00 ? 35  LEU A HD13 6  
ATOM 8974  H HD21 . LEU A 1 35  ? -6.760  -18.106 -7.414  1.00 0.00 ? 35  LEU A HD21 6  
ATOM 8975  H HD22 . LEU A 1 35  ? -7.505  -18.844 -5.996  1.00 0.00 ? 35  LEU A HD22 6  
ATOM 8976  H HD23 . LEU A 1 35  ? -6.457  -19.803 -7.043  1.00 0.00 ? 35  LEU A HD23 6  
ATOM 8977  N N    . LEU A 1 36  ? -4.336  -16.867 -2.706  1.00 0.00 ? 36  LEU A N    6  
ATOM 8978  C CA   . LEU A 1 36  ? -4.774  -15.878 -1.727  1.00 0.00 ? 36  LEU A CA   6  
ATOM 8979  C C    . LEU A 1 36  ? -5.787  -14.916 -2.340  1.00 0.00 ? 36  LEU A C    6  
ATOM 8980  O O    . LEU A 1 36  ? -5.667  -14.532 -3.503  1.00 0.00 ? 36  LEU A O    6  
ATOM 8981  C CB   . LEU A 1 36  ? -3.574  -15.098 -1.189  1.00 0.00 ? 36  LEU A CB   6  
ATOM 8982  C CG   . LEU A 1 36  ? -2.394  -15.937 -0.696  1.00 0.00 ? 36  LEU A CG   6  
ATOM 8983  C CD1  . LEU A 1 36  ? -1.163  -15.066 -0.501  1.00 0.00 ? 36  LEU A CD1  6  
ATOM 8984  C CD2  . LEU A 1 36  ? -2.752  -16.654 0.597   1.00 0.00 ? 36  LEU A CD2  6  
ATOM 8985  H H    . LEU A 1 36  ? -3.837  -16.569 -3.495  1.00 0.00 ? 36  LEU A H    6  
ATOM 8986  H HA   . LEU A 1 36  ? -5.245  -16.406 -0.911  1.00 0.00 ? 36  LEU A HA   6  
ATOM 8987  H HB2  . LEU A 1 36  ? -3.215  -14.456 -1.979  1.00 0.00 ? 36  LEU A HB2  6  
ATOM 8988  H HB3  . LEU A 1 36  ? -3.918  -14.492 -0.363  1.00 0.00 ? 36  LEU A HB3  6  
ATOM 8989  H HG   . LEU A 1 36  ? -2.158  -16.686 -1.440  1.00 0.00 ? 36  LEU A HG   6  
ATOM 8990  H HD11 . LEU A 1 36  ? -0.969  -14.510 -1.406  1.00 0.00 ? 36  LEU A HD11 6  
ATOM 8991  H HD12 . LEU A 1 36  ? -0.312  -15.690 -0.272  1.00 0.00 ? 36  LEU A HD12 6  
ATOM 8992  H HD13 . LEU A 1 36  ? -1.335  -14.378 0.314   1.00 0.00 ? 36  LEU A HD13 6  
ATOM 8993  H HD21 . LEU A 1 36  ? -3.113  -17.646 0.370   1.00 0.00 ? 36  LEU A HD21 6  
ATOM 8994  H HD22 . LEU A 1 36  ? -3.524  -16.100 1.114   1.00 0.00 ? 36  LEU A HD22 6  
ATOM 8995  H HD23 . LEU A 1 36  ? -1.877  -16.723 1.225   1.00 0.00 ? 36  LEU A HD23 6  
ATOM 8996  N N    . SER A 1 37  ? -6.782  -14.530 -1.549  1.00 0.00 ? 37  SER A N    6  
ATOM 8997  C CA   . SER A 1 37  ? -7.817  -13.614 -2.014  1.00 0.00 ? 37  SER A CA   6  
ATOM 8998  C C    . SER A 1 37  ? -7.884  -12.374 -1.127  1.00 0.00 ? 37  SER A C    6  
ATOM 8999  O O    . SER A 1 37  ? -8.202  -12.464 0.059   1.00 0.00 ? 37  SER A O    6  
ATOM 9000  C CB   . SER A 1 37  ? -9.177  -14.314 -2.035  1.00 0.00 ? 37  SER A CB   6  
ATOM 9001  O OG   . SER A 1 37  ? -9.306  -15.142 -3.178  1.00 0.00 ? 37  SER A OG   6  
ATOM 9002  H H    . SER A 1 37  ? -6.823  -14.871 -0.631  1.00 0.00 ? 37  SER A H    6  
ATOM 9003  H HA   . SER A 1 37  ? -7.563  -13.309 -3.018  1.00 0.00 ? 37  SER A HA   6  
ATOM 9004  H HB2  . SER A 1 37  ? -9.278  -14.925 -1.150  1.00 0.00 ? 37  SER A HB2  6  
ATOM 9005  H HB3  . SER A 1 37  ? -9.961  -13.572 -2.052  1.00 0.00 ? 37  SER A HB3  6  
ATOM 9006  H HG   . SER A 1 37  ? -8.437  -15.438 -3.460  1.00 0.00 ? 37  SER A HG   6  
ATOM 9007  N N    . TRP A 1 38  ? -7.583  -11.220 -1.710  1.00 0.00 ? 38  TRP A N    6  
ATOM 9008  C CA   . TRP A 1 38  ? -7.609  -9.962  -0.973  1.00 0.00 ? 38  TRP A CA   6  
ATOM 9009  C C    . TRP A 1 38  ? -8.250  -8.856  -1.805  1.00 0.00 ? 38  TRP A C    6  
ATOM 9010  O O    . TRP A 1 38  ? -8.319  -8.949  -3.031  1.00 0.00 ? 38  TRP A O    6  
ATOM 9011  C CB   . TRP A 1 38  ? -6.192  -9.555  -0.567  1.00 0.00 ? 38  TRP A CB   6  
ATOM 9012  C CG   . TRP A 1 38  ? -5.385  -9.000  -1.701  1.00 0.00 ? 38  TRP A CG   6  
ATOM 9013  C CD1  . TRP A 1 38  ? -5.477  -7.746  -2.235  1.00 0.00 ? 38  TRP A CD1  6  
ATOM 9014  C CD2  . TRP A 1 38  ? -4.366  -9.680  -2.442  1.00 0.00 ? 38  TRP A CD2  6  
ATOM 9015  N NE1  . TRP A 1 38  ? -4.576  -7.607  -3.264  1.00 0.00 ? 38  TRP A NE1  6  
ATOM 9016  C CE2  . TRP A 1 38  ? -3.882  -8.779  -3.410  1.00 0.00 ? 38  TRP A CE2  6  
ATOM 9017  C CE3  . TRP A 1 38  ? -3.814  -10.963 -2.381  1.00 0.00 ? 38  TRP A CE3  6  
ATOM 9018  C CZ2  . TRP A 1 38  ? -2.874  -9.121  -4.307  1.00 0.00 ? 38  TRP A CZ2  6  
ATOM 9019  C CZ3  . TRP A 1 38  ? -2.815  -11.301 -3.273  1.00 0.00 ? 38  TRP A CZ3  6  
ATOM 9020  C CH2  . TRP A 1 38  ? -2.352  -10.383 -4.225  1.00 0.00 ? 38  TRP A CH2  6  
ATOM 9021  H H    . TRP A 1 38  ? -7.338  -11.213 -2.659  1.00 0.00 ? 38  TRP A H    6  
ATOM 9022  H HA   . TRP A 1 38  ? -8.200  -10.113 -0.081  1.00 0.00 ? 38  TRP A HA   6  
ATOM 9023  H HB2  . TRP A 1 38  ? -6.247  -8.801  0.204   1.00 0.00 ? 38  TRP A HB2  6  
ATOM 9024  H HB3  . TRP A 1 38  ? -5.674  -10.421 -0.181  1.00 0.00 ? 38  TRP A HB3  6  
ATOM 9025  H HD1  . TRP A 1 38  ? -6.162  -6.987  -1.891  1.00 0.00 ? 38  TRP A HD1  6  
ATOM 9026  H HE1  . TRP A 1 38  ? -4.450  -6.798  -3.803  1.00 0.00 ? 38  TRP A HE1  6  
ATOM 9027  H HE3  . TRP A 1 38  ? -4.157  -11.684 -1.654  1.00 0.00 ? 38  TRP A HE3  6  
ATOM 9028  H HZ2  . TRP A 1 38  ? -2.507  -8.424  -5.047  1.00 0.00 ? 38  TRP A HZ2  6  
ATOM 9029  H HZ3  . TRP A 1 38  ? -2.376  -12.288 -3.241  1.00 0.00 ? 38  TRP A HZ3  6  
ATOM 9030  H HH2  . TRP A 1 38  ? -1.570  -10.690 -4.902  1.00 0.00 ? 38  TRP A HH2  6  
ATOM 9031  N N    . THR A 1 39  ? -8.717  -7.810  -1.132  1.00 0.00 ? 39  THR A N    6  
ATOM 9032  C CA   . THR A 1 39  ? -9.353  -6.687  -1.809  1.00 0.00 ? 39  THR A CA   6  
ATOM 9033  C C    . THR A 1 39  ? -8.549  -5.405  -1.622  1.00 0.00 ? 39  THR A C    6  
ATOM 9034  O O    . THR A 1 39  ? -8.340  -4.933  -0.504  1.00 0.00 ? 39  THR A O    6  
ATOM 9035  C CB   . THR A 1 39  ? -10.787 -6.460  -1.296  1.00 0.00 ? 39  THR A CB   6  
ATOM 9036  O OG1  . THR A 1 39  ? -11.588 -7.619  -1.550  1.00 0.00 ? 39  THR A OG1  6  
ATOM 9037  C CG2  . THR A 1 39  ? -11.416 -5.246  -1.965  1.00 0.00 ? 39  THR A CG2  6  
ATOM 9038  H H    . THR A 1 39  ? -8.632  -7.794  -0.155  1.00 0.00 ? 39  THR A H    6  
ATOM 9039  H HA   . THR A 1 39  ? -9.403  -6.918  -2.863  1.00 0.00 ? 39  THR A HA   6  
ATOM 9040  H HB   . THR A 1 39  ? -10.748 -6.285  -0.230  1.00 0.00 ? 39  THR A HB   6  
ATOM 9041  H HG1  . THR A 1 39  ? -11.688 -7.738  -2.497  1.00 0.00 ? 39  THR A HG1  6  
ATOM 9042  H HG21 . THR A 1 39  ? -12.357 -5.018  -1.486  1.00 0.00 ? 39  THR A HG21 6  
ATOM 9043  H HG22 . THR A 1 39  ? -11.585 -5.460  -3.010  1.00 0.00 ? 39  THR A HG22 6  
ATOM 9044  H HG23 . THR A 1 39  ? -10.751 -4.401  -1.873  1.00 0.00 ? 39  THR A HG23 6  
ATOM 9045  N N    . PRO A 1 40  ? -8.087  -4.826  -2.740  1.00 0.00 ? 40  PRO A N    6  
ATOM 9046  C CA   . PRO A 1 40  ? -7.300  -3.590  -2.725  1.00 0.00 ? 40  PRO A CA   6  
ATOM 9047  C C    . PRO A 1 40  ? -8.133  -2.377  -2.324  1.00 0.00 ? 40  PRO A C    6  
ATOM 9048  O O    . PRO A 1 40  ? -9.278  -2.214  -2.746  1.00 0.00 ? 40  PRO A O    6  
ATOM 9049  C CB   . PRO A 1 40  ? -6.822  -3.456  -4.173  1.00 0.00 ? 40  PRO A CB   6  
ATOM 9050  C CG   . PRO A 1 40  ? -7.832  -4.200  -4.976  1.00 0.00 ? 40  PRO A CG   6  
ATOM 9051  C CD   . PRO A 1 40  ? -8.299  -5.334  -4.106  1.00 0.00 ? 40  PRO A CD   6  
ATOM 9052  H HA   . PRO A 1 40  ? -6.446  -3.671  -2.068  1.00 0.00 ? 40  PRO A HA   6  
ATOM 9053  H HB2  . PRO A 1 40  ? -6.789  -2.411  -4.448  1.00 0.00 ? 40  PRO A HB2  6  
ATOM 9054  H HB3  . PRO A 1 40  ? -5.840  -3.892  -4.273  1.00 0.00 ? 40  PRO A HB3  6  
ATOM 9055  H HG2  . PRO A 1 40  ? -8.659  -3.550  -5.219  1.00 0.00 ? 40  PRO A HG2  6  
ATOM 9056  H HG3  . PRO A 1 40  ? -7.376  -4.582  -5.877  1.00 0.00 ? 40  PRO A HG3  6  
ATOM 9057  H HD2  . PRO A 1 40  ? -9.344  -5.541  -4.284  1.00 0.00 ? 40  PRO A HD2  6  
ATOM 9058  H HD3  . PRO A 1 40  ? -7.702  -6.217  -4.285  1.00 0.00 ? 40  PRO A HD3  6  
ATOM 9059  N N    . PRO A 1 41  ? -7.547  -1.504  -1.491  1.00 0.00 ? 41  PRO A N    6  
ATOM 9060  C CA   . PRO A 1 41  ? -8.217  -0.290  -1.017  1.00 0.00 ? 41  PRO A CA   6  
ATOM 9061  C C    . PRO A 1 41  ? -8.402  0.741   -2.125  1.00 0.00 ? 41  PRO A C    6  
ATOM 9062  O O    . PRO A 1 41  ? -7.944  0.545   -3.251  1.00 0.00 ? 41  PRO A O    6  
ATOM 9063  C CB   . PRO A 1 41  ? -7.266  0.243   0.058   1.00 0.00 ? 41  PRO A CB   6  
ATOM 9064  C CG   . PRO A 1 41  ? -5.929  -0.294  -0.320  1.00 0.00 ? 41  PRO A CG   6  
ATOM 9065  C CD   . PRO A 1 41  ? -6.184  -1.635  -0.949  1.00 0.00 ? 41  PRO A CD   6  
ATOM 9066  H HA   . PRO A 1 41  ? -9.176  -0.515  -0.572  1.00 0.00 ? 41  PRO A HA   6  
ATOM 9067  H HB2  . PRO A 1 41  ? -7.277  1.324   0.046   1.00 0.00 ? 41  PRO A HB2  6  
ATOM 9068  H HB3  . PRO A 1 41  ? -7.576  -0.115  1.028   1.00 0.00 ? 41  PRO A HB3  6  
ATOM 9069  H HG2  . PRO A 1 41  ? -5.454  0.368   -1.028  1.00 0.00 ? 41  PRO A HG2  6  
ATOM 9070  H HG3  . PRO A 1 41  ? -5.316  -0.405  0.562   1.00 0.00 ? 41  PRO A HG3  6  
ATOM 9071  H HD2  . PRO A 1 41  ? -5.471  -1.824  -1.739  1.00 0.00 ? 41  PRO A HD2  6  
ATOM 9072  H HD3  . PRO A 1 41  ? -6.140  -2.416  -0.204  1.00 0.00 ? 41  PRO A HD3  6  
ATOM 9073  N N    . ARG A 1 42  ? -9.074  1.840   -1.798  1.00 0.00 ? 42  ARG A N    6  
ATOM 9074  C CA   . ARG A 1 42  ? -9.319  2.902   -2.766  1.00 0.00 ? 42  ARG A CA   6  
ATOM 9075  C C    . ARG A 1 42  ? -8.037  3.268   -3.508  1.00 0.00 ? 42  ARG A C    6  
ATOM 9076  O O    . ARG A 1 42  ? -8.075  3.686   -4.665  1.00 0.00 ? 42  ARG A O    6  
ATOM 9077  C CB   . ARG A 1 42  ? -9.888  4.138   -2.067  1.00 0.00 ? 42  ARG A CB   6  
ATOM 9078  C CG   . ARG A 1 42  ? -10.254 5.263   -3.021  1.00 0.00 ? 42  ARG A CG   6  
ATOM 9079  C CD   . ARG A 1 42  ? -10.463 6.575   -2.281  1.00 0.00 ? 42  ARG A CD   6  
ATOM 9080  N NE   . ARG A 1 42  ? -11.655 6.543   -1.438  1.00 0.00 ? 42  ARG A NE   6  
ATOM 9081  C CZ   . ARG A 1 42  ? -12.889 6.699   -1.904  1.00 0.00 ? 42  ARG A CZ   6  
ATOM 9082  N NH1  . ARG A 1 42  ? -13.092 6.894   -3.200  1.00 0.00 ? 42  ARG A NH1  6  
ATOM 9083  N NH2  . ARG A 1 42  ? -13.923 6.657   -1.074  1.00 0.00 ? 42  ARG A NH2  6  
ATOM 9084  H H    . ARG A 1 42  ? -9.415  1.938   -0.884  1.00 0.00 ? 42  ARG A H    6  
ATOM 9085  H HA   . ARG A 1 42  ? -10.043 2.539   -3.481  1.00 0.00 ? 42  ARG A HA   6  
ATOM 9086  H HB2  . ARG A 1 42  ? -10.777 3.853   -1.523  1.00 0.00 ? 42  ARG A HB2  6  
ATOM 9087  H HB3  . ARG A 1 42  ? -9.153  4.511   -1.369  1.00 0.00 ? 42  ARG A HB3  6  
ATOM 9088  H HG2  . ARG A 1 42  ? -9.455  5.390   -3.736  1.00 0.00 ? 42  ARG A HG2  6  
ATOM 9089  H HG3  . ARG A 1 42  ? -11.165 5.002   -3.538  1.00 0.00 ? 42  ARG A HG3  6  
ATOM 9090  H HD2  . ARG A 1 42  ? -9.600  6.764   -1.660  1.00 0.00 ? 42  ARG A HD2  6  
ATOM 9091  H HD3  . ARG A 1 42  ? -10.566 7.369   -3.005  1.00 0.00 ? 42  ARG A HD3  6  
ATOM 9092  H HE   . ARG A 1 42  ? -11.528 6.400   -0.477  1.00 0.00 ? 42  ARG A HE   6  
ATOM 9093  H HH11 . ARG A 1 42  ? -12.315 6.925   -3.827  1.00 0.00 ? 42  ARG A HH11 6  
ATOM 9094  H HH12 . ARG A 1 42  ? -14.022 7.010   -3.548  1.00 0.00 ? 42  ARG A HH12 6  
ATOM 9095  H HH21 . ARG A 1 42  ? -13.774 6.510   -0.097  1.00 0.00 ? 42  ARG A HH21 6  
ATOM 9096  H HH22 . ARG A 1 42  ? -14.852 6.774   -1.426  1.00 0.00 ? 42  ARG A HH22 6  
ATOM 9097  N N    . SER A 1 43  ? -6.903  3.108   -2.833  1.00 0.00 ? 43  SER A N    6  
ATOM 9098  C CA   . SER A 1 43  ? -5.609  3.425   -3.426  1.00 0.00 ? 43  SER A CA   6  
ATOM 9099  C C    . SER A 1 43  ? -5.525  2.903   -4.857  1.00 0.00 ? 43  SER A C    6  
ATOM 9100  O O    . SER A 1 43  ? -5.340  1.707   -5.083  1.00 0.00 ? 43  SER A O    6  
ATOM 9101  C CB   . SER A 1 43  ? -4.479  2.829   -2.586  1.00 0.00 ? 43  SER A CB   6  
ATOM 9102  O OG   . SER A 1 43  ? -3.278  3.562   -2.753  1.00 0.00 ? 43  SER A OG   6  
ATOM 9103  H H    . SER A 1 43  ? -6.938  2.770   -1.914  1.00 0.00 ? 43  SER A H    6  
ATOM 9104  H HA   . SER A 1 43  ? -5.507  4.500   -3.441  1.00 0.00 ? 43  SER A HA   6  
ATOM 9105  H HB2  . SER A 1 43  ? -4.758  2.852   -1.543  1.00 0.00 ? 43  SER A HB2  6  
ATOM 9106  H HB3  . SER A 1 43  ? -4.309  1.806   -2.891  1.00 0.00 ? 43  SER A HB3  6  
ATOM 9107  H HG   . SER A 1 43  ? -3.144  3.749   -3.685  1.00 0.00 ? 43  SER A HG   6  
ATOM 9108  N N    . ASP A 1 44  ? -5.662  3.808   -5.820  1.00 0.00 ? 44  ASP A N    6  
ATOM 9109  C CA   . ASP A 1 44  ? -5.600  3.440   -7.230  1.00 0.00 ? 44  ASP A CA   6  
ATOM 9110  C C    . ASP A 1 44  ? -4.153  3.294   -7.690  1.00 0.00 ? 44  ASP A C    6  
ATOM 9111  O O    . ASP A 1 44  ? -3.888  2.940   -8.840  1.00 0.00 ? 44  ASP A O    6  
ATOM 9112  C CB   . ASP A 1 44  ? -6.316  4.488   -8.084  1.00 0.00 ? 44  ASP A CB   6  
ATOM 9113  C CG   . ASP A 1 44  ? -7.806  4.537   -7.810  1.00 0.00 ? 44  ASP A CG   6  
ATOM 9114  O OD1  . ASP A 1 44  ? -8.467  3.483   -7.924  1.00 0.00 ? 44  ASP A OD1  6  
ATOM 9115  O OD2  . ASP A 1 44  ? -8.312  5.630   -7.480  1.00 0.00 ? 44  ASP A OD2  6  
ATOM 9116  H H    . ASP A 1 44  ? -5.807  4.746   -5.576  1.00 0.00 ? 44  ASP A H    6  
ATOM 9117  H HA   . ASP A 1 44  ? -6.099  2.491   -7.347  1.00 0.00 ? 44  ASP A HA   6  
ATOM 9118  H HB2  . ASP A 1 44  ? -5.898  5.461   -7.874  1.00 0.00 ? 44  ASP A HB2  6  
ATOM 9119  H HB3  . ASP A 1 44  ? -6.168  4.254   -9.128  1.00 0.00 ? 44  ASP A HB3  6  
ATOM 9120  N N    . THR A 1 45  ? -3.218  3.569   -6.785  1.00 0.00 ? 45  THR A N    6  
ATOM 9121  C CA   . THR A 1 45  ? -1.798  3.470   -7.099  1.00 0.00 ? 45  THR A CA   6  
ATOM 9122  C C    . THR A 1 45  ? -1.105  2.458   -6.194  1.00 0.00 ? 45  THR A C    6  
ATOM 9123  O O    . THR A 1 45  ? -0.819  2.746   -5.031  1.00 0.00 ? 45  THR A O    6  
ATOM 9124  C CB   . THR A 1 45  ? -1.096  4.834   -6.958  1.00 0.00 ? 45  THR A CB   6  
ATOM 9125  O OG1  . THR A 1 45  ? -1.730  5.609   -5.935  1.00 0.00 ? 45  THR A OG1  6  
ATOM 9126  C CG2  . THR A 1 45  ? -1.129  5.598   -8.274  1.00 0.00 ? 45  THR A CG2  6  
ATOM 9127  H H    . THR A 1 45  ? -3.492  3.846   -5.886  1.00 0.00 ? 45  THR A H    6  
ATOM 9128  H HA   . THR A 1 45  ? -1.705  3.145   -8.125  1.00 0.00 ? 45  THR A HA   6  
ATOM 9129  H HB   . THR A 1 45  ? -0.065  4.664   -6.684  1.00 0.00 ? 45  THR A HB   6  
ATOM 9130  H HG1  . THR A 1 45  ? -2.622  5.834   -6.210  1.00 0.00 ? 45  THR A HG1  6  
ATOM 9131  H HG21 . THR A 1 45  ? -1.020  4.905   -9.095  1.00 0.00 ? 45  THR A HG21 6  
ATOM 9132  H HG22 . THR A 1 45  ? -0.320  6.312   -8.295  1.00 0.00 ? 45  THR A HG22 6  
ATOM 9133  H HG23 . THR A 1 45  ? -2.071  6.117   -8.364  1.00 0.00 ? 45  THR A HG23 6  
ATOM 9134  N N    . ILE A 1 46  ? -0.836  1.275   -6.734  1.00 0.00 ? 46  ILE A N    6  
ATOM 9135  C CA   . ILE A 1 46  ? -0.174  0.221   -5.975  1.00 0.00 ? 46  ILE A CA   6  
ATOM 9136  C C    . ILE A 1 46  ? 0.966   -0.399  -6.775  1.00 0.00 ? 46  ILE A C    6  
ATOM 9137  O O    . ILE A 1 46  ? 0.782   -0.812  -7.919  1.00 0.00 ? 46  ILE A O    6  
ATOM 9138  C CB   . ILE A 1 46  ? -1.164  -0.887  -5.568  1.00 0.00 ? 46  ILE A CB   6  
ATOM 9139  C CG1  . ILE A 1 46  ? -2.227  -0.328  -4.620  1.00 0.00 ? 46  ILE A CG1  6  
ATOM 9140  C CG2  . ILE A 1 46  ? -0.423  -2.046  -4.919  1.00 0.00 ? 46  ILE A CG2  6  
ATOM 9141  C CD1  . ILE A 1 46  ? -3.447  -1.213  -4.492  1.00 0.00 ? 46  ILE A CD1  6  
ATOM 9142  H H    . ILE A 1 46  ? -1.089  1.106   -7.665  1.00 0.00 ? 46  ILE A H    6  
ATOM 9143  H HA   . ILE A 1 46  ? 0.230   0.663   -5.075  1.00 0.00 ? 46  ILE A HA   6  
ATOM 9144  H HB   . ILE A 1 46  ? -1.645  -1.254  -6.461  1.00 0.00 ? 46  ILE A HB   6  
ATOM 9145  H HG12 . ILE A 1 46  ? -1.798  -0.212  -3.637  1.00 0.00 ? 46  ILE A HG12 6  
ATOM 9146  H HG13 . ILE A 1 46  ? -2.552  0.636   -4.983  1.00 0.00 ? 46  ILE A HG13 6  
ATOM 9147  H HG21 . ILE A 1 46  ? 0.616   -1.781  -4.788  1.00 0.00 ? 46  ILE A HG21 6  
ATOM 9148  H HG22 . ILE A 1 46  ? -0.863  -2.260  -3.956  1.00 0.00 ? 46  ILE A HG22 6  
ATOM 9149  H HG23 . ILE A 1 46  ? -0.496  -2.919  -5.550  1.00 0.00 ? 46  ILE A HG23 6  
ATOM 9150  H HD11 . ILE A 1 46  ? -3.847  -1.419  -5.474  1.00 0.00 ? 46  ILE A HD11 6  
ATOM 9151  H HD12 . ILE A 1 46  ? -3.172  -2.140  -4.013  1.00 0.00 ? 46  ILE A HD12 6  
ATOM 9152  H HD13 . ILE A 1 46  ? -4.196  -0.709  -3.898  1.00 0.00 ? 46  ILE A HD13 6  
ATOM 9153  N N    . ALA A 1 47  ? 2.144   -0.463  -6.163  1.00 0.00 ? 47  ALA A N    6  
ATOM 9154  C CA   . ALA A 1 47  ? 3.314   -1.037  -6.817  1.00 0.00 ? 47  ALA A CA   6  
ATOM 9155  C C    . ALA A 1 47  ? 3.328   -2.556  -6.682  1.00 0.00 ? 47  ALA A C    6  
ATOM 9156  O O    . ALA A 1 47  ? 3.531   -3.274  -7.660  1.00 0.00 ? 47  ALA A O    6  
ATOM 9157  C CB   . ALA A 1 47  ? 4.588   -0.442  -6.236  1.00 0.00 ? 47  ALA A CB   6  
ATOM 9158  H H    . ALA A 1 47  ? 2.228   -0.117  -5.250  1.00 0.00 ? 47  ALA A H    6  
ATOM 9159  H HA   . ALA A 1 47  ? 3.270   -0.780  -7.865  1.00 0.00 ? 47  ALA A HA   6  
ATOM 9160  H HB1  . ALA A 1 47  ? 5.409   -0.620  -6.915  1.00 0.00 ? 47  ALA A HB1  6  
ATOM 9161  H HB2  . ALA A 1 47  ? 4.458   0.621   -6.099  1.00 0.00 ? 47  ALA A HB2  6  
ATOM 9162  H HB3  . ALA A 1 47  ? 4.801   -0.905  -5.285  1.00 0.00 ? 47  ALA A HB3  6  
ATOM 9163  N N    . ASN A 1 48  ? 3.112   -3.039  -5.462  1.00 0.00 ? 48  ASN A N    6  
ATOM 9164  C CA   . ASN A 1 48  ? 3.101   -4.474  -5.199  1.00 0.00 ? 48  ASN A CA   6  
ATOM 9165  C C    . ASN A 1 48  ? 2.703   -4.759  -3.755  1.00 0.00 ? 48  ASN A C    6  
ATOM 9166  O O    . ASN A 1 48  ? 2.565   -3.842  -2.945  1.00 0.00 ? 48  ASN A O    6  
ATOM 9167  C CB   . ASN A 1 48  ? 4.477   -5.077  -5.490  1.00 0.00 ? 48  ASN A CB   6  
ATOM 9168  C CG   . ASN A 1 48  ? 5.610   -4.170  -5.049  1.00 0.00 ? 48  ASN A CG   6  
ATOM 9169  O OD1  . ASN A 1 48  ? 5.547   -3.550  -3.988  1.00 0.00 ? 48  ASN A OD1  6  
ATOM 9170  N ND2  . ASN A 1 48  ? 6.655   -4.089  -5.866  1.00 0.00 ? 48  ASN A ND2  6  
ATOM 9171  H H    . ASN A 1 48  ? 2.956   -2.417  -4.722  1.00 0.00 ? 48  ASN A H    6  
ATOM 9172  H HA   . ASN A 1 48  ? 2.374   -4.926  -5.857  1.00 0.00 ? 48  ASN A HA   6  
ATOM 9173  H HB2  . ASN A 1 48  ? 4.570   -6.017  -4.965  1.00 0.00 ? 48  ASN A HB2  6  
ATOM 9174  H HB3  . ASN A 1 48  ? 4.571   -5.251  -6.551  1.00 0.00 ? 48  ASN A HB3  6  
ATOM 9175  H HD21 . ASN A 1 48  ? 6.636   -4.612  -6.695  1.00 0.00 ? 48  ASN A HD21 6  
ATOM 9176  H HD22 . ASN A 1 48  ? 7.402   -3.511  -5.605  1.00 0.00 ? 48  ASN A HD22 6  
ATOM 9177  N N    . TYR A 1 49  ? 2.521   -6.036  -3.438  1.00 0.00 ? 49  TYR A N    6  
ATOM 9178  C CA   . TYR A 1 49  ? 2.138   -6.443  -2.091  1.00 0.00 ? 49  TYR A CA   6  
ATOM 9179  C C    . TYR A 1 49  ? 3.250   -7.249  -1.428  1.00 0.00 ? 49  TYR A C    6  
ATOM 9180  O O    . TYR A 1 49  ? 4.129   -7.784  -2.102  1.00 0.00 ? 49  TYR A O    6  
ATOM 9181  C CB   . TYR A 1 49  ? 0.850   -7.267  -2.133  1.00 0.00 ? 49  TYR A CB   6  
ATOM 9182  C CG   . TYR A 1 49  ? -0.356  -6.484  -2.602  1.00 0.00 ? 49  TYR A CG   6  
ATOM 9183  C CD1  . TYR A 1 49  ? -0.606  -6.302  -3.957  1.00 0.00 ? 49  TYR A CD1  6  
ATOM 9184  C CD2  . TYR A 1 49  ? -1.244  -5.926  -1.691  1.00 0.00 ? 49  TYR A CD2  6  
ATOM 9185  C CE1  . TYR A 1 49  ? -1.706  -5.587  -4.390  1.00 0.00 ? 49  TYR A CE1  6  
ATOM 9186  C CE2  . TYR A 1 49  ? -2.347  -5.210  -2.115  1.00 0.00 ? 49  TYR A CE2  6  
ATOM 9187  C CZ   . TYR A 1 49  ? -2.573  -5.043  -3.466  1.00 0.00 ? 49  TYR A CZ   6  
ATOM 9188  O OH   . TYR A 1 49  ? -3.670  -4.331  -3.893  1.00 0.00 ? 49  TYR A OH   6  
ATOM 9189  H H    . TYR A 1 49  ? 2.646   -6.722  -4.127  1.00 0.00 ? 49  TYR A H    6  
ATOM 9190  H HA   . TYR A 1 49  ? 1.963   -5.548  -1.512  1.00 0.00 ? 49  TYR A HA   6  
ATOM 9191  H HB2  . TYR A 1 49  ? 0.985   -8.100  -2.804  1.00 0.00 ? 49  TYR A HB2  6  
ATOM 9192  H HB3  . TYR A 1 49  ? 0.637   -7.640  -1.141  1.00 0.00 ? 49  TYR A HB3  6  
ATOM 9193  H HD1  . TYR A 1 49  ? 0.075   -6.730  -4.678  1.00 0.00 ? 49  TYR A HD1  6  
ATOM 9194  H HD2  . TYR A 1 49  ? -1.064  -6.058  -0.634  1.00 0.00 ? 49  TYR A HD2  6  
ATOM 9195  H HE1  . TYR A 1 49  ? -1.884  -5.457  -5.447  1.00 0.00 ? 49  TYR A HE1  6  
ATOM 9196  H HE2  . TYR A 1 49  ? -3.026  -4.784  -1.392  1.00 0.00 ? 49  TYR A HE2  6  
ATOM 9197  H HH   . TYR A 1 49  ? -3.917  -4.623  -4.774  1.00 0.00 ? 49  TYR A HH   6  
ATOM 9198  N N    . GLU A 1 50  ? 3.202   -7.332  -0.102  1.00 0.00 ? 50  GLU A N    6  
ATOM 9199  C CA   . GLU A 1 50  ? 4.205   -8.073  0.653   1.00 0.00 ? 50  GLU A CA   6  
ATOM 9200  C C    . GLU A 1 50  ? 3.605   -9.338  1.260   1.00 0.00 ? 50  GLU A C    6  
ATOM 9201  O O    . GLU A 1 50  ? 2.616   -9.280  1.993   1.00 0.00 ? 50  GLU A O    6  
ATOM 9202  C CB   . GLU A 1 50  ? 4.795   -7.195  1.758   1.00 0.00 ? 50  GLU A CB   6  
ATOM 9203  C CG   . GLU A 1 50  ? 6.233   -7.541  2.108   1.00 0.00 ? 50  GLU A CG   6  
ATOM 9204  C CD   . GLU A 1 50  ? 7.201   -7.220  0.986   1.00 0.00 ? 50  GLU A CD   6  
ATOM 9205  O OE1  . GLU A 1 50  ? 7.269   -8.007  0.019   1.00 0.00 ? 50  GLU A OE1  6  
ATOM 9206  O OE2  . GLU A 1 50  ? 7.889   -6.182  1.075   1.00 0.00 ? 50  GLU A OE2  6  
ATOM 9207  H H    . GLU A 1 50  ? 2.475   -6.884  0.379   1.00 0.00 ? 50  GLU A H    6  
ATOM 9208  H HA   . GLU A 1 50  ? 4.993   -8.355  -0.029  1.00 0.00 ? 50  GLU A HA   6  
ATOM 9209  H HB2  . GLU A 1 50  ? 4.763   -6.164  1.438   1.00 0.00 ? 50  GLU A HB2  6  
ATOM 9210  H HB3  . GLU A 1 50  ? 4.194   -7.305  2.648   1.00 0.00 ? 50  GLU A HB3  6  
ATOM 9211  H HG2  . GLU A 1 50  ? 6.522   -6.980  2.984   1.00 0.00 ? 50  GLU A HG2  6  
ATOM 9212  H HG3  . GLU A 1 50  ? 6.293   -8.598  2.324   1.00 0.00 ? 50  GLU A HG3  6  
ATOM 9213  N N    . LEU A 1 51  ? 4.208   -10.480 0.950   1.00 0.00 ? 51  LEU A N    6  
ATOM 9214  C CA   . LEU A 1 51  ? 3.734   -11.760 1.463   1.00 0.00 ? 51  LEU A CA   6  
ATOM 9215  C C    . LEU A 1 51  ? 4.737   -12.359 2.445   1.00 0.00 ? 51  LEU A C    6  
ATOM 9216  O O    . LEU A 1 51  ? 5.571   -13.183 2.071   1.00 0.00 ? 51  LEU A O    6  
ATOM 9217  C CB   . LEU A 1 51  ? 3.488   -12.735 0.310   1.00 0.00 ? 51  LEU A CB   6  
ATOM 9218  C CG   . LEU A 1 51  ? 3.201   -14.184 0.706   1.00 0.00 ? 51  LEU A CG   6  
ATOM 9219  C CD1  . LEU A 1 51  ? 1.945   -14.266 1.560   1.00 0.00 ? 51  LEU A CD1  6  
ATOM 9220  C CD2  . LEU A 1 51  ? 3.064   -15.058 -0.532  1.00 0.00 ? 51  LEU A CD2  6  
ATOM 9221  H H    . LEU A 1 51  ? 4.991   -10.463 0.361   1.00 0.00 ? 51  LEU A H    6  
ATOM 9222  H HA   . LEU A 1 51  ? 2.803   -11.585 1.981   1.00 0.00 ? 51  LEU A HA   6  
ATOM 9223  H HB2  . LEU A 1 51  ? 2.642   -12.373 -0.254  1.00 0.00 ? 51  LEU A HB2  6  
ATOM 9224  H HB3  . LEU A 1 51  ? 4.366   -12.731 -0.319  1.00 0.00 ? 51  LEU A HB3  6  
ATOM 9225  H HG   . LEU A 1 51  ? 4.028   -14.561 1.293   1.00 0.00 ? 51  LEU A HG   6  
ATOM 9226  H HD11 . LEU A 1 51  ? 1.781   -13.319 2.051   1.00 0.00 ? 51  LEU A HD11 6  
ATOM 9227  H HD12 . LEU A 1 51  ? 2.064   -15.041 2.302   1.00 0.00 ? 51  LEU A HD12 6  
ATOM 9228  H HD13 . LEU A 1 51  ? 1.097   -14.498 0.931   1.00 0.00 ? 51  LEU A HD13 6  
ATOM 9229  H HD21 . LEU A 1 51  ? 2.045   -15.405 -0.616  1.00 0.00 ? 51  LEU A HD21 6  
ATOM 9230  H HD22 . LEU A 1 51  ? 3.728   -15.907 -0.449  1.00 0.00 ? 51  LEU A HD22 6  
ATOM 9231  H HD23 . LEU A 1 51  ? 3.323   -14.483 -1.409  1.00 0.00 ? 51  LEU A HD23 6  
ATOM 9232  N N    . VAL A 1 52  ? 4.648   -11.939 3.703   1.00 0.00 ? 52  VAL A N    6  
ATOM 9233  C CA   . VAL A 1 52  ? 5.546   -12.435 4.739   1.00 0.00 ? 52  VAL A CA   6  
ATOM 9234  C C    . VAL A 1 52  ? 5.116   -13.816 5.223   1.00 0.00 ? 52  VAL A C    6  
ATOM 9235  O O    . VAL A 1 52  ? 4.174   -13.946 6.005   1.00 0.00 ? 52  VAL A O    6  
ATOM 9236  C CB   . VAL A 1 52  ? 5.599   -11.476 5.943   1.00 0.00 ? 52  VAL A CB   6  
ATOM 9237  C CG1  . VAL A 1 52  ? 6.367   -12.105 7.095   1.00 0.00 ? 52  VAL A CG1  6  
ATOM 9238  C CG2  . VAL A 1 52  ? 6.222   -10.148 5.538   1.00 0.00 ? 52  VAL A CG2  6  
ATOM 9239  H H    . VAL A 1 52  ? 3.963   -11.280 3.940   1.00 0.00 ? 52  VAL A H    6  
ATOM 9240  H HA   . VAL A 1 52  ? 6.538   -12.505 4.317   1.00 0.00 ? 52  VAL A HA   6  
ATOM 9241  H HB   . VAL A 1 52  ? 4.588   -11.289 6.273   1.00 0.00 ? 52  VAL A HB   6  
ATOM 9242  H HG11 . VAL A 1 52  ? 6.770   -13.057 6.780   1.00 0.00 ? 52  VAL A HG11 6  
ATOM 9243  H HG12 . VAL A 1 52  ? 7.174   -11.451 7.390   1.00 0.00 ? 52  VAL A HG12 6  
ATOM 9244  H HG13 . VAL A 1 52  ? 5.701   -12.256 7.931   1.00 0.00 ? 52  VAL A HG13 6  
ATOM 9245  H HG21 . VAL A 1 52  ? 5.947   -9.389  6.254   1.00 0.00 ? 52  VAL A HG21 6  
ATOM 9246  H HG22 . VAL A 1 52  ? 7.298   -10.248 5.514   1.00 0.00 ? 52  VAL A HG22 6  
ATOM 9247  H HG23 . VAL A 1 52  ? 5.866   -9.866  4.558   1.00 0.00 ? 52  VAL A HG23 6  
ATOM 9248  N N    . TYR A 1 53  ? 5.813   -14.844 4.753   1.00 0.00 ? 53  TYR A N    6  
ATOM 9249  C CA   . TYR A 1 53  ? 5.503   -16.217 5.136   1.00 0.00 ? 53  TYR A CA   6  
ATOM 9250  C C    . TYR A 1 53  ? 6.676   -16.855 5.874   1.00 0.00 ? 53  TYR A C    6  
ATOM 9251  O O    . TYR A 1 53  ? 7.838   -16.593 5.562   1.00 0.00 ? 53  TYR A O    6  
ATOM 9252  C CB   . TYR A 1 53  ? 5.152   -17.046 3.900   1.00 0.00 ? 53  TYR A CB   6  
ATOM 9253  C CG   . TYR A 1 53  ? 6.352   -17.418 3.059   1.00 0.00 ? 53  TYR A CG   6  
ATOM 9254  C CD1  . TYR A 1 53  ? 6.850   -16.546 2.099   1.00 0.00 ? 53  TYR A CD1  6  
ATOM 9255  C CD2  . TYR A 1 53  ? 6.989   -18.642 3.225   1.00 0.00 ? 53  TYR A CD2  6  
ATOM 9256  C CE1  . TYR A 1 53  ? 7.946   -16.882 1.328   1.00 0.00 ? 53  TYR A CE1  6  
ATOM 9257  C CE2  . TYR A 1 53  ? 8.086   -18.986 2.460   1.00 0.00 ? 53  TYR A CE2  6  
ATOM 9258  C CZ   . TYR A 1 53  ? 8.561   -18.103 1.512   1.00 0.00 ? 53  TYR A CZ   6  
ATOM 9259  O OH   . TYR A 1 53  ? 9.654   -18.441 0.747   1.00 0.00 ? 53  TYR A OH   6  
ATOM 9260  H H    . TYR A 1 53  ? 6.553   -14.677 4.133   1.00 0.00 ? 53  TYR A H    6  
ATOM 9261  H HA   . TYR A 1 53  ? 4.648   -16.192 5.796   1.00 0.00 ? 53  TYR A HA   6  
ATOM 9262  H HB2  . TYR A 1 53  ? 4.671   -17.960 4.213   1.00 0.00 ? 53  TYR A HB2  6  
ATOM 9263  H HB3  . TYR A 1 53  ? 4.472   -16.483 3.277   1.00 0.00 ? 53  TYR A HB3  6  
ATOM 9264  H HD1  . TYR A 1 53  ? 6.366   -15.590 1.958   1.00 0.00 ? 53  TYR A HD1  6  
ATOM 9265  H HD2  . TYR A 1 53  ? 6.615   -19.332 3.968   1.00 0.00 ? 53  TYR A HD2  6  
ATOM 9266  H HE1  . TYR A 1 53  ? 8.318   -16.190 0.587   1.00 0.00 ? 53  TYR A HE1  6  
ATOM 9267  H HE2  . TYR A 1 53  ? 8.568   -19.942 2.603   1.00 0.00 ? 53  TYR A HE2  6  
ATOM 9268  H HH   . TYR A 1 53  ? 9.732   -17.827 0.013   1.00 0.00 ? 53  TYR A HH   6  
ATOM 9269  N N    . LYS A 1 54  ? 6.363   -17.695 6.855   1.00 0.00 ? 54  LYS A N    6  
ATOM 9270  C CA   . LYS A 1 54  ? 7.388   -18.374 7.638   1.00 0.00 ? 54  LYS A CA   6  
ATOM 9271  C C    . LYS A 1 54  ? 6.943   -19.784 8.012   1.00 0.00 ? 54  LYS A C    6  
ATOM 9272  O O    . LYS A 1 54  ? 5.756   -20.035 8.222   1.00 0.00 ? 54  LYS A O    6  
ATOM 9273  C CB   . LYS A 1 54  ? 7.704   -17.575 8.904   1.00 0.00 ? 54  LYS A CB   6  
ATOM 9274  C CG   . LYS A 1 54  ? 6.469   -17.145 9.676   1.00 0.00 ? 54  LYS A CG   6  
ATOM 9275  C CD   . LYS A 1 54  ? 6.802   -16.092 10.721  1.00 0.00 ? 54  LYS A CD   6  
ATOM 9276  C CE   . LYS A 1 54  ? 5.823   -16.131 11.883  1.00 0.00 ? 54  LYS A CE   6  
ATOM 9277  N NZ   . LYS A 1 54  ? 6.140   -15.102 12.911  1.00 0.00 ? 54  LYS A NZ   6  
ATOM 9278  H H    . LYS A 1 54  ? 5.418   -17.863 7.056   1.00 0.00 ? 54  LYS A H    6  
ATOM 9279  H HA   . LYS A 1 54  ? 8.279   -18.439 7.032   1.00 0.00 ? 54  LYS A HA   6  
ATOM 9280  H HB2  . LYS A 1 54  ? 8.317   -18.181 9.555   1.00 0.00 ? 54  LYS A HB2  6  
ATOM 9281  H HB3  . LYS A 1 54  ? 8.257   -16.688 8.628   1.00 0.00 ? 54  LYS A HB3  6  
ATOM 9282  H HG2  . LYS A 1 54  ? 5.748   -16.735 8.985   1.00 0.00 ? 54  LYS A HG2  6  
ATOM 9283  H HG3  . LYS A 1 54  ? 6.046   -18.008 10.171  1.00 0.00 ? 54  LYS A HG3  6  
ATOM 9284  H HD2  . LYS A 1 54  ? 7.798   -16.274 11.097  1.00 0.00 ? 54  LYS A HD2  6  
ATOM 9285  H HD3  . LYS A 1 54  ? 6.762   -15.115 10.260  1.00 0.00 ? 54  LYS A HD3  6  
ATOM 9286  H HE2  . LYS A 1 54  ? 4.828   -15.954 11.505  1.00 0.00 ? 54  LYS A HE2  6  
ATOM 9287  H HE3  . LYS A 1 54  ? 5.865   -17.109 12.340  1.00 0.00 ? 54  LYS A HE3  6  
ATOM 9288  H HZ1  . LYS A 1 54  ? 7.114   -14.758 12.783  1.00 0.00 ? 54  LYS A HZ1  6  
ATOM 9289  H HZ2  . LYS A 1 54  ? 6.052   -15.509 13.864  1.00 0.00 ? 54  LYS A HZ2  6  
ATOM 9290  H HZ3  . LYS A 1 54  ? 5.486   -14.298 12.827  1.00 0.00 ? 54  LYS A HZ3  6  
ATOM 9291  N N    . ASP A 1 55  ? 7.902   -20.700 8.094   1.00 0.00 ? 55  ASP A N    6  
ATOM 9292  C CA   . ASP A 1 55  ? 7.608   -22.084 8.445   1.00 0.00 ? 55  ASP A CA   6  
ATOM 9293  C C    . ASP A 1 55  ? 7.272   -22.209 9.928   1.00 0.00 ? 55  ASP A C    6  
ATOM 9294  O O    . ASP A 1 55  ? 8.161   -22.199 10.779  1.00 0.00 ? 55  ASP A O    6  
ATOM 9295  C CB   . ASP A 1 55  ? 8.797   -22.983 8.102   1.00 0.00 ? 55  ASP A CB   6  
ATOM 9296  C CG   . ASP A 1 55  ? 8.864   -24.216 8.982   1.00 0.00 ? 55  ASP A CG   6  
ATOM 9297  O OD1  . ASP A 1 55  ? 7.804   -24.828 9.229   1.00 0.00 ? 55  ASP A OD1  6  
ATOM 9298  O OD2  . ASP A 1 55  ? 9.978   -24.569 9.423   1.00 0.00 ? 55  ASP A OD2  6  
ATOM 9299  H H    . ASP A 1 55  ? 8.829   -20.438 7.915   1.00 0.00 ? 55  ASP A H    6  
ATOM 9300  H HA   . ASP A 1 55  ? 6.752   -22.399 7.868   1.00 0.00 ? 55  ASP A HA   6  
ATOM 9301  H HB2  . ASP A 1 55  ? 8.713   -23.302 7.073   1.00 0.00 ? 55  ASP A HB2  6  
ATOM 9302  H HB3  . ASP A 1 55  ? 9.711   -22.423 8.227   1.00 0.00 ? 55  ASP A HB3  6  
ATOM 9303  N N    . GLY A 1 56  ? 5.983   -22.326 10.230  1.00 0.00 ? 56  GLY A N    6  
ATOM 9304  C CA   . GLY A 1 56  ? 5.552   -22.450 11.611  1.00 0.00 ? 56  GLY A CA   6  
ATOM 9305  C C    . GLY A 1 56  ? 5.634   -21.137 12.363  1.00 0.00 ? 56  GLY A C    6  
ATOM 9306  O O    . GLY A 1 56  ? 5.979   -20.105 11.788  1.00 0.00 ? 56  GLY A O    6  
ATOM 9307  H H    . GLY A 1 56  ? 5.318   -22.328 9.510   1.00 0.00 ? 56  GLY A H    6  
ATOM 9308  H HA2  . GLY A 1 56  ? 4.531   -22.800 11.628  1.00 0.00 ? 56  GLY A HA2  6  
ATOM 9309  H HA3  . GLY A 1 56  ? 6.180   -23.176 12.108  1.00 0.00 ? 56  GLY A HA3  6  
ATOM 9310  N N    . GLU A 1 57  ? 5.313   -21.175 13.653  1.00 0.00 ? 57  GLU A N    6  
ATOM 9311  C CA   . GLU A 1 57  ? 5.350   -19.977 14.484  1.00 0.00 ? 57  GLU A CA   6  
ATOM 9312  C C    . GLU A 1 57  ? 6.767   -19.417 14.570  1.00 0.00 ? 57  GLU A C    6  
ATOM 9313  O O    . GLU A 1 57  ? 6.994   -18.233 14.323  1.00 0.00 ? 57  GLU A O    6  
ATOM 9314  C CB   . GLU A 1 57  ? 4.826   -20.287 15.888  1.00 0.00 ? 57  GLU A CB   6  
ATOM 9315  C CG   . GLU A 1 57  ? 4.386   -19.055 16.660  1.00 0.00 ? 57  GLU A CG   6  
ATOM 9316  C CD   . GLU A 1 57  ? 4.177   -19.334 18.135  1.00 0.00 ? 57  GLU A CD   6  
ATOM 9317  O OE1  . GLU A 1 57  ? 3.203   -20.038 18.474  1.00 0.00 ? 57  GLU A OE1  6  
ATOM 9318  O OE2  . GLU A 1 57  ? 4.989   -18.848 18.951  1.00 0.00 ? 57  GLU A OE2  6  
ATOM 9319  H H    . GLU A 1 57  ? 5.045   -22.028 14.054  1.00 0.00 ? 57  GLU A H    6  
ATOM 9320  H HA   . GLU A 1 57  ? 4.710   -19.237 14.027  1.00 0.00 ? 57  GLU A HA   6  
ATOM 9321  H HB2  . GLU A 1 57  ? 3.982   -20.956 15.805  1.00 0.00 ? 57  GLU A HB2  6  
ATOM 9322  H HB3  . GLU A 1 57  ? 5.607   -20.778 16.450  1.00 0.00 ? 57  GLU A HB3  6  
ATOM 9323  H HG2  . GLU A 1 57  ? 5.144   -18.292 16.557  1.00 0.00 ? 57  GLU A HG2  6  
ATOM 9324  H HG3  . GLU A 1 57  ? 3.457   -18.696 16.241  1.00 0.00 ? 57  GLU A HG3  6  
ATOM 9325  N N    . HIS A 1 58  ? 7.716   -20.278 14.922  1.00 0.00 ? 58  HIS A N    6  
ATOM 9326  C CA   . HIS A 1 58  ? 9.112   -19.871 15.041  1.00 0.00 ? 58  HIS A CA   6  
ATOM 9327  C C    . HIS A 1 58  ? 9.817   -19.948 13.691  1.00 0.00 ? 58  HIS A C    6  
ATOM 9328  O O    . HIS A 1 58  ? 11.026  -20.164 13.622  1.00 0.00 ? 58  HIS A O    6  
ATOM 9329  C CB   . HIS A 1 58  ? 9.837   -20.750 16.060  1.00 0.00 ? 58  HIS A CB   6  
ATOM 9330  C CG   . HIS A 1 58  ? 9.733   -22.216 15.768  1.00 0.00 ? 58  HIS A CG   6  
ATOM 9331  N ND1  . HIS A 1 58  ? 10.746  -22.939 15.174  1.00 0.00 ? 58  HIS A ND1  6  
ATOM 9332  C CD2  . HIS A 1 58  ? 8.728   -23.094 15.992  1.00 0.00 ? 58  HIS A CD2  6  
ATOM 9333  C CE1  . HIS A 1 58  ? 10.368  -24.198 15.045  1.00 0.00 ? 58  HIS A CE1  6  
ATOM 9334  N NE2  . HIS A 1 58  ? 9.147   -24.319 15.534  1.00 0.00 ? 58  HIS A NE2  6  
ATOM 9335  H H    . HIS A 1 58  ? 7.473   -21.209 15.106  1.00 0.00 ? 58  HIS A H    6  
ATOM 9336  H HA   . HIS A 1 58  ? 9.130   -18.847 15.385  1.00 0.00 ? 58  HIS A HA   6  
ATOM 9337  H HB2  . HIS A 1 58  ? 10.885  -20.488 16.071  1.00 0.00 ? 58  HIS A HB2  6  
ATOM 9338  H HB3  . HIS A 1 58  ? 9.417   -20.576 17.040  1.00 0.00 ? 58  HIS A HB3  6  
ATOM 9339  H HD1  . HIS A 1 58  ? 11.612  -22.581 14.889  1.00 0.00 ? 58  HIS A HD1  6  
ATOM 9340  H HD2  . HIS A 1 58  ? 7.772   -22.873 16.447  1.00 0.00 ? 58  HIS A HD2  6  
ATOM 9341  H HE1  . HIS A 1 58  ? 10.956  -24.993 14.613  1.00 0.00 ? 58  HIS A HE1  6  
ATOM 9342  H HE2  . HIS A 1 58  ? 8.597   -25.128 15.485  1.00 0.00 ? 58  HIS A HE2  6  
ATOM 9343  N N    . GLY A 1 59  ? 9.052   -19.772 12.617  1.00 0.00 ? 59  GLY A N    6  
ATOM 9344  C CA   . GLY A 1 59  ? 9.621   -19.826 11.284  1.00 0.00 ? 59  GLY A CA   6  
ATOM 9345  C C    . GLY A 1 59  ? 10.368  -18.559 10.919  1.00 0.00 ? 59  GLY A C    6  
ATOM 9346  O O    . GLY A 1 59  ? 10.630  -17.717 11.778  1.00 0.00 ? 59  GLY A O    6  
ATOM 9347  H H    . GLY A 1 59  ? 8.094   -19.603 12.732  1.00 0.00 ? 59  GLY A H    6  
ATOM 9348  H HA2  . GLY A 1 59  ? 10.303  -20.662 11.229  1.00 0.00 ? 59  GLY A HA2  6  
ATOM 9349  H HA3  . GLY A 1 59  ? 8.824   -19.978 10.571  1.00 0.00 ? 59  GLY A HA3  6  
ATOM 9350  N N    . GLU A 1 60  ? 10.714  -18.423 9.643   1.00 0.00 ? 60  GLU A N    6  
ATOM 9351  C CA   . GLU A 1 60  ? 11.438  -17.249 9.169   1.00 0.00 ? 60  GLU A CA   6  
ATOM 9352  C C    . GLU A 1 60  ? 10.570  -16.419 8.228   1.00 0.00 ? 60  GLU A C    6  
ATOM 9353  O O    . GLU A 1 60  ? 9.987   -16.943 7.280   1.00 0.00 ? 60  GLU A O    6  
ATOM 9354  C CB   . GLU A 1 60  ? 12.725  -17.670 8.456   1.00 0.00 ? 60  GLU A CB   6  
ATOM 9355  C CG   . GLU A 1 60  ? 13.804  -18.176 9.397   1.00 0.00 ? 60  GLU A CG   6  
ATOM 9356  C CD   . GLU A 1 60  ? 14.960  -18.828 8.663   1.00 0.00 ? 60  GLU A CD   6  
ATOM 9357  O OE1  . GLU A 1 60  ? 15.441  -18.239 7.672   1.00 0.00 ? 60  GLU A OE1  6  
ATOM 9358  O OE2  . GLU A 1 60  ? 15.383  -19.927 9.078   1.00 0.00 ? 60  GLU A OE2  6  
ATOM 9359  H H    . GLU A 1 60  ? 10.477  -19.129 9.006   1.00 0.00 ? 60  GLU A H    6  
ATOM 9360  H HA   . GLU A 1 60  ? 11.693  -16.648 10.028  1.00 0.00 ? 60  GLU A HA   6  
ATOM 9361  H HB2  . GLU A 1 60  ? 12.492  -18.455 7.752   1.00 0.00 ? 60  GLU A HB2  6  
ATOM 9362  H HB3  . GLU A 1 60  ? 13.117  -16.821 7.916   1.00 0.00 ? 60  GLU A HB3  6  
ATOM 9363  H HG2  . GLU A 1 60  ? 14.186  -17.343 9.969   1.00 0.00 ? 60  GLU A HG2  6  
ATOM 9364  H HG3  . GLU A 1 60  ? 13.368  -18.902 10.068  1.00 0.00 ? 60  GLU A HG3  6  
ATOM 9365  N N    . GLU A 1 61  ? 10.490  -15.120 8.498   1.00 0.00 ? 61  GLU A N    6  
ATOM 9366  C CA   . GLU A 1 61  ? 9.693   -14.217 7.677   1.00 0.00 ? 61  GLU A CA   6  
ATOM 9367  C C    . GLU A 1 61  ? 10.331  -14.023 6.304   1.00 0.00 ? 61  GLU A C    6  
ATOM 9368  O O    . GLU A 1 61  ? 11.491  -13.625 6.199   1.00 0.00 ? 61  GLU A O    6  
ATOM 9369  C CB   . GLU A 1 61  ? 9.534   -12.863 8.373   1.00 0.00 ? 61  GLU A CB   6  
ATOM 9370  C CG   . GLU A 1 61  ? 8.573   -12.894 9.550   1.00 0.00 ? 61  GLU A CG   6  
ATOM 9371  C CD   . GLU A 1 61  ? 8.875   -11.820 10.577  1.00 0.00 ? 61  GLU A CD   6  
ATOM 9372  O OE1  . GLU A 1 61  ? 9.750   -12.052 11.437  1.00 0.00 ? 61  GLU A OE1  6  
ATOM 9373  O OE2  . GLU A 1 61  ? 8.237   -10.748 10.521  1.00 0.00 ? 61  GLU A OE2  6  
ATOM 9374  H H    . GLU A 1 61  ? 10.978  -14.760 9.269   1.00 0.00 ? 61  GLU A H    6  
ATOM 9375  H HA   . GLU A 1 61  ? 8.717   -14.660 7.547   1.00 0.00 ? 61  GLU A HA   6  
ATOM 9376  H HB2  . GLU A 1 61  ? 10.500  -12.541 8.731   1.00 0.00 ? 61  GLU A HB2  6  
ATOM 9377  H HB3  . GLU A 1 61  ? 9.168   -12.144 7.655   1.00 0.00 ? 61  GLU A HB3  6  
ATOM 9378  H HG2  . GLU A 1 61  ? 7.569   -12.746 9.182   1.00 0.00 ? 61  GLU A HG2  6  
ATOM 9379  H HG3  . GLU A 1 61  ? 8.642   -13.859 10.030  1.00 0.00 ? 61  GLU A HG3  6  
ATOM 9380  N N    . GLN A 1 62  ? 9.565   -14.308 5.256   1.00 0.00 ? 62  GLN A N    6  
ATOM 9381  C CA   . GLN A 1 62  ? 10.057  -14.166 3.891   1.00 0.00 ? 62  GLN A CA   6  
ATOM 9382  C C    . GLN A 1 62  ? 9.118   -13.296 3.062   1.00 0.00 ? 62  GLN A C    6  
ATOM 9383  O O    . GLN A 1 62  ? 7.921   -13.569 2.972   1.00 0.00 ? 62  GLN A O    6  
ATOM 9384  C CB   . GLN A 1 62  ? 10.208  -15.540 3.236   1.00 0.00 ? 62  GLN A CB   6  
ATOM 9385  C CG   . GLN A 1 62  ? 11.087  -16.497 4.026   1.00 0.00 ? 62  GLN A CG   6  
ATOM 9386  C CD   . GLN A 1 62  ? 11.725  -17.559 3.152   1.00 0.00 ? 62  GLN A CD   6  
ATOM 9387  O OE1  . GLN A 1 62  ? 12.612  -17.269 2.349   1.00 0.00 ? 62  GLN A OE1  6  
ATOM 9388  N NE2  . GLN A 1 62  ? 11.276  -18.800 3.305   1.00 0.00 ? 62  GLN A NE2  6  
ATOM 9389  H H    . GLN A 1 62  ? 8.649   -14.621 5.405   1.00 0.00 ? 62  GLN A H    6  
ATOM 9390  H HA   . GLN A 1 62  ? 11.024  -13.690 3.934   1.00 0.00 ? 62  GLN A HA   6  
ATOM 9391  H HB2  . GLN A 1 62  ? 9.231   -15.986 3.131   1.00 0.00 ? 62  GLN A HB2  6  
ATOM 9392  H HB3  . GLN A 1 62  ? 10.644  -15.413 2.256   1.00 0.00 ? 62  GLN A HB3  6  
ATOM 9393  H HG2  . GLN A 1 62  ? 11.871  -15.931 4.507   1.00 0.00 ? 62  GLN A HG2  6  
ATOM 9394  H HG3  . GLN A 1 62  ? 10.482  -16.984 4.776   1.00 0.00 ? 62  GLN A HG3  6  
ATOM 9395  H HE21 . GLN A 1 62  ? 10.566  -18.957 3.964   1.00 0.00 ? 62  GLN A HE21 6  
ATOM 9396  H HE22 . GLN A 1 62  ? 11.670  -19.506 2.753   1.00 0.00 ? 62  GLN A HE22 6  
ATOM 9397  N N    . ARG A 1 63  ? 9.669   -12.248 2.459   1.00 0.00 ? 63  ARG A N    6  
ATOM 9398  C CA   . ARG A 1 63  ? 8.880   -11.336 1.639   1.00 0.00 ? 63  ARG A CA   6  
ATOM 9399  C C    . ARG A 1 63  ? 9.006   -11.688 0.159   1.00 0.00 ? 63  ARG A C    6  
ATOM 9400  O O    . ARG A 1 63  ? 10.109  -11.897 -0.347  1.00 0.00 ? 63  ARG A O    6  
ATOM 9401  C CB   . ARG A 1 63  ? 9.327   -9.891  1.870   1.00 0.00 ? 63  ARG A CB   6  
ATOM 9402  C CG   . ARG A 1 63  ? 9.212   -9.442  3.317   1.00 0.00 ? 63  ARG A CG   6  
ATOM 9403  C CD   . ARG A 1 63  ? 10.233  -8.366  3.650   1.00 0.00 ? 63  ARG A CD   6  
ATOM 9404  N NE   . ARG A 1 63  ? 9.716   -7.024  3.400   1.00 0.00 ? 63  ARG A NE   6  
ATOM 9405  C CZ   . ARG A 1 63  ? 10.358  -5.913  3.742   1.00 0.00 ? 63  ARG A CZ   6  
ATOM 9406  N NH1  . ARG A 1 63  ? 11.537  -5.984  4.345   1.00 0.00 ? 63  ARG A NH1  6  
ATOM 9407  N NH2  . ARG A 1 63  ? 9.822   -4.727  3.480   1.00 0.00 ? 63  ARG A NH2  6  
ATOM 9408  H H    . ARG A 1 63  ? 10.629  -12.082 2.569   1.00 0.00 ? 63  ARG A H    6  
ATOM 9409  H HA   . ARG A 1 63  ? 7.846   -11.435 1.933   1.00 0.00 ? 63  ARG A HA   6  
ATOM 9410  H HB2  . ARG A 1 63  ? 10.359  -9.793  1.567   1.00 0.00 ? 63  ARG A HB2  6  
ATOM 9411  H HB3  . ARG A 1 63  ? 8.719   -9.238  1.263   1.00 0.00 ? 63  ARG A HB3  6  
ATOM 9412  H HG2  . ARG A 1 63  ? 8.221   -9.046  3.484   1.00 0.00 ? 63  ARG A HG2  6  
ATOM 9413  H HG3  . ARG A 1 63  ? 9.374   -10.293 3.962   1.00 0.00 ? 63  ARG A HG3  6  
ATOM 9414  H HD2  . ARG A 1 63  ? 10.499  -8.451  4.693   1.00 0.00 ? 63  ARG A HD2  6  
ATOM 9415  H HD3  . ARG A 1 63  ? 11.112  -8.523  3.042   1.00 0.00 ? 63  ARG A HD3  6  
ATOM 9416  H HE   . ARG A 1 63  ? 8.846   -6.948  2.955   1.00 0.00 ? 63  ARG A HE   6  
ATOM 9417  H HH11 . ARG A 1 63  ? 11.944  -6.875  4.542   1.00 0.00 ? 63  ARG A HH11 6  
ATOM 9418  H HH12 . ARG A 1 63  ? 12.019  -5.146  4.601   1.00 0.00 ? 63  ARG A HH12 6  
ATOM 9419  H HH21 . ARG A 1 63  ? 8.934   -4.670  3.026   1.00 0.00 ? 63  ARG A HH21 6  
ATOM 9420  H HH22 . ARG A 1 63  ? 10.307  -3.892  3.739   1.00 0.00 ? 63  ARG A HH22 6  
ATOM 9421  N N    . ILE A 1 64  ? 7.870   -11.754 -0.527  1.00 0.00 ? 64  ILE A N    6  
ATOM 9422  C CA   . ILE A 1 64  ? 7.854   -12.080 -1.947  1.00 0.00 ? 64  ILE A CA   6  
ATOM 9423  C C    . ILE A 1 64  ? 7.339   -10.908 -2.775  1.00 0.00 ? 64  ILE A C    6  
ATOM 9424  O O    . ILE A 1 64  ? 6.430   -10.190 -2.357  1.00 0.00 ? 64  ILE A O    6  
ATOM 9425  C CB   . ILE A 1 64  ? 6.981   -13.317 -2.231  1.00 0.00 ? 64  ILE A CB   6  
ATOM 9426  C CG1  . ILE A 1 64  ? 7.410   -14.486 -1.341  1.00 0.00 ? 64  ILE A CG1  6  
ATOM 9427  C CG2  . ILE A 1 64  ? 7.069   -13.702 -3.700  1.00 0.00 ? 64  ILE A CG2  6  
ATOM 9428  C CD1  . ILE A 1 64  ? 6.491   -15.684 -1.433  1.00 0.00 ? 64  ILE A CD1  6  
ATOM 9429  H H    . ILE A 1 64  ? 7.023   -11.578 -0.067  1.00 0.00 ? 64  ILE A H    6  
ATOM 9430  H HA   . ILE A 1 64  ? 8.867   -12.303 -2.249  1.00 0.00 ? 64  ILE A HA   6  
ATOM 9431  H HB   . ILE A 1 64  ? 5.955   -13.064 -2.011  1.00 0.00 ? 64  ILE A HB   6  
ATOM 9432  H HG12 . ILE A 1 64  ? 8.399   -14.804 -1.628  1.00 0.00 ? 64  ILE A HG12 6  
ATOM 9433  H HG13 . ILE A 1 64  ? 7.426   -14.157 -0.312  1.00 0.00 ? 64  ILE A HG13 6  
ATOM 9434  H HG21 . ILE A 1 64  ? 8.008   -14.204 -3.884  1.00 0.00 ? 64  ILE A HG21 6  
ATOM 9435  H HG22 . ILE A 1 64  ? 6.254   -14.365 -3.948  1.00 0.00 ? 64  ILE A HG22 6  
ATOM 9436  H HG23 . ILE A 1 64  ? 7.011   -12.813 -4.310  1.00 0.00 ? 64  ILE A HG23 6  
ATOM 9437  H HD11 . ILE A 1 64  ? 7.045   -16.582 -1.202  1.00 0.00 ? 64  ILE A HD11 6  
ATOM 9438  H HD12 . ILE A 1 64  ? 5.678   -15.570 -0.732  1.00 0.00 ? 64  ILE A HD12 6  
ATOM 9439  H HD13 . ILE A 1 64  ? 6.094   -15.756 -2.436  1.00 0.00 ? 64  ILE A HD13 6  
ATOM 9440  N N    . THR A 1 65  ? 7.925   -10.719 -3.953  1.00 0.00 ? 65  THR A N    6  
ATOM 9441  C CA   . THR A 1 65  ? 7.525   -9.635  -4.841  1.00 0.00 ? 65  THR A CA   6  
ATOM 9442  C C    . THR A 1 65  ? 6.243   -9.981  -5.589  1.00 0.00 ? 65  THR A C    6  
ATOM 9443  O O    . THR A 1 65  ? 6.283   -10.591 -6.658  1.00 0.00 ? 65  THR A O    6  
ATOM 9444  C CB   . THR A 1 65  ? 8.631   -9.309  -5.863  1.00 0.00 ? 65  THR A CB   6  
ATOM 9445  O OG1  . THR A 1 65  ? 9.849   -8.988  -5.182  1.00 0.00 ? 65  THR A OG1  6  
ATOM 9446  C CG2  . THR A 1 65  ? 8.220   -8.146  -6.753  1.00 0.00 ? 65  THR A CG2  6  
ATOM 9447  H H    . THR A 1 65  ? 8.643   -11.325 -4.231  1.00 0.00 ? 65  THR A H    6  
ATOM 9448  H HA   . THR A 1 65  ? 7.352   -8.756  -4.237  1.00 0.00 ? 65  THR A HA   6  
ATOM 9449  H HB   . THR A 1 65  ? 8.793   -10.178 -6.484  1.00 0.00 ? 65  THR A HB   6  
ATOM 9450  H HG1  . THR A 1 65  ? 9.775   -8.114  -4.789  1.00 0.00 ? 65  THR A HG1  6  
ATOM 9451  H HG21 . THR A 1 65  ? 8.026   -8.507  -7.752  1.00 0.00 ? 65  THR A HG21 6  
ATOM 9452  H HG22 . THR A 1 65  ? 9.015   -7.416  -6.782  1.00 0.00 ? 65  THR A HG22 6  
ATOM 9453  H HG23 . THR A 1 65  ? 7.326   -7.688  -6.356  1.00 0.00 ? 65  THR A HG23 6  
ATOM 9454  N N    . ILE A 1 66  ? 5.108   -9.588  -5.022  1.00 0.00 ? 66  ILE A N    6  
ATOM 9455  C CA   . ILE A 1 66  ? 3.814   -9.855  -5.638  1.00 0.00 ? 66  ILE A CA   6  
ATOM 9456  C C    . ILE A 1 66  ? 3.396   -8.713  -6.558  1.00 0.00 ? 66  ILE A C    6  
ATOM 9457  O O    . ILE A 1 66  ? 3.741   -7.556  -6.322  1.00 0.00 ? 66  ILE A O    6  
ATOM 9458  C CB   . ILE A 1 66  ? 2.719   -10.071 -4.576  1.00 0.00 ? 66  ILE A CB   6  
ATOM 9459  C CG1  . ILE A 1 66  ? 3.321   -10.683 -3.309  1.00 0.00 ? 66  ILE A CG1  6  
ATOM 9460  C CG2  . ILE A 1 66  ? 1.615   -10.960 -5.128  1.00 0.00 ? 66  ILE A CG2  6  
ATOM 9461  C CD1  . ILE A 1 66  ? 2.285   -11.088 -2.284  1.00 0.00 ? 66  ILE A CD1  6  
ATOM 9462  H H    . ILE A 1 66  ? 5.141   -9.105  -4.170  1.00 0.00 ? 66  ILE A H    6  
ATOM 9463  H HA   . ILE A 1 66  ? 3.904   -10.759 -6.222  1.00 0.00 ? 66  ILE A HA   6  
ATOM 9464  H HB   . ILE A 1 66  ? 2.289   -9.111  -4.335  1.00 0.00 ? 66  ILE A HB   6  
ATOM 9465  H HG12 . ILE A 1 66  ? 3.885   -11.563 -3.575  1.00 0.00 ? 66  ILE A HG12 6  
ATOM 9466  H HG13 . ILE A 1 66  ? 3.981   -9.962  -2.849  1.00 0.00 ? 66  ILE A HG13 6  
ATOM 9467  H HG21 . ILE A 1 66  ? 0.654   -10.563 -4.836  1.00 0.00 ? 66  ILE A HG21 6  
ATOM 9468  H HG22 . ILE A 1 66  ? 1.680   -10.988 -6.205  1.00 0.00 ? 66  ILE A HG22 6  
ATOM 9469  H HG23 . ILE A 1 66  ? 1.726   -11.959 -4.734  1.00 0.00 ? 66  ILE A HG23 6  
ATOM 9470  H HD11 . ILE A 1 66  ? 1.316   -10.716 -2.583  1.00 0.00 ? 66  ILE A HD11 6  
ATOM 9471  H HD12 . ILE A 1 66  ? 2.252   -12.164 -2.210  1.00 0.00 ? 66  ILE A HD12 6  
ATOM 9472  H HD13 . ILE A 1 66  ? 2.548   -10.670 -1.322  1.00 0.00 ? 66  ILE A HD13 6  
ATOM 9473  N N    . GLU A 1 67  ? 2.650   -9.047  -7.606  1.00 0.00 ? 67  GLU A N    6  
ATOM 9474  C CA   . GLU A 1 67  ? 2.184   -8.048  -8.560  1.00 0.00 ? 67  GLU A CA   6  
ATOM 9475  C C    . GLU A 1 67  ? 1.012   -7.255  -7.990  1.00 0.00 ? 67  GLU A C    6  
ATOM 9476  O O    . GLU A 1 67  ? 0.182   -7.775  -7.244  1.00 0.00 ? 67  GLU A O    6  
ATOM 9477  C CB   . GLU A 1 67  ? 1.770   -8.718  -9.872  1.00 0.00 ? 67  GLU A CB   6  
ATOM 9478  C CG   . GLU A 1 67  ? 2.940   -9.052  -10.781 1.00 0.00 ? 67  GLU A CG   6  
ATOM 9479  C CD   . GLU A 1 67  ? 2.654   -10.228 -11.695 1.00 0.00 ? 67  GLU A CD   6  
ATOM 9480  O OE1  . GLU A 1 67  ? 2.087   -10.006 -12.786 1.00 0.00 ? 67  GLU A OE1  6  
ATOM 9481  O OE2  . GLU A 1 67  ? 2.995   -11.368 -11.319 1.00 0.00 ? 67  GLU A OE2  6  
ATOM 9482  H H    . GLU A 1 67  ? 2.407   -9.987  -7.740  1.00 0.00 ? 67  GLU A H    6  
ATOM 9483  H HA   . GLU A 1 67  ? 3.001   -7.370  -8.756  1.00 0.00 ? 67  GLU A HA   6  
ATOM 9484  H HB2  . GLU A 1 67  ? 1.245   -9.634  -9.644  1.00 0.00 ? 67  GLU A HB2  6  
ATOM 9485  H HB3  . GLU A 1 67  ? 1.104   -8.056  -10.406 1.00 0.00 ? 67  GLU A HB3  6  
ATOM 9486  H HG2  . GLU A 1 67  ? 3.163   -8.189  -11.391 1.00 0.00 ? 67  GLU A HG2  6  
ATOM 9487  H HG3  . GLU A 1 67  ? 3.798   -9.290  -10.170 1.00 0.00 ? 67  GLU A HG3  6  
ATOM 9488  N N    . PRO A 1 68  ? 0.941   -5.964  -8.347  1.00 0.00 ? 68  PRO A N    6  
ATOM 9489  C CA   . PRO A 1 68  ? -0.124  -5.071  -7.883  1.00 0.00 ? 68  PRO A CA   6  
ATOM 9490  C C    . PRO A 1 68  ? -1.477  -5.416  -8.494  1.00 0.00 ? 68  PRO A C    6  
ATOM 9491  O O    . PRO A 1 68  ? -1.918  -4.779  -9.451  1.00 0.00 ? 68  PRO A O    6  
ATOM 9492  C CB   . PRO A 1 68  ? 0.340   -3.690  -8.354  1.00 0.00 ? 68  PRO A CB   6  
ATOM 9493  C CG   . PRO A 1 68  ? 1.221   -3.966  -9.523  1.00 0.00 ? 68  PRO A CG   6  
ATOM 9494  C CD   . PRO A 1 68  ? 1.896   -5.277  -9.233  1.00 0.00 ? 68  PRO A CD   6  
ATOM 9495  H HA   . PRO A 1 68  ? -0.205  -5.077  -6.806  1.00 0.00 ? 68  PRO A HA   6  
ATOM 9496  H HB2  . PRO A 1 68  ? -0.518  -3.097  -8.636  1.00 0.00 ? 68  PRO A HB2  6  
ATOM 9497  H HB3  . PRO A 1 68  ? 0.881   -3.198  -7.560  1.00 0.00 ? 68  PRO A HB3  6  
ATOM 9498  H HG2  . PRO A 1 68  ? 0.626   -4.040  -10.421 1.00 0.00 ? 68  PRO A HG2  6  
ATOM 9499  H HG3  . PRO A 1 68  ? 1.955   -3.180  -9.622  1.00 0.00 ? 68  PRO A HG3  6  
ATOM 9500  H HD2  . PRO A 1 68  ? 2.045   -5.835  -10.146 1.00 0.00 ? 68  PRO A HD2  6  
ATOM 9501  H HD3  . PRO A 1 68  ? 2.838   -5.114  -8.731  1.00 0.00 ? 68  PRO A HD3  6  
ATOM 9502  N N    . GLY A 1 69  ? -2.134  -6.428  -7.936  1.00 0.00 ? 69  GLY A N    6  
ATOM 9503  C CA   . GLY A 1 69  ? -3.431  -6.840  -8.440  1.00 0.00 ? 69  GLY A CA   6  
ATOM 9504  C C    . GLY A 1 69  ? -4.439  -7.066  -7.331  1.00 0.00 ? 69  GLY A C    6  
ATOM 9505  O O    . GLY A 1 69  ? -4.603  -6.223  -6.448  1.00 0.00 ? 69  GLY A O    6  
ATOM 9506  H H    . GLY A 1 69  ? -1.734  -6.900  -7.175  1.00 0.00 ? 69  GLY A H    6  
ATOM 9507  H HA2  . GLY A 1 69  ? -3.807  -6.074  -9.103  1.00 0.00 ? 69  GLY A HA2  6  
ATOM 9508  H HA3  . GLY A 1 69  ? -3.314  -7.758  -8.996  1.00 0.00 ? 69  GLY A HA3  6  
ATOM 9509  N N    . THR A 1 70  ? -5.119  -8.208  -7.375  1.00 0.00 ? 70  THR A N    6  
ATOM 9510  C CA   . THR A 1 70  ? -6.118  -8.541  -6.368  1.00 0.00 ? 70  THR A CA   6  
ATOM 9511  C C    . THR A 1 70  ? -5.838  -9.905  -5.746  1.00 0.00 ? 70  THR A C    6  
ATOM 9512  O O    . THR A 1 70  ? -6.039  -10.104 -4.548  1.00 0.00 ? 70  THR A O    6  
ATOM 9513  C CB   . THR A 1 70  ? -7.538  -8.544  -6.965  1.00 0.00 ? 70  THR A CB   6  
ATOM 9514  O OG1  . THR A 1 70  ? -7.582  -9.389  -8.120  1.00 0.00 ? 70  THR A OG1  6  
ATOM 9515  C CG2  . THR A 1 70  ? -7.969  -7.135  -7.344  1.00 0.00 ? 70  THR A CG2  6  
ATOM 9516  H H    . THR A 1 70  ? -4.944  -8.839  -8.104  1.00 0.00 ? 70  THR A H    6  
ATOM 9517  H HA   . THR A 1 70  ? -6.077  -7.788  -5.595  1.00 0.00 ? 70  THR A HA   6  
ATOM 9518  H HB   . THR A 1 70  ? -8.224  -8.927  -6.222  1.00 0.00 ? 70  THR A HB   6  
ATOM 9519  H HG1  . THR A 1 70  ? -7.249  -8.908  -8.881  1.00 0.00 ? 70  THR A HG1  6  
ATOM 9520  H HG21 . THR A 1 70  ? -7.101  -6.494  -7.391  1.00 0.00 ? 70  THR A HG21 6  
ATOM 9521  H HG22 . THR A 1 70  ? -8.657  -6.757  -6.603  1.00 0.00 ? 70  THR A HG22 6  
ATOM 9522  H HG23 . THR A 1 70  ? -8.454  -7.155  -8.309  1.00 0.00 ? 70  THR A HG23 6  
ATOM 9523  N N    . SER A 1 71  ? -5.372  -10.840 -6.567  1.00 0.00 ? 71  SER A N    6  
ATOM 9524  C CA   . SER A 1 71  ? -5.067  -12.186 -6.098  1.00 0.00 ? 71  SER A CA   6  
ATOM 9525  C C    . SER A 1 71  ? -3.689  -12.631 -6.580  1.00 0.00 ? 71  SER A C    6  
ATOM 9526  O O    . SER A 1 71  ? -3.168  -12.112 -7.567  1.00 0.00 ? 71  SER A O    6  
ATOM 9527  C CB   . SER A 1 71  ? -6.132  -13.172 -6.582  1.00 0.00 ? 71  SER A CB   6  
ATOM 9528  O OG   . SER A 1 71  ? -6.286  -13.106 -7.989  1.00 0.00 ? 71  SER A OG   6  
ATOM 9529  H H    . SER A 1 71  ? -5.233  -10.620 -7.512  1.00 0.00 ? 71  SER A H    6  
ATOM 9530  H HA   . SER A 1 71  ? -5.069  -12.169 -5.018  1.00 0.00 ? 71  SER A HA   6  
ATOM 9531  H HB2  . SER A 1 71  ? -5.840  -14.175 -6.311  1.00 0.00 ? 71  SER A HB2  6  
ATOM 9532  H HB3  . SER A 1 71  ? -7.077  -12.933 -6.117  1.00 0.00 ? 71  SER A HB3  6  
ATOM 9533  H HG   . SER A 1 71  ? -5.655  -13.696 -8.408  1.00 0.00 ? 71  SER A HG   6  
ATOM 9534  N N    . TYR A 1 72  ? -3.106  -13.595 -5.877  1.00 0.00 ? 72  TYR A N    6  
ATOM 9535  C CA   . TYR A 1 72  ? -1.788  -14.108 -6.231  1.00 0.00 ? 72  TYR A CA   6  
ATOM 9536  C C    . TYR A 1 72  ? -1.728  -15.623 -6.055  1.00 0.00 ? 72  TYR A C    6  
ATOM 9537  O O    . TYR A 1 72  ? -2.502  -16.201 -5.292  1.00 0.00 ? 72  TYR A O    6  
ATOM 9538  C CB   . TYR A 1 72  ? -0.711  -13.442 -5.374  1.00 0.00 ? 72  TYR A CB   6  
ATOM 9539  C CG   . TYR A 1 72  ? 0.668   -14.033 -5.566  1.00 0.00 ? 72  TYR A CG   6  
ATOM 9540  C CD1  . TYR A 1 72  ? 1.445   -13.691 -6.666  1.00 0.00 ? 72  TYR A CD1  6  
ATOM 9541  C CD2  . TYR A 1 72  ? 1.193   -14.932 -4.647  1.00 0.00 ? 72  TYR A CD2  6  
ATOM 9542  C CE1  . TYR A 1 72  ? 2.704   -14.229 -6.846  1.00 0.00 ? 72  TYR A CE1  6  
ATOM 9543  C CE2  . TYR A 1 72  ? 2.453   -15.474 -4.818  1.00 0.00 ? 72  TYR A CE2  6  
ATOM 9544  C CZ   . TYR A 1 72  ? 3.204   -15.120 -5.919  1.00 0.00 ? 72  TYR A CZ   6  
ATOM 9545  O OH   . TYR A 1 72  ? 4.459   -15.657 -6.093  1.00 0.00 ? 72  TYR A OH   6  
ATOM 9546  H H    . TYR A 1 72  ? -3.572  -13.969 -5.100  1.00 0.00 ? 72  TYR A H    6  
ATOM 9547  H HA   . TYR A 1 72  ? -1.607  -13.870 -7.269  1.00 0.00 ? 72  TYR A HA   6  
ATOM 9548  H HB2  . TYR A 1 72  ? -0.659  -12.393 -5.624  1.00 0.00 ? 72  TYR A HB2  6  
ATOM 9549  H HB3  . TYR A 1 72  ? -0.974  -13.545 -4.331  1.00 0.00 ? 72  TYR A HB3  6  
ATOM 9550  H HD1  . TYR A 1 72  ? 1.050   -12.992 -7.390  1.00 0.00 ? 72  TYR A HD1  6  
ATOM 9551  H HD2  . TYR A 1 72  ? 0.603   -15.208 -3.785  1.00 0.00 ? 72  TYR A HD2  6  
ATOM 9552  H HE1  . TYR A 1 72  ? 3.293   -13.951 -7.707  1.00 0.00 ? 72  TYR A HE1  6  
ATOM 9553  H HE2  . TYR A 1 72  ? 2.844   -16.172 -4.092  1.00 0.00 ? 72  TYR A HE2  6  
ATOM 9554  H HH   . TYR A 1 72  ? 4.673   -16.219 -5.345  1.00 0.00 ? 72  TYR A HH   6  
ATOM 9555  N N    . ARG A 1 73  ? -0.803  -16.258 -6.766  1.00 0.00 ? 73  ARG A N    6  
ATOM 9556  C CA   . ARG A 1 73  ? -0.642  -17.705 -6.691  1.00 0.00 ? 73  ARG A CA   6  
ATOM 9557  C C    . ARG A 1 73  ? 0.767   -18.072 -6.233  1.00 0.00 ? 73  ARG A C    6  
ATOM 9558  O O    . ARG A 1 73  ? 1.740   -17.872 -6.963  1.00 0.00 ? 73  ARG A O    6  
ATOM 9559  C CB   . ARG A 1 73  ? -0.930  -18.344 -8.050  1.00 0.00 ? 73  ARG A CB   6  
ATOM 9560  C CG   . ARG A 1 73  ? -1.005  -19.862 -8.007  1.00 0.00 ? 73  ARG A CG   6  
ATOM 9561  C CD   . ARG A 1 73  ? -1.358  -20.441 -9.368  1.00 0.00 ? 73  ARG A CD   6  
ATOM 9562  N NE   . ARG A 1 73  ? -2.802  -20.500 -9.580  1.00 0.00 ? 73  ARG A NE   6  
ATOM 9563  C CZ   . ARG A 1 73  ? -3.380  -21.284 -10.483 1.00 0.00 ? 73  ARG A CZ   6  
ATOM 9564  N NH1  . ARG A 1 73  ? -2.642  -22.071 -11.253 1.00 0.00 ? 73  ARG A NH1  6  
ATOM 9565  N NH2  . ARG A 1 73  ? -4.701  -21.282 -10.616 1.00 0.00 ? 73  ARG A NH2  6  
ATOM 9566  H H    . ARG A 1 73  ? -0.216  -15.742 -7.357  1.00 0.00 ? 73  ARG A H    6  
ATOM 9567  H HA   . ARG A 1 73  ? -1.351  -18.081 -5.968  1.00 0.00 ? 73  ARG A HA   6  
ATOM 9568  H HB2  . ARG A 1 73  ? -1.875  -17.970 -8.418  1.00 0.00 ? 73  ARG A HB2  6  
ATOM 9569  H HB3  . ARG A 1 73  ? -0.148  -18.064 -8.739  1.00 0.00 ? 73  ARG A HB3  6  
ATOM 9570  H HG2  . ARG A 1 73  ? -0.046  -20.252 -7.699  1.00 0.00 ? 73  ARG A HG2  6  
ATOM 9571  H HG3  . ARG A 1 73  ? -1.761  -20.155 -7.293  1.00 0.00 ? 73  ARG A HG3  6  
ATOM 9572  H HD2  . ARG A 1 73  ? -0.917  -19.821 -10.134 1.00 0.00 ? 73  ARG A HD2  6  
ATOM 9573  H HD3  . ARG A 1 73  ? -0.952  -21.440 -9.434  1.00 0.00 ? 73  ARG A HD3  6  
ATOM 9574  H HE   . ARG A 1 73  ? -3.366  -19.927 -9.021  1.00 0.00 ? 73  ARG A HE   6  
ATOM 9575  H HH11 . ARG A 1 73  ? -1.647  -22.076 -11.154 1.00 0.00 ? 73  ARG A HH11 6  
ATOM 9576  H HH12 . ARG A 1 73  ? -3.080  -22.661 -11.931 1.00 0.00 ? 73  ARG A HH12 6  
ATOM 9577  H HH21 . ARG A 1 73  ? -5.261  -20.691 -10.037 1.00 0.00 ? 73  ARG A HH21 6  
ATOM 9578  H HH22 . ARG A 1 73  ? -5.135  -21.872 -11.296 1.00 0.00 ? 73  ARG A HH22 6  
ATOM 9579  N N    . LEU A 1 74  ? 0.870   -18.607 -5.022  1.00 0.00 ? 74  LEU A N    6  
ATOM 9580  C CA   . LEU A 1 74  ? 2.160   -19.002 -4.467  1.00 0.00 ? 74  LEU A CA   6  
ATOM 9581  C C    . LEU A 1 74  ? 2.401   -20.496 -4.656  1.00 0.00 ? 74  LEU A C    6  
ATOM 9582  O O    . LEU A 1 74  ? 1.575   -21.321 -4.267  1.00 0.00 ? 74  LEU A O    6  
ATOM 9583  C CB   . LEU A 1 74  ? 2.227   -18.647 -2.980  1.00 0.00 ? 74  LEU A CB   6  
ATOM 9584  C CG   . LEU A 1 74  ? 3.533   -18.996 -2.265  1.00 0.00 ? 74  LEU A CG   6  
ATOM 9585  C CD1  . LEU A 1 74  ? 4.683   -18.170 -2.820  1.00 0.00 ? 74  LEU A CD1  6  
ATOM 9586  C CD2  . LEU A 1 74  ? 3.394   -18.780 -0.765  1.00 0.00 ? 74  LEU A CD2  6  
ATOM 9587  H H    . LEU A 1 74  ? 0.060   -18.742 -4.488  1.00 0.00 ? 74  LEU A H    6  
ATOM 9588  H HA   . LEU A 1 74  ? 2.928   -18.456 -4.994  1.00 0.00 ? 74  LEU A HA   6  
ATOM 9589  H HB2  . LEU A 1 74  ? 2.073   -17.583 -2.887  1.00 0.00 ? 74  LEU A HB2  6  
ATOM 9590  H HB3  . LEU A 1 74  ? 1.424   -19.170 -2.480  1.00 0.00 ? 74  LEU A HB3  6  
ATOM 9591  H HG   . LEU A 1 74  ? 3.760   -20.040 -2.434  1.00 0.00 ? 74  LEU A HG   6  
ATOM 9592  H HD11 . LEU A 1 74  ? 4.868   -17.329 -2.170  1.00 0.00 ? 74  LEU A HD11 6  
ATOM 9593  H HD12 . LEU A 1 74  ? 4.426   -17.813 -3.807  1.00 0.00 ? 74  LEU A HD12 6  
ATOM 9594  H HD13 . LEU A 1 74  ? 5.570   -18.783 -2.879  1.00 0.00 ? 74  LEU A HD13 6  
ATOM 9595  H HD21 . LEU A 1 74  ? 3.223   -19.730 -0.280  1.00 0.00 ? 74  LEU A HD21 6  
ATOM 9596  H HD22 . LEU A 1 74  ? 2.559   -18.122 -0.572  1.00 0.00 ? 74  LEU A HD22 6  
ATOM 9597  H HD23 . LEU A 1 74  ? 4.300   -18.336 -0.380  1.00 0.00 ? 74  LEU A HD23 6  
ATOM 9598  N N    . GLN A 1 75  ? 3.538   -20.835 -5.255  1.00 0.00 ? 75  GLN A N    6  
ATOM 9599  C CA   . GLN A 1 75  ? 3.888   -22.230 -5.494  1.00 0.00 ? 75  GLN A CA   6  
ATOM 9600  C C    . GLN A 1 75  ? 5.229   -22.573 -4.854  1.00 0.00 ? 75  GLN A C    6  
ATOM 9601  O O    . GLN A 1 75  ? 6.035   -21.689 -4.568  1.00 0.00 ? 75  GLN A O    6  
ATOM 9602  C CB   . GLN A 1 75  ? 3.939   -22.515 -6.996  1.00 0.00 ? 75  GLN A CB   6  
ATOM 9603  C CG   . GLN A 1 75  ? 2.624   -22.246 -7.711  1.00 0.00 ? 75  GLN A CG   6  
ATOM 9604  C CD   . GLN A 1 75  ? 2.701   -22.528 -9.199  1.00 0.00 ? 75  GLN A CD   6  
ATOM 9605  O OE1  . GLN A 1 75  ? 2.116   -23.494 -9.690  1.00 0.00 ? 75  GLN A OE1  6  
ATOM 9606  N NE2  . GLN A 1 75  ? 3.423   -21.684 -9.926  1.00 0.00 ? 75  GLN A NE2  6  
ATOM 9607  H H    . GLN A 1 75  ? 4.155   -20.132 -5.543  1.00 0.00 ? 75  GLN A H    6  
ATOM 9608  H HA   . GLN A 1 75  ? 3.122   -22.845 -5.047  1.00 0.00 ? 75  GLN A HA   6  
ATOM 9609  H HB2  . GLN A 1 75  ? 4.700   -21.894 -7.443  1.00 0.00 ? 75  GLN A HB2  6  
ATOM 9610  H HB3  . GLN A 1 75  ? 4.198   -23.553 -7.146  1.00 0.00 ? 75  GLN A HB3  6  
ATOM 9611  H HG2  . GLN A 1 75  ? 1.859   -22.875 -7.281  1.00 0.00 ? 75  GLN A HG2  6  
ATOM 9612  H HG3  . GLN A 1 75  ? 2.358   -21.209 -7.569  1.00 0.00 ? 75  GLN A HG3  6  
ATOM 9613  H HE21 . GLN A 1 75  ? 3.862   -20.937 -9.466  1.00 0.00 ? 75  GLN A HE21 6  
ATOM 9614  H HE22 . GLN A 1 75  ? 3.491   -21.843 -10.889 1.00 0.00 ? 75  GLN A HE22 6  
ATOM 9615  N N    . GLY A 1 76  ? 5.461   -23.863 -4.632  1.00 0.00 ? 76  GLY A N    6  
ATOM 9616  C CA   . GLY A 1 76  ? 6.706   -24.300 -4.027  1.00 0.00 ? 76  GLY A CA   6  
ATOM 9617  C C    . GLY A 1 76  ? 6.590   -24.477 -2.526  1.00 0.00 ? 76  GLY A C    6  
ATOM 9618  O O    . GLY A 1 76  ? 7.155   -23.700 -1.756  1.00 0.00 ? 76  GLY A O    6  
ATOM 9619  H H    . GLY A 1 76  ? 4.781   -24.524 -4.881  1.00 0.00 ? 76  GLY A H    6  
ATOM 9620  H HA2  . GLY A 1 76  ? 6.998   -25.241 -4.469  1.00 0.00 ? 76  GLY A HA2  6  
ATOM 9621  H HA3  . GLY A 1 76  ? 7.470   -23.564 -4.232  1.00 0.00 ? 76  GLY A HA3  6  
ATOM 9622  N N    . LEU A 1 77  ? 5.854   -25.501 -2.108  1.00 0.00 ? 77  LEU A N    6  
ATOM 9623  C CA   . LEU A 1 77  ? 5.663   -25.777 -0.688  1.00 0.00 ? 77  LEU A CA   6  
ATOM 9624  C C    . LEU A 1 77  ? 5.525   -27.276 -0.439  1.00 0.00 ? 77  LEU A C    6  
ATOM 9625  O O    . LEU A 1 77  ? 5.451   -28.068 -1.378  1.00 0.00 ? 77  LEU A O    6  
ATOM 9626  C CB   . LEU A 1 77  ? 4.425   -25.046 -0.168  1.00 0.00 ? 77  LEU A CB   6  
ATOM 9627  C CG   . LEU A 1 77  ? 4.308   -23.569 -0.548  1.00 0.00 ? 77  LEU A CG   6  
ATOM 9628  C CD1  . LEU A 1 77  ? 2.864   -23.103 -0.442  1.00 0.00 ? 77  LEU A CD1  6  
ATOM 9629  C CD2  . LEU A 1 77  ? 5.211   -22.719 0.334   1.00 0.00 ? 77  LEU A CD2  6  
ATOM 9630  H H    . LEU A 1 77  ? 5.428   -26.085 -2.769  1.00 0.00 ? 77  LEU A H    6  
ATOM 9631  H HA   . LEU A 1 77  ? 6.533   -25.415 -0.161  1.00 0.00 ? 77  LEU A HA   6  
ATOM 9632  H HB2  . LEU A 1 77  ? 3.554   -25.555 -0.551  1.00 0.00 ? 77  LEU A HB2  6  
ATOM 9633  H HB3  . LEU A 1 77  ? 4.432   -25.111 0.911   1.00 0.00 ? 77  LEU A HB3  6  
ATOM 9634  H HG   . LEU A 1 77  ? 4.624   -23.442 -1.574  1.00 0.00 ? 77  LEU A HG   6  
ATOM 9635  H HD11 . LEU A 1 77  ? 2.616   -22.501 -1.302  1.00 0.00 ? 77  LEU A HD11 6  
ATOM 9636  H HD12 . LEU A 1 77  ? 2.740   -22.516 0.456   1.00 0.00 ? 77  LEU A HD12 6  
ATOM 9637  H HD13 . LEU A 1 77  ? 2.211   -23.963 -0.402  1.00 0.00 ? 77  LEU A HD13 6  
ATOM 9638  H HD21 . LEU A 1 77  ? 6.244   -22.926 0.096   1.00 0.00 ? 77  LEU A HD21 6  
ATOM 9639  H HD22 . LEU A 1 77  ? 5.026   -22.955 1.372   1.00 0.00 ? 77  LEU A HD22 6  
ATOM 9640  H HD23 . LEU A 1 77  ? 5.003   -21.673 0.159   1.00 0.00 ? 77  LEU A HD23 6  
ATOM 9641  N N    . LYS A 1 78  ? 5.489   -27.657 0.833   1.00 0.00 ? 78  LYS A N    6  
ATOM 9642  C CA   . LYS A 1 78  ? 5.356   -29.060 1.208   1.00 0.00 ? 78  LYS A CA   6  
ATOM 9643  C C    . LYS A 1 78  ? 3.928   -29.375 1.642   1.00 0.00 ? 78  LYS A C    6  
ATOM 9644  O O    . LYS A 1 78  ? 3.251   -28.559 2.268   1.00 0.00 ? 78  LYS A O    6  
ATOM 9645  C CB   . LYS A 1 78  ? 6.331   -29.402 2.337   1.00 0.00 ? 78  LYS A CB   6  
ATOM 9646  C CG   . LYS A 1 78  ? 7.772   -29.540 1.877   1.00 0.00 ? 78  LYS A CG   6  
ATOM 9647  C CD   . LYS A 1 78  ? 7.993   -30.836 1.115   1.00 0.00 ? 78  LYS A CD   6  
ATOM 9648  C CE   . LYS A 1 78  ? 9.235   -30.764 0.241   1.00 0.00 ? 78  LYS A CE   6  
ATOM 9649  N NZ   . LYS A 1 78  ? 8.950   -30.136 -1.078  1.00 0.00 ? 78  LYS A NZ   6  
ATOM 9650  H H    . LYS A 1 78  ? 5.553   -26.979 1.538   1.00 0.00 ? 78  LYS A H    6  
ATOM 9651  H HA   . LYS A 1 78  ? 5.597   -29.659 0.343   1.00 0.00 ? 78  LYS A HA   6  
ATOM 9652  H HB2  . LYS A 1 78  ? 6.286   -28.623 3.084   1.00 0.00 ? 78  LYS A HB2  6  
ATOM 9653  H HB3  . LYS A 1 78  ? 6.028   -30.337 2.787   1.00 0.00 ? 78  LYS A HB3  6  
ATOM 9654  H HG2  . LYS A 1 78  ? 8.014   -28.709 1.230   1.00 0.00 ? 78  LYS A HG2  6  
ATOM 9655  H HG3  . LYS A 1 78  ? 8.419   -29.526 2.742   1.00 0.00 ? 78  LYS A HG3  6  
ATOM 9656  H HD2  . LYS A 1 78  ? 8.110   -31.644 1.822   1.00 0.00 ? 78  LYS A HD2  6  
ATOM 9657  H HD3  . LYS A 1 78  ? 7.133   -31.026 0.488   1.00 0.00 ? 78  LYS A HD3  6  
ATOM 9658  H HE2  . LYS A 1 78  ? 9.986   -30.182 0.753   1.00 0.00 ? 78  LYS A HE2  6  
ATOM 9659  H HE3  . LYS A 1 78  ? 9.605   -31.766 0.081   1.00 0.00 ? 78  LYS A HE3  6  
ATOM 9660  H HZ1  . LYS A 1 78  ? 8.271   -29.356 -0.963  1.00 0.00 ? 78  LYS A HZ1  6  
ATOM 9661  H HZ2  . LYS A 1 78  ? 8.546   -30.839 -1.729  1.00 0.00 ? 78  LYS A HZ2  6  
ATOM 9662  H HZ3  . LYS A 1 78  ? 9.827   -29.760 -1.492  1.00 0.00 ? 78  LYS A HZ3  6  
ATOM 9663  N N    . PRO A 1 79  ? 3.459   -30.585 1.304   1.00 0.00 ? 79  PRO A N    6  
ATOM 9664  C CA   . PRO A 1 79  ? 2.108   -31.035 1.651   1.00 0.00 ? 79  PRO A CA   6  
ATOM 9665  C C    . PRO A 1 79  ? 1.945   -31.281 3.147   1.00 0.00 ? 79  PRO A C    6  
ATOM 9666  O O    . PRO A 1 79  ? 2.922   -31.512 3.857   1.00 0.00 ? 79  PRO A O    6  
ATOM 9667  C CB   . PRO A 1 79  ? 1.960   -32.345 0.874   1.00 0.00 ? 79  PRO A CB   6  
ATOM 9668  C CG   . PRO A 1 79  ? 3.355   -32.836 0.689   1.00 0.00 ? 79  PRO A CG   6  
ATOM 9669  C CD   . PRO A 1 79  ? 4.211   -31.607 0.558   1.00 0.00 ? 79  PRO A CD   6  
ATOM 9670  H HA   . PRO A 1 79  ? 1.358   -30.331 1.319   1.00 0.00 ? 79  PRO A HA   6  
ATOM 9671  H HB2  . PRO A 1 79  ? 1.368   -33.043 1.449   1.00 0.00 ? 79  PRO A HB2  6  
ATOM 9672  H HB3  . PRO A 1 79  ? 1.480   -32.154 -0.075  1.00 0.00 ? 79  PRO A HB3  6  
ATOM 9673  H HG2  . PRO A 1 79  ? 3.657   -33.414 1.549   1.00 0.00 ? 79  PRO A HG2  6  
ATOM 9674  H HG3  . PRO A 1 79  ? 3.417   -33.434 -0.208  1.00 0.00 ? 79  PRO A HG3  6  
ATOM 9675  H HD2  . PRO A 1 79  ? 5.181   -31.774 1.003   1.00 0.00 ? 79  PRO A HD2  6  
ATOM 9676  H HD3  . PRO A 1 79  ? 4.314   -31.328 -0.481  1.00 0.00 ? 79  PRO A HD3  6  
ATOM 9677  N N    . ASN A 1 80  ? 0.703   -31.232 3.618   1.00 0.00 ? 80  ASN A N    6  
ATOM 9678  C CA   . ASN A 1 80  ? 0.413   -31.450 5.031   1.00 0.00 ? 80  ASN A CA   6  
ATOM 9679  C C    . ASN A 1 80  ? 1.367   -30.650 5.912   1.00 0.00 ? 80  ASN A C    6  
ATOM 9680  O O    . ASN A 1 80  ? 2.029   -31.203 6.790   1.00 0.00 ? 80  ASN A O    6  
ATOM 9681  C CB   . ASN A 1 80  ? 0.514   -32.938 5.370   1.00 0.00 ? 80  ASN A CB   6  
ATOM 9682  C CG   . ASN A 1 80  ? 1.879   -33.513 5.044   1.00 0.00 ? 80  ASN A CG   6  
ATOM 9683  O OD1  . ASN A 1 80  ? 2.789   -33.489 5.873   1.00 0.00 ? 80  ASN A OD1  6  
ATOM 9684  N ND2  . ASN A 1 80  ? 2.028   -34.034 3.831   1.00 0.00 ? 80  ASN A ND2  6  
ATOM 9685  H H    . ASN A 1 80  ? -0.035  -31.044 3.002   1.00 0.00 ? 80  ASN A H    6  
ATOM 9686  H HA   . ASN A 1 80  ? -0.597  -31.116 5.217   1.00 0.00 ? 80  ASN A HA   6  
ATOM 9687  H HB2  . ASN A 1 80  ? 0.331   -33.074 6.426   1.00 0.00 ? 80  ASN A HB2  6  
ATOM 9688  H HB3  . ASN A 1 80  ? -0.229  -33.482 4.807   1.00 0.00 ? 80  ASN A HB3  6  
ATOM 9689  H HD21 . ASN A 1 80  ? 1.259   -34.019 3.223   1.00 0.00 ? 80  ASN A HD21 6  
ATOM 9690  H HD22 . ASN A 1 80  ? 2.900   -34.414 3.594   1.00 0.00 ? 80  ASN A HD22 6  
ATOM 9691  N N    . SER A 1 81  ? 1.431   -29.344 5.672   1.00 0.00 ? 81  SER A N    6  
ATOM 9692  C CA   . SER A 1 81  ? 2.306   -28.467 6.441   1.00 0.00 ? 81  SER A CA   6  
ATOM 9693  C C    . SER A 1 81  ? 1.682   -27.085 6.605   1.00 0.00 ? 81  SER A C    6  
ATOM 9694  O O    . SER A 1 81  ? 1.066   -26.555 5.680   1.00 0.00 ? 81  SER A O    6  
ATOM 9695  C CB   . SER A 1 81  ? 3.670   -28.346 5.758   1.00 0.00 ? 81  SER A CB   6  
ATOM 9696  O OG   . SER A 1 81  ? 4.419   -29.540 5.901   1.00 0.00 ? 81  SER A OG   6  
ATOM 9697  H H    . SER A 1 81  ? 0.879   -28.962 4.958   1.00 0.00 ? 81  SER A H    6  
ATOM 9698  H HA   . SER A 1 81  ? 2.440   -28.907 7.418   1.00 0.00 ? 81  SER A HA   6  
ATOM 9699  H HB2  . SER A 1 81  ? 3.527   -28.148 4.707   1.00 0.00 ? 81  SER A HB2  6  
ATOM 9700  H HB3  . SER A 1 81  ? 4.223   -27.532 6.206   1.00 0.00 ? 81  SER A HB3  6  
ATOM 9701  H HG   . SER A 1 81  ? 4.159   -29.988 6.709   1.00 0.00 ? 81  SER A HG   6  
ATOM 9702  N N    . LEU A 1 82  ? 1.847   -26.505 7.789   1.00 0.00 ? 82  LEU A N    6  
ATOM 9703  C CA   . LEU A 1 82  ? 1.300   -25.184 8.077   1.00 0.00 ? 82  LEU A CA   6  
ATOM 9704  C C    . LEU A 1 82  ? 2.260   -24.087 7.624   1.00 0.00 ? 82  LEU A C    6  
ATOM 9705  O O    . LEU A 1 82  ? 3.478   -24.228 7.738   1.00 0.00 ? 82  LEU A O    6  
ATOM 9706  C CB   . LEU A 1 82  ? 1.015   -25.042 9.573   1.00 0.00 ? 82  LEU A CB   6  
ATOM 9707  C CG   . LEU A 1 82  ? 0.188   -23.825 9.987   1.00 0.00 ? 82  LEU A CG   6  
ATOM 9708  C CD1  . LEU A 1 82  ? -1.267  -24.006 9.585   1.00 0.00 ? 82  LEU A CD1  6  
ATOM 9709  C CD2  . LEU A 1 82  ? 0.304   -23.586 11.485  1.00 0.00 ? 82  LEU A CD2  6  
ATOM 9710  H H    . LEU A 1 82  ? 2.347   -26.976 8.487   1.00 0.00 ? 82  LEU A H    6  
ATOM 9711  H HA   . LEU A 1 82  ? 0.374   -25.082 7.531   1.00 0.00 ? 82  LEU A HA   6  
ATOM 9712  H HB2  . LEU A 1 82  ? 0.485   -25.926 9.893   1.00 0.00 ? 82  LEU A HB2  6  
ATOM 9713  H HB3  . LEU A 1 82  ? 1.965   -24.989 10.086  1.00 0.00 ? 82  LEU A HB3  6  
ATOM 9714  H HG   . LEU A 1 82  ? 0.568   -22.949 9.477   1.00 0.00 ? 82  LEU A HG   6  
ATOM 9715  H HD11 . LEU A 1 82  ? -1.489  -25.059 9.500   1.00 0.00 ? 82  LEU A HD11 6  
ATOM 9716  H HD12 . LEU A 1 82  ? -1.440  -23.524 8.634   1.00 0.00 ? 82  LEU A HD12 6  
ATOM 9717  H HD13 . LEU A 1 82  ? -1.905  -23.562 10.334  1.00 0.00 ? 82  LEU A HD13 6  
ATOM 9718  H HD21 . LEU A 1 82  ? -0.683  -23.576 11.925  1.00 0.00 ? 82  LEU A HD21 6  
ATOM 9719  H HD22 . LEU A 1 82  ? 0.786   -22.635 11.662  1.00 0.00 ? 82  LEU A HD22 6  
ATOM 9720  H HD23 . LEU A 1 82  ? 0.889   -24.376 11.931  1.00 0.00 ? 82  LEU A HD23 6  
ATOM 9721  N N    . TYR A 1 83  ? 1.703   -22.995 7.113   1.00 0.00 ? 83  TYR A N    6  
ATOM 9722  C CA   . TYR A 1 83  ? 2.509   -21.875 6.644   1.00 0.00 ? 83  TYR A CA   6  
ATOM 9723  C C    . TYR A 1 83  ? 1.776   -20.553 6.848   1.00 0.00 ? 83  TYR A C    6  
ATOM 9724  O O    . TYR A 1 83  ? 0.695   -20.337 6.298   1.00 0.00 ? 83  TYR A O    6  
ATOM 9725  C CB   . TYR A 1 83  ? 2.857   -22.054 5.165   1.00 0.00 ? 83  TYR A CB   6  
ATOM 9726  C CG   . TYR A 1 83  ? 3.912   -23.108 4.915   1.00 0.00 ? 83  TYR A CG   6  
ATOM 9727  C CD1  . TYR A 1 83  ? 5.262   -22.816 5.058   1.00 0.00 ? 83  TYR A CD1  6  
ATOM 9728  C CD2  . TYR A 1 83  ? 3.557   -24.397 4.537   1.00 0.00 ? 83  TYR A CD2  6  
ATOM 9729  C CE1  . TYR A 1 83  ? 6.229   -23.776 4.829   1.00 0.00 ? 83  TYR A CE1  6  
ATOM 9730  C CE2  . TYR A 1 83  ? 4.517   -25.364 4.308   1.00 0.00 ? 83  TYR A CE2  6  
ATOM 9731  C CZ   . TYR A 1 83  ? 5.851   -25.049 4.455   1.00 0.00 ? 83  TYR A CZ   6  
ATOM 9732  O OH   . TYR A 1 83  ? 6.811   -26.008 4.228   1.00 0.00 ? 83  TYR A OH   6  
ATOM 9733  H H    . TYR A 1 83  ? 0.727   -22.942 7.048   1.00 0.00 ? 83  TYR A H    6  
ATOM 9734  H HA   . TYR A 1 83  ? 3.423   -21.859 7.219   1.00 0.00 ? 83  TYR A HA   6  
ATOM 9735  H HB2  . TYR A 1 83  ? 1.968   -22.341 4.625   1.00 0.00 ? 83  TYR A HB2  6  
ATOM 9736  H HB3  . TYR A 1 83  ? 3.225   -21.117 4.773   1.00 0.00 ? 83  TYR A HB3  6  
ATOM 9737  H HD1  . TYR A 1 83  ? 5.555   -21.818 5.352   1.00 0.00 ? 83  TYR A HD1  6  
ATOM 9738  H HD2  . TYR A 1 83  ? 2.511   -24.642 4.422   1.00 0.00 ? 83  TYR A HD2  6  
ATOM 9739  H HE1  . TYR A 1 83  ? 7.274   -23.529 4.945   1.00 0.00 ? 83  TYR A HE1  6  
ATOM 9740  H HE2  . TYR A 1 83  ? 4.222   -26.361 4.014   1.00 0.00 ? 83  TYR A HE2  6  
ATOM 9741  H HH   . TYR A 1 83  ? 6.439   -26.713 3.693   1.00 0.00 ? 83  TYR A HH   6  
ATOM 9742  N N    . TYR A 1 84  ? 2.371   -19.670 7.642   1.00 0.00 ? 84  TYR A N    6  
ATOM 9743  C CA   . TYR A 1 84  ? 1.775   -18.369 7.922   1.00 0.00 ? 84  TYR A CA   6  
ATOM 9744  C C    . TYR A 1 84  ? 1.919   -17.435 6.725   1.00 0.00 ? 84  TYR A C    6  
ATOM 9745  O O    . TYR A 1 84  ? 2.847   -17.569 5.926   1.00 0.00 ? 84  TYR A O    6  
ATOM 9746  C CB   . TYR A 1 84  ? 2.427   -17.741 9.155   1.00 0.00 ? 84  TYR A CB   6  
ATOM 9747  C CG   . TYR A 1 84  ? 2.128   -18.479 10.441  1.00 0.00 ? 84  TYR A CG   6  
ATOM 9748  C CD1  . TYR A 1 84  ? 2.671   -19.734 10.685  1.00 0.00 ? 84  TYR A CD1  6  
ATOM 9749  C CD2  . TYR A 1 84  ? 1.304   -17.921 11.410  1.00 0.00 ? 84  TYR A CD2  6  
ATOM 9750  C CE1  . TYR A 1 84  ? 2.400   -20.413 11.858  1.00 0.00 ? 84  TYR A CE1  6  
ATOM 9751  C CE2  . TYR A 1 84  ? 1.029   -18.591 12.586  1.00 0.00 ? 84  TYR A CE2  6  
ATOM 9752  C CZ   . TYR A 1 84  ? 1.579   -19.837 12.805  1.00 0.00 ? 84  TYR A CZ   6  
ATOM 9753  O OH   . TYR A 1 84  ? 1.307   -20.509 13.975  1.00 0.00 ? 84  TYR A OH   6  
ATOM 9754  H H    . TYR A 1 84  ? 3.231   -19.899 8.052   1.00 0.00 ? 84  TYR A H    6  
ATOM 9755  H HA   . TYR A 1 84  ? 0.724   -18.521 8.121   1.00 0.00 ? 84  TYR A HA   6  
ATOM 9756  H HB2  . TYR A 1 84  ? 3.498   -17.729 9.021   1.00 0.00 ? 84  TYR A HB2  6  
ATOM 9757  H HB3  . TYR A 1 84  ? 2.072   -16.726 9.264   1.00 0.00 ? 84  TYR A HB3  6  
ATOM 9758  H HD1  . TYR A 1 84  ? 3.313   -20.183 9.942   1.00 0.00 ? 84  TYR A HD1  6  
ATOM 9759  H HD2  . TYR A 1 84  ? 0.874   -16.945 11.234  1.00 0.00 ? 84  TYR A HD2  6  
ATOM 9760  H HE1  . TYR A 1 84  ? 2.831   -21.388 12.031  1.00 0.00 ? 84  TYR A HE1  6  
ATOM 9761  H HE2  . TYR A 1 84  ? 0.386   -18.141 13.327  1.00 0.00 ? 84  TYR A HE2  6  
ATOM 9762  H HH   . TYR A 1 84  ? 1.960   -21.199 14.107  1.00 0.00 ? 84  TYR A HH   6  
ATOM 9763  N N    . PHE A 1 85  ? 0.995   -16.488 6.607   1.00 0.00 ? 85  PHE A N    6  
ATOM 9764  C CA   . PHE A 1 85  ? 1.017   -15.530 5.508   1.00 0.00 ? 85  PHE A CA   6  
ATOM 9765  C C    . PHE A 1 85  ? 0.528   -14.160 5.969   1.00 0.00 ? 85  PHE A C    6  
ATOM 9766  O O    . PHE A 1 85  ? -0.277  -14.057 6.895   1.00 0.00 ? 85  PHE A O    6  
ATOM 9767  C CB   . PHE A 1 85  ? 0.151   -16.030 4.350   1.00 0.00 ? 85  PHE A CB   6  
ATOM 9768  C CG   . PHE A 1 85  ? 0.477   -17.432 3.919   1.00 0.00 ? 85  PHE A CG   6  
ATOM 9769  C CD1  . PHE A 1 85  ? 1.713   -17.733 3.371   1.00 0.00 ? 85  PHE A CD1  6  
ATOM 9770  C CD2  . PHE A 1 85  ? -0.454  -18.448 4.063   1.00 0.00 ? 85  PHE A CD2  6  
ATOM 9771  C CE1  . PHE A 1 85  ? 2.016   -19.021 2.974   1.00 0.00 ? 85  PHE A CE1  6  
ATOM 9772  C CE2  . PHE A 1 85  ? -0.156  -19.739 3.668   1.00 0.00 ? 85  PHE A CE2  6  
ATOM 9773  C CZ   . PHE A 1 85  ? 1.080   -20.026 3.122   1.00 0.00 ? 85  PHE A CZ   6  
ATOM 9774  H H    . PHE A 1 85  ? 0.280   -16.432 7.276   1.00 0.00 ? 85  PHE A H    6  
ATOM 9775  H HA   . PHE A 1 85  ? 2.038   -15.439 5.169   1.00 0.00 ? 85  PHE A HA   6  
ATOM 9776  H HB2  . PHE A 1 85  ? -0.886  -16.008 4.650   1.00 0.00 ? 85  PHE A HB2  6  
ATOM 9777  H HB3  . PHE A 1 85  ? 0.289   -15.380 3.499   1.00 0.00 ? 85  PHE A HB3  6  
ATOM 9778  H HD1  . PHE A 1 85  ? 2.447   -16.947 3.255   1.00 0.00 ? 85  PHE A HD1  6  
ATOM 9779  H HD2  . PHE A 1 85  ? -1.421  -18.226 4.488   1.00 0.00 ? 85  PHE A HD2  6  
ATOM 9780  H HE1  . PHE A 1 85  ? 2.984   -19.242 2.548   1.00 0.00 ? 85  PHE A HE1  6  
ATOM 9781  H HE2  . PHE A 1 85  ? -0.890  -20.523 3.784   1.00 0.00 ? 85  PHE A HE2  6  
ATOM 9782  H HZ   . PHE A 1 85  ? 1.315   -21.033 2.813   1.00 0.00 ? 85  PHE A HZ   6  
ATOM 9783  N N    . ARG A 1 86  ? 1.021   -13.112 5.317   1.00 0.00 ? 86  ARG A N    6  
ATOM 9784  C CA   . ARG A 1 86  ? 0.636   -11.749 5.661   1.00 0.00 ? 86  ARG A CA   6  
ATOM 9785  C C    . ARG A 1 86  ? 0.732   -10.833 4.445   1.00 0.00 ? 86  ARG A C    6  
ATOM 9786  O O    . ARG A 1 86  ? 1.774   -10.758 3.792   1.00 0.00 ? 86  ARG A O    6  
ATOM 9787  C CB   . ARG A 1 86  ? 1.523   -11.214 6.787   1.00 0.00 ? 86  ARG A CB   6  
ATOM 9788  C CG   . ARG A 1 86  ? 1.131   -11.721 8.165   1.00 0.00 ? 86  ARG A CG   6  
ATOM 9789  C CD   . ARG A 1 86  ? 1.643   -10.802 9.263   1.00 0.00 ? 86  ARG A CD   6  
ATOM 9790  N NE   . ARG A 1 86  ? 0.784   -9.635  9.445   1.00 0.00 ? 86  ARG A NE   6  
ATOM 9791  C CZ   . ARG A 1 86  ? 0.753   -8.911  10.559  1.00 0.00 ? 86  ARG A CZ   6  
ATOM 9792  N NH1  . ARG A 1 86  ? 1.530   -9.233  11.584  1.00 0.00 ? 86  ARG A NH1  6  
ATOM 9793  N NH2  . ARG A 1 86  ? -0.055  -7.863  10.648  1.00 0.00 ? 86  ARG A NH2  6  
ATOM 9794  H H    . ARG A 1 86  ? 1.659   -13.259 4.588   1.00 0.00 ? 86  ARG A H    6  
ATOM 9795  H HA   . ARG A 1 86  ? -0.389  -11.769 6.002   1.00 0.00 ? 86  ARG A HA   6  
ATOM 9796  H HB2  . ARG A 1 86  ? 2.544   -11.510 6.596   1.00 0.00 ? 86  ARG A HB2  6  
ATOM 9797  H HB3  . ARG A 1 86  ? 1.465   -10.136 6.794   1.00 0.00 ? 86  ARG A HB3  6  
ATOM 9798  H HG2  . ARG A 1 86  ? 0.053   -11.771 8.227   1.00 0.00 ? 86  ARG A HG2  6  
ATOM 9799  H HG3  . ARG A 1 86  ? 1.548   -12.706 8.308   1.00 0.00 ? 86  ARG A HG3  6  
ATOM 9800  H HD2  . ARG A 1 86  ? 1.681   -11.356 10.189  1.00 0.00 ? 86  ARG A HD2  6  
ATOM 9801  H HD3  . ARG A 1 86  ? 2.636   -10.470 9.001   1.00 0.00 ? 86  ARG A HD3  6  
ATOM 9802  H HE   . ARG A 1 86  ? 0.202   -9.379  8.700   1.00 0.00 ? 86  ARG A HE   6  
ATOM 9803  H HH11 . ARG A 1 86  ? 2.141   -10.022 11.519  1.00 0.00 ? 86  ARG A HH11 6  
ATOM 9804  H HH12 . ARG A 1 86  ? 1.506   -8.686  12.421  1.00 0.00 ? 86  ARG A HH12 6  
ATOM 9805  H HH21 . ARG A 1 86  ? -0.642  -7.617  9.877   1.00 0.00 ? 86  ARG A HH21 6  
ATOM 9806  H HH22 . ARG A 1 86  ? -0.077  -7.319  11.487  1.00 0.00 ? 86  ARG A HH22 6  
ATOM 9807  N N    . LEU A 1 87  ? -0.360  -10.139 4.145   1.00 0.00 ? 87  LEU A N    6  
ATOM 9808  C CA   . LEU A 1 87  ? -0.399  -9.228  3.006   1.00 0.00 ? 87  LEU A CA   6  
ATOM 9809  C C    . LEU A 1 87  ? -0.276  -7.779  3.463   1.00 0.00 ? 87  LEU A C    6  
ATOM 9810  O O    . LEU A 1 87  ? -0.987  -7.340  4.367   1.00 0.00 ? 87  LEU A O    6  
ATOM 9811  C CB   . LEU A 1 87  ? -1.698  -9.418  2.221   1.00 0.00 ? 87  LEU A CB   6  
ATOM 9812  C CG   . LEU A 1 87  ? -1.624  -9.129  0.721   1.00 0.00 ? 87  LEU A CG   6  
ATOM 9813  C CD1  . LEU A 1 87  ? -0.710  -10.128 0.029   1.00 0.00 ? 87  LEU A CD1  6  
ATOM 9814  C CD2  . LEU A 1 87  ? -3.014  -9.159  0.103   1.00 0.00 ? 87  LEU A CD2  6  
ATOM 9815  H H    . LEU A 1 87  ? -1.160  -10.241 4.702   1.00 0.00 ? 87  LEU A H    6  
ATOM 9816  H HA   . LEU A 1 87  ? 0.437   -9.463  2.365   1.00 0.00 ? 87  LEU A HA   6  
ATOM 9817  H HB2  . LEU A 1 87  ? -2.013  -10.443 2.344   1.00 0.00 ? 87  LEU A HB2  6  
ATOM 9818  H HB3  . LEU A 1 87  ? -2.442  -8.761  2.649   1.00 0.00 ? 87  LEU A HB3  6  
ATOM 9819  H HG   . LEU A 1 87  ? -1.212  -8.141  0.571   1.00 0.00 ? 87  LEU A HG   6  
ATOM 9820  H HD11 . LEU A 1 87  ? -0.052  -10.578 0.757   1.00 0.00 ? 87  LEU A HD11 6  
ATOM 9821  H HD12 . LEU A 1 87  ? -0.123  -9.619  -0.721  1.00 0.00 ? 87  LEU A HD12 6  
ATOM 9822  H HD13 . LEU A 1 87  ? -1.306  -10.896 -0.441  1.00 0.00 ? 87  LEU A HD13 6  
ATOM 9823  H HD21 . LEU A 1 87  ? -3.056  -8.463  -0.722  1.00 0.00 ? 87  LEU A HD21 6  
ATOM 9824  H HD22 . LEU A 1 87  ? -3.746  -8.879  0.847   1.00 0.00 ? 87  LEU A HD22 6  
ATOM 9825  H HD23 . LEU A 1 87  ? -3.228  -10.155 -0.255  1.00 0.00 ? 87  LEU A HD23 6  
ATOM 9826  N N    . ALA A 1 88  ? 0.630   -7.039  2.832   1.00 0.00 ? 88  ALA A N    6  
ATOM 9827  C CA   . ALA A 1 88  ? 0.844   -5.638  3.171   1.00 0.00 ? 88  ALA A CA   6  
ATOM 9828  C C    . ALA A 1 88  ? 1.083   -4.800  1.920   1.00 0.00 ? 88  ALA A C    6  
ATOM 9829  O O    . ALA A 1 88  ? 2.153   -4.861  1.315   1.00 0.00 ? 88  ALA A O    6  
ATOM 9830  C CB   . ALA A 1 88  ? 2.015   -5.500  4.132   1.00 0.00 ? 88  ALA A CB   6  
ATOM 9831  H H    . ALA A 1 88  ? 1.167   -7.446  2.120   1.00 0.00 ? 88  ALA A H    6  
ATOM 9832  H HA   . ALA A 1 88  ? -0.044  -5.276  3.670   1.00 0.00 ? 88  ALA A HA   6  
ATOM 9833  H HB1  . ALA A 1 88  ? 1.668   -5.648  5.145   1.00 0.00 ? 88  ALA A HB1  6  
ATOM 9834  H HB2  . ALA A 1 88  ? 2.764   -6.242  3.896   1.00 0.00 ? 88  ALA A HB2  6  
ATOM 9835  H HB3  . ALA A 1 88  ? 2.444   -4.514  4.038   1.00 0.00 ? 88  ALA A HB3  6  
ATOM 9836  N N    . ALA A 1 89  ? 0.078   -4.019  1.536   1.00 0.00 ? 89  ALA A N    6  
ATOM 9837  C CA   . ALA A 1 89  ? 0.180   -3.168  0.357   1.00 0.00 ? 89  ALA A CA   6  
ATOM 9838  C C    . ALA A 1 89  ? 1.435   -2.303  0.411   1.00 0.00 ? 89  ALA A C    6  
ATOM 9839  O O    . ALA A 1 89  ? 1.657   -1.576  1.378   1.00 0.00 ? 89  ALA A O    6  
ATOM 9840  C CB   . ALA A 1 89  ? -1.060  -2.296  0.226   1.00 0.00 ? 89  ALA A CB   6  
ATOM 9841  H H    . ALA A 1 89  ? -0.750  -4.014  2.059   1.00 0.00 ? 89  ALA A H    6  
ATOM 9842  H HA   . ALA A 1 89  ? 0.233   -3.808  -0.513  1.00 0.00 ? 89  ALA A HA   6  
ATOM 9843  H HB1  . ALA A 1 89  ? -1.632  -2.613  -0.633  1.00 0.00 ? 89  ALA A HB1  6  
ATOM 9844  H HB2  . ALA A 1 89  ? -1.663  -2.393  1.117   1.00 0.00 ? 89  ALA A HB2  6  
ATOM 9845  H HB3  . ALA A 1 89  ? -0.763  -1.266  0.102   1.00 0.00 ? 89  ALA A HB3  6  
ATOM 9846  N N    . ARG A 1 90  ? 2.252   -2.388  -0.634  1.00 0.00 ? 90  ARG A N    6  
ATOM 9847  C CA   . ARG A 1 90  ? 3.485   -1.613  -0.704  1.00 0.00 ? 90  ARG A CA   6  
ATOM 9848  C C    . ARG A 1 90  ? 3.350   -0.463  -1.698  1.00 0.00 ? 90  ARG A C    6  
ATOM 9849  O O    . ARG A 1 90  ? 2.751   -0.617  -2.762  1.00 0.00 ? 90  ARG A O    6  
ATOM 9850  C CB   . ARG A 1 90  ? 4.655   -2.513  -1.106  1.00 0.00 ? 90  ARG A CB   6  
ATOM 9851  C CG   . ARG A 1 90  ? 6.017   -1.869  -0.902  1.00 0.00 ? 90  ARG A CG   6  
ATOM 9852  C CD   . ARG A 1 90  ? 6.467   -1.113  -2.142  1.00 0.00 ? 90  ARG A CD   6  
ATOM 9853  N NE   . ARG A 1 90  ? 7.748   -0.442  -1.939  1.00 0.00 ? 90  ARG A NE   6  
ATOM 9854  C CZ   . ARG A 1 90  ? 8.915   -1.076  -1.928  1.00 0.00 ? 90  ARG A CZ   6  
ATOM 9855  N NH1  . ARG A 1 90  ? 8.963   -2.389  -2.107  1.00 0.00 ? 90  ARG A NH1  6  
ATOM 9856  N NH2  . ARG A 1 90  ? 10.039  -0.396  -1.737  1.00 0.00 ? 90  ARG A NH2  6  
ATOM 9857  H H    . ARG A 1 90  ? 2.020   -2.986  -1.375  1.00 0.00 ? 90  ARG A H    6  
ATOM 9858  H HA   . ARG A 1 90  ? 3.677   -1.205  0.277   1.00 0.00 ? 90  ARG A HA   6  
ATOM 9859  H HB2  . ARG A 1 90  ? 4.618   -3.418  -0.517  1.00 0.00 ? 90  ARG A HB2  6  
ATOM 9860  H HB3  . ARG A 1 90  ? 4.555   -2.769  -2.150  1.00 0.00 ? 90  ARG A HB3  6  
ATOM 9861  H HG2  . ARG A 1 90  ? 5.958   -1.178  -0.074  1.00 0.00 ? 90  ARG A HG2  6  
ATOM 9862  H HG3  . ARG A 1 90  ? 6.739   -2.640  -0.679  1.00 0.00 ? 90  ARG A HG3  6  
ATOM 9863  H HD2  . ARG A 1 90  ? 6.563   -1.812  -2.959  1.00 0.00 ? 90  ARG A HD2  6  
ATOM 9864  H HD3  . ARG A 1 90  ? 5.719   -0.374  -2.387  1.00 0.00 ? 90  ARG A HD3  6  
ATOM 9865  H HE   . ARG A 1 90  ? 7.736   0.528   -1.805  1.00 0.00 ? 90  ARG A HE   6  
ATOM 9866  H HH11 . ARG A 1 90  ? 8.118   -2.904  -2.252  1.00 0.00 ? 90  ARG A HH11 6  
ATOM 9867  H HH12 . ARG A 1 90  ? 9.843   -2.864  -2.099  1.00 0.00 ? 90  ARG A HH12 6  
ATOM 9868  H HH21 . ARG A 1 90  ? 10.007  0.594   -1.602  1.00 0.00 ? 90  ARG A HH21 6  
ATOM 9869  H HH22 . ARG A 1 90  ? 10.917  -0.874  -1.728  1.00 0.00 ? 90  ARG A HH22 6  
ATOM 9870  N N    . SER A 1 91  ? 3.909   0.688   -1.342  1.00 0.00 ? 91  SER A N    6  
ATOM 9871  C CA   . SER A 1 91  ? 3.847   1.866   -2.200  1.00 0.00 ? 91  SER A CA   6  
ATOM 9872  C C    . SER A 1 91  ? 5.245   2.407   -2.483  1.00 0.00 ? 91  SER A C    6  
ATOM 9873  O O    . SER A 1 91  ? 6.179   2.224   -1.701  1.00 0.00 ? 91  SER A O    6  
ATOM 9874  C CB   . SER A 1 91  ? 2.989   2.953   -1.549  1.00 0.00 ? 91  SER A CB   6  
ATOM 9875  O OG   . SER A 1 91  ? 3.502   3.314   -0.278  1.00 0.00 ? 91  SER A OG   6  
ATOM 9876  H H    . SER A 1 91  ? 4.373   0.748   -0.480  1.00 0.00 ? 91  SER A H    6  
ATOM 9877  H HA   . SER A 1 91  ? 3.392   1.572   -3.134  1.00 0.00 ? 91  SER A HA   6  
ATOM 9878  H HB2  . SER A 1 91  ? 2.980   3.827   -2.182  1.00 0.00 ? 91  SER A HB2  6  
ATOM 9879  H HB3  . SER A 1 91  ? 1.980   2.586   -1.427  1.00 0.00 ? 91  SER A HB3  6  
ATOM 9880  H HG   . SER A 1 91  ? 3.869   2.538   0.151   1.00 0.00 ? 91  SER A HG   6  
ATOM 9881  N N    . PRO A 1 92  ? 5.395   3.088   -3.628  1.00 0.00 ? 92  PRO A N    6  
ATOM 9882  C CA   . PRO A 1 92  ? 6.675   3.671   -4.041  1.00 0.00 ? 92  PRO A CA   6  
ATOM 9883  C C    . PRO A 1 92  ? 7.082   4.854   -3.169  1.00 0.00 ? 92  PRO A C    6  
ATOM 9884  O O    . PRO A 1 92  ? 8.108   5.489   -3.411  1.00 0.00 ? 92  PRO A O    6  
ATOM 9885  C CB   . PRO A 1 92  ? 6.409   4.131   -5.477  1.00 0.00 ? 92  PRO A CB   6  
ATOM 9886  C CG   . PRO A 1 92  ? 4.938   4.357   -5.535  1.00 0.00 ? 92  PRO A CG   6  
ATOM 9887  C CD   . PRO A 1 92  ? 4.326   3.344   -4.607  1.00 0.00 ? 92  PRO A CD   6  
ATOM 9888  H HA   . PRO A 1 92  ? 7.465   2.934   -4.038  1.00 0.00 ? 92  PRO A HA   6  
ATOM 9889  H HB2  . PRO A 1 92  ? 6.958   5.041   -5.673  1.00 0.00 ? 92  PRO A HB2  6  
ATOM 9890  H HB3  . PRO A 1 92  ? 6.717   3.361   -6.168  1.00 0.00 ? 92  PRO A HB3  6  
ATOM 9891  H HG2  . PRO A 1 92  ? 4.706   5.358   -5.202  1.00 0.00 ? 92  PRO A HG2  6  
ATOM 9892  H HG3  . PRO A 1 92  ? 4.583   4.204   -6.543  1.00 0.00 ? 92  PRO A HG3  6  
ATOM 9893  H HD2  . PRO A 1 92  ? 3.451   3.754   -4.125  1.00 0.00 ? 92  PRO A HD2  6  
ATOM 9894  H HD3  . PRO A 1 92  ? 4.074   2.443   -5.147  1.00 0.00 ? 92  PRO A HD3  6  
ATOM 9895  N N    . GLN A 1 93  ? 6.273   5.142   -2.156  1.00 0.00 ? 93  GLN A N    6  
ATOM 9896  C CA   . GLN A 1 93  ? 6.550   6.250   -1.249  1.00 0.00 ? 93  GLN A CA   6  
ATOM 9897  C C    . GLN A 1 93  ? 6.837   5.741   0.160   1.00 0.00 ? 93  GLN A C    6  
ATOM 9898  O O    . GLN A 1 93  ? 7.613   6.341   0.902   1.00 0.00 ? 93  GLN A O    6  
ATOM 9899  C CB   . GLN A 1 93  ? 5.369   7.222   -1.222  1.00 0.00 ? 93  GLN A CB   6  
ATOM 9900  C CG   . GLN A 1 93  ? 5.266   8.088   -2.467  1.00 0.00 ? 93  GLN A CG   6  
ATOM 9901  C CD   . GLN A 1 93  ? 6.540   8.859   -2.749  1.00 0.00 ? 93  GLN A CD   6  
ATOM 9902  O OE1  . GLN A 1 93  ? 7.229   9.300   -1.829  1.00 0.00 ? 93  GLN A OE1  6  
ATOM 9903  N NE2  . GLN A 1 93  ? 6.860   9.027   -4.027  1.00 0.00 ? 93  GLN A NE2  6  
ATOM 9904  H H    . GLN A 1 93  ? 5.470   4.599   -2.015  1.00 0.00 ? 93  GLN A H    6  
ATOM 9905  H HA   . GLN A 1 93  ? 7.423   6.768   -1.615  1.00 0.00 ? 93  GLN A HA   6  
ATOM 9906  H HB2  . GLN A 1 93  ? 4.455   6.657   -1.125  1.00 0.00 ? 93  GLN A HB2  6  
ATOM 9907  H HB3  . GLN A 1 93  ? 5.474   7.873   -0.366  1.00 0.00 ? 93  GLN A HB3  6  
ATOM 9908  H HG2  . GLN A 1 93  ? 5.053   7.453   -3.315  1.00 0.00 ? 93  GLN A HG2  6  
ATOM 9909  H HG3  . GLN A 1 93  ? 4.458   8.792   -2.334  1.00 0.00 ? 93  GLN A HG3  6  
ATOM 9910  H HE21 . GLN A 1 93  ? 6.263   8.649   -4.707  1.00 0.00 ? 93  GLN A HE21 6  
ATOM 9911  H HE22 . GLN A 1 93  ? 7.678   9.522   -4.238  1.00 0.00 ? 93  GLN A HE22 6  
ATOM 9912  N N    . GLY A 1 94  ? 6.204   4.629   0.523   1.00 0.00 ? 94  GLY A N    6  
ATOM 9913  C CA   . GLY A 1 94  ? 6.404   4.058   1.842   1.00 0.00 ? 94  GLY A CA   6  
ATOM 9914  C C    . GLY A 1 94  ? 5.438   2.928   2.137   1.00 0.00 ? 94  GLY A C    6  
ATOM 9915  O O    . GLY A 1 94  ? 4.222   3.103   2.056   1.00 0.00 ? 94  GLY A O    6  
ATOM 9916  H H    . GLY A 1 94  ? 5.597   4.192   -0.111  1.00 0.00 ? 94  GLY A H    6  
ATOM 9917  H HA2  . GLY A 1 94  ? 7.414   3.682   1.910   1.00 0.00 ? 94  GLY A HA2  6  
ATOM 9918  H HA3  . GLY A 1 94  ? 6.269   4.834   2.581   1.00 0.00 ? 94  GLY A HA3  6  
ATOM 9919  N N    . LEU A 1 95  ? 5.979   1.764   2.479   1.00 0.00 ? 95  LEU A N    6  
ATOM 9920  C CA   . LEU A 1 95  ? 5.157   0.599   2.787   1.00 0.00 ? 95  LEU A CA   6  
ATOM 9921  C C    . LEU A 1 95  ? 4.088   0.943   3.819   1.00 0.00 ? 95  LEU A C    6  
ATOM 9922  O O    . LEU A 1 95  ? 4.297   1.794   4.683   1.00 0.00 ? 95  LEU A O    6  
ATOM 9923  C CB   . LEU A 1 95  ? 6.031   -0.545  3.303   1.00 0.00 ? 95  LEU A CB   6  
ATOM 9924  C CG   . LEU A 1 95  ? 5.417   -1.944  3.231   1.00 0.00 ? 95  LEU A CG   6  
ATOM 9925  C CD1  . LEU A 1 95  ? 6.502   -2.994  3.045   1.00 0.00 ? 95  LEU A CD1  6  
ATOM 9926  C CD2  . LEU A 1 95  ? 4.601   -2.234  4.482   1.00 0.00 ? 95  LEU A CD2  6  
ATOM 9927  H H    . LEU A 1 95  ? 6.954   1.685   2.527   1.00 0.00 ? 95  LEU A H    6  
ATOM 9928  H HA   . LEU A 1 95  ? 4.671   0.286   1.874   1.00 0.00 ? 95  LEU A HA   6  
ATOM 9929  H HB2  . LEU A 1 95  ? 6.941   -0.553  2.724   1.00 0.00 ? 95  LEU A HB2  6  
ATOM 9930  H HB3  . LEU A 1 95  ? 6.266   -0.339  4.338   1.00 0.00 ? 95  LEU A HB3  6  
ATOM 9931  H HG   . LEU A 1 95  ? 4.754   -1.996  2.378   1.00 0.00 ? 95  LEU A HG   6  
ATOM 9932  H HD11 . LEU A 1 95  ? 6.448   -3.713  3.847   1.00 0.00 ? 95  LEU A HD11 6  
ATOM 9933  H HD12 . LEU A 1 95  ? 7.470   -2.516  3.054   1.00 0.00 ? 95  LEU A HD12 6  
ATOM 9934  H HD13 . LEU A 1 95  ? 6.358   -3.496  2.099   1.00 0.00 ? 95  LEU A HD13 6  
ATOM 9935  H HD21 . LEU A 1 95  ? 4.489   -3.302  4.598   1.00 0.00 ? 95  LEU A HD21 6  
ATOM 9936  H HD22 . LEU A 1 95  ? 3.626   -1.778  4.389   1.00 0.00 ? 95  LEU A HD22 6  
ATOM 9937  H HD23 . LEU A 1 95  ? 5.108   -1.828  5.344   1.00 0.00 ? 95  LEU A HD23 6  
ATOM 9938  N N    . GLY A 1 96  ? 2.942   0.275   3.723   1.00 0.00 ? 96  GLY A N    6  
ATOM 9939  C CA   . GLY A 1 96  ? 1.859   0.523   4.656   1.00 0.00 ? 96  GLY A CA   6  
ATOM 9940  C C    . GLY A 1 96  ? 1.824   -0.487  5.786   1.00 0.00 ? 96  GLY A C    6  
ATOM 9941  O O    . GLY A 1 96  ? 2.849   -0.772  6.404   1.00 0.00 ? 96  GLY A O    6  
ATOM 9942  H H    . GLY A 1 96  ? 2.832   -0.392  3.014   1.00 0.00 ? 96  GLY A H    6  
ATOM 9943  H HA2  . GLY A 1 96  ? 1.977   1.512   5.074   1.00 0.00 ? 96  GLY A HA2  6  
ATOM 9944  H HA3  . GLY A 1 96  ? 0.921   0.480   4.121   1.00 0.00 ? 96  GLY A HA3  6  
ATOM 9945  N N    . ALA A 1 97  ? 0.641   -1.027  6.058   1.00 0.00 ? 97  ALA A N    6  
ATOM 9946  C CA   . ALA A 1 97  ? 0.476   -2.011  7.121   1.00 0.00 ? 97  ALA A CA   6  
ATOM 9947  C C    . ALA A 1 97  ? 0.138   -3.384  6.551   1.00 0.00 ? 97  ALA A C    6  
ATOM 9948  O O    . ALA A 1 97  ? -0.029  -3.541  5.341   1.00 0.00 ? 97  ALA A O    6  
ATOM 9949  C CB   . ALA A 1 97  ? -0.604  -1.561  8.094   1.00 0.00 ? 97  ALA A CB   6  
ATOM 9950  H H    . ALA A 1 97  ? -0.140  -0.759  5.530   1.00 0.00 ? 97  ALA A H    6  
ATOM 9951  H HA   . ALA A 1 97  ? 1.409   -2.077  7.662   1.00 0.00 ? 97  ALA A HA   6  
ATOM 9952  H HB1  . ALA A 1 97  ? -0.940  -2.408  8.674   1.00 0.00 ? 97  ALA A HB1  6  
ATOM 9953  H HB2  . ALA A 1 97  ? -0.201  -0.809  8.756   1.00 0.00 ? 97  ALA A HB2  6  
ATOM 9954  H HB3  . ALA A 1 97  ? -1.435  -1.149  7.543   1.00 0.00 ? 97  ALA A HB3  6  
ATOM 9955  N N    . SER A 1 98  ? 0.040   -4.377  7.429   1.00 0.00 ? 98  SER A N    6  
ATOM 9956  C CA   . SER A 1 98  ? -0.274  -5.738  7.012   1.00 0.00 ? 98  SER A CA   6  
ATOM 9957  C C    . SER A 1 98  ? -1.571  -6.218  7.655   1.00 0.00 ? 98  SER A C    6  
ATOM 9958  O O    . SER A 1 98  ? -1.936  -5.783  8.748   1.00 0.00 ? 98  SER A O    6  
ATOM 9959  C CB   . SER A 1 98  ? 0.871   -6.684  7.381   1.00 0.00 ? 98  SER A CB   6  
ATOM 9960  O OG   . SER A 1 98  ? 0.941   -7.776  6.481   1.00 0.00 ? 98  SER A OG   6  
ATOM 9961  H H    . SER A 1 98  ? 0.184   -4.189  8.381   1.00 0.00 ? 98  SER A H    6  
ATOM 9962  H HA   . SER A 1 98  ? -0.396  -5.736  5.939   1.00 0.00 ? 98  SER A HA   6  
ATOM 9963  H HB2  . SER A 1 98  ? 1.806   -6.144  7.346   1.00 0.00 ? 98  SER A HB2  6  
ATOM 9964  H HB3  . SER A 1 98  ? 0.712   -7.065  8.379   1.00 0.00 ? 98  SER A HB3  6  
ATOM 9965  H HG   . SER A 1 98  ? 0.610   -7.505  5.622   1.00 0.00 ? 98  SER A HG   6  
ATOM 9966  N N    . THR A 1 99  ? -2.267  -7.120  6.968   1.00 0.00 ? 99  THR A N    6  
ATOM 9967  C CA   . THR A 1 99  ? -3.525  -7.659  7.470   1.00 0.00 ? 99  THR A CA   6  
ATOM 9968  C C    . THR A 1 99  ? -3.286  -8.632  8.619   1.00 0.00 ? 99  THR A C    6  
ATOM 9969  O O    . THR A 1 99  ? -2.144  -8.939  8.958   1.00 0.00 ? 99  THR A O    6  
ATOM 9970  C CB   . THR A 1 99  ? -4.310  -8.379  6.357   1.00 0.00 ? 99  THR A CB   6  
ATOM 9971  O OG1  . THR A 1 99  ? -3.484  -9.369  5.736   1.00 0.00 ? 99  THR A OG1  6  
ATOM 9972  C CG2  . THR A 1 99  ? -4.797  -7.388  5.311   1.00 0.00 ? 99  THR A CG2  6  
ATOM 9973  H H    . THR A 1 99  ? -1.925  -7.428  6.103   1.00 0.00 ? 99  THR A H    6  
ATOM 9974  H HA   . THR A 1 99  ? -4.122  -6.833  7.827   1.00 0.00 ? 99  THR A HA   6  
ATOM 9975  H HB   . THR A 1 99  ? -5.169  -8.863  6.800   1.00 0.00 ? 99  THR A HB   6  
ATOM 9976  H HG1  . THR A 1 99  ? -3.267  -10.052 6.375   1.00 0.00 ? 99  THR A HG1  6  
ATOM 9977  H HG21 . THR A 1 99  ? -5.852  -7.540  5.134   1.00 0.00 ? 99  THR A HG21 6  
ATOM 9978  H HG22 . THR A 1 99  ? -4.253  -7.539  4.391   1.00 0.00 ? 99  THR A HG22 6  
ATOM 9979  H HG23 . THR A 1 99  ? -4.633  -6.381  5.665   1.00 0.00 ? 99  THR A HG23 6  
ATOM 9980  N N    . ALA A 1 100 ? -4.372  -9.113  9.215   1.00 0.00 ? 100 ALA A N    6  
ATOM 9981  C CA   . ALA A 1 100 ? -4.281  -10.054 10.325  1.00 0.00 ? 100 ALA A CA   6  
ATOM 9982  C C    . ALA A 1 100 ? -3.453  -11.276 9.942   1.00 0.00 ? 100 ALA A C    6  
ATOM 9983  O O    . ALA A 1 100 ? -3.485  -11.724 8.797   1.00 0.00 ? 100 ALA A O    6  
ATOM 9984  C CB   . ALA A 1 100 ? -5.672  -10.476 10.775  1.00 0.00 ? 100 ALA A CB   6  
ATOM 9985  H H    . ALA A 1 100 ? -5.256  -8.830  8.900   1.00 0.00 ? 100 ALA A H    6  
ATOM 9986  H HA   . ALA A 1 100 ? -3.800  -9.549  11.151  1.00 0.00 ? 100 ALA A HA   6  
ATOM 9987  H HB1  . ALA A 1 100 ? -5.731  -10.425 11.852  1.00 0.00 ? 100 ALA A HB1  6  
ATOM 9988  H HB2  . ALA A 1 100 ? -6.406  -9.814  10.341  1.00 0.00 ? 100 ALA A HB2  6  
ATOM 9989  H HB3  . ALA A 1 100 ? -5.862  -11.488 10.451  1.00 0.00 ? 100 ALA A HB3  6  
ATOM 9990  N N    . GLU A 1 101 ? -2.712  -11.809 10.908  1.00 0.00 ? 101 GLU A N    6  
ATOM 9991  C CA   . GLU A 1 101 ? -1.874  -12.979 10.671  1.00 0.00 ? 101 GLU A CA   6  
ATOM 9992  C C    . GLU A 1 101 ? -2.729  -14.218 10.419  1.00 0.00 ? 101 GLU A C    6  
ATOM 9993  O O    . GLU A 1 101 ? -3.434  -14.689 11.312  1.00 0.00 ? 101 GLU A O    6  
ATOM 9994  C CB   . GLU A 1 101 ? -0.945  -13.219 11.862  1.00 0.00 ? 101 GLU A CB   6  
ATOM 9995  C CG   . GLU A 1 101 ? 0.338   -13.947 11.497  1.00 0.00 ? 101 GLU A CG   6  
ATOM 9996  C CD   . GLU A 1 101 ? 1.260   -14.135 12.686  1.00 0.00 ? 101 GLU A CD   6  
ATOM 9997  O OE1  . GLU A 1 101 ? 1.944   -13.161 13.065  1.00 0.00 ? 101 GLU A OE1  6  
ATOM 9998  O OE2  . GLU A 1 101 ? 1.299   -15.256 13.236  1.00 0.00 ? 101 GLU A OE2  6  
ATOM 9999  H H    . GLU A 1 101 ? -2.729  -11.406 11.802  1.00 0.00 ? 101 GLU A H    6  
ATOM 10000 H HA   . GLU A 1 101 ? -1.276  -12.785 9.793   1.00 0.00 ? 101 GLU A HA   6  
ATOM 10001 H HB2  . GLU A 1 101 ? -0.683  -12.266 12.298  1.00 0.00 ? 101 GLU A HB2  6  
ATOM 10002 H HB3  . GLU A 1 101 ? -1.471  -13.809 12.599  1.00 0.00 ? 101 GLU A HB3  6  
ATOM 10003 H HG2  . GLU A 1 101 ? 0.085   -14.919 11.100  1.00 0.00 ? 101 GLU A HG2  6  
ATOM 10004 H HG3  . GLU A 1 101 ? 0.858   -13.375 10.743  1.00 0.00 ? 101 GLU A HG3  6  
ATOM 10005 N N    . ILE A 1 102 ? -2.660  -14.739 9.199   1.00 0.00 ? 102 ILE A N    6  
ATOM 10006 C CA   . ILE A 1 102 ? -3.426  -15.923 8.831   1.00 0.00 ? 102 ILE A CA   6  
ATOM 10007 C C    . ILE A 1 102 ? -2.511  -17.039 8.339   1.00 0.00 ? 102 ILE A C    6  
ATOM 10008 O O    . ILE A 1 102 ? -1.315  -16.832 8.138   1.00 0.00 ? 102 ILE A O    6  
ATOM 10009 C CB   . ILE A 1 102 ? -4.462  -15.605 7.736   1.00 0.00 ? 102 ILE A CB   6  
ATOM 10010 C CG1  . ILE A 1 102 ? -3.779  -14.960 6.528   1.00 0.00 ? 102 ILE A CG1  6  
ATOM 10011 C CG2  . ILE A 1 102 ? -5.550  -14.693 8.286   1.00 0.00 ? 102 ILE A CG2  6  
ATOM 10012 C CD1  . ILE A 1 102 ? -4.698  -14.778 5.341   1.00 0.00 ? 102 ILE A CD1  6  
ATOM 10013 H H    . ILE A 1 102 ? -2.080  -14.318 8.531   1.00 0.00 ? 102 ILE A H    6  
ATOM 10014 H HA   . ILE A 1 102 ? -3.954  -16.265 9.709   1.00 0.00 ? 102 ILE A HA   6  
ATOM 10015 H HB   . ILE A 1 102 ? -4.924  -16.531 7.429   1.00 0.00 ? 102 ILE A HB   6  
ATOM 10016 H HG12 . ILE A 1 102 ? -3.406  -13.989 6.810   1.00 0.00 ? 102 ILE A HG12 6  
ATOM 10017 H HG13 . ILE A 1 102 ? -2.953  -15.583 6.217   1.00 0.00 ? 102 ILE A HG13 6  
ATOM 10018 H HG21 . ILE A 1 102 ? -6.404  -15.287 8.577   1.00 0.00 ? 102 ILE A HG21 6  
ATOM 10019 H HG22 . ILE A 1 102 ? -5.172  -14.161 9.145   1.00 0.00 ? 102 ILE A HG22 6  
ATOM 10020 H HG23 . ILE A 1 102 ? -5.846  -13.987 7.525   1.00 0.00 ? 102 ILE A HG23 6  
ATOM 10021 H HD11 . ILE A 1 102 ? -5.363  -15.626 5.266   1.00 0.00 ? 102 ILE A HD11 6  
ATOM 10022 H HD12 . ILE A 1 102 ? -5.276  -13.876 5.467   1.00 0.00 ? 102 ILE A HD12 6  
ATOM 10023 H HD13 . ILE A 1 102 ? -4.108  -14.704 4.438   1.00 0.00 ? 102 ILE A HD13 6  
ATOM 10024 N N    . SER A 1 103 ? -3.082  -18.224 8.146   1.00 0.00 ? 103 SER A N    6  
ATOM 10025 C CA   . SER A 1 103 ? -2.318  -19.374 7.679   1.00 0.00 ? 103 SER A CA   6  
ATOM 10026 C C    . SER A 1 103 ? -3.200  -20.322 6.872   1.00 0.00 ? 103 SER A C    6  
ATOM 10027 O O    . SER A 1 103 ? -4.423  -20.189 6.859   1.00 0.00 ? 103 SER A O    6  
ATOM 10028 C CB   . SER A 1 103 ? -1.702  -20.119 8.865   1.00 0.00 ? 103 SER A CB   6  
ATOM 10029 O OG   . SER A 1 103 ? -2.612  -20.195 9.948   1.00 0.00 ? 103 SER A OG   6  
ATOM 10030 H H    . SER A 1 103 ? -4.041  -18.326 8.324   1.00 0.00 ? 103 SER A H    6  
ATOM 10031 H HA   . SER A 1 103 ? -1.525  -19.010 7.043   1.00 0.00 ? 103 SER A HA   6  
ATOM 10032 H HB2  . SER A 1 103 ? -1.438  -21.120 8.561   1.00 0.00 ? 103 SER A HB2  6  
ATOM 10033 H HB3  . SER A 1 103 ? -0.814  -19.596 9.193   1.00 0.00 ? 103 SER A HB3  6  
ATOM 10034 H HG   . SER A 1 103 ? -2.509  -21.039 10.395  1.00 0.00 ? 103 SER A HG   6  
ATOM 10035 N N    . ALA A 1 104 ? -2.569  -21.279 6.200   1.00 0.00 ? 104 ALA A N    6  
ATOM 10036 C CA   . ALA A 1 104 ? -3.296  -22.251 5.392   1.00 0.00 ? 104 ALA A CA   6  
ATOM 10037 C C    . ALA A 1 104 ? -2.592  -23.604 5.396   1.00 0.00 ? 104 ALA A C    6  
ATOM 10038 O O    . ALA A 1 104 ? -1.363  -23.675 5.379   1.00 0.00 ? 104 ALA A O    6  
ATOM 10039 C CB   . ALA A 1 104 ? -3.454  -21.740 3.968   1.00 0.00 ? 104 ALA A CB   6  
ATOM 10040 H H    . ALA A 1 104 ? -1.592  -21.334 6.250   1.00 0.00 ? 104 ALA A H    6  
ATOM 10041 H HA   . ALA A 1 104 ? -4.282  -22.369 5.818   1.00 0.00 ? 104 ALA A HA   6  
ATOM 10042 H HB1  . ALA A 1 104 ? -3.129  -20.711 3.918   1.00 0.00 ? 104 ALA A HB1  6  
ATOM 10043 H HB2  . ALA A 1 104 ? -2.853  -22.341 3.302   1.00 0.00 ? 104 ALA A HB2  6  
ATOM 10044 H HB3  . ALA A 1 104 ? -4.491  -21.805 3.676   1.00 0.00 ? 104 ALA A HB3  6  
ATOM 10045 N N    . ARG A 1 105 ? -3.378  -24.675 5.419   1.00 0.00 ? 105 ARG A N    6  
ATOM 10046 C CA   . ARG A 1 105 ? -2.830  -26.026 5.427   1.00 0.00 ? 105 ARG A CA   6  
ATOM 10047 C C    . ARG A 1 105 ? -2.903  -26.650 4.037   1.00 0.00 ? 105 ARG A C    6  
ATOM 10048 O O    . ARG A 1 105 ? -3.963  -26.678 3.411   1.00 0.00 ? 105 ARG A O    6  
ATOM 10049 C CB   . ARG A 1 105 ? -3.584  -26.900 6.431   1.00 0.00 ? 105 ARG A CB   6  
ATOM 10050 C CG   . ARG A 1 105 ? -3.107  -28.342 6.461   1.00 0.00 ? 105 ARG A CG   6  
ATOM 10051 C CD   . ARG A 1 105 ? -4.117  -29.248 7.149   1.00 0.00 ? 105 ARG A CD   6  
ATOM 10052 N NE   . ARG A 1 105 ? -5.139  -29.730 6.225   1.00 0.00 ? 105 ARG A NE   6  
ATOM 10053 C CZ   . ARG A 1 105 ? -6.236  -30.372 6.611   1.00 0.00 ? 105 ARG A CZ   6  
ATOM 10054 N NH1  . ARG A 1 105 ? -6.451  -30.609 7.898   1.00 0.00 ? 105 ARG A NH1  6  
ATOM 10055 N NH2  . ARG A 1 105 ? -7.120  -30.779 5.710   1.00 0.00 ? 105 ARG A NH2  6  
ATOM 10056 H H    . ARG A 1 105 ? -4.351  -24.554 5.432   1.00 0.00 ? 105 ARG A H    6  
ATOM 10057 H HA   . ARG A 1 105 ? -1.794  -25.962 5.726   1.00 0.00 ? 105 ARG A HA   6  
ATOM 10058 H HB2  . ARG A 1 105 ? -3.460  -26.482 7.419   1.00 0.00 ? 105 ARG A HB2  6  
ATOM 10059 H HB3  . ARG A 1 105 ? -4.633  -26.895 6.176   1.00 0.00 ? 105 ARG A HB3  6  
ATOM 10060 H HG2  . ARG A 1 105 ? -2.964  -28.686 5.448   1.00 0.00 ? 105 ARG A HG2  6  
ATOM 10061 H HG3  . ARG A 1 105 ? -2.170  -28.391 6.996   1.00 0.00 ? 105 ARG A HG3  6  
ATOM 10062 H HD2  . ARG A 1 105 ? -3.594  -30.096 7.566   1.00 0.00 ? 105 ARG A HD2  6  
ATOM 10063 H HD3  . ARG A 1 105 ? -4.594  -28.694 7.944   1.00 0.00 ? 105 ARG A HD3  6  
ATOM 10064 H HE   . ARG A 1 105 ? -5.001  -29.566 5.269   1.00 0.00 ? 105 ARG A HE   6  
ATOM 10065 H HH11 . ARG A 1 105 ? -5.786  -30.302 8.580   1.00 0.00 ? 105 ARG A HH11 6  
ATOM 10066 H HH12 . ARG A 1 105 ? -7.278  -31.092 8.187   1.00 0.00 ? 105 ARG A HH12 6  
ATOM 10067 H HH21 . ARG A 1 105 ? -6.962  -30.603 4.739   1.00 0.00 ? 105 ARG A HH21 6  
ATOM 10068 H HH22 . ARG A 1 105 ? -7.945  -31.263 6.002   1.00 0.00 ? 105 ARG A HH22 6  
ATOM 10069 N N    . THR A 1 106 ? -1.768  -27.151 3.558   1.00 0.00 ? 106 THR A N    6  
ATOM 10070 C CA   . THR A 1 106 ? -1.703  -27.773 2.242   1.00 0.00 ? 106 THR A CA   6  
ATOM 10071 C C    . THR A 1 106 ? -2.461  -29.096 2.221   1.00 0.00 ? 106 THR A C    6  
ATOM 10072 O O    . THR A 1 106 ? -2.753  -29.671 3.268   1.00 0.00 ? 106 THR A O    6  
ATOM 10073 C CB   . THR A 1 106 ? -0.245  -28.024 1.810   1.00 0.00 ? 106 THR A CB   6  
ATOM 10074 O OG1  . THR A 1 106 ? 0.517   -28.510 2.921   1.00 0.00 ? 106 THR A OG1  6  
ATOM 10075 C CG2  . THR A 1 106 ? 0.387   -26.748 1.274   1.00 0.00 ? 106 THR A CG2  6  
ATOM 10076 H H    . THR A 1 106 ? -0.956  -27.098 4.104   1.00 0.00 ? 106 THR A H    6  
ATOM 10077 H HA   . THR A 1 106 ? -2.156  -27.098 1.530   1.00 0.00 ? 106 THR A HA   6  
ATOM 10078 H HB   . THR A 1 106 ? -0.240  -28.768 1.027   1.00 0.00 ? 106 THR A HB   6  
ATOM 10079 H HG1  . THR A 1 106 ? 1.435   -28.612 2.658   1.00 0.00 ? 106 THR A HG1  6  
ATOM 10080 H HG21 . THR A 1 106 ? 1.463   -26.832 1.321   1.00 0.00 ? 106 THR A HG21 6  
ATOM 10081 H HG22 . THR A 1 106 ? 0.065   -25.908 1.871   1.00 0.00 ? 106 THR A HG22 6  
ATOM 10082 H HG23 . THR A 1 106 ? 0.082   -26.600 0.249   1.00 0.00 ? 106 THR A HG23 6  
ATOM 10083 N N    . MET A 1 107 ? -2.777  -29.572 1.021   1.00 0.00 ? 107 MET A N    6  
ATOM 10084 C CA   . MET A 1 107 ? -3.500  -30.829 0.864   1.00 0.00 ? 107 MET A CA   6  
ATOM 10085 C C    . MET A 1 107 ? -2.664  -32.003 1.363   1.00 0.00 ? 107 MET A C    6  
ATOM 10086 O O    . MET A 1 107 ? -1.468  -32.086 1.085   1.00 0.00 ? 107 MET A O    6  
ATOM 10087 C CB   . MET A 1 107 ? -3.880  -31.044 -0.602  1.00 0.00 ? 107 MET A CB   6  
ATOM 10088 C CG   . MET A 1 107 ? -4.725  -29.921 -1.182  1.00 0.00 ? 107 MET A CG   6  
ATOM 10089 S SD   . MET A 1 107 ? -6.442  -29.990 -0.633  1.00 0.00 ? 107 MET A SD   6  
ATOM 10090 C CE   . MET A 1 107 ? -7.078  -28.463 -1.321  1.00 0.00 ? 107 MET A CE   6  
ATOM 10091 H H    . MET A 1 107 ? -2.517  -29.068 0.221   1.00 0.00 ? 107 MET A H    6  
ATOM 10092 H HA   . MET A 1 107 ? -4.402  -30.768 1.455   1.00 0.00 ? 107 MET A HA   6  
ATOM 10093 H HB2  . MET A 1 107 ? -2.977  -31.125 -1.188  1.00 0.00 ? 107 MET A HB2  6  
ATOM 10094 H HB3  . MET A 1 107 ? -4.438  -31.965 -0.686  1.00 0.00 ? 107 MET A HB3  6  
ATOM 10095 H HG2  . MET A 1 107 ? -4.303  -28.976 -0.877  1.00 0.00 ? 107 MET A HG2  6  
ATOM 10096 H HG3  . MET A 1 107 ? -4.703  -29.993 -2.259  1.00 0.00 ? 107 MET A HG3  6  
ATOM 10097 H HE1  . MET A 1 107 ? -8.147  -28.544 -1.448  1.00 0.00 ? 107 MET A HE1  6  
ATOM 10098 H HE2  . MET A 1 107 ? -6.855  -27.646 -0.651  1.00 0.00 ? 107 MET A HE2  6  
ATOM 10099 H HE3  . MET A 1 107 ? -6.614  -28.280 -2.280  1.00 0.00 ? 107 MET A HE3  6  
ATOM 10100 N N    . GLN A 1 108 ? -3.301  -32.907 2.099   1.00 0.00 ? 108 GLN A N    6  
ATOM 10101 C CA   . GLN A 1 108 ? -2.614  -34.076 2.636   1.00 0.00 ? 108 GLN A CA   6  
ATOM 10102 C C    . GLN A 1 108 ? -2.263  -35.060 1.525   1.00 0.00 ? 108 GLN A C    6  
ATOM 10103 O O    . GLN A 1 108 ? -3.051  -35.946 1.195   1.00 0.00 ? 108 GLN A O    6  
ATOM 10104 C CB   . GLN A 1 108 ? -3.484  -34.766 3.688   1.00 0.00 ? 108 GLN A CB   6  
ATOM 10105 C CG   . GLN A 1 108 ? -4.974  -34.681 3.398   1.00 0.00 ? 108 GLN A CG   6  
ATOM 10106 C CD   . GLN A 1 108 ? -5.770  -35.757 4.109   1.00 0.00 ? 108 GLN A CD   6  
ATOM 10107 O OE1  . GLN A 1 108 ? -5.248  -36.828 4.420   1.00 0.00 ? 108 GLN A OE1  6  
ATOM 10108 N NE2  . GLN A 1 108 ? -7.042  -35.478 4.370   1.00 0.00 ? 108 GLN A NE2  6  
ATOM 10109 H H    . GLN A 1 108 ? -4.255  -32.786 2.286   1.00 0.00 ? 108 GLN A H    6  
ATOM 10110 H HA   . GLN A 1 108 ? -1.701  -33.738 3.103   1.00 0.00 ? 108 GLN A HA   6  
ATOM 10111 H HB2  . GLN A 1 108 ? -3.208  -35.809 3.739   1.00 0.00 ? 108 GLN A HB2  6  
ATOM 10112 H HB3  . GLN A 1 108 ? -3.300  -34.307 4.648   1.00 0.00 ? 108 GLN A HB3  6  
ATOM 10113 H HG2  . GLN A 1 108 ? -5.335  -33.715 3.720   1.00 0.00 ? 108 GLN A HG2  6  
ATOM 10114 H HG3  . GLN A 1 108 ? -5.126  -34.784 2.333   1.00 0.00 ? 108 GLN A HG3  6  
ATOM 10115 H HE21 . GLN A 1 108 ? -7.390  -34.604 4.091   1.00 0.00 ? 108 GLN A HE21 6  
ATOM 10116 H HE22 . GLN A 1 108 ? -7.580  -36.155 4.828   1.00 0.00 ? 108 GLN A HE22 6  
ATOM 10117 N N    . SER A 1 109 ? -1.075  -34.897 0.951   1.00 0.00 ? 109 SER A N    6  
ATOM 10118 C CA   . SER A 1 109 ? -0.621  -35.768 -0.127  1.00 0.00 ? 109 SER A CA   6  
ATOM 10119 C C    . SER A 1 109 ? -1.117  -37.196 0.083   1.00 0.00 ? 109 SER A C    6  
ATOM 10120 O O    . SER A 1 109 ? -1.223  -37.667 1.216   1.00 0.00 ? 109 SER A O    6  
ATOM 10121 C CB   . SER A 1 109 ? 0.906   -35.754 -0.214  1.00 0.00 ? 109 SER A CB   6  
ATOM 10122 O OG   . SER A 1 109 ? 1.491   -36.129 1.022   1.00 0.00 ? 109 SER A OG   6  
ATOM 10123 H H    . SER A 1 109 ? -0.492  -34.171 1.258   1.00 0.00 ? 109 SER A H    6  
ATOM 10124 H HA   . SER A 1 109 ? -1.030  -35.390 -1.053  1.00 0.00 ? 109 SER A HA   6  
ATOM 10125 H HB2  . SER A 1 109 ? 1.227   -36.447 -0.975  1.00 0.00 ? 109 SER A HB2  6  
ATOM 10126 H HB3  . SER A 1 109 ? 1.240   -34.758 -0.469  1.00 0.00 ? 109 SER A HB3  6  
ATOM 10127 H HG   . SER A 1 109 ? 1.087   -36.942 1.333   1.00 0.00 ? 109 SER A HG   6  
ATOM 10128 N N    . SER A 1 110 ? -1.418  -37.879 -1.016  1.00 0.00 ? 110 SER A N    6  
ATOM 10129 C CA   . SER A 1 110 ? -1.906  -39.251 -0.954  1.00 0.00 ? 110 SER A CA   6  
ATOM 10130 C C    . SER A 1 110 ? -1.025  -40.180 -1.784  1.00 0.00 ? 110 SER A C    6  
ATOM 10131 O O    . SER A 1 110 ? -0.408  -39.758 -2.761  1.00 0.00 ? 110 SER A O    6  
ATOM 10132 C CB   . SER A 1 110 ? -3.352  -39.324 -1.449  1.00 0.00 ? 110 SER A CB   6  
ATOM 10133 O OG   . SER A 1 110 ? -4.261  -38.957 -0.426  1.00 0.00 ? 110 SER A OG   6  
ATOM 10134 H H    . SER A 1 110 ? -1.312  -37.448 -1.890  1.00 0.00 ? 110 SER A H    6  
ATOM 10135 H HA   . SER A 1 110 ? -1.872  -39.569 0.078   1.00 0.00 ? 110 SER A HA   6  
ATOM 10136 H HB2  . SER A 1 110 ? -3.478  -38.652 -2.284  1.00 0.00 ? 110 SER A HB2  6  
ATOM 10137 H HB3  . SER A 1 110 ? -3.571  -40.334 -1.764  1.00 0.00 ? 110 SER A HB3  6  
ATOM 10138 H HG   . SER A 1 110 ? -3.861  -38.286 0.132   1.00 0.00 ? 110 SER A HG   6  
ATOM 10139 N N    . GLY A 1 111 ? -0.971  -41.447 -1.386  1.00 0.00 ? 111 GLY A N    6  
ATOM 10140 C CA   . GLY A 1 111 ? -0.163  -42.416 -2.103  1.00 0.00 ? 111 GLY A CA   6  
ATOM 10141 C C    . GLY A 1 111 ? -1.001  -43.381 -2.917  1.00 0.00 ? 111 GLY A C    6  
ATOM 10142 O O    . GLY A 1 111 ? -2.184  -43.151 -3.167  1.00 0.00 ? 111 GLY A O    6  
ATOM 10143 H H    . GLY A 1 111 ? -1.484  -41.726 -0.599  1.00 0.00 ? 111 GLY A H    6  
ATOM 10144 H HA2  . GLY A 1 111 ? 0.507   -41.890 -2.766  1.00 0.00 ? 111 GLY A HA2  6  
ATOM 10145 H HA3  . GLY A 1 111 ? 0.422   -42.979 -1.389  1.00 0.00 ? 111 GLY A HA3  6  
ATOM 10146 N N    . PRO A 1 112 ? -0.383  -44.491 -3.346  1.00 0.00 ? 112 PRO A N    6  
ATOM 10147 C CA   . PRO A 1 112 ? -1.061  -45.517 -4.145  1.00 0.00 ? 112 PRO A CA   6  
ATOM 10148 C C    . PRO A 1 112 ? -2.098  -46.289 -3.336  1.00 0.00 ? 112 PRO A C    6  
ATOM 10149 O O    . PRO A 1 112 ? -1.869  -46.622 -2.173  1.00 0.00 ? 112 PRO A O    6  
ATOM 10150 C CB   . PRO A 1 112 ? 0.079   -46.442 -4.576  1.00 0.00 ? 112 PRO A CB   6  
ATOM 10151 C CG   . PRO A 1 112 ? 1.128   -46.263 -3.533  1.00 0.00 ? 112 PRO A CG   6  
ATOM 10152 C CD   . PRO A 1 112 ? 1.026   -44.831 -3.086  1.00 0.00 ? 112 PRO A CD   6  
ATOM 10153 H HA   . PRO A 1 112 ? -1.532  -45.092 -5.019  1.00 0.00 ? 112 PRO A HA   6  
ATOM 10154 H HB2  . PRO A 1 112 ? -0.276  -47.463 -4.609  1.00 0.00 ? 112 PRO A HB2  6  
ATOM 10155 H HB3  . PRO A 1 112 ? 0.438   -46.148 -5.551  1.00 0.00 ? 112 PRO A HB3  6  
ATOM 10156 H HG2  . PRO A 1 112 ? 0.939   -46.929 -2.705  1.00 0.00 ? 112 PRO A HG2  6  
ATOM 10157 H HG3  . PRO A 1 112 ? 2.103   -46.455 -3.956  1.00 0.00 ? 112 PRO A HG3  6  
ATOM 10158 H HD2  . PRO A 1 112 ? 1.255   -44.747 -2.033  1.00 0.00 ? 112 PRO A HD2  6  
ATOM 10159 H HD3  . PRO A 1 112 ? 1.687   -44.206 -3.668  1.00 0.00 ? 112 PRO A HD3  6  
ATOM 10160 N N    . SER A 1 113 ? -3.237  -46.572 -3.959  1.00 0.00 ? 113 SER A N    6  
ATOM 10161 C CA   . SER A 1 113 ? -4.310  -47.303 -3.296  1.00 0.00 ? 113 SER A CA   6  
ATOM 10162 C C    . SER A 1 113 ? -4.181  -48.802 -3.545  1.00 0.00 ? 113 SER A C    6  
ATOM 10163 O O    . SER A 1 113 ? -4.314  -49.609 -2.625  1.00 0.00 ? 113 SER A O    6  
ATOM 10164 C CB   . SER A 1 113 ? -5.672  -46.808 -3.787  1.00 0.00 ? 113 SER A CB   6  
ATOM 10165 O OG   . SER A 1 113 ? -5.985  -45.542 -3.234  1.00 0.00 ? 113 SER A OG   6  
ATOM 10166 H H    . SER A 1 113 ? -3.360  -46.279 -4.887  1.00 0.00 ? 113 SER A H    6  
ATOM 10167 H HA   . SER A 1 113 ? -4.231  -47.118 -2.235  1.00 0.00 ? 113 SER A HA   6  
ATOM 10168 H HB2  . SER A 1 113 ? -5.655  -46.723 -4.863  1.00 0.00 ? 113 SER A HB2  6  
ATOM 10169 H HB3  . SER A 1 113 ? -6.436  -47.514 -3.494  1.00 0.00 ? 113 SER A HB3  6  
ATOM 10170 H HG   . SER A 1 113 ? -5.449  -44.866 -3.657  1.00 0.00 ? 113 SER A HG   6  
ATOM 10171 N N    . SER A 1 114 ? -3.921  -49.168 -4.796  1.00 0.00 ? 114 SER A N    6  
ATOM 10172 C CA   . SER A 1 114 ? -3.777  -50.570 -5.169  1.00 0.00 ? 114 SER A CA   6  
ATOM 10173 C C    . SER A 1 114 ? -2.412  -50.828 -5.799  1.00 0.00 ? 114 SER A C    6  
ATOM 10174 O O    . SER A 1 114 ? -2.130  -50.369 -6.905  1.00 0.00 ? 114 SER A O    6  
ATOM 10175 C CB   . SER A 1 114 ? -4.886  -50.978 -6.142  1.00 0.00 ? 114 SER A CB   6  
ATOM 10176 O OG   . SER A 1 114 ? -4.775  -50.271 -7.365  1.00 0.00 ? 114 SER A OG   6  
ATOM 10177 H H    . SER A 1 114 ? -3.826  -48.477 -5.486  1.00 0.00 ? 114 SER A H    6  
ATOM 10178 H HA   . SER A 1 114 ? -3.864  -51.163 -4.270  1.00 0.00 ? 114 SER A HA   6  
ATOM 10179 H HB2  . SER A 1 114 ? -4.813  -52.036 -6.343  1.00 0.00 ? 114 SER A HB2  6  
ATOM 10180 H HB3  . SER A 1 114 ? -5.847  -50.760 -5.699  1.00 0.00 ? 114 SER A HB3  6  
ATOM 10181 H HG   . SER A 1 114 ? -5.516  -49.668 -7.455  1.00 0.00 ? 114 SER A HG   6  
ATOM 10182 N N    . GLY A 1 115 ? -1.567  -51.566 -5.084  1.00 0.00 ? 115 GLY A N    6  
ATOM 10183 C CA   . GLY A 1 115 ? -0.241  -51.873 -5.588  1.00 0.00 ? 115 GLY A CA   6  
ATOM 10184 C C    . GLY A 1 115 ? 0.672   -52.432 -4.515  1.00 0.00 ? 115 GLY A C    6  
ATOM 10185 O O    . GLY A 1 115 ? 1.694   -53.045 -4.819  1.00 0.00 ? 115 GLY A O    6  
ATOM 10186 H H    . GLY A 1 115 ? -1.847  -51.905 -4.208  1.00 0.00 ? 115 GLY A H    6  
ATOM 10187 H HA2  . GLY A 1 115 ? -0.329  -52.596 -6.385  1.00 0.00 ? 115 GLY A HA2  6  
ATOM 10188 H HA3  . GLY A 1 115 ? 0.199   -50.969 -5.984  1.00 0.00 ? 115 GLY A HA3  6  
ATOM 10189 N N    . GLY A 1 1   ? -19.394 8.897   12.251  1.00 0.00 ? 1   GLY A N    7  
ATOM 10190 C CA   . GLY A 1 1   ? -18.075 9.077   11.674  1.00 0.00 ? 1   GLY A CA   7  
ATOM 10191 C C    . GLY A 1 1   ? -17.297 10.193  12.343  1.00 0.00 ? 1   GLY A C    7  
ATOM 10192 O O    . GLY A 1 1   ? -16.760 10.015  13.437  1.00 0.00 ? 1   GLY A O    7  
ATOM 10193 H H1   . GLY A 1 1   ? -20.086 9.576   12.109  1.00 0.00 ? 1   GLY A H1   7  
ATOM 10194 H HA2  . GLY A 1 1   ? -17.521 8.156   11.774  1.00 0.00 ? 1   GLY A HA2  7  
ATOM 10195 H HA3  . GLY A 1 1   ? -18.183 9.309   10.624  1.00 0.00 ? 1   GLY A HA3  7  
ATOM 10196 N N    . SER A 1 2   ? -17.234 11.346  11.685  1.00 0.00 ? 2   SER A N    7  
ATOM 10197 C CA   . SER A 1 2   ? -16.511 12.493  12.221  1.00 0.00 ? 2   SER A CA   7  
ATOM 10198 C C    . SER A 1 2   ? -17.291 13.784  11.989  1.00 0.00 ? 2   SER A C    7  
ATOM 10199 O O    . SER A 1 2   ? -18.073 13.888  11.044  1.00 0.00 ? 2   SER A O    7  
ATOM 10200 C CB   . SER A 1 2   ? -15.127 12.597  11.577  1.00 0.00 ? 2   SER A CB   7  
ATOM 10201 O OG   . SER A 1 2   ? -14.316 11.491  11.930  1.00 0.00 ? 2   SER A OG   7  
ATOM 10202 H H    . SER A 1 2   ? -17.683 11.426  10.818  1.00 0.00 ? 2   SER A H    7  
ATOM 10203 H HA   . SER A 1 2   ? -16.393 12.344  13.284  1.00 0.00 ? 2   SER A HA   7  
ATOM 10204 H HB2  . SER A 1 2   ? -15.234 12.621  10.503  1.00 0.00 ? 2   SER A HB2  7  
ATOM 10205 H HB3  . SER A 1 2   ? -14.645 13.504  11.911  1.00 0.00 ? 2   SER A HB3  7  
ATOM 10206 H HG   . SER A 1 2   ? -14.344 11.364  12.881  1.00 0.00 ? 2   SER A HG   7  
ATOM 10207 N N    . SER A 1 3   ? -17.072 14.764  12.859  1.00 0.00 ? 3   SER A N    7  
ATOM 10208 C CA   . SER A 1 3   ? -17.757 16.048  12.752  1.00 0.00 ? 3   SER A CA   7  
ATOM 10209 C C    . SER A 1 3   ? -17.443 16.721  11.420  1.00 0.00 ? 3   SER A C    7  
ATOM 10210 O O    . SER A 1 3   ? -18.333 17.249  10.754  1.00 0.00 ? 3   SER A O    7  
ATOM 10211 C CB   . SER A 1 3   ? -17.351 16.964  13.908  1.00 0.00 ? 3   SER A CB   7  
ATOM 10212 O OG   . SER A 1 3   ? -17.913 18.256  13.756  1.00 0.00 ? 3   SER A OG   7  
ATOM 10213 H H    . SER A 1 3   ? -16.437 14.620  13.592  1.00 0.00 ? 3   SER A H    7  
ATOM 10214 H HA   . SER A 1 3   ? -18.819 15.862  12.807  1.00 0.00 ? 3   SER A HA   7  
ATOM 10215 H HB2  . SER A 1 3   ? -17.698 16.541  14.838  1.00 0.00 ? 3   SER A HB2  7  
ATOM 10216 H HB3  . SER A 1 3   ? -16.274 17.053  13.932  1.00 0.00 ? 3   SER A HB3  7  
ATOM 10217 H HG   . SER A 1 3   ? -18.779 18.183  13.349  1.00 0.00 ? 3   SER A HG   7  
ATOM 10218 N N    . GLY A 1 4   ? -16.170 16.699  11.038  1.00 0.00 ? 4   GLY A N    7  
ATOM 10219 C CA   . GLY A 1 4   ? -15.760 17.311  9.787   1.00 0.00 ? 4   GLY A CA   7  
ATOM 10220 C C    . GLY A 1 4   ? -14.325 17.798  9.823   1.00 0.00 ? 4   GLY A C    7  
ATOM 10221 O O    . GLY A 1 4   ? -13.986 18.694  10.595  1.00 0.00 ? 4   GLY A O    7  
ATOM 10222 H H    . GLY A 1 4   ? -15.503 16.264  11.610  1.00 0.00 ? 4   GLY A H    7  
ATOM 10223 H HA2  . GLY A 1 4   ? -15.864 16.586  8.993   1.00 0.00 ? 4   GLY A HA2  7  
ATOM 10224 H HA3  . GLY A 1 4   ? -16.408 18.151  9.581   1.00 0.00 ? 4   GLY A HA3  7  
ATOM 10225 N N    . SER A 1 5   ? -13.480 17.205  8.986   1.00 0.00 ? 5   SER A N    7  
ATOM 10226 C CA   . SER A 1 5   ? -12.072 17.580  8.929   1.00 0.00 ? 5   SER A CA   7  
ATOM 10227 C C    . SER A 1 5   ? -11.777 18.393  7.672   1.00 0.00 ? 5   SER A C    7  
ATOM 10228 O O    . SER A 1 5   ? -12.552 18.383  6.716   1.00 0.00 ? 5   SER A O    7  
ATOM 10229 C CB   . SER A 1 5   ? -11.188 16.331  8.961   1.00 0.00 ? 5   SER A CB   7  
ATOM 10230 O OG   . SER A 1 5   ? -11.416 15.516  7.824   1.00 0.00 ? 5   SER A OG   7  
ATOM 10231 H H    . SER A 1 5   ? -13.810 16.496  8.395   1.00 0.00 ? 5   SER A H    7  
ATOM 10232 H HA   . SER A 1 5   ? -11.855 18.186  9.795   1.00 0.00 ? 5   SER A HA   7  
ATOM 10233 H HB2  . SER A 1 5   ? -10.150 16.628  8.973   1.00 0.00 ? 5   SER A HB2  7  
ATOM 10234 H HB3  . SER A 1 5   ? -11.410 15.759  9.850   1.00 0.00 ? 5   SER A HB3  7  
ATOM 10235 H HG   . SER A 1 5   ? -11.596 16.072  7.062   1.00 0.00 ? 5   SER A HG   7  
ATOM 10236 N N    . SER A 1 6   ? -10.650 19.099  7.683   1.00 0.00 ? 6   SER A N    7  
ATOM 10237 C CA   . SER A 1 6   ? -10.253 19.922  6.546   1.00 0.00 ? 6   SER A CA   7  
ATOM 10238 C C    . SER A 1 6   ? -9.203  19.209  5.699   1.00 0.00 ? 6   SER A C    7  
ATOM 10239 O O    . SER A 1 6   ? -8.035  19.127  6.077   1.00 0.00 ? 6   SER A O    7  
ATOM 10240 C CB   . SER A 1 6   ? -9.707  21.267  7.030   1.00 0.00 ? 6   SER A CB   7  
ATOM 10241 O OG   . SER A 1 6   ? -10.707 22.011  7.702   1.00 0.00 ? 6   SER A OG   7  
ATOM 10242 H H    . SER A 1 6   ? -10.073 19.066  8.475   1.00 0.00 ? 6   SER A H    7  
ATOM 10243 H HA   . SER A 1 6   ? -11.130 20.096  5.941   1.00 0.00 ? 6   SER A HA   7  
ATOM 10244 H HB2  . SER A 1 6   ? -8.885  21.096  7.708   1.00 0.00 ? 6   SER A HB2  7  
ATOM 10245 H HB3  . SER A 1 6   ? -9.360  21.837  6.180   1.00 0.00 ? 6   SER A HB3  7  
ATOM 10246 H HG   . SER A 1 6   ? -10.328 22.825  8.041   1.00 0.00 ? 6   SER A HG   7  
ATOM 10247 N N    . GLY A 1 7   ? -9.630  18.693  4.550   1.00 0.00 ? 7   GLY A N    7  
ATOM 10248 C CA   . GLY A 1 7   ? -8.716  17.993  3.667   1.00 0.00 ? 7   GLY A CA   7  
ATOM 10249 C C    . GLY A 1 7   ? -9.206  17.960  2.233   1.00 0.00 ? 7   GLY A C    7  
ATOM 10250 O O    . GLY A 1 7   ? -8.419  18.106  1.297   1.00 0.00 ? 7   GLY A O    7  
ATOM 10251 H H    . GLY A 1 7   ? -10.573 18.789  4.300   1.00 0.00 ? 7   GLY A H    7  
ATOM 10252 H HA2  . GLY A 1 7   ? -7.755  18.486  3.697   1.00 0.00 ? 7   GLY A HA2  7  
ATOM 10253 H HA3  . GLY A 1 7   ? -8.600  16.978  4.018   1.00 0.00 ? 7   GLY A HA3  7  
ATOM 10254 N N    . ASP A 1 8   ? -10.509 17.767  2.059   1.00 0.00 ? 8   ASP A N    7  
ATOM 10255 C CA   . ASP A 1 8   ? -11.103 17.715  0.728   1.00 0.00 ? 8   ASP A CA   7  
ATOM 10256 C C    . ASP A 1 8   ? -10.728 18.951  -0.084  1.00 0.00 ? 8   ASP A C    7  
ATOM 10257 O O    . ASP A 1 8   ? -10.373 18.849  -1.258  1.00 0.00 ? 8   ASP A O    7  
ATOM 10258 C CB   . ASP A 1 8   ? -12.625 17.600  0.831   1.00 0.00 ? 8   ASP A CB   7  
ATOM 10259 C CG   . ASP A 1 8   ? -13.083 16.174  1.060   1.00 0.00 ? 8   ASP A CG   7  
ATOM 10260 O OD1  . ASP A 1 8   ? -12.379 15.245  0.611   1.00 0.00 ? 8   ASP A OD1  7  
ATOM 10261 O OD2  . ASP A 1 8   ? -14.147 15.985  1.688   1.00 0.00 ? 8   ASP A OD2  7  
ATOM 10262 H H    . ASP A 1 8   ? -11.085 17.658  2.845   1.00 0.00 ? 8   ASP A H    7  
ATOM 10263 H HA   . ASP A 1 8   ? -10.718 16.840  0.227   1.00 0.00 ? 8   ASP A HA   7  
ATOM 10264 H HB2  . ASP A 1 8   ? -12.971 18.207  1.655   1.00 0.00 ? 8   ASP A HB2  7  
ATOM 10265 H HB3  . ASP A 1 8   ? -13.069 17.959  -0.086  1.00 0.00 ? 8   ASP A HB3  7  
ATOM 10266 N N    . ILE A 1 9   ? -10.809 20.116  0.550   1.00 0.00 ? 9   ILE A N    7  
ATOM 10267 C CA   . ILE A 1 9   ? -10.478 21.371  -0.114  1.00 0.00 ? 9   ILE A CA   7  
ATOM 10268 C C    . ILE A 1 9   ? -9.117  21.889  0.338   1.00 0.00 ? 9   ILE A C    7  
ATOM 10269 O O    . ILE A 1 9   ? -9.018  22.633  1.313   1.00 0.00 ? 9   ILE A O    7  
ATOM 10270 C CB   . ILE A 1 9   ? -11.542 22.450  0.159   1.00 0.00 ? 9   ILE A CB   7  
ATOM 10271 C CG1  . ILE A 1 9   ? -12.904 22.002  -0.374  1.00 0.00 ? 9   ILE A CG1  7  
ATOM 10272 C CG2  . ILE A 1 9   ? -11.129 23.772  -0.471  1.00 0.00 ? 9   ILE A CG2  7  
ATOM 10273 C CD1  . ILE A 1 9   ? -13.717 21.216  0.630   1.00 0.00 ? 9   ILE A CD1  7  
ATOM 10274 H H    . ILE A 1 9   ? -11.098 20.132  1.486   1.00 0.00 ? 9   ILE A H    7  
ATOM 10275 H HA   . ILE A 1 9   ? -10.446 21.186  -1.178  1.00 0.00 ? 9   ILE A HA   7  
ATOM 10276 H HB   . ILE A 1 9   ? -11.611 22.594  1.227   1.00 0.00 ? 9   ILE A HB   7  
ATOM 10277 H HG12 . ILE A 1 9   ? -13.477 22.871  -0.657  1.00 0.00 ? 9   ILE A HG12 7  
ATOM 10278 H HG13 . ILE A 1 9   ? -12.753 21.376  -1.243  1.00 0.00 ? 9   ILE A HG13 7  
ATOM 10279 H HG21 . ILE A 1 9   ? -10.126 23.687  -0.861  1.00 0.00 ? 9   ILE A HG21 7  
ATOM 10280 H HG22 . ILE A 1 9   ? -11.808 24.014  -1.275  1.00 0.00 ? 9   ILE A HG22 7  
ATOM 10281 H HG23 . ILE A 1 9   ? -11.160 24.552  0.275   1.00 0.00 ? 9   ILE A HG23 7  
ATOM 10282 H HD11 . ILE A 1 9   ? -13.120 20.406  1.023   1.00 0.00 ? 9   ILE A HD11 7  
ATOM 10283 H HD12 . ILE A 1 9   ? -14.020 21.866  1.437   1.00 0.00 ? 9   ILE A HD12 7  
ATOM 10284 H HD13 . ILE A 1 9   ? -14.595 20.812  0.145   1.00 0.00 ? 9   ILE A HD13 7  
ATOM 10285 N N    . GLN A 1 10  ? -8.070  21.491  -0.379  1.00 0.00 ? 10  GLN A N    7  
ATOM 10286 C CA   . GLN A 1 10  ? -6.715  21.916  -0.052  1.00 0.00 ? 10  GLN A CA   7  
ATOM 10287 C C    . GLN A 1 10  ? -5.767  21.658  -1.219  1.00 0.00 ? 10  GLN A C    7  
ATOM 10288 O O    . GLN A 1 10  ? -5.587  20.518  -1.645  1.00 0.00 ? 10  GLN A O    7  
ATOM 10289 C CB   . GLN A 1 10  ? -6.216  21.187  1.197   1.00 0.00 ? 10  GLN A CB   7  
ATOM 10290 C CG   . GLN A 1 10  ? -6.588  21.881  2.497   1.00 0.00 ? 10  GLN A CG   7  
ATOM 10291 C CD   . GLN A 1 10  ? -5.603  21.597  3.613   1.00 0.00 ? 10  GLN A CD   7  
ATOM 10292 O OE1  . GLN A 1 10  ? -5.445  20.453  4.041   1.00 0.00 ? 10  GLN A OE1  7  
ATOM 10293 N NE2  . GLN A 1 10  ? -4.934  22.639  4.092   1.00 0.00 ? 10  GLN A NE2  7  
ATOM 10294 H H    . GLN A 1 10  ? -8.214  20.897  -1.144  1.00 0.00 ? 10  GLN A H    7  
ATOM 10295 H HA   . GLN A 1 10  ? -6.739  22.977  0.148   1.00 0.00 ? 10  GLN A HA   7  
ATOM 10296 H HB2  . GLN A 1 10  ? -6.637  20.192  1.211   1.00 0.00 ? 10  GLN A HB2  7  
ATOM 10297 H HB3  . GLN A 1 10  ? -5.139  21.113  1.150   1.00 0.00 ? 10  GLN A HB3  7  
ATOM 10298 H HG2  . GLN A 1 10  ? -6.617  22.947  2.326   1.00 0.00 ? 10  GLN A HG2  7  
ATOM 10299 H HG3  . GLN A 1 10  ? -7.566  21.540  2.804   1.00 0.00 ? 10  GLN A HG3  7  
ATOM 10300 H HE21 . GLN A 1 10  ? -5.113  23.521  3.703   1.00 0.00 ? 10  GLN A HE21 7  
ATOM 10301 H HE22 . GLN A 1 10  ? -4.292  22.484  4.815   1.00 0.00 ? 10  GLN A HE22 7  
ATOM 10302 N N    . VAL A 1 11  ? -5.163  22.726  -1.731  1.00 0.00 ? 11  VAL A N    7  
ATOM 10303 C CA   . VAL A 1 11  ? -4.233  22.616  -2.848  1.00 0.00 ? 11  VAL A CA   7  
ATOM 10304 C C    . VAL A 1 11  ? -2.926  21.961  -2.413  1.00 0.00 ? 11  VAL A C    7  
ATOM 10305 O O    . VAL A 1 11  ? -2.346  21.162  -3.148  1.00 0.00 ? 11  VAL A O    7  
ATOM 10306 C CB   . VAL A 1 11  ? -3.925  23.995  -3.461  1.00 0.00 ? 11  VAL A CB   7  
ATOM 10307 C CG1  . VAL A 1 11  ? -5.187  24.618  -4.037  1.00 0.00 ? 11  VAL A CG1  7  
ATOM 10308 C CG2  . VAL A 1 11  ? -3.295  24.910  -2.421  1.00 0.00 ? 11  VAL A CG2  7  
ATOM 10309 H H    . VAL A 1 11  ? -5.347  23.609  -1.348  1.00 0.00 ? 11  VAL A H    7  
ATOM 10310 H HA   . VAL A 1 11  ? -4.695  22.003  -3.609  1.00 0.00 ? 11  VAL A HA   7  
ATOM 10311 H HB   . VAL A 1 11  ? -3.217  23.859  -4.266  1.00 0.00 ? 11  VAL A HB   7  
ATOM 10312 H HG11 . VAL A 1 11  ? -6.021  24.413  -3.381  1.00 0.00 ? 11  VAL A HG11 7  
ATOM 10313 H HG12 . VAL A 1 11  ? -5.053  25.686  -4.128  1.00 0.00 ? 11  VAL A HG12 7  
ATOM 10314 H HG13 . VAL A 1 11  ? -5.384  24.195  -5.011  1.00 0.00 ? 11  VAL A HG13 7  
ATOM 10315 H HG21 . VAL A 1 11  ? -2.302  24.557  -2.187  1.00 0.00 ? 11  VAL A HG21 7  
ATOM 10316 H HG22 . VAL A 1 11  ? -3.237  25.915  -2.814  1.00 0.00 ? 11  VAL A HG22 7  
ATOM 10317 H HG23 . VAL A 1 11  ? -3.899  24.908  -1.526  1.00 0.00 ? 11  VAL A HG23 7  
ATOM 10318 N N    . ILE A 1 12  ? -2.470  22.306  -1.214  1.00 0.00 ? 12  ILE A N    7  
ATOM 10319 C CA   . ILE A 1 12  ? -1.232  21.750  -0.680  1.00 0.00 ? 12  ILE A CA   7  
ATOM 10320 C C    . ILE A 1 12  ? -1.139  20.253  -0.953  1.00 0.00 ? 12  ILE A C    7  
ATOM 10321 O O    . ILE A 1 12  ? -2.085  19.505  -0.705  1.00 0.00 ? 12  ILE A O    7  
ATOM 10322 C CB   . ILE A 1 12  ? -1.114  21.993  0.836   1.00 0.00 ? 12  ILE A CB   7  
ATOM 10323 C CG1  . ILE A 1 12  ? -1.081  23.493  1.134   1.00 0.00 ? 12  ILE A CG1  7  
ATOM 10324 C CG2  . ILE A 1 12  ? 0.129   21.310  1.387   1.00 0.00 ? 12  ILE A CG2  7  
ATOM 10325 C CD1  . ILE A 1 12  ? -1.376  23.830  2.578   1.00 0.00 ? 12  ILE A CD1  7  
ATOM 10326 H H    . ILE A 1 12  ? -2.977  22.948  -0.675  1.00 0.00 ? 12  ILE A H    7  
ATOM 10327 H HA   . ILE A 1 12  ? -0.406  22.247  -1.169  1.00 0.00 ? 12  ILE A HA   7  
ATOM 10328 H HB   . ILE A 1 12  ? -1.977  21.557  1.316   1.00 0.00 ? 12  ILE A HB   7  
ATOM 10329 H HG12 . ILE A 1 12  ? -0.101  23.879  0.898   1.00 0.00 ? 12  ILE A HG12 7  
ATOM 10330 H HG13 . ILE A 1 12  ? -1.817  23.991  0.519   1.00 0.00 ? 12  ILE A HG13 7  
ATOM 10331 H HG21 . ILE A 1 12  ? 0.672   20.845  0.578   1.00 0.00 ? 12  ILE A HG21 7  
ATOM 10332 H HG22 . ILE A 1 12  ? 0.759   22.044  1.867   1.00 0.00 ? 12  ILE A HG22 7  
ATOM 10333 H HG23 . ILE A 1 12  ? -0.161  20.559  2.105   1.00 0.00 ? 12  ILE A HG23 7  
ATOM 10334 H HD11 . ILE A 1 12  ? -0.764  23.217  3.224   1.00 0.00 ? 12  ILE A HD11 7  
ATOM 10335 H HD12 . ILE A 1 12  ? -1.160  24.872  2.758   1.00 0.00 ? 12  ILE A HD12 7  
ATOM 10336 H HD13 . ILE A 1 12  ? -2.420  23.639  2.786   1.00 0.00 ? 12  ILE A HD13 7  
ATOM 10337 N N    . THR A 1 13  ? 0.010   19.820  -1.464  1.00 0.00 ? 13  THR A N    7  
ATOM 10338 C CA   . THR A 1 13  ? 0.228   18.412  -1.770  1.00 0.00 ? 13  THR A CA   7  
ATOM 10339 C C    . THR A 1 13  ? 0.437   17.599  -0.497  1.00 0.00 ? 13  THR A C    7  
ATOM 10340 O O    . THR A 1 13  ? 1.213   17.986  0.376   1.00 0.00 ? 13  THR A O    7  
ATOM 10341 C CB   . THR A 1 13  ? 1.445   18.220  -2.694  1.00 0.00 ? 13  THR A CB   7  
ATOM 10342 O OG1  . THR A 1 13  ? 2.594   18.864  -2.132  1.00 0.00 ? 13  THR A OG1  7  
ATOM 10343 C CG2  . THR A 1 13  ? 1.167   18.786  -4.079  1.00 0.00 ? 13  THR A CG2  7  
ATOM 10344 H H    . THR A 1 13  ? 0.726   20.465  -1.639  1.00 0.00 ? 13  THR A H    7  
ATOM 10345 H HA   . THR A 1 13  ? -0.649  18.042  -2.281  1.00 0.00 ? 13  THR A HA   7  
ATOM 10346 H HB   . THR A 1 13  ? 1.644   17.162  -2.787  1.00 0.00 ? 13  THR A HB   7  
ATOM 10347 H HG1  . THR A 1 13  ? 2.575   19.799  -2.349  1.00 0.00 ? 13  THR A HG1  7  
ATOM 10348 H HG21 . THR A 1 13  ? 1.431   19.833  -4.100  1.00 0.00 ? 13  THR A HG21 7  
ATOM 10349 H HG22 . THR A 1 13  ? 0.118   18.674  -4.309  1.00 0.00 ? 13  THR A HG22 7  
ATOM 10350 H HG23 . THR A 1 13  ? 1.755   18.252  -4.810  1.00 0.00 ? 13  THR A HG23 7  
ATOM 10351 N N    . GLN A 1 14  ? -0.258  16.471  -0.400  1.00 0.00 ? 14  GLN A N    7  
ATOM 10352 C CA   . GLN A 1 14  ? -0.147  15.603  0.767   1.00 0.00 ? 14  GLN A CA   7  
ATOM 10353 C C    . GLN A 1 14  ? -0.159  14.135  0.356   1.00 0.00 ? 14  GLN A C    7  
ATOM 10354 O O    . GLN A 1 14  ? -1.145  13.639  -0.190  1.00 0.00 ? 14  GLN A O    7  
ATOM 10355 C CB   . GLN A 1 14  ? -1.290  15.881  1.745   1.00 0.00 ? 14  GLN A CB   7  
ATOM 10356 C CG   . GLN A 1 14  ? -1.040  15.337  3.142   1.00 0.00 ? 14  GLN A CG   7  
ATOM 10357 C CD   . GLN A 1 14  ? -2.299  15.291  3.985   1.00 0.00 ? 14  GLN A CD   7  
ATOM 10358 O OE1  . GLN A 1 14  ? -3.399  15.091  3.468   1.00 0.00 ? 14  GLN A OE1  7  
ATOM 10359 N NE2  . GLN A 1 14  ? -2.146  15.476  5.291   1.00 0.00 ? 14  GLN A NE2  7  
ATOM 10360 H H    . GLN A 1 14  ? -0.860  16.216  -1.130  1.00 0.00 ? 14  GLN A H    7  
ATOM 10361 H HA   . GLN A 1 14  ? 0.792   15.821  1.253   1.00 0.00 ? 14  GLN A HA   7  
ATOM 10362 H HB2  . GLN A 1 14  ? -1.434  16.948  1.818   1.00 0.00 ? 14  GLN A HB2  7  
ATOM 10363 H HB3  . GLN A 1 14  ? -2.193  15.429  1.363   1.00 0.00 ? 14  GLN A HB3  7  
ATOM 10364 H HG2  . GLN A 1 14  ? -0.645  14.335  3.060   1.00 0.00 ? 14  GLN A HG2  7  
ATOM 10365 H HG3  . GLN A 1 14  ? -0.316  15.968  3.636   1.00 0.00 ? 14  GLN A HG3  7  
ATOM 10366 H HE21 . GLN A 1 14  ? -1.239  15.631  5.632   1.00 0.00 ? 14  GLN A HE21 7  
ATOM 10367 H HE22 . GLN A 1 14  ? -2.943  15.452  5.859   1.00 0.00 ? 14  GLN A HE22 7  
ATOM 10368 N N    . THR A 1 15  ? 0.945   13.442  0.622   1.00 0.00 ? 15  THR A N    7  
ATOM 10369 C CA   . THR A 1 15  ? 1.062   12.031  0.279   1.00 0.00 ? 15  THR A CA   7  
ATOM 10370 C C    . THR A 1 15  ? 1.088   11.161  1.531   1.00 0.00 ? 15  THR A C    7  
ATOM 10371 O O    . THR A 1 15  ? 1.389   11.638  2.624   1.00 0.00 ? 15  THR A O    7  
ATOM 10372 C CB   . THR A 1 15  ? 2.332   11.757  -0.548  1.00 0.00 ? 15  THR A CB   7  
ATOM 10373 O OG1  . THR A 1 15  ? 3.483   12.261  0.139   1.00 0.00 ? 15  THR A OG1  7  
ATOM 10374 C CG2  . THR A 1 15  ? 2.233   12.404  -1.922  1.00 0.00 ? 15  THR A CG2  7  
ATOM 10375 H H    . THR A 1 15  ? 1.697   13.893  1.059   1.00 0.00 ? 15  THR A H    7  
ATOM 10376 H HA   . THR A 1 15  ? 0.203   11.760  -0.318  1.00 0.00 ? 15  THR A HA   7  
ATOM 10377 H HB   . THR A 1 15  ? 2.438   10.689  -0.676  1.00 0.00 ? 15  THR A HB   7  
ATOM 10378 H HG1  . THR A 1 15  ? 3.654   13.164  -0.141  1.00 0.00 ? 15  THR A HG1  7  
ATOM 10379 H HG21 . THR A 1 15  ? 2.996   11.995  -2.568  1.00 0.00 ? 15  THR A HG21 7  
ATOM 10380 H HG22 . THR A 1 15  ? 2.372   13.470  -1.829  1.00 0.00 ? 15  THR A HG22 7  
ATOM 10381 H HG23 . THR A 1 15  ? 1.259   12.203  -2.344  1.00 0.00 ? 15  THR A HG23 7  
ATOM 10382 N N    . GLY A 1 16  ? 0.771   9.880   1.363   1.00 0.00 ? 16  GLY A N    7  
ATOM 10383 C CA   . GLY A 1 16  ? 0.765   8.964   2.489   1.00 0.00 ? 16  GLY A CA   7  
ATOM 10384 C C    . GLY A 1 16  ? 0.800   7.512   2.055   1.00 0.00 ? 16  GLY A C    7  
ATOM 10385 O O    . GLY A 1 16  ? 0.572   7.201   0.886   1.00 0.00 ? 16  GLY A O    7  
ATOM 10386 H H    . GLY A 1 16  ? 0.540   9.555   0.468   1.00 0.00 ? 16  GLY A H    7  
ATOM 10387 H HA2  . GLY A 1 16  ? 1.627   9.165   3.107   1.00 0.00 ? 16  GLY A HA2  7  
ATOM 10388 H HA3  . GLY A 1 16  ? -0.130  9.133   3.070   1.00 0.00 ? 16  GLY A HA3  7  
ATOM 10389 N N    . VAL A 1 17  ? 1.088   6.621   2.998   1.00 0.00 ? 17  VAL A N    7  
ATOM 10390 C CA   . VAL A 1 17  ? 1.153   5.194   2.707   1.00 0.00 ? 17  VAL A CA   7  
ATOM 10391 C C    . VAL A 1 17  ? -0.243  4.594   2.586   1.00 0.00 ? 17  VAL A C    7  
ATOM 10392 O O    . VAL A 1 17  ? -1.202  5.059   3.202   1.00 0.00 ? 17  VAL A O    7  
ATOM 10393 C CB   . VAL A 1 17  ? 1.934   4.434   3.796   1.00 0.00 ? 17  VAL A CB   7  
ATOM 10394 C CG1  . VAL A 1 17  ? 3.311   5.049   3.993   1.00 0.00 ? 17  VAL A CG1  7  
ATOM 10395 C CG2  . VAL A 1 17  ? 1.154   4.424   5.102   1.00 0.00 ? 17  VAL A CG2  7  
ATOM 10396 H H    . VAL A 1 17  ? 1.260   6.931   3.912   1.00 0.00 ? 17  VAL A H    7  
ATOM 10397 H HA   . VAL A 1 17  ? 1.671   5.068   1.768   1.00 0.00 ? 17  VAL A HA   7  
ATOM 10398 H HB   . VAL A 1 17  ? 2.064   3.412   3.470   1.00 0.00 ? 17  VAL A HB   7  
ATOM 10399 H HG11 . VAL A 1 17  ? 3.259   5.810   4.757   1.00 0.00 ? 17  VAL A HG11 7  
ATOM 10400 H HG12 . VAL A 1 17  ? 4.009   4.282   4.294   1.00 0.00 ? 17  VAL A HG12 7  
ATOM 10401 H HG13 . VAL A 1 17  ? 3.643   5.494   3.066   1.00 0.00 ? 17  VAL A HG13 7  
ATOM 10402 H HG21 . VAL A 1 17  ? 0.498   5.281   5.135   1.00 0.00 ? 17  VAL A HG21 7  
ATOM 10403 H HG22 . VAL A 1 17  ? 0.567   3.519   5.164   1.00 0.00 ? 17  VAL A HG22 7  
ATOM 10404 H HG23 . VAL A 1 17  ? 1.842   4.464   5.933   1.00 0.00 ? 17  VAL A HG23 7  
ATOM 10405 N N    . PRO A 1 18  ? -0.363  3.534   1.773   1.00 0.00 ? 18  PRO A N    7  
ATOM 10406 C CA   . PRO A 1 18  ? -1.638  2.845   1.552   1.00 0.00 ? 18  PRO A CA   7  
ATOM 10407 C C    . PRO A 1 18  ? -2.102  2.076   2.784   1.00 0.00 ? 18  PRO A C    7  
ATOM 10408 O O    . PRO A 1 18  ? -1.331  1.854   3.717   1.00 0.00 ? 18  PRO A O    7  
ATOM 10409 C CB   . PRO A 1 18  ? -1.327  1.881   0.405   1.00 0.00 ? 18  PRO A CB   7  
ATOM 10410 C CG   . PRO A 1 18  ? 0.141   1.642   0.499   1.00 0.00 ? 18  PRO A CG   7  
ATOM 10411 C CD   . PRO A 1 18  ? 0.738   2.925   1.007   1.00 0.00 ? 18  PRO A CD   7  
ATOM 10412 H HA   . PRO A 1 18  ? -2.412  3.533   1.246   1.00 0.00 ? 18  PRO A HA   7  
ATOM 10413 H HB2  . PRO A 1 18  ? -1.886  0.965   0.540   1.00 0.00 ? 18  PRO A HB2  7  
ATOM 10414 H HB3  . PRO A 1 18  ? -1.593  2.337   -0.536  1.00 0.00 ? 18  PRO A HB3  7  
ATOM 10415 H HG2  . PRO A 1 18  ? 0.339   0.837   1.191   1.00 0.00 ? 18  PRO A HG2  7  
ATOM 10416 H HG3  . PRO A 1 18  ? 0.537   1.405   -0.477  1.00 0.00 ? 18  PRO A HG3  7  
ATOM 10417 H HD2  . PRO A 1 18  ? 1.585   2.721   1.644   1.00 0.00 ? 18  PRO A HD2  7  
ATOM 10418 H HD3  . PRO A 1 18  ? 1.028   3.559   0.181   1.00 0.00 ? 18  PRO A HD3  7  
ATOM 10419 N N    . GLY A 1 19  ? -3.369  1.671   2.781   1.00 0.00 ? 19  GLY A N    7  
ATOM 10420 C CA   . GLY A 1 19  ? -3.913  0.930   3.904   1.00 0.00 ? 19  GLY A CA   7  
ATOM 10421 C C    . GLY A 1 19  ? -4.095  -0.542  3.594   1.00 0.00 ? 19  GLY A C    7  
ATOM 10422 O O    . GLY A 1 19  ? -4.517  -0.904  2.497   1.00 0.00 ? 19  GLY A O    7  
ATOM 10423 H H    . GLY A 1 19  ? -3.938  1.877   2.010   1.00 0.00 ? 19  GLY A H    7  
ATOM 10424 H HA2  . GLY A 1 19  ? -3.245  1.031   4.746   1.00 0.00 ? 19  GLY A HA2  7  
ATOM 10425 H HA3  . GLY A 1 19  ? -4.873  1.352   4.167   1.00 0.00 ? 19  GLY A HA3  7  
ATOM 10426 N N    . GLN A 1 20  ? -3.772  -1.393  4.563   1.00 0.00 ? 20  GLN A N    7  
ATOM 10427 C CA   . GLN A 1 20  ? -3.900  -2.835  4.386   1.00 0.00 ? 20  GLN A CA   7  
ATOM 10428 C C    . GLN A 1 20  ? -5.172  -3.179  3.619   1.00 0.00 ? 20  GLN A C    7  
ATOM 10429 O O    . GLN A 1 20  ? -6.185  -2.485  3.706   1.00 0.00 ? 20  GLN A O    7  
ATOM 10430 C CB   . GLN A 1 20  ? -3.904  -3.538  5.745   1.00 0.00 ? 20  GLN A CB   7  
ATOM 10431 C CG   . GLN A 1 20  ? -5.055  -3.118  6.644   1.00 0.00 ? 20  GLN A CG   7  
ATOM 10432 C CD   . GLN A 1 20  ? -4.819  -3.474  8.099   1.00 0.00 ? 20  GLN A CD   7  
ATOM 10433 O OE1  . GLN A 1 20  ? -3.775  -3.152  8.667   1.00 0.00 ? 20  GLN A OE1  7  
ATOM 10434 N NE2  . GLN A 1 20  ? -5.791  -4.141  8.710   1.00 0.00 ? 20  GLN A NE2  7  
ATOM 10435 H H    . GLN A 1 20  ? -3.440  -1.044  5.416   1.00 0.00 ? 20  GLN A H    7  
ATOM 10436 H HA   . GLN A 1 20  ? -3.048  -3.176  3.818   1.00 0.00 ? 20  GLN A HA   7  
ATOM 10437 H HB2  . GLN A 1 20  ? -3.970  -4.604  5.585   1.00 0.00 ? 20  GLN A HB2  7  
ATOM 10438 H HB3  . GLN A 1 20  ? -2.978  -3.315  6.255   1.00 0.00 ? 20  GLN A HB3  7  
ATOM 10439 H HG2  . GLN A 1 20  ? -5.183  -2.048  6.568   1.00 0.00 ? 20  GLN A HG2  7  
ATOM 10440 H HG3  . GLN A 1 20  ? -5.955  -3.612  6.309   1.00 0.00 ? 20  GLN A HG3  7  
ATOM 10441 H HE21 . GLN A 1 20  ? -6.594  -4.364  8.194   1.00 0.00 ? 20  GLN A HE21 7  
ATOM 10442 H HE22 . GLN A 1 20  ? -5.665  -4.384  9.650   1.00 0.00 ? 20  GLN A HE22 7  
ATOM 10443 N N    . PRO A 1 21  ? -5.120  -4.276  2.848   1.00 0.00 ? 21  PRO A N    7  
ATOM 10444 C CA   . PRO A 1 21  ? -6.260  -4.737  2.050   1.00 0.00 ? 21  PRO A CA   7  
ATOM 10445 C C    . PRO A 1 21  ? -7.393  -5.279  2.916   1.00 0.00 ? 21  PRO A C    7  
ATOM 10446 O O    . PRO A 1 21  ? -7.275  -5.343  4.141   1.00 0.00 ? 21  PRO A O    7  
ATOM 10447 C CB   . PRO A 1 21  ? -5.663  -5.854  1.191   1.00 0.00 ? 21  PRO A CB   7  
ATOM 10448 C CG   . PRO A 1 21  ? -4.493  -6.347  1.970   1.00 0.00 ? 21  PRO A CG   7  
ATOM 10449 C CD   . PRO A 1 21  ? -3.946  -5.151  2.697   1.00 0.00 ? 21  PRO A CD   7  
ATOM 10450 H HA   . PRO A 1 21  ? -6.641  -3.953  1.412   1.00 0.00 ? 21  PRO A HA   7  
ATOM 10451 H HB2  . PRO A 1 21  ? -6.399  -6.632  1.045   1.00 0.00 ? 21  PRO A HB2  7  
ATOM 10452 H HB3  . PRO A 1 21  ? -5.360  -5.454  0.235   1.00 0.00 ? 21  PRO A HB3  7  
ATOM 10453 H HG2  . PRO A 1 21  ? -4.813  -7.100  2.674   1.00 0.00 ? 21  PRO A HG2  7  
ATOM 10454 H HG3  . PRO A 1 21  ? -3.749  -6.751  1.299   1.00 0.00 ? 21  PRO A HG3  7  
ATOM 10455 H HD2  . PRO A 1 21  ? -3.554  -5.441  3.661   1.00 0.00 ? 21  PRO A HD2  7  
ATOM 10456 H HD3  . PRO A 1 21  ? -3.180  -4.668  2.107   1.00 0.00 ? 21  PRO A HD3  7  
ATOM 10457 N N    . LEU A 1 22  ? -8.488  -5.668  2.274   1.00 0.00 ? 22  LEU A N    7  
ATOM 10458 C CA   . LEU A 1 22  ? -9.643  -6.206  2.985   1.00 0.00 ? 22  LEU A CA   7  
ATOM 10459 C C    . LEU A 1 22  ? -9.990  -7.603  2.483   1.00 0.00 ? 22  LEU A C    7  
ATOM 10460 O O    . LEU A 1 22  ? -9.422  -8.079  1.501   1.00 0.00 ? 22  LEU A O    7  
ATOM 10461 C CB   . LEU A 1 22  ? -10.847 -5.277  2.819   1.00 0.00 ? 22  LEU A CB   7  
ATOM 10462 C CG   . LEU A 1 22  ? -10.723 -3.895  3.460   1.00 0.00 ? 22  LEU A CG   7  
ATOM 10463 C CD1  . LEU A 1 22  ? -11.787 -2.956  2.914   1.00 0.00 ? 22  LEU A CD1  7  
ATOM 10464 C CD2  . LEU A 1 22  ? -10.827 -3.999  4.975   1.00 0.00 ? 22  LEU A CD2  7  
ATOM 10465 H H    . LEU A 1 22  ? -8.523  -5.592  1.298   1.00 0.00 ? 22  LEU A H    7  
ATOM 10466 H HA   . LEU A 1 22  ? -9.387  -6.266  4.033   1.00 0.00 ? 22  LEU A HA   7  
ATOM 10467 H HB2  . LEU A 1 22  ? -11.012 -5.137  1.762   1.00 0.00 ? 22  LEU A HB2  7  
ATOM 10468 H HB3  . LEU A 1 22  ? -11.705 -5.769  3.254   1.00 0.00 ? 22  LEU A HB3  7  
ATOM 10469 H HG   . LEU A 1 22  ? -9.755  -3.478  3.218   1.00 0.00 ? 22  LEU A HG   7  
ATOM 10470 H HD11 . LEU A 1 22  ? -11.326 -2.228  2.264   1.00 0.00 ? 22  LEU A HD11 7  
ATOM 10471 H HD12 . LEU A 1 22  ? -12.274 -2.448  3.734   1.00 0.00 ? 22  LEU A HD12 7  
ATOM 10472 H HD13 . LEU A 1 22  ? -12.518 -3.524  2.358   1.00 0.00 ? 22  LEU A HD13 7  
ATOM 10473 H HD21 . LEU A 1 22  ? -10.058 -3.392  5.430   1.00 0.00 ? 22  LEU A HD21 7  
ATOM 10474 H HD22 . LEU A 1 22  ? -10.698 -5.029  5.275   1.00 0.00 ? 22  LEU A HD22 7  
ATOM 10475 H HD23 . LEU A 1 22  ? -11.798 -3.649  5.294   1.00 0.00 ? 22  LEU A HD23 7  
ATOM 10476 N N    . ASN A 1 23  ? -10.928 -8.255  3.163   1.00 0.00 ? 23  ASN A N    7  
ATOM 10477 C CA   . ASN A 1 23  ? -11.352 -9.598  2.784   1.00 0.00 ? 23  ASN A CA   7  
ATOM 10478 C C    . ASN A 1 23  ? -10.147 -10.494 2.518   1.00 0.00 ? 23  ASN A C    7  
ATOM 10479 O O    . ASN A 1 23  ? -10.126 -11.253 1.549   1.00 0.00 ? 23  ASN A O    7  
ATOM 10480 C CB   . ASN A 1 23  ? -12.245 -9.542  1.542   1.00 0.00 ? 23  ASN A CB   7  
ATOM 10481 C CG   . ASN A 1 23  ? -13.592 -8.908  1.827   1.00 0.00 ? 23  ASN A CG   7  
ATOM 10482 O OD1  . ASN A 1 23  ? -14.604 -9.599  1.941   1.00 0.00 ? 23  ASN A OD1  7  
ATOM 10483 N ND2  . ASN A 1 23  ? -13.611 -7.585  1.943   1.00 0.00 ? 23  ASN A ND2  7  
ATOM 10484 H H    . ASN A 1 23  ? -11.344 -7.823  3.937   1.00 0.00 ? 23  ASN A H    7  
ATOM 10485 H HA   . ASN A 1 23  ? -11.919 -10.010 3.605   1.00 0.00 ? 23  ASN A HA   7  
ATOM 10486 H HB2  . ASN A 1 23  ? -11.750 -8.962  0.777   1.00 0.00 ? 23  ASN A HB2  7  
ATOM 10487 H HB3  . ASN A 1 23  ? -12.408 -10.545 1.178   1.00 0.00 ? 23  ASN A HB3  7  
ATOM 10488 H HD21 . ASN A 1 23  ? -12.766 -7.099  1.840   1.00 0.00 ? 23  ASN A HD21 7  
ATOM 10489 H HD22 . ASN A 1 23  ? -14.469 -7.149  2.128   1.00 0.00 ? 23  ASN A HD22 7  
ATOM 10490 N N    . PHE A 1 24  ? -9.144  -10.402 3.385   1.00 0.00 ? 24  PHE A N    7  
ATOM 10491 C CA   . PHE A 1 24  ? -7.935  -11.204 3.244   1.00 0.00 ? 24  PHE A CA   7  
ATOM 10492 C C    . PHE A 1 24  ? -8.156  -12.618 3.773   1.00 0.00 ? 24  PHE A C    7  
ATOM 10493 O O    . PHE A 1 24  ? -8.411  -12.817 4.961   1.00 0.00 ? 24  PHE A O    7  
ATOM 10494 C CB   . PHE A 1 24  ? -6.771  -10.545 3.988   1.00 0.00 ? 24  PHE A CB   7  
ATOM 10495 C CG   . PHE A 1 24  ? -5.465  -11.267 3.816   1.00 0.00 ? 24  PHE A CG   7  
ATOM 10496 C CD1  . PHE A 1 24  ? -4.954  -11.511 2.552   1.00 0.00 ? 24  PHE A CD1  7  
ATOM 10497 C CD2  . PHE A 1 24  ? -4.748  -11.701 4.920   1.00 0.00 ? 24  PHE A CD2  7  
ATOM 10498 C CE1  . PHE A 1 24  ? -3.753  -12.175 2.391   1.00 0.00 ? 24  PHE A CE1  7  
ATOM 10499 C CE2  . PHE A 1 24  ? -3.546  -12.365 4.765   1.00 0.00 ? 24  PHE A CE2  7  
ATOM 10500 C CZ   . PHE A 1 24  ? -3.047  -12.602 3.499   1.00 0.00 ? 24  PHE A CZ   7  
ATOM 10501 H H    . PHE A 1 24  ? -9.220  -9.778  4.138   1.00 0.00 ? 24  PHE A H    7  
ATOM 10502 H HA   . PHE A 1 24  ? -7.695  -11.258 2.194   1.00 0.00 ? 24  PHE A HA   7  
ATOM 10503 H HB2  . PHE A 1 24  ? -6.643  -9.538  3.622   1.00 0.00 ? 24  PHE A HB2  7  
ATOM 10504 H HB3  . PHE A 1 24  ? -6.999  -10.515 5.043   1.00 0.00 ? 24  PHE A HB3  7  
ATOM 10505 H HD1  . PHE A 1 24  ? -5.504  -11.176 1.684   1.00 0.00 ? 24  PHE A HD1  7  
ATOM 10506 H HD2  . PHE A 1 24  ? -5.137  -11.516 5.911   1.00 0.00 ? 24  PHE A HD2  7  
ATOM 10507 H HE1  . PHE A 1 24  ? -3.365  -12.358 1.400   1.00 0.00 ? 24  PHE A HE1  7  
ATOM 10508 H HE2  . PHE A 1 24  ? -2.997  -12.698 5.634   1.00 0.00 ? 24  PHE A HE2  7  
ATOM 10509 H HZ   . PHE A 1 24  ? -2.109  -13.121 3.376   1.00 0.00 ? 24  PHE A HZ   7  
ATOM 10510 N N    . LYS A 1 25  ? -8.056  -13.598 2.881   1.00 0.00 ? 25  LYS A N    7  
ATOM 10511 C CA   . LYS A 1 25  ? -8.244  -14.995 3.255   1.00 0.00 ? 25  LYS A CA   7  
ATOM 10512 C C    . LYS A 1 25  ? -7.249  -15.892 2.526   1.00 0.00 ? 25  LYS A C    7  
ATOM 10513 O O    . LYS A 1 25  ? -6.847  -15.602 1.400   1.00 0.00 ? 25  LYS A O    7  
ATOM 10514 C CB   . LYS A 1 25  ? -9.674  -15.441 2.941   1.00 0.00 ? 25  LYS A CB   7  
ATOM 10515 C CG   . LYS A 1 25  ? -10.046 -15.303 1.474   1.00 0.00 ? 25  LYS A CG   7  
ATOM 10516 C CD   . LYS A 1 25  ? -11.552 -15.237 1.285   1.00 0.00 ? 25  LYS A CD   7  
ATOM 10517 C CE   . LYS A 1 25  ? -12.206 -16.583 1.555   1.00 0.00 ? 25  LYS A CE   7  
ATOM 10518 N NZ   . LYS A 1 25  ? -12.287 -17.418 0.324   1.00 0.00 ? 25  LYS A NZ   7  
ATOM 10519 H H    . LYS A 1 25  ? -7.851  -13.377 1.948   1.00 0.00 ? 25  LYS A H    7  
ATOM 10520 H HA   . LYS A 1 25  ? -8.075  -15.080 4.318   1.00 0.00 ? 25  LYS A HA   7  
ATOM 10521 H HB2  . LYS A 1 25  ? -9.785  -16.478 3.222   1.00 0.00 ? 25  LYS A HB2  7  
ATOM 10522 H HB3  . LYS A 1 25  ? -10.361 -14.843 3.522   1.00 0.00 ? 25  LYS A HB3  7  
ATOM 10523 H HG2  . LYS A 1 25  ? -9.605  -14.397 1.085   1.00 0.00 ? 25  LYS A HG2  7  
ATOM 10524 H HG3  . LYS A 1 25  ? -9.660  -16.155 0.933   1.00 0.00 ? 25  LYS A HG3  7  
ATOM 10525 H HD2  . LYS A 1 25  ? -11.961 -14.507 1.967   1.00 0.00 ? 25  LYS A HD2  7  
ATOM 10526 H HD3  . LYS A 1 25  ? -11.765 -14.941 0.267   1.00 0.00 ? 25  LYS A HD3  7  
ATOM 10527 H HE2  . LYS A 1 25  ? -11.626 -17.108 2.298   1.00 0.00 ? 25  LYS A HE2  7  
ATOM 10528 H HE3  . LYS A 1 25  ? -13.205 -16.414 1.931   1.00 0.00 ? 25  LYS A HE3  7  
ATOM 10529 H HZ1  . LYS A 1 25  ? -12.196 -16.818 -0.520  1.00 0.00 ? 25  LYS A HZ1  7  
ATOM 10530 H HZ2  . LYS A 1 25  ? -13.201 -17.912 0.287   1.00 0.00 ? 25  LYS A HZ2  7  
ATOM 10531 H HZ3  . LYS A 1 25  ? -11.523 -18.123 0.320   1.00 0.00 ? 25  LYS A HZ3  7  
ATOM 10532 N N    . ALA A 1 26  ? -6.856  -16.983 3.176   1.00 0.00 ? 26  ALA A N    7  
ATOM 10533 C CA   . ALA A 1 26  ? -5.911  -17.924 2.587   1.00 0.00 ? 26  ALA A CA   7  
ATOM 10534 C C    . ALA A 1 26  ? -6.570  -19.274 2.326   1.00 0.00 ? 26  ALA A C    7  
ATOM 10535 O O    . ALA A 1 26  ? -7.191  -19.854 3.216   1.00 0.00 ? 26  ALA A O    7  
ATOM 10536 C CB   . ALA A 1 26  ? -4.701  -18.092 3.494   1.00 0.00 ? 26  ALA A CB   7  
ATOM 10537 H H    . ALA A 1 26  ? -7.212  -17.160 4.071   1.00 0.00 ? 26  ALA A H    7  
ATOM 10538 H HA   . ALA A 1 26  ? -5.572  -17.512 1.647   1.00 0.00 ? 26  ALA A HA   7  
ATOM 10539 H HB1  . ALA A 1 26  ? -4.521  -17.171 4.028   1.00 0.00 ? 26  ALA A HB1  7  
ATOM 10540 H HB2  . ALA A 1 26  ? -4.888  -18.888 4.200   1.00 0.00 ? 26  ALA A HB2  7  
ATOM 10541 H HB3  . ALA A 1 26  ? -3.835  -18.337 2.896   1.00 0.00 ? 26  ALA A HB3  7  
ATOM 10542 N N    . GLU A 1 27  ? -6.432  -19.767 1.099   1.00 0.00 ? 27  GLU A N    7  
ATOM 10543 C CA   . GLU A 1 27  ? -7.017  -21.049 0.722   1.00 0.00 ? 27  GLU A CA   7  
ATOM 10544 C C    . GLU A 1 27  ? -6.031  -21.876 -0.098  1.00 0.00 ? 27  GLU A C    7  
ATOM 10545 O O    . GLU A 1 27  ? -5.511  -21.432 -1.122  1.00 0.00 ? 27  GLU A O    7  
ATOM 10546 C CB   . GLU A 1 27  ? -8.305  -20.832 -0.076  1.00 0.00 ? 27  GLU A CB   7  
ATOM 10547 C CG   . GLU A 1 27  ? -9.103  -19.620 0.375   1.00 0.00 ? 27  GLU A CG   7  
ATOM 10548 C CD   . GLU A 1 27  ? -8.672  -18.345 -0.323  1.00 0.00 ? 27  GLU A CD   7  
ATOM 10549 O OE1  . GLU A 1 27  ? -7.491  -17.963 -0.183  1.00 0.00 ? 27  GLU A OE1  7  
ATOM 10550 O OE2  . GLU A 1 27  ? -9.514  -17.729 -1.009  1.00 0.00 ? 27  GLU A OE2  7  
ATOM 10551 H H    . GLU A 1 27  ? -5.926  -19.257 0.433   1.00 0.00 ? 27  GLU A H    7  
ATOM 10552 H HA   . GLU A 1 27  ? -7.252  -21.586 1.628   1.00 0.00 ? 27  GLU A HA   7  
ATOM 10553 H HB2  . GLU A 1 27  ? -8.051  -20.703 -1.118  1.00 0.00 ? 27  GLU A HB2  7  
ATOM 10554 H HB3  . GLU A 1 27  ? -8.929  -21.707 0.028   1.00 0.00 ? 27  GLU A HB3  7  
ATOM 10555 H HG2  . GLU A 1 27  ? -10.147 -19.793 0.162   1.00 0.00 ? 27  GLU A HG2  7  
ATOM 10556 H HG3  . GLU A 1 27  ? -8.970  -19.493 1.439   1.00 0.00 ? 27  GLU A HG3  7  
ATOM 10557 N N    . PRO A 1 28  ? -5.767  -23.108 0.362   1.00 0.00 ? 28  PRO A N    7  
ATOM 10558 C CA   . PRO A 1 28  ? -4.842  -24.023 -0.313  1.00 0.00 ? 28  PRO A CA   7  
ATOM 10559 C C    . PRO A 1 28  ? -5.395  -24.532 -1.640  1.00 0.00 ? 28  PRO A C    7  
ATOM 10560 O O    . PRO A 1 28  ? -6.265  -25.402 -1.667  1.00 0.00 ? 28  PRO A O    7  
ATOM 10561 C CB   . PRO A 1 28  ? -4.696  -25.177 0.682   1.00 0.00 ? 28  PRO A CB   7  
ATOM 10562 C CG   . PRO A 1 28  ? -5.952  -25.149 1.483   1.00 0.00 ? 28  PRO A CG   7  
ATOM 10563 C CD   . PRO A 1 28  ? -6.351  -23.702 1.576   1.00 0.00 ? 28  PRO A CD   7  
ATOM 10564 H HA   . PRO A 1 28  ? -3.879  -23.564 -0.478  1.00 0.00 ? 28  PRO A HA   7  
ATOM 10565 H HB2  . PRO A 1 28  ? -4.590  -26.109 0.144   1.00 0.00 ? 28  PRO A HB2  7  
ATOM 10566 H HB3  . PRO A 1 28  ? -3.828  -25.013 1.304   1.00 0.00 ? 28  PRO A HB3  7  
ATOM 10567 H HG2  . PRO A 1 28  ? -6.720  -25.717 0.981   1.00 0.00 ? 28  PRO A HG2  7  
ATOM 10568 H HG3  . PRO A 1 28  ? -5.768  -25.551 2.468   1.00 0.00 ? 28  PRO A HG3  7  
ATOM 10569 H HD2  . PRO A 1 28  ? -7.426  -23.605 1.574   1.00 0.00 ? 28  PRO A HD2  7  
ATOM 10570 H HD3  . PRO A 1 28  ? -5.932  -23.252 2.464   1.00 0.00 ? 28  PRO A HD3  7  
ATOM 10571 N N    . GLU A 1 29  ? -4.884  -23.983 -2.738  1.00 0.00 ? 29  GLU A N    7  
ATOM 10572 C CA   . GLU A 1 29  ? -5.328  -24.382 -4.068  1.00 0.00 ? 29  GLU A CA   7  
ATOM 10573 C C    . GLU A 1 29  ? -4.729  -25.729 -4.461  1.00 0.00 ? 29  GLU A C    7  
ATOM 10574 O O    . GLU A 1 29  ? -5.195  -26.379 -5.396  1.00 0.00 ? 29  GLU A O    7  
ATOM 10575 C CB   . GLU A 1 29  ? -4.942  -23.319 -5.099  1.00 0.00 ? 29  GLU A CB   7  
ATOM 10576 C CG   . GLU A 1 29  ? -3.467  -22.955 -5.075  1.00 0.00 ? 29  GLU A CG   7  
ATOM 10577 C CD   . GLU A 1 29  ? -3.050  -22.126 -6.274  1.00 0.00 ? 29  GLU A CD   7  
ATOM 10578 O OE1  . GLU A 1 29  ? -3.684  -21.079 -6.521  1.00 0.00 ? 29  GLU A OE1  7  
ATOM 10579 O OE2  . GLU A 1 29  ? -2.090  -22.525 -6.965  1.00 0.00 ? 29  GLU A OE2  7  
ATOM 10580 H H    . GLU A 1 29  ? -4.193  -23.293 -2.651  1.00 0.00 ? 29  GLU A H    7  
ATOM 10581 H HA   . GLU A 1 29  ? -6.404  -24.473 -4.045  1.00 0.00 ? 29  GLU A HA   7  
ATOM 10582 H HB2  . GLU A 1 29  ? -5.185  -23.686 -6.085  1.00 0.00 ? 29  GLU A HB2  7  
ATOM 10583 H HB3  . GLU A 1 29  ? -5.515  -22.424 -4.907  1.00 0.00 ? 29  GLU A HB3  7  
ATOM 10584 H HG2  . GLU A 1 29  ? -3.264  -22.390 -4.178  1.00 0.00 ? 29  GLU A HG2  7  
ATOM 10585 H HG3  . GLU A 1 29  ? -2.885  -23.865 -5.065  1.00 0.00 ? 29  GLU A HG3  7  
ATOM 10586 N N    . SER A 1 30  ? -3.691  -26.141 -3.739  1.00 0.00 ? 30  SER A N    7  
ATOM 10587 C CA   . SER A 1 30  ? -3.024  -27.408 -4.014  1.00 0.00 ? 30  SER A CA   7  
ATOM 10588 C C    . SER A 1 30  ? -2.131  -27.816 -2.847  1.00 0.00 ? 30  SER A C    7  
ATOM 10589 O O    . SER A 1 30  ? -2.057  -27.119 -1.835  1.00 0.00 ? 30  SER A O    7  
ATOM 10590 C CB   . SER A 1 30  ? -2.194  -27.305 -5.295  1.00 0.00 ? 30  SER A CB   7  
ATOM 10591 O OG   . SER A 1 30  ? -2.947  -26.725 -6.346  1.00 0.00 ? 30  SER A OG   7  
ATOM 10592 H H    . SER A 1 30  ? -3.366  -25.578 -3.006  1.00 0.00 ? 30  SER A H    7  
ATOM 10593 H HA   . SER A 1 30  ? -3.786  -28.161 -4.149  1.00 0.00 ? 30  SER A HA   7  
ATOM 10594 H HB2  . SER A 1 30  ? -1.326  -26.690 -5.109  1.00 0.00 ? 30  SER A HB2  7  
ATOM 10595 H HB3  . SER A 1 30  ? -1.878  -28.293 -5.597  1.00 0.00 ? 30  SER A HB3  7  
ATOM 10596 H HG   . SER A 1 30  ? -3.084  -25.792 -6.166  1.00 0.00 ? 30  SER A HG   7  
ATOM 10597 N N    . GLU A 1 31  ? -1.454  -28.951 -2.996  1.00 0.00 ? 31  GLU A N    7  
ATOM 10598 C CA   . GLU A 1 31  ? -0.567  -29.453 -1.954  1.00 0.00 ? 31  GLU A CA   7  
ATOM 10599 C C    . GLU A 1 31  ? 0.763   -28.704 -1.965  1.00 0.00 ? 31  GLU A C    7  
ATOM 10600 O O    . GLU A 1 31  ? 1.441   -28.603 -0.941  1.00 0.00 ? 31  GLU A O    7  
ATOM 10601 C CB   . GLU A 1 31  ? -0.321  -30.952 -2.140  1.00 0.00 ? 31  GLU A CB   7  
ATOM 10602 C CG   . GLU A 1 31  ? 0.563   -31.281 -3.330  1.00 0.00 ? 31  GLU A CG   7  
ATOM 10603 C CD   . GLU A 1 31  ? -0.221  -31.406 -4.622  1.00 0.00 ? 31  GLU A CD   7  
ATOM 10604 O OE1  . GLU A 1 31  ? -0.468  -30.366 -5.268  1.00 0.00 ? 31  GLU A OE1  7  
ATOM 10605 O OE2  . GLU A 1 31  ? -0.587  -32.543 -4.987  1.00 0.00 ? 31  GLU A OE2  7  
ATOM 10606 H H    . GLU A 1 31  ? -1.555  -29.463 -3.826  1.00 0.00 ? 31  GLU A H    7  
ATOM 10607 H HA   . GLU A 1 31  ? -1.049  -29.292 -1.002  1.00 0.00 ? 31  GLU A HA   7  
ATOM 10608 H HB2  . GLU A 1 31  ? 0.149   -31.341 -1.249  1.00 0.00 ? 31  GLU A HB2  7  
ATOM 10609 H HB3  . GLU A 1 31  ? -1.272  -31.445 -2.278  1.00 0.00 ? 31  GLU A HB3  7  
ATOM 10610 H HG2  . GLU A 1 31  ? 1.295   -30.496 -3.447  1.00 0.00 ? 31  GLU A HG2  7  
ATOM 10611 H HG3  . GLU A 1 31  ? 1.067   -32.217 -3.140  1.00 0.00 ? 31  GLU A HG3  7  
ATOM 10612 N N    . THR A 1 32  ? 1.131   -28.180 -3.130  1.00 0.00 ? 32  THR A N    7  
ATOM 10613 C CA   . THR A 1 32  ? 2.379   -27.442 -3.276  1.00 0.00 ? 32  THR A CA   7  
ATOM 10614 C C    . THR A 1 32  ? 2.119   -25.999 -3.695  1.00 0.00 ? 32  THR A C    7  
ATOM 10615 O O    . THR A 1 32  ? 3.053   -25.235 -3.936  1.00 0.00 ? 32  THR A O    7  
ATOM 10616 C CB   . THR A 1 32  ? 3.307   -28.106 -4.311  1.00 0.00 ? 32  THR A CB   7  
ATOM 10617 O OG1  . THR A 1 32  ? 2.555   -28.491 -5.467  1.00 0.00 ? 32  THR A OG1  7  
ATOM 10618 C CG2  . THR A 1 32  ? 3.994   -29.326 -3.717  1.00 0.00 ? 32  THR A CG2  7  
ATOM 10619 H H    . THR A 1 32  ? 0.548   -28.294 -3.909  1.00 0.00 ? 32  THR A H    7  
ATOM 10620 H HA   . THR A 1 32  ? 2.881   -27.443 -2.319  1.00 0.00 ? 32  THR A HA   7  
ATOM 10621 H HB   . THR A 1 32  ? 4.063   -27.392 -4.604  1.00 0.00 ? 32  THR A HB   7  
ATOM 10622 H HG1  . THR A 1 32  ? 1.873   -29.117 -5.211  1.00 0.00 ? 32  THR A HG1  7  
ATOM 10623 H HG21 . THR A 1 32  ? 3.251   -30.062 -3.448  1.00 0.00 ? 32  THR A HG21 7  
ATOM 10624 H HG22 . THR A 1 32  ? 4.548   -29.034 -2.837  1.00 0.00 ? 32  THR A HG22 7  
ATOM 10625 H HG23 . THR A 1 32  ? 4.670   -29.748 -4.445  1.00 0.00 ? 32  THR A HG23 7  
ATOM 10626 N N    . SER A 1 33  ? 0.844   -25.633 -3.780  1.00 0.00 ? 33  SER A N    7  
ATOM 10627 C CA   . SER A 1 33  ? 0.461   -24.282 -4.173  1.00 0.00 ? 33  SER A CA   7  
ATOM 10628 C C    . SER A 1 33  ? -0.629  -23.738 -3.255  1.00 0.00 ? 33  SER A C    7  
ATOM 10629 O O    . SER A 1 33  ? -1.372  -24.500 -2.636  1.00 0.00 ? 33  SER A O    7  
ATOM 10630 C CB   . SER A 1 33  ? -0.024  -24.269 -5.624  1.00 0.00 ? 33  SER A CB   7  
ATOM 10631 O OG   . SER A 1 33  ? 0.929   -24.868 -6.485  1.00 0.00 ? 33  SER A OG   7  
ATOM 10632 H H    . SER A 1 33  ? 0.144   -26.288 -3.575  1.00 0.00 ? 33  SER A H    7  
ATOM 10633 H HA   . SER A 1 33  ? 1.334   -23.652 -4.088  1.00 0.00 ? 33  SER A HA   7  
ATOM 10634 H HB2  . SER A 1 33  ? -0.951  -24.816 -5.696  1.00 0.00 ? 33  SER A HB2  7  
ATOM 10635 H HB3  . SER A 1 33  ? -0.183  -23.247 -5.938  1.00 0.00 ? 33  SER A HB3  7  
ATOM 10636 H HG   . SER A 1 33  ? 1.620   -24.233 -6.690  1.00 0.00 ? 33  SER A HG   7  
ATOM 10637 N N    . ILE A 1 34  ? -0.719  -22.414 -3.175  1.00 0.00 ? 34  ILE A N    7  
ATOM 10638 C CA   . ILE A 1 34  ? -1.719  -21.767 -2.334  1.00 0.00 ? 34  ILE A CA   7  
ATOM 10639 C C    . ILE A 1 34  ? -2.227  -20.481 -2.976  1.00 0.00 ? 34  ILE A C    7  
ATOM 10640 O O    . ILE A 1 34  ? -1.443  -19.664 -3.461  1.00 0.00 ? 34  ILE A O    7  
ATOM 10641 C CB   . ILE A 1 34  ? -1.156  -21.443 -0.938  1.00 0.00 ? 34  ILE A CB   7  
ATOM 10642 C CG1  . ILE A 1 34  ? -0.770  -22.732 -0.208  1.00 0.00 ? 34  ILE A CG1  7  
ATOM 10643 C CG2  . ILE A 1 34  ? -2.173  -20.654 -0.127  1.00 0.00 ? 34  ILE A CG2  7  
ATOM 10644 C CD1  . ILE A 1 34  ? -0.232  -22.498 1.186   1.00 0.00 ? 34  ILE A CD1  7  
ATOM 10645 H H    . ILE A 1 34  ? -0.099  -21.860 -3.693  1.00 0.00 ? 34  ILE A H    7  
ATOM 10646 H HA   . ILE A 1 34  ? -2.548  -22.450 -2.217  1.00 0.00 ? 34  ILE A HA   7  
ATOM 10647 H HB   . ILE A 1 34  ? -0.277  -20.830 -1.062  1.00 0.00 ? 34  ILE A HB   7  
ATOM 10648 H HG12 . ILE A 1 34  ? -1.638  -23.366 -0.126  1.00 0.00 ? 34  ILE A HG12 7  
ATOM 10649 H HG13 . ILE A 1 34  ? -0.007  -23.243 -0.777  1.00 0.00 ? 34  ILE A HG13 7  
ATOM 10650 H HG21 . ILE A 1 34  ? -1.795  -19.658 0.053   1.00 0.00 ? 34  ILE A HG21 7  
ATOM 10651 H HG22 . ILE A 1 34  ? -3.101  -20.592 -0.676  1.00 0.00 ? 34  ILE A HG22 7  
ATOM 10652 H HG23 . ILE A 1 34  ? -2.345  -21.150 0.817   1.00 0.00 ? 34  ILE A HG23 7  
ATOM 10653 H HD11 . ILE A 1 34  ? 0.844   -22.590 1.178   1.00 0.00 ? 34  ILE A HD11 7  
ATOM 10654 H HD12 . ILE A 1 34  ? -0.507  -21.508 1.518   1.00 0.00 ? 34  ILE A HD12 7  
ATOM 10655 H HD13 . ILE A 1 34  ? -0.650  -23.232 1.860   1.00 0.00 ? 34  ILE A HD13 7  
ATOM 10656 N N    . LEU A 1 35  ? -3.544  -20.305 -2.974  1.00 0.00 ? 35  LEU A N    7  
ATOM 10657 C CA   . LEU A 1 35  ? -4.159  -19.116 -3.554  1.00 0.00 ? 35  LEU A CA   7  
ATOM 10658 C C    . LEU A 1 35  ? -4.624  -18.156 -2.464  1.00 0.00 ? 35  LEU A C    7  
ATOM 10659 O O    . LEU A 1 35  ? -5.205  -18.573 -1.462  1.00 0.00 ? 35  LEU A O    7  
ATOM 10660 C CB   . LEU A 1 35  ? -5.341  -19.511 -4.441  1.00 0.00 ? 35  LEU A CB   7  
ATOM 10661 C CG   . LEU A 1 35  ? -5.691  -18.535 -5.566  1.00 0.00 ? 35  LEU A CG   7  
ATOM 10662 C CD1  . LEU A 1 35  ? -4.558  -18.457 -6.577  1.00 0.00 ? 35  LEU A CD1  7  
ATOM 10663 C CD2  . LEU A 1 35  ? -6.988  -18.949 -6.246  1.00 0.00 ? 35  LEU A CD2  7  
ATOM 10664 H H    . LEU A 1 35  ? -4.118  -20.991 -2.573  1.00 0.00 ? 35  LEU A H    7  
ATOM 10665 H HA   . LEU A 1 35  ? -3.414  -18.621 -4.160  1.00 0.00 ? 35  LEU A HA   7  
ATOM 10666 H HB2  . LEU A 1 35  ? -5.113  -20.465 -4.891  1.00 0.00 ? 35  LEU A HB2  7  
ATOM 10667 H HB3  . LEU A 1 35  ? -6.210  -19.611 -3.807  1.00 0.00 ? 35  LEU A HB3  7  
ATOM 10668 H HG   . LEU A 1 35  ? -5.833  -17.548 -5.147  1.00 0.00 ? 35  LEU A HG   7  
ATOM 10669 H HD11 . LEU A 1 35  ? -4.831  -19.002 -7.467  1.00 0.00 ? 35  LEU A HD11 7  
ATOM 10670 H HD12 . LEU A 1 35  ? -3.665  -18.889 -6.150  1.00 0.00 ? 35  LEU A HD12 7  
ATOM 10671 H HD13 . LEU A 1 35  ? -4.372  -17.423 -6.829  1.00 0.00 ? 35  LEU A HD13 7  
ATOM 10672 H HD21 . LEU A 1 35  ? -7.819  -18.752 -5.586  1.00 0.00 ? 35  LEU A HD21 7  
ATOM 10673 H HD22 . LEU A 1 35  ? -6.953  -20.005 -6.475  1.00 0.00 ? 35  LEU A HD22 7  
ATOM 10674 H HD23 . LEU A 1 35  ? -7.111  -18.386 -7.159  1.00 0.00 ? 35  LEU A HD23 7  
ATOM 10675 N N    . LEU A 1 36  ? -4.366  -16.869 -2.668  1.00 0.00 ? 36  LEU A N    7  
ATOM 10676 C CA   . LEU A 1 36  ? -4.761  -15.848 -1.703  1.00 0.00 ? 36  LEU A CA   7  
ATOM 10677 C C    . LEU A 1 36  ? -5.832  -14.933 -2.286  1.00 0.00 ? 36  LEU A C    7  
ATOM 10678 O O    . LEU A 1 36  ? -5.787  -14.580 -3.465  1.00 0.00 ? 36  LEU A O    7  
ATOM 10679 C CB   . LEU A 1 36  ? -3.545  -15.023 -1.278  1.00 0.00 ? 36  LEU A CB   7  
ATOM 10680 C CG   . LEU A 1 36  ? -2.307  -15.818 -0.860  1.00 0.00 ? 36  LEU A CG   7  
ATOM 10681 C CD1  . LEU A 1 36  ? -1.066  -14.941 -0.916  1.00 0.00 ? 36  LEU A CD1  7  
ATOM 10682 C CD2  . LEU A 1 36  ? -2.491  -16.397 0.534   1.00 0.00 ? 36  LEU A CD2  7  
ATOM 10683 H H    . LEU A 1 36  ? -3.900  -16.598 -3.485  1.00 0.00 ? 36  LEU A H    7  
ATOM 10684 H HA   . LEU A 1 36  ? -5.166  -16.350 -0.837  1.00 0.00 ? 36  LEU A HA   7  
ATOM 10685 H HB2  . LEU A 1 36  ? -3.267  -14.392 -2.109  1.00 0.00 ? 36  LEU A HB2  7  
ATOM 10686 H HB3  . LEU A 1 36  ? -3.841  -14.406 -0.442  1.00 0.00 ? 36  LEU A HB3  7  
ATOM 10687 H HG   . LEU A 1 36  ? -2.165  -16.639 -1.549  1.00 0.00 ? 36  LEU A HG   7  
ATOM 10688 H HD11 . LEU A 1 36  ? -1.360  -13.904 -0.983  1.00 0.00 ? 36  LEU A HD11 7  
ATOM 10689 H HD12 . LEU A 1 36  ? -0.477  -15.205 -1.781  1.00 0.00 ? 36  LEU A HD12 7  
ATOM 10690 H HD13 . LEU A 1 36  ? -0.479  -15.091 -0.021  1.00 0.00 ? 36  LEU A HD13 7  
ATOM 10691 H HD21 . LEU A 1 36  ? -3.365  -17.032 0.547   1.00 0.00 ? 36  LEU A HD21 7  
ATOM 10692 H HD22 . LEU A 1 36  ? -2.620  -15.593 1.244   1.00 0.00 ? 36  LEU A HD22 7  
ATOM 10693 H HD23 . LEU A 1 36  ? -1.621  -16.978 0.801   1.00 0.00 ? 36  LEU A HD23 7  
ATOM 10694 N N    . SER A 1 37  ? -6.794  -14.550 -1.453  1.00 0.00 ? 37  SER A N    7  
ATOM 10695 C CA   . SER A 1 37  ? -7.878  -13.676 -1.886  1.00 0.00 ? 37  SER A CA   7  
ATOM 10696 C C    . SER A 1 37  ? -7.908  -12.395 -1.057  1.00 0.00 ? 37  SER A C    7  
ATOM 10697 O O    . SER A 1 37  ? -8.136  -12.431 0.152   1.00 0.00 ? 37  SER A O    7  
ATOM 10698 C CB   . SER A 1 37  ? -9.221  -14.401 -1.775  1.00 0.00 ? 37  SER A CB   7  
ATOM 10699 O OG   . SER A 1 37  ? -9.391  -15.325 -2.836  1.00 0.00 ? 37  SER A OG   7  
ATOM 10700 H H    . SER A 1 37  ? -6.775  -14.864 -0.525  1.00 0.00 ? 37  SER A H    7  
ATOM 10701 H HA   . SER A 1 37  ? -7.703  -13.418 -2.920  1.00 0.00 ? 37  SER A HA   7  
ATOM 10702 H HB2  . SER A 1 37  ? -9.262  -14.935 -0.838  1.00 0.00 ? 37  SER A HB2  7  
ATOM 10703 H HB3  . SER A 1 37  ? -10.022 -13.676 -1.812  1.00 0.00 ? 37  SER A HB3  7  
ATOM 10704 H HG   . SER A 1 37  ? -10.323 -15.393 -3.055  1.00 0.00 ? 37  SER A HG   7  
ATOM 10705 N N    . TRP A 1 38  ? -7.677  -11.266 -1.717  1.00 0.00 ? 38  TRP A N    7  
ATOM 10706 C CA   . TRP A 1 38  ? -7.677  -9.973  -1.042  1.00 0.00 ? 38  TRP A CA   7  
ATOM 10707 C C    . TRP A 1 38  ? -8.291  -8.896  -1.929  1.00 0.00 ? 38  TRP A C    7  
ATOM 10708 O O    . TRP A 1 38  ? -8.343  -9.039  -3.151  1.00 0.00 ? 38  TRP A O    7  
ATOM 10709 C CB   . TRP A 1 38  ? -6.252  -9.579  -0.651  1.00 0.00 ? 38  TRP A CB   7  
ATOM 10710 C CG   . TRP A 1 38  ? -5.447  -9.046  -1.798  1.00 0.00 ? 38  TRP A CG   7  
ATOM 10711 C CD1  . TRP A 1 38  ? -5.545  -7.806  -2.362  1.00 0.00 ? 38  TRP A CD1  7  
ATOM 10712 C CD2  . TRP A 1 38  ? -4.424  -9.739  -2.521  1.00 0.00 ? 38  TRP A CD2  7  
ATOM 10713 N NE1  . TRP A 1 38  ? -4.644  -7.686  -3.392  1.00 0.00 ? 38  TRP A NE1  7  
ATOM 10714 C CE2  . TRP A 1 38  ? -3.944  -8.858  -3.510  1.00 0.00 ? 38  TRP A CE2  7  
ATOM 10715 C CE3  . TRP A 1 38  ? -3.866  -11.017 -2.429  1.00 0.00 ? 38  TRP A CE3  7  
ATOM 10716 C CZ2  . TRP A 1 38  ? -2.933  -9.216  -4.398  1.00 0.00 ? 38  TRP A CZ2  7  
ATOM 10717 C CZ3  . TRP A 1 38  ? -2.863  -11.371 -3.312  1.00 0.00 ? 38  TRP A CZ3  7  
ATOM 10718 C CH2  . TRP A 1 38  ? -2.405  -10.474 -4.285  1.00 0.00 ? 38  TRP A CH2  7  
ATOM 10719 H H    . TRP A 1 38  ? -7.502  -11.302 -2.681  1.00 0.00 ? 38  TRP A H    7  
ATOM 10720 H HA   . TRP A 1 38  ? -8.273  -10.068 -0.146  1.00 0.00 ? 38  TRP A HA   7  
ATOM 10721 H HB2  . TRP A 1 38  ? -6.293  -8.814  0.111   1.00 0.00 ? 38  TRP A HB2  7  
ATOM 10722 H HB3  . TRP A 1 38  ? -5.741  -10.446 -0.258  1.00 0.00 ? 38  TRP A HB3  7  
ATOM 10723 H HD1  . TRP A 1 38  ? -6.234  -7.043  -2.036  1.00 0.00 ? 38  TRP A HD1  7  
ATOM 10724 H HE1  . TRP A 1 38  ? -4.521  -6.890  -3.951  1.00 0.00 ? 38  TRP A HE1  7  
ATOM 10725 H HE3  . TRP A 1 38  ? -4.206  -11.722 -1.685  1.00 0.00 ? 38  TRP A HE3  7  
ATOM 10726 H HZ2  . TRP A 1 38  ? -2.569  -8.536  -5.154  1.00 0.00 ? 38  TRP A HZ2  7  
ATOM 10727 H HZ3  . TRP A 1 38  ? -2.420  -12.354 -3.256  1.00 0.00 ? 38  TRP A HZ3  7  
ATOM 10728 H HH2  . TRP A 1 38  ? -1.620  -10.793 -4.954  1.00 0.00 ? 38  TRP A HH2  7  
ATOM 10729 N N    . THR A 1 39  ? -8.754  -7.816  -1.308  1.00 0.00 ? 39  THR A N    7  
ATOM 10730 C CA   . THR A 1 39  ? -9.365  -6.715  -2.042  1.00 0.00 ? 39  THR A CA   7  
ATOM 10731 C C    . THR A 1 39  ? -8.545  -5.438  -1.900  1.00 0.00 ? 39  THR A C    7  
ATOM 10732 O O    . THR A 1 39  ? -8.314  -4.939  -0.798  1.00 0.00 ? 39  THR A O    7  
ATOM 10733 C CB   . THR A 1 39  ? -10.802 -6.445  -1.556  1.00 0.00 ? 39  THR A CB   7  
ATOM 10734 O OG1  . THR A 1 39  ? -11.668 -7.507  -1.974  1.00 0.00 ? 39  THR A OG1  7  
ATOM 10735 C CG2  . THR A 1 39  ? -11.317 -5.121  -2.099  1.00 0.00 ? 39  THR A CG2  7  
ATOM 10736 H H    . THR A 1 39  ? -8.684  -7.761  -0.332  1.00 0.00 ? 39  THR A H    7  
ATOM 10737 H HA   . THR A 1 39  ? -9.406  -6.991  -3.085  1.00 0.00 ? 39  THR A HA   7  
ATOM 10738 H HB   . THR A 1 39  ? -10.798 -6.398  -0.477  1.00 0.00 ? 39  THR A HB   7  
ATOM 10739 H HG1  . THR A 1 39  ? -11.197 -8.342  -1.923  1.00 0.00 ? 39  THR A HG1  7  
ATOM 10740 H HG21 . THR A 1 39  ? -11.043 -5.027  -3.140  1.00 0.00 ? 39  THR A HG21 7  
ATOM 10741 H HG22 . THR A 1 39  ? -10.881 -4.308  -1.538  1.00 0.00 ? 39  THR A HG22 7  
ATOM 10742 H HG23 . THR A 1 39  ? -12.392 -5.088  -2.006  1.00 0.00 ? 39  THR A HG23 7  
ATOM 10743 N N    . PRO A 1 40  ? -8.094  -4.894  -3.040  1.00 0.00 ? 40  PRO A N    7  
ATOM 10744 C CA   . PRO A 1 40  ? -7.294  -3.666  -3.068  1.00 0.00 ? 40  PRO A CA   7  
ATOM 10745 C C    . PRO A 1 40  ? -8.107  -2.434  -2.687  1.00 0.00 ? 40  PRO A C    7  
ATOM 10746 O O    . PRO A 1 40  ? -9.218  -2.219  -3.174  1.00 0.00 ? 40  PRO A O    7  
ATOM 10747 C CB   . PRO A 1 40  ? -6.836  -3.575  -4.526  1.00 0.00 ? 40  PRO A CB   7  
ATOM 10748 C CG   . PRO A 1 40  ? -7.867  -4.328  -5.294  1.00 0.00 ? 40  PRO A CG   7  
ATOM 10749 C CD   . PRO A 1 40  ? -8.332  -5.434  -4.389  1.00 0.00 ? 40  PRO A CD   7  
ATOM 10750 H HA   . PRO A 1 40  ? -6.431  -3.740  -2.423  1.00 0.00 ? 40  PRO A HA   7  
ATOM 10751 H HB2  . PRO A 1 40  ? -6.796  -2.538  -4.829  1.00 0.00 ? 40  PRO A HB2  7  
ATOM 10752 H HB3  . PRO A 1 40  ? -5.860  -4.024  -4.630  1.00 0.00 ? 40  PRO A HB3  7  
ATOM 10753 H HG2  . PRO A 1 40  ? -8.690  -3.675  -5.542  1.00 0.00 ? 40  PRO A HG2  7  
ATOM 10754 H HG3  . PRO A 1 40  ? -7.428  -4.738  -6.192  1.00 0.00 ? 40  PRO A HG3  7  
ATOM 10755 H HD2  . PRO A 1 40  ? -9.382  -5.634  -4.545  1.00 0.00 ? 40  PRO A HD2  7  
ATOM 10756 H HD3  . PRO A 1 40  ? -7.748  -6.328  -4.553  1.00 0.00 ? 40  PRO A HD3  7  
ATOM 10757 N N    . PRO A 1 41  ? -7.544  -1.604  -1.796  1.00 0.00 ? 41  PRO A N    7  
ATOM 10758 C CA   . PRO A 1 41  ? -8.201  -0.379  -1.331  1.00 0.00 ? 41  PRO A CA   7  
ATOM 10759 C C    . PRO A 1 41  ? -8.279  0.686   -2.420  1.00 0.00 ? 41  PRO A C    7  
ATOM 10760 O O    . PRO A 1 41  ? -7.781  0.491   -3.529  1.00 0.00 ? 41  PRO A O    7  
ATOM 10761 C CB   . PRO A 1 41  ? -7.301  0.093   -0.186  1.00 0.00 ? 41  PRO A CB   7  
ATOM 10762 C CG   . PRO A 1 41  ? -5.962  -0.483  -0.495  1.00 0.00 ? 41  PRO A CG   7  
ATOM 10763 C CD   . PRO A 1 41  ? -6.224  -1.798  -1.175  1.00 0.00 ? 41  PRO A CD   7  
ATOM 10764 H HA   . PRO A 1 41  ? -9.192  -0.579  -0.953  1.00 0.00 ? 41  PRO A HA   7  
ATOM 10765 H HB2  . PRO A 1 41  ? -7.273  1.173   -0.169  1.00 0.00 ? 41  PRO A HB2  7  
ATOM 10766 H HB3  . PRO A 1 41  ? -7.683  -0.278  0.753   1.00 0.00 ? 41  PRO A HB3  7  
ATOM 10767 H HG2  . PRO A 1 41  ? -5.421  0.179   -1.154  1.00 0.00 ? 41  PRO A HG2  7  
ATOM 10768 H HG3  . PRO A 1 41  ? -5.410  -0.638  0.420   1.00 0.00 ? 41  PRO A HG3  7  
ATOM 10769 H HD2  . PRO A 1 41  ? -5.470  -1.992  -1.924  1.00 0.00 ? 41  PRO A HD2  7  
ATOM 10770 H HD3  . PRO A 1 41  ? -6.253  -2.599  -0.450  1.00 0.00 ? 41  PRO A HD3  7  
ATOM 10771 N N    . ARG A 1 42  ? -8.908  1.811   -2.097  1.00 0.00 ? 42  ARG A N    7  
ATOM 10772 C CA   . ARG A 1 42  ? -9.052  2.907   -3.048  1.00 0.00 ? 42  ARG A CA   7  
ATOM 10773 C C    . ARG A 1 42  ? -7.714  3.236   -3.704  1.00 0.00 ? 42  ARG A C    7  
ATOM 10774 O O    . ARG A 1 42  ? -7.648  3.498   -4.905  1.00 0.00 ? 42  ARG A O    7  
ATOM 10775 C CB   . ARG A 1 42  ? -9.609  4.148   -2.349  1.00 0.00 ? 42  ARG A CB   7  
ATOM 10776 C CG   . ARG A 1 42  ? -11.039 3.983   -1.863  1.00 0.00 ? 42  ARG A CG   7  
ATOM 10777 C CD   . ARG A 1 42  ? -12.023 3.966   -3.022  1.00 0.00 ? 42  ARG A CD   7  
ATOM 10778 N NE   . ARG A 1 42  ? -13.396 4.194   -2.579  1.00 0.00 ? 42  ARG A NE   7  
ATOM 10779 C CZ   . ARG A 1 42  ? -14.352 4.678   -3.364  1.00 0.00 ? 42  ARG A CZ   7  
ATOM 10780 N NH1  . ARG A 1 42  ? -14.085 4.983   -4.627  1.00 0.00 ? 42  ARG A NH1  7  
ATOM 10781 N NH2  . ARG A 1 42  ? -15.577 4.857   -2.888  1.00 0.00 ? 42  ARG A NH2  7  
ATOM 10782 H H    . ARG A 1 42  ? -9.284  1.907   -1.197  1.00 0.00 ? 42  ARG A H    7  
ATOM 10783 H HA   . ARG A 1 42  ? -9.746  2.593   -3.812  1.00 0.00 ? 42  ARG A HA   7  
ATOM 10784 H HB2  . ARG A 1 42  ? -8.987  4.376   -1.496  1.00 0.00 ? 42  ARG A HB2  7  
ATOM 10785 H HB3  . ARG A 1 42  ? -9.579  4.978   -3.038  1.00 0.00 ? 42  ARG A HB3  7  
ATOM 10786 H HG2  . ARG A 1 42  ? -11.121 3.051   -1.323  1.00 0.00 ? 42  ARG A HG2  7  
ATOM 10787 H HG3  . ARG A 1 42  ? -11.284 4.804   -1.206  1.00 0.00 ? 42  ARG A HG3  7  
ATOM 10788 H HD2  . ARG A 1 42  ? -11.748 4.742   -3.721  1.00 0.00 ? 42  ARG A HD2  7  
ATOM 10789 H HD3  . ARG A 1 42  ? -11.967 3.005   -3.511  1.00 0.00 ? 42  ARG A HD3  7  
ATOM 10790 H HE   . ARG A 1 42  ? -13.615 3.976   -1.649  1.00 0.00 ? 42  ARG A HE   7  
ATOM 10791 H HH11 . ARG A 1 42  ? -13.163 4.848   -4.989  1.00 0.00 ? 42  ARG A HH11 7  
ATOM 10792 H HH12 . ARG A 1 42  ? -14.807 5.346   -5.217  1.00 0.00 ? 42  ARG A HH12 7  
ATOM 10793 H HH21 . ARG A 1 42  ? -15.781 4.628   -1.937  1.00 0.00 ? 42  ARG A HH21 7  
ATOM 10794 H HH22 . ARG A 1 42  ? -16.295 5.221   -3.480  1.00 0.00 ? 42  ARG A HH22 7  
ATOM 10795 N N    . SER A 1 43  ? -6.651  3.223   -2.907  1.00 0.00 ? 43  SER A N    7  
ATOM 10796 C CA   . SER A 1 43  ? -5.315  3.525   -3.408  1.00 0.00 ? 43  SER A CA   7  
ATOM 10797 C C    . SER A 1 43  ? -5.049  2.791   -4.719  1.00 0.00 ? 43  SER A C    7  
ATOM 10798 O O    . SER A 1 43  ? -4.695  1.612   -4.723  1.00 0.00 ? 43  SER A O    7  
ATOM 10799 C CB   . SER A 1 43  ? -4.258  3.140   -2.371  1.00 0.00 ? 43  SER A CB   7  
ATOM 10800 O OG   . SER A 1 43  ? -4.169  4.115   -1.347  1.00 0.00 ? 43  SER A OG   7  
ATOM 10801 H H    . SER A 1 43  ? -6.768  3.007   -1.958  1.00 0.00 ? 43  SER A H    7  
ATOM 10802 H HA   . SER A 1 43  ? -5.261  4.588   -3.587  1.00 0.00 ? 43  SER A HA   7  
ATOM 10803 H HB2  . SER A 1 43  ? -4.523  2.192   -1.927  1.00 0.00 ? 43  SER A HB2  7  
ATOM 10804 H HB3  . SER A 1 43  ? -3.297  3.055   -2.856  1.00 0.00 ? 43  SER A HB3  7  
ATOM 10805 H HG   . SER A 1 43  ? -5.010  4.570   -1.264  1.00 0.00 ? 43  SER A HG   7  
ATOM 10806 N N    . ASP A 1 44  ? -5.222  3.498   -5.831  1.00 0.00 ? 44  ASP A N    7  
ATOM 10807 C CA   . ASP A 1 44  ? -4.999  2.916   -7.149  1.00 0.00 ? 44  ASP A CA   7  
ATOM 10808 C C    . ASP A 1 44  ? -3.513  2.677   -7.394  1.00 0.00 ? 44  ASP A C    7  
ATOM 10809 O O    . ASP A 1 44  ? -3.118  1.637   -7.922  1.00 0.00 ? 44  ASP A O    7  
ATOM 10810 C CB   . ASP A 1 44  ? -5.568  3.829   -8.236  1.00 0.00 ? 44  ASP A CB   7  
ATOM 10811 C CG   . ASP A 1 44  ? -7.070  3.997   -8.125  1.00 0.00 ? 44  ASP A CG   7  
ATOM 10812 O OD1  . ASP A 1 44  ? -7.801  3.047   -8.475  1.00 0.00 ? 44  ASP A OD1  7  
ATOM 10813 O OD2  . ASP A 1 44  ? -7.515  5.078   -7.686  1.00 0.00 ? 44  ASP A OD2  7  
ATOM 10814 H H    . ASP A 1 44  ? -5.505  4.434   -5.763  1.00 0.00 ? 44  ASP A H    7  
ATOM 10815 H HA   . ASP A 1 44  ? -5.514  1.967   -7.184  1.00 0.00 ? 44  ASP A HA   7  
ATOM 10816 H HB2  . ASP A 1 44  ? -5.109  4.804   -8.154  1.00 0.00 ? 44  ASP A HB2  7  
ATOM 10817 H HB3  . ASP A 1 44  ? -5.341  3.410   -9.205  1.00 0.00 ? 44  ASP A HB3  7  
ATOM 10818 N N    . THR A 1 45  ? -2.691  3.648   -7.008  1.00 0.00 ? 45  THR A N    7  
ATOM 10819 C CA   . THR A 1 45  ? -1.248  3.544   -7.187  1.00 0.00 ? 45  THR A CA   7  
ATOM 10820 C C    . THR A 1 45  ? -0.649  2.513   -6.238  1.00 0.00 ? 45  THR A C    7  
ATOM 10821 O O    . THR A 1 45  ? -0.353  2.817   -5.082  1.00 0.00 ? 45  THR A O    7  
ATOM 10822 C CB   . THR A 1 45  ? -0.555  4.901   -6.957  1.00 0.00 ? 45  THR A CB   7  
ATOM 10823 O OG1  . THR A 1 45  ? -1.009  5.480   -5.729  1.00 0.00 ? 45  THR A OG1  7  
ATOM 10824 C CG2  . THR A 1 45  ? -0.836  5.854   -8.108  1.00 0.00 ? 45  THR A CG2  7  
ATOM 10825 H H    . THR A 1 45  ? -3.065  4.453   -6.593  1.00 0.00 ? 45  THR A H    7  
ATOM 10826 H HA   . THR A 1 45  ? -1.060  3.236   -8.205  1.00 0.00 ? 45  THR A HA   7  
ATOM 10827 H HB   . THR A 1 45  ? 0.511   4.737   -6.896  1.00 0.00 ? 45  THR A HB   7  
ATOM 10828 H HG1  . THR A 1 45  ? -0.403  5.246   -5.021  1.00 0.00 ? 45  THR A HG1  7  
ATOM 10829 H HG21 . THR A 1 45  ? 0.031   6.475   -8.281  1.00 0.00 ? 45  THR A HG21 7  
ATOM 10830 H HG22 . THR A 1 45  ? -1.682  6.478   -7.860  1.00 0.00 ? 45  THR A HG22 7  
ATOM 10831 H HG23 . THR A 1 45  ? -1.056  5.287   -9.000  1.00 0.00 ? 45  THR A HG23 7  
ATOM 10832 N N    . ILE A 1 46  ? -0.471  1.293   -6.734  1.00 0.00 ? 46  ILE A N    7  
ATOM 10833 C CA   . ILE A 1 46  ? 0.095   0.217   -5.930  1.00 0.00 ? 46  ILE A CA   7  
ATOM 10834 C C    . ILE A 1 46  ? 1.269   -0.444  -6.645  1.00 0.00 ? 46  ILE A C    7  
ATOM 10835 O O    . ILE A 1 46  ? 1.122   -0.963  -7.751  1.00 0.00 ? 46  ILE A O    7  
ATOM 10836 C CB   . ILE A 1 46  ? -0.960  -0.855  -5.601  1.00 0.00 ? 46  ILE A CB   7  
ATOM 10837 C CG1  . ILE A 1 46  ? -2.113  -0.240  -4.806  1.00 0.00 ? 46  ILE A CG1  7  
ATOM 10838 C CG2  . ILE A 1 46  ? -0.327  -2.001  -4.826  1.00 0.00 ? 46  ILE A CG2  7  
ATOM 10839 C CD1  . ILE A 1 46  ? -3.331  -1.133  -4.717  1.00 0.00 ? 46  ILE A CD1  7  
ATOM 10840 H H    . ILE A 1 46  ? -0.727  1.112   -7.663  1.00 0.00 ? 46  ILE A H    7  
ATOM 10841 H HA   . ILE A 1 46  ? 0.447   0.644   -5.002  1.00 0.00 ? 46  ILE A HA   7  
ATOM 10842 H HB   . ILE A 1 46  ? -1.343  -1.249  -6.530  1.00 0.00 ? 46  ILE A HB   7  
ATOM 10843 H HG12 . ILE A 1 46  ? -1.780  -0.034  -3.801  1.00 0.00 ? 46  ILE A HG12 7  
ATOM 10844 H HG13 . ILE A 1 46  ? -2.413  0.685   -5.277  1.00 0.00 ? 46  ILE A HG13 7  
ATOM 10845 H HG21 . ILE A 1 46  ? 0.542   -2.359  -5.359  1.00 0.00 ? 46  ILE A HG21 7  
ATOM 10846 H HG22 . ILE A 1 46  ? -0.031  -1.653  -3.848  1.00 0.00 ? 46  ILE A HG22 7  
ATOM 10847 H HG23 . ILE A 1 46  ? -1.042  -2.804  -4.722  1.00 0.00 ? 46  ILE A HG23 7  
ATOM 10848 H HD11 . ILE A 1 46  ? -4.033  -0.863  -5.492  1.00 0.00 ? 46  ILE A HD11 7  
ATOM 10849 H HD12 . ILE A 1 46  ? -3.033  -2.163  -4.842  1.00 0.00 ? 46  ILE A HD12 7  
ATOM 10850 H HD13 . ILE A 1 46  ? -3.798  -1.009  -3.750  1.00 0.00 ? 46  ILE A HD13 7  
ATOM 10851 N N    . ALA A 1 47  ? 2.433   -0.422  -6.004  1.00 0.00 ? 47  ALA A N    7  
ATOM 10852 C CA   . ALA A 1 47  ? 3.632   -1.022  -6.577  1.00 0.00 ? 47  ALA A CA   7  
ATOM 10853 C C    . ALA A 1 47  ? 3.579   -2.544  -6.488  1.00 0.00 ? 47  ALA A C    7  
ATOM 10854 O O    . ALA A 1 47  ? 3.809   -3.240  -7.475  1.00 0.00 ? 47  ALA A O    7  
ATOM 10855 C CB   . ALA A 1 47  ? 4.874   -0.493  -5.875  1.00 0.00 ? 47  ALA A CB   7  
ATOM 10856 H H    . ALA A 1 47  ? 2.486   0.007   -5.125  1.00 0.00 ? 47  ALA A H    7  
ATOM 10857 H HA   . ALA A 1 47  ? 3.685   -0.734  -7.617  1.00 0.00 ? 47  ALA A HA   7  
ATOM 10858 H HB1  . ALA A 1 47  ? 4.654   -0.333  -4.829  1.00 0.00 ? 47  ALA A HB1  7  
ATOM 10859 H HB2  . ALA A 1 47  ? 5.674   -1.212  -5.970  1.00 0.00 ? 47  ALA A HB2  7  
ATOM 10860 H HB3  . ALA A 1 47  ? 5.172   0.441   -6.328  1.00 0.00 ? 47  ALA A HB3  7  
ATOM 10861 N N    . ASN A 1 48  ? 3.276   -3.052  -5.298  1.00 0.00 ? 48  ASN A N    7  
ATOM 10862 C CA   . ASN A 1 48  ? 3.195   -4.492  -5.081  1.00 0.00 ? 48  ASN A CA   7  
ATOM 10863 C C    . ASN A 1 48  ? 2.704   -4.803  -3.670  1.00 0.00 ? 48  ASN A C    7  
ATOM 10864 O O    . ASN A 1 48  ? 2.452   -3.896  -2.876  1.00 0.00 ? 48  ASN A O    7  
ATOM 10865 C CB   . ASN A 1 48  ? 4.561   -5.141  -5.312  1.00 0.00 ? 48  ASN A CB   7  
ATOM 10866 C CG   . ASN A 1 48  ? 5.708   -4.240  -4.896  1.00 0.00 ? 48  ASN A CG   7  
ATOM 10867 O OD1  . ASN A 1 48  ? 5.635   -3.556  -3.875  1.00 0.00 ? 48  ASN A OD1  7  
ATOM 10868 N ND2  . ASN A 1 48  ? 6.773   -4.234  -5.688  1.00 0.00 ? 48  ASN A ND2  7  
ATOM 10869 H H    . ASN A 1 48  ? 3.103   -2.446  -4.549  1.00 0.00 ? 48  ASN A H    7  
ATOM 10870 H HA   . ASN A 1 48  ? 2.490   -4.896  -5.792  1.00 0.00 ? 48  ASN A HA   7  
ATOM 10871 H HB2  . ASN A 1 48  ? 4.621   -6.055  -4.737  1.00 0.00 ? 48  ASN A HB2  7  
ATOM 10872 H HB3  . ASN A 1 48  ? 4.671   -5.373  -6.360  1.00 0.00 ? 48  ASN A HB3  7  
ATOM 10873 H HD21 . ASN A 1 48  ? 6.761   -4.804  -6.485  1.00 0.00 ? 48  ASN A HD21 7  
ATOM 10874 H HD22 . ASN A 1 48  ? 7.529   -3.661  -5.443  1.00 0.00 ? 48  ASN A HD22 7  
ATOM 10875 N N    . TYR A 1 49  ? 2.571   -6.089  -3.366  1.00 0.00 ? 49  TYR A N    7  
ATOM 10876 C CA   . TYR A 1 49  ? 2.108   -6.519  -2.052  1.00 0.00 ? 49  TYR A CA   7  
ATOM 10877 C C    . TYR A 1 49  ? 3.178   -7.342  -1.340  1.00 0.00 ? 49  TYR A C    7  
ATOM 10878 O O    . TYR A 1 49  ? 3.900   -8.116  -1.968  1.00 0.00 ? 49  TYR A O    7  
ATOM 10879 C CB   . TYR A 1 49  ? 0.823   -7.338  -2.183  1.00 0.00 ? 49  TYR A CB   7  
ATOM 10880 C CG   . TYR A 1 49  ? -0.380  -6.515  -2.587  1.00 0.00 ? 49  TYR A CG   7  
ATOM 10881 C CD1  . TYR A 1 49  ? -0.605  -6.185  -3.918  1.00 0.00 ? 49  TYR A CD1  7  
ATOM 10882 C CD2  . TYR A 1 49  ? -1.292  -6.070  -1.638  1.00 0.00 ? 49  TYR A CD2  7  
ATOM 10883 C CE1  . TYR A 1 49  ? -1.702  -5.433  -4.291  1.00 0.00 ? 49  TYR A CE1  7  
ATOM 10884 C CE2  . TYR A 1 49  ? -2.392  -5.319  -2.003  1.00 0.00 ? 49  TYR A CE2  7  
ATOM 10885 C CZ   . TYR A 1 49  ? -2.593  -5.003  -3.330  1.00 0.00 ? 49  TYR A CZ   7  
ATOM 10886 O OH   . TYR A 1 49  ? -3.688  -4.255  -3.698  1.00 0.00 ? 49  TYR A OH   7  
ATOM 10887 H H    . TYR A 1 49  ? 2.787   -6.765  -4.041  1.00 0.00 ? 49  TYR A H    7  
ATOM 10888 H HA   . TYR A 1 49  ? 1.902   -5.635  -1.466  1.00 0.00 ? 49  TYR A HA   7  
ATOM 10889 H HB2  . TYR A 1 49  ? 0.967   -8.103  -2.930  1.00 0.00 ? 49  TYR A HB2  7  
ATOM 10890 H HB3  . TYR A 1 49  ? 0.603   -7.804  -1.234  1.00 0.00 ? 49  TYR A HB3  7  
ATOM 10891 H HD1  . TYR A 1 49  ? 0.095   -6.524  -4.668  1.00 0.00 ? 49  TYR A HD1  7  
ATOM 10892 H HD2  . TYR A 1 49  ? -1.132  -6.319  -0.599  1.00 0.00 ? 49  TYR A HD2  7  
ATOM 10893 H HE1  . TYR A 1 49  ? -1.860  -5.186  -5.331  1.00 0.00 ? 49  TYR A HE1  7  
ATOM 10894 H HE2  . TYR A 1 49  ? -3.090  -4.981  -1.251  1.00 0.00 ? 49  TYR A HE2  7  
ATOM 10895 H HH   . TYR A 1 49  ? -3.903  -4.434  -4.617  1.00 0.00 ? 49  TYR A HH   7  
ATOM 10896 N N    . GLU A 1 50  ? 3.272   -7.169  -0.026  1.00 0.00 ? 50  GLU A N    7  
ATOM 10897 C CA   . GLU A 1 50  ? 4.253   -7.895  0.772   1.00 0.00 ? 50  GLU A CA   7  
ATOM 10898 C C    . GLU A 1 50  ? 3.636   -9.149  1.384   1.00 0.00 ? 50  GLU A C    7  
ATOM 10899 O O    . GLU A 1 50  ? 2.628   -9.079  2.088   1.00 0.00 ? 50  GLU A O    7  
ATOM 10900 C CB   . GLU A 1 50  ? 4.811   -6.996  1.877   1.00 0.00 ? 50  GLU A CB   7  
ATOM 10901 C CG   . GLU A 1 50  ? 6.179   -7.427  2.380   1.00 0.00 ? 50  GLU A CG   7  
ATOM 10902 C CD   . GLU A 1 50  ? 6.683   -6.557  3.515   1.00 0.00 ? 50  GLU A CD   7  
ATOM 10903 O OE1  . GLU A 1 50  ? 6.181   -6.710  4.648   1.00 0.00 ? 50  GLU A OE1  7  
ATOM 10904 O OE2  . GLU A 1 50  ? 7.581   -5.724  3.270   1.00 0.00 ? 50  GLU A OE2  7  
ATOM 10905 H H    . GLU A 1 50  ? 2.668   -6.537  0.418   1.00 0.00 ? 50  GLU A H    7  
ATOM 10906 H HA   . GLU A 1 50  ? 5.061   -8.188  0.118   1.00 0.00 ? 50  GLU A HA   7  
ATOM 10907 H HB2  . GLU A 1 50  ? 4.890   -5.987  1.499   1.00 0.00 ? 50  GLU A HB2  7  
ATOM 10908 H HB3  . GLU A 1 50  ? 4.125   -7.005  2.712   1.00 0.00 ? 50  GLU A HB3  7  
ATOM 10909 H HG2  . GLU A 1 50  ? 6.115   -8.446  2.729   1.00 0.00 ? 50  GLU A HG2  7  
ATOM 10910 H HG3  . GLU A 1 50  ? 6.883   -7.370  1.563   1.00 0.00 ? 50  GLU A HG3  7  
ATOM 10911 N N    . LEU A 1 51  ? 4.248   -10.296 1.110   1.00 0.00 ? 51  LEU A N    7  
ATOM 10912 C CA   . LEU A 1 51  ? 3.759   -11.567 1.633   1.00 0.00 ? 51  LEU A CA   7  
ATOM 10913 C C    . LEU A 1 51  ? 4.779   -12.196 2.577   1.00 0.00 ? 51  LEU A C    7  
ATOM 10914 O O    . LEU A 1 51  ? 5.715   -12.867 2.139   1.00 0.00 ? 51  LEU A O    7  
ATOM 10915 C CB   . LEU A 1 51  ? 3.450   -12.529 0.484   1.00 0.00 ? 51  LEU A CB   7  
ATOM 10916 C CG   . LEU A 1 51  ? 3.103   -13.963 0.884   1.00 0.00 ? 51  LEU A CG   7  
ATOM 10917 C CD1  . LEU A 1 51  ? 1.881   -13.984 1.789   1.00 0.00 ? 51  LEU A CD1  7  
ATOM 10918 C CD2  . LEU A 1 51  ? 2.868   -14.819 -0.352  1.00 0.00 ? 51  LEU A CD2  7  
ATOM 10919 H H    . LEU A 1 51  ? 5.047   -10.289 0.544   1.00 0.00 ? 51  LEU A H    7  
ATOM 10920 H HA   . LEU A 1 51  ? 2.851   -11.372 2.183   1.00 0.00 ? 51  LEU A HA   7  
ATOM 10921 H HB2  . LEU A 1 51  ? 2.613   -12.127 -0.067  1.00 0.00 ? 51  LEU A HB2  7  
ATOM 10922 H HB3  . LEU A 1 51  ? 4.318   -12.564 -0.159  1.00 0.00 ? 51  LEU A HB3  7  
ATOM 10923 H HG   . LEU A 1 51  ? 3.932   -14.388 1.434   1.00 0.00 ? 51  LEU A HG   7  
ATOM 10924 H HD11 . LEU A 1 51  ? 1.413   -14.956 1.740   1.00 0.00 ? 51  LEU A HD11 7  
ATOM 10925 H HD12 . LEU A 1 51  ? 1.179   -13.230 1.463   1.00 0.00 ? 51  LEU A HD12 7  
ATOM 10926 H HD13 . LEU A 1 51  ? 2.182   -13.779 2.806   1.00 0.00 ? 51  LEU A HD13 7  
ATOM 10927 H HD21 . LEU A 1 51  ? 3.818   -15.154 -0.743  1.00 0.00 ? 51  LEU A HD21 7  
ATOM 10928 H HD22 . LEU A 1 51  ? 2.356   -14.235 -1.103  1.00 0.00 ? 51  LEU A HD22 7  
ATOM 10929 H HD23 . LEU A 1 51  ? 2.265   -15.675 -0.088  1.00 0.00 ? 51  LEU A HD23 7  
ATOM 10930 N N    . VAL A 1 52  ? 4.592   -11.977 3.874   1.00 0.00 ? 52  VAL A N    7  
ATOM 10931 C CA   . VAL A 1 52  ? 5.493   -12.525 4.881   1.00 0.00 ? 52  VAL A CA   7  
ATOM 10932 C C    . VAL A 1 52  ? 5.084   -13.940 5.273   1.00 0.00 ? 52  VAL A C    7  
ATOM 10933 O O    . VAL A 1 52  ? 4.112   -14.136 6.004   1.00 0.00 ? 52  VAL A O    7  
ATOM 10934 C CB   . VAL A 1 52  ? 5.528   -11.643 6.143   1.00 0.00 ? 52  VAL A CB   7  
ATOM 10935 C CG1  . VAL A 1 52  ? 6.355   -12.305 7.234   1.00 0.00 ? 52  VAL A CG1  7  
ATOM 10936 C CG2  . VAL A 1 52  ? 6.073   -10.262 5.813   1.00 0.00 ? 52  VAL A CG2  7  
ATOM 10937 H H    . VAL A 1 52  ? 3.828   -11.435 4.162   1.00 0.00 ? 52  VAL A H    7  
ATOM 10938 H HA   . VAL A 1 52  ? 6.487   -12.552 4.459   1.00 0.00 ? 52  VAL A HA   7  
ATOM 10939 H HB   . VAL A 1 52  ? 4.517   -11.531 6.507   1.00 0.00 ? 52  VAL A HB   7  
ATOM 10940 H HG11 . VAL A 1 52  ? 6.778   -13.224 6.857   1.00 0.00 ? 52  VAL A HG11 7  
ATOM 10941 H HG12 . VAL A 1 52  ? 7.149   -11.639 7.538   1.00 0.00 ? 52  VAL A HG12 7  
ATOM 10942 H HG13 . VAL A 1 52  ? 5.723   -12.522 8.083   1.00 0.00 ? 52  VAL A HG13 7  
ATOM 10943 H HG21 . VAL A 1 52  ? 6.129   -9.673  6.716   1.00 0.00 ? 52  VAL A HG21 7  
ATOM 10944 H HG22 . VAL A 1 52  ? 7.060   -10.357 5.383   1.00 0.00 ? 52  VAL A HG22 7  
ATOM 10945 H HG23 . VAL A 1 52  ? 5.419   -9.776  5.105   1.00 0.00 ? 52  VAL A HG23 7  
ATOM 10946 N N    . TYR A 1 53  ? 5.830   -14.923 4.784   1.00 0.00 ? 53  TYR A N    7  
ATOM 10947 C CA   . TYR A 1 53  ? 5.544   -16.322 5.082   1.00 0.00 ? 53  TYR A CA   7  
ATOM 10948 C C    . TYR A 1 53  ? 6.728   -16.983 5.780   1.00 0.00 ? 53  TYR A C    7  
ATOM 10949 O O    . TYR A 1 53  ? 7.884   -16.739 5.434   1.00 0.00 ? 53  TYR A O    7  
ATOM 10950 C CB   . TYR A 1 53  ? 5.206   -17.080 3.797   1.00 0.00 ? 53  TYR A CB   7  
ATOM 10951 C CG   . TYR A 1 53  ? 6.424   -17.513 3.012   1.00 0.00 ? 53  TYR A CG   7  
ATOM 10952 C CD1  . TYR A 1 53  ? 7.095   -18.689 3.327   1.00 0.00 ? 53  TYR A CD1  7  
ATOM 10953 C CD2  . TYR A 1 53  ? 6.903   -16.748 1.957   1.00 0.00 ? 53  TYR A CD2  7  
ATOM 10954 C CE1  . TYR A 1 53  ? 8.208   -19.089 2.613   1.00 0.00 ? 53  TYR A CE1  7  
ATOM 10955 C CE2  . TYR A 1 53  ? 8.014   -17.140 1.236   1.00 0.00 ? 53  TYR A CE2  7  
ATOM 10956 C CZ   . TYR A 1 53  ? 8.663   -18.311 1.568   1.00 0.00 ? 53  TYR A CZ   7  
ATOM 10957 O OH   . TYR A 1 53  ? 9.772   -18.705 0.854   1.00 0.00 ? 53  TYR A OH   7  
ATOM 10958 H H    . TYR A 1 53  ? 6.591   -14.704 4.207   1.00 0.00 ? 53  TYR A H    7  
ATOM 10959 H HA   . TYR A 1 53  ? 4.689   -16.352 5.741   1.00 0.00 ? 53  TYR A HA   7  
ATOM 10960 H HB2  . TYR A 1 53  ? 4.642   -17.965 4.047   1.00 0.00 ? 53  TYR A HB2  7  
ATOM 10961 H HB3  . TYR A 1 53  ? 4.608   -16.445 3.159   1.00 0.00 ? 53  TYR A HB3  7  
ATOM 10962 H HD1  . TYR A 1 53  ? 6.736   -19.296 4.145   1.00 0.00 ? 53  TYR A HD1  7  
ATOM 10963 H HD2  . TYR A 1 53  ? 6.393   -15.831 1.700   1.00 0.00 ? 53  TYR A HD2  7  
ATOM 10964 H HE1  . TYR A 1 53  ? 8.716   -20.006 2.872   1.00 0.00 ? 53  TYR A HE1  7  
ATOM 10965 H HE2  . TYR A 1 53  ? 8.372   -16.532 0.419   1.00 0.00 ? 53  TYR A HE2  7  
ATOM 10966 H HH   . TYR A 1 53  ? 10.393  -19.141 1.442   1.00 0.00 ? 53  TYR A HH   7  
ATOM 10967 N N    . LYS A 1 54  ? 6.431   -17.823 6.766   1.00 0.00 ? 54  LYS A N    7  
ATOM 10968 C CA   . LYS A 1 54  ? 7.469   -18.524 7.513   1.00 0.00 ? 54  LYS A CA   7  
ATOM 10969 C C    . LYS A 1 54  ? 7.035   -19.949 7.841   1.00 0.00 ? 54  LYS A C    7  
ATOM 10970 O O    . LYS A 1 54  ? 5.898   -20.183 8.251   1.00 0.00 ? 54  LYS A O    7  
ATOM 10971 C CB   . LYS A 1 54  ? 7.794   -17.768 8.804   1.00 0.00 ? 54  LYS A CB   7  
ATOM 10972 C CG   . LYS A 1 54  ? 6.566   -17.392 9.614   1.00 0.00 ? 54  LYS A CG   7  
ATOM 10973 C CD   . LYS A 1 54  ? 6.917   -16.451 10.754  1.00 0.00 ? 54  LYS A CD   7  
ATOM 10974 C CE   . LYS A 1 54  ? 5.670   -15.851 11.386  1.00 0.00 ? 54  LYS A CE   7  
ATOM 10975 N NZ   . LYS A 1 54  ? 4.996   -14.886 10.474  1.00 0.00 ? 54  LYS A NZ   7  
ATOM 10976 H H    . LYS A 1 54  ? 5.491   -17.977 6.995   1.00 0.00 ? 54  LYS A H    7  
ATOM 10977 H HA   . LYS A 1 54  ? 8.354   -18.562 6.896   1.00 0.00 ? 54  LYS A HA   7  
ATOM 10978 H HB2  . LYS A 1 54  ? 8.429   -18.388 9.419   1.00 0.00 ? 54  LYS A HB2  7  
ATOM 10979 H HB3  . LYS A 1 54  ? 8.326   -16.862 8.552   1.00 0.00 ? 54  LYS A HB3  7  
ATOM 10980 H HG2  . LYS A 1 54  ? 5.854   -16.903 8.965   1.00 0.00 ? 54  LYS A HG2  7  
ATOM 10981 H HG3  . LYS A 1 54  ? 6.126   -18.290 10.023  1.00 0.00 ? 54  LYS A HG3  7  
ATOM 10982 H HD2  . LYS A 1 54  ? 7.460   -17.000 11.509  1.00 0.00 ? 54  LYS A HD2  7  
ATOM 10983 H HD3  . LYS A 1 54  ? 7.537   -15.652 10.373  1.00 0.00 ? 54  LYS A HD3  7  
ATOM 10984 H HE2  . LYS A 1 54  ? 4.984   -16.648 11.624  1.00 0.00 ? 54  LYS A HE2  7  
ATOM 10985 H HE3  . LYS A 1 54  ? 5.954   -15.337 12.293  1.00 0.00 ? 54  LYS A HE3  7  
ATOM 10986 H HZ1  . LYS A 1 54  ? 5.586   -14.716 9.634   1.00 0.00 ? 54  LYS A HZ1  7  
ATOM 10987 H HZ2  . LYS A 1 54  ? 4.840   -13.981 10.962  1.00 0.00 ? 54  LYS A HZ2  7  
ATOM 10988 H HZ3  . LYS A 1 54  ? 4.077   -15.266 10.168  1.00 0.00 ? 54  LYS A HZ3  7  
ATOM 10989 N N    . ASP A 1 55  ? 7.948   -20.897 7.659   1.00 0.00 ? 55  ASP A N    7  
ATOM 10990 C CA   . ASP A 1 55  ? 7.661   -22.299 7.939   1.00 0.00 ? 55  ASP A CA   7  
ATOM 10991 C C    . ASP A 1 55  ? 7.151   -22.475 9.365   1.00 0.00 ? 55  ASP A C    7  
ATOM 10992 O O    . ASP A 1 55  ? 7.919   -22.405 10.323  1.00 0.00 ? 55  ASP A O    7  
ATOM 10993 C CB   . ASP A 1 55  ? 8.912   -23.151 7.722   1.00 0.00 ? 55  ASP A CB   7  
ATOM 10994 C CG   . ASP A 1 55  ? 8.919   -24.399 8.583   1.00 0.00 ? 55  ASP A CG   7  
ATOM 10995 O OD1  . ASP A 1 55  ? 7.823   -24.908 8.899   1.00 0.00 ? 55  ASP A OD1  7  
ATOM 10996 O OD2  . ASP A 1 55  ? 10.020  -24.867 8.939   1.00 0.00 ? 55  ASP A OD2  7  
ATOM 10997 H H    . ASP A 1 55  ? 8.837   -20.647 7.330   1.00 0.00 ? 55  ASP A H    7  
ATOM 10998 H HA   . ASP A 1 55  ? 6.893   -22.623 7.253   1.00 0.00 ? 55  ASP A HA   7  
ATOM 10999 H HB2  . ASP A 1 55  ? 8.961   -23.451 6.685   1.00 0.00 ? 55  ASP A HB2  7  
ATOM 11000 H HB3  . ASP A 1 55  ? 9.786   -22.564 7.964   1.00 0.00 ? 55  ASP A HB3  7  
ATOM 11001 N N    . GLY A 1 56  ? 5.848   -22.704 9.499   1.00 0.00 ? 56  GLY A N    7  
ATOM 11002 C CA   . GLY A 1 56  ? 5.257   -22.886 10.812  1.00 0.00 ? 56  GLY A CA   7  
ATOM 11003 C C    . GLY A 1 56  ? 5.296   -21.620 11.645  1.00 0.00 ? 56  GLY A C    7  
ATOM 11004 O O    . GLY A 1 56  ? 5.347   -20.516 11.105  1.00 0.00 ? 56  GLY A O    7  
ATOM 11005 H H    . GLY A 1 56  ? 5.283   -22.750 8.699   1.00 0.00 ? 56  GLY A H    7  
ATOM 11006 H HA2  . GLY A 1 56  ? 4.229   -23.195 10.693  1.00 0.00 ? 56  GLY A HA2  7  
ATOM 11007 H HA3  . GLY A 1 56  ? 5.798   -23.662 11.333  1.00 0.00 ? 56  GLY A HA3  7  
ATOM 11008 N N    . GLU A 1 57  ? 5.269   -21.781 12.964  1.00 0.00 ? 57  GLU A N    7  
ATOM 11009 C CA   . GLU A 1 57  ? 5.299   -20.641 13.873  1.00 0.00 ? 57  GLU A CA   7  
ATOM 11010 C C    . GLU A 1 57  ? 6.732   -20.295 14.265  1.00 0.00 ? 57  GLU A C    7  
ATOM 11011 O O    . GLU A 1 57  ? 6.970   -19.360 15.031  1.00 0.00 ? 57  GLU A O    7  
ATOM 11012 C CB   . GLU A 1 57  ? 4.473   -20.938 15.127  1.00 0.00 ? 57  GLU A CB   7  
ATOM 11013 C CG   . GLU A 1 57  ? 4.966   -22.143 15.909  1.00 0.00 ? 57  GLU A CG   7  
ATOM 11014 C CD   . GLU A 1 57  ? 4.366   -23.445 15.414  1.00 0.00 ? 57  GLU A CD   7  
ATOM 11015 O OE1  . GLU A 1 57  ? 3.168   -23.451 15.062  1.00 0.00 ? 57  GLU A OE1  7  
ATOM 11016 O OE2  . GLU A 1 57  ? 5.096   -24.458 15.378  1.00 0.00 ? 57  GLU A OE2  7  
ATOM 11017 H H    . GLU A 1 57  ? 5.228   -22.687 13.335  1.00 0.00 ? 57  GLU A H    7  
ATOM 11018 H HA   . GLU A 1 57  ? 4.865   -19.796 13.359  1.00 0.00 ? 57  GLU A HA   7  
ATOM 11019 H HB2  . GLU A 1 57  ? 4.504   -20.075 15.776  1.00 0.00 ? 57  GLU A HB2  7  
ATOM 11020 H HB3  . GLU A 1 57  ? 3.450   -21.119 14.834  1.00 0.00 ? 57  GLU A HB3  7  
ATOM 11021 H HG2  . GLU A 1 57  ? 6.040   -22.202 15.816  1.00 0.00 ? 57  GLU A HG2  7  
ATOM 11022 H HG3  . GLU A 1 57  ? 4.703   -22.014 16.948  1.00 0.00 ? 57  GLU A HG3  7  
ATOM 11023 N N    . HIS A 1 58  ? 7.685   -21.055 13.734  1.00 0.00 ? 58  HIS A N    7  
ATOM 11024 C CA   . HIS A 1 58  ? 9.095   -20.829 14.028  1.00 0.00 ? 58  HIS A CA   7  
ATOM 11025 C C    . HIS A 1 58  ? 9.922   -20.817 12.745  1.00 0.00 ? 58  HIS A C    7  
ATOM 11026 O O    . HIS A 1 58  ? 11.105  -21.155 12.754  1.00 0.00 ? 58  HIS A O    7  
ATOM 11027 C CB   . HIS A 1 58  ? 9.620   -21.909 14.976  1.00 0.00 ? 58  HIS A CB   7  
ATOM 11028 C CG   . HIS A 1 58  ? 8.997   -21.864 16.337  1.00 0.00 ? 58  HIS A CG   7  
ATOM 11029 N ND1  . HIS A 1 58  ? 9.299   -20.895 17.271  1.00 0.00 ? 58  HIS A ND1  7  
ATOM 11030 C CD2  . HIS A 1 58  ? 8.084   -22.675 16.920  1.00 0.00 ? 58  HIS A CD2  7  
ATOM 11031 C CE1  . HIS A 1 58  ? 8.599   -21.113 18.370  1.00 0.00 ? 58  HIS A CE1  7  
ATOM 11032 N NE2  . HIS A 1 58  ? 7.853   -22.187 18.183  1.00 0.00 ? 58  HIS A NE2  7  
ATOM 11033 H H    . HIS A 1 58  ? 7.433   -21.784 13.130  1.00 0.00 ? 58  HIS A H    7  
ATOM 11034 H HA   . HIS A 1 58  ? 9.184   -19.867 14.508  1.00 0.00 ? 58  HIS A HA   7  
ATOM 11035 H HB2  . HIS A 1 58  ? 9.417   -22.881 14.551  1.00 0.00 ? 58  HIS A HB2  7  
ATOM 11036 H HB3  . HIS A 1 58  ? 10.687  -21.788 15.094  1.00 0.00 ? 58  HIS A HB3  7  
ATOM 11037 H HD1  . HIS A 1 58  ? 9.932   -20.158 17.147  1.00 0.00 ? 58  HIS A HD1  7  
ATOM 11038 H HD2  . HIS A 1 58  ? 7.622   -23.545 16.476  1.00 0.00 ? 58  HIS A HD2  7  
ATOM 11039 H HE1  . HIS A 1 58  ? 8.630   -20.515 19.268  1.00 0.00 ? 58  HIS A HE1  7  
ATOM 11040 H HE2  . HIS A 1 58  ? 7.303   -22.618 18.869  1.00 0.00 ? 58  HIS A HE2  7  
ATOM 11041 N N    . GLY A 1 59  ? 9.290   -20.425 11.643  1.00 0.00 ? 59  GLY A N    7  
ATOM 11042 C CA   . GLY A 1 59  ? 9.982   -20.377 10.369  1.00 0.00 ? 59  GLY A CA   7  
ATOM 11043 C C    . GLY A 1 59  ? 10.781  -19.101 10.191  1.00 0.00 ? 59  GLY A C    7  
ATOM 11044 O O    . GLY A 1 59  ? 11.253  -18.516 11.165  1.00 0.00 ? 59  GLY A O    7  
ATOM 11045 H H    . GLY A 1 59  ? 8.346   -20.167 11.696  1.00 0.00 ? 59  GLY A H    7  
ATOM 11046 H HA2  . GLY A 1 59  ? 10.652  -21.221 10.303  1.00 0.00 ? 59  GLY A HA2  7  
ATOM 11047 H HA3  . GLY A 1 59  ? 9.254   -20.445 9.574   1.00 0.00 ? 59  GLY A HA3  7  
ATOM 11048 N N    . GLU A 1 60  ? 10.935  -18.670 8.943   1.00 0.00 ? 60  GLU A N    7  
ATOM 11049 C CA   . GLU A 1 60  ? 11.685  -17.456 8.641   1.00 0.00 ? 60  GLU A CA   7  
ATOM 11050 C C    . GLU A 1 60  ? 10.842  -16.486 7.819   1.00 0.00 ? 60  GLU A C    7  
ATOM 11051 O O    . GLU A 1 60  ? 10.428  -16.799 6.704   1.00 0.00 ? 60  GLU A O    7  
ATOM 11052 C CB   . GLU A 1 60  ? 12.971  -17.799 7.886   1.00 0.00 ? 60  GLU A CB   7  
ATOM 11053 C CG   . GLU A 1 60  ? 13.970  -18.590 8.713   1.00 0.00 ? 60  GLU A CG   7  
ATOM 11054 C CD   . GLU A 1 60  ? 14.911  -19.417 7.857   1.00 0.00 ? 60  GLU A CD   7  
ATOM 11055 O OE1  . GLU A 1 60  ? 14.473  -20.462 7.333   1.00 0.00 ? 60  GLU A OE1  7  
ATOM 11056 O OE2  . GLU A 1 60  ? 16.085  -19.018 7.712   1.00 0.00 ? 60  GLU A OE2  7  
ATOM 11057 H H    . GLU A 1 60  ? 10.535  -19.180 8.208   1.00 0.00 ? 60  GLU A H    7  
ATOM 11058 H HA   . GLU A 1 60  ? 11.944  -16.985 9.578   1.00 0.00 ? 60  GLU A HA   7  
ATOM 11059 H HB2  . GLU A 1 60  ? 12.716  -18.381 7.012   1.00 0.00 ? 60  GLU A HB2  7  
ATOM 11060 H HB3  . GLU A 1 60  ? 13.444  -16.881 7.570   1.00 0.00 ? 60  GLU A HB3  7  
ATOM 11061 H HG2  . GLU A 1 60  ? 14.556  -17.901 9.302   1.00 0.00 ? 60  GLU A HG2  7  
ATOM 11062 H HG3  . GLU A 1 60  ? 13.428  -19.254 9.371   1.00 0.00 ? 60  GLU A HG3  7  
ATOM 11063 N N    . GLU A 1 61  ? 10.593  -15.306 8.380   1.00 0.00 ? 61  GLU A N    7  
ATOM 11064 C CA   . GLU A 1 61  ? 9.798   -14.291 7.699   1.00 0.00 ? 61  GLU A CA   7  
ATOM 11065 C C    . GLU A 1 61  ? 10.442  -13.895 6.373   1.00 0.00 ? 61  GLU A C    7  
ATOM 11066 O O    . GLU A 1 61  ? 11.524  -13.310 6.348   1.00 0.00 ? 61  GLU A O    7  
ATOM 11067 C CB   . GLU A 1 61  ? 9.637   -13.056 8.589   1.00 0.00 ? 61  GLU A CB   7  
ATOM 11068 C CG   . GLU A 1 61  ? 8.669   -13.260 9.742   1.00 0.00 ? 61  GLU A CG   7  
ATOM 11069 C CD   . GLU A 1 61  ? 8.603   -12.060 10.667  1.00 0.00 ? 61  GLU A CD   7  
ATOM 11070 O OE1  . GLU A 1 61  ? 8.398   -10.935 10.167  1.00 0.00 ? 61  GLU A OE1  7  
ATOM 11071 O OE2  . GLU A 1 61  ? 8.757   -12.247 11.892  1.00 0.00 ? 61  GLU A OE2  7  
ATOM 11072 H H    . GLU A 1 61  ? 10.950  -15.115 9.272   1.00 0.00 ? 61  GLU A H    7  
ATOM 11073 H HA   . GLU A 1 61  ? 8.823   -14.710 7.501   1.00 0.00 ? 61  GLU A HA   7  
ATOM 11074 H HB2  . GLU A 1 61  ? 10.602  -12.793 8.997   1.00 0.00 ? 61  GLU A HB2  7  
ATOM 11075 H HB3  . GLU A 1 61  ? 9.277   -12.237 7.984   1.00 0.00 ? 61  GLU A HB3  7  
ATOM 11076 H HG2  . GLU A 1 61  ? 7.683   -13.439 9.340   1.00 0.00 ? 61  GLU A HG2  7  
ATOM 11077 H HG3  . GLU A 1 61  ? 8.985   -14.120 10.314  1.00 0.00 ? 61  GLU A HG3  7  
ATOM 11078 N N    . GLN A 1 62  ? 9.767   -14.219 5.275   1.00 0.00 ? 62  GLN A N    7  
ATOM 11079 C CA   . GLN A 1 62  ? 10.274  -13.899 3.945   1.00 0.00 ? 62  GLN A CA   7  
ATOM 11080 C C    . GLN A 1 62  ? 9.251   -13.091 3.153   1.00 0.00 ? 62  GLN A C    7  
ATOM 11081 O O    . GLN A 1 62  ? 8.064   -13.417 3.141   1.00 0.00 ? 62  GLN A O    7  
ATOM 11082 C CB   . GLN A 1 62  ? 10.627  -15.180 3.188   1.00 0.00 ? 62  GLN A CB   7  
ATOM 11083 C CG   . GLN A 1 62  ? 11.762  -15.968 3.822   1.00 0.00 ? 62  GLN A CG   7  
ATOM 11084 C CD   . GLN A 1 62  ? 13.109  -15.295 3.646   1.00 0.00 ? 62  GLN A CD   7  
ATOM 11085 O OE1  . GLN A 1 62  ? 13.693  -15.322 2.562   1.00 0.00 ? 62  GLN A OE1  7  
ATOM 11086 N NE2  . GLN A 1 62  ? 13.610  -14.685 4.714   1.00 0.00 ? 62  GLN A NE2  7  
ATOM 11087 H H    . GLN A 1 62  ? 8.910   -14.685 5.360   1.00 0.00 ? 62  GLN A H    7  
ATOM 11088 H HA   . GLN A 1 62  ? 11.167  -13.305 4.066   1.00 0.00 ? 62  GLN A HA   7  
ATOM 11089 H HB2  . GLN A 1 62  ? 9.754   -15.814 3.151   1.00 0.00 ? 62  GLN A HB2  7  
ATOM 11090 H HB3  . GLN A 1 62  ? 10.916  -14.921 2.181   1.00 0.00 ? 62  GLN A HB3  7  
ATOM 11091 H HG2  . GLN A 1 62  ? 11.565  -16.073 4.878   1.00 0.00 ? 62  GLN A HG2  7  
ATOM 11092 H HG3  . GLN A 1 62  ? 11.803  -16.946 3.366   1.00 0.00 ? 62  GLN A HG3  7  
ATOM 11093 H HE21 . GLN A 1 62  ? 13.089  -14.705 5.545   1.00 0.00 ? 62  GLN A HE21 7  
ATOM 11094 H HE22 . GLN A 1 62  ? 14.479  -14.242 4.629   1.00 0.00 ? 62  GLN A HE22 7  
ATOM 11095 N N    . ARG A 1 63  ? 9.720   -12.037 2.493   1.00 0.00 ? 63  ARG A N    7  
ATOM 11096 C CA   . ARG A 1 63  ? 8.845   -11.182 1.699   1.00 0.00 ? 63  ARG A CA   7  
ATOM 11097 C C    . ARG A 1 63  ? 8.974   -11.502 0.213   1.00 0.00 ? 63  ARG A C    7  
ATOM 11098 O O    . ARG A 1 63  ? 10.078  -11.527 -0.333  1.00 0.00 ? 63  ARG A O    7  
ATOM 11099 C CB   . ARG A 1 63  ? 9.176   -9.709  1.945   1.00 0.00 ? 63  ARG A CB   7  
ATOM 11100 C CG   . ARG A 1 63  ? 8.743   -9.208  3.313   1.00 0.00 ? 63  ARG A CG   7  
ATOM 11101 C CD   . ARG A 1 63  ? 9.826   -9.430  4.357   1.00 0.00 ? 63  ARG A CD   7  
ATOM 11102 N NE   . ARG A 1 63  ? 9.639   -8.581  5.530   1.00 0.00 ? 63  ARG A NE   7  
ATOM 11103 C CZ   . ARG A 1 63  ? 9.847   -7.269  5.529   1.00 0.00 ? 63  ARG A CZ   7  
ATOM 11104 N NH1  . ARG A 1 63  ? 10.248  -6.659  4.421   1.00 0.00 ? 63  ARG A NH1  7  
ATOM 11105 N NH2  . ARG A 1 63  ? 9.655   -6.564  6.636   1.00 0.00 ? 63  ARG A NH2  7  
ATOM 11106 H H    . ARG A 1 63  ? 10.676  -11.829 2.541   1.00 0.00 ? 63  ARG A H    7  
ATOM 11107 H HA   . ARG A 1 63  ? 7.828   -11.370 2.009   1.00 0.00 ? 63  ARG A HA   7  
ATOM 11108 H HB2  . ARG A 1 63  ? 10.244  -9.573  1.858   1.00 0.00 ? 63  ARG A HB2  7  
ATOM 11109 H HB3  . ARG A 1 63  ? 8.683   -9.111  1.194   1.00 0.00 ? 63  ARG A HB3  7  
ATOM 11110 H HG2  . ARG A 1 63  ? 8.533   -8.150  3.249   1.00 0.00 ? 63  ARG A HG2  7  
ATOM 11111 H HG3  . ARG A 1 63  ? 7.851   -9.736  3.614   1.00 0.00 ? 63  ARG A HG3  7  
ATOM 11112 H HD2  . ARG A 1 63  ? 9.803   -10.465 4.666   1.00 0.00 ? 63  ARG A HD2  7  
ATOM 11113 H HD3  . ARG A 1 63  ? 10.786  -9.209  3.913   1.00 0.00 ? 63  ARG A HD3  7  
ATOM 11114 H HE   . ARG A 1 63  ? 9.344   -9.011  6.359   1.00 0.00 ? 63  ARG A HE   7  
ATOM 11115 H HH11 . ARG A 1 63  ? 10.392  -7.188  3.585   1.00 0.00 ? 63  ARG A HH11 7  
ATOM 11116 H HH12 . ARG A 1 63  ? 10.403  -5.671  4.422   1.00 0.00 ? 63  ARG A HH12 7  
ATOM 11117 H HH21 . ARG A 1 63  ? 9.353   -7.020  7.473   1.00 0.00 ? 63  ARG A HH21 7  
ATOM 11118 H HH22 . ARG A 1 63  ? 9.812   -5.577  6.634   1.00 0.00 ? 63  ARG A HH22 7  
ATOM 11119 N N    . ILE A 1 64  ? 7.841   -11.747 -0.435  1.00 0.00 ? 64  ILE A N    7  
ATOM 11120 C CA   . ILE A 1 64  ? 7.828   -12.065 -1.857  1.00 0.00 ? 64  ILE A CA   7  
ATOM 11121 C C    . ILE A 1 64  ? 7.322   -10.885 -2.680  1.00 0.00 ? 64  ILE A C    7  
ATOM 11122 O O    . ILE A 1 64  ? 6.464   -10.123 -2.232  1.00 0.00 ? 64  ILE A O    7  
ATOM 11123 C CB   . ILE A 1 64  ? 6.949   -13.295 -2.151  1.00 0.00 ? 64  ILE A CB   7  
ATOM 11124 C CG1  . ILE A 1 64  ? 7.394   -14.483 -1.296  1.00 0.00 ? 64  ILE A CG1  7  
ATOM 11125 C CG2  . ILE A 1 64  ? 7.009   -13.648 -3.630  1.00 0.00 ? 64  ILE A CG2  7  
ATOM 11126 C CD1  . ILE A 1 64  ? 6.568   -15.731 -1.518  1.00 0.00 ? 64  ILE A CD1  7  
ATOM 11127 H H    . ILE A 1 64  ? 6.993   -11.712 0.055   1.00 0.00 ? 64  ILE A H    7  
ATOM 11128 H HA   . ILE A 1 64  ? 8.841   -12.291 -2.157  1.00 0.00 ? 64  ILE A HA   7  
ATOM 11129 H HB   . ILE A 1 64  ? 5.928   -13.047 -1.906  1.00 0.00 ? 64  ILE A HB   7  
ATOM 11130 H HG12 . ILE A 1 64  ? 8.420   -14.721 -1.528  1.00 0.00 ? 64  ILE A HG12 7  
ATOM 11131 H HG13 . ILE A 1 64  ? 7.318   -14.215 -0.253  1.00 0.00 ? 64  ILE A HG13 7  
ATOM 11132 H HG21 . ILE A 1 64  ? 8.021   -13.914 -3.896  1.00 0.00 ? 64  ILE A HG21 7  
ATOM 11133 H HG22 . ILE A 1 64  ? 6.355   -14.484 -3.827  1.00 0.00 ? 64  ILE A HG22 7  
ATOM 11134 H HG23 . ILE A 1 64  ? 6.694   -12.797 -4.216  1.00 0.00 ? 64  ILE A HG23 7  
ATOM 11135 H HD11 . ILE A 1 64  ? 7.180   -16.491 -1.980  1.00 0.00 ? 64  ILE A HD11 7  
ATOM 11136 H HD12 . ILE A 1 64  ? 6.198   -16.091 -0.570  1.00 0.00 ? 64  ILE A HD12 7  
ATOM 11137 H HD13 . ILE A 1 64  ? 5.734   -15.499 -2.165  1.00 0.00 ? 64  ILE A HD13 7  
ATOM 11138 N N    . THR A 1 65  ? 7.859   -10.739 -3.888  1.00 0.00 ? 65  THR A N    7  
ATOM 11139 C CA   . THR A 1 65  ? 7.462   -9.652  -4.774  1.00 0.00 ? 65  THR A CA   7  
ATOM 11140 C C    . THR A 1 65  ? 6.202   -10.010 -5.554  1.00 0.00 ? 65  THR A C    7  
ATOM 11141 O O    . THR A 1 65  ? 6.276   -10.601 -6.632  1.00 0.00 ? 65  THR A O    7  
ATOM 11142 C CB   . THR A 1 65  ? 8.585   -9.299  -5.768  1.00 0.00 ? 65  THR A CB   7  
ATOM 11143 O OG1  . THR A 1 65  ? 9.813   -9.086  -5.064  1.00 0.00 ? 65  THR A OG1  7  
ATOM 11144 C CG2  . THR A 1 65  ? 8.229   -8.055  -6.567  1.00 0.00 ? 65  THR A CG2  7  
ATOM 11145 H H    . THR A 1 65  ? 8.538   -11.378 -4.188  1.00 0.00 ? 65  THR A H    7  
ATOM 11146 H HA   . THR A 1 65  ? 7.262   -8.782  -4.166  1.00 0.00 ? 65  THR A HA   7  
ATOM 11147 H HB   . THR A 1 65  ? 8.710   -10.126 -6.453  1.00 0.00 ? 65  THR A HB   7  
ATOM 11148 H HG1  . THR A 1 65  ? 10.553  -9.293  -5.640  1.00 0.00 ? 65  THR A HG1  7  
ATOM 11149 H HG21 . THR A 1 65  ? 8.852   -8.002  -7.448  1.00 0.00 ? 65  THR A HG21 7  
ATOM 11150 H HG22 . THR A 1 65  ? 8.391   -7.178  -5.958  1.00 0.00 ? 65  THR A HG22 7  
ATOM 11151 H HG23 . THR A 1 65  ? 7.192   -8.102  -6.862  1.00 0.00 ? 65  THR A HG23 7  
ATOM 11152 N N    . ILE A 1 66  ? 5.048   -9.649  -5.003  1.00 0.00 ? 66  ILE A N    7  
ATOM 11153 C CA   . ILE A 1 66  ? 3.773   -9.932  -5.649  1.00 0.00 ? 66  ILE A CA   7  
ATOM 11154 C C    . ILE A 1 66  ? 3.317   -8.755  -6.505  1.00 0.00 ? 66  ILE A C    7  
ATOM 11155 O O    . ILE A 1 66  ? 3.570   -7.598  -6.171  1.00 0.00 ? 66  ILE A O    7  
ATOM 11156 C CB   . ILE A 1 66  ? 2.677   -10.254 -4.615  1.00 0.00 ? 66  ILE A CB   7  
ATOM 11157 C CG1  . ILE A 1 66  ? 3.288   -10.934 -3.388  1.00 0.00 ? 66  ILE A CG1  7  
ATOM 11158 C CG2  . ILE A 1 66  ? 1.604   -11.135 -5.237  1.00 0.00 ? 66  ILE A CG2  7  
ATOM 11159 C CD1  . ILE A 1 66  ? 2.267   -11.319 -2.340  1.00 0.00 ? 66  ILE A CD1  7  
ATOM 11160 H H    . ILE A 1 66  ? 5.055   -9.181  -4.142  1.00 0.00 ? 66  ILE A H    7  
ATOM 11161 H HA   . ILE A 1 66  ? 3.905   -10.796 -6.284  1.00 0.00 ? 66  ILE A HA   7  
ATOM 11162 H HB   . ILE A 1 66  ? 2.216   -9.326  -4.312  1.00 0.00 ? 66  ILE A HB   7  
ATOM 11163 H HG12 . ILE A 1 66  ? 3.799   -11.832 -3.698  1.00 0.00 ? 66  ILE A HG12 7  
ATOM 11164 H HG13 . ILE A 1 66  ? 3.998   -10.261 -2.929  1.00 0.00 ? 66  ILE A HG13 7  
ATOM 11165 H HG21 . ILE A 1 66  ? 0.647   -10.903 -4.795  1.00 0.00 ? 66  ILE A HG21 7  
ATOM 11166 H HG22 . ILE A 1 66  ? 1.562   -10.954 -6.300  1.00 0.00 ? 66  ILE A HG22 7  
ATOM 11167 H HG23 . ILE A 1 66  ? 1.842   -12.173 -5.057  1.00 0.00 ? 66  ILE A HG23 7  
ATOM 11168 H HD11 . ILE A 1 66  ? 1.272   -11.163 -2.731  1.00 0.00 ? 66  ILE A HD11 7  
ATOM 11169 H HD12 . ILE A 1 66  ? 2.393   -12.359 -2.079  1.00 0.00 ? 66  ILE A HD12 7  
ATOM 11170 H HD13 . ILE A 1 66  ? 2.406   -10.708 -1.460  1.00 0.00 ? 66  ILE A HD13 7  
ATOM 11171 N N    . GLU A 1 67  ? 2.644   -9.060  -7.610  1.00 0.00 ? 67  GLU A N    7  
ATOM 11172 C CA   . GLU A 1 67  ? 2.152   -8.026  -8.514  1.00 0.00 ? 67  GLU A CA   7  
ATOM 11173 C C    . GLU A 1 67  ? 0.962   -7.291  -7.903  1.00 0.00 ? 67  GLU A C    7  
ATOM 11174 O O    . GLU A 1 67  ? 0.131   -7.873  -7.207  1.00 0.00 ? 67  GLU A O    7  
ATOM 11175 C CB   . GLU A 1 67  ? 1.752   -8.641  -9.857  1.00 0.00 ? 67  GLU A CB   7  
ATOM 11176 C CG   . GLU A 1 67  ? 2.908   -9.294  -10.596 1.00 0.00 ? 67  GLU A CG   7  
ATOM 11177 C CD   . GLU A 1 67  ? 3.157   -10.720 -10.145 1.00 0.00 ? 67  GLU A CD   7  
ATOM 11178 O OE1  . GLU A 1 67  ? 2.182   -11.400 -9.762  1.00 0.00 ? 67  GLU A OE1  7  
ATOM 11179 O OE2  . GLU A 1 67  ? 4.327   -11.156 -10.174 1.00 0.00 ? 67  GLU A OE2  7  
ATOM 11180 H H    . GLU A 1 67  ? 2.473   -10.001 -7.822  1.00 0.00 ? 67  GLU A H    7  
ATOM 11181 H HA   . GLU A 1 67  ? 2.952   -7.320  -8.676  1.00 0.00 ? 67  GLU A HA   7  
ATOM 11182 H HB2  . GLU A 1 67  ? 0.992   -9.389  -9.685  1.00 0.00 ? 67  GLU A HB2  7  
ATOM 11183 H HB3  . GLU A 1 67  ? 1.343   -7.864  -10.486 1.00 0.00 ? 67  GLU A HB3  7  
ATOM 11184 H HG2  . GLU A 1 67  ? 2.685   -9.301  -11.652 1.00 0.00 ? 67  GLU A HG2  7  
ATOM 11185 H HG3  . GLU A 1 67  ? 3.803   -8.715  -10.422 1.00 0.00 ? 67  GLU A HG3  7  
ATOM 11186 N N    . PRO A 1 68  ? 0.878   -5.979  -8.170  1.00 0.00 ? 68  PRO A N    7  
ATOM 11187 C CA   . PRO A 1 68  ? -0.205  -5.135  -7.658  1.00 0.00 ? 68  PRO A CA   7  
ATOM 11188 C C    . PRO A 1 68  ? -1.546  -5.453  -8.310  1.00 0.00 ? 68  PRO A C    7  
ATOM 11189 O O    . PRO A 1 68  ? -1.973  -4.770  -9.239  1.00 0.00 ? 68  PRO A O    7  
ATOM 11190 C CB   . PRO A 1 68  ? 0.245   -3.719  -8.025  1.00 0.00 ? 68  PRO A CB   7  
ATOM 11191 C CG   . PRO A 1 68  ? 1.144   -3.899  -9.199  1.00 0.00 ? 68  PRO A CG   7  
ATOM 11192 C CD   . PRO A 1 68  ? 1.834   -5.219  -8.994  1.00 0.00 ? 68  PRO A CD   7  
ATOM 11193 H HA   . PRO A 1 68  ? -0.299  -5.218  -6.585  1.00 0.00 ? 68  PRO A HA   7  
ATOM 11194 H HB2  . PRO A 1 68  ? -0.618  -3.118  -8.275  1.00 0.00 ? 68  PRO A HB2  7  
ATOM 11195 H HB3  . PRO A 1 68  ? 0.769   -3.276  -7.191  1.00 0.00 ? 68  PRO A HB3  7  
ATOM 11196 H HG2  . PRO A 1 68  ? 0.561   -3.918  -10.108 1.00 0.00 ? 68  PRO A HG2  7  
ATOM 11197 H HG3  . PRO A 1 68  ? 1.868   -3.099  -9.233  1.00 0.00 ? 68  PRO A HG3  7  
ATOM 11198 H HD2  . PRO A 1 68  ? 2.001   -5.709  -9.941  1.00 0.00 ? 68  PRO A HD2  7  
ATOM 11199 H HD3  . PRO A 1 68  ? 2.768   -5.079  -8.469  1.00 0.00 ? 68  PRO A HD3  7  
ATOM 11200 N N    . GLY A 1 69  ? -2.207  -6.496  -7.815  1.00 0.00 ? 69  GLY A N    7  
ATOM 11201 C CA   . GLY A 1 69  ? -3.493  -6.886  -8.362  1.00 0.00 ? 69  GLY A CA   7  
ATOM 11202 C C    . GLY A 1 69  ? -4.527  -7.146  -7.284  1.00 0.00 ? 69  GLY A C    7  
ATOM 11203 O O    . GLY A 1 69  ? -4.699  -6.339  -6.370  1.00 0.00 ? 69  GLY A O    7  
ATOM 11204 H H    . GLY A 1 69  ? -1.817  -7.004  -7.073  1.00 0.00 ? 69  GLY A H    7  
ATOM 11205 H HA2  . GLY A 1 69  ? -3.852  -6.098  -9.007  1.00 0.00 ? 69  GLY A HA2  7  
ATOM 11206 H HA3  . GLY A 1 69  ? -3.365  -7.786  -8.946  1.00 0.00 ? 69  GLY A HA3  7  
ATOM 11207 N N    . THR A 1 70  ? -5.219  -8.276  -7.390  1.00 0.00 ? 70  THR A N    7  
ATOM 11208 C CA   . THR A 1 70  ? -6.243  -8.640  -6.419  1.00 0.00 ? 70  THR A CA   7  
ATOM 11209 C C    . THR A 1 70  ? -5.965  -10.011 -5.813  1.00 0.00 ? 70  THR A C    7  
ATOM 11210 O O    . THR A 1 70  ? -6.234  -10.246 -4.635  1.00 0.00 ? 70  THR A O    7  
ATOM 11211 C CB   . THR A 1 70  ? -7.645  -8.648  -7.057  1.00 0.00 ? 70  THR A CB   7  
ATOM 11212 O OG1  . THR A 1 70  ? -7.626  -9.404  -8.273  1.00 0.00 ? 70  THR A OG1  7  
ATOM 11213 C CG2  . THR A 1 70  ? -8.117  -7.230  -7.343  1.00 0.00 ? 70  THR A CG2  7  
ATOM 11214 H H    . THR A 1 70  ? -5.036  -8.879  -8.141  1.00 0.00 ? 70  THR A H    7  
ATOM 11215 H HA   . THR A 1 70  ? -6.233  -7.900  -5.631  1.00 0.00 ? 70  THR A HA   7  
ATOM 11216 H HB   . THR A 1 70  ? -8.336  -9.109  -6.366  1.00 0.00 ? 70  THR A HB   7  
ATOM 11217 H HG1  . THR A 1 70  ? -6.830  -9.193  -8.768  1.00 0.00 ? 70  THR A HG1  7  
ATOM 11218 H HG21 . THR A 1 70  ? -8.648  -6.847  -6.483  1.00 0.00 ? 70  THR A HG21 7  
ATOM 11219 H HG22 . THR A 1 70  ? -8.775  -7.236  -8.199  1.00 0.00 ? 70  THR A HG22 7  
ATOM 11220 H HG23 . THR A 1 70  ? -7.264  -6.601  -7.548  1.00 0.00 ? 70  THR A HG23 7  
ATOM 11221 N N    . SER A 1 71  ? -5.424  -10.913 -6.626  1.00 0.00 ? 71  SER A N    7  
ATOM 11222 C CA   . SER A 1 71  ? -5.112  -12.262 -6.171  1.00 0.00 ? 71  SER A CA   7  
ATOM 11223 C C    . SER A 1 71  ? -3.766  -12.724 -6.721  1.00 0.00 ? 71  SER A C    7  
ATOM 11224 O O    . SER A 1 71  ? -3.281  -12.201 -7.725  1.00 0.00 ? 71  SER A O    7  
ATOM 11225 C CB   . SER A 1 71  ? -6.212  -13.235 -6.600  1.00 0.00 ? 71  SER A CB   7  
ATOM 11226 O OG   . SER A 1 71  ? -7.480  -12.808 -6.135  1.00 0.00 ? 71  SER A OG   7  
ATOM 11227 H H    . SER A 1 71  ? -5.232  -10.665 -7.555  1.00 0.00 ? 71  SER A H    7  
ATOM 11228 H HA   . SER A 1 71  ? -5.059  -12.244 -5.092  1.00 0.00 ? 71  SER A HA   7  
ATOM 11229 H HB2  . SER A 1 71  ? -6.238  -13.293 -7.677  1.00 0.00 ? 71  SER A HB2  7  
ATOM 11230 H HB3  . SER A 1 71  ? -6.002  -14.213 -6.192  1.00 0.00 ? 71  SER A HB3  7  
ATOM 11231 H HG   . SER A 1 71  ? -7.485  -12.804 -5.175  1.00 0.00 ? 71  SER A HG   7  
ATOM 11232 N N    . TYR A 1 72  ? -3.168  -13.707 -6.057  1.00 0.00 ? 72  TYR A N    7  
ATOM 11233 C CA   . TYR A 1 72  ? -1.877  -14.239 -6.477  1.00 0.00 ? 72  TYR A CA   7  
ATOM 11234 C C    . TYR A 1 72  ? -1.822  -15.751 -6.286  1.00 0.00 ? 72  TYR A C    7  
ATOM 11235 O O    . TYR A 1 72  ? -2.686  -16.337 -5.634  1.00 0.00 ? 72  TYR A O    7  
ATOM 11236 C CB   . TYR A 1 72  ? -0.747  -13.573 -5.690  1.00 0.00 ? 72  TYR A CB   7  
ATOM 11237 C CG   . TYR A 1 72  ? 0.593   -14.250 -5.864  1.00 0.00 ? 72  TYR A CG   7  
ATOM 11238 C CD1  . TYR A 1 72  ? 1.363   -14.029 -6.999  1.00 0.00 ? 72  TYR A CD1  7  
ATOM 11239 C CD2  . TYR A 1 72  ? 1.090   -15.111 -4.893  1.00 0.00 ? 72  TYR A CD2  7  
ATOM 11240 C CE1  . TYR A 1 72  ? 2.588   -14.647 -7.163  1.00 0.00 ? 72  TYR A CE1  7  
ATOM 11241 C CE2  . TYR A 1 72  ? 2.314   -15.731 -5.048  1.00 0.00 ? 72  TYR A CE2  7  
ATOM 11242 C CZ   . TYR A 1 72  ? 3.059   -15.497 -6.184  1.00 0.00 ? 72  TYR A CZ   7  
ATOM 11243 O OH   . TYR A 1 72  ? 4.280   -16.113 -6.343  1.00 0.00 ? 72  TYR A OH   7  
ATOM 11244 H H    . TYR A 1 72  ? -3.605  -14.083 -5.265  1.00 0.00 ? 72  TYR A H    7  
ATOM 11245 H HA   . TYR A 1 72  ? -1.752  -14.015 -7.527  1.00 0.00 ? 72  TYR A HA   7  
ATOM 11246 H HB2  . TYR A 1 72  ? -0.646  -12.549 -6.016  1.00 0.00 ? 72  TYR A HB2  7  
ATOM 11247 H HB3  . TYR A 1 72  ? -0.993  -13.588 -4.638  1.00 0.00 ? 72  TYR A HB3  7  
ATOM 11248 H HD1  . TYR A 1 72  ? 0.991   -13.362 -7.764  1.00 0.00 ? 72  TYR A HD1  7  
ATOM 11249 H HD2  . TYR A 1 72  ? 0.504   -15.293 -4.004  1.00 0.00 ? 72  TYR A HD2  7  
ATOM 11250 H HE1  . TYR A 1 72  ? 3.172   -14.462 -8.053  1.00 0.00 ? 72  TYR A HE1  7  
ATOM 11251 H HE2  . TYR A 1 72  ? 2.684   -16.397 -4.282  1.00 0.00 ? 72  TYR A HE2  7  
ATOM 11252 H HH   . TYR A 1 72  ? 4.961   -15.447 -6.460  1.00 0.00 ? 72  TYR A HH   7  
ATOM 11253 N N    . ARG A 1 73  ? -0.800  -16.377 -6.860  1.00 0.00 ? 73  ARG A N    7  
ATOM 11254 C CA   . ARG A 1 73  ? -0.631  -17.821 -6.754  1.00 0.00 ? 73  ARG A CA   7  
ATOM 11255 C C    . ARG A 1 73  ? 0.765   -18.170 -6.247  1.00 0.00 ? 73  ARG A C    7  
ATOM 11256 O O    . ARG A 1 73  ? 1.760   -17.966 -6.945  1.00 0.00 ? 73  ARG A O    7  
ATOM 11257 C CB   . ARG A 1 73  ? -0.873  -18.485 -8.111  1.00 0.00 ? 73  ARG A CB   7  
ATOM 11258 C CG   . ARG A 1 73  ? -1.106  -19.984 -8.022  1.00 0.00 ? 73  ARG A CG   7  
ATOM 11259 C CD   . ARG A 1 73  ? -1.966  -20.483 -9.172  1.00 0.00 ? 73  ARG A CD   7  
ATOM 11260 N NE   . ARG A 1 73  ? -1.863  -21.930 -9.346  1.00 0.00 ? 73  ARG A NE   7  
ATOM 11261 C CZ   . ARG A 1 73  ? -2.414  -22.590 -10.358 1.00 0.00 ? 73  ARG A CZ   7  
ATOM 11262 N NH1  . ARG A 1 73  ? -3.104  -21.936 -11.283 1.00 0.00 ? 73  ARG A NH1  7  
ATOM 11263 N NH2  . ARG A 1 73  ? -2.276  -23.907 -10.447 1.00 0.00 ? 73  ARG A NH2  7  
ATOM 11264 H H    . ARG A 1 73  ? -0.143  -15.855 -7.367  1.00 0.00 ? 73  ARG A H    7  
ATOM 11265 H HA   . ARG A 1 73  ? -1.360  -18.189 -6.048  1.00 0.00 ? 73  ARG A HA   7  
ATOM 11266 H HB2  . ARG A 1 73  ? -1.741  -18.035 -8.569  1.00 0.00 ? 73  ARG A HB2  7  
ATOM 11267 H HB3  . ARG A 1 73  ? -0.014  -18.313 -8.741  1.00 0.00 ? 73  ARG A HB3  7  
ATOM 11268 H HG2  . ARG A 1 73  ? -0.152  -20.490 -8.055  1.00 0.00 ? 73  ARG A HG2  7  
ATOM 11269 H HG3  . ARG A 1 73  ? -1.602  -20.208 -7.089  1.00 0.00 ? 73  ARG A HG3  7  
ATOM 11270 H HD2  . ARG A 1 73  ? -2.996  -20.228 -8.972  1.00 0.00 ? 73  ARG A HD2  7  
ATOM 11271 H HD3  . ARG A 1 73  ? -1.645  -19.997 -10.081 1.00 0.00 ? 73  ARG A HD3  7  
ATOM 11272 H HE   . ARG A 1 73  ? -1.358  -22.433 -8.674  1.00 0.00 ? 73  ARG A HE   7  
ATOM 11273 H HH11 . ARG A 1 73  ? -3.209  -20.944 -11.219 1.00 0.00 ? 73  ARG A HH11 7  
ATOM 11274 H HH12 . ARG A 1 73  ? -3.517  -22.436 -12.045 1.00 0.00 ? 73  ARG A HH12 7  
ATOM 11275 H HH21 . ARG A 1 73  ? -1.757  -24.403 -9.752  1.00 0.00 ? 73  ARG A HH21 7  
ATOM 11276 H HH22 . ARG A 1 73  ? -2.691  -24.402 -11.209 1.00 0.00 ? 73  ARG A HH22 7  
ATOM 11277 N N    . LEU A 1 74  ? 0.832   -18.695 -5.029  1.00 0.00 ? 74  LEU A N    7  
ATOM 11278 C CA   . LEU A 1 74  ? 2.107   -19.072 -4.427  1.00 0.00 ? 74  LEU A CA   7  
ATOM 11279 C C    . LEU A 1 74  ? 2.377   -20.562 -4.611  1.00 0.00 ? 74  LEU A C    7  
ATOM 11280 O O    . LEU A 1 74  ? 1.599   -21.402 -4.160  1.00 0.00 ? 74  LEU A O    7  
ATOM 11281 C CB   . LEU A 1 74  ? 2.114   -18.720 -2.938  1.00 0.00 ? 74  LEU A CB   7  
ATOM 11282 C CG   . LEU A 1 74  ? 3.387   -19.079 -2.170  1.00 0.00 ? 74  LEU A CG   7  
ATOM 11283 C CD1  . LEU A 1 74  ? 4.581   -18.323 -2.732  1.00 0.00 ? 74  LEU A CD1  7  
ATOM 11284 C CD2  . LEU A 1 74  ? 3.216   -18.784 -0.687  1.00 0.00 ? 74  LEU A CD2  7  
ATOM 11285 H H    . LEU A 1 74  ? 0.006   -18.833 -4.521  1.00 0.00 ? 74  LEU A H    7  
ATOM 11286 H HA   . LEU A 1 74  ? 2.886   -18.513 -4.925  1.00 0.00 ? 74  LEU A HA   7  
ATOM 11287 H HB2  . LEU A 1 74  ? 1.964   -17.655 -2.849  1.00 0.00 ? 74  LEU A HB2  7  
ATOM 11288 H HB3  . LEU A 1 74  ? 1.288   -19.239 -2.473  1.00 0.00 ? 74  LEU A HB3  7  
ATOM 11289 H HG   . LEU A 1 74  ? 3.581   -20.137 -2.282  1.00 0.00 ? 74  LEU A HG   7  
ATOM 11290 H HD11 . LEU A 1 74  ? 5.048   -18.911 -3.507  1.00 0.00 ? 74  LEU A HD11 7  
ATOM 11291 H HD12 . LEU A 1 74  ? 5.294   -18.137 -1.942  1.00 0.00 ? 74  LEU A HD12 7  
ATOM 11292 H HD13 . LEU A 1 74  ? 4.249   -17.381 -3.145  1.00 0.00 ? 74  LEU A HD13 7  
ATOM 11293 H HD21 . LEU A 1 74  ? 2.209   -18.439 -0.503  1.00 0.00 ? 74  LEU A HD21 7  
ATOM 11294 H HD22 . LEU A 1 74  ? 3.919   -18.019 -0.390  1.00 0.00 ? 74  LEU A HD22 7  
ATOM 11295 H HD23 . LEU A 1 74  ? 3.399   -19.683 -0.118  1.00 0.00 ? 74  LEU A HD23 7  
ATOM 11296 N N    . GLN A 1 75  ? 3.483   -20.880 -5.274  1.00 0.00 ? 75  GLN A N    7  
ATOM 11297 C CA   . GLN A 1 75  ? 3.856   -22.269 -5.515  1.00 0.00 ? 75  GLN A CA   7  
ATOM 11298 C C    . GLN A 1 75  ? 5.241   -22.567 -4.952  1.00 0.00 ? 75  GLN A C    7  
ATOM 11299 O O    . GLN A 1 75  ? 6.063   -21.666 -4.789  1.00 0.00 ? 75  GLN A O    7  
ATOM 11300 C CB   . GLN A 1 75  ? 3.825   -22.574 -7.014  1.00 0.00 ? 75  GLN A CB   7  
ATOM 11301 C CG   . GLN A 1 75  ? 2.551   -22.113 -7.703  1.00 0.00 ? 75  GLN A CG   7  
ATOM 11302 C CD   . GLN A 1 75  ? 2.228   -22.929 -8.939  1.00 0.00 ? 75  GLN A CD   7  
ATOM 11303 O OE1  . GLN A 1 75  ? 2.028   -24.142 -8.862  1.00 0.00 ? 75  GLN A OE1  7  
ATOM 11304 N NE2  . GLN A 1 75  ? 2.174   -22.266 -10.089 1.00 0.00 ? 75  GLN A NE2  7  
ATOM 11305 H H    . GLN A 1 75  ? 4.063   -20.165 -5.609  1.00 0.00 ? 75  GLN A H    7  
ATOM 11306 H HA   . GLN A 1 75  ? 3.135   -22.897 -5.015  1.00 0.00 ? 75  GLN A HA   7  
ATOM 11307 H HB2  . GLN A 1 75  ? 4.663   -22.083 -7.487  1.00 0.00 ? 75  GLN A HB2  7  
ATOM 11308 H HB3  . GLN A 1 75  ? 3.918   -23.641 -7.154  1.00 0.00 ? 75  GLN A HB3  7  
ATOM 11309 H HG2  . GLN A 1 75  ? 1.729   -22.201 -7.008  1.00 0.00 ? 75  GLN A HG2  7  
ATOM 11310 H HG3  . GLN A 1 75  ? 2.667   -21.079 -7.992  1.00 0.00 ? 75  GLN A HG3  7  
ATOM 11311 H HE21 . GLN A 1 75  ? 2.346   -21.301 -10.074 1.00 0.00 ? 75  GLN A HE21 7  
ATOM 11312 H HE22 . GLN A 1 75  ? 1.968   -22.769 -10.903 1.00 0.00 ? 75  GLN A HE22 7  
ATOM 11313 N N    . GLY A 1 76  ? 5.494   -23.839 -4.656  1.00 0.00 ? 76  GLY A N    7  
ATOM 11314 C CA   . GLY A 1 76  ? 6.781   -24.232 -4.113  1.00 0.00 ? 76  GLY A CA   7  
ATOM 11315 C C    . GLY A 1 76  ? 6.745   -24.413 -2.609  1.00 0.00 ? 76  GLY A C    7  
ATOM 11316 O O    . GLY A 1 76  ? 7.488   -23.756 -1.879  1.00 0.00 ? 76  GLY A O    7  
ATOM 11317 H H    . GLY A 1 76  ? 4.800   -24.514 -4.807  1.00 0.00 ? 76  GLY A H    7  
ATOM 11318 H HA2  . GLY A 1 76  ? 7.082   -25.163 -4.570  1.00 0.00 ? 76  GLY A HA2  7  
ATOM 11319 H HA3  . GLY A 1 76  ? 7.508   -23.472 -4.355  1.00 0.00 ? 76  GLY A HA3  7  
ATOM 11320 N N    . LEU A 1 77  ? 5.878   -25.305 -2.142  1.00 0.00 ? 77  LEU A N    7  
ATOM 11321 C CA   . LEU A 1 77  ? 5.747   -25.570 -0.714  1.00 0.00 ? 77  LEU A CA   7  
ATOM 11322 C C    . LEU A 1 77  ? 5.750   -27.070 -0.435  1.00 0.00 ? 77  LEU A C    7  
ATOM 11323 O O    . LEU A 1 77  ? 5.880   -27.882 -1.351  1.00 0.00 ? 77  LEU A O    7  
ATOM 11324 C CB   . LEU A 1 77  ? 4.460   -24.943 -0.175  1.00 0.00 ? 77  LEU A CB   7  
ATOM 11325 C CG   . LEU A 1 77  ? 4.234   -23.471 -0.523  1.00 0.00 ? 77  LEU A CG   7  
ATOM 11326 C CD1  . LEU A 1 77  ? 2.765   -23.106 -0.370  1.00 0.00 ? 77  LEU A CD1  7  
ATOM 11327 C CD2  . LEU A 1 77  ? 5.101   -22.577 0.351   1.00 0.00 ? 77  LEU A CD2  7  
ATOM 11328 H H    . LEU A 1 77  ? 5.313   -25.798 -2.772  1.00 0.00 ? 77  LEU A H    7  
ATOM 11329 H HA   . LEU A 1 77  ? 6.593   -25.121 -0.214  1.00 0.00 ? 77  LEU A HA   7  
ATOM 11330 H HB2  . LEU A 1 77  ? 3.628   -25.507 -0.568  1.00 0.00 ? 77  LEU A HB2  7  
ATOM 11331 H HB3  . LEU A 1 77  ? 4.475   -25.031 0.902   1.00 0.00 ? 77  LEU A HB3  7  
ATOM 11332 H HG   . LEU A 1 77  ? 4.513   -23.304 -1.554  1.00 0.00 ? 77  LEU A HG   7  
ATOM 11333 H HD11 . LEU A 1 77  ? 2.326   -23.702 0.416   1.00 0.00 ? 77  LEU A HD11 7  
ATOM 11334 H HD12 . LEU A 1 77  ? 2.248   -23.297 -1.298  1.00 0.00 ? 77  LEU A HD12 7  
ATOM 11335 H HD13 . LEU A 1 77  ? 2.679   -22.058 -0.120  1.00 0.00 ? 77  LEU A HD13 7  
ATOM 11336 H HD21 . LEU A 1 77  ? 6.040   -22.389 -0.148  1.00 0.00 ? 77  LEU A HD21 7  
ATOM 11337 H HD22 . LEU A 1 77  ? 5.288   -23.068 1.295   1.00 0.00 ? 77  LEU A HD22 7  
ATOM 11338 H HD23 . LEU A 1 77  ? 4.592   -21.641 0.526   1.00 0.00 ? 77  LEU A HD23 7  
ATOM 11339 N N    . LYS A 1 78  ? 5.605   -27.430 0.836   1.00 0.00 ? 78  LYS A N    7  
ATOM 11340 C CA   . LYS A 1 78  ? 5.588   -28.832 1.236   1.00 0.00 ? 78  LYS A CA   7  
ATOM 11341 C C    . LYS A 1 78  ? 4.173   -29.281 1.586   1.00 0.00 ? 78  LYS A C    7  
ATOM 11342 O O    . LYS A 1 78  ? 3.385   -28.534 2.167   1.00 0.00 ? 78  LYS A O    7  
ATOM 11343 C CB   . LYS A 1 78  ? 6.515   -29.053 2.434   1.00 0.00 ? 78  LYS A CB   7  
ATOM 11344 C CG   . LYS A 1 78  ? 7.990   -29.028 2.074   1.00 0.00 ? 78  LYS A CG   7  
ATOM 11345 C CD   . LYS A 1 78  ? 8.419   -30.314 1.387   1.00 0.00 ? 78  LYS A CD   7  
ATOM 11346 C CE   . LYS A 1 78  ? 8.586   -31.450 2.385   1.00 0.00 ? 78  LYS A CE   7  
ATOM 11347 N NZ   . LYS A 1 78  ? 9.820   -31.292 3.203   1.00 0.00 ? 78  LYS A NZ   7  
ATOM 11348 H H    . LYS A 1 78  ? 5.507   -26.736 1.521   1.00 0.00 ? 78  LYS A H    7  
ATOM 11349 H HA   . LYS A 1 78  ? 5.944   -29.420 0.403   1.00 0.00 ? 78  LYS A HA   7  
ATOM 11350 H HB2  . LYS A 1 78  ? 6.331   -28.279 3.164   1.00 0.00 ? 78  LYS A HB2  7  
ATOM 11351 H HB3  . LYS A 1 78  ? 6.290   -30.014 2.875   1.00 0.00 ? 78  LYS A HB3  7  
ATOM 11352 H HG2  . LYS A 1 78  ? 8.175   -28.198 1.408   1.00 0.00 ? 78  LYS A HG2  7  
ATOM 11353 H HG3  . LYS A 1 78  ? 8.570   -28.903 2.977   1.00 0.00 ? 78  LYS A HG3  7  
ATOM 11354 H HD2  . LYS A 1 78  ? 7.667   -30.593 0.663   1.00 0.00 ? 78  LYS A HD2  7  
ATOM 11355 H HD3  . LYS A 1 78  ? 9.361   -30.147 0.884   1.00 0.00 ? 78  LYS A HD3  7  
ATOM 11356 H HE2  . LYS A 1 78  ? 7.729   -31.465 3.040   1.00 0.00 ? 78  LYS A HE2  7  
ATOM 11357 H HE3  . LYS A 1 78  ? 8.640   -32.382 1.842   1.00 0.00 ? 78  LYS A HE3  7  
ATOM 11358 H HZ1  . LYS A 1 78  ? 10.153  -32.222 3.529   1.00 0.00 ? 78  LYS A HZ1  7  
ATOM 11359 H HZ2  . LYS A 1 78  ? 9.625   -30.696 4.033   1.00 0.00 ? 78  LYS A HZ2  7  
ATOM 11360 H HZ3  . LYS A 1 78  ? 10.570  -30.845 2.637   1.00 0.00 ? 78  LYS A HZ3  7  
ATOM 11361 N N    . PRO A 1 79  ? 3.841   -30.530 1.226   1.00 0.00 ? 79  PRO A N    7  
ATOM 11362 C CA   . PRO A 1 79  ? 2.520   -31.106 1.494   1.00 0.00 ? 79  PRO A CA   7  
ATOM 11363 C C    . PRO A 1 79  ? 2.292   -31.368 2.979   1.00 0.00 ? 79  PRO A C    7  
ATOM 11364 O O    . PRO A 1 79  ? 3.224   -31.702 3.710   1.00 0.00 ? 79  PRO A O    7  
ATOM 11365 C CB   . PRO A 1 79  ? 2.544   -32.424 0.716   1.00 0.00 ? 79  PRO A CB   7  
ATOM 11366 C CG   . PRO A 1 79  ? 3.987   -32.780 0.617   1.00 0.00 ? 79  PRO A CG   7  
ATOM 11367 C CD   . PRO A 1 79  ? 4.730   -31.475 0.531   1.00 0.00 ? 79  PRO A CD   7  
ATOM 11368 H HA   . PRO A 1 79  ? 1.728   -30.476 1.115   1.00 0.00 ? 79  PRO A HA   7  
ATOM 11369 H HB2  . PRO A 1 79  ? 1.987   -33.175 1.258   1.00 0.00 ? 79  PRO A HB2  7  
ATOM 11370 H HB3  . PRO A 1 79  ? 2.106   -32.278 -0.260  1.00 0.00 ? 79  PRO A HB3  7  
ATOM 11371 H HG2  . PRO A 1 79  ? 4.291   -33.327 1.496   1.00 0.00 ? 79  PRO A HG2  7  
ATOM 11372 H HG3  . PRO A 1 79  ? 4.159   -33.368 -0.272  1.00 0.00 ? 79  PRO A HG3  7  
ATOM 11373 H HD2  . PRO A 1 79  ? 5.683   -31.550 1.034   1.00 0.00 ? 79  PRO A HD2  7  
ATOM 11374 H HD3  . PRO A 1 79  ? 4.867   -31.187 -0.501  1.00 0.00 ? 79  PRO A HD3  7  
ATOM 11375 N N    . ASN A 1 80  ? 1.047   -31.216 3.418   1.00 0.00 ? 80  ASN A N    7  
ATOM 11376 C CA   . ASN A 1 80  ? 0.697   -31.437 4.816   1.00 0.00 ? 80  ASN A CA   7  
ATOM 11377 C C    . ASN A 1 80  ? 1.626   -30.654 5.740   1.00 0.00 ? 80  ASN A C    7  
ATOM 11378 O O    . ASN A 1 80  ? 2.208   -31.212 6.670   1.00 0.00 ? 80  ASN A O    7  
ATOM 11379 C CB   . ASN A 1 80  ? 0.765   -32.928 5.152   1.00 0.00 ? 80  ASN A CB   7  
ATOM 11380 C CG   . ASN A 1 80  ? -0.046  -33.281 6.383   1.00 0.00 ? 80  ASN A CG   7  
ATOM 11381 O OD1  . ASN A 1 80  ? 0.119   -32.677 7.443   1.00 0.00 ? 80  ASN A OD1  7  
ATOM 11382 N ND2  . ASN A 1 80  ? -0.928  -34.265 6.249   1.00 0.00 ? 80  ASN A ND2  7  
ATOM 11383 H H    . ASN A 1 80  ? 0.347   -30.949 2.787   1.00 0.00 ? 80  ASN A H    7  
ATOM 11384 H HA   . ASN A 1 80  ? -0.314  -31.090 4.964   1.00 0.00 ? 80  ASN A HA   7  
ATOM 11385 H HB2  . ASN A 1 80  ? 0.381   -33.496 4.317   1.00 0.00 ? 80  ASN A HB2  7  
ATOM 11386 H HB3  . ASN A 1 80  ? 1.793   -33.206 5.328   1.00 0.00 ? 80  ASN A HB3  7  
ATOM 11387 H HD21 . ASN A 1 80  ? -1.005  -34.702 5.375   1.00 0.00 ? 80  ASN A HD21 7  
ATOM 11388 H HD22 . ASN A 1 80  ? -1.466  -34.514 7.029   1.00 0.00 ? 80  ASN A HD22 7  
ATOM 11389 N N    . SER A 1 81  ? 1.759   -29.358 5.476   1.00 0.00 ? 81  SER A N    7  
ATOM 11390 C CA   . SER A 1 81  ? 2.620   -28.499 6.280   1.00 0.00 ? 81  SER A CA   7  
ATOM 11391 C C    . SER A 1 81  ? 1.991   -27.121 6.465   1.00 0.00 ? 81  SER A C    7  
ATOM 11392 O O    . SER A 1 81  ? 1.420   -26.556 5.531   1.00 0.00 ? 81  SER A O    7  
ATOM 11393 C CB   . SER A 1 81  ? 3.995   -28.361 5.625   1.00 0.00 ? 81  SER A CB   7  
ATOM 11394 O OG   . SER A 1 81  ? 4.815   -29.478 5.920   1.00 0.00 ? 81  SER A OG   7  
ATOM 11395 H H    . SER A 1 81  ? 1.269   -28.972 4.720   1.00 0.00 ? 81  SER A H    7  
ATOM 11396 H HA   . SER A 1 81  ? 2.737   -28.961 7.249   1.00 0.00 ? 81  SER A HA   7  
ATOM 11397 H HB2  . SER A 1 81  ? 3.875   -28.291 4.554   1.00 0.00 ? 81  SER A HB2  7  
ATOM 11398 H HB3  . SER A 1 81  ? 4.478   -27.467 5.993   1.00 0.00 ? 81  SER A HB3  7  
ATOM 11399 H HG   . SER A 1 81  ? 5.575   -29.191 6.432   1.00 0.00 ? 81  SER A HG   7  
ATOM 11400 N N    . LEU A 1 82  ? 2.101   -26.586 7.676   1.00 0.00 ? 82  LEU A N    7  
ATOM 11401 C CA   . LEU A 1 82  ? 1.544   -25.273 7.985   1.00 0.00 ? 82  LEU A CA   7  
ATOM 11402 C C    . LEU A 1 82  ? 2.474   -24.161 7.512   1.00 0.00 ? 82  LEU A C    7  
ATOM 11403 O O    . LEU A 1 82  ? 3.693   -24.331 7.478   1.00 0.00 ? 82  LEU A O    7  
ATOM 11404 C CB   . LEU A 1 82  ? 1.299   -25.143 9.490   1.00 0.00 ? 82  LEU A CB   7  
ATOM 11405 C CG   . LEU A 1 82  ? 0.461   -23.943 9.932   1.00 0.00 ? 82  LEU A CG   7  
ATOM 11406 C CD1  . LEU A 1 82  ? -0.986  -24.113 9.495   1.00 0.00 ? 82  LEU A CD1  7  
ATOM 11407 C CD2  . LEU A 1 82  ? 0.546   -23.760 11.440  1.00 0.00 ? 82  LEU A CD2  7  
ATOM 11408 H H    . LEU A 1 82  ? 2.567   -27.083 8.379   1.00 0.00 ? 82  LEU A H    7  
ATOM 11409 H HA   . LEU A 1 82  ? 0.601   -25.183 7.466   1.00 0.00 ? 82  LEU A HA   7  
ATOM 11410 H HB2  . LEU A 1 82  ? 0.796   -26.038 9.821   1.00 0.00 ? 82  LEU A HB2  7  
ATOM 11411 H HB3  . LEU A 1 82  ? 2.262   -25.072 9.976   1.00 0.00 ? 82  LEU A HB3  7  
ATOM 11412 H HG   . LEU A 1 82  ? 0.848   -23.049 9.463   1.00 0.00 ? 82  LEU A HG   7  
ATOM 11413 H HD11 . LEU A 1 82  ? -1.431  -24.936 10.034  1.00 0.00 ? 82  LEU A HD11 7  
ATOM 11414 H HD12 . LEU A 1 82  ? -1.021  -24.316 8.435   1.00 0.00 ? 82  LEU A HD12 7  
ATOM 11415 H HD13 . LEU A 1 82  ? -1.534  -23.206 9.706   1.00 0.00 ? 82  LEU A HD13 7  
ATOM 11416 H HD21 . LEU A 1 82  ? -0.287  -23.161 11.777  1.00 0.00 ? 82  LEU A HD21 7  
ATOM 11417 H HD22 . LEU A 1 82  ? 1.472   -23.261 11.690  1.00 0.00 ? 82  LEU A HD22 7  
ATOM 11418 H HD23 . LEU A 1 82  ? 0.515   -24.725 11.923  1.00 0.00 ? 82  LEU A HD23 7  
ATOM 11419 N N    . TYR A 1 83  ? 1.892   -23.024 7.150   1.00 0.00 ? 83  TYR A N    7  
ATOM 11420 C CA   . TYR A 1 83  ? 2.669   -21.884 6.678   1.00 0.00 ? 83  TYR A CA   7  
ATOM 11421 C C    . TYR A 1 83  ? 1.905   -20.580 6.888   1.00 0.00 ? 83  TYR A C    7  
ATOM 11422 O O    . TYR A 1 83  ? 0.823   -20.384 6.333   1.00 0.00 ? 83  TYR A O    7  
ATOM 11423 C CB   . TYR A 1 83  ? 3.014   -22.052 5.198   1.00 0.00 ? 83  TYR A CB   7  
ATOM 11424 C CG   . TYR A 1 83  ? 3.993   -23.172 4.928   1.00 0.00 ? 83  TYR A CG   7  
ATOM 11425 C CD1  . TYR A 1 83  ? 5.357   -22.990 5.119   1.00 0.00 ? 83  TYR A CD1  7  
ATOM 11426 C CD2  . TYR A 1 83  ? 3.554   -24.413 4.483   1.00 0.00 ? 83  TYR A CD2  7  
ATOM 11427 C CE1  . TYR A 1 83  ? 6.256   -24.010 4.874   1.00 0.00 ? 83  TYR A CE1  7  
ATOM 11428 C CE2  . TYR A 1 83  ? 4.445   -25.440 4.236   1.00 0.00 ? 83  TYR A CE2  7  
ATOM 11429 C CZ   . TYR A 1 83  ? 5.795   -25.233 4.433   1.00 0.00 ? 83  TYR A CZ   7  
ATOM 11430 O OH   . TYR A 1 83  ? 6.687   -26.252 4.188   1.00 0.00 ? 83  TYR A OH   7  
ATOM 11431 H H    . TYR A 1 83  ? 0.916   -22.949 7.199   1.00 0.00 ? 83  TYR A H    7  
ATOM 11432 H HA   . TYR A 1 83  ? 3.584   -21.847 7.249   1.00 0.00 ? 83  TYR A HA   7  
ATOM 11433 H HB2  . TYR A 1 83  ? 2.111   -22.263 4.646   1.00 0.00 ? 83  TYR A HB2  7  
ATOM 11434 H HB3  . TYR A 1 83  ? 3.449   -21.135 4.830   1.00 0.00 ? 83  TYR A HB3  7  
ATOM 11435 H HD1  . TYR A 1 83  ? 5.715   -22.031 5.466   1.00 0.00 ? 83  TYR A HD1  7  
ATOM 11436 H HD2  . TYR A 1 83  ? 2.497   -24.572 4.330   1.00 0.00 ? 83  TYR A HD2  7  
ATOM 11437 H HE1  . TYR A 1 83  ? 7.312   -23.849 5.028   1.00 0.00 ? 83  TYR A HE1  7  
ATOM 11438 H HE2  . TYR A 1 83  ? 4.085   -26.398 3.891   1.00 0.00 ? 83  TYR A HE2  7  
ATOM 11439 H HH   . TYR A 1 83  ? 6.908   -26.689 5.014   1.00 0.00 ? 83  TYR A HH   7  
ATOM 11440 N N    . TYR A 1 84  ? 2.476   -19.690 7.693   1.00 0.00 ? 84  TYR A N    7  
ATOM 11441 C CA   . TYR A 1 84  ? 1.850   -18.405 7.979   1.00 0.00 ? 84  TYR A CA   7  
ATOM 11442 C C    . TYR A 1 84  ? 1.913   -17.486 6.763   1.00 0.00 ? 84  TYR A C    7  
ATOM 11443 O O    . TYR A 1 84  ? 2.750   -17.664 5.878   1.00 0.00 ? 84  TYR A O    7  
ATOM 11444 C CB   . TYR A 1 84  ? 2.531   -17.737 9.174   1.00 0.00 ? 84  TYR A CB   7  
ATOM 11445 C CG   . TYR A 1 84  ? 2.224   -18.402 10.497  1.00 0.00 ? 84  TYR A CG   7  
ATOM 11446 C CD1  . TYR A 1 84  ? 2.611   -19.714 10.743  1.00 0.00 ? 84  TYR A CD1  7  
ATOM 11447 C CD2  . TYR A 1 84  ? 1.546   -17.720 11.499  1.00 0.00 ? 84  TYR A CD2  7  
ATOM 11448 C CE1  . TYR A 1 84  ? 2.331   -20.326 11.950  1.00 0.00 ? 84  TYR A CE1  7  
ATOM 11449 C CE2  . TYR A 1 84  ? 1.264   -18.324 12.709  1.00 0.00 ? 84  TYR A CE2  7  
ATOM 11450 C CZ   . TYR A 1 84  ? 1.658   -19.627 12.930  1.00 0.00 ? 84  TYR A CZ   7  
ATOM 11451 O OH   . TYR A 1 84  ? 1.378   -20.233 14.133  1.00 0.00 ? 84  TYR A OH   7  
ATOM 11452 H H    . TYR A 1 84  ? 3.339   -19.904 8.106   1.00 0.00 ? 84  TYR A H    7  
ATOM 11453 H HA   . TYR A 1 84  ? 0.814   -18.588 8.224   1.00 0.00 ? 84  TYR A HA   7  
ATOM 11454 H HB2  . TYR A 1 84  ? 3.600   -17.763 9.031   1.00 0.00 ? 84  TYR A HB2  7  
ATOM 11455 H HB3  . TYR A 1 84  ? 2.206   -16.709 9.236   1.00 0.00 ? 84  TYR A HB3  7  
ATOM 11456 H HD1  . TYR A 1 84  ? 3.138   -20.259 9.973   1.00 0.00 ? 84  TYR A HD1  7  
ATOM 11457 H HD2  . TYR A 1 84  ? 1.238   -16.699 11.323  1.00 0.00 ? 84  TYR A HD2  7  
ATOM 11458 H HE1  . TYR A 1 84  ? 2.640   -21.347 12.123  1.00 0.00 ? 84  TYR A HE1  7  
ATOM 11459 H HE2  . TYR A 1 84  ? 0.736   -17.777 13.477  1.00 0.00 ? 84  TYR A HE2  7  
ATOM 11460 H HH   . TYR A 1 84  ? 0.466   -20.054 14.376  1.00 0.00 ? 84  TYR A HH   7  
ATOM 11461 N N    . PHE A 1 85  ? 1.022   -16.500 6.728   1.00 0.00 ? 85  PHE A N    7  
ATOM 11462 C CA   . PHE A 1 85  ? 0.975   -15.552 5.621   1.00 0.00 ? 85  PHE A CA   7  
ATOM 11463 C C    . PHE A 1 85  ? 0.504   -14.181 6.100   1.00 0.00 ? 85  PHE A C    7  
ATOM 11464 O O    . PHE A 1 85  ? -0.310  -14.079 7.017   1.00 0.00 ? 85  PHE A O    7  
ATOM 11465 C CB   . PHE A 1 85  ? 0.047   -16.066 4.519   1.00 0.00 ? 85  PHE A CB   7  
ATOM 11466 C CG   . PHE A 1 85  ? 0.415   -17.433 4.015   1.00 0.00 ? 85  PHE A CG   7  
ATOM 11467 C CD1  . PHE A 1 85  ? 1.626   -17.647 3.375   1.00 0.00 ? 85  PHE A CD1  7  
ATOM 11468 C CD2  . PHE A 1 85  ? -0.449  -18.503 4.181   1.00 0.00 ? 85  PHE A CD2  7  
ATOM 11469 C CE1  . PHE A 1 85  ? 1.968   -18.902 2.911   1.00 0.00 ? 85  PHE A CE1  7  
ATOM 11470 C CE2  . PHE A 1 85  ? -0.112  -19.761 3.719   1.00 0.00 ? 85  PHE A CE2  7  
ATOM 11471 C CZ   . PHE A 1 85  ? 1.097   -19.961 3.082   1.00 0.00 ? 85  PHE A CZ   7  
ATOM 11472 H H    . PHE A 1 85  ? 0.380   -16.410 7.463   1.00 0.00 ? 85  PHE A H    7  
ATOM 11473 H HA   . PHE A 1 85  ? 1.974   -15.457 5.224   1.00 0.00 ? 85  PHE A HA   7  
ATOM 11474 H HB2  . PHE A 1 85  ? -0.961  -16.115 4.901   1.00 0.00 ? 85  PHE A HB2  7  
ATOM 11475 H HB3  . PHE A 1 85  ? 0.079   -15.383 3.684   1.00 0.00 ? 85  PHE A HB3  7  
ATOM 11476 H HD1  . PHE A 1 85  ? 2.308   -16.819 3.241   1.00 0.00 ? 85  PHE A HD1  7  
ATOM 11477 H HD2  . PHE A 1 85  ? -1.395  -18.348 4.678   1.00 0.00 ? 85  PHE A HD2  7  
ATOM 11478 H HE1  . PHE A 1 85  ? 2.914   -19.055 2.413   1.00 0.00 ? 85  PHE A HE1  7  
ATOM 11479 H HE2  . PHE A 1 85  ? -0.795  -20.587 3.854   1.00 0.00 ? 85  PHE A HE2  7  
ATOM 11480 H HZ   . PHE A 1 85  ? 1.363   -20.943 2.720   1.00 0.00 ? 85  PHE A HZ   7  
ATOM 11481 N N    . ARG A 1 86  ? 1.022   -13.131 5.471   1.00 0.00 ? 86  ARG A N    7  
ATOM 11482 C CA   . ARG A 1 86  ? 0.657   -11.767 5.833   1.00 0.00 ? 86  ARG A CA   7  
ATOM 11483 C C    . ARG A 1 86  ? 0.773   -10.836 4.630   1.00 0.00 ? 86  ARG A C    7  
ATOM 11484 O O    . ARG A 1 86  ? 1.847   -10.689 4.046   1.00 0.00 ? 86  ARG A O    7  
ATOM 11485 C CB   . ARG A 1 86  ? 1.548   -11.262 6.969   1.00 0.00 ? 86  ARG A CB   7  
ATOM 11486 C CG   . ARG A 1 86  ? 1.064   -11.673 8.351   1.00 0.00 ? 86  ARG A CG   7  
ATOM 11487 C CD   . ARG A 1 86  ? 1.475   -10.661 9.409   1.00 0.00 ? 86  ARG A CD   7  
ATOM 11488 N NE   . ARG A 1 86  ? 2.839   -10.887 9.881   1.00 0.00 ? 86  ARG A NE   7  
ATOM 11489 C CZ   . ARG A 1 86  ? 3.582   -9.948  10.457  1.00 0.00 ? 86  ARG A CZ   7  
ATOM 11490 N NH1  . ARG A 1 86  ? 3.096   -8.727  10.630  1.00 0.00 ? 86  ARG A NH1  7  
ATOM 11491 N NH2  . ARG A 1 86  ? 4.814   -10.231 10.861  1.00 0.00 ? 86  ARG A NH2  7  
ATOM 11492 H H    . ARG A 1 86  ? 1.667   -13.278 4.747   1.00 0.00 ? 86  ARG A H    7  
ATOM 11493 H HA   . ARG A 1 86  ? -0.369  -11.777 6.169   1.00 0.00 ? 86  ARG A HA   7  
ATOM 11494 H HB2  . ARG A 1 86  ? 2.545   -11.653 6.831   1.00 0.00 ? 86  ARG A HB2  7  
ATOM 11495 H HB3  . ARG A 1 86  ? 1.584   -10.184 6.930   1.00 0.00 ? 86  ARG A HB3  7  
ATOM 11496 H HG2  . ARG A 1 86  ? -0.013  -11.745 8.338   1.00 0.00 ? 86  ARG A HG2  7  
ATOM 11497 H HG3  . ARG A 1 86  ? 1.489   -12.634 8.599   1.00 0.00 ? 86  ARG A HG3  7  
ATOM 11498 H HD2  . ARG A 1 86  ? 1.412   -9.670  8.984   1.00 0.00 ? 86  ARG A HD2  7  
ATOM 11499 H HD3  . ARG A 1 86  ? 0.797   -10.738 10.245  1.00 0.00 ? 86  ARG A HD3  7  
ATOM 11500 H HE   . ARG A 1 86  ? 3.217   -11.782 9.763   1.00 0.00 ? 86  ARG A HE   7  
ATOM 11501 H HH11 . ARG A 1 86  ? 2.168   -8.511  10.328  1.00 0.00 ? 86  ARG A HH11 7  
ATOM 11502 H HH12 . ARG A 1 86  ? 3.657   -8.022  11.065  1.00 0.00 ? 86  ARG A HH12 7  
ATOM 11503 H HH21 . ARG A 1 86  ? 5.183   -11.150 10.732  1.00 0.00 ? 86  ARG A HH21 7  
ATOM 11504 H HH22 . ARG A 1 86  ? 5.372   -9.524  11.293  1.00 0.00 ? 86  ARG A HH22 7  
ATOM 11505 N N    . LEU A 1 87  ? -0.340  -10.210 4.264   1.00 0.00 ? 87  LEU A N    7  
ATOM 11506 C CA   . LEU A 1 87  ? -0.365  -9.293  3.129   1.00 0.00 ? 87  LEU A CA   7  
ATOM 11507 C C    . LEU A 1 87  ? -0.241  -7.846  3.596   1.00 0.00 ? 87  LEU A C    7  
ATOM 11508 O O    . LEU A 1 87  ? -0.825  -7.458  4.607   1.00 0.00 ? 87  LEU A O    7  
ATOM 11509 C CB   . LEU A 1 87  ? -1.656  -9.474  2.330   1.00 0.00 ? 87  LEU A CB   7  
ATOM 11510 C CG   . LEU A 1 87  ? -1.575  -9.141  0.839   1.00 0.00 ? 87  LEU A CG   7  
ATOM 11511 C CD1  . LEU A 1 87  ? -0.699  -10.151 0.114   1.00 0.00 ? 87  LEU A CD1  7  
ATOM 11512 C CD2  . LEU A 1 87  ? -2.966  -9.101  0.225   1.00 0.00 ? 87  LEU A CD2  7  
ATOM 11513 H H    . LEU A 1 87  ? -1.166  -10.367 4.767   1.00 0.00 ? 87  LEU A H    7  
ATOM 11514 H HA   . LEU A 1 87  ? 0.478   -9.528  2.496   1.00 0.00 ? 87  LEU A HA   7  
ATOM 11515 H HB2  . LEU A 1 87  ? -1.960  -10.505 2.422   1.00 0.00 ? 87  LEU A HB2  7  
ATOM 11516 H HB3  . LEU A 1 87  ? -2.410  -8.838  2.771   1.00 0.00 ? 87  LEU A HB3  7  
ATOM 11517 H HG   . LEU A 1 87  ? -1.127  -8.164  0.719   1.00 0.00 ? 87  LEU A HG   7  
ATOM 11518 H HD11 . LEU A 1 87  ? -1.311  -10.959 -0.256  1.00 0.00 ? 87  LEU A HD11 7  
ATOM 11519 H HD12 . LEU A 1 87  ? 0.040   -10.543 0.797   1.00 0.00 ? 87  LEU A HD12 7  
ATOM 11520 H HD13 . LEU A 1 87  ? -0.202  -9.666  -0.714  1.00 0.00 ? 87  LEU A HD13 7  
ATOM 11521 H HD21 . LEU A 1 87  ? -3.028  -9.828  -0.572  1.00 0.00 ? 87  LEU A HD21 7  
ATOM 11522 H HD22 . LEU A 1 87  ? -3.157  -8.115  -0.172  1.00 0.00 ? 87  LEU A HD22 7  
ATOM 11523 H HD23 . LEU A 1 87  ? -3.701  -9.334  0.982   1.00 0.00 ? 87  LEU A HD23 7  
ATOM 11524 N N    . ALA A 1 88  ? 0.522   -7.053  2.851   1.00 0.00 ? 88  ALA A N    7  
ATOM 11525 C CA   . ALA A 1 88  ? 0.718   -5.648  3.186   1.00 0.00 ? 88  ALA A CA   7  
ATOM 11526 C C    . ALA A 1 88  ? 1.015   -4.822  1.938   1.00 0.00 ? 88  ALA A C    7  
ATOM 11527 O O    . ALA A 1 88  ? 2.086   -4.943  1.343   1.00 0.00 ? 88  ALA A O    7  
ATOM 11528 C CB   . ALA A 1 88  ? 1.843   -5.499  4.199   1.00 0.00 ? 88  ALA A CB   7  
ATOM 11529 H H    . ALA A 1 88  ? 0.961   -7.421  2.056   1.00 0.00 ? 88  ALA A H    7  
ATOM 11530 H HA   . ALA A 1 88  ? -0.192  -5.282  3.639   1.00 0.00 ? 88  ALA A HA   7  
ATOM 11531 H HB1  . ALA A 1 88  ? 2.602   -4.841  3.800   1.00 0.00 ? 88  ALA A HB1  7  
ATOM 11532 H HB2  . ALA A 1 88  ? 1.450   -5.083  5.115   1.00 0.00 ? 88  ALA A HB2  7  
ATOM 11533 H HB3  . ALA A 1 88  ? 2.277   -6.468  4.400   1.00 0.00 ? 88  ALA A HB3  7  
ATOM 11534 N N    . ALA A 1 89  ? 0.061   -3.985  1.547   1.00 0.00 ? 89  ALA A N    7  
ATOM 11535 C CA   . ALA A 1 89  ? 0.221   -3.139  0.371   1.00 0.00 ? 89  ALA A CA   7  
ATOM 11536 C C    . ALA A 1 89  ? 1.480   -2.286  0.477   1.00 0.00 ? 89  ALA A C    7  
ATOM 11537 O O    . ALA A 1 89  ? 1.660   -1.544  1.442   1.00 0.00 ? 89  ALA A O    7  
ATOM 11538 C CB   . ALA A 1 89  ? -1.004  -2.255  0.186   1.00 0.00 ? 89  ALA A CB   7  
ATOM 11539 H H    . ALA A 1 89  ? -0.771  -3.934  2.063   1.00 0.00 ? 89  ALA A H    7  
ATOM 11540 H HA   . ALA A 1 89  ? 0.305   -3.781  -0.493  1.00 0.00 ? 89  ALA A HA   7  
ATOM 11541 H HB1  . ALA A 1 89  ? -1.891  -2.870  0.169   1.00 0.00 ? 89  ALA A HB1  7  
ATOM 11542 H HB2  . ALA A 1 89  ? -1.067  -1.553  1.004   1.00 0.00 ? 89  ALA A HB2  7  
ATOM 11543 H HB3  . ALA A 1 89  ? -0.921  -1.716  -0.746  1.00 0.00 ? 89  ALA A HB3  7  
ATOM 11544 N N    . ARG A 1 90  ? 2.350   -2.397  -0.522  1.00 0.00 ? 90  ARG A N    7  
ATOM 11545 C CA   . ARG A