data_1X62
# 
_entry.id   1X62 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1X62         
RCSB  RCSB024424   
WWPDB D_1000024424 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsi002002948.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1X62 
_pdbx_database_status.recvd_initial_deposition_date   2005-05-17 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Qin, X.R.'                                              1 
'Nagashima, T.'                                          2 
'Hayashi, F.'                                            3 
'Yokoyama, S.'                                           4 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the LIM domain of carboxyl terminal LIM domain protein 1' 
_citation.journal_abbrev            'To be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Qin, X.R.'     1 
primary 'Nagashima, T.' 2 
primary 'Hayashi, F.'   3 
primary 'Yokoyama, S.'  4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'C-terminal LIM domain protein 1' 8573.706 1 ? ? 'LIM domain' ? 
2 non-polymer syn 'ZINC ION'                        65.409   2 ? ? ?            ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'LIM domain protein CLP-36, Elfin' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GSSGSSGSIGNAQKLPMCDKCGTGIVGVFVKLRDRHRHPECYVCTDCGTNLKQKGHFFVEDQIYCEKHARERVSGPSSG 
_entity_poly.pdbx_seq_one_letter_code_can   GSSGSSGSIGNAQKLPMCDKCGTGIVGVFVKLRDRHRHPECYVCTDCGTNLKQKGHFFVEDQIYCEKHARERVSGPSSG 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsi002002948.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  SER n 
1 4  GLY n 
1 5  SER n 
1 6  SER n 
1 7  GLY n 
1 8  SER n 
1 9  ILE n 
1 10 GLY n 
1 11 ASN n 
1 12 ALA n 
1 13 GLN n 
1 14 LYS n 
1 15 LEU n 
1 16 PRO n 
1 17 MET n 
1 18 CYS n 
1 19 ASP n 
1 20 LYS n 
1 21 CYS n 
1 22 GLY n 
1 23 THR n 
1 24 GLY n 
1 25 ILE n 
1 26 VAL n 
1 27 GLY n 
1 28 VAL n 
1 29 PHE n 
1 30 VAL n 
1 31 LYS n 
1 32 LEU n 
1 33 ARG n 
1 34 ASP n 
1 35 ARG n 
1 36 HIS n 
1 37 ARG n 
1 38 HIS n 
1 39 PRO n 
1 40 GLU n 
1 41 CYS n 
1 42 TYR n 
1 43 VAL n 
1 44 CYS n 
1 45 THR n 
1 46 ASP n 
1 47 CYS n 
1 48 GLY n 
1 49 THR n 
1 50 ASN n 
1 51 LEU n 
1 52 LYS n 
1 53 GLN n 
1 54 LYS n 
1 55 GLY n 
1 56 HIS n 
1 57 PHE n 
1 58 PHE n 
1 59 VAL n 
1 60 GLU n 
1 61 ASP n 
1 62 GLN n 
1 63 ILE n 
1 64 TYR n 
1 65 CYS n 
1 66 GLU n 
1 67 LYS n 
1 68 HIS n 
1 69 ALA n 
1 70 ARG n 
1 71 GLU n 
1 72 ARG n 
1 73 VAL n 
1 74 SER n 
1 75 GLY n 
1 76 PRO n 
1 77 SER n 
1 78 SER n 
1 79 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'PDLIM1, CLIM1, CLP36' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P040830-06 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'cell free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PDLI1_HUMAN 
_struct_ref.pdbx_db_accession          O00151 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   SIGNAQKLPMCDKCGTGIVGVFVKLRDRHRHPECYVCTDCGTNLKQKGHFFVEDQIYCEKHARERV 
_struct_ref.pdbx_align_begin           249 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1X62 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 73 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O00151 
_struct_ref_seq.db_align_beg                  249 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  314 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       73 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1X62 GLY A 1  ? UNP O00151 ? ? 'CLONING ARTIFACT' 1  1  
1 1X62 SER A 2  ? UNP O00151 ? ? 'CLONING ARTIFACT' 2  2  
1 1X62 SER A 3  ? UNP O00151 ? ? 'CLONING ARTIFACT' 3  3  
1 1X62 GLY A 4  ? UNP O00151 ? ? 'CLONING ARTIFACT' 4  4  
1 1X62 SER A 5  ? UNP O00151 ? ? 'CLONING ARTIFACT' 5  5  
1 1X62 SER A 6  ? UNP O00151 ? ? 'CLONING ARTIFACT' 6  6  
1 1X62 GLY A 7  ? UNP O00151 ? ? 'CLONING ARTIFACT' 7  7  
1 1X62 SER A 74 ? UNP O00151 ? ? 'CLONING ARTIFACT' 74 8  
1 1X62 GLY A 75 ? UNP O00151 ? ? 'CLONING ARTIFACT' 75 9  
1 1X62 PRO A 76 ? UNP O00151 ? ? 'CLONING ARTIFACT' 76 10 
1 1X62 SER A 77 ? UNP O00151 ? ? 'CLONING ARTIFACT' 77 11 
1 1X62 SER A 78 ? UNP O00151 ? ? 'CLONING ARTIFACT' 78 12 
1 1X62 GLY A 79 ? UNP O00151 ? ? 'CLONING ARTIFACT' 79 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.18mM 13C,15N-labeled protein; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3, 0.01mM ZnCl2' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 INOVA Varian 800 ? 
2 INOVA Varian 900 ? 
# 
_pdbx_nmr_refine.entry_id           1X62 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1X62 
_pdbx_nmr_details.text       'spectrometer_id 1 for 3D_15N_separated_NOESY; spectrometer_id 2 for 3D_13C_separated_NOESY' 
# 
_pdbx_nmr_ensemble.entry_id                                      1X62 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'target function, structures with the lowest energy, structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1X62 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           VNMR    6.1C     Varian       1 
processing           NMRPipe 20031121 Delaglio,F.  2 
'data analysis'      NMRView 5.0.4    Johnson,B.A. 3 
'data analysis'      Kujira  0.9296   Kobayashi,N. 4 
'structure solution' CYANA   2.0.17   Guntert,P.   5 
refinement           CYANA   2.0.17   Guntert,P.   6 
# 
_exptl.entry_id          1X62 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1X62 
_struct.title                     'Solution structure of the LIM domain of carboxyl terminal LIM domain protein 1' 
_struct.pdbx_descriptor           'C-terminal LIM domain protein 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1X62 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN' 
_struct_keywords.text            
;LIM domain, PDZ and LIM domain protein 1, LIM domain protein CLP-36, C-terminal LIM domain protein 1, contractile protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural protein
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASN A 50 ? GLY A 55 ? ASN A 50 GLY A 55 1 ? 6  
HELX_P HELX_P2 2 CYS A 65 ? SER A 74 ? CYS A 65 SER A 74 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 18 SG  ? ? A ZN 201 A CYS 18 1_555 ? ? ? ? ? ? ? 2.337 ? 
metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 21 SG  ? ? A ZN 201 A CYS 21 1_555 ? ? ? ? ? ? ? 2.324 ? 
metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 38 ND1 ? ? A ZN 201 A HIS 38 1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 41 SG  ? ? A ZN 201 A CYS 41 1_555 ? ? ? ? ? ? ? 2.383 ? 
metalc5 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 44 SG  ? ? A ZN 401 A CYS 44 1_555 ? ? ? ? ? ? ? 2.329 ? 
metalc6 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 47 SG  ? ? A ZN 401 A CYS 47 1_555 ? ? ? ? ? ? ? 2.333 ? 
metalc7 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 65 SG  ? ? A ZN 401 A CYS 65 1_555 ? ? ? ? ? ? ? 2.329 ? 
metalc8 metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 68 ND1 ? ? A ZN 401 A HIS 68 1_555 ? ? ? ? ? ? ? 2.030 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 30 ? LYS A 31 ? VAL A 30 LYS A 31 
A 2 HIS A 36 ? ARG A 37 ? HIS A 36 ARG A 37 
B 1 PHE A 57 ? PHE A 58 ? PHE A 57 PHE A 58 
B 2 ILE A 63 ? TYR A 64 ? ILE A 63 TYR A 64 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 30 ? N VAL A 30 O ARG A 37 ? O ARG A 37 
B 1 2 N PHE A 57 ? N PHE A 57 O TYR A 64 ? O TYR A 64 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 201' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN A 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 18 ? CYS A 18 . ? 1_555 ? 
2 AC1 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 
3 AC1 4 HIS A 38 ? HIS A 38 . ? 1_555 ? 
4 AC1 4 CYS A 41 ? CYS A 41 . ? 1_555 ? 
5 AC2 5 CYS A 44 ? CYS A 44 . ? 1_555 ? 
6 AC2 5 ASP A 46 ? ASP A 46 . ? 1_555 ? 
7 AC2 5 CYS A 47 ? CYS A 47 . ? 1_555 ? 
8 AC2 5 CYS A 65 ? CYS A 65 . ? 1_555 ? 
9 AC2 5 HIS A 68 ? HIS A 68 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1X62 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1X62 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . GLY A 1 1  ? -23.700 10.985  14.476  1.00 0.00 ? 1   GLY A N    1  
ATOM   2     C  CA   . GLY A 1 1  ? -23.842 9.611   14.034  1.00 0.00 ? 1   GLY A CA   1  
ATOM   3     C  C    . GLY A 1 1  ? -24.967 9.437   13.033  1.00 0.00 ? 1   GLY A C    1  
ATOM   4     O  O    . GLY A 1 1  ? -25.912 10.226  13.007  1.00 0.00 ? 1   GLY A O    1  
ATOM   5     H  H1   . GLY A 1 1  ? -24.305 11.675  14.130  1.00 0.00 ? 1   GLY A H1   1  
ATOM   6     H  HA2  . GLY A 1 1  ? -22.916 9.294   13.577  1.00 0.00 ? 1   GLY A HA2  1  
ATOM   7     H  HA3  . GLY A 1 1  ? -24.041 8.987   14.892  1.00 0.00 ? 1   GLY A HA3  1  
ATOM   8     N  N    . SER A 1 2  ? -24.866 8.402   12.205  1.00 0.00 ? 2   SER A N    1  
ATOM   9     C  CA   . SER A 1 2  ? -25.881 8.131   11.193  1.00 0.00 ? 2   SER A CA   1  
ATOM   10    C  C    . SER A 1 2  ? -26.911 7.132   11.711  1.00 0.00 ? 2   SER A C    1  
ATOM   11    O  O    . SER A 1 2  ? -28.117 7.359   11.613  1.00 0.00 ? 2   SER A O    1  
ATOM   12    C  CB   . SER A 1 2  ? -25.229 7.594   9.918   1.00 0.00 ? 2   SER A CB   1  
ATOM   13    O  OG   . SER A 1 2  ? -24.506 8.611   9.247   1.00 0.00 ? 2   SER A OG   1  
ATOM   14    H  H    . SER A 1 2  ? -24.089 7.809   12.274  1.00 0.00 ? 2   SER A H    1  
ATOM   15    H  HA   . SER A 1 2  ? -26.381 9.061   10.967  1.00 0.00 ? 2   SER A HA   1  
ATOM   16    H  HB2  . SER A 1 2  ? -24.550 6.795   10.173  1.00 0.00 ? 2   SER A HB2  1  
ATOM   17    H  HB3  . SER A 1 2  ? -25.996 7.217   9.256   1.00 0.00 ? 2   SER A HB3  1  
ATOM   18    H  HG   . SER A 1 2  ? -23.619 8.667   9.612   1.00 0.00 ? 2   SER A HG   1  
ATOM   19    N  N    . SER A 1 3  ? -26.426 6.024   12.263  1.00 0.00 ? 3   SER A N    1  
ATOM   20    C  CA   . SER A 1 3  ? -27.303 4.987   12.794  1.00 0.00 ? 3   SER A CA   1  
ATOM   21    C  C    . SER A 1 3  ? -28.339 4.568   11.756  1.00 0.00 ? 3   SER A C    1  
ATOM   22    O  O    . SER A 1 3  ? -29.502 4.333   12.082  1.00 0.00 ? 3   SER A O    1  
ATOM   23    C  CB   . SER A 1 3  ? -28.004 5.482   14.061  1.00 0.00 ? 3   SER A CB   1  
ATOM   24    O  OG   . SER A 1 3  ? -29.182 6.203   13.743  1.00 0.00 ? 3   SER A OG   1  
ATOM   25    H  H    . SER A 1 3  ? -25.455 5.901   12.312  1.00 0.00 ? 3   SER A H    1  
ATOM   26    H  HA   . SER A 1 3  ? -26.693 4.131   13.041  1.00 0.00 ? 3   SER A HA   1  
ATOM   27    H  HB2  . SER A 1 3  ? -28.270 4.635   14.675  1.00 0.00 ? 3   SER A HB2  1  
ATOM   28    H  HB3  . SER A 1 3  ? -27.336 6.130   14.609  1.00 0.00 ? 3   SER A HB3  1  
ATOM   29    H  HG   . SER A 1 3  ? -28.967 6.916   13.137  1.00 0.00 ? 3   SER A HG   1  
ATOM   30    N  N    . GLY A 1 4  ? -27.908 4.478   10.501  1.00 0.00 ? 4   GLY A N    1  
ATOM   31    C  CA   . GLY A 1 4  ? -28.810 4.088   9.433   1.00 0.00 ? 4   GLY A CA   1  
ATOM   32    C  C    . GLY A 1 4  ? -28.485 2.717   8.872   1.00 0.00 ? 4   GLY A C    1  
ATOM   33    O  O    . GLY A 1 4  ? -28.576 1.713   9.577   1.00 0.00 ? 4   GLY A O    1  
ATOM   34    H  H    . GLY A 1 4  ? -26.970 4.677   10.299  1.00 0.00 ? 4   GLY A H    1  
ATOM   35    H  HA2  . GLY A 1 4  ? -29.820 4.080   9.814   1.00 0.00 ? 4   GLY A HA2  1  
ATOM   36    H  HA3  . GLY A 1 4  ? -28.742 4.815   8.637   1.00 0.00 ? 4   GLY A HA3  1  
ATOM   37    N  N    . SER A 1 5  ? -28.108 2.675   7.598   1.00 0.00 ? 5   SER A N    1  
ATOM   38    C  CA   . SER A 1 5  ? -27.775 1.417   6.941   1.00 0.00 ? 5   SER A CA   1  
ATOM   39    C  C    . SER A 1 5  ? -28.987 0.492   6.891   1.00 0.00 ? 5   SER A C    1  
ATOM   40    O  O    . SER A 1 5  ? -28.874 -0.711  7.125   1.00 0.00 ? 5   SER A O    1  
ATOM   41    C  CB   . SER A 1 5  ? -26.621 0.726   7.670   1.00 0.00 ? 5   SER A CB   1  
ATOM   42    O  OG   . SER A 1 5  ? -26.127 -0.371  6.921   1.00 0.00 ? 5   SER A OG   1  
ATOM   43    H  H    . SER A 1 5  ? -28.055 3.511   7.088   1.00 0.00 ? 5   SER A H    1  
ATOM   44    H  HA   . SER A 1 5  ? -27.467 1.642   5.930   1.00 0.00 ? 5   SER A HA   1  
ATOM   45    H  HB2  . SER A 1 5  ? -25.820 1.433   7.823   1.00 0.00 ? 5   SER A HB2  1  
ATOM   46    H  HB3  . SER A 1 5  ? -26.969 0.365   8.627   1.00 0.00 ? 5   SER A HB3  1  
ATOM   47    H  HG   . SER A 1 5  ? -26.003 -1.125  7.501   1.00 0.00 ? 5   SER A HG   1  
ATOM   48    N  N    . SER A 1 6  ? -30.147 1.064   6.585   1.00 0.00 ? 6   SER A N    1  
ATOM   49    C  CA   . SER A 1 6  ? -31.383 0.293   6.508   1.00 0.00 ? 6   SER A CA   1  
ATOM   50    C  C    . SER A 1 6  ? -31.692 -0.095  5.065   1.00 0.00 ? 6   SER A C    1  
ATOM   51    O  O    . SER A 1 6  ? -31.274 0.580   4.126   1.00 0.00 ? 6   SER A O    1  
ATOM   52    C  CB   . SER A 1 6  ? -32.547 1.095   7.093   1.00 0.00 ? 6   SER A CB   1  
ATOM   53    O  OG   . SER A 1 6  ? -33.670 0.265   7.329   1.00 0.00 ? 6   SER A OG   1  
ATOM   54    H  H    . SER A 1 6  ? -30.173 2.028   6.409   1.00 0.00 ? 6   SER A H    1  
ATOM   55    H  HA   . SER A 1 6  ? -31.249 -0.607  7.090   1.00 0.00 ? 6   SER A HA   1  
ATOM   56    H  HB2  . SER A 1 6  ? -32.240 1.540   8.027   1.00 0.00 ? 6   SER A HB2  1  
ATOM   57    H  HB3  . SER A 1 6  ? -32.829 1.873   6.398   1.00 0.00 ? 6   SER A HB3  1  
ATOM   58    H  HG   . SER A 1 6  ? -33.450 -0.643  7.110   1.00 0.00 ? 6   SER A HG   1  
ATOM   59    N  N    . GLY A 1 7  ? -32.427 -1.191  4.898   1.00 0.00 ? 7   GLY A N    1  
ATOM   60    C  CA   . GLY A 1 7  ? -32.780 -1.651  3.568   1.00 0.00 ? 7   GLY A CA   1  
ATOM   61    C  C    . GLY A 1 7  ? -32.699 -3.159  3.436   1.00 0.00 ? 7   GLY A C    1  
ATOM   62    O  O    . GLY A 1 7  ? -31.608 -3.729  3.416   1.00 0.00 ? 7   GLY A O    1  
ATOM   63    H  H    . GLY A 1 7  ? -32.732 -1.690  5.685   1.00 0.00 ? 7   GLY A H    1  
ATOM   64    H  HA2  . GLY A 1 7  ? -33.788 -1.335  3.345   1.00 0.00 ? 7   GLY A HA2  1  
ATOM   65    H  HA3  . GLY A 1 7  ? -32.106 -1.202  2.853   1.00 0.00 ? 7   GLY A HA3  1  
ATOM   66    N  N    . SER A 1 8  ? -33.856 -3.807  3.348   1.00 0.00 ? 8   SER A N    1  
ATOM   67    C  CA   . SER A 1 8  ? -33.911 -5.259  3.223   1.00 0.00 ? 8   SER A CA   1  
ATOM   68    C  C    . SER A 1 8  ? -33.564 -5.696  1.803   1.00 0.00 ? 8   SER A C    1  
ATOM   69    O  O    . SER A 1 8  ? -34.126 -5.190  0.832   1.00 0.00 ? 8   SER A O    1  
ATOM   70    C  CB   . SER A 1 8  ? -35.302 -5.772  3.601   1.00 0.00 ? 8   SER A CB   1  
ATOM   71    O  OG   . SER A 1 8  ? -36.238 -5.514  2.568   1.00 0.00 ? 8   SER A OG   1  
ATOM   72    H  H    . SER A 1 8  ? -34.692 -3.297  3.370   1.00 0.00 ? 8   SER A H    1  
ATOM   73    H  HA   . SER A 1 8  ? -33.186 -5.678  3.904   1.00 0.00 ? 8   SER A HA   1  
ATOM   74    H  HB2  . SER A 1 8  ? -35.257 -6.836  3.771   1.00 0.00 ? 8   SER A HB2  1  
ATOM   75    H  HB3  . SER A 1 8  ? -35.633 -5.276  4.502   1.00 0.00 ? 8   SER A HB3  1  
ATOM   76    H  HG   . SER A 1 8  ? -36.046 -4.664  2.166   1.00 0.00 ? 8   SER A HG   1  
ATOM   77    N  N    . ILE A 1 9  ? -32.634 -6.638  1.692   1.00 0.00 ? 9   ILE A N    1  
ATOM   78    C  CA   . ILE A 1 9  ? -32.212 -7.144  0.392   1.00 0.00 ? 9   ILE A CA   1  
ATOM   79    C  C    . ILE A 1 9  ? -31.679 -8.569  0.503   1.00 0.00 ? 9   ILE A C    1  
ATOM   80    O  O    . ILE A 1 9  ? -30.980 -8.908  1.457   1.00 0.00 ? 9   ILE A O    1  
ATOM   81    C  CB   . ILE A 1 9  ? -31.127 -6.250  -0.235  1.00 0.00 ? 9   ILE A CB   1  
ATOM   82    C  CG1  . ILE A 1 9  ? -29.921 -6.140  0.701   1.00 0.00 ? 9   ILE A CG1  1  
ATOM   83    C  CG2  . ILE A 1 9  ? -31.691 -4.871  -0.545  1.00 0.00 ? 9   ILE A CG2  1  
ATOM   84    C  CD1  . ILE A 1 9  ? -28.663 -5.661  0.012   1.00 0.00 ? 9   ILE A CD1  1  
ATOM   85    H  H    . ILE A 1 9  ? -32.223 -7.002  2.503   1.00 0.00 ? 9   ILE A H    1  
ATOM   86    H  HA   . ILE A 1 9  ? -33.073 -7.144  -0.261  1.00 0.00 ? 9   ILE A HA   1  
ATOM   87    H  HB   . ILE A 1 9  ? -30.812 -6.700  -1.164  1.00 0.00 ? 9   ILE A HB   1  
ATOM   88    H  HG12 . ILE A 1 9  ? -30.150 -5.445  1.493   1.00 0.00 ? 9   ILE A HG12 1  
ATOM   89    H  HG13 . ILE A 1 9  ? -29.718 -7.111  1.128   1.00 0.00 ? 9   ILE A HG13 1  
ATOM   90    H  HG21 . ILE A 1 9  ? -31.981 -4.386  0.376   1.00 0.00 ? 9   ILE A HG21 1  
ATOM   91    H  HG22 . ILE A 1 9  ? -30.938 -4.277  -1.041  1.00 0.00 ? 9   ILE A HG22 1  
ATOM   92    H  HG23 . ILE A 1 9  ? -32.553 -4.970  -1.187  1.00 0.00 ? 9   ILE A HG23 1  
ATOM   93    H  HD11 . ILE A 1 9  ? -28.829 -5.620  -1.055  1.00 0.00 ? 9   ILE A HD11 1  
ATOM   94    H  HD12 . ILE A 1 9  ? -28.404 -4.678  0.375   1.00 0.00 ? 9   ILE A HD12 1  
ATOM   95    H  HD13 . ILE A 1 9  ? -27.854 -6.347  0.222   1.00 0.00 ? 9   ILE A HD13 1  
ATOM   96    N  N    . GLY A 1 10 ? -32.012 -9.399  -0.481  1.00 0.00 ? 10  GLY A N    1  
ATOM   97    C  CA   . GLY A 1 10 ? -31.557 -10.777 -0.476  1.00 0.00 ? 10  GLY A CA   1  
ATOM   98    C  C    . GLY A 1 10 ? -30.149 -10.924 -1.016  1.00 0.00 ? 10  GLY A C    1  
ATOM   99    O  O    . GLY A 1 10 ? -29.223 -10.268 -0.542  1.00 0.00 ? 10  GLY A O    1  
ATOM   100   H  H    . GLY A 1 10 ? -32.572 -9.072  -1.216  1.00 0.00 ? 10  GLY A H    1  
ATOM   101   H  HA2  . GLY A 1 10 ? -31.583 -11.149 0.538   1.00 0.00 ? 10  GLY A HA2  1  
ATOM   102   H  HA3  . GLY A 1 10 ? -32.227 -11.367 -1.083  1.00 0.00 ? 10  GLY A HA3  1  
ATOM   103   N  N    . ASN A 1 11 ? -29.986 -11.790 -2.012  1.00 0.00 ? 11  ASN A N    1  
ATOM   104   C  CA   . ASN A 1 11 ? -28.680 -12.023 -2.616  1.00 0.00 ? 11  ASN A CA   1  
ATOM   105   C  C    . ASN A 1 11 ? -28.066 -10.716 -3.108  1.00 0.00 ? 11  ASN A C    1  
ATOM   106   O  O    . ASN A 1 11 ? -28.775 -9.742  -3.362  1.00 0.00 ? 11  ASN A O    1  
ATOM   107   C  CB   . ASN A 1 11 ? -28.801 -13.011 -3.778  1.00 0.00 ? 11  ASN A CB   1  
ATOM   108   C  CG   . ASN A 1 11 ? -29.662 -14.210 -3.430  1.00 0.00 ? 11  ASN A CG   1  
ATOM   109   O  OD1  . ASN A 1 11 ? -29.501 -14.818 -2.372  1.00 0.00 ? 11  ASN A OD1  1  
ATOM   110   N  ND2  . ASN A 1 11 ? -30.583 -14.556 -4.322  1.00 0.00 ? 11  ASN A ND2  1  
ATOM   111   H  H    . ASN A 1 11 ? -30.763 -12.284 -2.347  1.00 0.00 ? 11  ASN A H    1  
ATOM   112   H  HA   . ASN A 1 11 ? -28.036 -12.447 -1.860  1.00 0.00 ? 11  ASN A HA   1  
ATOM   113   H  HB2  . ASN A 1 11 ? -29.245 -12.508 -4.625  1.00 0.00 ? 11  ASN A HB2  1  
ATOM   114   H  HB3  . ASN A 1 11 ? -27.817 -13.364 -4.048  1.00 0.00 ? 11  ASN A HB3  1  
ATOM   115   H  HD21 . ASN A 1 11 ? -30.655 -14.026 -5.143  1.00 0.00 ? 11  ASN A HD21 1  
ATOM   116   H  HD22 . ASN A 1 11 ? -31.154 -15.327 -4.122  1.00 0.00 ? 11  ASN A HD22 1  
ATOM   117   N  N    . ALA A 1 12 ? -26.744 -10.702 -3.240  1.00 0.00 ? 12  ALA A N    1  
ATOM   118   C  CA   . ALA A 1 12 ? -26.035 -9.515  -3.704  1.00 0.00 ? 12  ALA A CA   1  
ATOM   119   C  C    . ALA A 1 12 ? -24.734 -9.892  -4.405  1.00 0.00 ? 12  ALA A C    1  
ATOM   120   O  O    . ALA A 1 12 ? -24.050 -10.831 -3.999  1.00 0.00 ? 12  ALA A O    1  
ATOM   121   C  CB   . ALA A 1 12 ? -25.757 -8.578  -2.539  1.00 0.00 ? 12  ALA A CB   1  
ATOM   122   H  H    . ALA A 1 12 ? -26.233 -11.509 -3.022  1.00 0.00 ? 12  ALA A H    1  
ATOM   123   H  HA   . ALA A 1 12 ? -26.674 -8.998  -4.406  1.00 0.00 ? 12  ALA A HA   1  
ATOM   124   H  HB1  . ALA A 1 12 ? -24.887 -7.977  -2.761  1.00 0.00 ? 12  ALA A HB1  1  
ATOM   125   H  HB2  . ALA A 1 12 ? -26.610 -7.934  -2.383  1.00 0.00 ? 12  ALA A HB2  1  
ATOM   126   H  HB3  . ALA A 1 12 ? -25.576 -9.157  -1.646  1.00 0.00 ? 12  ALA A HB3  1  
ATOM   127   N  N    . GLN A 1 13 ? -24.401 -9.155  -5.459  1.00 0.00 ? 13  GLN A N    1  
ATOM   128   C  CA   . GLN A 1 13 ? -23.182 -9.414  -6.217  1.00 0.00 ? 13  GLN A CA   1  
ATOM   129   C  C    . GLN A 1 13 ? -21.965 -9.437  -5.298  1.00 0.00 ? 13  GLN A C    1  
ATOM   130   O  O    . GLN A 1 13 ? -21.797 -8.562  -4.449  1.00 0.00 ? 13  GLN A O    1  
ATOM   131   C  CB   . GLN A 1 13 ? -22.996 -8.352  -7.302  1.00 0.00 ? 13  GLN A CB   1  
ATOM   132   C  CG   . GLN A 1 13 ? -24.013 -8.449  -8.428  1.00 0.00 ? 13  GLN A CG   1  
ATOM   133   C  CD   . GLN A 1 13 ? -23.748 -7.454  -9.541  1.00 0.00 ? 13  GLN A CD   1  
ATOM   134   O  OE1  . GLN A 1 13 ? -24.592 -6.611  -9.849  1.00 0.00 ? 13  GLN A OE1  1  
ATOM   135   N  NE2  . GLN A 1 13 ? -22.572 -7.545  -10.150 1.00 0.00 ? 13  GLN A NE2  1  
ATOM   136   H  H    . GLN A 1 13 ? -24.987 -8.420  -5.734  1.00 0.00 ? 13  GLN A H    1  
ATOM   137   H  HA   . GLN A 1 13 ? -23.282 -10.381 -6.685  1.00 0.00 ? 13  GLN A HA   1  
ATOM   138   H  HB2  . GLN A 1 13 ? -23.082 -7.375  -6.852  1.00 0.00 ? 13  GLN A HB2  1  
ATOM   139   H  HB3  . GLN A 1 13 ? -22.009 -8.459  -7.728  1.00 0.00 ? 13  GLN A HB3  1  
ATOM   140   H  HG2  . GLN A 1 13 ? -23.978 -9.446  -8.843  1.00 0.00 ? 13  GLN A HG2  1  
ATOM   141   H  HG3  . GLN A 1 13 ? -24.997 -8.263  -8.024  1.00 0.00 ? 13  GLN A HG3  1  
ATOM   142   H  HE21 . GLN A 1 13 ? -21.950 -8.242  -9.852  1.00 0.00 ? 13  GLN A HE21 1  
ATOM   143   H  HE22 . GLN A 1 13 ? -22.375 -6.915  -10.873 1.00 0.00 ? 13  GLN A HE22 1  
ATOM   144   N  N    . LYS A 1 14 ? -21.116 -10.444 -5.474  1.00 0.00 ? 14  LYS A N    1  
ATOM   145   C  CA   . LYS A 1 14 ? -19.913 -10.583 -4.662  1.00 0.00 ? 14  LYS A CA   1  
ATOM   146   C  C    . LYS A 1 14 ? -19.024 -9.350  -4.793  1.00 0.00 ? 14  LYS A C    1  
ATOM   147   O  O    . LYS A 1 14 ? -18.779 -8.864  -5.898  1.00 0.00 ? 14  LYS A O    1  
ATOM   148   C  CB   . LYS A 1 14 ? -19.134 -11.833 -5.076  1.00 0.00 ? 14  LYS A CB   1  
ATOM   149   C  CG   . LYS A 1 14 ? -18.151 -12.314 -4.024  1.00 0.00 ? 14  LYS A CG   1  
ATOM   150   C  CD   . LYS A 1 14 ? -18.846 -13.114 -2.935  1.00 0.00 ? 14  LYS A CD   1  
ATOM   151   C  CE   . LYS A 1 14 ? -17.897 -14.108 -2.282  1.00 0.00 ? 14  LYS A CE   1  
ATOM   152   N  NZ   . LYS A 1 14 ? -18.614 -15.044 -1.372  1.00 0.00 ? 14  LYS A NZ   1  
ATOM   153   H  H    . LYS A 1 14 ? -21.304 -11.112 -6.168  1.00 0.00 ? 14  LYS A H    1  
ATOM   154   H  HA   . LYS A 1 14 ? -20.218 -10.684 -3.631  1.00 0.00 ? 14  LYS A HA   1  
ATOM   155   H  HB2  . LYS A 1 14 ? -19.836 -12.630 -5.274  1.00 0.00 ? 14  LYS A HB2  1  
ATOM   156   H  HB3  . LYS A 1 14 ? -18.584 -11.617 -5.981  1.00 0.00 ? 14  LYS A HB3  1  
ATOM   157   H  HG2  . LYS A 1 14 ? -17.408 -12.939 -4.496  1.00 0.00 ? 14  LYS A HG2  1  
ATOM   158   H  HG3  . LYS A 1 14 ? -17.669 -11.456 -3.576  1.00 0.00 ? 14  LYS A HG3  1  
ATOM   159   H  HD2  . LYS A 1 14 ? -19.213 -12.435 -2.180  1.00 0.00 ? 14  LYS A HD2  1  
ATOM   160   H  HD3  . LYS A 1 14 ? -19.675 -13.654 -3.370  1.00 0.00 ? 14  LYS A HD3  1  
ATOM   161   H  HE2  . LYS A 1 14 ? -17.405 -14.677 -3.055  1.00 0.00 ? 14  LYS A HE2  1  
ATOM   162   H  HE3  . LYS A 1 14 ? -17.159 -13.561 -1.713  1.00 0.00 ? 14  LYS A HE3  1  
ATOM   163   H  HZ1  . LYS A 1 14 ? -18.031 -15.245 -0.535  1.00 0.00 ? 14  LYS A HZ1  1  
ATOM   164   H  HZ2  . LYS A 1 14 ? -18.814 -15.938 -1.865  1.00 0.00 ? 14  LYS A HZ2  1  
ATOM   165   H  HZ3  . LYS A 1 14 ? -19.513 -14.623 -1.063  1.00 0.00 ? 14  LYS A HZ3  1  
ATOM   166   N  N    . LEU A 1 15 ? -18.542 -8.851  -3.661  1.00 0.00 ? 15  LEU A N    1  
ATOM   167   C  CA   . LEU A 1 15 ? -17.677 -7.676  -3.649  1.00 0.00 ? 15  LEU A CA   1  
ATOM   168   C  C    . LEU A 1 15 ? -16.385 -7.958  -2.890  1.00 0.00 ? 15  LEU A C    1  
ATOM   169   O  O    . LEU A 1 15 ? -16.378 -8.621  -1.852  1.00 0.00 ? 15  LEU A O    1  
ATOM   170   C  CB   . LEU A 1 15 ? -18.406 -6.489  -3.017  1.00 0.00 ? 15  LEU A CB   1  
ATOM   171   C  CG   . LEU A 1 15 ? -19.756 -6.123  -3.634  1.00 0.00 ? 15  LEU A CG   1  
ATOM   172   C  CD1  . LEU A 1 15 ? -20.559 -5.249  -2.684  1.00 0.00 ? 15  LEU A CD1  1  
ATOM   173   C  CD2  . LEU A 1 15 ? -19.559 -5.422  -4.970  1.00 0.00 ? 15  LEU A CD2  1  
ATOM   174   H  H    . LEU A 1 15 ? -18.772 -9.282  -2.812  1.00 0.00 ? 15  LEU A H    1  
ATOM   175   H  HA   . LEU A 1 15 ? -17.434 -7.434  -4.673  1.00 0.00 ? 15  LEU A HA   1  
ATOM   176   H  HB2  . LEU A 1 15 ? -18.570 -6.719  -1.975  1.00 0.00 ? 15  LEU A HB2  1  
ATOM   177   H  HB3  . LEU A 1 15 ? -17.760 -5.626  -3.096  1.00 0.00 ? 15  LEU A HB3  1  
ATOM   178   H  HG   . LEU A 1 15 ? -20.321 -7.029  -3.811  1.00 0.00 ? 15  LEU A HG   1  
ATOM   179   H  HD11 . LEU A 1 15 ? -19.951 -4.995  -1.829  1.00 0.00 ? 15  LEU A HD11 1  
ATOM   180   H  HD12 . LEU A 1 15 ? -21.436 -5.785  -2.355  1.00 0.00 ? 15  LEU A HD12 1  
ATOM   181   H  HD13 . LEU A 1 15 ? -20.860 -4.345  -3.194  1.00 0.00 ? 15  LEU A HD13 1  
ATOM   182   H  HD21 . LEU A 1 15 ? -19.019 -4.499  -4.815  1.00 0.00 ? 15  LEU A HD21 1  
ATOM   183   H  HD22 . LEU A 1 15 ? -20.523 -5.205  -5.408  1.00 0.00 ? 15  LEU A HD22 1  
ATOM   184   H  HD23 . LEU A 1 15 ? -18.997 -6.062  -5.634  1.00 0.00 ? 15  LEU A HD23 1  
ATOM   185   N  N    . PRO A 1 16 ? -15.265 -7.441  -3.415  1.00 0.00 ? 16  PRO A N    1  
ATOM   186   C  CA   . PRO A 1 16 ? -13.946 -7.621  -2.801  1.00 0.00 ? 16  PRO A CA   1  
ATOM   187   C  C    . PRO A 1 16 ? -13.805 -6.850  -1.493  1.00 0.00 ? 16  PRO A C    1  
ATOM   188   O  O    . PRO A 1 16 ? -13.413 -5.684  -1.489  1.00 0.00 ? 16  PRO A O    1  
ATOM   189   C  CB   . PRO A 1 16 ? -12.985 -7.067  -3.856  1.00 0.00 ? 16  PRO A CB   1  
ATOM   190   C  CG   . PRO A 1 16 ? -13.799 -6.092  -4.635  1.00 0.00 ? 16  PRO A CG   1  
ATOM   191   C  CD   . PRO A 1 16 ? -15.199 -6.640  -4.649  1.00 0.00 ? 16  PRO A CD   1  
ATOM   192   H  HA   . PRO A 1 16 ? -13.729 -8.665  -2.628  1.00 0.00 ? 16  PRO A HA   1  
ATOM   193   H  HB2  . PRO A 1 16 ? -12.150 -6.584  -3.367  1.00 0.00 ? 16  PRO A HB2  1  
ATOM   194   H  HB3  . PRO A 1 16 ? -12.627 -7.871  -4.481  1.00 0.00 ? 16  PRO A HB3  1  
ATOM   195   H  HG2  . PRO A 1 16 ? -13.779 -5.127  -4.151  1.00 0.00 ? 16  PRO A HG2  1  
ATOM   196   H  HG3  . PRO A 1 16 ? -13.416 -6.017  -5.642  1.00 0.00 ? 16  PRO A HG3  1  
ATOM   197   H  HD2  . PRO A 1 16 ? -15.919 -5.836  -4.626  1.00 0.00 ? 16  PRO A HD2  1  
ATOM   198   H  HD3  . PRO A 1 16 ? -15.352 -7.261  -5.520  1.00 0.00 ? 16  PRO A HD3  1  
ATOM   199   N  N    . MET A 1 17 ? -14.126 -7.509  -0.385  1.00 0.00 ? 17  MET A N    1  
ATOM   200   C  CA   . MET A 1 17 ? -14.034 -6.885  0.929   1.00 0.00 ? 17  MET A CA   1  
ATOM   201   C  C    . MET A 1 17 ? -12.606 -6.429  1.215   1.00 0.00 ? 17  MET A C    1  
ATOM   202   O  O    . MET A 1 17 ? -11.655 -7.192  1.047   1.00 0.00 ? 17  MET A O    1  
ATOM   203   C  CB   . MET A 1 17 ? -14.497 -7.859  2.014   1.00 0.00 ? 17  MET A CB   1  
ATOM   204   C  CG   . MET A 1 17 ? -13.492 -8.959  2.313   1.00 0.00 ? 17  MET A CG   1  
ATOM   205   S  SD   . MET A 1 17 ? -14.277 -10.491 2.850   1.00 0.00 ? 17  MET A SD   1  
ATOM   206   C  CE   . MET A 1 17 ? -15.420 -9.871  4.083   1.00 0.00 ? 17  MET A CE   1  
ATOM   207   H  H    . MET A 1 17 ? -14.433 -8.438  -0.452  1.00 0.00 ? 17  MET A H    1  
ATOM   208   H  HA   . MET A 1 17 ? -14.682 -6.022  0.932   1.00 0.00 ? 17  MET A HA   1  
ATOM   209   H  HB2  . MET A 1 17 ? -14.676 -7.307  2.925   1.00 0.00 ? 17  MET A HB2  1  
ATOM   210   H  HB3  . MET A 1 17 ? -15.420 -8.322  1.696   1.00 0.00 ? 17  MET A HB3  1  
ATOM   211   H  HG2  . MET A 1 17 ? -12.920 -9.159  1.419   1.00 0.00 ? 17  MET A HG2  1  
ATOM   212   H  HG3  . MET A 1 17 ? -12.827 -8.618  3.093   1.00 0.00 ? 17  MET A HG3  1  
ATOM   213   H  HE1  . MET A 1 17 ? -15.982 -9.046  3.670   1.00 0.00 ? 17  MET A HE1  1  
ATOM   214   H  HE2  . MET A 1 17 ? -16.098 -10.660 4.373   1.00 0.00 ? 17  MET A HE2  1  
ATOM   215   H  HE3  . MET A 1 17 ? -14.867 -9.533  4.948   1.00 0.00 ? 17  MET A HE3  1  
ATOM   216   N  N    . CYS A 1 18 ? -12.464 -5.181  1.647   1.00 0.00 ? 18  CYS A N    1  
ATOM   217   C  CA   . CYS A 1 18 ? -11.153 -4.623  1.956   1.00 0.00 ? 18  CYS A CA   1  
ATOM   218   C  C    . CYS A 1 18 ? -10.410 -5.501  2.959   1.00 0.00 ? 18  CYS A C    1  
ATOM   219   O  O    . CYS A 1 18 ? -11.022 -6.282  3.687   1.00 0.00 ? 18  CYS A O    1  
ATOM   220   C  CB   . CYS A 1 18 ? -11.297 -3.204  2.511   1.00 0.00 ? 18  CYS A CB   1  
ATOM   221   S  SG   . CYS A 1 18 ? -9.722  -2.438  3.011   1.00 0.00 ? 18  CYS A SG   1  
ATOM   222   H  H    . CYS A 1 18 ? -13.260 -4.620  1.762   1.00 0.00 ? 18  CYS A H    1  
ATOM   223   H  HA   . CYS A 1 18 ? -10.584 -4.585  1.039   1.00 0.00 ? 18  CYS A HA   1  
ATOM   224   H  HB2  . CYS A 1 18 ? -11.742 -2.574  1.755   1.00 0.00 ? 18  CYS A HB2  1  
ATOM   225   H  HB3  . CYS A 1 18 ? -11.941 -3.229  3.377   1.00 0.00 ? 18  CYS A HB3  1  
ATOM   226   N  N    . ASP A 1 19 ? -9.089  -5.365  2.991   1.00 0.00 ? 19  ASP A N    1  
ATOM   227   C  CA   . ASP A 1 19 ? -8.262  -6.144  3.905   1.00 0.00 ? 19  ASP A CA   1  
ATOM   228   C  C    . ASP A 1 19 ? -7.916  -5.333  5.150   1.00 0.00 ? 19  ASP A C    1  
ATOM   229   O  O    . ASP A 1 19 ? -7.943  -5.848  6.268   1.00 0.00 ? 19  ASP A O    1  
ATOM   230   C  CB   . ASP A 1 19 ? -6.981  -6.600  3.205   1.00 0.00 ? 19  ASP A CB   1  
ATOM   231   C  CG   . ASP A 1 19 ? -5.977  -7.201  4.170   1.00 0.00 ? 19  ASP A CG   1  
ATOM   232   O  OD1  . ASP A 1 19 ? -6.404  -7.717  5.224   1.00 0.00 ? 19  ASP A OD1  1  
ATOM   233   O  OD2  . ASP A 1 19 ? -4.766  -7.155  3.871   1.00 0.00 ? 19  ASP A OD2  1  
ATOM   234   H  H    . ASP A 1 19 ? -8.659  -4.725  2.385   1.00 0.00 ? 19  ASP A H    1  
ATOM   235   H  HA   . ASP A 1 19 ? -8.827  -7.014  4.204   1.00 0.00 ? 19  ASP A HA   1  
ATOM   236   H  HB2  . ASP A 1 19 ? -7.229  -7.345  2.463   1.00 0.00 ? 19  ASP A HB2  1  
ATOM   237   H  HB3  . ASP A 1 19 ? -6.523  -5.752  2.719   1.00 0.00 ? 19  ASP A HB3  1  
ATOM   238   N  N    . LYS A 1 20 ? -7.589  -4.061  4.949   1.00 0.00 ? 20  LYS A N    1  
ATOM   239   C  CA   . LYS A 1 20 ? -7.237  -3.177  6.054   1.00 0.00 ? 20  LYS A CA   1  
ATOM   240   C  C    . LYS A 1 20 ? -8.334  -3.168  7.114   1.00 0.00 ? 20  LYS A C    1  
ATOM   241   O  O    . LYS A 1 20 ? -8.094  -3.509  8.272   1.00 0.00 ? 20  LYS A O    1  
ATOM   242   C  CB   . LYS A 1 20 ? -6.997  -1.756  5.540   1.00 0.00 ? 20  LYS A CB   1  
ATOM   243   C  CG   . LYS A 1 20 ? -6.330  -0.846  6.557   1.00 0.00 ? 20  LYS A CG   1  
ATOM   244   C  CD   . LYS A 1 20 ? -5.437  0.183   5.884   1.00 0.00 ? 20  LYS A CD   1  
ATOM   245   C  CE   . LYS A 1 20 ? -4.984  1.254   6.864   1.00 0.00 ? 20  LYS A CE   1  
ATOM   246   N  NZ   . LYS A 1 20 ? -6.020  2.307   7.054   1.00 0.00 ? 20  LYS A NZ   1  
ATOM   247   H  H    . LYS A 1 20 ? -7.585  -3.708  4.034   1.00 0.00 ? 20  LYS A H    1  
ATOM   248   H  HA   . LYS A 1 20 ? -6.326  -3.548  6.498   1.00 0.00 ? 20  LYS A HA   1  
ATOM   249   H  HB2  . LYS A 1 20 ? -6.368  -1.804  4.664   1.00 0.00 ? 20  LYS A HB2  1  
ATOM   250   H  HB3  . LYS A 1 20 ? -7.948  -1.319  5.267   1.00 0.00 ? 20  LYS A HB3  1  
ATOM   251   H  HG2  . LYS A 1 20 ? -7.093  -0.330  7.121   1.00 0.00 ? 20  LYS A HG2  1  
ATOM   252   H  HG3  . LYS A 1 20 ? -5.730  -1.447  7.226   1.00 0.00 ? 20  LYS A HG3  1  
ATOM   253   H  HD2  . LYS A 1 20 ? -4.567  -0.315  5.484   1.00 0.00 ? 20  LYS A HD2  1  
ATOM   254   H  HD3  . LYS A 1 20 ? -5.987  0.652   5.080   1.00 0.00 ? 20  LYS A HD3  1  
ATOM   255   H  HE2  . LYS A 1 20 ? -4.778  0.788   7.816   1.00 0.00 ? 20  LYS A HE2  1  
ATOM   256   H  HE3  . LYS A 1 20 ? -4.082  1.712   6.485   1.00 0.00 ? 20  LYS A HE3  1  
ATOM   257   H  HZ1  . LYS A 1 20 ? -6.929  1.988   6.663   1.00 0.00 ? 20  LYS A HZ1  1  
ATOM   258   H  HZ2  . LYS A 1 20 ? -5.734  3.181   6.568   1.00 0.00 ? 20  LYS A HZ2  1  
ATOM   259   H  HZ3  . LYS A 1 20 ? -6.142  2.510   8.066   1.00 0.00 ? 20  LYS A HZ3  1  
ATOM   260   N  N    . CYS A 1 21 ? -9.538  -2.776  6.710   1.00 0.00 ? 21  CYS A N    1  
ATOM   261   C  CA   . CYS A 1 21 ? -10.672 -2.724  7.624   1.00 0.00 ? 21  CYS A CA   1  
ATOM   262   C  C    . CYS A 1 21 ? -11.427 -4.050  7.631   1.00 0.00 ? 21  CYS A C    1  
ATOM   263   O  O    . CYS A 1 21 ? -11.594 -4.676  8.677   1.00 0.00 ? 21  CYS A O    1  
ATOM   264   C  CB   . CYS A 1 21 ? -11.618 -1.588  7.231   1.00 0.00 ? 21  CYS A CB   1  
ATOM   265   S  SG   . CYS A 1 21 ? -11.878 -1.424  5.435   1.00 0.00 ? 21  CYS A SG   1  
ATOM   266   H  H    . CYS A 1 21 ? -9.667  -2.516  5.773   1.00 0.00 ? 21  CYS A H    1  
ATOM   267   H  HA   . CYS A 1 21 ? -10.290 -2.536  8.616   1.00 0.00 ? 21  CYS A HA   1  
ATOM   268   H  HB2  . CYS A 1 21 ? -12.582 -1.758  7.687   1.00 0.00 ? 21  CYS A HB2  1  
ATOM   269   H  HB3  . CYS A 1 21 ? -11.216 -0.653  7.592   1.00 0.00 ? 21  CYS A HB3  1  
ATOM   270   N  N    . GLY A 1 22 ? -11.881 -4.472  6.455   1.00 0.00 ? 22  GLY A N    1  
ATOM   271   C  CA   . GLY A 1 22 ? -12.613 -5.721  6.347   1.00 0.00 ? 22  GLY A CA   1  
ATOM   272   C  C    . GLY A 1 22 ? -14.090 -5.507  6.082   1.00 0.00 ? 22  GLY A C    1  
ATOM   273   O  O    . GLY A 1 22 ? -14.940 -5.979  6.838   1.00 0.00 ? 22  GLY A O    1  
ATOM   274   H  H    . GLY A 1 22 ? -11.718 -3.931  5.654   1.00 0.00 ? 22  GLY A H    1  
ATOM   275   H  HA2  . GLY A 1 22 ? -12.193 -6.303  5.540   1.00 0.00 ? 22  GLY A HA2  1  
ATOM   276   H  HA3  . GLY A 1 22 ? -12.501 -6.271  7.270   1.00 0.00 ? 22  GLY A HA3  1  
ATOM   277   N  N    . THR A 1 23 ? -14.398 -4.790  5.005   1.00 0.00 ? 23  THR A N    1  
ATOM   278   C  CA   . THR A 1 23 ? -15.782 -4.512  4.644   1.00 0.00 ? 23  THR A CA   1  
ATOM   279   C  C    . THR A 1 23 ? -15.980 -4.578  3.134   1.00 0.00 ? 23  THR A C    1  
ATOM   280   O  O    . THR A 1 23 ? -15.116 -4.158  2.366   1.00 0.00 ? 23  THR A O    1  
ATOM   281   C  CB   . THR A 1 23 ? -16.227 -3.126  5.148   1.00 0.00 ? 23  THR A CB   1  
ATOM   282   O  OG1  . THR A 1 23 ? -15.414 -2.106  4.557   1.00 0.00 ? 23  THR A OG1  1  
ATOM   283   C  CG2  . THR A 1 23 ? -16.128 -3.045  6.664   1.00 0.00 ? 23  THR A CG2  1  
ATOM   284   H  H    . THR A 1 23 ? -13.677 -4.441  4.442   1.00 0.00 ? 23  THR A H    1  
ATOM   285   H  HA   . THR A 1 23 ? -16.406 -5.259  5.112   1.00 0.00 ? 23  THR A HA   1  
ATOM   286   H  HB   . THR A 1 23 ? -17.256 -2.968  4.860   1.00 0.00 ? 23  THR A HB   1  
ATOM   287   H  HG1  . THR A 1 23 ? -14.670 -1.916  5.133   1.00 0.00 ? 23  THR A HG1  1  
ATOM   288   H  HG21 . THR A 1 23 ? -16.054 -4.041  7.074   1.00 0.00 ? 23  THR A HG21 1  
ATOM   289   H  HG22 . THR A 1 23 ? -17.009 -2.558  7.056   1.00 0.00 ? 23  THR A HG22 1  
ATOM   290   H  HG23 . THR A 1 23 ? -15.252 -2.477  6.938   1.00 0.00 ? 23  THR A HG23 1  
ATOM   291   N  N    . GLY A 1 24 ? -17.125 -5.108  2.714   1.00 0.00 ? 24  GLY A N    1  
ATOM   292   C  CA   . GLY A 1 24 ? -17.415 -5.218  1.296   1.00 0.00 ? 24  GLY A CA   1  
ATOM   293   C  C    . GLY A 1 24 ? -17.182 -3.918  0.553   1.00 0.00 ? 24  GLY A C    1  
ATOM   294   O  O    . GLY A 1 24 ? -17.807 -2.901  0.856   1.00 0.00 ? 24  GLY A O    1  
ATOM   295   H  H    . GLY A 1 24 ? -17.778 -5.426  3.372   1.00 0.00 ? 24  GLY A H    1  
ATOM   296   H  HA2  . GLY A 1 24 ? -16.784 -5.983  0.869   1.00 0.00 ? 24  GLY A HA2  1  
ATOM   297   H  HA3  . GLY A 1 24 ? -18.449 -5.508  1.174   1.00 0.00 ? 24  GLY A HA3  1  
ATOM   298   N  N    . ILE A 1 25 ? -16.277 -3.948  -0.420  1.00 0.00 ? 25  ILE A N    1  
ATOM   299   C  CA   . ILE A 1 25 ? -15.963 -2.763  -1.207  1.00 0.00 ? 25  ILE A CA   1  
ATOM   300   C  C    . ILE A 1 25 ? -17.005 -2.533  -2.296  1.00 0.00 ? 25  ILE A C    1  
ATOM   301   O  O    . ILE A 1 25 ? -17.653 -3.472  -2.759  1.00 0.00 ? 25  ILE A O    1  
ATOM   302   C  CB   . ILE A 1 25 ? -14.571 -2.873  -1.858  1.00 0.00 ? 25  ILE A CB   1  
ATOM   303   C  CG1  . ILE A 1 25 ? -13.501 -3.103  -0.790  1.00 0.00 ? 25  ILE A CG1  1  
ATOM   304   C  CG2  . ILE A 1 25 ? -14.263 -1.619  -2.663  1.00 0.00 ? 25  ILE A CG2  1  
ATOM   305   C  CD1  . ILE A 1 25 ? -12.130 -3.393  -1.361  1.00 0.00 ? 25  ILE A CD1  1  
ATOM   306   H  H    . ILE A 1 25 ? -15.812 -4.788  -0.614  1.00 0.00 ? 25  ILE A H    1  
ATOM   307   H  HA   . ILE A 1 25 ? -15.960 -1.912  -0.541  1.00 0.00 ? 25  ILE A HA   1  
ATOM   308   H  HB   . ILE A 1 25 ? -14.581 -3.713  -2.535  1.00 0.00 ? 25  ILE A HB   1  
ATOM   309   H  HG12 . ILE A 1 25 ? -13.422 -2.222  -0.172  1.00 0.00 ? 25  ILE A HG12 1  
ATOM   310   H  HG13 . ILE A 1 25 ? -13.790 -3.943  -0.176  1.00 0.00 ? 25  ILE A HG13 1  
ATOM   311   H  HG21 . ILE A 1 25 ? -13.194 -1.469  -2.701  1.00 0.00 ? 25  ILE A HG21 1  
ATOM   312   H  HG22 . ILE A 1 25 ? -14.645 -1.733  -3.667  1.00 0.00 ? 25  ILE A HG22 1  
ATOM   313   H  HG23 . ILE A 1 25 ? -14.730 -0.766  -2.195  1.00 0.00 ? 25  ILE A HG23 1  
ATOM   314   H  HD11 . ILE A 1 25 ? -11.641 -2.464  -1.615  1.00 0.00 ? 25  ILE A HD11 1  
ATOM   315   H  HD12 . ILE A 1 25 ? -11.540 -3.924  -0.629  1.00 0.00 ? 25  ILE A HD12 1  
ATOM   316   H  HD13 . ILE A 1 25 ? -12.232 -4.000  -2.249  1.00 0.00 ? 25  ILE A HD13 1  
ATOM   317   N  N    . VAL A 1 26 ? -17.160 -1.277  -2.703  1.00 0.00 ? 26  VAL A N    1  
ATOM   318   C  CA   . VAL A 1 26 ? -18.122 -0.924  -3.741  1.00 0.00 ? 26  VAL A CA   1  
ATOM   319   C  C    . VAL A 1 26 ? -17.628 0.257   -4.568  1.00 0.00 ? 26  VAL A C    1  
ATOM   320   O  O    . VAL A 1 26 ? -17.214 1.280   -4.024  1.00 0.00 ? 26  VAL A O    1  
ATOM   321   C  CB   . VAL A 1 26 ? -19.496 -0.575  -3.138  1.00 0.00 ? 26  VAL A CB   1  
ATOM   322   C  CG1  . VAL A 1 26 ? -19.355 0.506   -2.077  1.00 0.00 ? 26  VAL A CG1  1  
ATOM   323   C  CG2  . VAL A 1 26 ? -20.461 -0.140  -4.230  1.00 0.00 ? 26  VAL A CG2  1  
ATOM   324   H  H    . VAL A 1 26 ? -16.615 -0.572  -2.297  1.00 0.00 ? 26  VAL A H    1  
ATOM   325   H  HA   . VAL A 1 26 ? -18.243 -1.779  -4.389  1.00 0.00 ? 26  VAL A HA   1  
ATOM   326   H  HB   . VAL A 1 26 ? -19.894 -1.462  -2.666  1.00 0.00 ? 26  VAL A HB   1  
ATOM   327   H  HG11 . VAL A 1 26 ? -18.990 1.413   -2.535  1.00 0.00 ? 26  VAL A HG11 1  
ATOM   328   H  HG12 . VAL A 1 26 ? -20.317 0.692   -1.622  1.00 0.00 ? 26  VAL A HG12 1  
ATOM   329   H  HG13 . VAL A 1 26 ? -18.656 0.179   -1.321  1.00 0.00 ? 26  VAL A HG13 1  
ATOM   330   H  HG21 . VAL A 1 26 ? -19.932 0.451   -4.962  1.00 0.00 ? 26  VAL A HG21 1  
ATOM   331   H  HG22 . VAL A 1 26 ? -20.883 -1.013  -4.707  1.00 0.00 ? 26  VAL A HG22 1  
ATOM   332   H  HG23 . VAL A 1 26 ? -21.254 0.450   -3.795  1.00 0.00 ? 26  VAL A HG23 1  
ATOM   333   N  N    . GLY A 1 27 ? -17.675 0.109   -5.889  1.00 0.00 ? 27  GLY A N    1  
ATOM   334   C  CA   . GLY A 1 27 ? -17.230 1.172   -6.771  1.00 0.00 ? 27  GLY A CA   1  
ATOM   335   C  C    . GLY A 1 27 ? -15.731 1.146   -6.999  1.00 0.00 ? 27  GLY A C    1  
ATOM   336   O  O    . GLY A 1 27 ? -15.144 0.082   -7.194  1.00 0.00 ? 27  GLY A O    1  
ATOM   337   H  H    . GLY A 1 27 ? -18.015 -0.729  -6.267  1.00 0.00 ? 27  GLY A H    1  
ATOM   338   H  HA2  . GLY A 1 27 ? -17.730 1.069   -7.722  1.00 0.00 ? 27  GLY A HA2  1  
ATOM   339   H  HA3  . GLY A 1 27 ? -17.500 2.123   -6.335  1.00 0.00 ? 27  GLY A HA3  1  
ATOM   340   N  N    . VAL A 1 28 ? -15.111 2.322   -6.977  1.00 0.00 ? 28  VAL A N    1  
ATOM   341   C  CA   . VAL A 1 28 ? -13.672 2.431   -7.183  1.00 0.00 ? 28  VAL A CA   1  
ATOM   342   C  C    . VAL A 1 28 ? -12.902 1.803   -6.027  1.00 0.00 ? 28  VAL A C    1  
ATOM   343   O  O    . VAL A 1 28 ? -13.270 1.962   -4.863  1.00 0.00 ? 28  VAL A O    1  
ATOM   344   C  CB   . VAL A 1 28 ? -13.236 3.900   -7.338  1.00 0.00 ? 28  VAL A CB   1  
ATOM   345   C  CG1  . VAL A 1 28 ? -13.687 4.720   -6.139  1.00 0.00 ? 28  VAL A CG1  1  
ATOM   346   C  CG2  . VAL A 1 28 ? -11.729 3.992   -7.521  1.00 0.00 ? 28  VAL A CG2  1  
ATOM   347   H  H    . VAL A 1 28 ? -15.634 3.135   -6.817  1.00 0.00 ? 28  VAL A H    1  
ATOM   348   H  HA   . VAL A 1 28 ? -13.425 1.906   -8.095  1.00 0.00 ? 28  VAL A HA   1  
ATOM   349   H  HB   . VAL A 1 28 ? -13.710 4.304   -8.220  1.00 0.00 ? 28  VAL A HB   1  
ATOM   350   H  HG11 . VAL A 1 28 ? -13.812 5.751   -6.434  1.00 0.00 ? 28  VAL A HG11 1  
ATOM   351   H  HG12 . VAL A 1 28 ? -14.626 4.333   -5.770  1.00 0.00 ? 28  VAL A HG12 1  
ATOM   352   H  HG13 . VAL A 1 28 ? -12.941 4.658   -5.360  1.00 0.00 ? 28  VAL A HG13 1  
ATOM   353   H  HG21 . VAL A 1 28 ? -11.453 5.018   -7.716  1.00 0.00 ? 28  VAL A HG21 1  
ATOM   354   H  HG22 . VAL A 1 28 ? -11.235 3.651   -6.622  1.00 0.00 ? 28  VAL A HG22 1  
ATOM   355   H  HG23 . VAL A 1 28 ? -11.428 3.373   -8.353  1.00 0.00 ? 28  VAL A HG23 1  
ATOM   356   N  N    . PHE A 1 29 ? -11.830 1.089   -6.355  1.00 0.00 ? 29  PHE A N    1  
ATOM   357   C  CA   . PHE A 1 29 ? -11.007 0.436   -5.344  1.00 0.00 ? 29  PHE A CA   1  
ATOM   358   C  C    . PHE A 1 29 ? -9.665  0.007   -5.929  1.00 0.00 ? 29  PHE A C    1  
ATOM   359   O  O    . PHE A 1 29 ? -9.455  0.067   -7.140  1.00 0.00 ? 29  PHE A O    1  
ATOM   360   C  CB   . PHE A 1 29 ? -11.737 -0.780  -4.769  1.00 0.00 ? 29  PHE A CB   1  
ATOM   361   C  CG   . PHE A 1 29 ? -12.109 -1.802  -5.806  1.00 0.00 ? 29  PHE A CG   1  
ATOM   362   C  CD1  . PHE A 1 29 ? -11.143 -2.624  -6.364  1.00 0.00 ? 29  PHE A CD1  1  
ATOM   363   C  CD2  . PHE A 1 29 ? -13.423 -1.939  -6.222  1.00 0.00 ? 29  PHE A CD2  1  
ATOM   364   C  CE1  . PHE A 1 29 ? -11.482 -3.566  -7.318  1.00 0.00 ? 29  PHE A CE1  1  
ATOM   365   C  CE2  . PHE A 1 29 ? -13.768 -2.879  -7.175  1.00 0.00 ? 29  PHE A CE2  1  
ATOM   366   C  CZ   . PHE A 1 29 ? -12.796 -3.692  -7.724  1.00 0.00 ? 29  PHE A CZ   1  
ATOM   367   H  H    . PHE A 1 29 ? -11.588 0.998   -7.301  1.00 0.00 ? 29  PHE A H    1  
ATOM   368   H  HA   . PHE A 1 29 ? -10.831 1.147   -4.552  1.00 0.00 ? 29  PHE A HA   1  
ATOM   369   H  HB2  . PHE A 1 29 ? -11.102 -1.262  -4.042  1.00 0.00 ? 29  PHE A HB2  1  
ATOM   370   H  HB3  . PHE A 1 29 ? -12.645 -0.450  -4.286  1.00 0.00 ? 29  PHE A HB3  1  
ATOM   371   H  HD1  . PHE A 1 29 ? -10.115 -2.525  -6.046  1.00 0.00 ? 29  PHE A HD1  1  
ATOM   372   H  HD2  . PHE A 1 29 ? -14.184 -1.303  -5.794  1.00 0.00 ? 29  PHE A HD2  1  
ATOM   373   H  HE1  . PHE A 1 29 ? -10.719 -4.200  -7.745  1.00 0.00 ? 29  PHE A HE1  1  
ATOM   374   H  HE2  . PHE A 1 29 ? -14.795 -2.976  -7.491  1.00 0.00 ? 29  PHE A HE2  1  
ATOM   375   H  HZ   . PHE A 1 29 ? -13.062 -4.428  -8.469  1.00 0.00 ? 29  PHE A HZ   1  
ATOM   376   N  N    . VAL A 1 30 ? -8.758  -0.426  -5.059  1.00 0.00 ? 30  VAL A N    1  
ATOM   377   C  CA   . VAL A 1 30 ? -7.435  -0.865  -5.487  1.00 0.00 ? 30  VAL A CA   1  
ATOM   378   C  C    . VAL A 1 30 ? -7.294  -2.378  -5.370  1.00 0.00 ? 30  VAL A C    1  
ATOM   379   O  O    . VAL A 1 30 ? -7.104  -2.913  -4.277  1.00 0.00 ? 30  VAL A O    1  
ATOM   380   C  CB   . VAL A 1 30 ? -6.324  -0.191  -4.660  1.00 0.00 ? 30  VAL A CB   1  
ATOM   381   C  CG1  . VAL A 1 30 ? -4.954  -0.547  -5.216  1.00 0.00 ? 30  VAL A CG1  1  
ATOM   382   C  CG2  . VAL A 1 30 ? -6.522  1.317   -4.632  1.00 0.00 ? 30  VAL A CG2  1  
ATOM   383   H  H    . VAL A 1 30 ? -8.984  -0.451  -4.105  1.00 0.00 ? 30  VAL A H    1  
ATOM   384   H  HA   . VAL A 1 30 ? -7.308  -0.580  -6.522  1.00 0.00 ? 30  VAL A HA   1  
ATOM   385   H  HB   . VAL A 1 30 ? -6.384  -0.560  -3.647  1.00 0.00 ? 30  VAL A HB   1  
ATOM   386   H  HG11 . VAL A 1 30 ? -4.747  -1.589  -5.022  1.00 0.00 ? 30  VAL A HG11 1  
ATOM   387   H  HG12 . VAL A 1 30 ? -4.940  -0.367  -6.281  1.00 0.00 ? 30  VAL A HG12 1  
ATOM   388   H  HG13 . VAL A 1 30 ? -4.202  0.064   -4.738  1.00 0.00 ? 30  VAL A HG13 1  
ATOM   389   H  HG21 . VAL A 1 30 ? -6.120  1.749   -5.536  1.00 0.00 ? 30  VAL A HG21 1  
ATOM   390   H  HG22 . VAL A 1 30 ? -7.577  1.541   -4.565  1.00 0.00 ? 30  VAL A HG22 1  
ATOM   391   H  HG23 . VAL A 1 30 ? -6.011  1.732   -3.776  1.00 0.00 ? 30  VAL A HG23 1  
ATOM   392   N  N    . LYS A 1 31 ? -7.388  -3.066  -6.503  1.00 0.00 ? 31  LYS A N    1  
ATOM   393   C  CA   . LYS A 1 31 ? -7.269  -4.519  -6.529  1.00 0.00 ? 31  LYS A CA   1  
ATOM   394   C  C    . LYS A 1 31 ? -5.810  -4.947  -6.412  1.00 0.00 ? 31  LYS A C    1  
ATOM   395   O  O    . LYS A 1 31 ? -4.966  -4.539  -7.211  1.00 0.00 ? 31  LYS A O    1  
ATOM   396   C  CB   . LYS A 1 31 ? -7.873  -5.077  -7.820  1.00 0.00 ? 31  LYS A CB   1  
ATOM   397   C  CG   . LYS A 1 31 ? -8.196  -6.559  -7.749  1.00 0.00 ? 31  LYS A CG   1  
ATOM   398   C  CD   . LYS A 1 31 ? -7.027  -7.408  -8.222  1.00 0.00 ? 31  LYS A CD   1  
ATOM   399   C  CE   . LYS A 1 31 ? -7.212  -8.870  -7.847  1.00 0.00 ? 31  LYS A CE   1  
ATOM   400   N  NZ   . LYS A 1 31 ? -8.040  -9.599  -8.848  1.00 0.00 ? 31  LYS A NZ   1  
ATOM   401   H  H    . LYS A 1 31 ? -7.540  -2.583  -7.343  1.00 0.00 ? 31  LYS A H    1  
ATOM   402   H  HA   . LYS A 1 31 ? -7.817  -4.912  -5.686  1.00 0.00 ? 31  LYS A HA   1  
ATOM   403   H  HB2  . LYS A 1 31 ? -8.785  -4.541  -8.037  1.00 0.00 ? 31  LYS A HB2  1  
ATOM   404   H  HB3  . LYS A 1 31 ? -7.173  -4.921  -8.628  1.00 0.00 ? 31  LYS A HB3  1  
ATOM   405   H  HG2  . LYS A 1 31 ? -8.425  -6.820  -6.726  1.00 0.00 ? 31  LYS A HG2  1  
ATOM   406   H  HG3  . LYS A 1 31 ? -9.053  -6.762  -8.375  1.00 0.00 ? 31  LYS A HG3  1  
ATOM   407   H  HD2  . LYS A 1 31 ? -6.949  -7.330  -9.296  1.00 0.00 ? 31  LYS A HD2  1  
ATOM   408   H  HD3  . LYS A 1 31 ? -6.119  -7.040  -7.765  1.00 0.00 ? 31  LYS A HD3  1  
ATOM   409   H  HE2  . LYS A 1 31 ? -6.242  -9.338  -7.786  1.00 0.00 ? 31  LYS A HE2  1  
ATOM   410   H  HE3  . LYS A 1 31 ? -7.698  -8.922  -6.884  1.00 0.00 ? 31  LYS A HE3  1  
ATOM   411   H  HZ1  . LYS A 1 31 ? -7.985  -9.123  -9.771  1.00 0.00 ? 31  LYS A HZ1  1  
ATOM   412   H  HZ2  . LYS A 1 31 ? -9.034  -9.621  -8.541  1.00 0.00 ? 31  LYS A HZ2  1  
ATOM   413   H  HZ3  . LYS A 1 31 ? -7.698  -10.575 -8.952  1.00 0.00 ? 31  LYS A HZ3  1  
ATOM   414   N  N    . LEU A 1 32 ? -5.520  -5.773  -5.412  1.00 0.00 ? 32  LEU A N    1  
ATOM   415   C  CA   . LEU A 1 32 ? -4.162  -6.258  -5.191  1.00 0.00 ? 32  LEU A CA   1  
ATOM   416   C  C    . LEU A 1 32 ? -3.936  -7.588  -5.904  1.00 0.00 ? 32  LEU A C    1  
ATOM   417   O  O    . LEU A 1 32 ? -4.886  -8.237  -6.343  1.00 0.00 ? 32  LEU A O    1  
ATOM   418   C  CB   . LEU A 1 32 ? -3.894  -6.418  -3.693  1.00 0.00 ? 32  LEU A CB   1  
ATOM   419   C  CG   . LEU A 1 32 ? -3.954  -5.137  -2.860  1.00 0.00 ? 32  LEU A CG   1  
ATOM   420   C  CD1  . LEU A 1 32 ? -4.024  -5.467  -1.377  1.00 0.00 ? 32  LEU A CD1  1  
ATOM   421   C  CD2  . LEU A 1 32 ? -2.752  -4.252  -3.155  1.00 0.00 ? 32  LEU A CD2  1  
ATOM   422   H  H    . LEU A 1 32 ? -6.234  -6.063  -4.808  1.00 0.00 ? 32  LEU A H    1  
ATOM   423   H  HA   . LEU A 1 32 ? -3.478  -5.526  -5.594  1.00 0.00 ? 32  LEU A HA   1  
ATOM   424   H  HB2  . LEU A 1 32 ? -4.627  -7.104  -3.297  1.00 0.00 ? 32  LEU A HB2  1  
ATOM   425   H  HB3  . LEU A 1 32 ? -2.907  -6.843  -3.578  1.00 0.00 ? 32  LEU A HB3  1  
ATOM   426   H  HG   . LEU A 1 32 ? -4.847  -4.587  -3.122  1.00 0.00 ? 32  LEU A HG   1  
ATOM   427   H  HD11 . LEU A 1 32 ? -4.950  -5.981  -1.167  1.00 0.00 ? 32  LEU A HD11 1  
ATOM   428   H  HD12 . LEU A 1 32 ? -3.981  -4.554  -0.803  1.00 0.00 ? 32  LEU A HD12 1  
ATOM   429   H  HD13 . LEU A 1 32 ? -3.191  -6.100  -1.110  1.00 0.00 ? 32  LEU A HD13 1  
ATOM   430   H  HD21 . LEU A 1 32 ? -1.993  -4.833  -3.659  1.00 0.00 ? 32  LEU A HD21 1  
ATOM   431   H  HD22 . LEU A 1 32 ? -2.353  -3.866  -2.228  1.00 0.00 ? 32  LEU A HD22 1  
ATOM   432   H  HD23 . LEU A 1 32 ? -3.055  -3.431  -3.787  1.00 0.00 ? 32  LEU A HD23 1  
ATOM   433   N  N    . ARG A 1 33 ? -2.674  -7.988  -6.013  1.00 0.00 ? 33  ARG A N    1  
ATOM   434   C  CA   . ARG A 1 33 ? -2.323  -9.241  -6.671  1.00 0.00 ? 33  ARG A CA   1  
ATOM   435   C  C    . ARG A 1 33 ? -3.421  -10.283 -6.476  1.00 0.00 ? 33  ARG A C    1  
ATOM   436   O  O    . ARG A 1 33 ? -4.151  -10.612 -7.412  1.00 0.00 ? 33  ARG A O    1  
ATOM   437   C  CB   . ARG A 1 33 ? -0.997  -9.774  -6.127  1.00 0.00 ? 33  ARG A CB   1  
ATOM   438   C  CG   . ARG A 1 33 ? -0.221  -10.614 -7.129  1.00 0.00 ? 33  ARG A CG   1  
ATOM   439   C  CD   . ARG A 1 33 ? 0.706   -11.598 -6.432  1.00 0.00 ? 33  ARG A CD   1  
ATOM   440   N  NE   . ARG A 1 33 ? 1.745   -12.098 -7.327  1.00 0.00 ? 33  ARG A NE   1  
ATOM   441   C  CZ   . ARG A 1 33 ? 2.200   -13.346 -7.299  1.00 0.00 ? 33  ARG A CZ   1  
ATOM   442   N  NH1  . ARG A 1 33 ? 1.709   -14.215 -6.427  1.00 0.00 ? 33  ARG A NH1  1  
ATOM   443   N  NH2  . ARG A 1 33 ? 3.148   -13.727 -8.146  1.00 0.00 ? 33  ARG A NH2  1  
ATOM   444   H  H    . ARG A 1 33 ? -1.960  -7.427  -5.642  1.00 0.00 ? 33  ARG A H    1  
ATOM   445   H  HA   . ARG A 1 33 ? -2.215  -9.042  -7.727  1.00 0.00 ? 33  ARG A HA   1  
ATOM   446   H  HB2  . ARG A 1 33 ? -0.378  -8.938  -5.836  1.00 0.00 ? 33  ARG A HB2  1  
ATOM   447   H  HB3  . ARG A 1 33 ? -1.197  -10.383 -5.258  1.00 0.00 ? 33  ARG A HB3  1  
ATOM   448   H  HG2  . ARG A 1 33 ? -0.920  -11.166 -7.740  1.00 0.00 ? 33  ARG A HG2  1  
ATOM   449   H  HG3  . ARG A 1 33 ? 0.367   -9.959  -7.754  1.00 0.00 ? 33  ARG A HG3  1  
ATOM   450   H  HD2  . ARG A 1 33 ? 1.173   -11.100 -5.595  1.00 0.00 ? 33  ARG A HD2  1  
ATOM   451   H  HD3  . ARG A 1 33 ? 0.120   -12.431 -6.073  1.00 0.00 ? 33  ARG A HD3  1  
ATOM   452   H  HE   . ARG A 1 33 ? 2.122   -11.473 -7.979  1.00 0.00 ? 33  ARG A HE   1  
ATOM   453   H  HH11 . ARG A 1 33 ? 0.994   -13.932 -5.789  1.00 0.00 ? 33  ARG A HH11 1  
ATOM   454   H  HH12 . ARG A 1 33 ? 2.052   -15.155 -6.409  1.00 0.00 ? 33  ARG A HH12 1  
ATOM   455   H  HH21 . ARG A 1 33 ? 3.521   -13.074 -8.806  1.00 0.00 ? 33  ARG A HH21 1  
ATOM   456   H  HH22 . ARG A 1 33 ? 3.489   -14.666 -8.125  1.00 0.00 ? 33  ARG A HH22 1  
ATOM   457   N  N    . ASP A 1 34 ? -3.531  -10.797 -5.257  1.00 0.00 ? 34  ASP A N    1  
ATOM   458   C  CA   . ASP A 1 34 ? -4.539  -11.802 -4.939  1.00 0.00 ? 34  ASP A CA   1  
ATOM   459   C  C    . ASP A 1 34 ? -5.505  -11.285 -3.877  1.00 0.00 ? 34  ASP A C    1  
ATOM   460   O  O    . ASP A 1 34 ? -6.452  -11.973 -3.497  1.00 0.00 ? 34  ASP A O    1  
ATOM   461   C  CB   . ASP A 1 34 ? -3.872  -13.090 -4.455  1.00 0.00 ? 34  ASP A CB   1  
ATOM   462   C  CG   . ASP A 1 34 ? -2.953  -13.693 -5.499  1.00 0.00 ? 34  ASP A CG   1  
ATOM   463   O  OD1  . ASP A 1 34 ? -2.005  -13.001 -5.926  1.00 0.00 ? 34  ASP A OD1  1  
ATOM   464   O  OD2  . ASP A 1 34 ? -3.181  -14.857 -5.889  1.00 0.00 ? 34  ASP A OD2  1  
ATOM   465   H  H    . ASP A 1 34 ? -2.920  -10.494 -4.553  1.00 0.00 ? 34  ASP A H    1  
ATOM   466   H  HA   . ASP A 1 34 ? -5.095  -12.011 -5.841  1.00 0.00 ? 34  ASP A HA   1  
ATOM   467   H  HB2  . ASP A 1 34 ? -3.290  -12.876 -3.571  1.00 0.00 ? 34  ASP A HB2  1  
ATOM   468   H  HB3  . ASP A 1 34 ? -4.636  -13.814 -4.212  1.00 0.00 ? 34  ASP A HB3  1  
ATOM   469   N  N    . ARG A 1 35 ? -5.258  -10.069 -3.401  1.00 0.00 ? 35  ARG A N    1  
ATOM   470   C  CA   . ARG A 1 35 ? -6.104  -9.461  -2.382  1.00 0.00 ? 35  ARG A CA   1  
ATOM   471   C  C    . ARG A 1 35 ? -6.778  -8.200  -2.915  1.00 0.00 ? 35  ARG A C    1  
ATOM   472   O  O    . ARG A 1 35 ? -6.516  -7.772  -4.040  1.00 0.00 ? 35  ARG A O    1  
ATOM   473   C  CB   . ARG A 1 35 ? -5.279  -9.123  -1.138  1.00 0.00 ? 35  ARG A CB   1  
ATOM   474   C  CG   . ARG A 1 35 ? -4.740  -10.346 -0.415  1.00 0.00 ? 35  ARG A CG   1  
ATOM   475   C  CD   . ARG A 1 35 ? -5.852  -11.120 0.276   1.00 0.00 ? 35  ARG A CD   1  
ATOM   476   N  NE   . ARG A 1 35 ? -6.432  -10.371 1.387   1.00 0.00 ? 35  ARG A NE   1  
ATOM   477   C  CZ   . ARG A 1 35 ? -7.458  -10.805 2.110   1.00 0.00 ? 35  ARG A CZ   1  
ATOM   478   N  NH1  . ARG A 1 35 ? -8.015  -11.977 1.839   1.00 0.00 ? 35  ARG A NH1  1  
ATOM   479   N  NH2  . ARG A 1 35 ? -7.930  -10.065 3.105   1.00 0.00 ? 35  ARG A NH2  1  
ATOM   480   H  H    . ARG A 1 35 ? -4.488  -9.569  -3.743  1.00 0.00 ? 35  ARG A H    1  
ATOM   481   H  HA   . ARG A 1 35 ? -6.867  -10.176 -2.113  1.00 0.00 ? 35  ARG A HA   1  
ATOM   482   H  HB2  . ARG A 1 35 ? -4.441  -8.508  -1.433  1.00 0.00 ? 35  ARG A HB2  1  
ATOM   483   H  HB3  . ARG A 1 35 ? -5.898  -8.568  -0.450  1.00 0.00 ? 35  ARG A HB3  1  
ATOM   484   H  HG2  . ARG A 1 35 ? -4.257  -10.994 -1.132  1.00 0.00 ? 35  ARG A HG2  1  
ATOM   485   H  HG3  . ARG A 1 35 ? -4.021  -10.027 0.325   1.00 0.00 ? 35  ARG A HG3  1  
ATOM   486   H  HD2  . ARG A 1 35 ? -6.626  -11.332 -0.446  1.00 0.00 ? 35  ARG A HD2  1  
ATOM   487   H  HD3  . ARG A 1 35 ? -5.446  -12.048 0.652   1.00 0.00 ? 35  ARG A HD3  1  
ATOM   488   H  HE   . ARG A 1 35 ? -6.036  -9.502  1.604   1.00 0.00 ? 35  ARG A HE   1  
ATOM   489   H  HH11 . ARG A 1 35 ? -7.661  -12.537 1.090   1.00 0.00 ? 35  ARG A HH11 1  
ATOM   490   H  HH12 . ARG A 1 35 ? -8.787  -12.302 2.386   1.00 0.00 ? 35  ARG A HH12 1  
ATOM   491   H  HH21 . ARG A 1 35 ? -7.513  -9.181  3.312   1.00 0.00 ? 35  ARG A HH21 1  
ATOM   492   H  HH22 . ARG A 1 35 ? -8.703  -10.392 3.648   1.00 0.00 ? 35  ARG A HH22 1  
ATOM   493   N  N    . HIS A 1 36 ? -7.648  -7.611  -2.101  1.00 0.00 ? 36  HIS A N    1  
ATOM   494   C  CA   . HIS A 1 36 ? -8.360  -6.399  -2.492  1.00 0.00 ? 36  HIS A CA   1  
ATOM   495   C  C    . HIS A 1 36 ? -8.400  -5.398  -1.341  1.00 0.00 ? 36  HIS A C    1  
ATOM   496   O  O    . HIS A 1 36 ? -8.448  -5.782  -0.172  1.00 0.00 ? 36  HIS A O    1  
ATOM   497   C  CB   . HIS A 1 36 ? -9.783  -6.739  -2.936  1.00 0.00 ? 36  HIS A CB   1  
ATOM   498   C  CG   . HIS A 1 36 ? -9.838  -7.598  -4.162  1.00 0.00 ? 36  HIS A CG   1  
ATOM   499   N  ND1  . HIS A 1 36 ? -9.399  -8.905  -4.185  1.00 0.00 ? 36  HIS A ND1  1  
ATOM   500   C  CD2  . HIS A 1 36 ? -10.287 -7.332  -5.411  1.00 0.00 ? 36  HIS A CD2  1  
ATOM   501   C  CE1  . HIS A 1 36 ? -9.573  -9.405  -5.395  1.00 0.00 ? 36  HIS A CE1  1  
ATOM   502   N  NE2  . HIS A 1 36 ? -10.110 -8.470  -6.158  1.00 0.00 ? 36  HIS A NE2  1  
ATOM   503   H  H    . HIS A 1 36 ? -7.815  -7.999  -1.218  1.00 0.00 ? 36  HIS A H    1  
ATOM   504   H  HA   . HIS A 1 36 ? -7.830  -5.955  -3.320  1.00 0.00 ? 36  HIS A HA   1  
ATOM   505   H  HB2  . HIS A 1 36 ? -10.286 -7.266  -2.139  1.00 0.00 ? 36  HIS A HB2  1  
ATOM   506   H  HB3  . HIS A 1 36 ? -10.316 -5.823  -3.148  1.00 0.00 ? 36  HIS A HB3  1  
ATOM   507   H  HD1  . HIS A 1 36 ? -9.015  -9.393  -3.427  1.00 0.00 ? 36  HIS A HD1  1  
ATOM   508   H  HD2  . HIS A 1 36 ? -10.705 -6.397  -5.756  1.00 0.00 ? 36  HIS A HD2  1  
ATOM   509   H  HE1  . HIS A 1 36 ? -9.319  -10.406 -5.709  1.00 0.00 ? 36  HIS A HE1  1  
ATOM   510   H  HE2  . HIS A 1 36 ? -10.264 -8.548  -7.123  1.00 0.00 ? 36  HIS A HE2  1  
ATOM   511   N  N    . ARG A 1 37 ? -8.379  -4.113  -1.680  1.00 0.00 ? 37  ARG A N    1  
ATOM   512   C  CA   . ARG A 1 37 ? -8.410  -3.057  -0.675  1.00 0.00 ? 37  ARG A CA   1  
ATOM   513   C  C    . ARG A 1 37 ? -9.158  -1.833  -1.196  1.00 0.00 ? 37  ARG A C    1  
ATOM   514   O  O    . ARG A 1 37 ? -9.441  -1.727  -2.390  1.00 0.00 ? 37  ARG A O    1  
ATOM   515   C  CB   . ARG A 1 37 ? -6.987  -2.665  -0.272  1.00 0.00 ? 37  ARG A CB   1  
ATOM   516   C  CG   . ARG A 1 37 ? -6.446  -3.461  0.904   1.00 0.00 ? 37  ARG A CG   1  
ATOM   517   C  CD   . ARG A 1 37 ? -5.464  -2.642  1.726   1.00 0.00 ? 37  ARG A CD   1  
ATOM   518   N  NE   . ARG A 1 37 ? -5.008  -3.363  2.912   1.00 0.00 ? 37  ARG A NE   1  
ATOM   519   C  CZ   . ARG A 1 37 ? -3.974  -4.196  2.914   1.00 0.00 ? 37  ARG A CZ   1  
ATOM   520   N  NH1  . ARG A 1 37 ? -3.290  -4.411  1.799   1.00 0.00 ? 37  ARG A NH1  1  
ATOM   521   N  NH2  . ARG A 1 37 ? -3.620  -4.814  4.034   1.00 0.00 ? 37  ARG A NH2  1  
ATOM   522   H  H    . ARG A 1 37 ? -8.340  -3.869  -2.628  1.00 0.00 ? 37  ARG A H    1  
ATOM   523   H  HA   . ARG A 1 37 ? -8.928  -3.439  0.192   1.00 0.00 ? 37  ARG A HA   1  
ATOM   524   H  HB2  . ARG A 1 37 ? -6.331  -2.819  -1.116  1.00 0.00 ? 37  ARG A HB2  1  
ATOM   525   H  HB3  . ARG A 1 37 ? -6.977  -1.619  -0.005  1.00 0.00 ? 37  ARG A HB3  1  
ATOM   526   H  HG2  . ARG A 1 37 ? -7.270  -3.756  1.537   1.00 0.00 ? 37  ARG A HG2  1  
ATOM   527   H  HG3  . ARG A 1 37 ? -5.944  -4.341  0.530   1.00 0.00 ? 37  ARG A HG3  1  
ATOM   528   H  HD2  . ARG A 1 37 ? -4.609  -2.406  1.111   1.00 0.00 ? 37  ARG A HD2  1  
ATOM   529   H  HD3  . ARG A 1 37 ? -5.948  -1.728  2.035   1.00 0.00 ? 37  ARG A HD3  1  
ATOM   530   H  HE   . ARG A 1 37 ? -5.500  -3.219  3.747   1.00 0.00 ? 37  ARG A HE   1  
ATOM   531   H  HH11 . ARG A 1 37 ? -3.553  -3.946  0.954   1.00 0.00 ? 37  ARG A HH11 1  
ATOM   532   H  HH12 . ARG A 1 37 ? -2.510  -5.038  1.803   1.00 0.00 ? 37  ARG A HH12 1  
ATOM   533   H  HH21 . ARG A 1 37 ? -4.133  -4.654  4.876   1.00 0.00 ? 37  ARG A HH21 1  
ATOM   534   H  HH22 . ARG A 1 37 ? -2.842  -5.441  4.034   1.00 0.00 ? 37  ARG A HH22 1  
ATOM   535   N  N    . HIS A 1 38 ? -9.477  -0.912  -0.292  1.00 0.00 ? 38  HIS A N    1  
ATOM   536   C  CA   . HIS A 1 38 ? -10.192 0.305   -0.660  1.00 0.00 ? 38  HIS A CA   1  
ATOM   537   C  C    . HIS A 1 38 ? -9.247  1.319   -1.296  1.00 0.00 ? 38  HIS A C    1  
ATOM   538   O  O    . HIS A 1 38 ? -8.026  1.237   -1.161  1.00 0.00 ? 38  HIS A O    1  
ATOM   539   C  CB   . HIS A 1 38 ? -10.865 0.917   0.569   1.00 0.00 ? 38  HIS A CB   1  
ATOM   540   C  CG   . HIS A 1 38 ? -12.191 0.303   0.895   1.00 0.00 ? 38  HIS A CG   1  
ATOM   541   N  ND1  . HIS A 1 38 ? -12.423 -0.418  2.048   1.00 0.00 ? 38  HIS A ND1  1  
ATOM   542   C  CD2  . HIS A 1 38 ? -13.360 0.305   0.213   1.00 0.00 ? 38  HIS A CD2  1  
ATOM   543   C  CE1  . HIS A 1 38 ? -13.678 -0.833  2.059   1.00 0.00 ? 38  HIS A CE1  1  
ATOM   544   N  NE2  . HIS A 1 38 ? -14.268 -0.407  0.957   1.00 0.00 ? 38  HIS A NE2  1  
ATOM   545   H  H    . HIS A 1 38 ? -9.224  -1.054  0.644   1.00 0.00 ? 38  HIS A H    1  
ATOM   546   H  HA   . HIS A 1 38 ? -10.952 0.038   -1.379  1.00 0.00 ? 38  HIS A HA   1  
ATOM   547   H  HB2  . HIS A 1 38 ? -10.220 0.788   1.426   1.00 0.00 ? 38  HIS A HB2  1  
ATOM   548   H  HB3  . HIS A 1 38 ? -11.020 1.973   0.398   1.00 0.00 ? 38  HIS A HB3  1  
ATOM   549   H  HD2  . HIS A 1 38 ? -13.545 0.779   -0.741  1.00 0.00 ? 38  HIS A HD2  1  
ATOM   550   H  HE1  . HIS A 1 38 ? -14.142 -1.420  2.837   1.00 0.00 ? 38  HIS A HE1  1  
ATOM   551   H  HE2  . HIS A 1 38 ? -15.174 -0.647  0.674   1.00 0.00 ? 38  HIS A HE2  1  
ATOM   552   N  N    . PRO A 1 39 ? -9.823  2.300   -2.008  1.00 0.00 ? 39  PRO A N    1  
ATOM   553   C  CA   . PRO A 1 39 ? -9.050  3.349   -2.680  1.00 0.00 ? 39  PRO A CA   1  
ATOM   554   C  C    . PRO A 1 39 ? -8.401  4.313   -1.693  1.00 0.00 ? 39  PRO A C    1  
ATOM   555   O  O    . PRO A 1 39 ? -7.565  5.132   -2.071  1.00 0.00 ? 39  PRO A O    1  
ATOM   556   C  CB   . PRO A 1 39 ? -10.099 4.075   -3.526  1.00 0.00 ? 39  PRO A CB   1  
ATOM   557   C  CG   . PRO A 1 39 ? -11.390 3.828   -2.823  1.00 0.00 ? 39  PRO A CG   1  
ATOM   558   C  CD   . PRO A 1 39 ? -11.273 2.460   -2.211  1.00 0.00 ? 39  PRO A CD   1  
ATOM   559   H  HA   . PRO A 1 39 ? -8.292  2.931   -3.325  1.00 0.00 ? 39  PRO A HA   1  
ATOM   560   H  HB2  . PRO A 1 39 ? -9.866  5.130   -3.566  1.00 0.00 ? 39  PRO A HB2  1  
ATOM   561   H  HB3  . PRO A 1 39 ? -10.109 3.665   -4.524  1.00 0.00 ? 39  PRO A HB3  1  
ATOM   562   H  HG2  . PRO A 1 39 ? -11.537 4.572   -2.055  1.00 0.00 ? 39  PRO A HG2  1  
ATOM   563   H  HG3  . PRO A 1 39 ? -12.204 3.853   -3.533  1.00 0.00 ? 39  PRO A HG3  1  
ATOM   564   H  HD2  . PRO A 1 39 ? -11.801 2.421   -1.270  1.00 0.00 ? 39  PRO A HD2  1  
ATOM   565   H  HD3  . PRO A 1 39 ? -11.652 1.710   -2.890  1.00 0.00 ? 39  PRO A HD3  1  
ATOM   566   N  N    . GLU A 1 40 ? -8.793  4.209   -0.426  1.00 0.00 ? 40  GLU A N    1  
ATOM   567   C  CA   . GLU A 1 40 ? -8.248  5.073   0.614   1.00 0.00 ? 40  GLU A CA   1  
ATOM   568   C  C    . GLU A 1 40 ? -7.393  4.273   1.593   1.00 0.00 ? 40  GLU A C    1  
ATOM   569   O  O    . GLU A 1 40 ? -6.486  4.813   2.227   1.00 0.00 ? 40  GLU A O    1  
ATOM   570   C  CB   . GLU A 1 40 ? -9.379  5.778   1.366   1.00 0.00 ? 40  GLU A CB   1  
ATOM   571   C  CG   . GLU A 1 40 ? -10.329 4.824   2.071   1.00 0.00 ? 40  GLU A CG   1  
ATOM   572   C  CD   . GLU A 1 40 ? -11.036 5.468   3.247   1.00 0.00 ? 40  GLU A CD   1  
ATOM   573   O  OE1  . GLU A 1 40 ? -11.636 6.548   3.060   1.00 0.00 ? 40  GLU A OE1  1  
ATOM   574   O  OE2  . GLU A 1 40 ? -10.991 4.893   4.355   1.00 0.00 ? 40  GLU A OE2  1  
ATOM   575   H  H    . GLU A 1 40 ? -9.464  3.536   -0.187  1.00 0.00 ? 40  GLU A H    1  
ATOM   576   H  HA   . GLU A 1 40 ? -7.628  5.816   0.137   1.00 0.00 ? 40  GLU A HA   1  
ATOM   577   H  HB2  . GLU A 1 40 ? -8.948  6.436   2.106   1.00 0.00 ? 40  GLU A HB2  1  
ATOM   578   H  HB3  . GLU A 1 40 ? -9.950  6.367   0.663   1.00 0.00 ? 40  GLU A HB3  1  
ATOM   579   H  HG2  . GLU A 1 40 ? -11.072 4.489   1.363   1.00 0.00 ? 40  GLU A HG2  1  
ATOM   580   H  HG3  . GLU A 1 40 ? -9.766  3.975   2.429   1.00 0.00 ? 40  GLU A HG3  1  
ATOM   581   N  N    . CYS A 1 41 ? -7.690  2.983   1.712   1.00 0.00 ? 41  CYS A N    1  
ATOM   582   C  CA   . CYS A 1 41 ? -6.950  2.108   2.613   1.00 0.00 ? 41  CYS A CA   1  
ATOM   583   C  C    . CYS A 1 41 ? -5.616  1.695   1.998   1.00 0.00 ? 41  CYS A C    1  
ATOM   584   O  O    . CYS A 1 41 ? -4.648  1.429   2.710   1.00 0.00 ? 41  CYS A O    1  
ATOM   585   C  CB   . CYS A 1 41 ? -7.778  0.865   2.943   1.00 0.00 ? 41  CYS A CB   1  
ATOM   586   S  SG   . CYS A 1 41 ? -9.335  1.219   3.820   1.00 0.00 ? 41  CYS A SG   1  
ATOM   587   H  H    . CYS A 1 41 ? -8.424  2.610   1.179   1.00 0.00 ? 41  CYS A H    1  
ATOM   588   H  HA   . CYS A 1 41 ? -6.759  2.654   3.524   1.00 0.00 ? 41  CYS A HA   1  
ATOM   589   H  HB2  . CYS A 1 41 ? -8.029  0.354   2.024   1.00 0.00 ? 41  CYS A HB2  1  
ATOM   590   H  HB3  . CYS A 1 41 ? -7.192  0.206   3.567   1.00 0.00 ? 41  CYS A HB3  1  
ATOM   591   N  N    . TYR A 1 42 ? -5.573  1.645   0.671   1.00 0.00 ? 42  TYR A N    1  
ATOM   592   C  CA   . TYR A 1 42 ? -4.359  1.263   -0.041  1.00 0.00 ? 42  TYR A CA   1  
ATOM   593   C  C    . TYR A 1 42 ? -3.135  1.940   0.568   1.00 0.00 ? 42  TYR A C    1  
ATOM   594   O  O    . TYR A 1 42 ? -2.008  1.470   0.410   1.00 0.00 ? 42  TYR A O    1  
ATOM   595   C  CB   . TYR A 1 42 ? -4.475  1.628   -1.522  1.00 0.00 ? 42  TYR A CB   1  
ATOM   596   C  CG   . TYR A 1 42 ? -3.271  1.222   -2.341  1.00 0.00 ? 42  TYR A CG   1  
ATOM   597   C  CD1  . TYR A 1 42 ? -2.673  -0.020  -2.165  1.00 0.00 ? 42  TYR A CD1  1  
ATOM   598   C  CD2  . TYR A 1 42 ? -2.731  2.080   -3.291  1.00 0.00 ? 42  TYR A CD2  1  
ATOM   599   C  CE1  . TYR A 1 42 ? -1.573  -0.395  -2.911  1.00 0.00 ? 42  TYR A CE1  1  
ATOM   600   C  CE2  . TYR A 1 42 ? -1.631  1.713   -4.042  1.00 0.00 ? 42  TYR A CE2  1  
ATOM   601   C  CZ   . TYR A 1 42 ? -1.056  0.474   -3.849  1.00 0.00 ? 42  TYR A CZ   1  
ATOM   602   O  OH   . TYR A 1 42 ? 0.040   0.105   -4.594  1.00 0.00 ? 42  TYR A OH   1  
ATOM   603   H  H    . TYR A 1 42 ? -6.378  1.868   0.158   1.00 0.00 ? 42  TYR A H    1  
ATOM   604   H  HA   . TYR A 1 42 ? -4.246  0.192   0.048   1.00 0.00 ? 42  TYR A HA   1  
ATOM   605   H  HB2  . TYR A 1 42 ? -5.341  1.138   -1.940  1.00 0.00 ? 42  TYR A HB2  1  
ATOM   606   H  HB3  . TYR A 1 42 ? -4.593  2.698   -1.613  1.00 0.00 ? 42  TYR A HB3  1  
ATOM   607   H  HD1  . TYR A 1 42 ? -3.081  -0.699  -1.430  1.00 0.00 ? 42  TYR A HD1  1  
ATOM   608   H  HD2  . TYR A 1 42 ? -3.184  3.050   -3.440  1.00 0.00 ? 42  TYR A HD2  1  
ATOM   609   H  HE1  . TYR A 1 42 ? -1.122  -1.365  -2.760  1.00 0.00 ? 42  TYR A HE1  1  
ATOM   610   H  HE2  . TYR A 1 42 ? -1.226  2.393   -4.776  1.00 0.00 ? 42  TYR A HE2  1  
ATOM   611   H  HH   . TYR A 1 42 ? 0.511   -0.600  -4.143  1.00 0.00 ? 42  TYR A HH   1  
ATOM   612   N  N    . VAL A 1 43 ? -3.365  3.049   1.264   1.00 0.00 ? 43  VAL A N    1  
ATOM   613   C  CA   . VAL A 1 43 ? -2.283  3.791   1.899   1.00 0.00 ? 43  VAL A CA   1  
ATOM   614   C  C    . VAL A 1 43 ? -1.462  2.891   2.815   1.00 0.00 ? 43  VAL A C    1  
ATOM   615   O  O    . VAL A 1 43 ? -1.930  1.839   3.252   1.00 0.00 ? 43  VAL A O    1  
ATOM   616   C  CB   . VAL A 1 43 ? -2.822  4.981   2.715   1.00 0.00 ? 43  VAL A CB   1  
ATOM   617   C  CG1  . VAL A 1 43 ? -3.716  5.859   1.853   1.00 0.00 ? 43  VAL A CG1  1  
ATOM   618   C  CG2  . VAL A 1 43 ? -3.571  4.488   3.944   1.00 0.00 ? 43  VAL A CG2  1  
ATOM   619   H  H    . VAL A 1 43 ? -4.285  3.374   1.355   1.00 0.00 ? 43  VAL A H    1  
ATOM   620   H  HA   . VAL A 1 43 ? -1.641  4.177   1.120   1.00 0.00 ? 43  VAL A HA   1  
ATOM   621   H  HB   . VAL A 1 43 ? -1.982  5.575   3.046   1.00 0.00 ? 43  VAL A HB   1  
ATOM   622   H  HG11 . VAL A 1 43 ? -4.498  5.257   1.416   1.00 0.00 ? 43  VAL A HG11 1  
ATOM   623   H  HG12 . VAL A 1 43 ? -4.155  6.635   2.462   1.00 0.00 ? 43  VAL A HG12 1  
ATOM   624   H  HG13 . VAL A 1 43 ? -3.127  6.309   1.066   1.00 0.00 ? 43  VAL A HG13 1  
ATOM   625   H  HG21 . VAL A 1 43 ? -3.857  3.457   3.801   1.00 0.00 ? 43  VAL A HG21 1  
ATOM   626   H  HG22 . VAL A 1 43 ? -2.932  4.567   4.812   1.00 0.00 ? 43  VAL A HG22 1  
ATOM   627   H  HG23 . VAL A 1 43 ? -4.455  5.090   4.093   1.00 0.00 ? 43  VAL A HG23 1  
ATOM   628   N  N    . CYS A 1 44 ? -0.235  3.311   3.103   1.00 0.00 ? 44  CYS A N    1  
ATOM   629   C  CA   . CYS A 1 44 ? 0.653   2.543   3.968   1.00 0.00 ? 44  CYS A CA   1  
ATOM   630   C  C    . CYS A 1 44 ? -0.032  2.204   5.289   1.00 0.00 ? 44  CYS A C    1  
ATOM   631   O  O    . CYS A 1 44 ? -0.947  2.904   5.724   1.00 0.00 ? 44  CYS A O    1  
ATOM   632   C  CB   . CYS A 1 44 ? 1.941   3.325   4.235   1.00 0.00 ? 44  CYS A CB   1  
ATOM   633   S  SG   . CYS A 1 44 ? 3.132   2.454   5.303   1.00 0.00 ? 44  CYS A SG   1  
ATOM   634   H  H    . CYS A 1 44 ? 0.082   4.158   2.725   1.00 0.00 ? 44  CYS A H    1  
ATOM   635   H  HA   . CYS A 1 44 ? 0.900   1.624   3.459   1.00 0.00 ? 44  CYS A HA   1  
ATOM   636   H  HB2  . CYS A 1 44 ? 2.431   3.528   3.294   1.00 0.00 ? 44  CYS A HB2  1  
ATOM   637   H  HB3  . CYS A 1 44 ? 1.692   4.260   4.715   1.00 0.00 ? 44  CYS A HB3  1  
ATOM   638   N  N    . THR A 1 45 ? 0.417   1.126   5.923   1.00 0.00 ? 45  THR A N    1  
ATOM   639   C  CA   . THR A 1 45 ? -0.153  0.693   7.193   1.00 0.00 ? 45  THR A CA   1  
ATOM   640   C  C    . THR A 1 45 ? 0.544   1.370   8.367   1.00 0.00 ? 45  THR A C    1  
ATOM   641   O  O    . THR A 1 45 ? -0.080  1.663   9.387   1.00 0.00 ? 45  THR A O    1  
ATOM   642   C  CB   . THR A 1 45 ? -0.053  -0.835  7.362   1.00 0.00 ? 45  THR A CB   1  
ATOM   643   O  OG1  . THR A 1 45 ? -0.727  -1.492  6.283   1.00 0.00 ? 45  THR A OG1  1  
ATOM   644   C  CG2  . THR A 1 45 ? -0.658  -1.273  8.687   1.00 0.00 ? 45  THR A CG2  1  
ATOM   645   H  H    . THR A 1 45 ? 1.148   0.609   5.525   1.00 0.00 ? 45  THR A H    1  
ATOM   646   H  HA   . THR A 1 45 ? -1.198  0.967   7.200   1.00 0.00 ? 45  THR A HA   1  
ATOM   647   H  HB   . THR A 1 45 ? 0.990   -1.116  7.348   1.00 0.00 ? 45  THR A HB   1  
ATOM   648   H  HG1  . THR A 1 45 ? -0.353  -1.203  5.447   1.00 0.00 ? 45  THR A HG1  1  
ATOM   649   H  HG21 . THR A 1 45 ? 0.042   -1.076  9.485   1.00 0.00 ? 45  THR A HG21 1  
ATOM   650   H  HG22 . THR A 1 45 ? -0.875  -2.331  8.651   1.00 0.00 ? 45  THR A HG22 1  
ATOM   651   H  HG23 . THR A 1 45 ? -1.570  -0.724  8.865   1.00 0.00 ? 45  THR A HG23 1  
ATOM   652   N  N    . ASP A 1 46 ? 1.841   1.615   8.217   1.00 0.00 ? 46  ASP A N    1  
ATOM   653   C  CA   . ASP A 1 46 ? 2.623   2.260   9.266   1.00 0.00 ? 46  ASP A CA   1  
ATOM   654   C  C    . ASP A 1 46 ? 2.199   3.714   9.445   1.00 0.00 ? 46  ASP A C    1  
ATOM   655   O  O    . ASP A 1 46 ? 1.663   4.092   10.487  1.00 0.00 ? 46  ASP A O    1  
ATOM   656   C  CB   . ASP A 1 46 ? 4.115   2.188   8.936   1.00 0.00 ? 46  ASP A CB   1  
ATOM   657   C  CG   . ASP A 1 46 ? 4.986   2.655   10.086  1.00 0.00 ? 46  ASP A CG   1  
ATOM   658   O  OD1  . ASP A 1 46 ? 4.800   3.803   10.542  1.00 0.00 ? 46  ASP A OD1  1  
ATOM   659   O  OD2  . ASP A 1 46 ? 5.852   1.873   10.530  1.00 0.00 ? 46  ASP A OD2  1  
ATOM   660   H  H    . ASP A 1 46 ? 2.283   1.358   7.381   1.00 0.00 ? 46  ASP A H    1  
ATOM   661   H  HA   . ASP A 1 46 ? 2.442   1.729   10.188  1.00 0.00 ? 46  ASP A HA   1  
ATOM   662   H  HB2  . ASP A 1 46 ? 4.377   1.166   8.703   1.00 0.00 ? 46  ASP A HB2  1  
ATOM   663   H  HB3  . ASP A 1 46 ? 4.318   2.811   8.077   1.00 0.00 ? 46  ASP A HB3  1  
ATOM   664   N  N    . CYS A 1 47 ? 2.443   4.526   8.422   1.00 0.00 ? 47  CYS A N    1  
ATOM   665   C  CA   . CYS A 1 47 ? 2.088   5.939   8.465   1.00 0.00 ? 47  CYS A CA   1  
ATOM   666   C  C    . CYS A 1 47 ? 0.713   6.174   7.847   1.00 0.00 ? 47  CYS A C    1  
ATOM   667   O  O    . CYS A 1 47 ? -0.218  6.609   8.523   1.00 0.00 ? 47  CYS A O    1  
ATOM   668   C  CB   . CYS A 1 47 ? 3.139   6.774   7.731   1.00 0.00 ? 47  CYS A CB   1  
ATOM   669   S  SG   . CYS A 1 47 ? 3.811   5.976   6.238   1.00 0.00 ? 47  CYS A SG   1  
ATOM   670   H  H    . CYS A 1 47 ? 2.873   4.166   7.617   1.00 0.00 ? 47  CYS A H    1  
ATOM   671   H  HA   . CYS A 1 47 ? 2.059   6.243   9.501   1.00 0.00 ? 47  CYS A HA   1  
ATOM   672   H  HB2  . CYS A 1 47 ? 2.697   7.712   7.430   1.00 0.00 ? 47  CYS A HB2  1  
ATOM   673   H  HB3  . CYS A 1 47 ? 3.964   6.969   8.400   1.00 0.00 ? 47  CYS A HB3  1  
ATOM   674   N  N    . GLY A 1 48 ? 0.594   5.883   6.555   1.00 0.00 ? 48  GLY A N    1  
ATOM   675   C  CA   . GLY A 1 48 ? -0.670  6.068   5.866   1.00 0.00 ? 48  GLY A CA   1  
ATOM   676   C  C    . GLY A 1 48 ? -0.551  7.003   4.678   1.00 0.00 ? 48  GLY A C    1  
ATOM   677   O  O    . GLY A 1 48 ? -1.316  7.960   4.552   1.00 0.00 ? 48  GLY A O    1  
ATOM   678   H  H    . GLY A 1 48 ? 1.371   5.539   6.065   1.00 0.00 ? 48  GLY A H    1  
ATOM   679   H  HA2  . GLY A 1 48 ? -1.024  5.108   5.521   1.00 0.00 ? 48  GLY A HA2  1  
ATOM   680   H  HA3  . GLY A 1 48 ? -1.389  6.478   6.560   1.00 0.00 ? 48  GLY A HA3  1  
ATOM   681   N  N    . THR A 1 49 ? 0.412   6.727   3.804   1.00 0.00 ? 49  THR A N    1  
ATOM   682   C  CA   . THR A 1 49 ? 0.631   7.552   2.623   1.00 0.00 ? 49  THR A CA   1  
ATOM   683   C  C    . THR A 1 49 ? 0.028   6.904   1.381   1.00 0.00 ? 49  THR A C    1  
ATOM   684   O  O    . THR A 1 49 ? 0.010   5.681   1.254   1.00 0.00 ? 49  THR A O    1  
ATOM   685   C  CB   . THR A 1 49 ? 2.132   7.801   2.381   1.00 0.00 ? 49  THR A CB   1  
ATOM   686   O  OG1  . THR A 1 49 ? 2.307   8.722   1.299   1.00 0.00 ? 49  THR A OG1  1  
ATOM   687   C  CG2  . THR A 1 49 ? 2.852   6.498   2.067   1.00 0.00 ? 49  THR A CG2  1  
ATOM   688   H  H    . THR A 1 49 ? 0.990   5.951   3.960   1.00 0.00 ? 49  THR A H    1  
ATOM   689   H  HA   . THR A 1 49 ? 0.151   8.506   2.788   1.00 0.00 ? 49  THR A HA   1  
ATOM   690   H  HB   . THR A 1 49 ? 2.560   8.225   3.278   1.00 0.00 ? 49  THR A HB   1  
ATOM   691   H  HG1  . THR A 1 49 ? 3.236   8.756   1.055   1.00 0.00 ? 49  THR A HG1  1  
ATOM   692   H  HG21 . THR A 1 49 ? 2.676   5.788   2.861   1.00 0.00 ? 49  THR A HG21 1  
ATOM   693   H  HG22 . THR A 1 49 ? 3.912   6.685   1.980   1.00 0.00 ? 49  THR A HG22 1  
ATOM   694   H  HG23 . THR A 1 49 ? 2.480   6.097   1.137   1.00 0.00 ? 49  THR A HG23 1  
ATOM   695   N  N    . ASN A 1 50 ? -0.464  7.733   0.466   1.00 0.00 ? 50  ASN A N    1  
ATOM   696   C  CA   . ASN A 1 50 ? -1.068  7.240   -0.766  1.00 0.00 ? 50  ASN A CA   1  
ATOM   697   C  C    . ASN A 1 50 ? -0.051  6.466   -1.598  1.00 0.00 ? 50  ASN A C    1  
ATOM   698   O  O    . ASN A 1 50 ? 0.825   7.054   -2.234  1.00 0.00 ? 50  ASN A O    1  
ATOM   699   C  CB   . ASN A 1 50 ? -1.632  8.404   -1.584  1.00 0.00 ? 50  ASN A CB   1  
ATOM   700   C  CG   . ASN A 1 50 ? -2.798  9.084   -0.893  1.00 0.00 ? 50  ASN A CG   1  
ATOM   701   O  OD1  . ASN A 1 50 ? -2.713  10.251  -0.510  1.00 0.00 ? 50  ASN A OD1  1  
ATOM   702   N  ND2  . ASN A 1 50 ? -3.896  8.355   -0.731  1.00 0.00 ? 50  ASN A ND2  1  
ATOM   703   H  H    . ASN A 1 50 ? -0.421  8.700   0.624   1.00 0.00 ? 50  ASN A H    1  
ATOM   704   H  HA   . ASN A 1 50 ? -1.876  6.577   -0.497  1.00 0.00 ? 50  ASN A HA   1  
ATOM   705   H  HB2  . ASN A 1 50 ? -0.854  9.138   -1.739  1.00 0.00 ? 50  ASN A HB2  1  
ATOM   706   H  HB3  . ASN A 1 50 ? -1.969  8.035   -2.540  1.00 0.00 ? 50  ASN A HB3  1  
ATOM   707   H  HD21 . ASN A 1 50 ? -3.893  7.432   -1.061  1.00 0.00 ? 50  ASN A HD21 1  
ATOM   708   H  HD22 . ASN A 1 50 ? -4.666  8.770   -0.288  1.00 0.00 ? 50  ASN A HD22 1  
ATOM   709   N  N    . LEU A 1 51 ? -0.172  5.143   -1.590  1.00 0.00 ? 51  LEU A N    1  
ATOM   710   C  CA   . LEU A 1 51 ? 0.736   4.286   -2.344  1.00 0.00 ? 51  LEU A CA   1  
ATOM   711   C  C    . LEU A 1 51 ? 0.280   4.151   -3.793  1.00 0.00 ? 51  LEU A C    1  
ATOM   712   O  O    . LEU A 1 51 ? 0.767   3.295   -4.532  1.00 0.00 ? 51  LEU A O    1  
ATOM   713   C  CB   . LEU A 1 51 ? 0.824   2.904   -1.694  1.00 0.00 ? 51  LEU A CB   1  
ATOM   714   C  CG   . LEU A 1 51 ? 1.110   2.886   -0.192  1.00 0.00 ? 51  LEU A CG   1  
ATOM   715   C  CD1  . LEU A 1 51 ? 0.929   1.485   0.369   1.00 0.00 ? 51  LEU A CD1  1  
ATOM   716   C  CD2  . LEU A 1 51 ? 2.516   3.397   0.089   1.00 0.00 ? 51  LEU A CD2  1  
ATOM   717   H  H    . LEU A 1 51 ? -0.889  4.732   -1.064  1.00 0.00 ? 51  LEU A H    1  
ATOM   718   H  HA   . LEU A 1 51 ? 1.714   4.745   -2.329  1.00 0.00 ? 51  LEU A HA   1  
ATOM   719   H  HB2  . LEU A 1 51 ? -0.117  2.402   -1.857  1.00 0.00 ? 51  LEU A HB2  1  
ATOM   720   H  HB3  . LEU A 1 51 ? 1.613   2.356   -2.189  1.00 0.00 ? 51  LEU A HB3  1  
ATOM   721   H  HG   . LEU A 1 51 ? 0.410   3.540   0.309   1.00 0.00 ? 51  LEU A HG   1  
ATOM   722   H  HD11 . LEU A 1 51 ? 0.731   0.796   -0.439  1.00 0.00 ? 51  LEU A HD11 1  
ATOM   723   H  HD12 . LEU A 1 51 ? 0.098   1.478   1.059   1.00 0.00 ? 51  LEU A HD12 1  
ATOM   724   H  HD13 . LEU A 1 51 ? 1.828   1.185   0.886   1.00 0.00 ? 51  LEU A HD13 1  
ATOM   725   H  HD21 . LEU A 1 51 ? 2.606   4.415   -0.262  1.00 0.00 ? 51  LEU A HD21 1  
ATOM   726   H  HD22 . LEU A 1 51 ? 3.235   2.775   -0.425  1.00 0.00 ? 51  LEU A HD22 1  
ATOM   727   H  HD23 . LEU A 1 51 ? 2.705   3.365   1.151   1.00 0.00 ? 51  LEU A HD23 1  
ATOM   728   N  N    . LYS A 1 52 ? -0.657  5.003   -4.195  1.00 0.00 ? 52  LYS A N    1  
ATOM   729   C  CA   . LYS A 1 52 ? -1.178  4.982   -5.557  1.00 0.00 ? 52  LYS A CA   1  
ATOM   730   C  C    . LYS A 1 52 ? -0.042  4.986   -6.574  1.00 0.00 ? 52  LYS A C    1  
ATOM   731   O  O    . LYS A 1 52 ? 0.054   4.092   -7.413  1.00 0.00 ? 52  LYS A O    1  
ATOM   732   C  CB   . LYS A 1 52 ? -2.093  6.187   -5.793  1.00 0.00 ? 52  LYS A CB   1  
ATOM   733   C  CG   . LYS A 1 52 ? -2.925  6.079   -7.059  1.00 0.00 ? 52  LYS A CG   1  
ATOM   734   C  CD   . LYS A 1 52 ? -4.038  7.113   -7.085  1.00 0.00 ? 52  LYS A CD   1  
ATOM   735   C  CE   . LYS A 1 52 ? -3.526  8.472   -7.535  1.00 0.00 ? 52  LYS A CE   1  
ATOM   736   N  NZ   . LYS A 1 52 ? -4.419  9.577   -7.088  1.00 0.00 ? 52  LYS A NZ   1  
ATOM   737   H  H    . LYS A 1 52 ? -1.007  5.663   -3.560  1.00 0.00 ? 52  LYS A H    1  
ATOM   738   H  HA   . LYS A 1 52 ? -1.752  4.076   -5.679  1.00 0.00 ? 52  LYS A HA   1  
ATOM   739   H  HB2  . LYS A 1 52 ? -2.764  6.284   -4.953  1.00 0.00 ? 52  LYS A HB2  1  
ATOM   740   H  HB3  . LYS A 1 52 ? -1.485  7.077   -5.862  1.00 0.00 ? 52  LYS A HB3  1  
ATOM   741   H  HG2  . LYS A 1 52 ? -2.284  6.235   -7.915  1.00 0.00 ? 52  LYS A HG2  1  
ATOM   742   H  HG3  . LYS A 1 52 ? -3.362  5.091   -7.109  1.00 0.00 ? 52  LYS A HG3  1  
ATOM   743   H  HD2  . LYS A 1 52 ? -4.806  6.785   -7.770  1.00 0.00 ? 52  LYS A HD2  1  
ATOM   744   H  HD3  . LYS A 1 52 ? -4.454  7.205   -6.091  1.00 0.00 ? 52  LYS A HD3  1  
ATOM   745   H  HE2  . LYS A 1 52 ? -2.542  8.627   -7.120  1.00 0.00 ? 52  LYS A HE2  1  
ATOM   746   H  HE3  . LYS A 1 52 ? -3.468  8.481   -8.613  1.00 0.00 ? 52  LYS A HE3  1  
ATOM   747   H  HZ1  . LYS A 1 52 ? -4.857  9.335   -6.176  1.00 0.00 ? 52  LYS A HZ1  1  
ATOM   748   H  HZ2  . LYS A 1 52 ? -5.171  9.735   -7.790  1.00 0.00 ? 52  LYS A HZ2  1  
ATOM   749   H  HZ3  . LYS A 1 52 ? -3.874  10.455  -6.977  1.00 0.00 ? 52  LYS A HZ3  1  
ATOM   750   N  N    . GLN A 1 53 ? 0.817   5.998   -6.492  1.00 0.00 ? 53  GLN A N    1  
ATOM   751   C  CA   . GLN A 1 53 ? 1.947   6.116   -7.406  1.00 0.00 ? 53  GLN A CA   1  
ATOM   752   C  C    . GLN A 1 53 ? 3.199   5.481   -6.808  1.00 0.00 ? 53  GLN A C    1  
ATOM   753   O  O    . GLN A 1 53 ? 3.886   4.700   -7.466  1.00 0.00 ? 53  GLN A O    1  
ATOM   754   C  CB   . GLN A 1 53 ? 2.213   7.586   -7.733  1.00 0.00 ? 53  GLN A CB   1  
ATOM   755   C  CG   . GLN A 1 53 ? 1.060   8.268   -8.452  1.00 0.00 ? 53  GLN A CG   1  
ATOM   756   C  CD   . GLN A 1 53 ? 1.001   7.916   -9.925  1.00 0.00 ? 53  GLN A CD   1  
ATOM   757   O  OE1  . GLN A 1 53 ? 1.825   8.372   -10.718 1.00 0.00 ? 53  GLN A OE1  1  
ATOM   758   N  NE2  . GLN A 1 53 ? 0.022   7.100   -10.301 1.00 0.00 ? 53  GLN A NE2  1  
ATOM   759   H  H    . GLN A 1 53 ? 0.687   6.680   -5.801  1.00 0.00 ? 53  GLN A H    1  
ATOM   760   H  HA   . GLN A 1 53 ? 1.693   5.594   -8.316  1.00 0.00 ? 53  GLN A HA   1  
ATOM   761   H  HB2  . GLN A 1 53 ? 2.402   8.119   -6.814  1.00 0.00 ? 53  GLN A HB2  1  
ATOM   762   H  HB3  . GLN A 1 53 ? 3.088   7.650   -8.363  1.00 0.00 ? 53  GLN A HB3  1  
ATOM   763   H  HG2  . GLN A 1 53 ? 0.133   7.964   -7.988  1.00 0.00 ? 53  GLN A HG2  1  
ATOM   764   H  HG3  . GLN A 1 53 ? 1.175   9.337   -8.357  1.00 0.00 ? 53  GLN A HG3  1  
ATOM   765   H  HE21 . GLN A 1 53 ? -0.599  6.776   -9.614  1.00 0.00 ? 53  GLN A HE21 1  
ATOM   766   H  HE22 . GLN A 1 53 ? -0.040  6.856   -11.247 1.00 0.00 ? 53  GLN A HE22 1  
ATOM   767   N  N    . LYS A 1 54 ? 3.490   5.822   -5.558  1.00 0.00 ? 54  LYS A N    1  
ATOM   768   C  CA   . LYS A 1 54 ? 4.658   5.286   -4.870  1.00 0.00 ? 54  LYS A CA   1  
ATOM   769   C  C    . LYS A 1 54 ? 4.702   3.765   -4.977  1.00 0.00 ? 54  LYS A C    1  
ATOM   770   O  O    . LYS A 1 54 ? 5.713   3.190   -5.378  1.00 0.00 ? 54  LYS A O    1  
ATOM   771   C  CB   . LYS A 1 54 ? 4.645   5.703   -3.398  1.00 0.00 ? 54  LYS A CB   1  
ATOM   772   C  CG   . LYS A 1 54 ? 4.758   7.204   -3.191  1.00 0.00 ? 54  LYS A CG   1  
ATOM   773   C  CD   . LYS A 1 54 ? 4.583   7.579   -1.729  1.00 0.00 ? 54  LYS A CD   1  
ATOM   774   C  CE   . LYS A 1 54 ? 5.219   8.926   -1.419  1.00 0.00 ? 54  LYS A CE   1  
ATOM   775   N  NZ   . LYS A 1 54 ? 4.431   10.055  -1.985  1.00 0.00 ? 54  LYS A NZ   1  
ATOM   776   H  H    . LYS A 1 54 ? 2.903   6.450   -5.085  1.00 0.00 ? 54  LYS A H    1  
ATOM   777   H  HA   . LYS A 1 54 ? 5.538   5.693   -5.344  1.00 0.00 ? 54  LYS A HA   1  
ATOM   778   H  HB2  . LYS A 1 54 ? 3.723   5.367   -2.948  1.00 0.00 ? 54  LYS A HB2  1  
ATOM   779   H  HB3  . LYS A 1 54 ? 5.475   5.229   -2.894  1.00 0.00 ? 54  LYS A HB3  1  
ATOM   780   H  HG2  . LYS A 1 54 ? 5.732   7.532   -3.521  1.00 0.00 ? 54  LYS A HG2  1  
ATOM   781   H  HG3  . LYS A 1 54 ? 3.993   7.697   -3.773  1.00 0.00 ? 54  LYS A HG3  1  
ATOM   782   H  HD2  . LYS A 1 54 ? 3.528   7.633   -1.503  1.00 0.00 ? 54  LYS A HD2  1  
ATOM   783   H  HD3  . LYS A 1 54 ? 5.047   6.821   -1.113  1.00 0.00 ? 54  LYS A HD3  1  
ATOM   784   H  HE2  . LYS A 1 54 ? 5.281   9.042   -0.348  1.00 0.00 ? 54  LYS A HE2  1  
ATOM   785   H  HE3  . LYS A 1 54 ? 6.214   8.944   -1.840  1.00 0.00 ? 54  LYS A HE3  1  
ATOM   786   H  HZ1  . LYS A 1 54 ? 5.011   10.919  -2.008  1.00 0.00 ? 54  LYS A HZ1  1  
ATOM   787   H  HZ2  . LYS A 1 54 ? 3.590   10.232  -1.401  1.00 0.00 ? 54  LYS A HZ2  1  
ATOM   788   H  HZ3  . LYS A 1 54 ? 4.127   9.829   -2.954  1.00 0.00 ? 54  LYS A HZ3  1  
ATOM   789   N  N    . GLY A 1 55 ? 3.597   3.118   -4.618  1.00 0.00 ? 55  GLY A N    1  
ATOM   790   C  CA   . GLY A 1 55 ? 3.530   1.670   -4.683  1.00 0.00 ? 55  GLY A CA   1  
ATOM   791   C  C    . GLY A 1 55 ? 3.498   1.029   -3.309  1.00 0.00 ? 55  GLY A C    1  
ATOM   792   O  O    . GLY A 1 55 ? 3.792   1.679   -2.306  1.00 0.00 ? 55  GLY A O    1  
ATOM   793   H  H    . GLY A 1 55 ? 2.820   3.629   -4.306  1.00 0.00 ? 55  GLY A H    1  
ATOM   794   H  HA2  . GLY A 1 55 ? 2.639   1.385   -5.222  1.00 0.00 ? 55  GLY A HA2  1  
ATOM   795   H  HA3  . GLY A 1 55 ? 4.395   1.305   -5.217  1.00 0.00 ? 55  GLY A HA3  1  
ATOM   796   N  N    . HIS A 1 56 ? 3.138   -0.250  -3.263  1.00 0.00 ? 56  HIS A N    1  
ATOM   797   C  CA   . HIS A 1 56 ? 3.067   -0.979  -2.001  1.00 0.00 ? 56  HIS A CA   1  
ATOM   798   C  C    . HIS A 1 56 ? 4.014   -2.175  -2.012  1.00 0.00 ? 56  HIS A C    1  
ATOM   799   O  O    . HIS A 1 56 ? 4.323   -2.726  -3.068  1.00 0.00 ? 56  HIS A O    1  
ATOM   800   C  CB   . HIS A 1 56 ? 1.636   -1.448  -1.739  1.00 0.00 ? 56  HIS A CB   1  
ATOM   801   C  CG   . HIS A 1 56 ? 1.354   -2.827  -2.252  1.00 0.00 ? 56  HIS A CG   1  
ATOM   802   N  ND1  . HIS A 1 56 ? 0.519   -3.076  -3.320  1.00 0.00 ? 56  HIS A ND1  1  
ATOM   803   C  CD2  . HIS A 1 56 ? 1.804   -4.034  -1.838  1.00 0.00 ? 56  HIS A CD2  1  
ATOM   804   C  CE1  . HIS A 1 56 ? 0.466   -4.378  -3.540  1.00 0.00 ? 56  HIS A CE1  1  
ATOM   805   N  NE2  . HIS A 1 56 ? 1.237   -4.982  -2.654  1.00 0.00 ? 56  HIS A NE2  1  
ATOM   806   H  H    . HIS A 1 56 ? 2.916   -0.714  -4.096  1.00 0.00 ? 56  HIS A H    1  
ATOM   807   H  HA   . HIS A 1 56 ? 3.366   -0.306  -1.212  1.00 0.00 ? 56  HIS A HA   1  
ATOM   808   H  HB2  . HIS A 1 56 ? 1.453   -1.447  -0.675  1.00 0.00 ? 56  HIS A HB2  1  
ATOM   809   H  HB3  . HIS A 1 56 ? 0.947   -0.768  -2.219  1.00 0.00 ? 56  HIS A HB3  1  
ATOM   810   H  HD1  . HIS A 1 56 ? 0.036   -2.400  -3.839  1.00 0.00 ? 56  HIS A HD1  1  
ATOM   811   H  HD2  . HIS A 1 56 ? 2.482   -4.220  -1.017  1.00 0.00 ? 56  HIS A HD2  1  
ATOM   812   H  HE1  . HIS A 1 56 ? -0.109  -4.866  -4.313  1.00 0.00 ? 56  HIS A HE1  1  
ATOM   813   H  HE2  . HIS A 1 56 ? 1.311   -5.952  -2.539  1.00 0.00 ? 56  HIS A HE2  1  
ATOM   814   N  N    . PHE A 1 57 ? 4.471   -2.571  -0.828  1.00 0.00 ? 57  PHE A N    1  
ATOM   815   C  CA   . PHE A 1 57 ? 5.384   -3.701  -0.701  1.00 0.00 ? 57  PHE A CA   1  
ATOM   816   C  C    . PHE A 1 57 ? 4.737   -4.837  0.085   1.00 0.00 ? 57  PHE A C    1  
ATOM   817   O  O    . PHE A 1 57 ? 3.719   -4.646  0.750   1.00 0.00 ? 57  PHE A O    1  
ATOM   818   C  CB   . PHE A 1 57 ? 6.679   -3.263  -0.014  1.00 0.00 ? 57  PHE A CB   1  
ATOM   819   C  CG   . PHE A 1 57 ? 7.700   -2.701  -0.962  1.00 0.00 ? 57  PHE A CG   1  
ATOM   820   C  CD1  . PHE A 1 57 ? 7.433   -1.550  -1.686  1.00 0.00 ? 57  PHE A CD1  1  
ATOM   821   C  CD2  . PHE A 1 57 ? 8.927   -3.322  -1.128  1.00 0.00 ? 57  PHE A CD2  1  
ATOM   822   C  CE1  . PHE A 1 57 ? 8.370   -1.031  -2.559  1.00 0.00 ? 57  PHE A CE1  1  
ATOM   823   C  CE2  . PHE A 1 57 ? 9.869   -2.808  -1.999  1.00 0.00 ? 57  PHE A CE2  1  
ATOM   824   C  CZ   . PHE A 1 57 ? 9.590   -1.660  -2.715  1.00 0.00 ? 57  PHE A CZ   1  
ATOM   825   H  H    . PHE A 1 57 ? 4.189   -2.092  -0.021  1.00 0.00 ? 57  PHE A H    1  
ATOM   826   H  HA   . PHE A 1 57 ? 5.615   -4.053  -1.695  1.00 0.00 ? 57  PHE A HA   1  
ATOM   827   H  HB2  . PHE A 1 57 ? 6.451   -2.502  0.717   1.00 0.00 ? 57  PHE A HB2  1  
ATOM   828   H  HB3  . PHE A 1 57 ? 7.120   -4.114  0.484   1.00 0.00 ? 57  PHE A HB3  1  
ATOM   829   H  HD1  . PHE A 1 57 ? 6.480   -1.057  -1.565  1.00 0.00 ? 57  PHE A HD1  1  
ATOM   830   H  HD2  . PHE A 1 57 ? 9.147   -4.220  -0.567  1.00 0.00 ? 57  PHE A HD2  1  
ATOM   831   H  HE1  . PHE A 1 57 ? 8.150   -0.134  -3.118  1.00 0.00 ? 57  PHE A HE1  1  
ATOM   832   H  HE2  . PHE A 1 57 ? 10.822  -3.302  -2.118  1.00 0.00 ? 57  PHE A HE2  1  
ATOM   833   H  HZ   . PHE A 1 57 ? 10.324  -1.257  -3.397  1.00 0.00 ? 57  PHE A HZ   1  
ATOM   834   N  N    . PHE A 1 58 ? 5.336   -6.021  0.004   1.00 0.00 ? 58  PHE A N    1  
ATOM   835   C  CA   . PHE A 1 58 ? 4.818   -7.190  0.706   1.00 0.00 ? 58  PHE A CA   1  
ATOM   836   C  C    . PHE A 1 58 ? 5.747   -7.595  1.847   1.00 0.00 ? 58  PHE A C    1  
ATOM   837   O  O    . PHE A 1 58 ? 6.857   -8.075  1.618   1.00 0.00 ? 58  PHE A O    1  
ATOM   838   C  CB   . PHE A 1 58 ? 4.644   -8.359  -0.265  1.00 0.00 ? 58  PHE A CB   1  
ATOM   839   C  CG   . PHE A 1 58 ? 3.338   -8.335  -1.006  1.00 0.00 ? 58  PHE A CG   1  
ATOM   840   C  CD1  . PHE A 1 58 ? 2.136   -8.309  -0.316  1.00 0.00 ? 58  PHE A CD1  1  
ATOM   841   C  CD2  . PHE A 1 58 ? 3.311   -8.338  -2.391  1.00 0.00 ? 58  PHE A CD2  1  
ATOM   842   C  CE1  . PHE A 1 58 ? 0.932   -8.286  -0.995  1.00 0.00 ? 58  PHE A CE1  1  
ATOM   843   C  CE2  . PHE A 1 58 ? 2.111   -8.314  -3.075  1.00 0.00 ? 58  PHE A CE2  1  
ATOM   844   C  CZ   . PHE A 1 58 ? 0.920   -8.290  -2.376  1.00 0.00 ? 58  PHE A CZ   1  
ATOM   845   H  H    . PHE A 1 58 ? 6.145   -6.111  -0.542  1.00 0.00 ? 58  PHE A H    1  
ATOM   846   H  HA   . PHE A 1 58 ? 3.855   -6.928  1.117   1.00 0.00 ? 58  PHE A HA   1  
ATOM   847   H  HB2  . PHE A 1 58 ? 5.439   -8.333  -0.995  1.00 0.00 ? 58  PHE A HB2  1  
ATOM   848   H  HB3  . PHE A 1 58 ? 4.698   -9.286  0.286   1.00 0.00 ? 58  PHE A HB3  1  
ATOM   849   H  HD1  . PHE A 1 58 ? 2.145   -8.307  0.765   1.00 0.00 ? 58  PHE A HD1  1  
ATOM   850   H  HD2  . PHE A 1 58 ? 4.242   -8.358  -2.939  1.00 0.00 ? 58  PHE A HD2  1  
ATOM   851   H  HE1  . PHE A 1 58 ? 0.003   -8.267  -0.445  1.00 0.00 ? 58  PHE A HE1  1  
ATOM   852   H  HE2  . PHE A 1 58 ? 2.103   -8.317  -4.154  1.00 0.00 ? 58  PHE A HE2  1  
ATOM   853   H  HZ   . PHE A 1 58 ? -0.020  -8.271  -2.908  1.00 0.00 ? 58  PHE A HZ   1  
ATOM   854   N  N    . VAL A 1 59 ? 5.285   -7.396  3.077   1.00 0.00 ? 59  VAL A N    1  
ATOM   855   C  CA   . VAL A 1 59 ? 6.073   -7.741  4.255   1.00 0.00 ? 59  VAL A CA   1  
ATOM   856   C  C    . VAL A 1 59 ? 5.193   -8.330  5.351   1.00 0.00 ? 59  VAL A C    1  
ATOM   857   O  O    . VAL A 1 59 ? 4.331   -7.647  5.902   1.00 0.00 ? 59  VAL A O    1  
ATOM   858   C  CB   . VAL A 1 59 ? 6.815   -6.512  4.812   1.00 0.00 ? 59  VAL A CB   1  
ATOM   859   C  CG1  . VAL A 1 59 ? 7.597   -6.882  6.063   1.00 0.00 ? 59  VAL A CG1  1  
ATOM   860   C  CG2  . VAL A 1 59 ? 7.735   -5.920  3.755   1.00 0.00 ? 59  VAL A CG2  1  
ATOM   861   H  H    . VAL A 1 59 ? 4.392   -7.010  3.196   1.00 0.00 ? 59  VAL A H    1  
ATOM   862   H  HA   . VAL A 1 59 ? 6.808   -8.476  3.961   1.00 0.00 ? 59  VAL A HA   1  
ATOM   863   H  HB   . VAL A 1 59 ? 6.083   -5.765  5.080   1.00 0.00 ? 59  VAL A HB   1  
ATOM   864   H  HG11 . VAL A 1 59 ? 8.446   -6.223  6.165   1.00 0.00 ? 59  VAL A HG11 1  
ATOM   865   H  HG12 . VAL A 1 59 ? 6.959   -6.785  6.929   1.00 0.00 ? 59  VAL A HG12 1  
ATOM   866   H  HG13 . VAL A 1 59 ? 7.942   -7.902  5.983   1.00 0.00 ? 59  VAL A HG13 1  
ATOM   867   H  HG21 . VAL A 1 59 ? 8.762   -6.131  4.013   1.00 0.00 ? 59  VAL A HG21 1  
ATOM   868   H  HG22 . VAL A 1 59 ? 7.509   -6.359  2.794   1.00 0.00 ? 59  VAL A HG22 1  
ATOM   869   H  HG23 . VAL A 1 59 ? 7.587   -4.852  3.705   1.00 0.00 ? 59  VAL A HG23 1  
ATOM   870   N  N    . GLU A 1 60 ? 5.419   -9.603  5.663   1.00 0.00 ? 60  GLU A N    1  
ATOM   871   C  CA   . GLU A 1 60 ? 4.646   -10.284 6.695   1.00 0.00 ? 60  GLU A CA   1  
ATOM   872   C  C    . GLU A 1 60 ? 3.156   -10.259 6.365   1.00 0.00 ? 60  GLU A C    1  
ATOM   873   O  O    . GLU A 1 60 ? 2.319   -10.043 7.241   1.00 0.00 ? 60  GLU A O    1  
ATOM   874   C  CB   . GLU A 1 60 ? 4.888   -9.633  8.059   1.00 0.00 ? 60  GLU A CB   1  
ATOM   875   C  CG   . GLU A 1 60 ? 6.349   -9.619  8.475   1.00 0.00 ? 60  GLU A CG   1  
ATOM   876   C  CD   . GLU A 1 60 ? 6.581   -8.856  9.765   1.00 0.00 ? 60  GLU A CD   1  
ATOM   877   O  OE1  . GLU A 1 60 ? 5.991   -7.766  9.923   1.00 0.00 ? 60  GLU A OE1  1  
ATOM   878   O  OE2  . GLU A 1 60 ? 7.350   -9.348  10.616  1.00 0.00 ? 60  GLU A OE2  1  
ATOM   879   H  H    . GLU A 1 60 ? 6.121   -10.094 5.189   1.00 0.00 ? 60  GLU A H    1  
ATOM   880   H  HA   . GLU A 1 60 ? 4.976   -11.311 6.733   1.00 0.00 ? 60  GLU A HA   1  
ATOM   881   H  HB2  . GLU A 1 60 ? 4.534   -8.614  8.026   1.00 0.00 ? 60  GLU A HB2  1  
ATOM   882   H  HB3  . GLU A 1 60 ? 4.328   -10.175 8.807   1.00 0.00 ? 60  GLU A HB3  1  
ATOM   883   H  HG2  . GLU A 1 60 ? 6.682   -10.637 8.612   1.00 0.00 ? 60  GLU A HG2  1  
ATOM   884   H  HG3  . GLU A 1 60 ? 6.929   -9.155  7.691   1.00 0.00 ? 60  GLU A HG3  1  
ATOM   885   N  N    . ASP A 1 61 ? 2.834   -10.480 5.095   1.00 0.00 ? 61  ASP A N    1  
ATOM   886   C  CA   . ASP A 1 61 ? 1.446   -10.483 4.647   1.00 0.00 ? 61  ASP A CA   1  
ATOM   887   C  C    . ASP A 1 61 ? 0.800   -9.119  4.870   1.00 0.00 ? 61  ASP A C    1  
ATOM   888   O  O    . ASP A 1 61 ? -0.399  -9.026  5.131   1.00 0.00 ? 61  ASP A O    1  
ATOM   889   C  CB   . ASP A 1 61 ? 0.653   -11.564 5.384   1.00 0.00 ? 61  ASP A CB   1  
ATOM   890   C  CG   . ASP A 1 61 ? -0.690  -11.838 4.738   1.00 0.00 ? 61  ASP A CG   1  
ATOM   891   O  OD1  . ASP A 1 61 ? -0.776  -11.764 3.494   1.00 0.00 ? 61  ASP A OD1  1  
ATOM   892   O  OD2  . ASP A 1 61 ? -1.657  -12.126 5.475   1.00 0.00 ? 61  ASP A OD2  1  
ATOM   893   H  H    . ASP A 1 61 ? 3.547   -10.646 4.443   1.00 0.00 ? 61  ASP A H    1  
ATOM   894   H  HA   . ASP A 1 61 ? 1.439   -10.702 3.590   1.00 0.00 ? 61  ASP A HA   1  
ATOM   895   H  HB2  . ASP A 1 61 ? 1.224   -12.481 5.387   1.00 0.00 ? 61  ASP A HB2  1  
ATOM   896   H  HB3  . ASP A 1 61 ? 0.485   -11.246 6.403   1.00 0.00 ? 61  ASP A HB3  1  
ATOM   897   N  N    . GLN A 1 62 ? 1.604   -8.066  4.768   1.00 0.00 ? 62  GLN A N    1  
ATOM   898   C  CA   . GLN A 1 62 ? 1.110   -6.707  4.960   1.00 0.00 ? 62  GLN A CA   1  
ATOM   899   C  C    . GLN A 1 62 ? 1.602   -5.787  3.848   1.00 0.00 ? 62  GLN A C    1  
ATOM   900   O  O    . GLN A 1 62 ? 2.369   -6.202  2.979   1.00 0.00 ? 62  GLN A O    1  
ATOM   901   C  CB   . GLN A 1 62 ? 1.556   -6.168  6.320   1.00 0.00 ? 62  GLN A CB   1  
ATOM   902   C  CG   . GLN A 1 62 ? 0.661   -6.601  7.470   1.00 0.00 ? 62  GLN A CG   1  
ATOM   903   C  CD   . GLN A 1 62 ? -0.750  -6.060  7.346   1.00 0.00 ? 62  GLN A CD   1  
ATOM   904   O  OE1  . GLN A 1 62 ? -1.594  -6.643  6.665   1.00 0.00 ? 62  GLN A OE1  1  
ATOM   905   N  NE2  . GLN A 1 62 ? -1.014  -4.938  8.006   1.00 0.00 ? 62  GLN A NE2  1  
ATOM   906   H  H    . GLN A 1 62 ? 2.550   -8.205  4.558   1.00 0.00 ? 62  GLN A H    1  
ATOM   907   H  HA   . GLN A 1 62 ? 0.032   -6.740  4.933   1.00 0.00 ? 62  GLN A HA   1  
ATOM   908   H  HB2  . GLN A 1 62 ? 2.558   -6.516  6.521   1.00 0.00 ? 62  GLN A HB2  1  
ATOM   909   H  HB3  . GLN A 1 62 ? 1.560   -5.089  6.282   1.00 0.00 ? 62  GLN A HB3  1  
ATOM   910   H  HG2  . GLN A 1 62 ? 0.615   -7.679  7.488   1.00 0.00 ? 62  GLN A HG2  1  
ATOM   911   H  HG3  . GLN A 1 62 ? 1.088   -6.244  8.396   1.00 0.00 ? 62  GLN A HG3  1  
ATOM   912   H  HE21 . GLN A 1 62 ? -0.293  -4.528  8.528   1.00 0.00 ? 62  GLN A HE21 1  
ATOM   913   H  HE22 . GLN A 1 62 ? -1.918  -4.566  7.943   1.00 0.00 ? 62  GLN A HE22 1  
ATOM   914   N  N    . ILE A 1 63 ? 1.155   -4.536  3.882   1.00 0.00 ? 63  ILE A N    1  
ATOM   915   C  CA   . ILE A 1 63 ? 1.551   -3.557  2.877   1.00 0.00 ? 63  ILE A CA   1  
ATOM   916   C  C    . ILE A 1 63 ? 2.116   -2.299  3.528   1.00 0.00 ? 63  ILE A C    1  
ATOM   917   O  O    . ILE A 1 63 ? 1.563   -1.789  4.503   1.00 0.00 ? 63  ILE A O    1  
ATOM   918   C  CB   . ILE A 1 63 ? 0.366   -3.166  1.975   1.00 0.00 ? 63  ILE A CB   1  
ATOM   919   C  CG1  . ILE A 1 63 ? -0.796  -2.642  2.820   1.00 0.00 ? 63  ILE A CG1  1  
ATOM   920   C  CG2  . ILE A 1 63 ? -0.076  -4.356  1.136   1.00 0.00 ? 63  ILE A CG2  1  
ATOM   921   C  CD1  . ILE A 1 63 ? -1.797  -1.826  2.032   1.00 0.00 ? 63  ILE A CD1  1  
ATOM   922   H  H    . ILE A 1 63 ? 0.546   -4.265  4.600   1.00 0.00 ? 63  ILE A H    1  
ATOM   923   H  HA   . ILE A 1 63 ? 2.316   -4.004  2.260   1.00 0.00 ? 63  ILE A HA   1  
ATOM   924   H  HB   . ILE A 1 63 ? 0.695   -2.386  1.305   1.00 0.00 ? 63  ILE A HB   1  
ATOM   925   H  HG12 . ILE A 1 63 ? -1.321  -3.477  3.257   1.00 0.00 ? 63  ILE A HG12 1  
ATOM   926   H  HG13 . ILE A 1 63 ? -0.404  -2.016  3.609   1.00 0.00 ? 63  ILE A HG13 1  
ATOM   927   H  HG21 . ILE A 1 63 ? -0.524  -5.101  1.777   1.00 0.00 ? 63  ILE A HG21 1  
ATOM   928   H  HG22 . ILE A 1 63 ? -0.799  -4.031  0.403   1.00 0.00 ? 63  ILE A HG22 1  
ATOM   929   H  HG23 . ILE A 1 63 ? 0.780   -4.780  0.634   1.00 0.00 ? 63  ILE A HG23 1  
ATOM   930   H  HD11 . ILE A 1 63 ? -2.753  -1.845  2.535   1.00 0.00 ? 63  ILE A HD11 1  
ATOM   931   H  HD12 . ILE A 1 63 ? -1.450  -0.807  1.954   1.00 0.00 ? 63  ILE A HD12 1  
ATOM   932   H  HD13 . ILE A 1 63 ? -1.904  -2.247  1.042   1.00 0.00 ? 63  ILE A HD13 1  
ATOM   933   N  N    . TYR A 1 64 ? 3.220   -1.802  2.982   1.00 0.00 ? 64  TYR A N    1  
ATOM   934   C  CA   . TYR A 1 64 ? 3.861   -0.603  3.510   1.00 0.00 ? 64  TYR A CA   1  
ATOM   935   C  C    . TYR A 1 64 ? 4.521   0.199   2.392   1.00 0.00 ? 64  TYR A C    1  
ATOM   936   O  O    . TYR A 1 64 ? 4.627   -0.266  1.257   1.00 0.00 ? 64  TYR A O    1  
ATOM   937   C  CB   . TYR A 1 64 ? 4.902   -0.979  4.566   1.00 0.00 ? 64  TYR A CB   1  
ATOM   938   C  CG   . TYR A 1 64 ? 4.384   -1.941  5.611   1.00 0.00 ? 64  TYR A CG   1  
ATOM   939   C  CD1  . TYR A 1 64 ? 3.747   -1.478  6.755   1.00 0.00 ? 64  TYR A CD1  1  
ATOM   940   C  CD2  . TYR A 1 64 ? 4.533   -3.314  5.454   1.00 0.00 ? 64  TYR A CD2  1  
ATOM   941   C  CE1  . TYR A 1 64 ? 3.273   -2.354  7.713   1.00 0.00 ? 64  TYR A CE1  1  
ATOM   942   C  CE2  . TYR A 1 64 ? 4.061   -4.197  6.405   1.00 0.00 ? 64  TYR A CE2  1  
ATOM   943   C  CZ   . TYR A 1 64 ? 3.432   -3.712  7.533   1.00 0.00 ? 64  TYR A CZ   1  
ATOM   944   O  OH   . TYR A 1 64 ? 2.962   -4.589  8.484   1.00 0.00 ? 64  TYR A OH   1  
ATOM   945   H  H    . TYR A 1 64 ? 3.615   -2.252  2.207   1.00 0.00 ? 64  TYR A H    1  
ATOM   946   H  HA   . TYR A 1 64 ? 3.097   0.006   3.972   1.00 0.00 ? 64  TYR A HA   1  
ATOM   947   H  HB2  . TYR A 1 64 ? 5.747   -1.441  4.080   1.00 0.00 ? 64  TYR A HB2  1  
ATOM   948   H  HB3  . TYR A 1 64 ? 5.229   -0.083  5.073   1.00 0.00 ? 64  TYR A HB3  1  
ATOM   949   H  HD1  . TYR A 1 64 ? 3.624   -0.414  6.893   1.00 0.00 ? 64  TYR A HD1  1  
ATOM   950   H  HD2  . TYR A 1 64 ? 5.027   -3.690  4.569   1.00 0.00 ? 64  TYR A HD2  1  
ATOM   951   H  HE1  . TYR A 1 64 ? 2.780   -1.975  8.596   1.00 0.00 ? 64  TYR A HE1  1  
ATOM   952   H  HE2  . TYR A 1 64 ? 4.186   -5.260  6.265   1.00 0.00 ? 64  TYR A HE2  1  
ATOM   953   H  HH   . TYR A 1 64 ? 3.665   -5.190  8.741   1.00 0.00 ? 64  TYR A HH   1  
ATOM   954   N  N    . CYS A 1 65 ? 4.964   1.408   2.722   1.00 0.00 ? 65  CYS A N    1  
ATOM   955   C  CA   . CYS A 1 65 ? 5.614   2.277   1.749   1.00 0.00 ? 65  CYS A CA   1  
ATOM   956   C  C    . CYS A 1 65 ? 7.105   1.966   1.652   1.00 0.00 ? 65  CYS A C    1  
ATOM   957   O  O    . CYS A 1 65 ? 7.767   1.739   2.664   1.00 0.00 ? 65  CYS A O    1  
ATOM   958   C  CB   . CYS A 1 65 ? 5.411   3.745   2.129   1.00 0.00 ? 65  CYS A CB   1  
ATOM   959   S  SG   . CYS A 1 65 ? 6.017   4.173   3.792   1.00 0.00 ? 65  CYS A SG   1  
ATOM   960   H  H    . CYS A 1 65 ? 4.850   1.724   3.644   1.00 0.00 ? 65  CYS A H    1  
ATOM   961   H  HA   . CYS A 1 65 ? 5.158   2.097   0.787   1.00 0.00 ? 65  CYS A HA   1  
ATOM   962   H  HB2  . CYS A 1 65 ? 5.935   4.368   1.419   1.00 0.00 ? 65  CYS A HB2  1  
ATOM   963   H  HB3  . CYS A 1 65 ? 4.356   3.975   2.093   1.00 0.00 ? 65  CYS A HB3  1  
ATOM   964   N  N    . GLU A 1 66 ? 7.624   1.959   0.429   1.00 0.00 ? 66  GLU A N    1  
ATOM   965   C  CA   . GLU A 1 66 ? 9.037   1.676   0.201   1.00 0.00 ? 66  GLU A CA   1  
ATOM   966   C  C    . GLU A 1 66 ? 9.889   2.201   1.352   1.00 0.00 ? 66  GLU A C    1  
ATOM   967   O  O    . GLU A 1 66 ? 10.876  1.578   1.744   1.00 0.00 ? 66  GLU A O    1  
ATOM   968   C  CB   . GLU A 1 66 ? 9.499   2.300   -1.117  1.00 0.00 ? 66  GLU A CB   1  
ATOM   969   C  CG   . GLU A 1 66 ? 10.994  2.176   -1.358  1.00 0.00 ? 66  GLU A CG   1  
ATOM   970   C  CD   . GLU A 1 66 ? 11.405  2.662   -2.735  1.00 0.00 ? 66  GLU A CD   1  
ATOM   971   O  OE1  . GLU A 1 66 ? 11.320  1.868   -3.694  1.00 0.00 ? 66  GLU A OE1  1  
ATOM   972   O  OE2  . GLU A 1 66 ? 11.811  3.837   -2.851  1.00 0.00 ? 66  GLU A OE2  1  
ATOM   973   H  H    . GLU A 1 66 ? 7.045   2.148   -0.338  1.00 0.00 ? 66  GLU A H    1  
ATOM   974   H  HA   . GLU A 1 66 ? 9.155   0.604   0.142   1.00 0.00 ? 66  GLU A HA   1  
ATOM   975   H  HB2  . GLU A 1 66 ? 8.982   1.816   -1.932  1.00 0.00 ? 66  GLU A HB2  1  
ATOM   976   H  HB3  . GLU A 1 66 ? 9.242   3.349   -1.113  1.00 0.00 ? 66  GLU A HB3  1  
ATOM   977   H  HG2  . GLU A 1 66 ? 11.515  2.763   -0.616  1.00 0.00 ? 66  GLU A HG2  1  
ATOM   978   H  HG3  . GLU A 1 66 ? 11.277  1.139   -1.259  1.00 0.00 ? 66  GLU A HG3  1  
ATOM   979   N  N    . LYS A 1 67 ? 9.502   3.353   1.890   1.00 0.00 ? 67  LYS A N    1  
ATOM   980   C  CA   . LYS A 1 67 ? 10.228  3.964   2.996   1.00 0.00 ? 67  LYS A CA   1  
ATOM   981   C  C    . LYS A 1 67 ? 10.218  3.056   4.222   1.00 0.00 ? 67  LYS A C    1  
ATOM   982   O  O    . LYS A 1 67 ? 11.262  2.790   4.819   1.00 0.00 ? 67  LYS A O    1  
ATOM   983   C  CB   . LYS A 1 67 ? 9.615   5.321   3.349   1.00 0.00 ? 67  LYS A CB   1  
ATOM   984   C  CG   . LYS A 1 67 ? 10.242  5.974   4.569   1.00 0.00 ? 67  LYS A CG   1  
ATOM   985   C  CD   . LYS A 1 67 ? 9.359   7.077   5.126   1.00 0.00 ? 67  LYS A CD   1  
ATOM   986   C  CE   . LYS A 1 67 ? 10.049  7.825   6.258   1.00 0.00 ? 67  LYS A CE   1  
ATOM   987   N  NZ   . LYS A 1 67 ? 11.160  8.682   5.759   1.00 0.00 ? 67  LYS A NZ   1  
ATOM   988   H  H    . LYS A 1 67 ? 8.706   3.803   1.534   1.00 0.00 ? 67  LYS A H    1  
ATOM   989   H  HA   . LYS A 1 67 ? 11.250  4.112   2.681   1.00 0.00 ? 67  LYS A HA   1  
ATOM   990   H  HB2  . LYS A 1 67 ? 9.736   5.987   2.508   1.00 0.00 ? 67  LYS A HB2  1  
ATOM   991   H  HB3  . LYS A 1 67 ? 8.560   5.186   3.542   1.00 0.00 ? 67  LYS A HB3  1  
ATOM   992   H  HG2  . LYS A 1 67 ? 10.388  5.224   5.332   1.00 0.00 ? 67  LYS A HG2  1  
ATOM   993   H  HG3  . LYS A 1 67 ? 11.197  6.396   4.289   1.00 0.00 ? 67  LYS A HG3  1  
ATOM   994   H  HD2  . LYS A 1 67 ? 9.129   7.777   4.336   1.00 0.00 ? 67  LYS A HD2  1  
ATOM   995   H  HD3  . LYS A 1 67 ? 8.444   6.640   5.501   1.00 0.00 ? 67  LYS A HD3  1  
ATOM   996   H  HE2  . LYS A 1 67 ? 9.322   8.447   6.756   1.00 0.00 ? 67  LYS A HE2  1  
ATOM   997   H  HE3  . LYS A 1 67 ? 10.446  7.105   6.957   1.00 0.00 ? 67  LYS A HE3  1  
ATOM   998   H  HZ1  . LYS A 1 67 ? 11.468  9.337   6.507   1.00 0.00 ? 67  LYS A HZ1  1  
ATOM   999   H  HZ2  . LYS A 1 67 ? 10.844  9.235   4.938   1.00 0.00 ? 67  LYS A HZ2  1  
ATOM   1000  H  HZ3  . LYS A 1 67 ? 11.968  8.091   5.476   1.00 0.00 ? 67  LYS A HZ3  1  
ATOM   1001  N  N    . HIS A 1 68 ? 9.033   2.581   4.591   1.00 0.00 ? 68  HIS A N    1  
ATOM   1002  C  CA   . HIS A 1 68 ? 8.888   1.700   5.744   1.00 0.00 ? 68  HIS A CA   1  
ATOM   1003  C  C    . HIS A 1 68 ? 9.220   0.258   5.372   1.00 0.00 ? 68  HIS A C    1  
ATOM   1004  O  O    . HIS A 1 68 ? 10.001  -0.405  6.055   1.00 0.00 ? 68  HIS A O    1  
ATOM   1005  C  CB   . HIS A 1 68 ? 7.465   1.780   6.299   1.00 0.00 ? 68  HIS A CB   1  
ATOM   1006  C  CG   . HIS A 1 68 ? 7.280   2.861   7.319   1.00 0.00 ? 68  HIS A CG   1  
ATOM   1007  N  ND1  . HIS A 1 68 ? 6.258   3.785   7.259   1.00 0.00 ? 68  HIS A ND1  1  
ATOM   1008  C  CD2  . HIS A 1 68 ? 7.992   3.161   8.430   1.00 0.00 ? 68  HIS A CD2  1  
ATOM   1009  C  CE1  . HIS A 1 68 ? 6.351   4.608   8.288   1.00 0.00 ? 68  HIS A CE1  1  
ATOM   1010  N  NE2  . HIS A 1 68 ? 7.395   4.251   9.015   1.00 0.00 ? 68  HIS A NE2  1  
ATOM   1011  H  H    . HIS A 1 68 ? 8.237   2.828   4.075   1.00 0.00 ? 68  HIS A H    1  
ATOM   1012  H  HA   . HIS A 1 68 ? 9.580   2.031   6.504   1.00 0.00 ? 68  HIS A HA   1  
ATOM   1013  H  HB2  . HIS A 1 68 ? 6.780   1.971   5.486   1.00 0.00 ? 68  HIS A HB2  1  
ATOM   1014  H  HB3  . HIS A 1 68 ? 7.212   0.838   6.763   1.00 0.00 ? 68  HIS A HB3  1  
ATOM   1015  H  HD2  . HIS A 1 68 ? 8.869   2.641   8.790   1.00 0.00 ? 68  HIS A HD2  1  
ATOM   1016  H  HE1  . HIS A 1 68 ? 5.687   5.432   8.501   1.00 0.00 ? 68  HIS A HE1  1  
ATOM   1017  H  HE2  . HIS A 1 68 ? 7.741   4.745   9.786   1.00 0.00 ? 68  HIS A HE2  1  
ATOM   1018  N  N    . ALA A 1 69 ? 8.623   -0.221  4.286   1.00 0.00 ? 69  ALA A N    1  
ATOM   1019  C  CA   . ALA A 1 69 ? 8.857   -1.583  3.823   1.00 0.00 ? 69  ALA A CA   1  
ATOM   1020  C  C    . ALA A 1 69 ? 10.341  -1.929  3.863   1.00 0.00 ? 69  ALA A C    1  
ATOM   1021  O  O    . ALA A 1 69 ? 10.746  -2.893  4.513   1.00 0.00 ? 69  ALA A O    1  
ATOM   1022  C  CB   . ALA A 1 69 ? 8.309   -1.763  2.415   1.00 0.00 ? 69  ALA A CB   1  
ATOM   1023  H  H    . ALA A 1 69 ? 8.011   0.357   3.783   1.00 0.00 ? 69  ALA A H    1  
ATOM   1024  H  HA   . ALA A 1 69 ? 8.323   -2.255  4.479   1.00 0.00 ? 69  ALA A HA   1  
ATOM   1025  H  HB1  . ALA A 1 69 ? 9.121   -1.710  1.704   1.00 0.00 ? 69  ALA A HB1  1  
ATOM   1026  H  HB2  . ALA A 1 69 ? 7.824   -2.725  2.338   1.00 0.00 ? 69  ALA A HB2  1  
ATOM   1027  H  HB3  . ALA A 1 69 ? 7.595   -0.981  2.204   1.00 0.00 ? 69  ALA A HB3  1  
ATOM   1028  N  N    . ARG A 1 70 ? 11.148  -1.137  3.164   1.00 0.00 ? 70  ARG A N    1  
ATOM   1029  C  CA   . ARG A 1 70 ? 12.588  -1.362  3.119   1.00 0.00 ? 70  ARG A CA   1  
ATOM   1030  C  C    . ARG A 1 70 ? 13.151  -1.562  4.523   1.00 0.00 ? 70  ARG A C    1  
ATOM   1031  O  O    . ARG A 1 70 ? 13.985  -2.439  4.747   1.00 0.00 ? 70  ARG A O    1  
ATOM   1032  C  CB   . ARG A 1 70 ? 13.288  -0.183  2.440   1.00 0.00 ? 70  ARG A CB   1  
ATOM   1033  C  CG   . ARG A 1 70 ? 13.396  1.051   3.321   1.00 0.00 ? 70  ARG A CG   1  
ATOM   1034  C  CD   . ARG A 1 70 ? 14.190  2.154   2.639   1.00 0.00 ? 70  ARG A CD   1  
ATOM   1035  N  NE   . ARG A 1 70 ? 15.620  2.051   2.918   1.00 0.00 ? 70  ARG A NE   1  
ATOM   1036  C  CZ   . ARG A 1 70 ? 16.489  1.473   2.096   1.00 0.00 ? 70  ARG A CZ   1  
ATOM   1037  N  NH1  . ARG A 1 70 ? 16.076  0.949   0.951   1.00 0.00 ? 70  ARG A NH1  1  
ATOM   1038  N  NH2  . ARG A 1 70 ? 17.775  1.418   2.420   1.00 0.00 ? 70  ARG A NH2  1  
ATOM   1039  H  H    . ARG A 1 70 ? 10.766  -0.385  2.666   1.00 0.00 ? 70  ARG A H    1  
ATOM   1040  H  HA   . ARG A 1 70 ? 12.766  -2.256  2.541   1.00 0.00 ? 70  ARG A HA   1  
ATOM   1041  H  HB2  . ARG A 1 70 ? 14.286  -0.486  2.159   1.00 0.00 ? 70  ARG A HB2  1  
ATOM   1042  H  HB3  . ARG A 1 70 ? 12.738  0.083   1.550   1.00 0.00 ? 70  ARG A HB3  1  
ATOM   1043  H  HG2  . ARG A 1 70 ? 12.402  1.417   3.534   1.00 0.00 ? 70  ARG A HG2  1  
ATOM   1044  H  HG3  . ARG A 1 70 ? 13.888  0.781   4.243   1.00 0.00 ? 70  ARG A HG3  1  
ATOM   1045  H  HD2  . ARG A 1 70 ? 14.035  2.085   1.573   1.00 0.00 ? 70  ARG A HD2  1  
ATOM   1046  H  HD3  . ARG A 1 70 ? 13.831  3.109   2.994   1.00 0.00 ? 70  ARG A HD3  1  
ATOM   1047  H  HE   . ARG A 1 70 ? 15.947  2.432   3.759   1.00 0.00 ? 70  ARG A HE   1  
ATOM   1048  H  HH11 . ARG A 1 70 ? 15.107  0.989   0.704   1.00 0.00 ? 70  ARG A HH11 1  
ATOM   1049  H  HH12 . ARG A 1 70 ? 16.732  0.515   0.333   1.00 0.00 ? 70  ARG A HH12 1  
ATOM   1050  H  HH21 . ARG A 1 70 ? 18.090  1.813   3.283   1.00 0.00 ? 70  ARG A HH21 1  
ATOM   1051  H  HH22 . ARG A 1 70 ? 18.428  0.983   1.801   1.00 0.00 ? 70  ARG A HH22 1  
ATOM   1052  N  N    . GLU A 1 71 ? 12.690  -0.743  5.462   1.00 0.00 ? 71  GLU A N    1  
ATOM   1053  C  CA   . GLU A 1 71 ? 13.149  -0.830  6.844   1.00 0.00 ? 71  GLU A CA   1  
ATOM   1054  C  C    . GLU A 1 71 ? 12.766  -2.172  7.461   1.00 0.00 ? 71  GLU A C    1  
ATOM   1055  O  O    . GLU A 1 71 ? 13.524  -2.747  8.241   1.00 0.00 ? 71  GLU A O    1  
ATOM   1056  C  CB   . GLU A 1 71 ? 12.560  0.313   7.673   1.00 0.00 ? 71  GLU A CB   1  
ATOM   1057  C  CG   . GLU A 1 71 ? 12.935  1.693   7.161   1.00 0.00 ? 71  GLU A CG   1  
ATOM   1058  C  CD   . GLU A 1 71 ? 14.269  2.173   7.699   1.00 0.00 ? 71  GLU A CD   1  
ATOM   1059  O  OE1  . GLU A 1 71 ? 15.230  1.376   7.698   1.00 0.00 ? 71  GLU A OE1  1  
ATOM   1060  O  OE2  . GLU A 1 71 ? 14.352  3.346   8.120   1.00 0.00 ? 71  GLU A OE2  1  
ATOM   1061  H  H    . GLU A 1 71 ? 12.026  -0.064  5.221   1.00 0.00 ? 71  GLU A H    1  
ATOM   1062  H  HA   . GLU A 1 71 ? 14.225  -0.743  6.841   1.00 0.00 ? 71  GLU A HA   1  
ATOM   1063  H  HB2  . GLU A 1 71 ? 11.484  0.229   7.667   1.00 0.00 ? 71  GLU A HB2  1  
ATOM   1064  H  HB3  . GLU A 1 71 ? 12.913  0.222   8.690   1.00 0.00 ? 71  GLU A HB3  1  
ATOM   1065  H  HG2  . GLU A 1 71 ? 12.990  1.660   6.083   1.00 0.00 ? 71  GLU A HG2  1  
ATOM   1066  H  HG3  . GLU A 1 71 ? 12.169  2.394   7.459   1.00 0.00 ? 71  GLU A HG3  1  
ATOM   1067  N  N    . ARG A 1 72 ? 11.583  -2.663  7.106   1.00 0.00 ? 72  ARG A N    1  
ATOM   1068  C  CA   . ARG A 1 72 ? 11.097  -3.936  7.626   1.00 0.00 ? 72  ARG A CA   1  
ATOM   1069  C  C    . ARG A 1 72 ? 11.825  -5.105  6.969   1.00 0.00 ? 72  ARG A C    1  
ATOM   1070  O  O    . ARG A 1 72 ? 12.448  -5.922  7.647   1.00 0.00 ? 72  ARG A O    1  
ATOM   1071  C  CB   . ARG A 1 72 ? 9.591   -4.064  7.394   1.00 0.00 ? 72  ARG A CB   1  
ATOM   1072  C  CG   . ARG A 1 72 ? 8.757   -3.172  8.299   1.00 0.00 ? 72  ARG A CG   1  
ATOM   1073  C  CD   . ARG A 1 72 ? 7.268   -3.395  8.084   1.00 0.00 ? 72  ARG A CD   1  
ATOM   1074  N  NE   . ARG A 1 72 ? 6.462   -2.741  9.111   1.00 0.00 ? 72  ARG A NE   1  
ATOM   1075  C  CZ   . ARG A 1 72 ? 6.385   -3.168  10.367  1.00 0.00 ? 72  ARG A CZ   1  
ATOM   1076  N  NH1  . ARG A 1 72 ? 7.061   -4.243  10.748  1.00 0.00 ? 72  ARG A NH1  1  
ATOM   1077  N  NH2  . ARG A 1 72 ? 5.630   -2.520  11.244  1.00 0.00 ? 72  ARG A NH2  1  
ATOM   1078  H  H    . ARG A 1 72 ? 11.023  -2.158  6.480   1.00 0.00 ? 72  ARG A H    1  
ATOM   1079  H  HA   . ARG A 1 72 ? 11.292  -3.956  8.688   1.00 0.00 ? 72  ARG A HA   1  
ATOM   1080  H  HB2  . ARG A 1 72 ? 9.373   -3.803  6.369   1.00 0.00 ? 72  ARG A HB2  1  
ATOM   1081  H  HB3  . ARG A 1 72 ? 9.298   -5.089  7.566   1.00 0.00 ? 72  ARG A HB3  1  
ATOM   1082  H  HG2  . ARG A 1 72 ? 8.997   -3.394  9.329   1.00 0.00 ? 72  ARG A HG2  1  
ATOM   1083  H  HG3  . ARG A 1 72 ? 8.992   -2.140  8.087   1.00 0.00 ? 72  ARG A HG3  1  
ATOM   1084  H  HD2  . ARG A 1 72 ? 6.995   -2.997  7.118   1.00 0.00 ? 72  ARG A HD2  1  
ATOM   1085  H  HD3  . ARG A 1 72 ? 7.071   -4.456  8.105   1.00 0.00 ? 72  ARG A HD3  1  
ATOM   1086  H  HE   . ARG A 1 72 ? 5.954   -1.945  8.851   1.00 0.00 ? 72  ARG A HE   1  
ATOM   1087  H  HH11 . ARG A 1 72 ? 7.632   -4.733  10.089  1.00 0.00 ? 72  ARG A HH11 1  
ATOM   1088  H  HH12 . ARG A 1 72 ? 7.002   -4.562  11.694  1.00 0.00 ? 72  ARG A HH12 1  
ATOM   1089  H  HH21 . ARG A 1 72 ? 5.118   -1.709  10.960  1.00 0.00 ? 72  ARG A HH21 1  
ATOM   1090  H  HH22 . ARG A 1 72 ? 5.572   -2.842  12.188  1.00 0.00 ? 72  ARG A HH22 1  
ATOM   1091  N  N    . VAL A 1 73 ? 11.742  -5.178  5.645   1.00 0.00 ? 73  VAL A N    1  
ATOM   1092  C  CA   . VAL A 1 73 ? 12.393  -6.246  4.896   1.00 0.00 ? 73  VAL A CA   1  
ATOM   1093  C  C    . VAL A 1 73 ? 13.889  -6.287  5.184   1.00 0.00 ? 73  VAL A C    1  
ATOM   1094  O  O    . VAL A 1 73 ? 14.524  -7.336  5.078   1.00 0.00 ? 73  VAL A O    1  
ATOM   1095  C  CB   . VAL A 1 73 ? 12.178  -6.080  3.379   1.00 0.00 ? 73  VAL A CB   1  
ATOM   1096  C  CG1  . VAL A 1 73 ? 12.657  -4.712  2.919   1.00 0.00 ? 73  VAL A CG1  1  
ATOM   1097  C  CG2  . VAL A 1 73 ? 12.889  -7.188  2.617   1.00 0.00 ? 73  VAL A CG2  1  
ATOM   1098  H  H    . VAL A 1 73 ? 11.231  -4.497  5.159   1.00 0.00 ? 73  VAL A H    1  
ATOM   1099  H  HA   . VAL A 1 73 ? 11.952  -7.184  5.200   1.00 0.00 ? 73  VAL A HA   1  
ATOM   1100  H  HB   . VAL A 1 73 ? 11.120  -6.154  3.176   1.00 0.00 ? 73  VAL A HB   1  
ATOM   1101  H  HG11 . VAL A 1 73 ? 13.006  -4.148  3.771   1.00 0.00 ? 73  VAL A HG11 1  
ATOM   1102  H  HG12 . VAL A 1 73 ? 13.463  -4.832  2.210   1.00 0.00 ? 73  VAL A HG12 1  
ATOM   1103  H  HG13 . VAL A 1 73 ? 11.840  -4.185  2.449   1.00 0.00 ? 73  VAL A HG13 1  
ATOM   1104  H  HG21 . VAL A 1 73 ? 12.201  -7.644  1.921   1.00 0.00 ? 73  VAL A HG21 1  
ATOM   1105  H  HG22 . VAL A 1 73 ? 13.726  -6.772  2.074   1.00 0.00 ? 73  VAL A HG22 1  
ATOM   1106  H  HG23 . VAL A 1 73 ? 13.246  -7.933  3.312   1.00 0.00 ? 73  VAL A HG23 1  
ATOM   1107  N  N    . SER A 1 74 ? 14.447  -5.138  5.551   1.00 0.00 ? 74  SER A N    1  
ATOM   1108  C  CA   . SER A 1 74 ? 15.871  -5.041  5.852   1.00 0.00 ? 74  SER A CA   1  
ATOM   1109  C  C    . SER A 1 74 ? 16.092  -4.565  7.285   1.00 0.00 ? 74  SER A C    1  
ATOM   1110  O  O    . SER A 1 74 ? 15.794  -3.420  7.624   1.00 0.00 ? 74  SER A O    1  
ATOM   1111  C  CB   . SER A 1 74 ? 16.557  -4.086  4.874   1.00 0.00 ? 74  SER A CB   1  
ATOM   1112  O  OG   . SER A 1 74 ? 17.950  -4.012  5.125   1.00 0.00 ? 74  SER A OG   1  
ATOM   1113  H  H    . SER A 1 74 ? 13.888  -4.335  5.618   1.00 0.00 ? 74  SER A H    1  
ATOM   1114  H  HA   . SER A 1 74 ? 16.301  -6.025  5.743   1.00 0.00 ? 74  SER A HA   1  
ATOM   1115  H  HB2  . SER A 1 74 ? 16.403  -4.436  3.865   1.00 0.00 ? 74  SER A HB2  1  
ATOM   1116  H  HB3  . SER A 1 74 ? 16.131  -3.098  4.981   1.00 0.00 ? 74  SER A HB3  1  
ATOM   1117  H  HG   . SER A 1 74 ? 18.426  -4.018  4.291   1.00 0.00 ? 74  SER A HG   1  
ATOM   1118  N  N    . GLY A 1 75 ? 16.617  -5.453  8.123   1.00 0.00 ? 75  GLY A N    1  
ATOM   1119  C  CA   . GLY A 1 75 ? 16.869  -5.106  9.510   1.00 0.00 ? 75  GLY A CA   1  
ATOM   1120  C  C    . GLY A 1 75 ? 16.575  -6.253  10.457  1.00 0.00 ? 75  GLY A C    1  
ATOM   1121  O  O    . GLY A 1 75 ? 16.761  -7.424  10.125  1.00 0.00 ? 75  GLY A O    1  
ATOM   1122  H  H    . GLY A 1 75 ? 16.835  -6.352  7.798   1.00 0.00 ? 75  GLY A H    1  
ATOM   1123  H  HA2  . GLY A 1 75 ? 17.905  -4.822  9.616   1.00 0.00 ? 75  GLY A HA2  1  
ATOM   1124  H  HA3  . GLY A 1 75 ? 16.246  -4.265  9.777   1.00 0.00 ? 75  GLY A HA3  1  
ATOM   1125  N  N    . PRO A 1 76 ? 16.106  -5.919  11.668  1.00 0.00 ? 76  PRO A N    1  
ATOM   1126  C  CA   . PRO A 1 76 ? 15.777  -6.916  12.692  1.00 0.00 ? 76  PRO A CA   1  
ATOM   1127  C  C    . PRO A 1 76 ? 14.541  -7.733  12.330  1.00 0.00 ? 76  PRO A C    1  
ATOM   1128  O  O    . PRO A 1 76 ? 13.942  -7.534  11.273  1.00 0.00 ? 76  PRO A O    1  
ATOM   1129  C  CB   . PRO A 1 76 ? 15.512  -6.070  13.939  1.00 0.00 ? 76  PRO A CB   1  
ATOM   1130  C  CG   . PRO A 1 76 ? 15.096  -4.739  13.413  1.00 0.00 ? 76  PRO A CG   1  
ATOM   1131  C  CD   . PRO A 1 76 ? 15.859  -4.544  12.132  1.00 0.00 ? 76  PRO A CD   1  
ATOM   1132  H  HA   . PRO A 1 76 ? 16.606  -7.583  12.877  1.00 0.00 ? 76  PRO A HA   1  
ATOM   1133  H  HB2  . PRO A 1 76 ? 14.728  -6.526  14.527  1.00 0.00 ? 76  PRO A HB2  1  
ATOM   1134  H  HB3  . PRO A 1 76 ? 16.414  -5.997  14.528  1.00 0.00 ? 76  PRO A HB3  1  
ATOM   1135  H  HG2  . PRO A 1 76 ? 14.034  -4.736  13.221  1.00 0.00 ? 76  PRO A HG2  1  
ATOM   1136  H  HG3  . PRO A 1 76 ? 15.353  -3.967  14.123  1.00 0.00 ? 76  PRO A HG3  1  
ATOM   1137  H  HD2  . PRO A 1 76 ? 15.263  -3.997  11.417  1.00 0.00 ? 76  PRO A HD2  1  
ATOM   1138  H  HD3  . PRO A 1 76 ? 16.790  -4.029  12.322  1.00 0.00 ? 76  PRO A HD3  1  
ATOM   1139  N  N    . SER A 1 77 ? 14.165  -8.652  13.214  1.00 0.00 ? 77  SER A N    1  
ATOM   1140  C  CA   . SER A 1 77 ? 13.002  -9.501  12.985  1.00 0.00 ? 77  SER A CA   1  
ATOM   1141  C  C    . SER A 1 77 ? 12.191  -9.668  14.267  1.00 0.00 ? 77  SER A C    1  
ATOM   1142  O  O    . SER A 1 77 ? 12.629  -10.326 15.210  1.00 0.00 ? 77  SER A O    1  
ATOM   1143  C  CB   . SER A 1 77 ? 13.439  -10.871 12.463  1.00 0.00 ? 77  SER A CB   1  
ATOM   1144  O  OG   . SER A 1 77 ? 12.382  -11.513 11.771  1.00 0.00 ? 77  SER A OG   1  
ATOM   1145  H  H    . SER A 1 77 ? 14.684  -8.762  14.038  1.00 0.00 ? 77  SER A H    1  
ATOM   1146  H  HA   . SER A 1 77 ? 12.383  -9.022  12.241  1.00 0.00 ? 77  SER A HA   1  
ATOM   1147  H  HB2  . SER A 1 77 ? 14.272  -10.747 11.788  1.00 0.00 ? 77  SER A HB2  1  
ATOM   1148  H  HB3  . SER A 1 77 ? 13.739  -11.491 13.295  1.00 0.00 ? 77  SER A HB3  1  
ATOM   1149  H  HG   . SER A 1 77 ? 11.569  -11.423 12.272  1.00 0.00 ? 77  SER A HG   1  
ATOM   1150  N  N    . SER A 1 78 ? 11.006  -9.067  14.292  1.00 0.00 ? 78  SER A N    1  
ATOM   1151  C  CA   . SER A 1 78 ? 10.134  -9.145  15.459  1.00 0.00 ? 78  SER A CA   1  
ATOM   1152  C  C    . SER A 1 78 ? 9.308   -10.427 15.435  1.00 0.00 ? 78  SER A C    1  
ATOM   1153  O  O    . SER A 1 78 ? 8.472   -10.624 14.554  1.00 0.00 ? 78  SER A O    1  
ATOM   1154  C  CB   . SER A 1 78 ? 9.207   -7.929  15.511  1.00 0.00 ? 78  SER A CB   1  
ATOM   1155  O  OG   . SER A 1 78 ? 8.244   -7.977  14.473  1.00 0.00 ? 78  SER A OG   1  
ATOM   1156  H  H    . SER A 1 78 ? 10.712  -8.556  13.509  1.00 0.00 ? 78  SER A H    1  
ATOM   1157  H  HA   . SER A 1 78 ? 10.759  -9.149  16.340  1.00 0.00 ? 78  SER A HA   1  
ATOM   1158  H  HB2  . SER A 1 78 ? 8.695   -7.911  16.461  1.00 0.00 ? 78  SER A HB2  1  
ATOM   1159  H  HB3  . SER A 1 78 ? 9.793   -7.028  15.401  1.00 0.00 ? 78  SER A HB3  1  
ATOM   1160  H  HG   . SER A 1 78 ? 7.389   -7.706  14.817  1.00 0.00 ? 78  SER A HG   1  
ATOM   1161  N  N    . GLY A 1 79 ? 9.550   -11.298 16.411  1.00 0.00 ? 79  GLY A N    1  
ATOM   1162  C  CA   . GLY A 1 79 ? 8.822   -12.551 16.484  1.00 0.00 ? 79  GLY A CA   1  
ATOM   1163  C  C    . GLY A 1 79 ? 7.327   -12.363 16.317  1.00 0.00 ? 79  GLY A C    1  
ATOM   1164  O  O    . GLY A 1 79 ? 6.600   -12.436 17.307  1.00 0.00 ? 79  GLY A O    1  
ATOM   1165  H  H    . GLY A 1 79 ? 10.229  -11.087 17.086  1.00 0.00 ? 79  GLY A H    1  
ATOM   1166  H  HA2  . GLY A 1 79 ? 9.181   -13.209 15.707  1.00 0.00 ? 79  GLY A HA2  1  
ATOM   1167  H  HA3  . GLY A 1 79 ? 9.010   -13.008 17.444  1.00 0.00 ? 79  GLY A HA3  1  
HETATM 1168  ZN ZN   . ZN  B 2 .  ? -10.945 -0.511  3.512   1.00 0.00 ? 201 ZN  A ZN   1  
HETATM 1169  ZN ZN   . ZN  C 2 .  ? 4.857   3.938   5.798   1.00 0.00 ? 401 ZN  A ZN   1  
ATOM   1170  N  N    . GLY A 1 1  ? -24.706 -7.258  37.218  1.00 0.00 ? 1   GLY A N    2  
ATOM   1171  C  CA   . GLY A 1 1  ? -25.907 -7.646  36.502  1.00 0.00 ? 1   GLY A CA   2  
ATOM   1172  C  C    . GLY A 1 1  ? -25.603 -8.462  35.261  1.00 0.00 ? 1   GLY A C    2  
ATOM   1173  O  O    . GLY A 1 1  ? -24.500 -8.987  35.109  1.00 0.00 ? 1   GLY A O    2  
ATOM   1174  H  H1   . GLY A 1 1  ? -24.521 -6.310  37.383  1.00 0.00 ? 1   GLY A H1   2  
ATOM   1175  H  HA2  . GLY A 1 1  ? -26.532 -8.231  37.160  1.00 0.00 ? 1   GLY A HA2  2  
ATOM   1176  H  HA3  . GLY A 1 1  ? -26.442 -6.755  36.210  1.00 0.00 ? 1   GLY A HA3  2  
ATOM   1177  N  N    . SER A 1 2  ? -26.585 -8.571  34.371  1.00 0.00 ? 2   SER A N    2  
ATOM   1178  C  CA   . SER A 1 2  ? -26.419 -9.333  33.139  1.00 0.00 ? 2   SER A CA   2  
ATOM   1179  C  C    . SER A 1 2  ? -27.248 -8.728  32.010  1.00 0.00 ? 2   SER A C    2  
ATOM   1180  O  O    . SER A 1 2  ? -28.281 -8.104  32.249  1.00 0.00 ? 2   SER A O    2  
ATOM   1181  C  CB   . SER A 1 2  ? -26.825 -10.792 33.359  1.00 0.00 ? 2   SER A CB   2  
ATOM   1182  O  OG   . SER A 1 2  ? -25.749 -11.547 33.888  1.00 0.00 ? 2   SER A OG   2  
ATOM   1183  H  H    . SER A 1 2  ? -27.442 -8.129  34.549  1.00 0.00 ? 2   SER A H    2  
ATOM   1184  H  HA   . SER A 1 2  ? -25.376 -9.296  32.864  1.00 0.00 ? 2   SER A HA   2  
ATOM   1185  H  HB2  . SER A 1 2  ? -27.652 -10.833 34.052  1.00 0.00 ? 2   SER A HB2  2  
ATOM   1186  H  HB3  . SER A 1 2  ? -27.124 -11.226 32.416  1.00 0.00 ? 2   SER A HB3  2  
ATOM   1187  H  HG   . SER A 1 2  ? -25.321 -11.047 34.587  1.00 0.00 ? 2   SER A HG   2  
ATOM   1188  N  N    . SER A 1 3  ? -26.785 -8.917  30.778  1.00 0.00 ? 3   SER A N    2  
ATOM   1189  C  CA   . SER A 1 3  ? -27.480 -8.387  29.611  1.00 0.00 ? 3   SER A CA   2  
ATOM   1190  C  C    . SER A 1 3  ? -27.678 -9.472  28.557  1.00 0.00 ? 3   SER A C    2  
ATOM   1191  O  O    . SER A 1 3  ? -27.137 -10.571 28.672  1.00 0.00 ? 3   SER A O    2  
ATOM   1192  C  CB   . SER A 1 3  ? -26.698 -7.216  29.014  1.00 0.00 ? 3   SER A CB   2  
ATOM   1193  O  OG   . SER A 1 3  ? -27.555 -6.338  28.305  1.00 0.00 ? 3   SER A OG   2  
ATOM   1194  H  H    . SER A 1 3  ? -25.956 -9.424  30.652  1.00 0.00 ? 3   SER A H    2  
ATOM   1195  H  HA   . SER A 1 3  ? -28.449 -8.035  29.934  1.00 0.00 ? 3   SER A HA   2  
ATOM   1196  H  HB2  . SER A 1 3  ? -26.215 -6.667  29.807  1.00 0.00 ? 3   SER A HB2  2  
ATOM   1197  H  HB3  . SER A 1 3  ? -25.950 -7.597  28.333  1.00 0.00 ? 3   SER A HB3  2  
ATOM   1198  H  HG   . SER A 1 3  ? -27.067 -5.918  27.594  1.00 0.00 ? 3   SER A HG   2  
ATOM   1199  N  N    . GLY A 1 4  ? -28.458 -9.155  27.528  1.00 0.00 ? 4   GLY A N    2  
ATOM   1200  C  CA   . GLY A 1 4  ? -28.714 -10.112 26.468  1.00 0.00 ? 4   GLY A CA   2  
ATOM   1201  C  C    . GLY A 1 4  ? -28.789 -9.459  25.103  1.00 0.00 ? 4   GLY A C    2  
ATOM   1202  O  O    . GLY A 1 4  ? -29.356 -8.376  24.955  1.00 0.00 ? 4   GLY A O    2  
ATOM   1203  H  H    . GLY A 1 4  ? -28.863 -8.263  27.489  1.00 0.00 ? 4   GLY A H    2  
ATOM   1204  H  HA2  . GLY A 1 4  ? -27.923 -10.846 26.462  1.00 0.00 ? 4   GLY A HA2  2  
ATOM   1205  H  HA3  . GLY A 1 4  ? -29.652 -10.610 26.668  1.00 0.00 ? 4   GLY A HA3  2  
ATOM   1206  N  N    . SER A 1 5  ? -28.213 -10.116 24.101  1.00 0.00 ? 5   SER A N    2  
ATOM   1207  C  CA   . SER A 1 5  ? -28.211 -9.590  22.742  1.00 0.00 ? 5   SER A CA   2  
ATOM   1208  C  C    . SER A 1 5  ? -28.946 -10.533 21.793  1.00 0.00 ? 5   SER A C    2  
ATOM   1209  O  O    . SER A 1 5  ? -29.406 -11.601 22.196  1.00 0.00 ? 5   SER A O    2  
ATOM   1210  C  CB   . SER A 1 5  ? -26.776 -9.376  22.256  1.00 0.00 ? 5   SER A CB   2  
ATOM   1211  O  OG   . SER A 1 5  ? -26.122 -10.614 22.038  1.00 0.00 ? 5   SER A OG   2  
ATOM   1212  H  H    . SER A 1 5  ? -27.776 -10.975 24.283  1.00 0.00 ? 5   SER A H    2  
ATOM   1213  H  HA   . SER A 1 5  ? -28.723 -8.639  22.753  1.00 0.00 ? 5   SER A HA   2  
ATOM   1214  H  HB2  . SER A 1 5  ? -26.791 -8.823  21.330  1.00 0.00 ? 5   SER A HB2  2  
ATOM   1215  H  HB3  . SER A 1 5  ? -26.227 -8.818  23.001  1.00 0.00 ? 5   SER A HB3  2  
ATOM   1216  H  HG   . SER A 1 5  ? -26.701 -11.333 22.301  1.00 0.00 ? 5   SER A HG   2  
ATOM   1217  N  N    . SER A 1 6  ? -29.051 -10.129 20.531  1.00 0.00 ? 6   SER A N    2  
ATOM   1218  C  CA   . SER A 1 6  ? -29.732 -10.935 19.525  1.00 0.00 ? 6   SER A CA   2  
ATOM   1219  C  C    . SER A 1 6  ? -29.331 -10.501 18.118  1.00 0.00 ? 6   SER A C    2  
ATOM   1220  O  O    . SER A 1 6  ? -28.878 -9.377  17.909  1.00 0.00 ? 6   SER A O    2  
ATOM   1221  C  CB   . SER A 1 6  ? -31.249 -10.822 19.693  1.00 0.00 ? 6   SER A CB   2  
ATOM   1222  O  OG   . SER A 1 6  ? -31.691 -9.497  19.457  1.00 0.00 ? 6   SER A OG   2  
ATOM   1223  H  H    . SER A 1 6  ? -28.663 -9.267  20.272  1.00 0.00 ? 6   SER A H    2  
ATOM   1224  H  HA   . SER A 1 6  ? -29.438 -11.964 19.669  1.00 0.00 ? 6   SER A HA   2  
ATOM   1225  H  HB2  . SER A 1 6  ? -31.736 -11.482 18.991  1.00 0.00 ? 6   SER A HB2  2  
ATOM   1226  H  HB3  . SER A 1 6  ? -31.519 -11.106 20.700  1.00 0.00 ? 6   SER A HB3  2  
ATOM   1227  H  HG   . SER A 1 6  ? -31.468 -8.946  20.211  1.00 0.00 ? 6   SER A HG   2  
ATOM   1228  N  N    . GLY A 1 7  ? -29.502 -11.403 17.156  1.00 0.00 ? 7   GLY A N    2  
ATOM   1229  C  CA   . GLY A 1 7  ? -29.153 -11.096 15.782  1.00 0.00 ? 7   GLY A CA   2  
ATOM   1230  C  C    . GLY A 1 7  ? -28.284 -12.165 15.151  1.00 0.00 ? 7   GLY A C    2  
ATOM   1231  O  O    . GLY A 1 7  ? -27.113 -12.309 15.501  1.00 0.00 ? 7   GLY A O    2  
ATOM   1232  H  H    . GLY A 1 7  ? -29.868 -12.284 17.382  1.00 0.00 ? 7   GLY A H    2  
ATOM   1233  H  HA2  . GLY A 1 7  ? -30.061 -10.997 15.205  1.00 0.00 ? 7   GLY A HA2  2  
ATOM   1234  H  HA3  . GLY A 1 7  ? -28.621 -10.156 15.759  1.00 0.00 ? 7   GLY A HA3  2  
ATOM   1235  N  N    . SER A 1 8  ? -28.858 -12.919 14.219  1.00 0.00 ? 8   SER A N    2  
ATOM   1236  C  CA   . SER A 1 8  ? -28.130 -13.986 13.542  1.00 0.00 ? 8   SER A CA   2  
ATOM   1237  C  C    . SER A 1 8  ? -27.751 -13.570 12.124  1.00 0.00 ? 8   SER A C    2  
ATOM   1238  O  O    . SER A 1 8  ? -28.376 -12.686 11.537  1.00 0.00 ? 8   SER A O    2  
ATOM   1239  C  CB   . SER A 1 8  ? -28.971 -15.263 13.504  1.00 0.00 ? 8   SER A CB   2  
ATOM   1240  O  OG   . SER A 1 8  ? -28.914 -15.949 14.743  1.00 0.00 ? 8   SER A OG   2  
ATOM   1241  H  H    . SER A 1 8  ? -29.796 -12.756 13.983  1.00 0.00 ? 8   SER A H    2  
ATOM   1242  H  HA   . SER A 1 8  ? -27.226 -14.177 14.102  1.00 0.00 ? 8   SER A HA   2  
ATOM   1243  H  HB2  . SER A 1 8  ? -29.999 -15.007 13.295  1.00 0.00 ? 8   SER A HB2  2  
ATOM   1244  H  HB3  . SER A 1 8  ? -28.597 -15.914 12.728  1.00 0.00 ? 8   SER A HB3  2  
ATOM   1245  H  HG   . SER A 1 8  ? -28.301 -16.684 14.674  1.00 0.00 ? 8   SER A HG   2  
ATOM   1246  N  N    . ILE A 1 9  ? -26.724 -14.213 11.580  1.00 0.00 ? 9   ILE A N    2  
ATOM   1247  C  CA   . ILE A 1 9  ? -26.262 -13.911 10.231  1.00 0.00 ? 9   ILE A CA   2  
ATOM   1248  C  C    . ILE A 1 9  ? -26.492 -15.093 9.294   1.00 0.00 ? 9   ILE A C    2  
ATOM   1249  O  O    . ILE A 1 9  ? -26.053 -16.209 9.567   1.00 0.00 ? 9   ILE A O    2  
ATOM   1250  C  CB   . ILE A 1 9  ? -24.767 -13.542 10.217  1.00 0.00 ? 9   ILE A CB   2  
ATOM   1251  C  CG1  . ILE A 1 9  ? -24.432 -12.730 8.964   1.00 0.00 ? 9   ILE A CG1  2  
ATOM   1252  C  CG2  . ILE A 1 9  ? -23.911 -14.798 10.285  1.00 0.00 ? 9   ILE A CG2  2  
ATOM   1253  C  CD1  . ILE A 1 9  ? -24.223 -13.580 7.730   1.00 0.00 ? 9   ILE A CD1  2  
ATOM   1254  H  H    . ILE A 1 9  ? -26.266 -14.908 12.098  1.00 0.00 ? 9   ILE A H    2  
ATOM   1255  H  HA   . ILE A 1 9  ? -26.825 -13.064 9.868   1.00 0.00 ? 9   ILE A HA   2  
ATOM   1256  H  HB   . ILE A 1 9  ? -24.558 -12.945 11.091  1.00 0.00 ? 9   ILE A HB   2  
ATOM   1257  H  HG12 . ILE A 1 9  ? -25.239 -12.044 8.761   1.00 0.00 ? 9   ILE A HG12 2  
ATOM   1258  H  HG13 . ILE A 1 9  ? -23.525 -12.170 9.140   1.00 0.00 ? 9   ILE A HG13 2  
ATOM   1259  H  HG21 . ILE A 1 9  ? -22.874 -14.520 10.401  1.00 0.00 ? 9   ILE A HG21 2  
ATOM   1260  H  HG22 . ILE A 1 9  ? -24.219 -15.398 11.128  1.00 0.00 ? 9   ILE A HG22 2  
ATOM   1261  H  HG23 . ILE A 1 9  ? -24.032 -15.366 9.375   1.00 0.00 ? 9   ILE A HG23 2  
ATOM   1262  H  HD11 . ILE A 1 9  ? -23.367 -14.222 7.876   1.00 0.00 ? 9   ILE A HD11 2  
ATOM   1263  H  HD12 . ILE A 1 9  ? -25.101 -14.182 7.555   1.00 0.00 ? 9   ILE A HD12 2  
ATOM   1264  H  HD13 . ILE A 1 9  ? -24.050 -12.939 6.877   1.00 0.00 ? 9   ILE A HD13 2  
ATOM   1265  N  N    . GLY A 1 10 ? -27.181 -14.838 8.186   1.00 0.00 ? 10  GLY A N    2  
ATOM   1266  C  CA   . GLY A 1 10 ? -27.455 -15.889 7.224   1.00 0.00 ? 10  GLY A CA   2  
ATOM   1267  C  C    . GLY A 1 10 ? -26.922 -15.565 5.843   1.00 0.00 ? 10  GLY A C    2  
ATOM   1268  O  O    . GLY A 1 10 ? -26.007 -16.226 5.353   1.00 0.00 ? 10  GLY A O    2  
ATOM   1269  H  H    . GLY A 1 10 ? -27.506 -13.928 8.020   1.00 0.00 ? 10  GLY A H    2  
ATOM   1270  H  HA2  . GLY A 1 10 ? -27.000 -16.805 7.569   1.00 0.00 ? 10  GLY A HA2  2  
ATOM   1271  H  HA3  . GLY A 1 10 ? -28.524 -16.033 7.160   1.00 0.00 ? 10  GLY A HA3  2  
ATOM   1272  N  N    . ASN A 1 11 ? -27.496 -14.546 5.213   1.00 0.00 ? 11  ASN A N    2  
ATOM   1273  C  CA   . ASN A 1 11 ? -27.073 -14.137 3.878   1.00 0.00 ? 11  ASN A CA   2  
ATOM   1274  C  C    . ASN A 1 11 ? -25.569 -13.888 3.836   1.00 0.00 ? 11  ASN A C    2  
ATOM   1275  O  O    . ASN A 1 11 ? -24.970 -13.475 4.829   1.00 0.00 ? 11  ASN A O    2  
ATOM   1276  C  CB   . ASN A 1 11 ? -27.823 -12.875 3.447   1.00 0.00 ? 11  ASN A CB   2  
ATOM   1277  C  CG   . ASN A 1 11 ? -29.146 -13.189 2.777   1.00 0.00 ? 11  ASN A CG   2  
ATOM   1278  O  OD1  . ASN A 1 11 ? -29.303 -13.001 1.570   1.00 0.00 ? 11  ASN A OD1  2  
ATOM   1279  N  ND2  . ASN A 1 11 ? -30.106 -13.669 3.558   1.00 0.00 ? 11  ASN A ND2  2  
ATOM   1280  H  H    . ASN A 1 11 ? -28.221 -14.057 5.655   1.00 0.00 ? 11  ASN A H    2  
ATOM   1281  H  HA   . ASN A 1 11 ? -27.313 -14.938 3.195   1.00 0.00 ? 11  ASN A HA   2  
ATOM   1282  H  HB2  . ASN A 1 11 ? -28.019 -12.265 4.318   1.00 0.00 ? 11  ASN A HB2  2  
ATOM   1283  H  HB3  . ASN A 1 11 ? -27.211 -12.318 2.753   1.00 0.00 ? 11  ASN A HB3  2  
ATOM   1284  H  HD21 . ASN A 1 11 ? -29.910 -13.793 4.510   1.00 0.00 ? 11  ASN A HD21 2  
ATOM   1285  H  HD22 . ASN A 1 11 ? -30.972 -13.881 3.150   1.00 0.00 ? 11  ASN A HD22 2  
ATOM   1286  N  N    . ALA A 1 12 ? -24.965 -14.140 2.679   1.00 0.00 ? 12  ALA A N    2  
ATOM   1287  C  CA   . ALA A 1 12 ? -23.531 -13.941 2.507   1.00 0.00 ? 12  ALA A CA   2  
ATOM   1288  C  C    . ALA A 1 12 ? -23.248 -12.773 1.568   1.00 0.00 ? 12  ALA A C    2  
ATOM   1289  O  O    . ALA A 1 12 ? -24.010 -12.516 0.636   1.00 0.00 ? 12  ALA A O    2  
ATOM   1290  C  CB   . ALA A 1 12 ? -22.881 -15.212 1.982   1.00 0.00 ? 12  ALA A CB   2  
ATOM   1291  H  H    . ALA A 1 12 ? -25.496 -14.467 1.924   1.00 0.00 ? 12  ALA A H    2  
ATOM   1292  H  HA   . ALA A 1 12 ? -23.106 -13.722 3.476   1.00 0.00 ? 12  ALA A HA   2  
ATOM   1293  H  HB1  . ALA A 1 12 ? -23.417 -16.072 2.358   1.00 0.00 ? 12  ALA A HB1  2  
ATOM   1294  H  HB2  . ALA A 1 12 ? -22.911 -15.213 0.902   1.00 0.00 ? 12  ALA A HB2  2  
ATOM   1295  H  HB3  . ALA A 1 12 ? -21.854 -15.255 2.314   1.00 0.00 ? 12  ALA A HB3  2  
ATOM   1296  N  N    . GLN A 1 13 ? -22.150 -12.070 1.820   1.00 0.00 ? 13  GLN A N    2  
ATOM   1297  C  CA   . GLN A 1 13 ? -21.768 -10.928 0.997   1.00 0.00 ? 13  GLN A CA   2  
ATOM   1298  C  C    . GLN A 1 13 ? -21.037 -11.384 -0.261  1.00 0.00 ? 13  GLN A C    2  
ATOM   1299  O  O    . GLN A 1 13 ? -20.260 -12.339 -0.229  1.00 0.00 ? 13  GLN A O    2  
ATOM   1300  C  CB   . GLN A 1 13 ? -20.883 -9.969  1.796   1.00 0.00 ? 13  GLN A CB   2  
ATOM   1301  C  CG   . GLN A 1 13 ? -21.013 -8.518  1.363   1.00 0.00 ? 13  GLN A CG   2  
ATOM   1302  C  CD   . GLN A 1 13 ? -20.786 -7.546  2.504   1.00 0.00 ? 13  GLN A CD   2  
ATOM   1303  O  OE1  . GLN A 1 13 ? -19.856 -6.739  2.472   1.00 0.00 ? 13  GLN A OE1  2  
ATOM   1304  N  NE2  . GLN A 1 13 ? -21.636 -7.618  3.522   1.00 0.00 ? 13  GLN A NE2  2  
ATOM   1305  H  H    . GLN A 1 13 ? -21.583 -12.324 2.578   1.00 0.00 ? 13  GLN A H    2  
ATOM   1306  H  HA   . GLN A 1 13 ? -22.671 -10.412 0.707   1.00 0.00 ? 13  GLN A HA   2  
ATOM   1307  H  HB2  . GLN A 1 13 ? -21.151 -10.037 2.840   1.00 0.00 ? 13  GLN A HB2  2  
ATOM   1308  H  HB3  . GLN A 1 13 ? -19.852 -10.267 1.677   1.00 0.00 ? 13  GLN A HB3  2  
ATOM   1309  H  HG2  . GLN A 1 13 ? -20.284 -8.319  0.591   1.00 0.00 ? 13  GLN A HG2  2  
ATOM   1310  H  HG3  . GLN A 1 13 ? -22.006 -8.361  0.968   1.00 0.00 ? 13  GLN A HG3  2  
ATOM   1311  H  HE21 . GLN A 1 13 ? -22.352 -8.286  3.480   1.00 0.00 ? 13  GLN A HE21 2  
ATOM   1312  H  HE22 . GLN A 1 13 ? -21.512 -7.002  4.273   1.00 0.00 ? 13  GLN A HE22 2  
ATOM   1313  N  N    . LYS A 1 14 ? -21.291 -10.696 -1.369  1.00 0.00 ? 14  LYS A N    2  
ATOM   1314  C  CA   . LYS A 1 14 ? -20.657 -11.028 -2.639  1.00 0.00 ? 14  LYS A CA   2  
ATOM   1315  C  C    . LYS A 1 14 ? -19.659 -9.950  -3.048  1.00 0.00 ? 14  LYS A C    2  
ATOM   1316  O  O    . LYS A 1 14 ? -19.266 -9.863  -4.212  1.00 0.00 ? 14  LYS A O    2  
ATOM   1317  C  CB   . LYS A 1 14 ? -21.715 -11.200 -3.731  1.00 0.00 ? 14  LYS A CB   2  
ATOM   1318  C  CG   . LYS A 1 14 ? -21.294 -12.144 -4.844  1.00 0.00 ? 14  LYS A CG   2  
ATOM   1319  C  CD   . LYS A 1 14 ? -22.494 -12.681 -5.605  1.00 0.00 ? 14  LYS A CD   2  
ATOM   1320  C  CE   . LYS A 1 14 ? -22.068 -13.486 -6.822  1.00 0.00 ? 14  LYS A CE   2  
ATOM   1321  N  NZ   . LYS A 1 14 ? -23.229 -14.128 -7.497  1.00 0.00 ? 14  LYS A NZ   2  
ATOM   1322  H  H    . LYS A 1 14 ? -21.920 -9.944  -1.331  1.00 0.00 ? 14  LYS A H    2  
ATOM   1323  H  HA   . LYS A 1 14 ? -20.129 -11.961 -2.512  1.00 0.00 ? 14  LYS A HA   2  
ATOM   1324  H  HB2  . LYS A 1 14 ? -22.619 -11.586 -3.283  1.00 0.00 ? 14  LYS A HB2  2  
ATOM   1325  H  HB3  . LYS A 1 14 ? -21.925 -10.234 -4.168  1.00 0.00 ? 14  LYS A HB3  2  
ATOM   1326  H  HG2  . LYS A 1 14 ? -20.653 -11.612 -5.532  1.00 0.00 ? 14  LYS A HG2  2  
ATOM   1327  H  HG3  . LYS A 1 14 ? -20.751 -12.974 -4.413  1.00 0.00 ? 14  LYS A HG3  2  
ATOM   1328  H  HD2  . LYS A 1 14 ? -23.070 -13.318 -4.950  1.00 0.00 ? 14  LYS A HD2  2  
ATOM   1329  H  HD3  . LYS A 1 14 ? -23.105 -11.850 -5.929  1.00 0.00 ? 14  LYS A HD3  2  
ATOM   1330  H  HE2  . LYS A 1 14 ? -21.577 -12.826 -7.520  1.00 0.00 ? 14  LYS A HE2  2  
ATOM   1331  H  HE3  . LYS A 1 14 ? -21.377 -14.254 -6.506  1.00 0.00 ? 14  LYS A HE3  2  
ATOM   1332  H  HZ1  . LYS A 1 14 ? -24.119 -13.750 -7.113  1.00 0.00 ? 14  LYS A HZ1  2  
ATOM   1333  H  HZ2  . LYS A 1 14 ? -23.208 -15.157 -7.344  1.00 0.00 ? 14  LYS A HZ2  2  
ATOM   1334  H  HZ3  . LYS A 1 14 ? -23.198 -13.940 -8.520  1.00 0.00 ? 14  LYS A HZ3  2  
ATOM   1335  N  N    . LEU A 1 15 ? -19.253 -9.130  -2.085  1.00 0.00 ? 15  LEU A N    2  
ATOM   1336  C  CA   . LEU A 1 15 ? -18.300 -8.057  -2.345  1.00 0.00 ? 15  LEU A CA   2  
ATOM   1337  C  C    . LEU A 1 15 ? -16.972 -8.328  -1.645  1.00 0.00 ? 15  LEU A C    2  
ATOM   1338  O  O    . LEU A 1 15 ? -16.924 -8.850  -0.531  1.00 0.00 ? 15  LEU A O    2  
ATOM   1339  C  CB   . LEU A 1 15 ? -18.871 -6.716  -1.879  1.00 0.00 ? 15  LEU A CB   2  
ATOM   1340  C  CG   . LEU A 1 15 ? -20.275 -6.375  -2.380  1.00 0.00 ? 15  LEU A CG   2  
ATOM   1341  C  CD1  . LEU A 1 15 ? -20.755 -5.067  -1.771  1.00 0.00 ? 15  LEU A CD1  2  
ATOM   1342  C  CD2  . LEU A 1 15 ? -20.295 -6.297  -3.899  1.00 0.00 ? 15  LEU A CD2  2  
ATOM   1343  H  H    . LEU A 1 15 ? -19.602 -9.248  -1.177  1.00 0.00 ? 15  LEU A H    2  
ATOM   1344  H  HA   . LEU A 1 15 ? -18.129 -8.016  -3.411  1.00 0.00 ? 15  LEU A HA   2  
ATOM   1345  H  HB2  . LEU A 1 15 ? -18.897 -6.725  -0.801  1.00 0.00 ? 15  LEU A HB2  2  
ATOM   1346  H  HB3  . LEU A 1 15 ? -18.200 -5.938  -2.215  1.00 0.00 ? 15  LEU A HB3  2  
ATOM   1347  H  HG   . LEU A 1 15 ? -20.958 -7.155  -2.074  1.00 0.00 ? 15  LEU A HG   2  
ATOM   1348  H  HD11 . LEU A 1 15 ? -19.906 -4.503  -1.413  1.00 0.00 ? 15  LEU A HD11 2  
ATOM   1349  H  HD12 . LEU A 1 15 ? -21.421 -5.276  -0.947  1.00 0.00 ? 15  LEU A HD12 2  
ATOM   1350  H  HD13 . LEU A 1 15 ? -21.279 -4.492  -2.520  1.00 0.00 ? 15  LEU A HD13 2  
ATOM   1351  H  HD21 . LEU A 1 15 ? -20.145 -7.284  -4.312  1.00 0.00 ? 15  LEU A HD21 2  
ATOM   1352  H  HD22 . LEU A 1 15 ? -19.505 -5.642  -4.237  1.00 0.00 ? 15  LEU A HD22 2  
ATOM   1353  H  HD23 . LEU A 1 15 ? -21.249 -5.911  -4.227  1.00 0.00 ? 15  LEU A HD23 2  
ATOM   1354  N  N    . PRO A 1 16 ? -15.866 -7.962  -2.311  1.00 0.00 ? 16  PRO A N    2  
ATOM   1355  C  CA   . PRO A 1 16 ? -14.517 -8.153  -1.771  1.00 0.00 ? 16  PRO A CA   2  
ATOM   1356  C  C    . PRO A 1 16 ? -14.229 -7.231  -0.591  1.00 0.00 ? 16  PRO A C    2  
ATOM   1357  O  O    . PRO A 1 16 ? -13.933 -6.051  -0.772  1.00 0.00 ? 16  PRO A O    2  
ATOM   1358  C  CB   . PRO A 1 16 ? -13.609 -7.808  -2.954  1.00 0.00 ? 16  PRO A CB   2  
ATOM   1359  C  CG   . PRO A 1 16 ? -14.421 -6.888  -3.799  1.00 0.00 ? 16  PRO A CG   2  
ATOM   1360  C  CD   . PRO A 1 16 ? -15.848 -7.334  -3.643  1.00 0.00 ? 16  PRO A CD   2  
ATOM   1361  H  HA   . PRO A 1 16 ? -14.350 -9.179  -1.474  1.00 0.00 ? 16  PRO A HA   2  
ATOM   1362  H  HB2  . PRO A 1 16 ? -12.711 -7.326  -2.593  1.00 0.00 ? 16  PRO A HB2  2  
ATOM   1363  H  HB3  . PRO A 1 16 ? -13.350 -8.709  -3.489  1.00 0.00 ? 16  PRO A HB3  2  
ATOM   1364  H  HG2  . PRO A 1 16 ? -14.306 -5.873  -3.451  1.00 0.00 ? 16  PRO A HG2  2  
ATOM   1365  H  HG3  . PRO A 1 16 ? -14.113 -6.970  -4.831  1.00 0.00 ? 16  PRO A HG3  2  
ATOM   1366  H  HD2  . PRO A 1 16 ? -16.515 -6.486  -3.678  1.00 0.00 ? 16  PRO A HD2  2  
ATOM   1367  H  HD3  . PRO A 1 16 ? -16.105 -8.051  -4.410  1.00 0.00 ? 16  PRO A HD3  2  
ATOM   1368  N  N    . MET A 1 17 ? -14.317 -7.778  0.617   1.00 0.00 ? 17  MET A N    2  
ATOM   1369  C  CA   . MET A 1 17 ? -14.063 -7.004  1.826   1.00 0.00 ? 17  MET A CA   2  
ATOM   1370  C  C    . MET A 1 17 ? -12.634 -6.473  1.842   1.00 0.00 ? 17  MET A C    2  
ATOM   1371  O  O    . MET A 1 17 ? -11.680 -7.221  1.621   1.00 0.00 ? 17  MET A O    2  
ATOM   1372  C  CB   . MET A 1 17 ? -14.316 -7.861  3.068   1.00 0.00 ? 17  MET A CB   2  
ATOM   1373  C  CG   . MET A 1 17 ? -15.732 -7.746  3.608   1.00 0.00 ? 17  MET A CG   2  
ATOM   1374  S  SD   . MET A 1 17 ? -15.889 -8.381  5.288   1.00 0.00 ? 17  MET A SD   2  
ATOM   1375  C  CE   . MET A 1 17 ? -16.886 -7.099  6.043   1.00 0.00 ? 17  MET A CE   2  
ATOM   1376  H  H    . MET A 1 17 ? -14.556 -8.725  0.697   1.00 0.00 ? 17  MET A H    2  
ATOM   1377  H  HA   . MET A 1 17 ? -14.746 -6.167  1.832   1.00 0.00 ? 17  MET A HA   2  
ATOM   1378  H  HB2  . MET A 1 17 ? -14.131 -8.895  2.821   1.00 0.00 ? 17  MET A HB2  2  
ATOM   1379  H  HB3  . MET A 1 17 ? -13.632 -7.557  3.846   1.00 0.00 ? 17  MET A HB3  2  
ATOM   1380  H  HG2  . MET A 1 17 ? -16.022 -6.706  3.603   1.00 0.00 ? 17  MET A HG2  2  
ATOM   1381  H  HG3  . MET A 1 17 ? -16.395 -8.305  2.963   1.00 0.00 ? 17  MET A HG3  2  
ATOM   1382  H  HE1  . MET A 1 17 ? -17.248 -6.427  5.279   1.00 0.00 ? 17  MET A HE1  2  
ATOM   1383  H  HE2  . MET A 1 17 ? -17.724 -7.549  6.554   1.00 0.00 ? 17  MET A HE2  2  
ATOM   1384  H  HE3  . MET A 1 17 ? -16.286 -6.547  6.752   1.00 0.00 ? 17  MET A HE3  2  
ATOM   1385  N  N    . CYS A 1 18 ? -12.491 -5.179  2.105   1.00 0.00 ? 18  CYS A N    2  
ATOM   1386  C  CA   . CYS A 1 18 ? -11.177 -4.547  2.150   1.00 0.00 ? 18  CYS A CA   2  
ATOM   1387  C  C    . CYS A 1 18 ? -10.237 -5.312  3.076   1.00 0.00 ? 18  CYS A C    2  
ATOM   1388  O  O    . CYS A 1 18 ? -10.680 -6.031  3.972   1.00 0.00 ? 18  CYS A O    2  
ATOM   1389  C  CB   . CYS A 1 18 ? -11.302 -3.096  2.617   1.00 0.00 ? 18  CYS A CB   2  
ATOM   1390  S  SG   . CYS A 1 18 ? -9.744  -2.154  2.543   1.00 0.00 ? 18  CYS A SG   2  
ATOM   1391  H  H    . CYS A 1 18 ? -13.289 -4.634  2.274   1.00 0.00 ? 18  CYS A H    2  
ATOM   1392  H  HA   . CYS A 1 18 ? -10.768 -4.561  1.151   1.00 0.00 ? 18  CYS A HA   2  
ATOM   1393  H  HB2  . CYS A 1 18 ? -12.023 -2.586  1.994   1.00 0.00 ? 18  CYS A HB2  2  
ATOM   1394  H  HB3  . CYS A 1 18 ? -11.646 -3.083  3.640   1.00 0.00 ? 18  CYS A HB3  2  
ATOM   1395  N  N    . ASP A 1 19 ? -8.937  -5.152  2.854   1.00 0.00 ? 19  ASP A N    2  
ATOM   1396  C  CA   . ASP A 1 19 ? -7.933  -5.826  3.670   1.00 0.00 ? 19  ASP A CA   2  
ATOM   1397  C  C    . ASP A 1 19 ? -7.417  -4.903  4.769   1.00 0.00 ? 19  ASP A C    2  
ATOM   1398  O  O    . ASP A 1 19 ? -7.183  -5.335  5.898   1.00 0.00 ? 19  ASP A O    2  
ATOM   1399  C  CB   . ASP A 1 19 ? -6.770  -6.300  2.797   1.00 0.00 ? 19  ASP A CB   2  
ATOM   1400  C  CG   . ASP A 1 19 ? -6.961  -7.718  2.297   1.00 0.00 ? 19  ASP A CG   2  
ATOM   1401  O  OD1  . ASP A 1 19 ? -7.953  -7.966  1.580   1.00 0.00 ? 19  ASP A OD1  2  
ATOM   1402  O  OD2  . ASP A 1 19 ? -6.120  -8.581  2.625   1.00 0.00 ? 19  ASP A OD2  2  
ATOM   1403  H  H    . ASP A 1 19 ? -8.646  -4.566  2.125   1.00 0.00 ? 19  ASP A H    2  
ATOM   1404  H  HA   . ASP A 1 19 ? -8.400  -6.685  4.128   1.00 0.00 ? 19  ASP A HA   2  
ATOM   1405  H  HB2  . ASP A 1 19 ? -6.681  -5.646  1.941   1.00 0.00 ? 19  ASP A HB2  2  
ATOM   1406  H  HB3  . ASP A 1 19 ? -5.857  -6.259  3.372   1.00 0.00 ? 19  ASP A HB3  2  
ATOM   1407  N  N    . LYS A 1 20 ? -7.241  -3.630  4.432   1.00 0.00 ? 20  LYS A N    2  
ATOM   1408  C  CA   . LYS A 1 20 ? -6.753  -2.645  5.389   1.00 0.00 ? 20  LYS A CA   2  
ATOM   1409  C  C    . LYS A 1 20 ? -7.757  -2.439  6.519   1.00 0.00 ? 20  LYS A C    2  
ATOM   1410  O  O    . LYS A 1 20 ? -7.498  -2.801  7.667   1.00 0.00 ? 20  LYS A O    2  
ATOM   1411  C  CB   . LYS A 1 20 ? -6.480  -1.313  4.687   1.00 0.00 ? 20  LYS A CB   2  
ATOM   1412  C  CG   . LYS A 1 20 ? -5.884  -0.255  5.600   1.00 0.00 ? 20  LYS A CG   2  
ATOM   1413  C  CD   . LYS A 1 20 ? -6.961  0.625   6.211   1.00 0.00 ? 20  LYS A CD   2  
ATOM   1414  C  CE   . LYS A 1 20 ? -6.414  1.993   6.590   1.00 0.00 ? 20  LYS A CE   2  
ATOM   1415  N  NZ   . LYS A 1 20 ? -6.639  2.998   5.515   1.00 0.00 ? 20  LYS A NZ   2  
ATOM   1416  H  H    . LYS A 1 20 ? -7.446  -3.346  3.516   1.00 0.00 ? 20  LYS A H    2  
ATOM   1417  H  HA   . LYS A 1 20 ? -5.830  -3.018  5.808   1.00 0.00 ? 20  LYS A HA   2  
ATOM   1418  H  HB2  . LYS A 1 20 ? -5.792  -1.484  3.872   1.00 0.00 ? 20  LYS A HB2  2  
ATOM   1419  H  HB3  . LYS A 1 20 ? -7.409  -0.932  4.289   1.00 0.00 ? 20  LYS A HB3  2  
ATOM   1420  H  HG2  . LYS A 1 20 ? -5.339  -0.743  6.394   1.00 0.00 ? 20  LYS A HG2  2  
ATOM   1421  H  HG3  . LYS A 1 20 ? -5.208  0.363   5.025   1.00 0.00 ? 20  LYS A HG3  2  
ATOM   1422  H  HD2  . LYS A 1 20 ? -7.757  0.755   5.494   1.00 0.00 ? 20  LYS A HD2  2  
ATOM   1423  H  HD3  . LYS A 1 20 ? -7.347  0.143   7.098   1.00 0.00 ? 20  LYS A HD3  2  
ATOM   1424  H  HE2  . LYS A 1 20 ? -6.906  2.326   7.491   1.00 0.00 ? 20  LYS A HE2  2  
ATOM   1425  H  HE3  . LYS A 1 20 ? -5.353  1.904   6.771   1.00 0.00 ? 20  LYS A HE3  2  
ATOM   1426  H  HZ1  . LYS A 1 20 ? -7.214  3.786   5.877   1.00 0.00 ? 20  LYS A HZ1  2  
ATOM   1427  H  HZ2  . LYS A 1 20 ? -7.139  2.560   4.715   1.00 0.00 ? 20  LYS A HZ2  2  
ATOM   1428  H  HZ3  . LYS A 1 20 ? -5.730  3.373   5.179   1.00 0.00 ? 20  LYS A HZ3  2  
ATOM   1429  N  N    . CYS A 1 21 ? -8.905  -1.859  6.185   1.00 0.00 ? 21  CYS A N    2  
ATOM   1430  C  CA   . CYS A 1 21 ? -9.950  -1.606  7.171   1.00 0.00 ? 21  CYS A CA   2  
ATOM   1431  C  C    . CYS A 1 21 ? -10.790 -2.857  7.405   1.00 0.00 ? 21  CYS A C    2  
ATOM   1432  O  O    . CYS A 1 21 ? -10.953 -3.305  8.539   1.00 0.00 ? 21  CYS A O    2  
ATOM   1433  C  CB   . CYS A 1 21 ? -10.846 -0.455  6.711   1.00 0.00 ? 21  CYS A CB   2  
ATOM   1434  S  SG   . CYS A 1 21 ? -11.405 -0.592  4.982   1.00 0.00 ? 21  CYS A SG   2  
ATOM   1435  H  H    . CYS A 1 21 ? -9.054  -1.593  5.253   1.00 0.00 ? 21  CYS A H    2  
ATOM   1436  H  HA   . CYS A 1 21 ? -9.471  -1.330  8.098   1.00 0.00 ? 21  CYS A HA   2  
ATOM   1437  H  HB2  . CYS A 1 21 ? -11.725 -0.420  7.338   1.00 0.00 ? 21  CYS A HB2  2  
ATOM   1438  H  HB3  . CYS A 1 21 ? -10.304 0.475   6.808   1.00 0.00 ? 21  CYS A HB3  2  
ATOM   1439  N  N    . GLY A 1 22 ? -11.322 -3.418  6.323   1.00 0.00 ? 22  GLY A N    2  
ATOM   1440  C  CA   . GLY A 1 22 ? -12.140 -4.612  6.431   1.00 0.00 ? 22  GLY A CA   2  
ATOM   1441  C  C    . GLY A 1 22 ? -13.616 -4.323  6.243   1.00 0.00 ? 22  GLY A C    2  
ATOM   1442  O  O    . GLY A 1 22 ? -14.412 -4.487  7.169   1.00 0.00 ? 22  GLY A O    2  
ATOM   1443  H  H    . GLY A 1 22 ? -11.159 -3.017  5.443   1.00 0.00 ? 22  GLY A H    2  
ATOM   1444  H  HA2  . GLY A 1 22 ? -11.824 -5.321  5.681   1.00 0.00 ? 22  GLY A HA2  2  
ATOM   1445  H  HA3  . GLY A 1 22 ? -11.992 -5.048  7.408   1.00 0.00 ? 22  GLY A HA3  2  
ATOM   1446  N  N    . THR A 1 23 ? -13.984 -3.891  5.041   1.00 0.00 ? 23  THR A N    2  
ATOM   1447  C  CA   . THR A 1 23 ? -15.374 -3.576  4.735   1.00 0.00 ? 23  THR A CA   2  
ATOM   1448  C  C    . THR A 1 23 ? -15.718 -3.946  3.297   1.00 0.00 ? 23  THR A C    2  
ATOM   1449  O  O    . THR A 1 23 ? -14.880 -3.843  2.402   1.00 0.00 ? 23  THR A O    2  
ATOM   1450  C  CB   . THR A 1 23 ? -15.672 -2.080  4.954   1.00 0.00 ? 23  THR A CB   2  
ATOM   1451  O  OG1  . THR A 1 23 ? -14.791 -1.283  4.154   1.00 0.00 ? 23  THR A OG1  2  
ATOM   1452  C  CG2  . THR A 1 23 ? -15.514 -1.705  6.419   1.00 0.00 ? 23  THR A CG2  2  
ATOM   1453  H  H    . THR A 1 23 ? -13.304 -3.781  4.345   1.00 0.00 ? 23  THR A H    2  
ATOM   1454  H  HA   . THR A 1 23 ? -16.001 -4.148  5.404   1.00 0.00 ? 23  THR A HA   2  
ATOM   1455  H  HB   . THR A 1 23 ? -16.692 -1.885  4.656   1.00 0.00 ? 23  THR A HB   2  
ATOM   1456  H  HG1  . THR A 1 23 ? -13.956 -1.169  4.615   1.00 0.00 ? 23  THR A HG1  2  
ATOM   1457  H  HG21 . THR A 1 23 ? -14.538 -1.271  6.577   1.00 0.00 ? 23  THR A HG21 2  
ATOM   1458  H  HG22 . THR A 1 23 ? -15.617 -2.590  7.030   1.00 0.00 ? 23  THR A HG22 2  
ATOM   1459  H  HG23 . THR A 1 23 ? -16.274 -0.989  6.691   1.00 0.00 ? 23  THR A HG23 2  
ATOM   1460  N  N    . GLY A 1 24 ? -16.957 -4.376  3.082   1.00 0.00 ? 24  GLY A N    2  
ATOM   1461  C  CA   . GLY A 1 24 ? -17.390 -4.755  1.749   1.00 0.00 ? 24  GLY A CA   2  
ATOM   1462  C  C    . GLY A 1 24 ? -17.164 -3.654  0.732   1.00 0.00 ? 24  GLY A C    2  
ATOM   1463  O  O    . GLY A 1 24 ? -17.801 -2.602  0.793   1.00 0.00 ? 24  GLY A O    2  
ATOM   1464  H  H    . GLY A 1 24 ? -17.583 -4.438  3.834   1.00 0.00 ? 24  GLY A H    2  
ATOM   1465  H  HA2  . GLY A 1 24 ? -16.844 -5.634  1.441   1.00 0.00 ? 24  GLY A HA2  2  
ATOM   1466  H  HA3  . GLY A 1 24 ? -18.444 -4.990  1.779   1.00 0.00 ? 24  GLY A HA3  2  
ATOM   1467  N  N    . ILE A 1 25 ? -16.253 -3.896  -0.206  1.00 0.00 ? 25  ILE A N    2  
ATOM   1468  C  CA   . ILE A 1 25 ? -15.944 -2.916  -1.240  1.00 0.00 ? 25  ILE A CA   2  
ATOM   1469  C  C    . ILE A 1 25 ? -17.055 -2.848  -2.282  1.00 0.00 ? 25  ILE A C    2  
ATOM   1470  O  O    . ILE A 1 25 ? -17.777 -3.821  -2.500  1.00 0.00 ? 25  ILE A O    2  
ATOM   1471  C  CB   . ILE A 1 25 ? -14.614 -3.242  -1.945  1.00 0.00 ? 25  ILE A CB   2  
ATOM   1472  C  CG1  . ILE A 1 25 ? -13.482 -3.348  -0.920  1.00 0.00 ? 25  ILE A CG1  2  
ATOM   1473  C  CG2  . ILE A 1 25 ? -14.294 -2.182  -2.988  1.00 0.00 ? 25  ILE A CG2  2  
ATOM   1474  C  CD1  . ILE A 1 25 ? -12.218 -3.964  -1.479  1.00 0.00 ? 25  ILE A CD1  2  
ATOM   1475  H  H    . ILE A 1 25 ? -15.779 -4.753  -0.202  1.00 0.00 ? 25  ILE A H    2  
ATOM   1476  H  HA   . ILE A 1 25 ? -15.850 -1.950  -0.766  1.00 0.00 ? 25  ILE A HA   2  
ATOM   1477  H  HB   . ILE A 1 25 ? -14.723 -4.189  -2.450  1.00 0.00 ? 25  ILE A HB   2  
ATOM   1478  H  HG12 . ILE A 1 25 ? -13.238 -2.362  -0.559  1.00 0.00 ? 25  ILE A HG12 2  
ATOM   1479  H  HG13 . ILE A 1 25 ? -13.812 -3.959  -0.092  1.00 0.00 ? 25  ILE A HG13 2  
ATOM   1480  H  HG21 . ILE A 1 25 ? -14.903 -2.344  -3.865  1.00 0.00 ? 25  ILE A HG21 2  
ATOM   1481  H  HG22 . ILE A 1 25 ? -14.502 -1.203  -2.582  1.00 0.00 ? 25  ILE A HG22 2  
ATOM   1482  H  HG23 . ILE A 1 25 ? -13.250 -2.246  -3.258  1.00 0.00 ? 25  ILE A HG23 2  
ATOM   1483  H  HD11 . ILE A 1 25 ? -11.794 -3.306  -2.222  1.00 0.00 ? 25  ILE A HD11 2  
ATOM   1484  H  HD12 . ILE A 1 25 ? -11.507 -4.114  -0.680  1.00 0.00 ? 25  ILE A HD12 2  
ATOM   1485  H  HD13 . ILE A 1 25 ? -12.453 -4.916  -1.934  1.00 0.00 ? 25  ILE A HD13 2  
ATOM   1486  N  N    . VAL A 1 26 ? -17.186 -1.692  -2.925  1.00 0.00 ? 26  VAL A N    2  
ATOM   1487  C  CA   . VAL A 1 26 ? -18.207 -1.498  -3.948  1.00 0.00 ? 26  VAL A CA   2  
ATOM   1488  C  C    . VAL A 1 26 ? -17.759 -0.473  -4.984  1.00 0.00 ? 26  VAL A C    2  
ATOM   1489  O  O    . VAL A 1 26 ? -17.382 0.647   -4.642  1.00 0.00 ? 26  VAL A O    2  
ATOM   1490  C  CB   . VAL A 1 26 ? -19.540 -1.036  -3.329  1.00 0.00 ? 26  VAL A CB   2  
ATOM   1491  C  CG1  . VAL A 1 26 ? -19.389 0.340   -2.699  1.00 0.00 ? 26  VAL A CG1  2  
ATOM   1492  C  CG2  . VAL A 1 26 ? -20.641 -1.033  -4.378  1.00 0.00 ? 26  VAL A CG2  2  
ATOM   1493  H  H    . VAL A 1 26 ? -16.581 -0.953  -2.708  1.00 0.00 ? 26  VAL A H    2  
ATOM   1494  H  HA   . VAL A 1 26 ? -18.372 -2.445  -4.440  1.00 0.00 ? 26  VAL A HA   2  
ATOM   1495  H  HB   . VAL A 1 26 ? -19.814 -1.735  -2.552  1.00 0.00 ? 26  VAL A HB   2  
ATOM   1496  H  HG11 . VAL A 1 26 ? -19.399 1.093   -3.474  1.00 0.00 ? 26  VAL A HG11 2  
ATOM   1497  H  HG12 . VAL A 1 26 ? -20.205 0.515   -2.014  1.00 0.00 ? 26  VAL A HG12 2  
ATOM   1498  H  HG13 . VAL A 1 26 ? -18.452 0.390   -2.164  1.00 0.00 ? 26  VAL A HG13 2  
ATOM   1499  H  HG21 . VAL A 1 26 ? -20.236 -0.705  -5.324  1.00 0.00 ? 26  VAL A HG21 2  
ATOM   1500  H  HG22 . VAL A 1 26 ? -21.040 -2.032  -4.485  1.00 0.00 ? 26  VAL A HG22 2  
ATOM   1501  H  HG23 . VAL A 1 26 ? -21.429 -0.362  -4.072  1.00 0.00 ? 26  VAL A HG23 2  
ATOM   1502  N  N    . GLY A 1 27 ? -17.803 -0.865  -6.254  1.00 0.00 ? 27  GLY A N    2  
ATOM   1503  C  CA   . GLY A 1 27 ? -17.399 0.031   -7.321  1.00 0.00 ? 27  GLY A CA   2  
ATOM   1504  C  C    . GLY A 1 27 ? -15.899 0.031   -7.542  1.00 0.00 ? 27  GLY A C    2  
ATOM   1505  O  O    . GLY A 1 27 ? -15.267 -1.025  -7.562  1.00 0.00 ? 27  GLY A O    2  
ATOM   1506  H  H    . GLY A 1 27 ? -18.112 -1.771  -6.467  1.00 0.00 ? 27  GLY A H    2  
ATOM   1507  H  HA2  . GLY A 1 27 ? -17.887 -0.273  -8.236  1.00 0.00 ? 27  GLY A HA2  2  
ATOM   1508  H  HA3  . GLY A 1 27 ? -17.715 1.034   -7.073  1.00 0.00 ? 27  GLY A HA3  2  
ATOM   1509  N  N    . VAL A 1 28 ? -15.328 1.219   -7.709  1.00 0.00 ? 28  VAL A N    2  
ATOM   1510  C  CA   . VAL A 1 28 ? -13.893 1.353   -7.930  1.00 0.00 ? 28  VAL A CA   2  
ATOM   1511  C  C    . VAL A 1 28 ? -13.102 0.838   -6.732  1.00 0.00 ? 28  VAL A C    2  
ATOM   1512  O  O    . VAL A 1 28 ? -13.486 1.053   -5.582  1.00 0.00 ? 28  VAL A O    2  
ATOM   1513  C  CB   . VAL A 1 28 ? -13.500 2.818   -8.199  1.00 0.00 ? 28  VAL A CB   2  
ATOM   1514  C  CG1  . VAL A 1 28 ? -13.945 3.710   -7.049  1.00 0.00 ? 28  VAL A CG1  2  
ATOM   1515  C  CG2  . VAL A 1 28 ? -12.000 2.935   -8.425  1.00 0.00 ? 28  VAL A CG2  2  
ATOM   1516  H  H    . VAL A 1 28 ? -15.884 2.026   -7.683  1.00 0.00 ? 28  VAL A H    2  
ATOM   1517  H  HA   . VAL A 1 28 ? -13.633 0.768   -8.800  1.00 0.00 ? 28  VAL A HA   2  
ATOM   1518  H  HB   . VAL A 1 28 ? -14.005 3.146   -9.095  1.00 0.00 ? 28  VAL A HB   2  
ATOM   1519  H  HG11 . VAL A 1 28 ? -13.597 3.293   -6.115  1.00 0.00 ? 28  VAL A HG11 2  
ATOM   1520  H  HG12 . VAL A 1 28 ? -13.532 4.699   -7.180  1.00 0.00 ? 28  VAL A HG12 2  
ATOM   1521  H  HG13 . VAL A 1 28 ? -15.023 3.768   -7.036  1.00 0.00 ? 28  VAL A HG13 2  
ATOM   1522  H  HG21 . VAL A 1 28 ? -11.553 1.953   -8.378  1.00 0.00 ? 28  VAL A HG21 2  
ATOM   1523  H  HG22 . VAL A 1 28 ? -11.815 3.369   -9.397  1.00 0.00 ? 28  VAL A HG22 2  
ATOM   1524  H  HG23 . VAL A 1 28 ? -11.569 3.565   -7.662  1.00 0.00 ? 28  VAL A HG23 2  
ATOM   1525  N  N    . PHE A 1 29 ? -11.995 0.157   -7.010  1.00 0.00 ? 29  PHE A N    2  
ATOM   1526  C  CA   . PHE A 1 29 ? -11.150 -0.390  -5.955  1.00 0.00 ? 29  PHE A CA   2  
ATOM   1527  C  C    . PHE A 1 29 ? -9.808  -0.851  -6.518  1.00 0.00 ? 29  PHE A C    2  
ATOM   1528  O  O    . PHE A 1 29 ? -9.664  -1.052  -7.724  1.00 0.00 ? 29  PHE A O    2  
ATOM   1529  C  CB   . PHE A 1 29 ? -11.853 -1.559  -5.263  1.00 0.00 ? 29  PHE A CB   2  
ATOM   1530  C  CG   . PHE A 1 29 ? -12.203 -2.685  -6.193  1.00 0.00 ? 29  PHE A CG   2  
ATOM   1531  C  CD1  . PHE A 1 29 ? -11.209 -3.461  -6.767  1.00 0.00 ? 29  PHE A CD1  2  
ATOM   1532  C  CD2  . PHE A 1 29 ? -13.526 -2.967  -6.494  1.00 0.00 ? 29  PHE A CD2  2  
ATOM   1533  C  CE1  . PHE A 1 29 ? -11.527 -4.498  -7.624  1.00 0.00 ? 29  PHE A CE1  2  
ATOM   1534  C  CE2  . PHE A 1 29 ? -13.850 -4.003  -7.350  1.00 0.00 ? 29  PHE A CE2  2  
ATOM   1535  C  CZ   . PHE A 1 29 ? -12.850 -4.768  -7.916  1.00 0.00 ? 29  PHE A CZ   2  
ATOM   1536  H  H    . PHE A 1 29 ? -11.742 0.018   -7.947  1.00 0.00 ? 29  PHE A H    2  
ATOM   1537  H  HA   . PHE A 1 29 ? -10.974 0.392   -5.233  1.00 0.00 ? 29  PHE A HA   2  
ATOM   1538  H  HB2  . PHE A 1 29 ? -11.207 -1.954  -4.493  1.00 0.00 ? 29  PHE A HB2  2  
ATOM   1539  H  HB3  . PHE A 1 29 ? -12.768 -1.203  -4.812  1.00 0.00 ? 29  PHE A HB3  2  
ATOM   1540  H  HD1  . PHE A 1 29 ? -10.174 -3.249  -6.539  1.00 0.00 ? 29  PHE A HD1  2  
ATOM   1541  H  HD2  . PHE A 1 29 ? -14.309 -2.368  -6.053  1.00 0.00 ? 29  PHE A HD2  2  
ATOM   1542  H  HE1  . PHE A 1 29 ? -10.743 -5.094  -8.065  1.00 0.00 ? 29  PHE A HE1  2  
ATOM   1543  H  HE2  . PHE A 1 29 ? -14.885 -4.212  -7.577  1.00 0.00 ? 29  PHE A HE2  2  
ATOM   1544  H  HZ   . PHE A 1 29 ? -13.101 -5.578  -8.585  1.00 0.00 ? 29  PHE A HZ   2  
ATOM   1545  N  N    . VAL A 1 30 ? -8.828  -1.016  -5.635  1.00 0.00 ? 30  VAL A N    2  
ATOM   1546  C  CA   . VAL A 1 30 ? -7.498  -1.454  -6.042  1.00 0.00 ? 30  VAL A CA   2  
ATOM   1547  C  C    . VAL A 1 30 ? -7.369  -2.970  -5.959  1.00 0.00 ? 30  VAL A C    2  
ATOM   1548  O  O    . VAL A 1 30 ? -7.199  -3.532  -4.877  1.00 0.00 ? 30  VAL A O    2  
ATOM   1549  C  CB   . VAL A 1 30 ? -6.404  -0.808  -5.171  1.00 0.00 ? 30  VAL A CB   2  
ATOM   1550  C  CG1  . VAL A 1 30 ? -5.026  -1.283  -5.605  1.00 0.00 ? 30  VAL A CG1  2  
ATOM   1551  C  CG2  . VAL A 1 30 ? -6.499  0.709   -5.235  1.00 0.00 ? 30  VAL A CG2  2  
ATOM   1552  H  H    . VAL A 1 30 ? -9.004  -0.840  -4.687  1.00 0.00 ? 30  VAL A H    2  
ATOM   1553  H  HA   . VAL A 1 30 ? -7.344  -1.144  -7.065  1.00 0.00 ? 30  VAL A HA   2  
ATOM   1554  H  HB   . VAL A 1 30 ? -6.560  -1.115  -4.147  1.00 0.00 ? 30  VAL A HB   2  
ATOM   1555  H  HG11 . VAL A 1 30 ? -5.129  -2.004  -6.403  1.00 0.00 ? 30  VAL A HG11 2  
ATOM   1556  H  HG12 . VAL A 1 30 ? -4.447  -0.440  -5.952  1.00 0.00 ? 30  VAL A HG12 2  
ATOM   1557  H  HG13 . VAL A 1 30 ? -4.524  -1.745  -4.768  1.00 0.00 ? 30  VAL A HG13 2  
ATOM   1558  H  HG21 . VAL A 1 30 ? -6.714  1.013   -6.248  1.00 0.00 ? 30  VAL A HG21 2  
ATOM   1559  H  HG22 . VAL A 1 30 ? -7.290  1.048   -4.582  1.00 0.00 ? 30  VAL A HG22 2  
ATOM   1560  H  HG23 . VAL A 1 30 ? -5.562  1.142   -4.919  1.00 0.00 ? 30  VAL A HG23 2  
ATOM   1561  N  N    . LYS A 1 31 ? -7.452  -3.629  -7.110  1.00 0.00 ? 31  LYS A N    2  
ATOM   1562  C  CA   . LYS A 1 31 ? -7.343  -5.082  -7.171  1.00 0.00 ? 31  LYS A CA   2  
ATOM   1563  C  C    . LYS A 1 31 ? -5.889  -5.524  -7.039  1.00 0.00 ? 31  LYS A C    2  
ATOM   1564  O  O    . LYS A 1 31 ? -5.103  -5.397  -7.979  1.00 0.00 ? 31  LYS A O    2  
ATOM   1565  C  CB   . LYS A 1 31 ? -7.929  -5.604  -8.484  1.00 0.00 ? 31  LYS A CB   2  
ATOM   1566  C  CG   . LYS A 1 31 ? -8.257  -7.087  -8.457  1.00 0.00 ? 31  LYS A CG   2  
ATOM   1567  C  CD   . LYS A 1 31 ? -7.033  -7.934  -8.763  1.00 0.00 ? 31  LYS A CD   2  
ATOM   1568  C  CE   . LYS A 1 31 ? -7.270  -9.398  -8.425  1.00 0.00 ? 31  LYS A CE   2  
ATOM   1569  N  NZ   . LYS A 1 31 ? -8.017  -10.102 -9.504  1.00 0.00 ? 31  LYS A NZ   2  
ATOM   1570  H  H    . LYS A 1 31 ? -7.589  -3.125  -7.940  1.00 0.00 ? 31  LYS A H    2  
ATOM   1571  H  HA   . LYS A 1 31 ? -7.907  -5.491  -6.347  1.00 0.00 ? 31  LYS A HA   2  
ATOM   1572  H  HB2  . LYS A 1 31 ? -8.836  -5.060  -8.701  1.00 0.00 ? 31  LYS A HB2  2  
ATOM   1573  H  HB3  . LYS A 1 31 ? -7.216  -5.429  -9.277  1.00 0.00 ? 31  LYS A HB3  2  
ATOM   1574  H  HG2  . LYS A 1 31 ? -8.625  -7.347  -7.476  1.00 0.00 ? 31  LYS A HG2  2  
ATOM   1575  H  HG3  . LYS A 1 31 ? -9.019  -7.291  -9.196  1.00 0.00 ? 31  LYS A HG3  2  
ATOM   1576  H  HD2  . LYS A 1 31 ? -6.802  -7.852  -9.815  1.00 0.00 ? 31  LYS A HD2  2  
ATOM   1577  H  HD3  . LYS A 1 31 ? -6.199  -7.569  -8.180  1.00 0.00 ? 31  LYS A HD3  2  
ATOM   1578  H  HE2  . LYS A 1 31 ? -6.315  -9.881  -8.286  1.00 0.00 ? 31  LYS A HE2  2  
ATOM   1579  H  HE3  . LYS A 1 31 ? -7.839  -9.454  -7.509  1.00 0.00 ? 31  LYS A HE3  2  
ATOM   1580  H  HZ1  . LYS A 1 31 ? -8.602  -10.860 -9.096  1.00 0.00 ? 31  LYS A HZ1  2  
ATOM   1581  H  HZ2  . LYS A 1 31 ? -7.352  -10.522 -10.184 1.00 0.00 ? 31  LYS A HZ2  2  
ATOM   1582  H  HZ3  . LYS A 1 31 ? -8.635  -9.434  -10.006 1.00 0.00 ? 31  LYS A HZ3  2  
ATOM   1583  N  N    . LEU A 1 32 ? -5.538  -6.046  -5.868  1.00 0.00 ? 32  LEU A N    2  
ATOM   1584  C  CA   . LEU A 1 32 ? -4.178  -6.509  -5.614  1.00 0.00 ? 32  LEU A CA   2  
ATOM   1585  C  C    . LEU A 1 32 ? -3.974  -7.920  -6.156  1.00 0.00 ? 32  LEU A C    2  
ATOM   1586  O  O    . LEU A 1 32 ? -4.936  -8.622  -6.466  1.00 0.00 ? 32  LEU A O    2  
ATOM   1587  C  CB   . LEU A 1 32 ? -3.880  -6.477  -4.114  1.00 0.00 ? 32  LEU A CB   2  
ATOM   1588  C  CG   . LEU A 1 32 ? -3.712  -5.091  -3.492  1.00 0.00 ? 32  LEU A CG   2  
ATOM   1589  C  CD1  . LEU A 1 32 ? -3.677  -5.187  -1.975  1.00 0.00 ? 32  LEU A CD1  2  
ATOM   1590  C  CD2  . LEU A 1 32 ? -2.450  -4.420  -4.015  1.00 0.00 ? 32  LEU A CD2  2  
ATOM   1591  H  H    . LEU A 1 32 ? -6.208  -6.121  -5.158  1.00 0.00 ? 32  LEU A H    2  
ATOM   1592  H  HA   . LEU A 1 32 ? -3.500  -5.840  -6.122  1.00 0.00 ? 32  LEU A HA   2  
ATOM   1593  H  HB2  . LEU A 1 32 ? -4.692  -6.972  -3.605  1.00 0.00 ? 32  LEU A HB2  2  
ATOM   1594  H  HB3  . LEU A 1 32 ? -2.965  -7.028  -3.949  1.00 0.00 ? 32  LEU A HB3  2  
ATOM   1595  H  HG   . LEU A 1 32 ? -4.558  -4.475  -3.768  1.00 0.00 ? 32  LEU A HG   2  
ATOM   1596  H  HD11 . LEU A 1 32 ? -4.588  -4.776  -1.567  1.00 0.00 ? 32  LEU A HD11 2  
ATOM   1597  H  HD12 . LEU A 1 32 ? -2.831  -4.632  -1.599  1.00 0.00 ? 32  LEU A HD12 2  
ATOM   1598  H  HD13 . LEU A 1 32 ? -3.587  -6.223  -1.682  1.00 0.00 ? 32  LEU A HD13 2  
ATOM   1599  H  HD21 . LEU A 1 32 ? -2.617  -3.357  -4.099  1.00 0.00 ? 32  LEU A HD21 2  
ATOM   1600  H  HD22 . LEU A 1 32 ? -2.205  -4.824  -4.987  1.00 0.00 ? 32  LEU A HD22 2  
ATOM   1601  H  HD23 . LEU A 1 32 ? -1.635  -4.605  -3.332  1.00 0.00 ? 32  LEU A HD23 2  
ATOM   1602  N  N    . ARG A 1 33 ? -2.714  -8.330  -6.264  1.00 0.00 ? 33  ARG A N    2  
ATOM   1603  C  CA   . ARG A 1 33 ? -2.383  -9.658  -6.766  1.00 0.00 ? 33  ARG A CA   2  
ATOM   1604  C  C    . ARG A 1 33 ? -3.464  -10.667 -6.388  1.00 0.00 ? 33  ARG A C    2  
ATOM   1605  O  O    . ARG A 1 33 ? -4.277  -11.063 -7.223  1.00 0.00 ? 33  ARG A O    2  
ATOM   1606  C  CB   . ARG A 1 33 ? -1.031  -10.113 -6.216  1.00 0.00 ? 33  ARG A CB   2  
ATOM   1607  C  CG   . ARG A 1 33 ? 0.158   -9.507  -6.944  1.00 0.00 ? 33  ARG A CG   2  
ATOM   1608  C  CD   . ARG A 1 33 ? 1.476   -9.983  -6.352  1.00 0.00 ? 33  ARG A CD   2  
ATOM   1609  N  NE   . ARG A 1 33 ? 2.603   -9.721  -7.243  1.00 0.00 ? 33  ARG A NE   2  
ATOM   1610  C  CZ   . ARG A 1 33 ? 3.724   -10.432 -7.238  1.00 0.00 ? 33  ARG A CZ   2  
ATOM   1611  N  NH1  . ARG A 1 33 ? 3.868   -11.445 -6.394  1.00 0.00 ? 33  ARG A NH1  2  
ATOM   1612  N  NH2  . ARG A 1 33 ? 4.705   -10.132 -8.080  1.00 0.00 ? 33  ARG A NH2  2  
ATOM   1613  H  H    . ARG A 1 33 ? -1.990  -7.725  -6.000  1.00 0.00 ? 33  ARG A H    2  
ATOM   1614  H  HA   . ARG A 1 33 ? -2.323  -9.600  -7.843  1.00 0.00 ? 33  ARG A HA   2  
ATOM   1615  H  HB2  . ARG A 1 33 ? -0.967  -9.834  -5.174  1.00 0.00 ? 33  ARG A HB2  2  
ATOM   1616  H  HB3  . ARG A 1 33 ? -0.966  -11.187 -6.297  1.00 0.00 ? 33  ARG A HB3  2  
ATOM   1617  H  HG2  . ARG A 1 33 ? 0.118   -9.798  -7.983  1.00 0.00 ? 33  ARG A HG2  2  
ATOM   1618  H  HG3  . ARG A 1 33 ? 0.106   -8.432  -6.866  1.00 0.00 ? 33  ARG A HG3  2  
ATOM   1619  H  HD2  . ARG A 1 33 ? 1.641   -9.469  -5.417  1.00 0.00 ? 33  ARG A HD2  2  
ATOM   1620  H  HD3  . ARG A 1 33 ? 1.411   -11.046 -6.172  1.00 0.00 ? 33  ARG A HD3  2  
ATOM   1621  H  HE   . ARG A 1 33 ? 2.518   -8.977  -7.874  1.00 0.00 ? 33  ARG A HE   2  
ATOM   1622  H  HH11 . ARG A 1 33 ? 3.129   -11.674 -5.760  1.00 0.00 ? 33  ARG A HH11 2  
ATOM   1623  H  HH12 . ARG A 1 33 ? 4.713   -11.980 -6.394  1.00 0.00 ? 33  ARG A HH12 2  
ATOM   1624  H  HH21 . ARG A 1 33 ? 4.601   -9.369  -8.717  1.00 0.00 ? 33  ARG A HH21 2  
ATOM   1625  H  HH22 . ARG A 1 33 ? 5.549   -10.668 -8.075  1.00 0.00 ? 33  ARG A HH22 2  
ATOM   1626  N  N    . ASP A 1 34 ? -3.465  -11.079 -5.125  1.00 0.00 ? 34  ASP A N    2  
ATOM   1627  C  CA   . ASP A 1 34 ? -4.445  -12.042 -4.636  1.00 0.00 ? 34  ASP A CA   2  
ATOM   1628  C  C    . ASP A 1 34 ? -5.308  -11.428 -3.537  1.00 0.00 ? 34  ASP A C    2  
ATOM   1629  O  O    . ASP A 1 34 ? -6.036  -12.134 -2.840  1.00 0.00 ? 34  ASP A O    2  
ATOM   1630  C  CB   . ASP A 1 34 ? -3.743  -13.295 -4.110  1.00 0.00 ? 34  ASP A CB   2  
ATOM   1631  C  CG   . ASP A 1 34 ? -3.121  -13.080 -2.745  1.00 0.00 ? 34  ASP A CG   2  
ATOM   1632  O  OD1  . ASP A 1 34 ? -2.292  -12.156 -2.610  1.00 0.00 ? 34  ASP A OD1  2  
ATOM   1633  O  OD2  . ASP A 1 34 ? -3.462  -13.836 -1.811  1.00 0.00 ? 34  ASP A OD2  2  
ATOM   1634  H  H    . ASP A 1 34 ? -2.791  -10.727 -4.507  1.00 0.00 ? 34  ASP A H    2  
ATOM   1635  H  HA   . ASP A 1 34 ? -5.081  -12.317 -5.464  1.00 0.00 ? 34  ASP A HA   2  
ATOM   1636  H  HB2  . ASP A 1 34 ? -4.462  -14.098 -4.035  1.00 0.00 ? 34  ASP A HB2  2  
ATOM   1637  H  HB3  . ASP A 1 34 ? -2.963  -13.579 -4.801  1.00 0.00 ? 34  ASP A HB3  2  
ATOM   1638  N  N    . ARG A 1 35 ? -5.219  -10.111 -3.389  1.00 0.00 ? 35  ARG A N    2  
ATOM   1639  C  CA   . ARG A 1 35 ? -5.989  -9.403  -2.374  1.00 0.00 ? 35  ARG A CA   2  
ATOM   1640  C  C    . ARG A 1 35 ? -6.746  -8.228  -2.987  1.00 0.00 ? 35  ARG A C    2  
ATOM   1641  O  O    . ARG A 1 35 ? -6.589  -7.924  -4.170  1.00 0.00 ? 35  ARG A O    2  
ATOM   1642  C  CB   . ARG A 1 35 ? -5.067  -8.903  -1.260  1.00 0.00 ? 35  ARG A CB   2  
ATOM   1643  C  CG   . ARG A 1 35 ? -4.319  -10.016 -0.543  1.00 0.00 ? 35  ARG A CG   2  
ATOM   1644  C  CD   . ARG A 1 35 ? -5.271  -10.925 0.219   1.00 0.00 ? 35  ARG A CD   2  
ATOM   1645  N  NE   . ARG A 1 35 ? -4.564  -12.000 0.910   1.00 0.00 ? 35  ARG A NE   2  
ATOM   1646  C  CZ   . ARG A 1 35 ? -5.127  -13.158 1.236   1.00 0.00 ? 35  ARG A CZ   2  
ATOM   1647  N  NH1  . ARG A 1 35 ? -6.398  -13.390 0.936   1.00 0.00 ? 35  ARG A NH1  2  
ATOM   1648  N  NH2  . ARG A 1 35 ? -4.419  -14.088 1.864   1.00 0.00 ? 35  ARG A NH2  2  
ATOM   1649  H  H    . ARG A 1 35 ? -4.620  -9.602  -3.975  1.00 0.00 ? 35  ARG A H    2  
ATOM   1650  H  HA   . ARG A 1 35 ? -6.702  -10.096 -1.954  1.00 0.00 ? 35  ARG A HA   2  
ATOM   1651  H  HB2  . ARG A 1 35 ? -4.340  -8.227  -1.686  1.00 0.00 ? 35  ARG A HB2  2  
ATOM   1652  H  HB3  . ARG A 1 35 ? -5.659  -8.369  -0.532  1.00 0.00 ? 35  ARG A HB3  2  
ATOM   1653  H  HG2  . ARG A 1 35 ? -3.783  -10.605 -1.273  1.00 0.00 ? 35  ARG A HG2  2  
ATOM   1654  H  HG3  . ARG A 1 35 ? -3.620  -9.576  0.152   1.00 0.00 ? 35  ARG A HG3  2  
ATOM   1655  H  HD2  . ARG A 1 35 ? -5.807  -10.334 0.946   1.00 0.00 ? 35  ARG A HD2  2  
ATOM   1656  H  HD3  . ARG A 1 35 ? -5.971  -11.357 -0.480  1.00 0.00 ? 35  ARG A HD3  2  
ATOM   1657  H  HE   . ARG A 1 35 ? -3.624  -11.851 1.141   1.00 0.00 ? 35  ARG A HE   2  
ATOM   1658  H  HH11 . ARG A 1 35 ? -6.934  -12.691 0.462   1.00 0.00 ? 35  ARG A HH11 2  
ATOM   1659  H  HH12 . ARG A 1 35 ? -6.819  -14.263 1.182   1.00 0.00 ? 35  ARG A HH12 2  
ATOM   1660  H  HH21 . ARG A 1 35 ? -3.461  -13.917 2.092   1.00 0.00 ? 35  ARG A HH21 2  
ATOM   1661  H  HH22 . ARG A 1 35 ? -4.843  -14.959 2.110   1.00 0.00 ? 35  ARG A HH22 2  
ATOM   1662  N  N    . HIS A 1 36 ? -7.569  -7.572  -2.174  1.00 0.00 ? 36  HIS A N    2  
ATOM   1663  C  CA   . HIS A 1 36 ? -8.351  -6.431  -2.636  1.00 0.00 ? 36  HIS A CA   2  
ATOM   1664  C  C    . HIS A 1 36 ? -8.410  -5.344  -1.567  1.00 0.00 ? 36  HIS A C    2  
ATOM   1665  O  O    . HIS A 1 36 ? -8.472  -5.637  -0.373  1.00 0.00 ? 36  HIS A O    2  
ATOM   1666  C  CB   . HIS A 1 36 ? -9.766  -6.873  -3.009  1.00 0.00 ? 36  HIS A CB   2  
ATOM   1667  C  CG   . HIS A 1 36 ? -9.814  -7.803  -4.182  1.00 0.00 ? 36  HIS A CG   2  
ATOM   1668  N  ND1  . HIS A 1 36 ? -9.721  -9.173  -4.060  1.00 0.00 ? 36  HIS A ND1  2  
ATOM   1669  C  CD2  . HIS A 1 36 ? -9.947  -7.552  -5.506  1.00 0.00 ? 36  HIS A CD2  2  
ATOM   1670  C  CE1  . HIS A 1 36 ? -9.794  -9.725  -5.258  1.00 0.00 ? 36  HIS A CE1  2  
ATOM   1671  N  NE2  . HIS A 1 36 ? -9.931  -8.763  -6.153  1.00 0.00 ? 36  HIS A NE2  2  
ATOM   1672  H  H    . HIS A 1 36 ? -7.651  -7.862  -1.242  1.00 0.00 ? 36  HIS A H    2  
ATOM   1673  H  HA   . HIS A 1 36 ? -7.866  -6.030  -3.513  1.00 0.00 ? 36  HIS A HA   2  
ATOM   1674  H  HB2  . HIS A 1 36 ? -10.211 -7.380  -2.166  1.00 0.00 ? 36  HIS A HB2  2  
ATOM   1675  H  HB3  . HIS A 1 36 ? -10.357 -6.001  -3.251  1.00 0.00 ? 36  HIS A HB3  2  
ATOM   1676  H  HD1  . HIS A 1 36 ? -9.616  -9.667  -3.221  1.00 0.00 ? 36  HIS A HD1  2  
ATOM   1677  H  HD2  . HIS A 1 36 ? -10.046 -6.580  -5.968  1.00 0.00 ? 36  HIS A HD2  2  
ATOM   1678  H  HE1  . HIS A 1 36 ? -9.749  -10.783 -5.471  1.00 0.00 ? 36  HIS A HE1  2  
ATOM   1679  H  HE2  . HIS A 1 36 ? -9.923  -8.891  -7.124  1.00 0.00 ? 36  HIS A HE2  2  
ATOM   1680  N  N    . ARG A 1 37 ? -8.388  -4.089  -2.005  1.00 0.00 ? 37  ARG A N    2  
ATOM   1681  C  CA   . ARG A 1 37 ? -8.437  -2.959  -1.085  1.00 0.00 ? 37  ARG A CA   2  
ATOM   1682  C  C    . ARG A 1 37 ? -9.123  -1.760  -1.733  1.00 0.00 ? 37  ARG A C    2  
ATOM   1683  O  O    . ARG A 1 37 ? -9.334  -1.733  -2.946  1.00 0.00 ? 37  ARG A O    2  
ATOM   1684  C  CB   . ARG A 1 37 ? -7.024  -2.573  -0.642  1.00 0.00 ? 37  ARG A CB   2  
ATOM   1685  C  CG   . ARG A 1 37 ? -6.569  -3.279  0.625   1.00 0.00 ? 37  ARG A CG   2  
ATOM   1686  C  CD   . ARG A 1 37 ? -5.522  -2.467  1.370   1.00 0.00 ? 37  ARG A CD   2  
ATOM   1687  N  NE   . ARG A 1 37 ? -4.781  -3.280  2.331   1.00 0.00 ? 37  ARG A NE   2  
ATOM   1688  C  CZ   . ARG A 1 37 ? -3.837  -4.148  1.986   1.00 0.00 ? 37  ARG A CZ   2  
ATOM   1689  N  NH1  . ARG A 1 37 ? -3.521  -4.316  0.709   1.00 0.00 ? 37  ARG A NH1  2  
ATOM   1690  N  NH2  . ARG A 1 37 ? -3.207  -4.851  2.918   1.00 0.00 ? 37  ARG A NH2  2  
ATOM   1691  H  H    . ARG A 1 37 ? -8.337  -3.919  -2.968  1.00 0.00 ? 37  ARG A H    2  
ATOM   1692  H  HA   . ARG A 1 37 ? -9.007  -3.260  -0.219  1.00 0.00 ? 37  ARG A HA   2  
ATOM   1693  H  HB2  . ARG A 1 37 ? -6.331  -2.819  -1.433  1.00 0.00 ? 37  ARG A HB2  2  
ATOM   1694  H  HB3  . ARG A 1 37 ? -6.993  -1.509  -0.465  1.00 0.00 ? 37  ARG A HB3  2  
ATOM   1695  H  HG2  . ARG A 1 37 ? -7.423  -3.425  1.271   1.00 0.00 ? 37  ARG A HG2  2  
ATOM   1696  H  HG3  . ARG A 1 37 ? -6.148  -4.238  0.360   1.00 0.00 ? 37  ARG A HG3  2  
ATOM   1697  H  HD2  . ARG A 1 37 ? -4.829  -2.054  0.653   1.00 0.00 ? 37  ARG A HD2  2  
ATOM   1698  H  HD3  . ARG A 1 37 ? -6.016  -1.664  1.897   1.00 0.00 ? 37  ARG A HD3  2  
ATOM   1699  H  HE   . ARG A 1 37 ? -4.998  -3.172  3.280   1.00 0.00 ? 37  ARG A HE   2  
ATOM   1700  H  HH11 . ARG A 1 37 ? -3.993  -3.787  0.004   1.00 0.00 ? 37  ARG A HH11 2  
ATOM   1701  H  HH12 . ARG A 1 37 ? -2.809  -4.970  0.451   1.00 0.00 ? 37  ARG A HH12 2  
ATOM   1702  H  HH21 . ARG A 1 37 ? -3.442  -4.728  3.882   1.00 0.00 ? 37  ARG A HH21 2  
ATOM   1703  H  HH22 . ARG A 1 37 ? -2.497  -5.505  2.657   1.00 0.00 ? 37  ARG A HH22 2  
ATOM   1704  N  N    . HIS A 1 38 ? -9.469  -0.770  -0.917  1.00 0.00 ? 38  HIS A N    2  
ATOM   1705  C  CA   . HIS A 1 38 ? -10.131 0.432   -1.410  1.00 0.00 ? 38  HIS A CA   2  
ATOM   1706  C  C    . HIS A 1 38 ? -9.124  1.384   -2.049  1.00 0.00 ? 38  HIS A C    2  
ATOM   1707  O  O    . HIS A 1 38 ? -7.917  1.287   -1.830  1.00 0.00 ? 38  HIS A O    2  
ATOM   1708  C  CB   . HIS A 1 38 ? -10.868 1.139   -0.272  1.00 0.00 ? 38  HIS A CB   2  
ATOM   1709  C  CG   . HIS A 1 38 ? -12.203 0.537   0.042   1.00 0.00 ? 38  HIS A CG   2  
ATOM   1710  N  ND1  . HIS A 1 38 ? -12.420 -0.290  1.124   1.00 0.00 ? 38  HIS A ND1  2  
ATOM   1711  C  CD2  . HIS A 1 38 ? -13.395 0.647   -0.589  1.00 0.00 ? 38  HIS A CD2  2  
ATOM   1712  C  CE1  . HIS A 1 38 ? -13.687 -0.664  1.143   1.00 0.00 ? 38  HIS A CE1  2  
ATOM   1713  N  NE2  . HIS A 1 38 ? -14.300 -0.108  0.114   1.00 0.00 ? 38  HIS A NE2  2  
ATOM   1714  H  H    . HIS A 1 38 ? -9.274  -0.849  0.040   1.00 0.00 ? 38  HIS A H    2  
ATOM   1715  H  HA   . HIS A 1 38 ? -10.848 0.132   -2.159  1.00 0.00 ? 38  HIS A HA   2  
ATOM   1716  H  HB2  . HIS A 1 38 ? -10.264 1.091   0.623   1.00 0.00 ? 38  HIS A HB2  2  
ATOM   1717  H  HB3  . HIS A 1 38 ? -11.024 2.174   -0.540  1.00 0.00 ? 38  HIS A HB3  2  
ATOM   1718  H  HD2  . HIS A 1 38 ? -13.597 1.223   -1.482  1.00 0.00 ? 38  HIS A HD2  2  
ATOM   1719  H  HE1  . HIS A 1 38 ? -14.144 -1.313  1.875   1.00 0.00 ? 38  HIS A HE1  2  
ATOM   1720  H  HE2  . HIS A 1 38 ? -15.225 -0.288  -0.156  1.00 0.00 ? 38  HIS A HE2  2  
ATOM   1721  N  N    . PRO A 1 39 ? -9.631  2.327   -2.857  1.00 0.00 ? 39  PRO A N    2  
ATOM   1722  C  CA   . PRO A 1 39 ? -8.793  3.314   -3.544  1.00 0.00 ? 39  PRO A CA   2  
ATOM   1723  C  C    . PRO A 1 39 ? -8.185  4.329   -2.581  1.00 0.00 ? 39  PRO A C    2  
ATOM   1724  O  O    . PRO A 1 39 ? -7.316  5.114   -2.960  1.00 0.00 ? 39  PRO A O    2  
ATOM   1725  C  CB   . PRO A 1 39 ? -9.768  4.004   -4.501  1.00 0.00 ? 39  PRO A CB   2  
ATOM   1726  C  CG   . PRO A 1 39 ? -11.106 3.829   -3.869  1.00 0.00 ? 39  PRO A CG   2  
ATOM   1727  C  CD   . PRO A 1 39 ? -11.060 2.502   -3.164  1.00 0.00 ? 39  PRO A CD   2  
ATOM   1728  H  HA   . PRO A 1 39 ? -8.004  2.841   -4.111  1.00 0.00 ? 39  PRO A HA   2  
ATOM   1729  H  HB2  . PRO A 1 39 ? -9.508  5.049   -4.593  1.00 0.00 ? 39  PRO A HB2  2  
ATOM   1730  H  HB3  . PRO A 1 39 ? -9.724  3.529   -5.470  1.00 0.00 ? 39  PRO A HB3  2  
ATOM   1731  H  HG2  . PRO A 1 39 ? -11.284 4.624   -3.161  1.00 0.00 ? 39  PRO A HG2  2  
ATOM   1732  H  HG3  . PRO A 1 39 ? -11.873 3.823   -4.629  1.00 0.00 ? 39  PRO A HG3  2  
ATOM   1733  H  HD2  . PRO A 1 39 ? -11.648 2.535   -2.258  1.00 0.00 ? 39  PRO A HD2  2  
ATOM   1734  H  HD3  . PRO A 1 39 ? -11.413 1.716   -3.816  1.00 0.00 ? 39  PRO A HD3  2  
ATOM   1735  N  N    . GLU A 1 40 ? -8.647  4.305   -1.335  1.00 0.00 ? 40  GLU A N    2  
ATOM   1736  C  CA   . GLU A 1 40 ? -8.148  5.224   -0.318  1.00 0.00 ? 40  GLU A CA   2  
ATOM   1737  C  C    . GLU A 1 40 ? -7.429  4.466   0.794   1.00 0.00 ? 40  GLU A C    2  
ATOM   1738  O  O    . GLU A 1 40 ? -6.529  5.000   1.443   1.00 0.00 ? 40  GLU A O    2  
ATOM   1739  C  CB   . GLU A 1 40 ? -9.298  6.044   0.269   1.00 0.00 ? 40  GLU A CB   2  
ATOM   1740  C  CG   . GLU A 1 40 ? -10.223 5.239   1.167   1.00 0.00 ? 40  GLU A CG   2  
ATOM   1741  C  CD   . GLU A 1 40 ? -11.639 5.780   1.180   1.00 0.00 ? 40  GLU A CD   2  
ATOM   1742  O  OE1  . GLU A 1 40 ? -12.329 5.663   0.145   1.00 0.00 ? 40  GLU A OE1  2  
ATOM   1743  O  OE2  . GLU A 1 40 ? -12.058 6.321   2.225   1.00 0.00 ? 40  GLU A OE2  2  
ATOM   1744  H  H    . GLU A 1 40 ? -9.340  3.656   -1.094  1.00 0.00 ? 40  GLU A H    2  
ATOM   1745  H  HA   . GLU A 1 40 ? -7.446  5.894   -0.793  1.00 0.00 ? 40  GLU A HA   2  
ATOM   1746  H  HB2  . GLU A 1 40 ? -8.886  6.857   0.848   1.00 0.00 ? 40  GLU A HB2  2  
ATOM   1747  H  HB3  . GLU A 1 40 ? -9.884  6.452   -0.542  1.00 0.00 ? 40  GLU A HB3  2  
ATOM   1748  H  HG2  . GLU A 1 40 ? -10.248 4.219   0.814   1.00 0.00 ? 40  GLU A HG2  2  
ATOM   1749  H  HG3  . GLU A 1 40 ? -9.835  5.261   2.174   1.00 0.00 ? 40  GLU A HG3  2  
ATOM   1750  N  N    . CYS A 1 41 ? -7.832  3.219   1.008   1.00 0.00 ? 41  CYS A N    2  
ATOM   1751  C  CA   . CYS A 1 41 ? -7.229  2.386   2.042   1.00 0.00 ? 41  CYS A CA   2  
ATOM   1752  C  C    . CYS A 1 41 ? -5.903  1.802   1.565   1.00 0.00 ? 41  CYS A C    2  
ATOM   1753  O  O    . CYS A 1 41 ? -5.216  1.102   2.310   1.00 0.00 ? 41  CYS A O    2  
ATOM   1754  C  CB   . CYS A 1 41 ? -8.183  1.257   2.438   1.00 0.00 ? 41  CYS A CB   2  
ATOM   1755  S  SG   . CYS A 1 41 ? -9.803  1.830   3.043   1.00 0.00 ? 41  CYS A SG   2  
ATOM   1756  H  H    . CYS A 1 41 ? -8.555  2.848   0.458   1.00 0.00 ? 41  CYS A H    2  
ATOM   1757  H  HA   . CYS A 1 41 ? -7.045  3.009   2.904   1.00 0.00 ? 41  CYS A HA   2  
ATOM   1758  H  HB2  . CYS A 1 41 ? -8.359  0.627   1.578   1.00 0.00 ? 41  CYS A HB2  2  
ATOM   1759  H  HB3  . CYS A 1 41 ? -7.728  0.670   3.222   1.00 0.00 ? 41  CYS A HB3  2  
ATOM   1760  N  N    . TYR A 1 42 ? -5.548  2.095   0.318   1.00 0.00 ? 42  TYR A N    2  
ATOM   1761  C  CA   . TYR A 1 42 ? -4.305  1.598   -0.260  1.00 0.00 ? 42  TYR A CA   2  
ATOM   1762  C  C    . TYR A 1 42 ? -3.097  2.272   0.383   1.00 0.00 ? 42  TYR A C    2  
ATOM   1763  O  O    . TYR A 1 42 ? -1.960  2.073   -0.044  1.00 0.00 ? 42  TYR A O    2  
ATOM   1764  C  CB   . TYR A 1 42 ? -4.291  1.834   -1.771  1.00 0.00 ? 42  TYR A CB   2  
ATOM   1765  C  CG   . TYR A 1 42 ? -2.973  1.486   -2.426  1.00 0.00 ? 42  TYR A CG   2  
ATOM   1766  C  CD1  . TYR A 1 42 ? -2.293  0.323   -2.088  1.00 0.00 ? 42  TYR A CD1  2  
ATOM   1767  C  CD2  . TYR A 1 42 ? -2.408  2.322   -3.381  1.00 0.00 ? 42  TYR A CD2  2  
ATOM   1768  C  CE1  . TYR A 1 42 ? -1.088  0.001   -2.683  1.00 0.00 ? 42  TYR A CE1  2  
ATOM   1769  C  CE2  . TYR A 1 42 ? -1.204  2.008   -3.982  1.00 0.00 ? 42  TYR A CE2  2  
ATOM   1770  C  CZ   . TYR A 1 42 ? -0.548  0.847   -3.629  1.00 0.00 ? 42  TYR A CZ   2  
ATOM   1771  O  OH   . TYR A 1 42 ? 0.652   0.531   -4.225  1.00 0.00 ? 42  TYR A OH   2  
ATOM   1772  H  H    . TYR A 1 42 ? -6.137  2.658   -0.227  1.00 0.00 ? 42  TYR A H    2  
ATOM   1773  H  HA   . TYR A 1 42 ? -4.253  0.535   -0.071  1.00 0.00 ? 42  TYR A HA   2  
ATOM   1774  H  HB2  . TYR A 1 42 ? -5.058  1.229   -2.230  1.00 0.00 ? 42  TYR A HB2  2  
ATOM   1775  H  HB3  . TYR A 1 42 ? -4.495  2.876   -1.967  1.00 0.00 ? 42  TYR A HB3  2  
ATOM   1776  H  HD1  . TYR A 1 42 ? -2.718  -0.338  -1.346  1.00 0.00 ? 42  TYR A HD1  2  
ATOM   1777  H  HD2  . TYR A 1 42 ? -2.924  3.231   -3.654  1.00 0.00 ? 42  TYR A HD2  2  
ATOM   1778  H  HE1  . TYR A 1 42 ? -0.574  -0.908  -2.407  1.00 0.00 ? 42  TYR A HE1  2  
ATOM   1779  H  HE2  . TYR A 1 42 ? -0.781  2.670   -4.723  1.00 0.00 ? 42  TYR A HE2  2  
ATOM   1780  H  HH   . TYR A 1 42 ? 0.917   1.246   -4.808  1.00 0.00 ? 42  TYR A HH   2  
ATOM   1781  N  N    . VAL A 1 43 ? -3.353  3.072   1.414   1.00 0.00 ? 43  VAL A N    2  
ATOM   1782  C  CA   . VAL A 1 43 ? -2.288  3.775   2.118   1.00 0.00 ? 43  VAL A CA   2  
ATOM   1783  C  C    . VAL A 1 43 ? -1.467  2.816   2.972   1.00 0.00 ? 43  VAL A C    2  
ATOM   1784  O  O    . VAL A 1 43 ? -1.914  1.714   3.293   1.00 0.00 ? 43  VAL A O    2  
ATOM   1785  C  CB   . VAL A 1 43 ? -2.852  4.891   3.018   1.00 0.00 ? 43  VAL A CB   2  
ATOM   1786  C  CG1  . VAL A 1 43 ? -3.513  5.972   2.177   1.00 0.00 ? 43  VAL A CG1  2  
ATOM   1787  C  CG2  . VAL A 1 43 ? -3.833  4.316   4.028   1.00 0.00 ? 43  VAL A CG2  2  
ATOM   1788  H  H    . VAL A 1 43 ? -4.280  3.191   1.708   1.00 0.00 ? 43  VAL A H    2  
ATOM   1789  H  HA   . VAL A 1 43 ? -1.642  4.228   1.380   1.00 0.00 ? 43  VAL A HA   2  
ATOM   1790  H  HB   . VAL A 1 43 ? -2.031  5.339   3.559   1.00 0.00 ? 43  VAL A HB   2  
ATOM   1791  H  HG11 . VAL A 1 43 ? -4.516  6.146   2.538   1.00 0.00 ? 43  VAL A HG11 2  
ATOM   1792  H  HG12 . VAL A 1 43 ? -2.940  6.885   2.247   1.00 0.00 ? 43  VAL A HG12 2  
ATOM   1793  H  HG13 . VAL A 1 43 ? -3.554  5.651   1.146   1.00 0.00 ? 43  VAL A HG13 2  
ATOM   1794  H  HG21 . VAL A 1 43 ? -4.319  5.123   4.556   1.00 0.00 ? 43  VAL A HG21 2  
ATOM   1795  H  HG22 . VAL A 1 43 ? -4.575  3.724   3.513   1.00 0.00 ? 43  VAL A HG22 2  
ATOM   1796  H  HG23 . VAL A 1 43 ? -3.301  3.693   4.732   1.00 0.00 ? 43  VAL A HG23 2  
ATOM   1797  N  N    . CYS A 1 44 ? -0.262  3.241   3.338   1.00 0.00 ? 44  CYS A N    2  
ATOM   1798  C  CA   . CYS A 1 44 ? 0.624   2.420   4.155   1.00 0.00 ? 44  CYS A CA   2  
ATOM   1799  C  C    . CYS A 1 44 ? -0.079  1.966   5.431   1.00 0.00 ? 44  CYS A C    2  
ATOM   1800  O  O    . CYS A 1 44 ? -1.097  2.534   5.829   1.00 0.00 ? 44  CYS A O    2  
ATOM   1801  C  CB   . CYS A 1 44 ? 1.893   3.199   4.508   1.00 0.00 ? 44  CYS A CB   2  
ATOM   1802  S  SG   . CYS A 1 44 ? 3.071   2.270   5.542   1.00 0.00 ? 44  CYS A SG   2  
ATOM   1803  H  H    . CYS A 1 44 ? 0.039   4.129   3.051   1.00 0.00 ? 44  CYS A H    2  
ATOM   1804  H  HA   . CYS A 1 44 ? 0.894   1.549   3.579   1.00 0.00 ? 44  CYS A HA   2  
ATOM   1805  H  HB2  . CYS A 1 44 ? 2.403   3.473   3.596   1.00 0.00 ? 44  CYS A HB2  2  
ATOM   1806  H  HB3  . CYS A 1 44 ? 1.619   4.095   5.044   1.00 0.00 ? 44  CYS A HB3  2  
ATOM   1807  N  N    . THR A 1 45 ? 0.471   0.939   6.070   1.00 0.00 ? 45  THR A N    2  
ATOM   1808  C  CA   . THR A 1 45 ? -0.102  0.407   7.300   1.00 0.00 ? 45  THR A CA   2  
ATOM   1809  C  C    . THR A 1 45 ? 0.608   0.970   8.526   1.00 0.00 ? 45  THR A C    2  
ATOM   1810  O  O    . THR A 1 45 ? -0.014  1.208   9.561   1.00 0.00 ? 45  THR A O    2  
ATOM   1811  C  CB   . THR A 1 45 ? -0.024  -1.131  7.337   1.00 0.00 ? 45  THR A CB   2  
ATOM   1812  O  OG1  . THR A 1 45 ? -0.702  -1.683  6.203   1.00 0.00 ? 45  THR A OG1  2  
ATOM   1813  C  CG2  . THR A 1 45 ? -0.642  -1.673  8.618   1.00 0.00 ? 45  THR A CG2  2  
ATOM   1814  H  H    . THR A 1 45 ? 1.282   0.528   5.703   1.00 0.00 ? 45  THR A H    2  
ATOM   1815  H  HA   . THR A 1 45 ? -1.143  0.695   7.335   1.00 0.00 ? 45  THR A HA   2  
ATOM   1816  H  HB   . THR A 1 45 ? 1.015   -1.425  7.304   1.00 0.00 ? 45  THR A HB   2  
ATOM   1817  H  HG1  . THR A 1 45 ? -0.057  -2.025  5.580   1.00 0.00 ? 45  THR A HG1  2  
ATOM   1818  H  HG21 . THR A 1 45 ? -1.216  -2.560  8.393   1.00 0.00 ? 45  THR A HG21 2  
ATOM   1819  H  HG22 . THR A 1 45 ? -1.290  -0.925  9.049   1.00 0.00 ? 45  THR A HG22 2  
ATOM   1820  H  HG23 . THR A 1 45 ? 0.141   -1.919  9.318   1.00 0.00 ? 45  THR A HG23 2  
ATOM   1821  N  N    . ASP A 1 46 ? 1.914   1.183   8.402   1.00 0.00 ? 46  ASP A N    2  
ATOM   1822  C  CA   . ASP A 1 46 ? 2.708   1.720   9.500   1.00 0.00 ? 46  ASP A CA   2  
ATOM   1823  C  C    . ASP A 1 46 ? 2.302   3.157   9.812   1.00 0.00 ? 46  ASP A C    2  
ATOM   1824  O  O    . ASP A 1 46 ? 1.844   3.459   10.915  1.00 0.00 ? 46  ASP A O    2  
ATOM   1825  C  CB   . ASP A 1 46 ? 4.198   1.662   9.156   1.00 0.00 ? 46  ASP A CB   2  
ATOM   1826  C  CG   . ASP A 1 46 ? 5.075   2.126   10.302  1.00 0.00 ? 46  ASP A CG   2  
ATOM   1827  O  OD1  . ASP A 1 46 ? 4.756   3.169   10.909  1.00 0.00 ? 46  ASP A OD1  2  
ATOM   1828  O  OD2  . ASP A 1 46 ? 6.080   1.445   10.592  1.00 0.00 ? 46  ASP A OD2  2  
ATOM   1829  H  H    . ASP A 1 46 ? 2.353   0.974   7.551   1.00 0.00 ? 46  ASP A H    2  
ATOM   1830  H  HA   . ASP A 1 46 ? 2.525   1.110   10.371  1.00 0.00 ? 46  ASP A HA   2  
ATOM   1831  H  HB2  . ASP A 1 46 ? 4.464   0.643   8.913   1.00 0.00 ? 46  ASP A HB2  2  
ATOM   1832  H  HB3  . ASP A 1 46 ? 4.388   2.294   8.301   1.00 0.00 ? 46  ASP A HB3  2  
ATOM   1833  N  N    . CYS A 1 47 ? 2.473   4.041   8.835   1.00 0.00 ? 47  CYS A N    2  
ATOM   1834  C  CA   . CYS A 1 47 ? 2.126   5.447   9.004   1.00 0.00 ? 47  CYS A CA   2  
ATOM   1835  C  C    . CYS A 1 47 ? 0.727   5.731   8.466   1.00 0.00 ? 47  CYS A C    2  
ATOM   1836  O  O    . CYS A 1 47 ? -0.140  6.221   9.188   1.00 0.00 ? 47  CYS A O    2  
ATOM   1837  C  CB   . CYS A 1 47 ? 3.149   6.335   8.293   1.00 0.00 ? 47  CYS A CB   2  
ATOM   1838  S  SG   . CYS A 1 47 ? 3.652   5.723   6.653   1.00 0.00 ? 47  CYS A SG   2  
ATOM   1839  H  H    . CYS A 1 47 ? 2.843   3.740   7.977   1.00 0.00 ? 47  CYS A H    2  
ATOM   1840  H  HA   . CYS A 1 47 ? 2.144   5.668   10.061  1.00 0.00 ? 47  CYS A HA   2  
ATOM   1841  H  HB2  . CYS A 1 47 ? 2.726   7.321   8.159   1.00 0.00 ? 47  CYS A HB2  2  
ATOM   1842  H  HB3  . CYS A 1 47 ? 4.036   6.410   8.904   1.00 0.00 ? 47  CYS A HB3  2  
ATOM   1843  N  N    . GLY A 1 48 ? 0.515   5.418   7.191   1.00 0.00 ? 48  GLY A N    2  
ATOM   1844  C  CA   . GLY A 1 48 ? -0.780  5.646   6.577   1.00 0.00 ? 48  GLY A CA   2  
ATOM   1845  C  C    . GLY A 1 48 ? -0.743  6.750   5.539   1.00 0.00 ? 48  GLY A C    2  
ATOM   1846  O  O    . GLY A 1 48 ? -1.552  7.677   5.577   1.00 0.00 ? 48  GLY A O    2  
ATOM   1847  H  H    . GLY A 1 48 ? 1.244   5.029   6.663   1.00 0.00 ? 48  GLY A H    2  
ATOM   1848  H  HA2  . GLY A 1 48 ? -1.108  4.732   6.105   1.00 0.00 ? 48  GLY A HA2  2  
ATOM   1849  H  HA3  . GLY A 1 48 ? -1.488  5.916   7.347   1.00 0.00 ? 48  GLY A HA3  2  
ATOM   1850  N  N    . THR A 1 49 ? 0.200   6.652   4.607   1.00 0.00 ? 49  THR A N    2  
ATOM   1851  C  CA   . THR A 1 49 ? 0.342   7.651   3.555   1.00 0.00 ? 49  THR A CA   2  
ATOM   1852  C  C    . THR A 1 49 ? -0.149  7.113   2.216   1.00 0.00 ? 49  THR A C    2  
ATOM   1853  O  O    . THR A 1 49 ? 0.003   5.929   1.919   1.00 0.00 ? 49  THR A O    2  
ATOM   1854  C  CB   . THR A 1 49 ? 1.805   8.108   3.407   1.00 0.00 ? 49  THR A CB   2  
ATOM   1855  O  OG1  . THR A 1 49 ? 1.878   9.249   2.545   1.00 0.00 ? 49  THR A OG1  2  
ATOM   1856  C  CG2  . THR A 1 49 ? 2.668   6.987   2.847   1.00 0.00 ? 49  THR A CG2  2  
ATOM   1857  H  H    . THR A 1 49 ? 0.815   5.890   4.629   1.00 0.00 ? 49  THR A H    2  
ATOM   1858  H  HA   . THR A 1 49 ? -0.256  8.509   3.828   1.00 0.00 ? 49  THR A HA   2  
ATOM   1859  H  HB   . THR A 1 49 ? 2.182   8.378   4.383   1.00 0.00 ? 49  THR A HB   2  
ATOM   1860  H  HG1  . THR A 1 49 ? 2.753   9.299   2.154   1.00 0.00 ? 49  THR A HG1  2  
ATOM   1861  H  HG21 . THR A 1 49 ? 2.707   6.174   3.556   1.00 0.00 ? 49  THR A HG21 2  
ATOM   1862  H  HG22 . THR A 1 49 ? 3.666   7.357   2.666   1.00 0.00 ? 49  THR A HG22 2  
ATOM   1863  H  HG23 . THR A 1 49 ? 2.241   6.634   1.920   1.00 0.00 ? 49  THR A HG23 2  
ATOM   1864  N  N    . ASN A 1 50 ? -0.737  7.991   1.410   1.00 0.00 ? 50  ASN A N    2  
ATOM   1865  C  CA   . ASN A 1 50 ? -1.250  7.603   0.101   1.00 0.00 ? 50  ASN A CA   2  
ATOM   1866  C  C    . ASN A 1 50 ? -0.158  6.947   -0.739  1.00 0.00 ? 50  ASN A C    2  
ATOM   1867  O  O    . ASN A 1 50 ? 0.762   7.615   -1.214  1.00 0.00 ? 50  ASN A O    2  
ATOM   1868  C  CB   . ASN A 1 50 ? -1.808  8.823   -0.633  1.00 0.00 ? 50  ASN A CB   2  
ATOM   1869  C  CG   . ASN A 1 50 ? -2.629  8.441   -1.850  1.00 0.00 ? 50  ASN A CG   2  
ATOM   1870  O  OD1  . ASN A 1 50 ? -2.208  8.652   -2.988  1.00 0.00 ? 50  ASN A OD1  2  
ATOM   1871  N  ND2  . ASN A 1 50 ? -3.807  7.874   -1.615  1.00 0.00 ? 50  ASN A ND2  2  
ATOM   1872  H  H    . ASN A 1 50 ? -0.829  8.922   1.702   1.00 0.00 ? 50  ASN A H    2  
ATOM   1873  H  HA   . ASN A 1 50 ? -2.046  6.891   0.255   1.00 0.00 ? 50  ASN A HA   2  
ATOM   1874  H  HB2  . ASN A 1 50 ? -2.440  9.383   0.041   1.00 0.00 ? 50  ASN A HB2  2  
ATOM   1875  H  HB3  . ASN A 1 50 ? -0.989  9.449   -0.956  1.00 0.00 ? 50  ASN A HB3  2  
ATOM   1876  H  HD21 . ASN A 1 50 ? -4.077  7.737   -0.683  1.00 0.00 ? 50  ASN A HD21 2  
ATOM   1877  H  HD22 . ASN A 1 50 ? -4.357  7.616   -2.383  1.00 0.00 ? 50  ASN A HD22 2  
ATOM   1878  N  N    . LEU A 1 51 ? -0.265  5.635   -0.917  1.00 0.00 ? 51  LEU A N    2  
ATOM   1879  C  CA   . LEU A 1 51 ? 0.713   4.887   -1.700  1.00 0.00 ? 51  LEU A CA   2  
ATOM   1880  C  C    . LEU A 1 51 ? 0.299   4.818   -3.167  1.00 0.00 ? 51  LEU A C    2  
ATOM   1881  O  O    . LEU A 1 51 ? 0.837   4.025   -3.939  1.00 0.00 ? 51  LEU A O    2  
ATOM   1882  C  CB   . LEU A 1 51 ? 0.873   3.474   -1.137  1.00 0.00 ? 51  LEU A CB   2  
ATOM   1883  C  CG   . LEU A 1 51 ? 1.177   3.378   0.359   1.00 0.00 ? 51  LEU A CG   2  
ATOM   1884  C  CD1  . LEU A 1 51 ? 1.026   1.944   0.843   1.00 0.00 ? 51  LEU A CD1  2  
ATOM   1885  C  CD2  . LEU A 1 51 ? 2.576   3.898   0.653   1.00 0.00 ? 51  LEU A CD2  2  
ATOM   1886  H  H    . LEU A 1 51 ? -1.019  5.157   -0.514  1.00 0.00 ? 51  LEU A H    2  
ATOM   1887  H  HA   . LEU A 1 51 ? 1.659   5.403   -1.629  1.00 0.00 ? 51  LEU A HA   2  
ATOM   1888  H  HB2  . LEU A 1 51 ? -0.045  2.938   -1.322  1.00 0.00 ? 51  LEU A HB2  2  
ATOM   1889  H  HB3  . LEU A 1 51 ? 1.682   2.995   -1.671  1.00 0.00 ? 51  LEU A HB3  2  
ATOM   1890  H  HG   . LEU A 1 51 ? 0.471   3.989   0.903   1.00 0.00 ? 51  LEU A HG   2  
ATOM   1891  H  HD11 . LEU A 1 51 ? 0.029   1.797   1.228   1.00 0.00 ? 51  LEU A HD11 2  
ATOM   1892  H  HD12 . LEU A 1 51 ? 1.746   1.751   1.625   1.00 0.00 ? 51  LEU A HD12 2  
ATOM   1893  H  HD13 . LEU A 1 51 ? 1.199   1.266   0.020   1.00 0.00 ? 51  LEU A HD13 2  
ATOM   1894  H  HD21 . LEU A 1 51 ? 3.259   3.065   0.740   1.00 0.00 ? 51  LEU A HD21 2  
ATOM   1895  H  HD22 . LEU A 1 51 ? 2.567   4.452   1.580   1.00 0.00 ? 51  LEU A HD22 2  
ATOM   1896  H  HD23 . LEU A 1 51 ? 2.897   4.544   -0.150  1.00 0.00 ? 51  LEU A HD23 2  
ATOM   1897  N  N    . LYS A 1 52 ? -0.660  5.656   -3.545  1.00 0.00 ? 52  LYS A N    2  
ATOM   1898  C  CA   . LYS A 1 52 ? -1.145  5.694   -4.919  1.00 0.00 ? 52  LYS A CA   2  
ATOM   1899  C  C    . LYS A 1 52 ? 0.015   5.804   -5.903  1.00 0.00 ? 52  LYS A C    2  
ATOM   1900  O  O    . LYS A 1 52 ? 0.097   5.043   -6.867  1.00 0.00 ? 52  LYS A O    2  
ATOM   1901  C  CB   . LYS A 1 52 ? -2.104  6.872   -5.111  1.00 0.00 ? 52  LYS A CB   2  
ATOM   1902  C  CG   . LYS A 1 52 ? -2.807  6.871   -6.458  1.00 0.00 ? 52  LYS A CG   2  
ATOM   1903  C  CD   . LYS A 1 52 ? -3.998  7.814   -6.466  1.00 0.00 ? 52  LYS A CD   2  
ATOM   1904  C  CE   . LYS A 1 52 ? -3.556  9.269   -6.465  1.00 0.00 ? 52  LYS A CE   2  
ATOM   1905  N  NZ   . LYS A 1 52 ? -3.350  9.787   -7.846  1.00 0.00 ? 52  LYS A NZ   2  
ATOM   1906  H  H    . LYS A 1 52 ? -1.051  6.265   -2.883  1.00 0.00 ? 52  LYS A H    2  
ATOM   1907  H  HA   . LYS A 1 52 ? -1.677  4.774   -5.109  1.00 0.00 ? 52  LYS A HA   2  
ATOM   1908  H  HB2  . LYS A 1 52 ? -2.855  6.839   -4.336  1.00 0.00 ? 52  LYS A HB2  2  
ATOM   1909  H  HB3  . LYS A 1 52 ? -1.546  7.793   -5.021  1.00 0.00 ? 52  LYS A HB3  2  
ATOM   1910  H  HG2  . LYS A 1 52 ? -2.108  7.184   -7.219  1.00 0.00 ? 52  LYS A HG2  2  
ATOM   1911  H  HG3  . LYS A 1 52 ? -3.151  5.869   -6.673  1.00 0.00 ? 52  LYS A HG3  2  
ATOM   1912  H  HD2  . LYS A 1 52 ? -4.587  7.629   -7.352  1.00 0.00 ? 52  LYS A HD2  2  
ATOM   1913  H  HD3  . LYS A 1 52 ? -4.599  7.628   -5.587  1.00 0.00 ? 52  LYS A HD3  2  
ATOM   1914  H  HE2  . LYS A 1 52 ? -4.315  9.862   -5.977  1.00 0.00 ? 52  LYS A HE2  2  
ATOM   1915  H  HE3  . LYS A 1 52 ? -2.629  9.350   -5.917  1.00 0.00 ? 52  LYS A HE3  2  
ATOM   1916  H  HZ1  . LYS A 1 52 ? -4.207  9.636   -8.415  1.00 0.00 ? 52  LYS A HZ1  2  
ATOM   1917  H  HZ2  . LYS A 1 52 ? -2.555  9.292   -8.298  1.00 0.00 ? 52  LYS A HZ2  2  
ATOM   1918  H  HZ3  . LYS A 1 52 ? -3.140  10.805  -7.818  1.00 0.00 ? 52  LYS A HZ3  2  
ATOM   1919  N  N    . GLN A 1 53 ? 0.910   6.754   -5.652  1.00 0.00 ? 53  GLN A N    2  
ATOM   1920  C  CA   . GLN A 1 53 ? 2.066   6.962   -6.516  1.00 0.00 ? 53  GLN A CA   2  
ATOM   1921  C  C    . GLN A 1 53 ? 3.301   6.270   -5.948  1.00 0.00 ? 53  GLN A C    2  
ATOM   1922  O  O    . GLN A 1 53 ? 3.879   5.387   -6.582  1.00 0.00 ? 53  GLN A O    2  
ATOM   1923  C  CB   . GLN A 1 53 ? 2.338   8.457   -6.689  1.00 0.00 ? 53  GLN A CB   2  
ATOM   1924  C  CG   . GLN A 1 53 ? 1.175   9.220   -7.300  1.00 0.00 ? 53  GLN A CG   2  
ATOM   1925  C  CD   . GLN A 1 53 ? 1.122   10.666  -6.846  1.00 0.00 ? 53  GLN A CD   2  
ATOM   1926  O  OE1  . GLN A 1 53 ? 2.043   11.158  -6.195  1.00 0.00 ? 53  GLN A OE1  2  
ATOM   1927  N  NE2  . GLN A 1 53 ? 0.039   11.355  -7.188  1.00 0.00 ? 53  GLN A NE2  2  
ATOM   1928  H  H    . GLN A 1 53 ? 0.790   7.329   -4.868  1.00 0.00 ? 53  GLN A H    2  
ATOM   1929  H  HA   . GLN A 1 53 ? 1.840   6.532   -7.480  1.00 0.00 ? 53  GLN A HA   2  
ATOM   1930  H  HB2  . GLN A 1 53 ? 2.554   8.886   -5.721  1.00 0.00 ? 53  GLN A HB2  2  
ATOM   1931  H  HB3  . GLN A 1 53 ? 3.199   8.582   -7.329  1.00 0.00 ? 53  GLN A HB3  2  
ATOM   1932  H  HG2  . GLN A 1 53 ? 1.273   9.201   -8.376  1.00 0.00 ? 53  GLN A HG2  2  
ATOM   1933  H  HG3  . GLN A 1 53 ? 0.253   8.734   -7.016  1.00 0.00 ? 53  GLN A HG3  2  
ATOM   1934  H  HE21 . GLN A 1 53 ? -0.656  10.896  -7.706  1.00 0.00 ? 53  GLN A HE21 2  
ATOM   1935  H  HE22 . GLN A 1 53 ? -0.022  12.290  -6.907  1.00 0.00 ? 53  GLN A HE22 2  
ATOM   1936  N  N    . LYS A 1 54 ? 3.702   6.678   -4.749  1.00 0.00 ? 54  LYS A N    2  
ATOM   1937  C  CA   . LYS A 1 54 ? 4.869   6.098   -4.093  1.00 0.00 ? 54  LYS A CA   2  
ATOM   1938  C  C    . LYS A 1 54 ? 4.978   4.607   -4.397  1.00 0.00 ? 54  LYS A C    2  
ATOM   1939  O  O    . LYS A 1 54 ? 5.914   4.167   -5.063  1.00 0.00 ? 54  LYS A O    2  
ATOM   1940  C  CB   . LYS A 1 54 ? 4.791   6.316   -2.581  1.00 0.00 ? 54  LYS A CB   2  
ATOM   1941  C  CG   . LYS A 1 54 ? 4.714   7.780   -2.181  1.00 0.00 ? 54  LYS A CG   2  
ATOM   1942  C  CD   . LYS A 1 54 ? 4.791   7.950   -0.673  1.00 0.00 ? 54  LYS A CD   2  
ATOM   1943  C  CE   . LYS A 1 54 ? 6.229   8.109   -0.202  1.00 0.00 ? 54  LYS A CE   2  
ATOM   1944  N  NZ   . LYS A 1 54 ? 6.356   7.917   1.269   1.00 0.00 ? 54  LYS A NZ   2  
ATOM   1945  H  H    . LYS A 1 54 ? 3.201   7.386   -4.292  1.00 0.00 ? 54  LYS A H    2  
ATOM   1946  H  HA   . LYS A 1 54 ? 5.746   6.597   -4.476  1.00 0.00 ? 54  LYS A HA   2  
ATOM   1947  H  HB2  . LYS A 1 54 ? 3.913   5.815   -2.201  1.00 0.00 ? 54  LYS A HB2  2  
ATOM   1948  H  HB3  . LYS A 1 54 ? 5.668   5.885   -2.121  1.00 0.00 ? 54  LYS A HB3  2  
ATOM   1949  H  HG2  . LYS A 1 54 ? 5.538   8.311   -2.635  1.00 0.00 ? 54  LYS A HG2  2  
ATOM   1950  H  HG3  . LYS A 1 54 ? 3.779   8.191   -2.533  1.00 0.00 ? 54  LYS A HG3  2  
ATOM   1951  H  HD2  . LYS A 1 54 ? 4.233   8.830   -0.389  1.00 0.00 ? 54  LYS A HD2  2  
ATOM   1952  H  HD3  . LYS A 1 54 ? 4.361   7.080   -0.198  1.00 0.00 ? 54  LYS A HD3  2  
ATOM   1953  H  HE2  . LYS A 1 54 ? 6.842   7.378   -0.706  1.00 0.00 ? 54  LYS A HE2  2  
ATOM   1954  H  HE3  . LYS A 1 54 ? 6.570   9.101   -0.458  1.00 0.00 ? 54  LYS A HE3  2  
ATOM   1955  H  HZ1  . LYS A 1 54 ? 5.436   8.072   1.730   1.00 0.00 ? 54  LYS A HZ1  2  
ATOM   1956  H  HZ2  . LYS A 1 54 ? 7.044   8.591   1.659   1.00 0.00 ? 54  LYS A HZ2  2  
ATOM   1957  H  HZ3  . LYS A 1 54 ? 6.677   6.950   1.477   1.00 0.00 ? 54  LYS A HZ3  2  
ATOM   1958  N  N    . GLY A 1 55 ? 4.014   3.835   -3.906  1.00 0.00 ? 55  GLY A N    2  
ATOM   1959  C  CA   . GLY A 1 55 ? 4.021   2.402   -4.137  1.00 0.00 ? 55  GLY A CA   2  
ATOM   1960  C  C    . GLY A 1 55 ? 3.811   1.608   -2.863  1.00 0.00 ? 55  GLY A C    2  
ATOM   1961  O  O    . GLY A 1 55 ? 3.874   2.158   -1.763  1.00 0.00 ? 55  GLY A O    2  
ATOM   1962  H  H    . GLY A 1 55 ? 3.292   4.241   -3.382  1.00 0.00 ? 55  GLY A H    2  
ATOM   1963  H  HA2  . GLY A 1 55 ? 3.234   2.157   -4.835  1.00 0.00 ? 55  GLY A HA2  2  
ATOM   1964  H  HA3  . GLY A 1 55 ? 4.971   2.123   -4.569  1.00 0.00 ? 55  GLY A HA3  2  
ATOM   1965  N  N    . HIS A 1 56 ? 3.559   0.311   -3.010  1.00 0.00 ? 56  HIS A N    2  
ATOM   1966  C  CA   . HIS A 1 56 ? 3.338   -0.560  -1.861  1.00 0.00 ? 56  HIS A CA   2  
ATOM   1967  C  C    . HIS A 1 56 ? 4.198   -1.815  -1.958  1.00 0.00 ? 56  HIS A C    2  
ATOM   1968  O  O    . HIS A 1 56 ? 4.573   -2.241  -3.051  1.00 0.00 ? 56  HIS A O    2  
ATOM   1969  C  CB   . HIS A 1 56 ? 1.861   -0.945  -1.764  1.00 0.00 ? 56  HIS A CB   2  
ATOM   1970  C  CG   . HIS A 1 56 ? 1.520   -2.201  -2.506  1.00 0.00 ? 56  HIS A CG   2  
ATOM   1971  N  ND1  . HIS A 1 56 ? 0.942   -2.202  -3.758  1.00 0.00 ? 56  HIS A ND1  2  
ATOM   1972  C  CD2  . HIS A 1 56 ? 1.680   -3.501  -2.166  1.00 0.00 ? 56  HIS A CD2  2  
ATOM   1973  C  CE1  . HIS A 1 56 ? 0.760   -3.448  -4.156  1.00 0.00 ? 56  HIS A CE1  2  
ATOM   1974  N  NE2  . HIS A 1 56 ? 1.200   -4.256  -3.208  1.00 0.00 ? 56  HIS A NE2  2  
ATOM   1975  H  H    . HIS A 1 56 ? 3.521   -0.068  -3.912  1.00 0.00 ? 56  HIS A H    2  
ATOM   1976  H  HA   . HIS A 1 56 ? 3.617   -0.014  -0.973  1.00 0.00 ? 56  HIS A HA   2  
ATOM   1977  H  HB2  . HIS A 1 56 ? 1.602   -1.093  -0.726  1.00 0.00 ? 56  HIS A HB2  2  
ATOM   1978  H  HB3  . HIS A 1 56 ? 1.259   -0.145  -2.170  1.00 0.00 ? 56  HIS A HB3  2  
ATOM   1979  H  HD1  . HIS A 1 56 ? 0.700   -1.407  -4.277  1.00 0.00 ? 56  HIS A HD1  2  
ATOM   1980  H  HD2  . HIS A 1 56 ? 2.106   -3.877  -1.246  1.00 0.00 ? 56  HIS A HD2  2  
ATOM   1981  H  HE1  . HIS A 1 56 ? 0.326   -3.755  -5.095  1.00 0.00 ? 56  HIS A HE1  2  
ATOM   1982  H  HE2  . HIS A 1 56 ? 1.106   -5.232  -3.209  1.00 0.00 ? 56  HIS A HE2  2  
ATOM   1983  N  N    . PHE A 1 57 ? 4.509   -2.404  -0.808  1.00 0.00 ? 57  PHE A N    2  
ATOM   1984  C  CA   . PHE A 1 57 ? 5.327   -3.610  -0.763  1.00 0.00 ? 57  PHE A CA   2  
ATOM   1985  C  C    . PHE A 1 57 ? 4.606   -4.729  -0.016  1.00 0.00 ? 57  PHE A C    2  
ATOM   1986  O  O    . PHE A 1 57 ? 3.611   -4.493  0.669   1.00 0.00 ? 57  PHE A O    2  
ATOM   1987  C  CB   . PHE A 1 57 ? 6.670   -3.316  -0.091  1.00 0.00 ? 57  PHE A CB   2  
ATOM   1988  C  CG   . PHE A 1 57 ? 7.722   -2.825  -1.043  1.00 0.00 ? 57  PHE A CG   2  
ATOM   1989  C  CD1  . PHE A 1 57 ? 7.532   -1.657  -1.764  1.00 0.00 ? 57  PHE A CD1  2  
ATOM   1990  C  CD2  . PHE A 1 57 ? 8.902   -3.530  -1.217  1.00 0.00 ? 57  PHE A CD2  2  
ATOM   1991  C  CE1  . PHE A 1 57 ? 8.498   -1.203  -2.642  1.00 0.00 ? 57  PHE A CE1  2  
ATOM   1992  C  CE2  . PHE A 1 57 ? 9.872   -3.081  -2.093  1.00 0.00 ? 57  PHE A CE2  2  
ATOM   1993  C  CZ   . PHE A 1 57 ? 9.670   -1.915  -2.806  1.00 0.00 ? 57  PHE A CZ   2  
ATOM   1994  H  H    . PHE A 1 57 ? 4.180   -2.017  0.031   1.00 0.00 ? 57  PHE A H    2  
ATOM   1995  H  HA   . PHE A 1 57 ? 5.505   -3.928  -1.778  1.00 0.00 ? 57  PHE A HA   2  
ATOM   1996  H  HB2  . PHE A 1 57 ? 6.528   -2.559  0.666   1.00 0.00 ? 57  PHE A HB2  2  
ATOM   1997  H  HB3  . PHE A 1 57 ? 7.037   -4.219  0.374   1.00 0.00 ? 57  PHE A HB3  2  
ATOM   1998  H  HD1  . PHE A 1 57 ? 6.616   -1.098  -1.636  1.00 0.00 ? 57  PHE A HD1  2  
ATOM   1999  H  HD2  . PHE A 1 57 ? 9.061   -4.442  -0.659  1.00 0.00 ? 57  PHE A HD2  2  
ATOM   2000  H  HE1  . PHE A 1 57 ? 8.338   -0.291  -3.198  1.00 0.00 ? 57  PHE A HE1  2  
ATOM   2001  H  HE2  . PHE A 1 57 ? 10.787  -3.640  -2.219  1.00 0.00 ? 57  PHE A HE2  2  
ATOM   2002  H  HZ   . PHE A 1 57 ? 10.426  -1.563  -3.491  1.00 0.00 ? 57  PHE A HZ   2  
ATOM   2003  N  N    . PHE A 1 58 ? 5.116   -5.948  -0.154  1.00 0.00 ? 58  PHE A N    2  
ATOM   2004  C  CA   . PHE A 1 58 ? 4.521   -7.105  0.505   1.00 0.00 ? 58  PHE A CA   2  
ATOM   2005  C  C    . PHE A 1 58 ? 5.418   -7.610  1.632   1.00 0.00 ? 58  PHE A C    2  
ATOM   2006  O  O    . PHE A 1 58 ? 6.499   -8.145  1.388   1.00 0.00 ? 58  PHE A O    2  
ATOM   2007  C  CB   . PHE A 1 58 ? 4.276   -8.226  -0.507  1.00 0.00 ? 58  PHE A CB   2  
ATOM   2008  C  CG   . PHE A 1 58 ? 2.950   -8.122  -1.206  1.00 0.00 ? 58  PHE A CG   2  
ATOM   2009  C  CD1  . PHE A 1 58 ? 1.768   -8.142  -0.484  1.00 0.00 ? 58  PHE A CD1  2  
ATOM   2010  C  CD2  . PHE A 1 58 ? 2.887   -8.006  -2.585  1.00 0.00 ? 58  PHE A CD2  2  
ATOM   2011  C  CE1  . PHE A 1 58 ? 0.546   -8.047  -1.124  1.00 0.00 ? 58  PHE A CE1  2  
ATOM   2012  C  CE2  . PHE A 1 58 ? 1.668   -7.910  -3.231  1.00 0.00 ? 58  PHE A CE2  2  
ATOM   2013  C  CZ   . PHE A 1 58 ? 0.497   -7.932  -2.499  1.00 0.00 ? 58  PHE A CZ   2  
ATOM   2014  H  H    . PHE A 1 58 ? 5.912   -6.073  -0.713  1.00 0.00 ? 58  PHE A H    2  
ATOM   2015  H  HA   . PHE A 1 58 ? 3.576   -6.796  0.924   1.00 0.00 ? 58  PHE A HA   2  
ATOM   2016  H  HB2  . PHE A 1 58 ? 5.050   -8.197  -1.259  1.00 0.00 ? 58  PHE A HB2  2  
ATOM   2017  H  HB3  . PHE A 1 58 ? 4.310   -9.176  0.004   1.00 0.00 ? 58  PHE A HB3  2  
ATOM   2018  H  HD1  . PHE A 1 58 ? 1.806   -8.232  0.593   1.00 0.00 ? 58  PHE A HD1  2  
ATOM   2019  H  HD2  . PHE A 1 58 ? 3.802   -7.990  -3.159  1.00 0.00 ? 58  PHE A HD2  2  
ATOM   2020  H  HE1  . PHE A 1 58 ? -0.367  -8.064  -0.549  1.00 0.00 ? 58  PHE A HE1  2  
ATOM   2021  H  HE2  . PHE A 1 58 ? 1.632   -7.820  -4.306  1.00 0.00 ? 58  PHE A HE2  2  
ATOM   2022  H  HZ   . PHE A 1 58 ? -0.456  -7.856  -3.001  1.00 0.00 ? 58  PHE A HZ   2  
ATOM   2023  N  N    . VAL A 1 59 ? 4.961   -7.434  2.868   1.00 0.00 ? 59  VAL A N    2  
ATOM   2024  C  CA   . VAL A 1 59 ? 5.720   -7.871  4.033   1.00 0.00 ? 59  VAL A CA   2  
ATOM   2025  C  C    . VAL A 1 59 ? 4.804   -8.479  5.089   1.00 0.00 ? 59  VAL A C    2  
ATOM   2026  O  O    . VAL A 1 59 ? 3.948   -7.795  5.650   1.00 0.00 ? 59  VAL A O    2  
ATOM   2027  C  CB   . VAL A 1 59 ? 6.506   -6.705  4.661   1.00 0.00 ? 59  VAL A CB   2  
ATOM   2028  C  CG1  . VAL A 1 59 ? 7.233   -7.165  5.915   1.00 0.00 ? 59  VAL A CG1  2  
ATOM   2029  C  CG2  . VAL A 1 59 ? 7.483   -6.118  3.653   1.00 0.00 ? 59  VAL A CG2  2  
ATOM   2030  H  H    . VAL A 1 59 ? 4.092   -7.000  2.999   1.00 0.00 ? 59  VAL A H    2  
ATOM   2031  H  HA   . VAL A 1 59 ? 6.427   -8.621  3.709   1.00 0.00 ? 59  VAL A HA   2  
ATOM   2032  H  HB   . VAL A 1 59 ? 5.804   -5.934  4.941   1.00 0.00 ? 59  VAL A HB   2  
ATOM   2033  H  HG11 . VAL A 1 59 ? 7.931   -7.949  5.659   1.00 0.00 ? 59  VAL A HG11 2  
ATOM   2034  H  HG12 . VAL A 1 59 ? 7.768   -6.332  6.348   1.00 0.00 ? 59  VAL A HG12 2  
ATOM   2035  H  HG13 . VAL A 1 59 ? 6.516   -7.543  6.629   1.00 0.00 ? 59  VAL A HG13 2  
ATOM   2036  H  HG21 . VAL A 1 59 ? 7.374   -6.628  2.708   1.00 0.00 ? 59  VAL A HG21 2  
ATOM   2037  H  HG22 . VAL A 1 59 ? 7.275   -5.066  3.521   1.00 0.00 ? 59  VAL A HG22 2  
ATOM   2038  H  HG23 . VAL A 1 59 ? 8.493   -6.243  4.016   1.00 0.00 ? 59  VAL A HG23 2  
ATOM   2039  N  N    . GLU A 1 60 ? 4.990   -9.768  5.355   1.00 0.00 ? 60  GLU A N    2  
ATOM   2040  C  CA   . GLU A 1 60 ? 4.179   -10.468 6.345   1.00 0.00 ? 60  GLU A CA   2  
ATOM   2041  C  C    . GLU A 1 60 ? 2.698   -10.390 5.988   1.00 0.00 ? 60  GLU A C    2  
ATOM   2042  O  O    . GLU A 1 60 ? 1.850   -10.179 6.856   1.00 0.00 ? 60  GLU A O    2  
ATOM   2043  C  CB   . GLU A 1 60 ? 4.412   -9.878  7.737   1.00 0.00 ? 60  GLU A CB   2  
ATOM   2044  C  CG   . GLU A 1 60 ? 5.865   -9.921  8.181   1.00 0.00 ? 60  GLU A CG   2  
ATOM   2045  C  CD   . GLU A 1 60 ? 6.081   -9.267  9.532   1.00 0.00 ? 60  GLU A CD   2  
ATOM   2046  O  OE1  . GLU A 1 60 ? 5.459   -9.718  10.517  1.00 0.00 ? 60  GLU A OE1  2  
ATOM   2047  O  OE2  . GLU A 1 60 ? 6.873   -8.304  9.605   1.00 0.00 ? 60  GLU A OE2  2  
ATOM   2048  H  H    . GLU A 1 60 ? 5.688   -10.260 4.875   1.00 0.00 ? 60  GLU A H    2  
ATOM   2049  H  HA   . GLU A 1 60 ? 4.481   -11.505 6.348   1.00 0.00 ? 60  GLU A HA   2  
ATOM   2050  H  HB2  . GLU A 1 60 ? 4.086   -8.848  7.738   1.00 0.00 ? 60  GLU A HB2  2  
ATOM   2051  H  HB3  . GLU A 1 60 ? 3.823   -10.433 8.453   1.00 0.00 ? 60  GLU A HB3  2  
ATOM   2052  H  HG2  . GLU A 1 60 ? 6.179   -10.952 8.243   1.00 0.00 ? 60  GLU A HG2  2  
ATOM   2053  H  HG3  . GLU A 1 60 ? 6.467   -9.405  7.448   1.00 0.00 ? 60  GLU A HG3  2  
ATOM   2054  N  N    . ASP A 1 61 ? 2.394   -10.559 4.706   1.00 0.00 ? 61  ASP A N    2  
ATOM   2055  C  CA   . ASP A 1 61 ? 1.015   -10.508 4.234   1.00 0.00 ? 61  ASP A CA   2  
ATOM   2056  C  C    . ASP A 1 61 ? 0.398   -9.139  4.505   1.00 0.00 ? 61  ASP A C    2  
ATOM   2057  O  O    . ASP A 1 61 ? -0.802  -9.028  4.754   1.00 0.00 ? 61  ASP A O    2  
ATOM   2058  C  CB   . ASP A 1 61 ? 0.182   -11.599 4.907   1.00 0.00 ? 61  ASP A CB   2  
ATOM   2059  C  CG   . ASP A 1 61 ? -1.098  -11.899 4.153   1.00 0.00 ? 61  ASP A CG   2  
ATOM   2060  O  OD1  . ASP A 1 61 ? -1.644  -10.972 3.517   1.00 0.00 ? 61  ASP A OD1  2  
ATOM   2061  O  OD2  . ASP A 1 61 ? -1.554  -13.061 4.197   1.00 0.00 ? 61  ASP A OD2  2  
ATOM   2062  H  H    . ASP A 1 61 ? 3.114   -10.724 4.062   1.00 0.00 ? 61  ASP A H    2  
ATOM   2063  H  HA   . ASP A 1 61 ? 1.023   -10.681 3.168   1.00 0.00 ? 61  ASP A HA   2  
ATOM   2064  H  HB2  . ASP A 1 61 ? 0.766   -12.507 4.963   1.00 0.00 ? 61  ASP A HB2  2  
ATOM   2065  H  HB3  . ASP A 1 61 ? -0.076  -11.281 5.907   1.00 0.00 ? 61  ASP A HB3  2  
ATOM   2066  N  N    . GLN A 1 62 ? 1.228   -8.102  4.454   1.00 0.00 ? 62  GLN A N    2  
ATOM   2067  C  CA   . GLN A 1 62 ? 0.763   -6.741  4.696   1.00 0.00 ? 62  GLN A CA   2  
ATOM   2068  C  C    . GLN A 1 62 ? 1.288   -5.788  3.628   1.00 0.00 ? 62  GLN A C    2  
ATOM   2069  O  O    . GLN A 1 62 ? 2.049   -6.188  2.746   1.00 0.00 ? 62  GLN A O    2  
ATOM   2070  C  CB   . GLN A 1 62 ? 1.206   -6.267  6.082   1.00 0.00 ? 62  GLN A CB   2  
ATOM   2071  C  CG   . GLN A 1 62 ? 0.366   -6.832  7.216   1.00 0.00 ? 62  GLN A CG   2  
ATOM   2072  C  CD   . GLN A 1 62 ? -1.120  -6.779  6.923   1.00 0.00 ? 62  GLN A CD   2  
ATOM   2073  O  OE1  . GLN A 1 62 ? -1.774  -7.812  6.782   1.00 0.00 ? 62  GLN A OE1  2  
ATOM   2074  N  NE2  . GLN A 1 62 ? -1.663  -5.570  6.831   1.00 0.00 ? 62  GLN A NE2  2  
ATOM   2075  H  H    . GLN A 1 62 ? 2.173   -8.255  4.250   1.00 0.00 ? 62  GLN A H    2  
ATOM   2076  H  HA   . GLN A 1 62 ? -0.316  -6.747  4.656   1.00 0.00 ? 62  GLN A HA   2  
ATOM   2077  H  HB2  . GLN A 1 62 ? 2.232   -6.564  6.239   1.00 0.00 ? 62  GLN A HB2  2  
ATOM   2078  H  HB3  . GLN A 1 62 ? 1.143   -5.189  6.118   1.00 0.00 ? 62  GLN A HB3  2  
ATOM   2079  H  HG2  . GLN A 1 62 ? 0.649   -7.861  7.378   1.00 0.00 ? 62  GLN A HG2  2  
ATOM   2080  H  HG3  . GLN A 1 62 ? 0.563   -6.260  8.111   1.00 0.00 ? 62  GLN A HG3  2  
ATOM   2081  H  HE21 . GLN A 1 62 ? -1.080  -4.791  6.954   1.00 0.00 ? 62  GLN A HE21 2  
ATOM   2082  H  HE22 . GLN A 1 62 ? -2.621  -5.506  6.642   1.00 0.00 ? 62  GLN A HE22 2  
ATOM   2083  N  N    . ILE A 1 63 ? 0.878   -4.528  3.713   1.00 0.00 ? 63  ILE A N    2  
ATOM   2084  C  CA   . ILE A 1 63 ? 1.308   -3.518  2.753   1.00 0.00 ? 63  ILE A CA   2  
ATOM   2085  C  C    . ILE A 1 63 ? 1.966   -2.336  3.456   1.00 0.00 ? 63  ILE A C    2  
ATOM   2086  O  O    . ILE A 1 63 ? 1.508   -1.894  4.510   1.00 0.00 ? 63  ILE A O    2  
ATOM   2087  C  CB   . ILE A 1 63 ? 0.127   -3.006  1.908   1.00 0.00 ? 63  ILE A CB   2  
ATOM   2088  C  CG1  . ILE A 1 63 ? -0.962  -2.427  2.812   1.00 0.00 ? 63  ILE A CG1  2  
ATOM   2089  C  CG2  . ILE A 1 63 ? -0.433  -4.127  1.045   1.00 0.00 ? 63  ILE A CG2  2  
ATOM   2090  C  CD1  . ILE A 1 63 ? -1.896  -1.474  2.099   1.00 0.00 ? 63  ILE A CD1  2  
ATOM   2091  H  H    . ILE A 1 63 ? 0.272   -4.270  4.438   1.00 0.00 ? 63  ILE A H    2  
ATOM   2092  H  HA   . ILE A 1 63 ? 2.028   -3.975  2.090   1.00 0.00 ? 63  ILE A HA   2  
ATOM   2093  H  HB   . ILE A 1 63 ? 0.492   -2.229  1.253   1.00 0.00 ? 63  ILE A HB   2  
ATOM   2094  H  HG12 . ILE A 1 63 ? -1.556  -3.234  3.213   1.00 0.00 ? 63  ILE A HG12 2  
ATOM   2095  H  HG13 . ILE A 1 63 ? -0.497  -1.890  3.626   1.00 0.00 ? 63  ILE A HG13 2  
ATOM   2096  H  HG21 . ILE A 1 63 ? -1.085  -3.710  0.292   1.00 0.00 ? 63  ILE A HG21 2  
ATOM   2097  H  HG22 . ILE A 1 63 ? 0.380   -4.652  0.565   1.00 0.00 ? 63  ILE A HG22 2  
ATOM   2098  H  HG23 . ILE A 1 63 ? -0.990  -4.814  1.664   1.00 0.00 ? 63  ILE A HG23 2  
ATOM   2099  H  HD11 . ILE A 1 63 ? -1.376  -1.009  1.274   1.00 0.00 ? 63  ILE A HD11 2  
ATOM   2100  H  HD12 . ILE A 1 63 ? -2.751  -2.017  1.727   1.00 0.00 ? 63  ILE A HD12 2  
ATOM   2101  H  HD13 . ILE A 1 63 ? -2.227  -0.711  2.790   1.00 0.00 ? 63  ILE A HD13 2  
ATOM   2102  N  N    . TYR A 1 64 ? 3.042   -1.828  2.866   1.00 0.00 ? 64  TYR A N    2  
ATOM   2103  C  CA   . TYR A 1 64 ? 3.764   -0.696  3.435   1.00 0.00 ? 64  TYR A CA   2  
ATOM   2104  C  C    . TYR A 1 64 ? 4.404   0.150   2.339   1.00 0.00 ? 64  TYR A C    2  
ATOM   2105  O  O    . TYR A 1 64 ? 4.435   -0.244  1.173   1.00 0.00 ? 64  TYR A O    2  
ATOM   2106  C  CB   . TYR A 1 64 ? 4.838   -1.187  4.408   1.00 0.00 ? 64  TYR A CB   2  
ATOM   2107  C  CG   . TYR A 1 64 ? 4.311   -2.131  5.465   1.00 0.00 ? 64  TYR A CG   2  
ATOM   2108  C  CD1  . TYR A 1 64 ? 3.797   -1.647  6.662   1.00 0.00 ? 64  TYR A CD1  2  
ATOM   2109  C  CD2  . TYR A 1 64 ? 4.328   -3.506  5.268   1.00 0.00 ? 64  TYR A CD2  2  
ATOM   2110  C  CE1  . TYR A 1 64 ? 3.316   -2.505  7.632   1.00 0.00 ? 64  TYR A CE1  2  
ATOM   2111  C  CE2  . TYR A 1 64 ? 3.847   -4.372  6.232   1.00 0.00 ? 64  TYR A CE2  2  
ATOM   2112  C  CZ   . TYR A 1 64 ? 3.342   -3.867  7.412   1.00 0.00 ? 64  TYR A CZ   2  
ATOM   2113  O  OH   . TYR A 1 64 ? 2.863   -4.726  8.374   1.00 0.00 ? 64  TYR A OH   2  
ATOM   2114  H  H    . TYR A 1 64 ? 3.359   -2.223  2.027   1.00 0.00 ? 64  TYR A H    2  
ATOM   2115  H  HA   . TYR A 1 64 ? 3.054   -0.088  3.976   1.00 0.00 ? 64  TYR A HA   2  
ATOM   2116  H  HB2  . TYR A 1 64 ? 5.605   -1.706  3.854   1.00 0.00 ? 64  TYR A HB2  2  
ATOM   2117  H  HB3  . TYR A 1 64 ? 5.275   -0.337  4.910   1.00 0.00 ? 64  TYR A HB3  2  
ATOM   2118  H  HD1  . TYR A 1 64 ? 3.778   -0.580  6.832   1.00 0.00 ? 64  TYR A HD1  2  
ATOM   2119  H  HD2  . TYR A 1 64 ? 4.724   -3.899  4.343   1.00 0.00 ? 64  TYR A HD2  2  
ATOM   2120  H  HE1  . TYR A 1 64 ? 2.920   -2.110  8.556   1.00 0.00 ? 64  TYR A HE1  2  
ATOM   2121  H  HE2  . TYR A 1 64 ? 3.868   -5.438  6.060   1.00 0.00 ? 64  TYR A HE2  2  
ATOM   2122  H  HH   . TYR A 1 64 ? 2.615   -5.558  7.965   1.00 0.00 ? 64  TYR A HH   2  
ATOM   2123  N  N    . CYS A 1 65 ? 4.914   1.316   2.722   1.00 0.00 ? 65  CYS A N    2  
ATOM   2124  C  CA   . CYS A 1 65 ? 5.553   2.220   1.774   1.00 0.00 ? 65  CYS A CA   2  
ATOM   2125  C  C    . CYS A 1 65 ? 7.010   1.827   1.547   1.00 0.00 ? 65  CYS A C    2  
ATOM   2126  O  O    . CYS A 1 65 ? 7.680   1.336   2.455   1.00 0.00 ? 65  CYS A O    2  
ATOM   2127  C  CB   . CYS A 1 65 ? 5.475   3.662   2.280   1.00 0.00 ? 65  CYS A CB   2  
ATOM   2128  S  SG   . CYS A 1 65 ? 5.983   3.868   4.017   1.00 0.00 ? 65  CYS A SG   2  
ATOM   2129  H  H    . CYS A 1 65 ? 4.858   1.575   3.667   1.00 0.00 ? 65  CYS A H    2  
ATOM   2130  H  HA   . CYS A 1 65 ? 5.023   2.147   0.837   1.00 0.00 ? 65  CYS A HA   2  
ATOM   2131  H  HB2  . CYS A 1 65 ? 6.119   4.283   1.675   1.00 0.00 ? 65  CYS A HB2  2  
ATOM   2132  H  HB3  . CYS A 1 65 ? 4.458   4.012   2.190   1.00 0.00 ? 65  CYS A HB3  2  
ATOM   2133  N  N    . GLU A 1 66 ? 7.494   2.049   0.328   1.00 0.00 ? 66  GLU A N    2  
ATOM   2134  C  CA   . GLU A 1 66 ? 8.871   1.717   -0.018  1.00 0.00 ? 66  GLU A CA   2  
ATOM   2135  C  C    . GLU A 1 66 ? 9.813   2.026   1.142   1.00 0.00 ? 66  GLU A C    2  
ATOM   2136  O  O    . GLU A 1 66 ? 10.638  1.197   1.525   1.00 0.00 ? 66  GLU A O    2  
ATOM   2137  C  CB   . GLU A 1 66 ? 9.307   2.491   -1.264  1.00 0.00 ? 66  GLU A CB   2  
ATOM   2138  C  CG   . GLU A 1 66 ? 10.794  2.383   -1.559  1.00 0.00 ? 66  GLU A CG   2  
ATOM   2139  C  CD   . GLU A 1 66 ? 11.218  3.234   -2.740  1.00 0.00 ? 66  GLU A CD   2  
ATOM   2140  O  OE1  . GLU A 1 66 ? 10.404  3.405   -3.671  1.00 0.00 ? 66  GLU A OE1  2  
ATOM   2141  O  OE2  . GLU A 1 66 ? 12.365  3.729   -2.732  1.00 0.00 ? 66  GLU A OE2  2  
ATOM   2142  H  H    . GLU A 1 66 ? 6.911   2.443   -0.353  1.00 0.00 ? 66  GLU A H    2  
ATOM   2143  H  HA   . GLU A 1 66 ? 8.914   0.660   -0.229  1.00 0.00 ? 66  GLU A HA   2  
ATOM   2144  H  HB2  . GLU A 1 66 ? 8.763   2.113   -2.117  1.00 0.00 ? 66  GLU A HB2  2  
ATOM   2145  H  HB3  . GLU A 1 66 ? 9.064   3.535   -1.128  1.00 0.00 ? 66  GLU A HB3  2  
ATOM   2146  H  HG2  . GLU A 1 66 ? 11.344  2.704   -0.687  1.00 0.00 ? 66  GLU A HG2  2  
ATOM   2147  H  HG3  . GLU A 1 66 ? 11.031  1.351   -1.773  1.00 0.00 ? 66  GLU A HG3  2  
ATOM   2148  N  N    . LYS A 1 67 ? 9.684   3.227   1.697   1.00 0.00 ? 67  LYS A N    2  
ATOM   2149  C  CA   . LYS A 1 67 ? 10.522  3.648   2.813   1.00 0.00 ? 67  LYS A CA   2  
ATOM   2150  C  C    . LYS A 1 67 ? 10.516  2.601   3.923   1.00 0.00 ? 67  LYS A C    2  
ATOM   2151  O  O    . LYS A 1 67 ? 11.558  2.044   4.270   1.00 0.00 ? 67  LYS A O    2  
ATOM   2152  C  CB   . LYS A 1 67 ? 10.039  4.992   3.363   1.00 0.00 ? 67  LYS A CB   2  
ATOM   2153  C  CG   . LYS A 1 67 ? 10.707  5.392   4.666   1.00 0.00 ? 67  LYS A CG   2  
ATOM   2154  C  CD   . LYS A 1 67 ? 9.858   6.380   5.448   1.00 0.00 ? 67  LYS A CD   2  
ATOM   2155  C  CE   . LYS A 1 67 ? 10.024  7.797   4.921   1.00 0.00 ? 67  LYS A CE   2  
ATOM   2156  N  NZ   . LYS A 1 67 ? 9.040   8.109   3.847   1.00 0.00 ? 67  LYS A NZ   2  
ATOM   2157  H  H    . LYS A 1 67 ? 9.008   3.845   1.347   1.00 0.00 ? 67  LYS A H    2  
ATOM   2158  H  HA   . LYS A 1 67 ? 11.531  3.760   2.447   1.00 0.00 ? 67  LYS A HA   2  
ATOM   2159  H  HB2  . LYS A 1 67 ? 10.238  5.759   2.630   1.00 0.00 ? 67  LYS A HB2  2  
ATOM   2160  H  HB3  . LYS A 1 67 ? 8.973   4.935   3.531   1.00 0.00 ? 67  LYS A HB3  2  
ATOM   2161  H  HG2  . LYS A 1 67 ? 10.858  4.509   5.269   1.00 0.00 ? 67  LYS A HG2  2  
ATOM   2162  H  HG3  . LYS A 1 67 ? 11.662  5.847   4.446   1.00 0.00 ? 67  LYS A HG3  2  
ATOM   2163  H  HD2  . LYS A 1 67 ? 8.819   6.096   5.362   1.00 0.00 ? 67  LYS A HD2  2  
ATOM   2164  H  HD3  . LYS A 1 67 ? 10.155  6.355   6.487   1.00 0.00 ? 67  LYS A HD3  2  
ATOM   2165  H  HE2  . LYS A 1 67 ? 9.885   8.490   5.737   1.00 0.00 ? 67  LYS A HE2  2  
ATOM   2166  H  HE3  . LYS A 1 67 ? 11.023  7.904   4.524   1.00 0.00 ? 67  LYS A HE3  2  
ATOM   2167  H  HZ1  . LYS A 1 67 ? 9.178   9.082   3.508   1.00 0.00 ? 67  LYS A HZ1  2  
ATOM   2168  H  HZ2  . LYS A 1 67 ? 8.071   8.016   4.213   1.00 0.00 ? 67  LYS A HZ2  2  
ATOM   2169  H  HZ3  . LYS A 1 67 ? 9.162   7.454   3.049   1.00 0.00 ? 67  LYS A HZ3  2  
ATOM   2170  N  N    . HIS A 1 68 ? 9.337   2.338   4.475   1.00 0.00 ? 68  HIS A N    2  
ATOM   2171  C  CA   . HIS A 1 68 ? 9.195   1.356   5.545   1.00 0.00 ? 68  HIS A CA   2  
ATOM   2172  C  C    . HIS A 1 68 ? 9.565   -0.040  5.053   1.00 0.00 ? 68  HIS A C    2  
ATOM   2173  O  O    . HIS A 1 68 ? 10.513  -0.651  5.545   1.00 0.00 ? 68  HIS A O    2  
ATOM   2174  C  CB   . HIS A 1 68 ? 7.764   1.357   6.081   1.00 0.00 ? 68  HIS A CB   2  
ATOM   2175  C  CG   . HIS A 1 68 ? 7.509   2.421   7.105   1.00 0.00 ? 68  HIS A CG   2  
ATOM   2176  N  ND1  . HIS A 1 68 ? 6.287   3.042   7.256   1.00 0.00 ? 68  HIS A ND1  2  
ATOM   2177  C  CD2  . HIS A 1 68 ? 8.326   2.970   8.033   1.00 0.00 ? 68  HIS A CD2  2  
ATOM   2178  C  CE1  . HIS A 1 68 ? 6.365   3.930   8.231   1.00 0.00 ? 68  HIS A CE1  2  
ATOM   2179  N  NE2  . HIS A 1 68 ? 7.592   3.906   8.720   1.00 0.00 ? 68  HIS A NE2  2  
ATOM   2180  H  H    . HIS A 1 68 ? 8.542   2.814   4.156   1.00 0.00 ? 68  HIS A H    2  
ATOM   2181  H  HA   . HIS A 1 68 ? 9.869   1.633   6.341   1.00 0.00 ? 68  HIS A HA   2  
ATOM   2182  H  HB2  . HIS A 1 68 ? 7.079   1.516   5.261   1.00 0.00 ? 68  HIS A HB2  2  
ATOM   2183  H  HB3  . HIS A 1 68 ? 7.556   0.400   6.537   1.00 0.00 ? 68  HIS A HB3  2  
ATOM   2184  H  HD2  . HIS A 1 68 ? 9.364   2.721   8.202   1.00 0.00 ? 68  HIS A HD2  2  
ATOM   2185  H  HE1  . HIS A 1 68 ? 5.563   4.567   8.572   1.00 0.00 ? 68  HIS A HE1  2  
ATOM   2186  H  HE2  . HIS A 1 68 ? 7.943   4.524   9.393   1.00 0.00 ? 68  HIS A HE2  2  
ATOM   2187  N  N    . ALA A 1 69 ? 8.810   -0.539  4.079   1.00 0.00 ? 69  ALA A N    2  
ATOM   2188  C  CA   . ALA A 1 69 ? 9.060   -1.862  3.520   1.00 0.00 ? 69  ALA A CA   2  
ATOM   2189  C  C    . ALA A 1 69 ? 10.550  -2.185  3.520   1.00 0.00 ? 69  ALA A C    2  
ATOM   2190  O  O    . ALA A 1 69 ? 10.956  -3.286  3.893   1.00 0.00 ? 69  ALA A O    2  
ATOM   2191  C  CB   . ALA A 1 69 ? 8.498   -1.953  2.110   1.00 0.00 ? 69  ALA A CB   2  
ATOM   2192  H  H    . ALA A 1 69 ? 8.069   -0.004  3.728   1.00 0.00 ? 69  ALA A H    2  
ATOM   2193  H  HA   . ALA A 1 69 ? 8.545   -2.586  4.135   1.00 0.00 ? 69  ALA A HA   2  
ATOM   2194  H  HB1  . ALA A 1 69 ? 7.802   -1.143  1.947   1.00 0.00 ? 69  ALA A HB1  2  
ATOM   2195  H  HB2  . ALA A 1 69 ? 9.304   -1.884  1.396   1.00 0.00 ? 69  ALA A HB2  2  
ATOM   2196  H  HB3  . ALA A 1 69 ? 7.987   -2.896  1.986   1.00 0.00 ? 69  ALA A HB3  2  
ATOM   2197  N  N    . ARG A 1 70 ? 11.360  -1.220  3.098   1.00 0.00 ? 70  ARG A N    2  
ATOM   2198  C  CA   . ARG A 1 70 ? 12.806  -1.404  3.048   1.00 0.00 ? 70  ARG A CA   2  
ATOM   2199  C  C    . ARG A 1 70 ? 13.369  -1.669  4.441   1.00 0.00 ? 70  ARG A C    2  
ATOM   2200  O  O    . ARG A 1 70 ? 14.172  -2.581  4.632   1.00 0.00 ? 70  ARG A O    2  
ATOM   2201  C  CB   . ARG A 1 70 ? 13.477  -0.170  2.440   1.00 0.00 ? 70  ARG A CB   2  
ATOM   2202  C  CG   . ARG A 1 70 ? 13.533  -0.193  0.922   1.00 0.00 ? 70  ARG A CG   2  
ATOM   2203  C  CD   . ARG A 1 70 ? 14.298  1.002   0.374   1.00 0.00 ? 70  ARG A CD   2  
ATOM   2204  N  NE   . ARG A 1 70 ? 14.580  0.864   -1.052  1.00 0.00 ? 70  ARG A NE   2  
ATOM   2205  C  CZ   . ARG A 1 70 ? 15.557  0.107   -1.538  1.00 0.00 ? 70  ARG A CZ   2  
ATOM   2206  N  NH1  . ARG A 1 70 ? 16.340  -0.579  -0.717  1.00 0.00 ? 70  ARG A NH1  2  
ATOM   2207  N  NH2  . ARG A 1 70 ? 15.751  0.033   -2.849  1.00 0.00 ? 70  ARG A NH2  2  
ATOM   2208  H  H    . ARG A 1 70 ? 10.977  -0.364  2.814   1.00 0.00 ? 70  ARG A H    2  
ATOM   2209  H  HA   . ARG A 1 70 ? 13.010  -2.259  2.421   1.00 0.00 ? 70  ARG A HA   2  
ATOM   2210  H  HB2  . ARG A 1 70 ? 12.930  0.710   2.745   1.00 0.00 ? 70  ARG A HB2  2  
ATOM   2211  H  HB3  . ARG A 1 70 ? 14.487  -0.104  2.815   1.00 0.00 ? 70  ARG A HB3  2  
ATOM   2212  H  HG2  . ARG A 1 70 ? 14.028  -1.099  0.603   1.00 0.00 ? 70  ARG A HG2  2  
ATOM   2213  H  HG3  . ARG A 1 70 ? 12.526  -0.175  0.533   1.00 0.00 ? 70  ARG A HG3  2  
ATOM   2214  H  HD2  . ARG A 1 70 ? 13.707  1.892   0.530   1.00 0.00 ? 70  ARG A HD2  2  
ATOM   2215  H  HD3  . ARG A 1 70 ? 15.231  1.091   0.910   1.00 0.00 ? 70  ARG A HD3  2  
ATOM   2216  H  HE   . ARG A 1 70 ? 14.013  1.362   -1.677  1.00 0.00 ? 70  ARG A HE   2  
ATOM   2217  H  HH11 . ARG A 1 70 ? 16.195  -0.526  0.271   1.00 0.00 ? 70  ARG A HH11 2  
ATOM   2218  H  HH12 . ARG A 1 70 ? 17.074  -1.150  -1.086  1.00 0.00 ? 70  ARG A HH12 2  
ATOM   2219  H  HH21 . ARG A 1 70 ? 15.163  0.548   -3.471  1.00 0.00 ? 70  ARG A HH21 2  
ATOM   2220  H  HH22 . ARG A 1 70 ? 16.486  -0.537  -3.214  1.00 0.00 ? 70  ARG A HH22 2  
ATOM   2221  N  N    . GLU A 1 71 ? 12.943  -0.864  5.409   1.00 0.00 ? 71  GLU A N    2  
ATOM   2222  C  CA   . GLU A 1 71 ? 13.406  -1.011  6.784   1.00 0.00 ? 71  GLU A CA   2  
ATOM   2223  C  C    . GLU A 1 71 ? 12.815  -2.263  7.426   1.00 0.00 ? 71  GLU A C    2  
ATOM   2224  O  O    . GLU A 1 71 ? 13.423  -2.866  8.311   1.00 0.00 ? 71  GLU A O    2  
ATOM   2225  C  CB   . GLU A 1 71 ? 13.032  0.223   7.607   1.00 0.00 ? 71  GLU A CB   2  
ATOM   2226  C  CG   . GLU A 1 71 ? 11.671  0.121   8.273   1.00 0.00 ? 71  GLU A CG   2  
ATOM   2227  C  CD   . GLU A 1 71 ? 11.458  1.184   9.333   1.00 0.00 ? 71  GLU A CD   2  
ATOM   2228  O  OE1  . GLU A 1 71 ? 11.844  2.347   9.091   1.00 0.00 ? 71  GLU A OE1  2  
ATOM   2229  O  OE2  . GLU A 1 71 ? 10.908  0.854   10.404  1.00 0.00 ? 71  GLU A OE2  2  
ATOM   2230  H  H    . GLU A 1 71 ? 12.302  -0.155  5.194   1.00 0.00 ? 71  GLU A H    2  
ATOM   2231  H  HA   . GLU A 1 71 ? 14.481  -1.106  6.763   1.00 0.00 ? 71  GLU A HA   2  
ATOM   2232  H  HB2  . GLU A 1 71 ? 13.777  0.368   8.375   1.00 0.00 ? 71  GLU A HB2  2  
ATOM   2233  H  HB3  . GLU A 1 71 ? 13.027  1.086   6.957   1.00 0.00 ? 71  GLU A HB3  2  
ATOM   2234  H  HG2  . GLU A 1 71 ? 10.906  0.228   7.519   1.00 0.00 ? 71  GLU A HG2  2  
ATOM   2235  H  HG3  . GLU A 1 71 ? 11.583  -0.851  8.737   1.00 0.00 ? 71  GLU A HG3  2  
ATOM   2236  N  N    . ARG A 1 72 ? 11.625  -2.646  6.975   1.00 0.00 ? 72  ARG A N    2  
ATOM   2237  C  CA   . ARG A 1 72 ? 10.950  -3.824  7.506   1.00 0.00 ? 72  ARG A CA   2  
ATOM   2238  C  C    . ARG A 1 72 ? 11.679  -5.100  7.096   1.00 0.00 ? 72  ARG A C    2  
ATOM   2239  O  O    . ARG A 1 72 ? 11.925  -5.980  7.921   1.00 0.00 ? 72  ARG A O    2  
ATOM   2240  C  CB   . ARG A 1 72 ? 9.501   -3.872  7.016   1.00 0.00 ? 72  ARG A CB   2  
ATOM   2241  C  CG   . ARG A 1 72 ? 8.589   -2.876  7.714   1.00 0.00 ? 72  ARG A CG   2  
ATOM   2242  C  CD   . ARG A 1 72 ? 7.137   -3.325  7.670   1.00 0.00 ? 72  ARG A CD   2  
ATOM   2243  N  NE   . ARG A 1 72 ? 6.354   -2.753  8.762   1.00 0.00 ? 72  ARG A NE   2  
ATOM   2244  C  CZ   . ARG A 1 72 ? 6.278   -3.293  9.974   1.00 0.00 ? 72  ARG A CZ   2  
ATOM   2245  N  NH1  . ARG A 1 72 ? 6.935   -4.412  10.247  1.00 0.00 ? 72  ARG A NH1  2  
ATOM   2246  N  NH2  . ARG A 1 72 ? 5.545   -2.713  10.915  1.00 0.00 ? 72  ARG A NH2  2  
ATOM   2247  H  H    . ARG A 1 72 ? 11.190  -2.125  6.268   1.00 0.00 ? 72  ARG A H    2  
ATOM   2248  H  HA   . ARG A 1 72 ? 10.954  -3.752  8.583   1.00 0.00 ? 72  ARG A HA   2  
ATOM   2249  H  HB2  . ARG A 1 72 ? 9.484   -3.662  5.957   1.00 0.00 ? 72  ARG A HB2  2  
ATOM   2250  H  HB3  . ARG A 1 72 ? 9.110   -4.864  7.185   1.00 0.00 ? 72  ARG A HB3  2  
ATOM   2251  H  HG2  . ARG A 1 72 ? 8.895   -2.783  8.745   1.00 0.00 ? 72  ARG A HG2  2  
ATOM   2252  H  HG3  . ARG A 1 72 ? 8.676   -1.918  7.223   1.00 0.00 ? 72  ARG A HG3  2  
ATOM   2253  H  HD2  . ARG A 1 72 ? 6.706   -3.015  6.730   1.00 0.00 ? 72  ARG A HD2  2  
ATOM   2254  H  HD3  . ARG A 1 72 ? 7.105   -4.402  7.742   1.00 0.00 ? 72  ARG A HD3  2  
ATOM   2255  H  HE   . ARG A 1 72 ? 5.861   -1.926  8.582   1.00 0.00 ? 72  ARG A HE   2  
ATOM   2256  H  HH11 . ARG A 1 72 ? 7.489   -4.851  9.539   1.00 0.00 ? 72  ARG A HH11 2  
ATOM   2257  H  HH12 . ARG A 1 72 ? 6.877   -4.816  11.160  1.00 0.00 ? 72  ARG A HH12 2  
ATOM   2258  H  HH21 . ARG A 1 72 ? 5.049   -1.869  10.713  1.00 0.00 ? 72  ARG A HH21 2  
ATOM   2259  H  HH22 . ARG A 1 72 ? 5.488   -3.120  11.826  1.00 0.00 ? 72  ARG A HH22 2  
ATOM   2260  N  N    . VAL A 1 73 ? 12.022  -5.194  5.815   1.00 0.00 ? 73  VAL A N    2  
ATOM   2261  C  CA   . VAL A 1 73 ? 12.724  -6.362  5.295   1.00 0.00 ? 73  VAL A CA   2  
ATOM   2262  C  C    . VAL A 1 73 ? 14.165  -6.402  5.790   1.00 0.00 ? 73  VAL A C    2  
ATOM   2263  O  O    . VAL A 1 73 ? 14.678  -7.460  6.153   1.00 0.00 ? 73  VAL A O    2  
ATOM   2264  C  CB   . VAL A 1 73 ? 12.720  -6.379  3.755   1.00 0.00 ? 73  VAL A CB   2  
ATOM   2265  C  CG1  . VAL A 1 73 ? 13.400  -5.134  3.206   1.00 0.00 ? 73  VAL A CG1  2  
ATOM   2266  C  CG2  . VAL A 1 73 ? 13.397  -7.638  3.235   1.00 0.00 ? 73  VAL A CG2  2  
ATOM   2267  H  H    . VAL A 1 73 ? 11.799  -4.460  5.206   1.00 0.00 ? 73  VAL A H    2  
ATOM   2268  H  HA   . VAL A 1 73 ? 12.208  -7.244  5.645   1.00 0.00 ? 73  VAL A HA   2  
ATOM   2269  H  HB   . VAL A 1 73 ? 11.694  -6.381  3.417   1.00 0.00 ? 73  VAL A HB   2  
ATOM   2270  H  HG11 . VAL A 1 73 ? 13.327  -5.130  2.128   1.00 0.00 ? 73  VAL A HG11 2  
ATOM   2271  H  HG12 . VAL A 1 73 ? 12.915  -4.254  3.603   1.00 0.00 ? 73  VAL A HG12 2  
ATOM   2272  H  HG13 . VAL A 1 73 ? 14.440  -5.134  3.495   1.00 0.00 ? 73  VAL A HG13 2  
ATOM   2273  H  HG21 . VAL A 1 73 ? 14.432  -7.426  3.016   1.00 0.00 ? 73  VAL A HG21 2  
ATOM   2274  H  HG22 . VAL A 1 73 ? 13.340  -8.414  3.985   1.00 0.00 ? 73  VAL A HG22 2  
ATOM   2275  H  HG23 . VAL A 1 73 ? 12.898  -7.970  2.337   1.00 0.00 ? 73  VAL A HG23 2  
ATOM   2276  N  N    . SER A 1 74 ? 14.814  -5.242  5.801   1.00 0.00 ? 74  SER A N    2  
ATOM   2277  C  CA   . SER A 1 74 ? 16.199  -5.145  6.248   1.00 0.00 ? 74  SER A CA   2  
ATOM   2278  C  C    . SER A 1 74 ? 16.286  -5.229  7.769   1.00 0.00 ? 74  SER A C    2  
ATOM   2279  O  O    . SER A 1 74 ? 15.367  -4.820  8.478   1.00 0.00 ? 74  SER A O    2  
ATOM   2280  C  CB   . SER A 1 74 ? 16.823  -3.835  5.762   1.00 0.00 ? 74  SER A CB   2  
ATOM   2281  O  OG   . SER A 1 74 ? 18.214  -3.803  6.030   1.00 0.00 ? 74  SER A OG   2  
ATOM   2282  H  H    . SER A 1 74 ? 14.351  -4.433  5.499   1.00 0.00 ? 74  SER A H    2  
ATOM   2283  H  HA   . SER A 1 74 ? 16.744  -5.973  5.822   1.00 0.00 ? 74  SER A HA   2  
ATOM   2284  H  HB2  . SER A 1 74 ? 16.671  -3.740  4.698   1.00 0.00 ? 74  SER A HB2  2  
ATOM   2285  H  HB3  . SER A 1 74 ? 16.351  -3.005  6.269   1.00 0.00 ? 74  SER A HB3  2  
ATOM   2286  H  HG   . SER A 1 74 ? 18.429  -4.467  6.690   1.00 0.00 ? 74  SER A HG   2  
ATOM   2287  N  N    . GLY A 1 75 ? 17.398  -5.763  8.264   1.00 0.00 ? 75  GLY A N    2  
ATOM   2288  C  CA   . GLY A 1 75 ? 17.586  -5.892  9.697   1.00 0.00 ? 75  GLY A CA   2  
ATOM   2289  C  C    . GLY A 1 75 ? 18.958  -6.428  10.056  1.00 0.00 ? 75  GLY A C    2  
ATOM   2290  O  O    . GLY A 1 75 ? 19.724  -6.859  9.194   1.00 0.00 ? 75  GLY A O    2  
ATOM   2291  H  H    . GLY A 1 75 ? 18.097  -6.072  7.650   1.00 0.00 ? 75  GLY A H    2  
ATOM   2292  H  HA2  . GLY A 1 75 ? 17.459  -4.922  10.154  1.00 0.00 ? 75  GLY A HA2  2  
ATOM   2293  H  HA3  . GLY A 1 75 ? 16.836  -6.564  10.087  1.00 0.00 ? 75  GLY A HA3  2  
ATOM   2294  N  N    . PRO A 1 76 ? 19.285  -6.404  11.356  1.00 0.00 ? 76  PRO A N    2  
ATOM   2295  C  CA   . PRO A 1 76 ? 20.575  -6.887  11.857  1.00 0.00 ? 76  PRO A CA   2  
ATOM   2296  C  C    . PRO A 1 76 ? 20.708  -8.403  11.751  1.00 0.00 ? 76  PRO A C    2  
ATOM   2297  O  O    . PRO A 1 76 ? 21.710  -8.979  12.174  1.00 0.00 ? 76  PRO A O    2  
ATOM   2298  C  CB   . PRO A 1 76 ? 20.571  -6.453  13.325  1.00 0.00 ? 76  PRO A CB   2  
ATOM   2299  C  CG   . PRO A 1 76 ? 19.129  -6.352  13.686  1.00 0.00 ? 76  PRO A CG   2  
ATOM   2300  C  CD   . PRO A 1 76 ? 18.420  -5.905  12.438  1.00 0.00 ? 76  PRO A CD   2  
ATOM   2301  H  HA   . PRO A 1 76 ? 21.401  -6.418  11.343  1.00 0.00 ? 76  PRO A HA   2  
ATOM   2302  H  HB2  . PRO A 1 76 ? 21.079  -7.195  13.924  1.00 0.00 ? 76  PRO A HB2  2  
ATOM   2303  H  HB3  . PRO A 1 76 ? 21.070  -5.500  13.423  1.00 0.00 ? 76  PRO A HB3  2  
ATOM   2304  H  HG2  . PRO A 1 76 ? 18.762  -7.317  14.002  1.00 0.00 ? 76  PRO A HG2  2  
ATOM   2305  H  HG3  . PRO A 1 76 ? 18.998  -5.624  14.473  1.00 0.00 ? 76  PRO A HG3  2  
ATOM   2306  H  HD2  . PRO A 1 76 ? 17.437  -6.350  12.383  1.00 0.00 ? 76  PRO A HD2  2  
ATOM   2307  H  HD3  . PRO A 1 76 ? 18.351  -4.827  12.409  1.00 0.00 ? 76  PRO A HD3  2  
ATOM   2308  N  N    . SER A 1 77 ? 19.691  -9.043  11.183  1.00 0.00 ? 77  SER A N    2  
ATOM   2309  C  CA   . SER A 1 77 ? 19.693  -10.492 11.024  1.00 0.00 ? 77  SER A CA   2  
ATOM   2310  C  C    . SER A 1 77 ? 20.488  -10.902 9.787   1.00 0.00 ? 77  SER A C    2  
ATOM   2311  O  O    . SER A 1 77 ? 20.701  -10.100 8.879   1.00 0.00 ? 77  SER A O    2  
ATOM   2312  C  CB   . SER A 1 77 ? 18.260  -11.017 10.920  1.00 0.00 ? 77  SER A CB   2  
ATOM   2313  O  OG   . SER A 1 77 ? 17.691  -10.702 9.661   1.00 0.00 ? 77  SER A OG   2  
ATOM   2314  H  H    . SER A 1 77 ? 18.920  -8.528  10.865  1.00 0.00 ? 77  SER A H    2  
ATOM   2315  H  HA   . SER A 1 77 ? 20.162  -10.921 11.897  1.00 0.00 ? 77  SER A HA   2  
ATOM   2316  H  HB2  . SER A 1 77 ? 18.262  -12.090 11.042  1.00 0.00 ? 77  SER A HB2  2  
ATOM   2317  H  HB3  . SER A 1 77 ? 17.658  -10.568 11.697  1.00 0.00 ? 77  SER A HB3  2  
ATOM   2318  H  HG   . SER A 1 77 ? 18.316  -10.184 9.148   1.00 0.00 ? 77  SER A HG   2  
ATOM   2319  N  N    . SER A 1 78 ? 20.923  -12.158 9.761   1.00 0.00 ? 78  SER A N    2  
ATOM   2320  C  CA   . SER A 1 78 ? 21.698  -12.675 8.639   1.00 0.00 ? 78  SER A CA   2  
ATOM   2321  C  C    . SER A 1 78 ? 20.825  -12.815 7.395   1.00 0.00 ? 78  SER A C    2  
ATOM   2322  O  O    . SER A 1 78 ? 19.599  -12.747 7.473   1.00 0.00 ? 78  SER A O    2  
ATOM   2323  C  CB   . SER A 1 78 ? 22.315  -14.028 8.998   1.00 0.00 ? 78  SER A CB   2  
ATOM   2324  O  OG   . SER A 1 78 ? 23.356  -13.877 9.947   1.00 0.00 ? 78  SER A OG   2  
ATOM   2325  H  H    . SER A 1 78 ? 20.721  -12.749 10.516  1.00 0.00 ? 78  SER A H    2  
ATOM   2326  H  HA   . SER A 1 78 ? 22.490  -11.971 8.431   1.00 0.00 ? 78  SER A HA   2  
ATOM   2327  H  HB2  . SER A 1 78 ? 21.553  -14.668 9.416   1.00 0.00 ? 78  SER A HB2  2  
ATOM   2328  H  HB3  . SER A 1 78 ? 22.719  -14.484 8.106   1.00 0.00 ? 78  SER A HB3  2  
ATOM   2329  H  HG   . SER A 1 78 ? 24.173  -13.657 9.494   1.00 0.00 ? 78  SER A HG   2  
ATOM   2330  N  N    . GLY A 1 79 ? 21.467  -13.011 6.248   1.00 0.00 ? 79  GLY A N    2  
ATOM   2331  C  CA   . GLY A 1 79 ? 20.735  -13.158 5.003   1.00 0.00 ? 79  GLY A CA   2  
ATOM   2332  C  C    . GLY A 1 79 ? 21.645  -13.148 3.791   1.00 0.00 ? 79  GLY A C    2  
ATOM   2333  O  O    . GLY A 1 79 ? 22.732  -13.721 3.853   1.00 0.00 ? 79  GLY A O    2  
ATOM   2334  H  H    . GLY A 1 79 ? 22.447  -13.057 6.247   1.00 0.00 ? 79  GLY A H    2  
ATOM   2335  H  HA2  . GLY A 1 79 ? 20.193  -14.091 5.026   1.00 0.00 ? 79  GLY A HA2  2  
ATOM   2336  H  HA3  . GLY A 1 79 ? 20.030  -12.345 4.916   1.00 0.00 ? 79  GLY A HA3  2  
HETATM 2337  ZN ZN   . ZN  B 2 .  ? -11.038 -0.202  2.693   1.00 0.00 ? 201 ZN  A ZN   2  
HETATM 2338  ZN ZN   . ZN  C 2 .  ? 4.787   3.759   6.043   1.00 0.00 ? 401 ZN  A ZN   2  
ATOM   2339  N  N    . GLY A 1 1  ? -36.887 -6.923  28.327  1.00 0.00 ? 1   GLY A N    3  
ATOM   2340  C  CA   . GLY A 1 1  ? -36.742 -8.063  27.442  1.00 0.00 ? 1   GLY A CA   3  
ATOM   2341  C  C    . GLY A 1 1  ? -35.948 -9.190  28.073  1.00 0.00 ? 1   GLY A C    3  
ATOM   2342  O  O    . GLY A 1 1  ? -34.842 -8.976  28.569  1.00 0.00 ? 1   GLY A O    3  
ATOM   2343  H  H1   . GLY A 1 1  ? -37.467 -6.176  28.069  1.00 0.00 ? 1   GLY A H1   3  
ATOM   2344  H  HA2  . GLY A 1 1  ? -37.723 -8.430  27.181  1.00 0.00 ? 1   GLY A HA2  3  
ATOM   2345  H  HA3  . GLY A 1 1  ? -36.238 -7.744  26.541  1.00 0.00 ? 1   GLY A HA3  3  
ATOM   2346  N  N    . SER A 1 2  ? -36.514 -10.392 28.056  1.00 0.00 ? 2   SER A N    3  
ATOM   2347  C  CA   . SER A 1 2  ? -35.854 -11.556 28.637  1.00 0.00 ? 2   SER A CA   3  
ATOM   2348  C  C    . SER A 1 2  ? -34.912 -12.206 27.628  1.00 0.00 ? 2   SER A C    3  
ATOM   2349  O  O    . SER A 1 2  ? -33.744 -12.458 27.925  1.00 0.00 ? 2   SER A O    3  
ATOM   2350  C  CB   . SER A 1 2  ? -36.892 -12.574 29.112  1.00 0.00 ? 2   SER A CB   3  
ATOM   2351  O  OG   . SER A 1 2  ? -36.317 -13.509 30.008  1.00 0.00 ? 2   SER A OG   3  
ATOM   2352  H  H    . SER A 1 2  ? -37.398 -10.499 27.646  1.00 0.00 ? 2   SER A H    3  
ATOM   2353  H  HA   . SER A 1 2  ? -35.277 -11.220 29.486  1.00 0.00 ? 2   SER A HA   3  
ATOM   2354  H  HB2  . SER A 1 2  ? -37.695 -12.057 29.615  1.00 0.00 ? 2   SER A HB2  3  
ATOM   2355  H  HB3  . SER A 1 2  ? -37.286 -13.106 28.258  1.00 0.00 ? 2   SER A HB3  3  
ATOM   2356  H  HG   . SER A 1 2  ? -35.851 -13.040 30.704  1.00 0.00 ? 2   SER A HG   3  
ATOM   2357  N  N    . SER A 1 3  ? -35.429 -12.474 26.433  1.00 0.00 ? 3   SER A N    3  
ATOM   2358  C  CA   . SER A 1 3  ? -34.637 -13.099 25.380  1.00 0.00 ? 3   SER A CA   3  
ATOM   2359  C  C    . SER A 1 3  ? -35.343 -12.989 24.032  1.00 0.00 ? 3   SER A C    3  
ATOM   2360  O  O    . SER A 1 3  ? -36.520 -12.640 23.961  1.00 0.00 ? 3   SER A O    3  
ATOM   2361  C  CB   . SER A 1 3  ? -34.375 -14.568 25.713  1.00 0.00 ? 3   SER A CB   3  
ATOM   2362  O  OG   . SER A 1 3  ? -33.530 -15.168 24.746  1.00 0.00 ? 3   SER A OG   3  
ATOM   2363  H  H    . SER A 1 3  ? -36.367 -12.249 26.257  1.00 0.00 ? 3   SER A H    3  
ATOM   2364  H  HA   . SER A 1 3  ? -33.693 -12.577 25.322  1.00 0.00 ? 3   SER A HA   3  
ATOM   2365  H  HB2  . SER A 1 3  ? -33.899 -14.636 26.680  1.00 0.00 ? 3   SER A HB2  3  
ATOM   2366  H  HB3  . SER A 1 3  ? -35.313 -15.103 25.735  1.00 0.00 ? 3   SER A HB3  3  
ATOM   2367  H  HG   . SER A 1 3  ? -33.510 -16.118 24.883  1.00 0.00 ? 3   SER A HG   3  
ATOM   2368  N  N    . GLY A 1 4  ? -34.613 -13.291 22.962  1.00 0.00 ? 4   GLY A N    3  
ATOM   2369  C  CA   . GLY A 1 4  ? -35.184 -13.220 21.630  1.00 0.00 ? 4   GLY A CA   3  
ATOM   2370  C  C    . GLY A 1 4  ? -34.126 -13.141 20.548  1.00 0.00 ? 4   GLY A C    3  
ATOM   2371  O  O    . GLY A 1 4  ? -32.956 -12.883 20.833  1.00 0.00 ? 4   GLY A O    3  
ATOM   2372  H  H    . GLY A 1 4  ? -33.678 -13.563 23.079  1.00 0.00 ? 4   GLY A H    3  
ATOM   2373  H  HA2  . GLY A 1 4  ? -35.790 -14.099 21.463  1.00 0.00 ? 4   GLY A HA2  3  
ATOM   2374  H  HA3  . GLY A 1 4  ? -35.814 -12.345 21.567  1.00 0.00 ? 4   GLY A HA3  3  
ATOM   2375  N  N    . SER A 1 5  ? -34.535 -13.364 19.304  1.00 0.00 ? 5   SER A N    3  
ATOM   2376  C  CA   . SER A 1 5  ? -33.612 -13.321 18.176  1.00 0.00 ? 5   SER A CA   3  
ATOM   2377  C  C    . SER A 1 5  ? -34.251 -12.628 16.977  1.00 0.00 ? 5   SER A C    3  
ATOM   2378  O  O    . SER A 1 5  ? -35.464 -12.694 16.781  1.00 0.00 ? 5   SER A O    3  
ATOM   2379  C  CB   . SER A 1 5  ? -33.180 -14.737 17.790  1.00 0.00 ? 5   SER A CB   3  
ATOM   2380  O  OG   . SER A 1 5  ? -34.264 -15.471 17.247  1.00 0.00 ? 5   SER A OG   3  
ATOM   2381  H  H    . SER A 1 5  ? -35.481 -13.565 19.141  1.00 0.00 ? 5   SER A H    3  
ATOM   2382  H  HA   . SER A 1 5  ? -32.742 -12.759 18.481  1.00 0.00 ? 5   SER A HA   3  
ATOM   2383  H  HB2  . SER A 1 5  ? -32.393 -14.683 17.053  1.00 0.00 ? 5   SER A HB2  3  
ATOM   2384  H  HB3  . SER A 1 5  ? -32.816 -15.252 18.667  1.00 0.00 ? 5   SER A HB3  3  
ATOM   2385  H  HG   . SER A 1 5  ? -34.558 -16.127 17.884  1.00 0.00 ? 5   SER A HG   3  
ATOM   2386  N  N    . SER A 1 6  ? -33.424 -11.962 16.177  1.00 0.00 ? 6   SER A N    3  
ATOM   2387  C  CA   . SER A 1 6  ? -33.908 -11.252 14.998  1.00 0.00 ? 6   SER A CA   3  
ATOM   2388  C  C    . SER A 1 6  ? -32.913 -11.369 13.847  1.00 0.00 ? 6   SER A C    3  
ATOM   2389  O  O    . SER A 1 6  ? -31.720 -11.582 14.062  1.00 0.00 ? 6   SER A O    3  
ATOM   2390  C  CB   . SER A 1 6  ? -34.151 -9.778  15.329  1.00 0.00 ? 6   SER A CB   3  
ATOM   2391  O  OG   . SER A 1 6  ? -34.973 -9.165  14.351  1.00 0.00 ? 6   SER A OG   3  
ATOM   2392  H  H    . SER A 1 6  ? -32.467 -11.946 16.386  1.00 0.00 ? 6   SER A H    3  
ATOM   2393  H  HA   . SER A 1 6  ? -34.841 -11.704 14.699  1.00 0.00 ? 6   SER A HA   3  
ATOM   2394  H  HB2  . SER A 1 6  ? -34.638 -9.703  16.289  1.00 0.00 ? 6   SER A HB2  3  
ATOM   2395  H  HB3  . SER A 1 6  ? -33.204 -9.259  15.363  1.00 0.00 ? 6   SER A HB3  3  
ATOM   2396  H  HG   . SER A 1 6  ? -35.486 -9.838  13.896  1.00 0.00 ? 6   SER A HG   3  
ATOM   2397  N  N    . GLY A 1 7  ? -33.413 -11.228 12.624  1.00 0.00 ? 7   GLY A N    3  
ATOM   2398  C  CA   . GLY A 1 7  ? -32.557 -11.321 11.456  1.00 0.00 ? 7   GLY A CA   3  
ATOM   2399  C  C    . GLY A 1 7  ? -33.145 -10.621 10.247  1.00 0.00 ? 7   GLY A C    3  
ATOM   2400  O  O    . GLY A 1 7  ? -34.227 -10.038 10.325  1.00 0.00 ? 7   GLY A O    3  
ATOM   2401  H  H    . GLY A 1 7  ? -34.373 -11.059 12.513  1.00 0.00 ? 7   GLY A H    3  
ATOM   2402  H  HA2  . GLY A 1 7  ? -31.601 -10.875 11.688  1.00 0.00 ? 7   GLY A HA2  3  
ATOM   2403  H  HA3  . GLY A 1 7  ? -32.407 -12.364 11.216  1.00 0.00 ? 7   GLY A HA3  3  
ATOM   2404  N  N    . SER A 1 8  ? -32.432 -10.677 9.127   1.00 0.00 ? 8   SER A N    3  
ATOM   2405  C  CA   . SER A 1 8  ? -32.887 -10.038 7.898   1.00 0.00 ? 8   SER A CA   3  
ATOM   2406  C  C    . SER A 1 8  ? -33.263 -11.082 6.851   1.00 0.00 ? 8   SER A C    3  
ATOM   2407  O  O    . SER A 1 8  ? -32.897 -12.252 6.965   1.00 0.00 ? 8   SER A O    3  
ATOM   2408  C  CB   . SER A 1 8  ? -31.801 -9.113  7.346   1.00 0.00 ? 8   SER A CB   3  
ATOM   2409  O  OG   . SER A 1 8  ? -32.284 -8.357  6.250   1.00 0.00 ? 8   SER A OG   3  
ATOM   2410  H  H    . SER A 1 8  ? -31.577 -11.157 9.129   1.00 0.00 ? 8   SER A H    3  
ATOM   2411  H  HA   . SER A 1 8  ? -33.762 -9.451  8.134   1.00 0.00 ? 8   SER A HA   3  
ATOM   2412  H  HB2  . SER A 1 8  ? -31.480 -8.435  8.122   1.00 0.00 ? 8   SER A HB2  3  
ATOM   2413  H  HB3  . SER A 1 8  ? -30.960 -9.707  7.016   1.00 0.00 ? 8   SER A HB3  3  
ATOM   2414  H  HG   . SER A 1 8  ? -32.799 -7.614  6.575   1.00 0.00 ? 8   SER A HG   3  
ATOM   2415  N  N    . ILE A 1 9  ? -33.996 -10.650 5.831   1.00 0.00 ? 9   ILE A N    3  
ATOM   2416  C  CA   . ILE A 1 9  ? -34.421 -11.545 4.762   1.00 0.00 ? 9   ILE A CA   3  
ATOM   2417  C  C    . ILE A 1 9  ? -34.270 -10.883 3.397   1.00 0.00 ? 9   ILE A C    3  
ATOM   2418  O  O    . ILE A 1 9  ? -34.970 -9.922  3.080   1.00 0.00 ? 9   ILE A O    3  
ATOM   2419  C  CB   . ILE A 1 9  ? -35.885 -11.987 4.947   1.00 0.00 ? 9   ILE A CB   3  
ATOM   2420  C  CG1  . ILE A 1 9  ? -36.061 -12.695 6.292   1.00 0.00 ? 9   ILE A CG1  3  
ATOM   2421  C  CG2  . ILE A 1 9  ? -36.312 -12.896 3.804   1.00 0.00 ? 9   ILE A CG2  3  
ATOM   2422  C  CD1  . ILE A 1 9  ? -37.499 -12.762 6.756   1.00 0.00 ? 9   ILE A CD1  3  
ATOM   2423  H  H    . ILE A 1 9  ? -34.257 -9.706  5.795   1.00 0.00 ? 9   ILE A H    3  
ATOM   2424  H  HA   . ILE A 1 9  ? -33.794 -12.424 4.795   1.00 0.00 ? 9   ILE A HA   3  
ATOM   2425  H  HB   . ILE A 1 9  ? -36.509 -11.107 4.927   1.00 0.00 ? 9   ILE A HB   3  
ATOM   2426  H  HG12 . ILE A 1 9  ? -35.692 -13.705 6.211   1.00 0.00 ? 9   ILE A HG12 3  
ATOM   2427  H  HG13 . ILE A 1 9  ? -35.493 -12.168 7.044   1.00 0.00 ? 9   ILE A HG13 3  
ATOM   2428  H  HG21 . ILE A 1 9  ? -36.938 -13.688 4.188   1.00 0.00 ? 9   ILE A HG21 3  
ATOM   2429  H  HG22 . ILE A 1 9  ? -36.865 -12.322 3.075   1.00 0.00 ? 9   ILE A HG22 3  
ATOM   2430  H  HG23 . ILE A 1 9  ? -35.437 -13.324 3.337   1.00 0.00 ? 9   ILE A HG23 3  
ATOM   2431  H  HD11 . ILE A 1 9  ? -38.128 -13.077 5.936   1.00 0.00 ? 9   ILE A HD11 3  
ATOM   2432  H  HD12 . ILE A 1 9  ? -37.584 -13.467 7.568   1.00 0.00 ? 9   ILE A HD12 3  
ATOM   2433  H  HD13 . ILE A 1 9  ? -37.814 -11.784 7.094   1.00 0.00 ? 9   ILE A HD13 3  
ATOM   2434  N  N    . GLY A 1 10 ? -33.351 -11.405 2.590   1.00 0.00 ? 10  GLY A N    3  
ATOM   2435  C  CA   . GLY A 1 10 ? -33.126 -10.853 1.267   1.00 0.00 ? 10  GLY A CA   3  
ATOM   2436  C  C    . GLY A 1 10 ? -31.735 -11.152 0.743   1.00 0.00 ? 10  GLY A C    3  
ATOM   2437  O  O    . GLY A 1 10 ? -30.748 -10.991 1.460   1.00 0.00 ? 10  GLY A O    3  
ATOM   2438  H  H    . GLY A 1 10 ? -32.822 -12.172 2.896   1.00 0.00 ? 10  GLY A H    3  
ATOM   2439  H  HA2  . GLY A 1 10 ? -33.853 -11.271 0.586   1.00 0.00 ? 10  GLY A HA2  3  
ATOM   2440  H  HA3  . GLY A 1 10 ? -33.260 -9.782  1.309   1.00 0.00 ? 10  GLY A HA3  3  
ATOM   2441  N  N    . ASN A 1 11 ? -31.657 -11.589 -0.509  1.00 0.00 ? 11  ASN A N    3  
ATOM   2442  C  CA   . ASN A 1 11 ? -30.376 -11.913 -1.127  1.00 0.00 ? 11  ASN A CA   3  
ATOM   2443  C  C    . ASN A 1 11 ? -29.505 -10.668 -1.258  1.00 0.00 ? 11  ASN A C    3  
ATOM   2444  O  O    . ASN A 1 11 ? -30.009 -9.562  -1.453  1.00 0.00 ? 11  ASN A O    3  
ATOM   2445  C  CB   . ASN A 1 11 ? -30.596 -12.543 -2.504  1.00 0.00 ? 11  ASN A CB   3  
ATOM   2446  C  CG   . ASN A 1 11 ? -31.477 -11.689 -3.396  1.00 0.00 ? 11  ASN A CG   3  
ATOM   2447  O  OD1  . ASN A 1 11 ? -32.093 -10.726 -2.940  1.00 0.00 ? 11  ASN A OD1  3  
ATOM   2448  N  ND2  . ASN A 1 11 ? -31.540 -12.040 -4.676  1.00 0.00 ? 11  ASN A ND2  3  
ATOM   2449  H  H    . ASN A 1 11 ? -32.480 -11.697 -1.030  1.00 0.00 ? 11  ASN A H    3  
ATOM   2450  H  HA   . ASN A 1 11 ? -29.873 -12.626 -0.492  1.00 0.00 ? 11  ASN A HA   3  
ATOM   2451  H  HB2  . ASN A 1 11 ? -29.640 -12.670 -2.992  1.00 0.00 ? 11  ASN A HB2  3  
ATOM   2452  H  HB3  . ASN A 1 11 ? -31.065 -13.507 -2.383  1.00 0.00 ? 11  ASN A HB3  3  
ATOM   2453  H  HD21 . ASN A 1 11 ? -31.022 -12.819 -4.968  1.00 0.00 ? 11  ASN A HD21 3  
ATOM   2454  H  HD22 . ASN A 1 11 ? -32.102 -11.506 -5.275  1.00 0.00 ? 11  ASN A HD22 3  
ATOM   2455  N  N    . ALA A 1 12 ? -28.194 -10.856 -1.151  1.00 0.00 ? 12  ALA A N    3  
ATOM   2456  C  CA   . ALA A 1 12 ? -27.252 -9.749  -1.260  1.00 0.00 ? 12  ALA A CA   3  
ATOM   2457  C  C    . ALA A 1 12 ? -26.027 -10.148 -2.076  1.00 0.00 ? 12  ALA A C    3  
ATOM   2458  O  O    . ALA A 1 12 ? -25.466 -11.226 -1.882  1.00 0.00 ? 12  ALA A O    3  
ATOM   2459  C  CB   . ALA A 1 12 ? -26.834 -9.273  0.124   1.00 0.00 ? 12  ALA A CB   3  
ATOM   2460  H  H    . ALA A 1 12 ? -27.852 -11.761 -0.996  1.00 0.00 ? 12  ALA A H    3  
ATOM   2461  H  HA   . ALA A 1 12 ? -27.753 -8.931  -1.758  1.00 0.00 ? 12  ALA A HA   3  
ATOM   2462  H  HB1  . ALA A 1 12 ? -25.826 -9.605  0.329   1.00 0.00 ? 12  ALA A HB1  3  
ATOM   2463  H  HB2  . ALA A 1 12 ? -26.872 -8.195  0.160   1.00 0.00 ? 12  ALA A HB2  3  
ATOM   2464  H  HB3  . ALA A 1 12 ? -27.506 -9.683  0.863   1.00 0.00 ? 12  ALA A HB3  3  
ATOM   2465  N  N    . GLN A 1 13 ? -25.620 -9.273  -2.989  1.00 0.00 ? 13  GLN A N    3  
ATOM   2466  C  CA   . GLN A 1 13 ? -24.462 -9.536  -3.836  1.00 0.00 ? 13  GLN A CA   3  
ATOM   2467  C  C    . GLN A 1 13 ? -23.184 -9.603  -3.006  1.00 0.00 ? 13  GLN A C    3  
ATOM   2468  O  O    . GLN A 1 13 ? -23.095 -9.003  -1.934  1.00 0.00 ? 13  GLN A O    3  
ATOM   2469  C  CB   . GLN A 1 13 ? -24.331 -8.454  -4.909  1.00 0.00 ? 13  GLN A CB   3  
ATOM   2470  C  CG   . GLN A 1 13 ? -25.483 -8.439  -5.901  1.00 0.00 ? 13  GLN A CG   3  
ATOM   2471  C  CD   . GLN A 1 13 ? -25.516 -9.676  -6.776  1.00 0.00 ? 13  GLN A CD   3  
ATOM   2472  O  OE1  . GLN A 1 13 ? -24.982 -9.680  -7.886  1.00 0.00 ? 13  GLN A OE1  3  
ATOM   2473  N  NE2  . GLN A 1 13 ? -26.145 -10.735 -6.281  1.00 0.00 ? 13  GLN A NE2  3  
ATOM   2474  H  H    . GLN A 1 13 ? -26.109 -8.431  -3.097  1.00 0.00 ? 13  GLN A H    3  
ATOM   2475  H  HA   . GLN A 1 13 ? -24.614 -10.491 -4.317  1.00 0.00 ? 13  GLN A HA   3  
ATOM   2476  H  HB2  . GLN A 1 13 ? -24.287 -7.489  -4.427  1.00 0.00 ? 13  GLN A HB2  3  
ATOM   2477  H  HB3  . GLN A 1 13 ? -23.415 -8.616  -5.457  1.00 0.00 ? 13  GLN A HB3  3  
ATOM   2478  H  HG2  . GLN A 1 13 ? -26.412 -8.379  -5.354  1.00 0.00 ? 13  GLN A HG2  3  
ATOM   2479  H  HG3  . GLN A 1 13 ? -25.384 -7.570  -6.535  1.00 0.00 ? 13  GLN A HG3  3  
ATOM   2480  H  HE21 . GLN A 1 13 ? -26.549 -10.659 -5.390  1.00 0.00 ? 13  GLN A HE21 3  
ATOM   2481  H  HE22 . GLN A 1 13 ? -26.183 -11.548 -6.825  1.00 0.00 ? 13  GLN A HE22 3  
ATOM   2482  N  N    . LYS A 1 14 ? -22.196 -10.336 -3.507  1.00 0.00 ? 14  LYS A N    3  
ATOM   2483  C  CA   . LYS A 1 14 ? -20.922 -10.481 -2.813  1.00 0.00 ? 14  LYS A CA   3  
ATOM   2484  C  C    . LYS A 1 14 ? -19.958 -9.367  -3.207  1.00 0.00 ? 14  LYS A C    3  
ATOM   2485  O  O    . LYS A 1 14 ? -20.046 -8.815  -4.305  1.00 0.00 ? 14  LYS A O    3  
ATOM   2486  C  CB   . LYS A 1 14 ? -20.299 -11.843 -3.127  1.00 0.00 ? 14  LYS A CB   3  
ATOM   2487  C  CG   . LYS A 1 14 ? -19.884 -12.002 -4.580  1.00 0.00 ? 14  LYS A CG   3  
ATOM   2488  C  CD   . LYS A 1 14 ? -18.794 -13.049 -4.737  1.00 0.00 ? 14  LYS A CD   3  
ATOM   2489  C  CE   . LYS A 1 14 ? -17.408 -12.431 -4.630  1.00 0.00 ? 14  LYS A CE   3  
ATOM   2490  N  NZ   . LYS A 1 14 ? -16.905 -12.435 -3.229  1.00 0.00 ? 14  LYS A NZ   3  
ATOM   2491  H  H    . LYS A 1 14 ? -22.327 -10.791 -4.366  1.00 0.00 ? 14  LYS A H    3  
ATOM   2492  H  HA   . LYS A 1 14 ? -21.113 -10.418 -1.753  1.00 0.00 ? 14  LYS A HA   3  
ATOM   2493  H  HB2  . LYS A 1 14 ? -19.425 -11.977 -2.508  1.00 0.00 ? 14  LYS A HB2  3  
ATOM   2494  H  HB3  . LYS A 1 14 ? -21.017 -12.616 -2.894  1.00 0.00 ? 14  LYS A HB3  3  
ATOM   2495  H  HG2  . LYS A 1 14 ? -20.743 -12.303 -5.160  1.00 0.00 ? 14  LYS A HG2  3  
ATOM   2496  H  HG3  . LYS A 1 14 ? -19.515 -11.054 -4.945  1.00 0.00 ? 14  LYS A HG3  3  
ATOM   2497  H  HD2  . LYS A 1 14 ? -18.905 -13.791 -3.960  1.00 0.00 ? 14  LYS A HD2  3  
ATOM   2498  H  HD3  . LYS A 1 14 ? -18.895 -13.520 -5.704  1.00 0.00 ? 14  LYS A HD3  3  
ATOM   2499  H  HE2  . LYS A 1 14 ? -16.728 -12.996 -5.249  1.00 0.00 ? 14  LYS A HE2  3  
ATOM   2500  H  HE3  . LYS A 1 14 ? -17.454 -11.412 -4.985  1.00 0.00 ? 14  LYS A HE3  3  
ATOM   2501  H  HZ1  . LYS A 1 14 ? -16.885 -11.464 -2.854  1.00 0.00 ? 14  LYS A HZ1  3  
ATOM   2502  H  HZ2  . LYS A 1 14 ? -15.943 -12.827 -3.195  1.00 0.00 ? 14  LYS A HZ2  3  
ATOM   2503  H  HZ3  . LYS A 1 14 ? -17.525 -13.014 -2.628  1.00 0.00 ? 14  LYS A HZ3  3  
ATOM   2504  N  N    . LEU A 1 15 ? -19.038 -9.041  -2.306  1.00 0.00 ? 15  LEU A N    3  
ATOM   2505  C  CA   . LEU A 1 15 ? -18.056 -7.992  -2.560  1.00 0.00 ? 15  LEU A CA   3  
ATOM   2506  C  C    . LEU A 1 15 ? -16.739 -8.297  -1.853  1.00 0.00 ? 15  LEU A C    3  
ATOM   2507  O  O    . LEU A 1 15 ? -16.708 -8.901  -0.781  1.00 0.00 ? 15  LEU A O    3  
ATOM   2508  C  CB   . LEU A 1 15 ? -18.595 -6.638  -2.098  1.00 0.00 ? 15  LEU A CB   3  
ATOM   2509  C  CG   . LEU A 1 15 ? -19.994 -6.268  -2.592  1.00 0.00 ? 15  LEU A CG   3  
ATOM   2510  C  CD1  . LEU A 1 15 ? -20.581 -5.149  -1.746  1.00 0.00 ? 15  LEU A CD1  3  
ATOM   2511  C  CD2  . LEU A 1 15 ? -19.953 -5.865  -4.059  1.00 0.00 ? 15  LEU A CD2  3  
ATOM   2512  H  H    . LEU A 1 15 ? -19.018 -9.515  -1.449  1.00 0.00 ? 15  LEU A H    3  
ATOM   2513  H  HA   . LEU A 1 15 ? -17.879 -7.956  -3.625  1.00 0.00 ? 15  LEU A HA   3  
ATOM   2514  H  HB2  . LEU A 1 15 ? -18.616 -6.641  -1.019  1.00 0.00 ? 15  LEU A HB2  3  
ATOM   2515  H  HB3  . LEU A 1 15 ? -17.910 -5.875  -2.440  1.00 0.00 ? 15  LEU A HB3  3  
ATOM   2516  H  HG   . LEU A 1 15 ? -20.641 -7.130  -2.499  1.00 0.00 ? 15  LEU A HG   3  
ATOM   2517  H  HD11 . LEU A 1 15 ? -20.770 -5.513  -0.748  1.00 0.00 ? 15  LEU A HD11 3  
ATOM   2518  H  HD12 . LEU A 1 15 ? -21.507 -4.811  -2.188  1.00 0.00 ? 15  LEU A HD12 3  
ATOM   2519  H  HD13 . LEU A 1 15 ? -19.882 -4.326  -1.703  1.00 0.00 ? 15  LEU A HD13 3  
ATOM   2520  H  HD21 . LEU A 1 15 ? -19.827 -4.795  -4.134  1.00 0.00 ? 15  LEU A HD21 3  
ATOM   2521  H  HD22 . LEU A 1 15 ? -20.877 -6.153  -4.538  1.00 0.00 ? 15  LEU A HD22 3  
ATOM   2522  H  HD23 . LEU A 1 15 ? -19.125 -6.361  -4.545  1.00 0.00 ? 15  LEU A HD23 3  
ATOM   2523  N  N    . PRO A 1 16 ? -15.626 -7.867  -2.464  1.00 0.00 ? 16  PRO A N    3  
ATOM   2524  C  CA   . PRO A 1 16 ? -14.286 -8.080  -1.909  1.00 0.00 ? 16  PRO A CA   3  
ATOM   2525  C  C    . PRO A 1 16 ? -14.037 -7.246  -0.657  1.00 0.00 ? 16  PRO A C    3  
ATOM   2526  O  O    . PRO A 1 16 ? -13.773 -6.047  -0.741  1.00 0.00 ? 16  PRO A O    3  
ATOM   2527  C  CB   . PRO A 1 16 ? -13.358 -7.633  -3.042  1.00 0.00 ? 16  PRO A CB   3  
ATOM   2528  C  CG   . PRO A 1 16 ? -14.165 -6.664  -3.833  1.00 0.00 ? 16  PRO A CG   3  
ATOM   2529  C  CD   . PRO A 1 16 ? -15.589 -7.140  -3.744  1.00 0.00 ? 16  PRO A CD   3  
ATOM   2530  H  HA   . PRO A 1 16 ? -14.109 -9.122  -1.687  1.00 0.00 ? 16  PRO A HA   3  
ATOM   2531  H  HB2  . PRO A 1 16 ? -12.476 -7.167  -2.625  1.00 0.00 ? 16  PRO A HB2  3  
ATOM   2532  H  HB3  . PRO A 1 16 ? -13.073 -8.488  -3.637  1.00 0.00 ? 16  PRO A HB3  3  
ATOM   2533  H  HG2  . PRO A 1 16 ? -14.073 -5.676  -3.408  1.00 0.00 ? 16  PRO A HG2  3  
ATOM   2534  H  HG3  . PRO A 1 16 ? -13.834 -6.663  -4.861  1.00 0.00 ? 16  PRO A HG3  3  
ATOM   2535  H  HD2  . PRO A 1 16 ? -16.268 -6.300  -3.731  1.00 0.00 ? 16  PRO A HD2  3  
ATOM   2536  H  HD3  . PRO A 1 16 ? -15.818 -7.800  -4.568  1.00 0.00 ? 16  PRO A HD3  3  
ATOM   2537  N  N    . MET A 1 17 ? -14.125 -7.888  0.503   1.00 0.00 ? 17  MET A N    3  
ATOM   2538  C  CA   . MET A 1 17 ? -13.908 -7.204  1.773   1.00 0.00 ? 17  MET A CA   3  
ATOM   2539  C  C    . MET A 1 17 ? -12.485 -6.661  1.861   1.00 0.00 ? 17  MET A C    3  
ATOM   2540  O  O    . MET A 1 17 ? -11.517 -7.385  1.625   1.00 0.00 ? 17  MET A O    3  
ATOM   2541  C  CB   . MET A 1 17 ? -14.176 -8.155  2.941   1.00 0.00 ? 17  MET A CB   3  
ATOM   2542  C  CG   . MET A 1 17 ? -15.618 -8.133  3.423   1.00 0.00 ? 17  MET A CG   3  
ATOM   2543  S  SD   . MET A 1 17 ? -15.934 -9.342  4.722   1.00 0.00 ? 17  MET A SD   3  
ATOM   2544  C  CE   . MET A 1 17 ? -16.342 -8.266  6.095   1.00 0.00 ? 17  MET A CE   3  
ATOM   2545  H  H    . MET A 1 17 ? -14.339 -8.844  0.506   1.00 0.00 ? 17  MET A H    3  
ATOM   2546  H  HA   . MET A 1 17 ? -14.600 -6.378  1.826   1.00 0.00 ? 17  MET A HA   3  
ATOM   2547  H  HB2  . MET A 1 17 ? -13.938 -9.162  2.632   1.00 0.00 ? 17  MET A HB2  3  
ATOM   2548  H  HB3  . MET A 1 17 ? -13.539 -7.880  3.768   1.00 0.00 ? 17  MET A HB3  3  
ATOM   2549  H  HG2  . MET A 1 17 ? -15.840 -7.148  3.807   1.00 0.00 ? 17  MET A HG2  3  
ATOM   2550  H  HG3  . MET A 1 17 ? -16.266 -8.345  2.586   1.00 0.00 ? 17  MET A HG3  3  
ATOM   2551  H  HE1  . MET A 1 17 ? -16.307 -7.237  5.769   1.00 0.00 ? 17  MET A HE1  3  
ATOM   2552  H  HE2  . MET A 1 17 ? -17.335 -8.498  6.451   1.00 0.00 ? 17  MET A HE2  3  
ATOM   2553  H  HE3  . MET A 1 17 ? -15.629 -8.415  6.893   1.00 0.00 ? 17  MET A HE3  3  
ATOM   2554  N  N    . CYS A 1 18 ? -12.365 -5.382  2.202   1.00 0.00 ? 18  CYS A N    3  
ATOM   2555  C  CA   . CYS A 1 18 ? -11.061 -4.741  2.321   1.00 0.00 ? 18  CYS A CA   3  
ATOM   2556  C  C    . CYS A 1 18 ? -10.168 -5.502  3.296   1.00 0.00 ? 18  CYS A C    3  
ATOM   2557  O  O    . CYS A 1 18 ? -10.654 -6.241  4.153   1.00 0.00 ? 18  CYS A O    3  
ATOM   2558  C  CB   . CYS A 1 18 ? -11.223 -3.292  2.786   1.00 0.00 ? 18  CYS A CB   3  
ATOM   2559  S  SG   . CYS A 1 18 ? -9.648  -2.402  3.005   1.00 0.00 ? 18  CYS A SG   3  
ATOM   2560  H  H    . CYS A 1 18 ? -13.174 -4.856  2.378   1.00 0.00 ? 18  CYS A H    3  
ATOM   2561  H  HA   . CYS A 1 18 ? -10.598 -4.748  1.347   1.00 0.00 ? 18  CYS A HA   3  
ATOM   2562  H  HB2  . CYS A 1 18 ? -11.806 -2.751  2.055   1.00 0.00 ? 18  CYS A HB2  3  
ATOM   2563  H  HB3  . CYS A 1 18 ? -11.742 -3.281  3.732   1.00 0.00 ? 18  CYS A HB3  3  
ATOM   2564  N  N    . ASP A 1 19 ? -8.859  -5.316  3.160   1.00 0.00 ? 19  ASP A N    3  
ATOM   2565  C  CA   . ASP A 1 19 ? -7.897  -5.984  4.029   1.00 0.00 ? 19  ASP A CA   3  
ATOM   2566  C  C    . ASP A 1 19 ? -7.366  -5.025  5.089   1.00 0.00 ? 19  ASP A C    3  
ATOM   2567  O  O    . ASP A 1 19 ? -7.078  -5.427  6.217   1.00 0.00 ? 19  ASP A O    3  
ATOM   2568  C  CB   . ASP A 1 19 ? -6.737  -6.545  3.204   1.00 0.00 ? 19  ASP A CB   3  
ATOM   2569  C  CG   . ASP A 1 19 ? -5.758  -7.338  4.048   1.00 0.00 ? 19  ASP A CG   3  
ATOM   2570  O  OD1  . ASP A 1 19 ? -6.168  -7.846  5.112   1.00 0.00 ? 19  ASP A OD1  3  
ATOM   2571  O  OD2  . ASP A 1 19 ? -4.582  -7.450  3.644   1.00 0.00 ? 19  ASP A OD2  3  
ATOM   2572  H  H    . ASP A 1 19 ? -8.533  -4.715  2.458   1.00 0.00 ? 19  ASP A H    3  
ATOM   2573  H  HA   . ASP A 1 19 ? -8.405  -6.800  4.521   1.00 0.00 ? 19  ASP A HA   3  
ATOM   2574  H  HB2  . ASP A 1 19 ? -7.131  -7.196  2.437   1.00 0.00 ? 19  ASP A HB2  3  
ATOM   2575  H  HB3  . ASP A 1 19 ? -6.206  -5.728  2.740   1.00 0.00 ? 19  ASP A HB3  3  
ATOM   2576  N  N    . LYS A 1 20 ? -7.238  -3.755  4.721   1.00 0.00 ? 20  LYS A N    3  
ATOM   2577  C  CA   . LYS A 1 20 ? -6.742  -2.737  5.640   1.00 0.00 ? 20  LYS A CA   3  
ATOM   2578  C  C    . LYS A 1 20 ? -7.735  -2.496  6.772   1.00 0.00 ? 20  LYS A C    3  
ATOM   2579  O  O    . LYS A 1 20 ? -7.433  -2.744  7.940   1.00 0.00 ? 20  LYS A O    3  
ATOM   2580  C  CB   . LYS A 1 20 ? -6.479  -1.429  4.891   1.00 0.00 ? 20  LYS A CB   3  
ATOM   2581  C  CG   . LYS A 1 20 ? -5.823  -0.360  5.746   1.00 0.00 ? 20  LYS A CG   3  
ATOM   2582  C  CD   . LYS A 1 20 ? -6.847  0.615   6.303   1.00 0.00 ? 20  LYS A CD   3  
ATOM   2583  C  CE   . LYS A 1 20 ? -6.178  1.830   6.927   1.00 0.00 ? 20  LYS A CE   3  
ATOM   2584  N  NZ   . LYS A 1 20 ? -5.794  1.585   8.345   1.00 0.00 ? 20  LYS A NZ   3  
ATOM   2585  H  H    . LYS A 1 20 ? -7.484  -3.495  3.808   1.00 0.00 ? 20  LYS A H    3  
ATOM   2586  H  HA   . LYS A 1 20 ? -5.814  -3.094  6.060   1.00 0.00 ? 20  LYS A HA   3  
ATOM   2587  H  HB2  . LYS A 1 20 ? -5.834  -1.634  4.049   1.00 0.00 ? 20  LYS A HB2  3  
ATOM   2588  H  HB3  . LYS A 1 20 ? -7.420  -1.042  4.526   1.00 0.00 ? 20  LYS A HB3  3  
ATOM   2589  H  HG2  . LYS A 1 20 ? -5.309  -0.834  6.569   1.00 0.00 ? 20  LYS A HG2  3  
ATOM   2590  H  HG3  . LYS A 1 20 ? -5.112  0.186   5.142   1.00 0.00 ? 20  LYS A HG3  3  
ATOM   2591  H  HD2  . LYS A 1 20 ? -7.491  0.945   5.502   1.00 0.00 ? 20  LYS A HD2  3  
ATOM   2592  H  HD3  . LYS A 1 20 ? -7.436  0.112   7.057   1.00 0.00 ? 20  LYS A HD3  3  
ATOM   2593  H  HE2  . LYS A 1 20 ? -5.292  2.068   6.360   1.00 0.00 ? 20  LYS A HE2  3  
ATOM   2594  H  HE3  . LYS A 1 20 ? -6.865  2.663   6.888   1.00 0.00 ? 20  LYS A HE3  3  
ATOM   2595  H  HZ1  . LYS A 1 20 ? -5.501  0.595   8.470   1.00 0.00 ? 20  LYS A HZ1  3  
ATOM   2596  H  HZ2  . LYS A 1 20 ? -6.601  1.777   8.972   1.00 0.00 ? 20  LYS A HZ2  3  
ATOM   2597  H  HZ3  . LYS A 1 20 ? -5.004  2.205   8.614   1.00 0.00 ? 20  LYS A HZ3  3  
ATOM   2598  N  N    . CYS A 1 21 ? -8.922  -2.013  6.420   1.00 0.00 ? 21  CYS A N    3  
ATOM   2599  C  CA   . CYS A 1 21 ? -9.960  -1.739  7.406   1.00 0.00 ? 21  CYS A CA   3  
ATOM   2600  C  C    . CYS A 1 21 ? -10.843 -2.965  7.621   1.00 0.00 ? 21  CYS A C    3  
ATOM   2601  O  O    . CYS A 1 21 ? -11.059 -3.397  8.752   1.00 0.00 ? 21  CYS A O    3  
ATOM   2602  C  CB   . CYS A 1 21 ? -10.816 -0.553  6.959   1.00 0.00 ? 21  CYS A CB   3  
ATOM   2603  S  SG   . CYS A 1 21 ? -11.417 -0.673  5.244   1.00 0.00 ? 21  CYS A SG   3  
ATOM   2604  H  H    . CYS A 1 21 ? -9.104  -1.835  5.472   1.00 0.00 ? 21  CYS A H    3  
ATOM   2605  H  HA   . CYS A 1 21 ? -9.476  -1.492  8.338   1.00 0.00 ? 21  CYS A HA   3  
ATOM   2606  H  HB2  . CYS A 1 21 ? -11.680 -0.479  7.605   1.00 0.00 ? 21  CYS A HB2  3  
ATOM   2607  H  HB3  . CYS A 1 21 ? -10.234 0.353   7.042   1.00 0.00 ? 21  CYS A HB3  3  
ATOM   2608  N  N    . GLY A 1 22 ? -11.350 -3.522  6.525   1.00 0.00 ? 22  GLY A N    3  
ATOM   2609  C  CA   . GLY A 1 22 ? -12.203 -4.693  6.614   1.00 0.00 ? 22  GLY A CA   3  
ATOM   2610  C  C    . GLY A 1 22 ? -13.666 -4.362  6.397   1.00 0.00 ? 22  GLY A C    3  
ATOM   2611  O  O    . GLY A 1 22 ? -14.467 -4.410  7.332   1.00 0.00 ? 22  GLY A O    3  
ATOM   2612  H  H    . GLY A 1 22 ? -11.143 -3.135  5.648   1.00 0.00 ? 22  GLY A H    3  
ATOM   2613  H  HA2  . GLY A 1 22 ? -11.892 -5.409  5.868   1.00 0.00 ? 22  GLY A HA2  3  
ATOM   2614  H  HA3  . GLY A 1 22 ? -12.087 -5.135  7.593   1.00 0.00 ? 22  GLY A HA3  3  
ATOM   2615  N  N    . THR A 1 23 ? -14.018 -4.023  5.161   1.00 0.00 ? 23  THR A N    3  
ATOM   2616  C  CA   . THR A 1 23 ? -15.394 -3.680  4.825   1.00 0.00 ? 23  THR A CA   3  
ATOM   2617  C  C    . THR A 1 23 ? -15.676 -3.924  3.347   1.00 0.00 ? 23  THR A C    3  
ATOM   2618  O  O    . THR A 1 23 ? -14.891 -3.536  2.483   1.00 0.00 ? 23  THR A O    3  
ATOM   2619  C  CB   . THR A 1 23 ? -15.703 -2.208  5.159   1.00 0.00 ? 23  THR A CB   3  
ATOM   2620  O  OG1  . THR A 1 23 ? -14.831 -1.344  4.421   1.00 0.00 ? 23  THR A OG1  3  
ATOM   2621  C  CG2  . THR A 1 23 ? -15.544 -1.946  6.649   1.00 0.00 ? 23  THR A CG2  3  
ATOM   2622  H  H    . THR A 1 23 ? -13.334 -4.003  4.459   1.00 0.00 ? 23  THR A H    3  
ATOM   2623  H  HA   . THR A 1 23 ? -16.047 -4.306  5.415   1.00 0.00 ? 23  THR A HA   3  
ATOM   2624  H  HB   . THR A 1 23 ? -16.726 -1.999  4.879   1.00 0.00 ? 23  THR A HB   3  
ATOM   2625  H  HG1  . THR A 1 23 ? -13.945 -1.715  4.413   1.00 0.00 ? 23  THR A HG1  3  
ATOM   2626  H  HG21 . THR A 1 23 ? -16.282 -2.513  7.195   1.00 0.00 ? 23  THR A HG21 3  
ATOM   2627  H  HG22 . THR A 1 23 ? -15.680 -0.893  6.846   1.00 0.00 ? 23  THR A HG22 3  
ATOM   2628  H  HG23 . THR A 1 23 ? -14.555 -2.246  6.963   1.00 0.00 ? 23  THR A HG23 3  
ATOM   2629  N  N    . GLY A 1 24 ? -16.804 -4.569  3.063   1.00 0.00 ? 24  GLY A N    3  
ATOM   2630  C  CA   . GLY A 1 24 ? -17.169 -4.853  1.688   1.00 0.00 ? 24  GLY A CA   3  
ATOM   2631  C  C    . GLY A 1 24 ? -16.933 -3.671  0.769   1.00 0.00 ? 24  GLY A C    3  
ATOM   2632  O  O    . GLY A 1 24 ? -17.455 -2.580  1.004   1.00 0.00 ? 24  GLY A O    3  
ATOM   2633  H  H    . GLY A 1 24 ? -17.392 -4.854  3.793   1.00 0.00 ? 24  GLY A H    3  
ATOM   2634  H  HA2  . GLY A 1 24 ? -16.585 -5.691  1.337   1.00 0.00 ? 24  GLY A HA2  3  
ATOM   2635  H  HA3  . GLY A 1 24 ? -18.216 -5.117  1.653   1.00 0.00 ? 24  GLY A HA3  3  
ATOM   2636  N  N    . ILE A 1 25 ? -16.145 -3.886  -0.279  1.00 0.00 ? 25  ILE A N    3  
ATOM   2637  C  CA   . ILE A 1 25 ? -15.841 -2.829  -1.235  1.00 0.00 ? 25  ILE A CA   3  
ATOM   2638  C  C    . ILE A 1 25 ? -16.923 -2.727  -2.305  1.00 0.00 ? 25  ILE A C    3  
ATOM   2639  O  O    . ILE A 1 25 ? -17.577 -3.716  -2.638  1.00 0.00 ? 25  ILE A O    3  
ATOM   2640  C  CB   . ILE A 1 25 ? -14.480 -3.061  -1.918  1.00 0.00 ? 25  ILE A CB   3  
ATOM   2641  C  CG1  . ILE A 1 25 ? -13.381 -3.234  -0.868  1.00 0.00 ? 25  ILE A CG1  3  
ATOM   2642  C  CG2  . ILE A 1 25 ? -14.151 -1.906  -2.851  1.00 0.00 ? 25  ILE A CG2  3  
ATOM   2643  C  CD1  . ILE A 1 25 ? -12.076 -3.746  -1.437  1.00 0.00 ? 25  ILE A CD1  3  
ATOM   2644  H  H    . ILE A 1 25 ? -15.760 -4.777  -0.412  1.00 0.00 ? 25  ILE A H    3  
ATOM   2645  H  HA   . ILE A 1 25 ? -15.795 -1.894  -0.695  1.00 0.00 ? 25  ILE A HA   3  
ATOM   2646  H  HB   . ILE A 1 25 ? -14.549 -3.962  -2.509  1.00 0.00 ? 25  ILE A HB   3  
ATOM   2647  H  HG12 . ILE A 1 25 ? -13.187 -2.283  -0.399  1.00 0.00 ? 25  ILE A HG12 3  
ATOM   2648  H  HG13 . ILE A 1 25 ? -13.716 -3.938  -0.119  1.00 0.00 ? 25  ILE A HG13 3  
ATOM   2649  H  HG21 . ILE A 1 25 ? -14.680 -1.021  -2.529  1.00 0.00 ? 25  ILE A HG21 3  
ATOM   2650  H  HG22 . ILE A 1 25 ? -13.089 -1.718  -2.830  1.00 0.00 ? 25  ILE A HG22 3  
ATOM   2651  H  HG23 . ILE A 1 25 ? -14.452 -2.158  -3.857  1.00 0.00 ? 25  ILE A HG23 3  
ATOM   2652  H  HD11 . ILE A 1 25 ? -12.126 -4.820  -1.543  1.00 0.00 ? 25  ILE A HD11 3  
ATOM   2653  H  HD12 . ILE A 1 25 ? -11.903 -3.296  -2.402  1.00 0.00 ? 25  ILE A HD12 3  
ATOM   2654  H  HD13 . ILE A 1 25 ? -11.267 -3.489  -0.769  1.00 0.00 ? 25  ILE A HD13 3  
ATOM   2655  N  N    . VAL A 1 26 ? -17.106 -1.525  -2.842  1.00 0.00 ? 26  VAL A N    3  
ATOM   2656  C  CA   . VAL A 1 26 ? -18.107 -1.294  -3.876  1.00 0.00 ? 26  VAL A CA   3  
ATOM   2657  C  C    . VAL A 1 26 ? -17.655 -0.206  -4.845  1.00 0.00 ? 26  VAL A C    3  
ATOM   2658  O  O    . VAL A 1 26 ? -17.308 0.900   -4.434  1.00 0.00 ? 26  VAL A O    3  
ATOM   2659  C  CB   . VAL A 1 26 ? -19.463 -0.892  -3.266  1.00 0.00 ? 26  VAL A CB   3  
ATOM   2660  C  CG1  . VAL A 1 26 ? -19.312 0.350   -2.401  1.00 0.00 ? 26  VAL A CG1  3  
ATOM   2661  C  CG2  . VAL A 1 26 ? -20.494 -0.667  -4.362  1.00 0.00 ? 26  VAL A CG2  3  
ATOM   2662  H  H    . VAL A 1 26 ? -16.554 -0.776  -2.535  1.00 0.00 ? 26  VAL A H    3  
ATOM   2663  H  HA   . VAL A 1 26 ? -18.241 -2.216  -4.423  1.00 0.00 ? 26  VAL A HA   3  
ATOM   2664  H  HB   . VAL A 1 26 ? -19.806 -1.701  -2.639  1.00 0.00 ? 26  VAL A HB   3  
ATOM   2665  H  HG11 . VAL A 1 26 ? -18.278 0.661   -2.395  1.00 0.00 ? 26  VAL A HG11 3  
ATOM   2666  H  HG12 . VAL A 1 26 ? -19.926 1.144   -2.800  1.00 0.00 ? 26  VAL A HG12 3  
ATOM   2667  H  HG13 . VAL A 1 26 ? -19.625 0.125   -1.392  1.00 0.00 ? 26  VAL A HG13 3  
ATOM   2668  H  HG21 . VAL A 1 26 ? -20.766 -1.615  -4.800  1.00 0.00 ? 26  VAL A HG21 3  
ATOM   2669  H  HG22 . VAL A 1 26 ? -21.372 -0.200  -3.940  1.00 0.00 ? 26  VAL A HG22 3  
ATOM   2670  H  HG23 . VAL A 1 26 ? -20.076 -0.025  -5.123  1.00 0.00 ? 26  VAL A HG23 3  
ATOM   2671  N  N    . GLY A 1 27 ? -17.664 -0.529  -6.135  1.00 0.00 ? 27  GLY A N    3  
ATOM   2672  C  CA   . GLY A 1 27 ? -17.253 0.431   -7.142  1.00 0.00 ? 27  GLY A CA   3  
ATOM   2673  C  C    . GLY A 1 27 ? -15.757 0.415   -7.383  1.00 0.00 ? 27  GLY A C    3  
ATOM   2674  O  O    . GLY A 1 27 ? -15.149 -0.651  -7.489  1.00 0.00 ? 27  GLY A O    3  
ATOM   2675  H  H    . GLY A 1 27 ? -17.951 -1.427  -6.404  1.00 0.00 ? 27  GLY A H    3  
ATOM   2676  H  HA2  . GLY A 1 27 ? -17.759 0.203   -8.068  1.00 0.00 ? 27  GLY A HA2  3  
ATOM   2677  H  HA3  . GLY A 1 27 ? -17.543 1.420   -6.819  1.00 0.00 ? 27  GLY A HA3  3  
ATOM   2678  N  N    . VAL A 1 28 ? -15.160 1.599   -7.473  1.00 0.00 ? 28  VAL A N    3  
ATOM   2679  C  CA   . VAL A 1 28 ? -13.725 1.717   -7.705  1.00 0.00 ? 28  VAL A CA   3  
ATOM   2680  C  C    . VAL A 1 28 ? -12.932 1.226   -6.499  1.00 0.00 ? 28  VAL A C    3  
ATOM   2681  O  O    . VAL A 1 28 ? -13.264 1.539   -5.355  1.00 0.00 ? 28  VAL A O    3  
ATOM   2682  C  CB   . VAL A 1 28 ? -13.324 3.172   -8.012  1.00 0.00 ? 28  VAL A CB   3  
ATOM   2683  C  CG1  . VAL A 1 28 ? -13.763 4.096   -6.887  1.00 0.00 ? 28  VAL A CG1  3  
ATOM   2684  C  CG2  . VAL A 1 28 ? -11.824 3.273   -8.241  1.00 0.00 ? 28  VAL A CG2  3  
ATOM   2685  H  H    . VAL A 1 28 ? -15.698 2.413   -7.381  1.00 0.00 ? 28  VAL A H    3  
ATOM   2686  H  HA   . VAL A 1 28 ? -13.474 1.107   -8.561  1.00 0.00 ? 28  VAL A HA   3  
ATOM   2687  H  HB   . VAL A 1 28 ? -13.827 3.479   -8.918  1.00 0.00 ? 28  VAL A HB   3  
ATOM   2688  H  HG11 . VAL A 1 28 ? -13.841 5.106   -7.262  1.00 0.00 ? 28  VAL A HG11 3  
ATOM   2689  H  HG12 . VAL A 1 28 ? -14.724 3.775   -6.511  1.00 0.00 ? 28  VAL A HG12 3  
ATOM   2690  H  HG13 . VAL A 1 28 ? -13.035 4.064   -6.090  1.00 0.00 ? 28  VAL A HG13 3  
ATOM   2691  H  HG21 . VAL A 1 28 ? -11.624 4.027   -8.988  1.00 0.00 ? 28  VAL A HG21 3  
ATOM   2692  H  HG22 . VAL A 1 28 ? -11.335 3.544   -7.316  1.00 0.00 ? 28  VAL A HG22 3  
ATOM   2693  H  HG23 . VAL A 1 28 ? -11.446 2.320   -8.582  1.00 0.00 ? 28  VAL A HG23 3  
ATOM   2694  N  N    . PHE A 1 29 ? -11.882 0.456   -6.762  1.00 0.00 ? 29  PHE A N    3  
ATOM   2695  C  CA   . PHE A 1 29 ? -11.041 -0.079  -5.698  1.00 0.00 ? 29  PHE A CA   3  
ATOM   2696  C  C    . PHE A 1 29 ? -9.704  -0.563  -6.253  1.00 0.00 ? 29  PHE A C    3  
ATOM   2697  O  O    . PHE A 1 29 ? -9.569  -0.810  -7.451  1.00 0.00 ? 29  PHE A O    3  
ATOM   2698  C  CB   . PHE A 1 29 ? -11.755 -1.228  -4.983  1.00 0.00 ? 29  PHE A CB   3  
ATOM   2699  C  CG   . PHE A 1 29 ? -12.033 -2.406  -5.871  1.00 0.00 ? 29  PHE A CG   3  
ATOM   2700  C  CD1  . PHE A 1 29 ? -11.017 -3.277  -6.230  1.00 0.00 ? 29  PHE A CD1  3  
ATOM   2701  C  CD2  . PHE A 1 29 ? -13.312 -2.643  -6.349  1.00 0.00 ? 29  PHE A CD2  3  
ATOM   2702  C  CE1  . PHE A 1 29 ? -11.270 -4.362  -7.047  1.00 0.00 ? 29  PHE A CE1  3  
ATOM   2703  C  CE2  . PHE A 1 29 ? -13.572 -3.727  -7.167  1.00 0.00 ? 29  PHE A CE2  3  
ATOM   2704  C  CZ   . PHE A 1 29 ? -12.549 -4.587  -7.517  1.00 0.00 ? 29  PHE A CZ   3  
ATOM   2705  H  H    . PHE A 1 29 ? -11.668 0.241   -7.694  1.00 0.00 ? 29  PHE A H    3  
ATOM   2706  H  HA   . PHE A 1 29 ? -10.857 0.715   -4.991  1.00 0.00 ? 29  PHE A HA   3  
ATOM   2707  H  HB2  . PHE A 1 29 ? -11.141 -1.570  -4.163  1.00 0.00 ? 29  PHE A HB2  3  
ATOM   2708  H  HB3  . PHE A 1 29 ? -12.698 -0.871  -4.597  1.00 0.00 ? 29  PHE A HB3  3  
ATOM   2709  H  HD1  . PHE A 1 29 ? -10.015 -3.101  -5.863  1.00 0.00 ? 29  PHE A HD1  3  
ATOM   2710  H  HD2  . PHE A 1 29 ? -14.113 -1.971  -6.077  1.00 0.00 ? 29  PHE A HD2  3  
ATOM   2711  H  HE1  . PHE A 1 29 ? -10.468 -5.032  -7.319  1.00 0.00 ? 29  PHE A HE1  3  
ATOM   2712  H  HE2  . PHE A 1 29 ? -14.572 -3.901  -7.533  1.00 0.00 ? 29  PHE A HE2  3  
ATOM   2713  H  HZ   . PHE A 1 29 ? -12.749 -5.435  -8.155  1.00 0.00 ? 29  PHE A HZ   3  
ATOM   2714  N  N    . VAL A 1 30 ? -8.717  -0.695  -5.372  1.00 0.00 ? 30  VAL A N    3  
ATOM   2715  C  CA   . VAL A 1 30 ? -7.391  -1.149  -5.772  1.00 0.00 ? 30  VAL A CA   3  
ATOM   2716  C  C    . VAL A 1 30 ? -7.265  -2.663  -5.637  1.00 0.00 ? 30  VAL A C    3  
ATOM   2717  O  O    . VAL A 1 30 ? -7.087  -3.187  -4.537  1.00 0.00 ? 30  VAL A O    3  
ATOM   2718  C  CB   . VAL A 1 30 ? -6.290  -0.477  -4.931  1.00 0.00 ? 30  VAL A CB   3  
ATOM   2719  C  CG1  . VAL A 1 30 ? -4.912  -0.871  -5.441  1.00 0.00 ? 30  VAL A CG1  3  
ATOM   2720  C  CG2  . VAL A 1 30 ? -6.459  1.035   -4.944  1.00 0.00 ? 30  VAL A CG2  3  
ATOM   2721  H  H    . VAL A 1 30 ? -8.886  -0.483  -4.430  1.00 0.00 ? 30  VAL A H    3  
ATOM   2722  H  HA   . VAL A 1 30 ? -7.242  -0.876  -6.806  1.00 0.00 ? 30  VAL A HA   3  
ATOM   2723  H  HB   . VAL A 1 30 ? -6.384  -0.820  -3.911  1.00 0.00 ? 30  VAL A HB   3  
ATOM   2724  H  HG11 . VAL A 1 30 ? -4.155  -0.442  -4.801  1.00 0.00 ? 30  VAL A HG11 3  
ATOM   2725  H  HG12 . VAL A 1 30 ? -4.821  -1.947  -5.436  1.00 0.00 ? 30  VAL A HG12 3  
ATOM   2726  H  HG13 . VAL A 1 30 ? -4.782  -0.503  -6.448  1.00 0.00 ? 30  VAL A HG13 3  
ATOM   2727  H  HG21 . VAL A 1 30 ? -7.505  1.280   -4.836  1.00 0.00 ? 30  VAL A HG21 3  
ATOM   2728  H  HG22 . VAL A 1 30 ? -5.903  1.467   -4.124  1.00 0.00 ? 30  VAL A HG22 3  
ATOM   2729  H  HG23 . VAL A 1 30 ? -6.090  1.431   -5.878  1.00 0.00 ? 30  VAL A HG23 3  
ATOM   2730  N  N    . LYS A 1 31 ? -7.357  -3.361  -6.763  1.00 0.00 ? 31  LYS A N    3  
ATOM   2731  C  CA   . LYS A 1 31 ? -7.251  -4.815  -6.773  1.00 0.00 ? 31  LYS A CA   3  
ATOM   2732  C  C    . LYS A 1 31 ? -5.803  -5.257  -6.591  1.00 0.00 ? 31  LYS A C    3  
ATOM   2733  O  O    . LYS A 1 31 ? -4.966  -5.054  -7.472  1.00 0.00 ? 31  LYS A O    3  
ATOM   2734  C  CB   . LYS A 1 31 ? -7.807  -5.379  -8.084  1.00 0.00 ? 31  LYS A CB   3  
ATOM   2735  C  CG   . LYS A 1 31 ? -8.043  -6.879  -8.049  1.00 0.00 ? 31  LYS A CG   3  
ATOM   2736  C  CD   . LYS A 1 31 ? -6.799  -7.649  -8.459  1.00 0.00 ? 31  LYS A CD   3  
ATOM   2737  C  CE   . LYS A 1 31 ? -6.938  -9.133  -8.159  1.00 0.00 ? 31  LYS A CE   3  
ATOM   2738  N  NZ   . LYS A 1 31 ? -7.633  -9.859  -9.258  1.00 0.00 ? 31  LYS A NZ   3  
ATOM   2739  H  H    . LYS A 1 31 ? -7.499  -2.886  -7.610  1.00 0.00 ? 31  LYS A H    3  
ATOM   2740  H  HA   . LYS A 1 31 ? -7.838  -5.196  -5.951  1.00 0.00 ? 31  LYS A HA   3  
ATOM   2741  H  HB2  . LYS A 1 31 ? -8.746  -4.892  -8.301  1.00 0.00 ? 31  LYS A HB2  3  
ATOM   2742  H  HB3  . LYS A 1 31 ? -7.107  -5.164  -8.879  1.00 0.00 ? 31  LYS A HB3  3  
ATOM   2743  H  HG2  . LYS A 1 31 ? -8.318  -7.168  -7.046  1.00 0.00 ? 31  LYS A HG2  3  
ATOM   2744  H  HG3  . LYS A 1 31 ? -8.847  -7.123  -8.729  1.00 0.00 ? 31  LYS A HG3  3  
ATOM   2745  H  HD2  . LYS A 1 31 ? -6.639  -7.521  -9.519  1.00 0.00 ? 31  LYS A HD2  3  
ATOM   2746  H  HD3  . LYS A 1 31 ? -5.949  -7.258  -7.916  1.00 0.00 ? 31  LYS A HD3  3  
ATOM   2747  H  HE2  . LYS A 1 31 ? -5.953  -9.554  -8.028  1.00 0.00 ? 31  LYS A HE2  3  
ATOM   2748  H  HE3  . LYS A 1 31 ? -7.504  -9.251  -7.246  1.00 0.00 ? 31  LYS A HE3  3  
ATOM   2749  H  HZ1  . LYS A 1 31 ? -8.141  -10.683 -8.876  1.00 0.00 ? 31  LYS A HZ1  3  
ATOM   2750  H  HZ2  . LYS A 1 31 ? -6.942  -10.187 -9.962  1.00 0.00 ? 31  LYS A HZ2  3  
ATOM   2751  H  HZ3  . LYS A 1 31 ? -8.317  -9.230  -9.725  1.00 0.00 ? 31  LYS A HZ3  3  
ATOM   2752  N  N    . LEU A 1 32 ? -5.514  -5.863  -5.445  1.00 0.00 ? 32  LEU A N    3  
ATOM   2753  C  CA   . LEU A 1 32 ? -4.166  -6.335  -5.148  1.00 0.00 ? 32  LEU A CA   3  
ATOM   2754  C  C    . LEU A 1 32 ? -3.909  -7.692  -5.797  1.00 0.00 ? 32  LEU A C    3  
ATOM   2755  O  O    . LEU A 1 32 ? -4.840  -8.370  -6.230  1.00 0.00 ? 32  LEU A O    3  
ATOM   2756  C  CB   . LEU A 1 32 ? -3.960  -6.433  -3.636  1.00 0.00 ? 32  LEU A CB   3  
ATOM   2757  C  CG   . LEU A 1 32 ? -3.940  -5.108  -2.874  1.00 0.00 ? 32  LEU A CG   3  
ATOM   2758  C  CD1  . LEU A 1 32 ? -3.838  -5.354  -1.376  1.00 0.00 ? 32  LEU A CD1  3  
ATOM   2759  C  CD2  . LEU A 1 32 ? -2.788  -4.235  -3.352  1.00 0.00 ? 32  LEU A CD2  3  
ATOM   2760  H  H    . LEU A 1 32 ? -6.222  -5.997  -4.782  1.00 0.00 ? 32  LEU A H    3  
ATOM   2761  H  HA   . LEU A 1 32 ? -3.467  -5.618  -5.553  1.00 0.00 ? 32  LEU A HA   3  
ATOM   2762  H  HB2  . LEU A 1 32 ? -4.760  -7.034  -3.232  1.00 0.00 ? 32  LEU A HB2  3  
ATOM   2763  H  HB3  . LEU A 1 32 ? -3.016  -6.930  -3.463  1.00 0.00 ? 32  LEU A HB3  3  
ATOM   2764  H  HG   . LEU A 1 32 ? -4.863  -4.577  -3.062  1.00 0.00 ? 32  LEU A HG   3  
ATOM   2765  H  HD11 . LEU A 1 32 ? -2.934  -4.902  -0.998  1.00 0.00 ? 32  LEU A HD11 3  
ATOM   2766  H  HD12 . LEU A 1 32 ? -3.816  -6.417  -1.187  1.00 0.00 ? 32  LEU A HD12 3  
ATOM   2767  H  HD13 . LEU A 1 32 ? -4.694  -4.919  -0.881  1.00 0.00 ? 32  LEU A HD13 3  
ATOM   2768  H  HD21 . LEU A 1 32 ? -2.066  -4.847  -3.872  1.00 0.00 ? 32  LEU A HD21 3  
ATOM   2769  H  HD22 . LEU A 1 32 ? -2.316  -3.765  -2.501  1.00 0.00 ? 32  LEU A HD22 3  
ATOM   2770  H  HD23 . LEU A 1 32 ? -3.166  -3.476  -4.020  1.00 0.00 ? 32  LEU A HD23 3  
ATOM   2771  N  N    . ARG A 1 33 ? -2.640  -8.082  -5.858  1.00 0.00 ? 33  ARG A N    3  
ATOM   2772  C  CA   . ARG A 1 33 ? -2.260  -9.357  -6.453  1.00 0.00 ? 33  ARG A CA   3  
ATOM   2773  C  C    . ARG A 1 33 ? -3.351  -10.403 -6.239  1.00 0.00 ? 33  ARG A C    3  
ATOM   2774  O  O    . ARG A 1 33 ? -4.064  -10.772 -7.173  1.00 0.00 ? 33  ARG A O    3  
ATOM   2775  C  CB   . ARG A 1 33 ? -0.942  -9.851  -5.855  1.00 0.00 ? 33  ARG A CB   3  
ATOM   2776  C  CG   . ARG A 1 33 ? -0.179  -10.802 -6.763  1.00 0.00 ? 33  ARG A CG   3  
ATOM   2777  C  CD   . ARG A 1 33 ? 1.280   -10.915 -6.352  1.00 0.00 ? 33  ARG A CD   3  
ATOM   2778  N  NE   . ARG A 1 33 ? 2.152   -11.178 -7.493  1.00 0.00 ? 33  ARG A NE   3  
ATOM   2779  C  CZ   . ARG A 1 33 ? 3.322   -11.799 -7.397  1.00 0.00 ? 33  ARG A CZ   3  
ATOM   2780  N  NH1  . ARG A 1 33 ? 3.758   -12.221 -6.218  1.00 0.00 ? 33  ARG A NH1  3  
ATOM   2781  N  NH2  . ARG A 1 33 ? 4.059   -12.002 -8.482  1.00 0.00 ? 33  ARG A NH2  3  
ATOM   2782  H  H    . ARG A 1 33 ? -1.942  -7.497  -5.496  1.00 0.00 ? 33  ARG A H    3  
ATOM   2783  H  HA   . ARG A 1 33 ? -2.129  -9.204  -7.513  1.00 0.00 ? 33  ARG A HA   3  
ATOM   2784  H  HB2  . ARG A 1 33 ? -0.310  -8.999  -5.652  1.00 0.00 ? 33  ARG A HB2  3  
ATOM   2785  H  HB3  . ARG A 1 33 ? -1.150  -10.363 -4.928  1.00 0.00 ? 33  ARG A HB3  3  
ATOM   2786  H  HG2  . ARG A 1 33 ? -0.634  -11.780 -6.708  1.00 0.00 ? 33  ARG A HG2  3  
ATOM   2787  H  HG3  . ARG A 1 33 ? -0.231  -10.435 -7.777  1.00 0.00 ? 33  ARG A HG3  3  
ATOM   2788  H  HD2  . ARG A 1 33 ? 1.582   -9.988  -5.886  1.00 0.00 ? 33  ARG A HD2  3  
ATOM   2789  H  HD3  . ARG A 1 33 ? 1.379   -11.722 -5.642  1.00 0.00 ? 33  ARG A HD3  3  
ATOM   2790  H  HE   . ARG A 1 33 ? 1.850   -10.875 -8.375  1.00 0.00 ? 33  ARG A HE   3  
ATOM   2791  H  HH11 . ARG A 1 33 ? 3.204   -12.070 -5.399  1.00 0.00 ? 33  ARG A HH11 3  
ATOM   2792  H  HH12 . ARG A 1 33 ? 4.638   -12.690 -6.148  1.00 0.00 ? 33  ARG A HH12 3  
ATOM   2793  H  HH21 . ARG A 1 33 ? 3.734   -11.686 -9.373  1.00 0.00 ? 33  ARG A HH21 3  
ATOM   2794  H  HH22 . ARG A 1 33 ? 4.939   -12.470 -8.408  1.00 0.00 ? 33  ARG A HH22 3  
ATOM   2795  N  N    . ASP A 1 34 ? -3.475  -10.876 -5.004  1.00 0.00 ? 34  ASP A N    3  
ATOM   2796  C  CA   . ASP A 1 34 ? -4.479  -11.879 -4.666  1.00 0.00 ? 34  ASP A CA   3  
ATOM   2797  C  C    . ASP A 1 34 ? -5.466  -11.335 -3.637  1.00 0.00 ? 34  ASP A C    3  
ATOM   2798  O  O    . ASP A 1 34 ? -6.291  -12.076 -3.102  1.00 0.00 ? 34  ASP A O    3  
ATOM   2799  C  CB   . ASP A 1 34 ? -3.807  -13.143 -4.129  1.00 0.00 ? 34  ASP A CB   3  
ATOM   2800  C  CG   . ASP A 1 34 ? -2.625  -12.834 -3.231  1.00 0.00 ? 34  ASP A CG   3  
ATOM   2801  O  OD1  . ASP A 1 34 ? -1.550  -12.492 -3.765  1.00 0.00 ? 34  ASP A OD1  3  
ATOM   2802  O  OD2  . ASP A 1 34 ? -2.776  -12.936 -1.995  1.00 0.00 ? 34  ASP A OD2  3  
ATOM   2803  H  H    . ASP A 1 34 ? -2.877  -10.543 -4.302  1.00 0.00 ? 34  ASP A H    3  
ATOM   2804  H  HA   . ASP A 1 34 ? -5.019  -12.125 -5.568  1.00 0.00 ? 34  ASP A HA   3  
ATOM   2805  H  HB2  . ASP A 1 34 ? -4.529  -13.712 -3.559  1.00 0.00 ? 34  ASP A HB2  3  
ATOM   2806  H  HB3  . ASP A 1 34 ? -3.460  -13.739 -4.960  1.00 0.00 ? 34  ASP A HB3  3  
ATOM   2807  N  N    . ARG A 1 35 ? -5.373  -10.037 -3.365  1.00 0.00 ? 35  ARG A N    3  
ATOM   2808  C  CA   . ARG A 1 35 ? -6.256  -9.395  -2.398  1.00 0.00 ? 35  ARG A CA   3  
ATOM   2809  C  C    . ARG A 1 35 ? -6.902  -8.149  -2.997  1.00 0.00 ? 35  ARG A C    3  
ATOM   2810  O  O    . ARG A 1 35 ? -6.585  -7.749  -4.117  1.00 0.00 ? 35  ARG A O    3  
ATOM   2811  C  CB   . ARG A 1 35 ? -5.479  -9.023  -1.135  1.00 0.00 ? 35  ARG A CB   3  
ATOM   2812  C  CG   . ARG A 1 35 ? -4.935  -10.224 -0.378  1.00 0.00 ? 35  ARG A CG   3  
ATOM   2813  C  CD   . ARG A 1 35 ? -6.047  -10.993 0.318   1.00 0.00 ? 35  ARG A CD   3  
ATOM   2814  N  NE   . ARG A 1 35 ? -6.433  -10.373 1.582   1.00 0.00 ? 35  ARG A NE   3  
ATOM   2815  C  CZ   . ARG A 1 35 ? -7.624  -10.539 2.149   1.00 0.00 ? 35  ARG A CZ   3  
ATOM   2816  N  NH1  . ARG A 1 35 ? -8.538  -11.302 1.566   1.00 0.00 ? 35  ARG A NH1  3  
ATOM   2817  N  NH2  . ARG A 1 35 ? -7.901  -9.941  3.301   1.00 0.00 ? 35  ARG A NH2  3  
ATOM   2818  H  H    . ARG A 1 35 ? -4.695  -9.499  -3.824  1.00 0.00 ? 35  ARG A H    3  
ATOM   2819  H  HA   . ARG A 1 35 ? -7.032  -10.099 -2.139  1.00 0.00 ? 35  ARG A HA   3  
ATOM   2820  H  HB2  . ARG A 1 35 ? -4.646  -8.392  -1.411  1.00 0.00 ? 35  ARG A HB2  3  
ATOM   2821  H  HB3  . ARG A 1 35 ? -6.132  -8.474  -0.474  1.00 0.00 ? 35  ARG A HB3  3  
ATOM   2822  H  HG2  . ARG A 1 35 ? -4.439  -10.882 -1.075  1.00 0.00 ? 35  ARG A HG2  3  
ATOM   2823  H  HG3  . ARG A 1 35 ? -4.228  -9.881  0.363   1.00 0.00 ? 35  ARG A HG3  3  
ATOM   2824  H  HD2  . ARG A 1 35 ? -6.907  -11.025 -0.334  1.00 0.00 ? 35  ARG A HD2  3  
ATOM   2825  H  HD3  . ARG A 1 35 ? -5.704  -11.999 0.511   1.00 0.00 ? 35  ARG A HD3  3  
ATOM   2826  H  HE   . ARG A 1 35 ? -5.773  -9.805  2.030   1.00 0.00 ? 35  ARG A HE   3  
ATOM   2827  H  HH11 . ARG A 1 35 ? -8.332  -11.754 0.699   1.00 0.00 ? 35  ARG A HH11 3  
ATOM   2828  H  HH12 . ARG A 1 35 ? -9.433  -11.426 1.995   1.00 0.00 ? 35  ARG A HH12 3  
ATOM   2829  H  HH21 . ARG A 1 35 ? -7.214  -9.366  3.743   1.00 0.00 ? 35  ARG A HH21 3  
ATOM   2830  H  HH22 . ARG A 1 35 ? -8.797  -10.067 3.726   1.00 0.00 ? 35  ARG A HH22 3  
ATOM   2831  N  N    . HIS A 1 36 ? -7.811  -7.540  -2.242  1.00 0.00 ? 36  HIS A N    3  
ATOM   2832  C  CA   . HIS A 1 36 ? -8.502  -6.339  -2.697  1.00 0.00 ? 36  HIS A CA   3  
ATOM   2833  C  C    . HIS A 1 36 ? -8.592  -5.306  -1.578  1.00 0.00 ? 36  HIS A C    3  
ATOM   2834  O  O    . HIS A 1 36 ? -8.830  -5.650  -0.420  1.00 0.00 ? 36  HIS A O    3  
ATOM   2835  C  CB   . HIS A 1 36 ? -9.904  -6.690  -3.196  1.00 0.00 ? 36  HIS A CB   3  
ATOM   2836  C  CG   . HIS A 1 36 ? -9.915  -7.744  -4.260  1.00 0.00 ? 36  HIS A CG   3  
ATOM   2837  N  ND1  . HIS A 1 36 ? -9.731  -9.085  -3.993  1.00 0.00 ? 36  HIS A ND1  3  
ATOM   2838  C  CD2  . HIS A 1 36 ? -10.090 -7.649  -5.599  1.00 0.00 ? 36  HIS A CD2  3  
ATOM   2839  C  CE1  . HIS A 1 36 ? -9.791  -9.768  -5.122  1.00 0.00 ? 36  HIS A CE1  3  
ATOM   2840  N  NE2  . HIS A 1 36 ? -10.008 -8.921  -6.112  1.00 0.00 ? 36  HIS A NE2  3  
ATOM   2841  H  H    . HIS A 1 36 ? -8.021  -7.906  -1.358  1.00 0.00 ? 36  HIS A H    3  
ATOM   2842  H  HA   . HIS A 1 36 ? -7.934  -5.918  -3.513  1.00 0.00 ? 36  HIS A HA   3  
ATOM   2843  H  HB2  . HIS A 1 36 ? -10.495 -7.051  -2.367  1.00 0.00 ? 36  HIS A HB2  3  
ATOM   2844  H  HB3  . HIS A 1 36 ? -10.368 -5.803  -3.603  1.00 0.00 ? 36  HIS A HB3  3  
ATOM   2845  H  HD1  . HIS A 1 36 ? -9.578  -9.476  -3.109  1.00 0.00 ? 36  HIS A HD1  3  
ATOM   2846  H  HD2  . HIS A 1 36 ? -10.261 -6.742  -6.161  1.00 0.00 ? 36  HIS A HD2  3  
ATOM   2847  H  HE1  . HIS A 1 36 ? -9.682  -10.838 -5.220  1.00 0.00 ? 36  HIS A HE1  3  
ATOM   2848  H  HE2  . HIS A 1 36 ? -10.011 -9.153  -7.063  1.00 0.00 ? 36  HIS A HE2  3  
ATOM   2849  N  N    . ARG A 1 37 ? -8.399  -4.039  -1.931  1.00 0.00 ? 37  ARG A N    3  
ATOM   2850  C  CA   . ARG A 1 37 ? -8.456  -2.957  -0.956  1.00 0.00 ? 37  ARG A CA   3  
ATOM   2851  C  C    . ARG A 1 37 ? -9.152  -1.733  -1.543  1.00 0.00 ? 37  ARG A C    3  
ATOM   2852  O  O    . ARG A 1 37 ? -9.320  -1.624  -2.758  1.00 0.00 ? 37  ARG A O    3  
ATOM   2853  C  CB   . ARG A 1 37 ? -7.047  -2.583  -0.494  1.00 0.00 ? 37  ARG A CB   3  
ATOM   2854  C  CG   . ARG A 1 37 ? -6.588  -3.343  0.740   1.00 0.00 ? 37  ARG A CG   3  
ATOM   2855  C  CD   . ARG A 1 37 ? -5.498  -2.589  1.485   1.00 0.00 ? 37  ARG A CD   3  
ATOM   2856  N  NE   . ARG A 1 37 ? -4.742  -3.463  2.378   1.00 0.00 ? 37  ARG A NE   3  
ATOM   2857  C  CZ   . ARG A 1 37 ? -3.868  -3.018  3.274   1.00 0.00 ? 37  ARG A CZ   3  
ATOM   2858  N  NH1  . ARG A 1 37 ? -3.641  -1.717  3.396   1.00 0.00 ? 37  ARG A NH1  3  
ATOM   2859  N  NH2  . ARG A 1 37 ? -3.218  -3.875  4.051   1.00 0.00 ? 37  ARG A NH2  3  
ATOM   2860  H  H    . ARG A 1 37 ? -8.213  -3.827  -2.870  1.00 0.00 ? 37  ARG A H    3  
ATOM   2861  H  HA   . ARG A 1 37 ? -9.023  -3.306  -0.106  1.00 0.00 ? 37  ARG A HA   3  
ATOM   2862  H  HB2  . ARG A 1 37 ? -6.352  -2.789  -1.295  1.00 0.00 ? 37  ARG A HB2  3  
ATOM   2863  H  HB3  . ARG A 1 37 ? -7.023  -1.527  -0.270  1.00 0.00 ? 37  ARG A HB3  3  
ATOM   2864  H  HG2  . ARG A 1 37 ? -7.432  -3.481  1.400   1.00 0.00 ? 37  ARG A HG2  3  
ATOM   2865  H  HG3  . ARG A 1 37 ? -6.205  -4.306  0.436   1.00 0.00 ? 37  ARG A HG3  3  
ATOM   2866  H  HD2  . ARG A 1 37 ? -4.822  -2.155  0.765   1.00 0.00 ? 37  ARG A HD2  3  
ATOM   2867  H  HD3  . ARG A 1 37 ? -5.957  -1.804  2.068   1.00 0.00 ? 37  ARG A HD3  3  
ATOM   2868  H  HE   . ARG A 1 37 ? -4.894  -4.428  2.305   1.00 0.00 ? 37  ARG A HE   3  
ATOM   2869  H  HH11 . ARG A 1 37 ? -4.130  -1.069  2.813   1.00 0.00 ? 37  ARG A HH11 3  
ATOM   2870  H  HH12 . ARG A 1 37 ? -2.983  -1.385  4.072   1.00 0.00 ? 37  ARG A HH12 3  
ATOM   2871  H  HH21 . ARG A 1 37 ? -3.386  -4.857  3.963   1.00 0.00 ? 37  ARG A HH21 3  
ATOM   2872  H  HH22 . ARG A 1 37 ? -2.560  -3.540  4.725   1.00 0.00 ? 37  ARG A HH22 3  
ATOM   2873  N  N    . HIS A 1 38 ? -9.556  -0.813  -0.672  1.00 0.00 ? 38  HIS A N    3  
ATOM   2874  C  CA   . HIS A 1 38 ? -10.234 0.404   -1.104  1.00 0.00 ? 38  HIS A CA   3  
ATOM   2875  C  C    . HIS A 1 38 ? -9.249  1.376   -1.745  1.00 0.00 ? 38  HIS A C    3  
ATOM   2876  O  O    . HIS A 1 38 ? -8.037  1.293   -1.544  1.00 0.00 ? 38  HIS A O    3  
ATOM   2877  C  CB   . HIS A 1 38 ? -10.930 1.073   0.081   1.00 0.00 ? 38  HIS A CB   3  
ATOM   2878  C  CG   . HIS A 1 38 ? -12.223 0.420   0.463   1.00 0.00 ? 38  HIS A CG   3  
ATOM   2879  N  ND1  . HIS A 1 38 ? -12.342 -0.450  1.526   1.00 0.00 ? 38  HIS A ND1  3  
ATOM   2880  C  CD2  . HIS A 1 38 ? -13.458 0.516   -0.083  1.00 0.00 ? 38  HIS A CD2  3  
ATOM   2881  C  CE1  . HIS A 1 38 ? -13.594 -0.862  1.617   1.00 0.00 ? 38  HIS A CE1  3  
ATOM   2882  N  NE2  . HIS A 1 38 ? -14.292 -0.290  0.652   1.00 0.00 ? 38  HIS A NE2  3  
ATOM   2883  H  H    . HIS A 1 38 ? -9.393  -0.957  0.284   1.00 0.00 ? 38  HIS A H    3  
ATOM   2884  H  HA   . HIS A 1 38 ? -10.976 0.128   -1.837  1.00 0.00 ? 38  HIS A HA   3  
ATOM   2885  H  HB2  . HIS A 1 38 ? -10.276 1.040   0.940   1.00 0.00 ? 38  HIS A HB2  3  
ATOM   2886  H  HB3  . HIS A 1 38 ? -11.138 2.104   -0.167  1.00 0.00 ? 38  HIS A HB3  3  
ATOM   2887  H  HD2  . HIS A 1 38 ? -13.737 1.116   -0.938  1.00 0.00 ? 38  HIS A HD2  3  
ATOM   2888  H  HE1  . HIS A 1 38 ? -13.982 -1.549  2.354   1.00 0.00 ? 38  HIS A HE1  3  
ATOM   2889  H  HE2  . HIS A 1 38 ? -15.227 -0.488  0.439   1.00 0.00 ? 38  HIS A HE2  3  
ATOM   2890  N  N    . PRO A 1 39 ? -9.779  2.321   -2.537  1.00 0.00 ? 39  PRO A N    3  
ATOM   2891  C  CA   . PRO A 1 39 ? -8.963  3.327   -3.224  1.00 0.00 ? 39  PRO A CA   3  
ATOM   2892  C  C    . PRO A 1 39 ? -8.355  4.338   -2.258  1.00 0.00 ? 39  PRO A C    3  
ATOM   2893  O  O    . PRO A 1 39 ? -7.513  5.149   -2.643  1.00 0.00 ? 39  PRO A O    3  
ATOM   2894  C  CB   . PRO A 1 39 ? -9.961  4.014   -4.159  1.00 0.00 ? 39  PRO A CB   3  
ATOM   2895  C  CG   . PRO A 1 39 ? -11.287 3.814   -3.511  1.00 0.00 ? 39  PRO A CG   3  
ATOM   2896  C  CD   . PRO A 1 39 ? -11.215 2.480   -2.821  1.00 0.00 ? 39  PRO A CD   3  
ATOM   2897  H  HA   . PRO A 1 39 ? -8.177  2.870   -3.806  1.00 0.00 ? 39  PRO A HA   3  
ATOM   2898  H  HB2  . PRO A 1 39 ? -9.716  5.063   -4.244  1.00 0.00 ? 39  PRO A HB2  3  
ATOM   2899  H  HB3  . PRO A 1 39 ? -9.925  3.550   -5.133  1.00 0.00 ? 39  PRO A HB3  3  
ATOM   2900  H  HG2  . PRO A 1 39 ? -11.466 4.599   -2.791  1.00 0.00 ? 39  PRO A HG2  3  
ATOM   2901  H  HG3  . PRO A 1 39 ? -12.065 3.806   -4.260  1.00 0.00 ? 39  PRO A HG3  3  
ATOM   2902  H  HD2  . PRO A 1 39 ? -11.789 2.496   -1.907  1.00 0.00 ? 39  PRO A HD2  3  
ATOM   2903  H  HD3  . PRO A 1 39 ? -11.566 1.697   -3.476  1.00 0.00 ? 39  PRO A HD3  3  
ATOM   2904  N  N    . GLU A 1 40 ? -8.788  4.285   -1.002  1.00 0.00 ? 40  GLU A N    3  
ATOM   2905  C  CA   . GLU A 1 40 ? -8.285  5.197   0.018   1.00 0.00 ? 40  GLU A CA   3  
ATOM   2906  C  C    . GLU A 1 40 ? -7.532  4.437   1.105   1.00 0.00 ? 40  GLU A C    3  
ATOM   2907  O  O    . GLU A 1 40 ? -6.702  5.005   1.816   1.00 0.00 ? 40  GLU A O    3  
ATOM   2908  C  CB   . GLU A 1 40 ? -9.438  5.988   0.639   1.00 0.00 ? 40  GLU A CB   3  
ATOM   2909  C  CG   . GLU A 1 40 ? -10.509 5.112   1.266   1.00 0.00 ? 40  GLU A CG   3  
ATOM   2910  C  CD   . GLU A 1 40 ? -11.852 5.810   1.361   1.00 0.00 ? 40  GLU A CD   3  
ATOM   2911  O  OE1  . GLU A 1 40 ? -11.872 7.022   1.659   1.00 0.00 ? 40  GLU A OE1  3  
ATOM   2912  O  OE2  . GLU A 1 40 ? -12.884 5.143   1.136   1.00 0.00 ? 40  GLU A OE2  3  
ATOM   2913  H  H    . GLU A 1 40 ? -9.460  3.616   -0.756  1.00 0.00 ? 40  GLU A H    3  
ATOM   2914  H  HA   . GLU A 1 40 ? -7.605  5.886   -0.459  1.00 0.00 ? 40  GLU A HA   3  
ATOM   2915  H  HB2  . GLU A 1 40 ? -9.041  6.639   1.404   1.00 0.00 ? 40  GLU A HB2  3  
ATOM   2916  H  HB3  . GLU A 1 40 ? -9.900  6.591   -0.129  1.00 0.00 ? 40  GLU A HB3  3  
ATOM   2917  H  HG2  . GLU A 1 40 ? -10.625 4.222   0.666   1.00 0.00 ? 40  GLU A HG2  3  
ATOM   2918  H  HG3  . GLU A 1 40 ? -10.193 4.835   2.261   1.00 0.00 ? 40  GLU A HG3  3  
ATOM   2919  N  N    . CYS A 1 41 ? -7.827  3.147   1.230   1.00 0.00 ? 41  CYS A N    3  
ATOM   2920  C  CA   . CYS A 1 41 ? -7.180  2.307   2.230   1.00 0.00 ? 41  CYS A CA   3  
ATOM   2921  C  C    . CYS A 1 41 ? -5.828  1.808   1.729   1.00 0.00 ? 41  CYS A C    3  
ATOM   2922  O  O    . CYS A 1 41 ? -4.948  1.469   2.521   1.00 0.00 ? 41  CYS A O    3  
ATOM   2923  C  CB   . CYS A 1 41 ? -8.075  1.118   2.584   1.00 0.00 ? 41  CYS A CB   3  
ATOM   2924  S  SG   . CYS A 1 41 ? -9.645  1.581   3.384   1.00 0.00 ? 41  CYS A SG   3  
ATOM   2925  H  H    . CYS A 1 41 ? -8.498  2.750   0.634   1.00 0.00 ? 41  CYS A H    3  
ATOM   2926  H  HA   . CYS A 1 41 ? -7.024  2.905   3.115   1.00 0.00 ? 41  CYS A HA   3  
ATOM   2927  H  HB2  . CYS A 1 41 ? -8.315  0.576   1.681   1.00 0.00 ? 41  CYS A HB2  3  
ATOM   2928  H  HB3  . CYS A 1 41 ? -7.543  0.464   3.259   1.00 0.00 ? 41  CYS A HB3  3  
ATOM   2929  N  N    . TYR A 1 42 ? -5.670  1.767   0.411   1.00 0.00 ? 42  TYR A N    3  
ATOM   2930  C  CA   . TYR A 1 42 ? -4.427  1.307   -0.196  1.00 0.00 ? 42  TYR A CA   3  
ATOM   2931  C  C    . TYR A 1 42 ? -3.219  1.924   0.503   1.00 0.00 ? 42  TYR A C    3  
ATOM   2932  O  O    . TYR A 1 42 ? -2.100  1.421   0.394   1.00 0.00 ? 42  TYR A O    3  
ATOM   2933  C  CB   . TYR A 1 42 ? -4.402  1.658   -1.685  1.00 0.00 ? 42  TYR A CB   3  
ATOM   2934  C  CG   . TYR A 1 42 ? -3.086  1.341   -2.359  1.00 0.00 ? 42  TYR A CG   3  
ATOM   2935  C  CD1  . TYR A 1 42 ? -2.454  0.121   -2.154  1.00 0.00 ? 42  TYR A CD1  3  
ATOM   2936  C  CD2  . TYR A 1 42 ? -2.475  2.262   -3.201  1.00 0.00 ? 42  TYR A CD2  3  
ATOM   2937  C  CE1  . TYR A 1 42 ? -1.252  -0.173  -2.768  1.00 0.00 ? 42  TYR A CE1  3  
ATOM   2938  C  CE2  . TYR A 1 42 ? -1.273  1.976   -3.820  1.00 0.00 ? 42  TYR A CE2  3  
ATOM   2939  C  CZ   . TYR A 1 42 ? -0.665  0.758   -3.600  1.00 0.00 ? 42  TYR A CZ   3  
ATOM   2940  O  OH   . TYR A 1 42 ? 0.532   0.470   -4.213  1.00 0.00 ? 42  TYR A OH   3  
ATOM   2941  H  H    . TYR A 1 42 ? -6.408  2.050   -0.168  1.00 0.00 ? 42  TYR A H    3  
ATOM   2942  H  HA   . TYR A 1 42 ? -4.382  0.234   -0.088  1.00 0.00 ? 42  TYR A HA   3  
ATOM   2943  H  HB2  . TYR A 1 42 ? -5.176  1.102   -2.191  1.00 0.00 ? 42  TYR A HB2  3  
ATOM   2944  H  HB3  . TYR A 1 42 ? -4.589  2.715   -1.802  1.00 0.00 ? 42  TYR A HB3  3  
ATOM   2945  H  HD1  . TYR A 1 42 ? -2.916  -0.607  -1.502  1.00 0.00 ? 42  TYR A HD1  3  
ATOM   2946  H  HD2  . TYR A 1 42 ? -2.953  3.216   -3.371  1.00 0.00 ? 42  TYR A HD2  3  
ATOM   2947  H  HE1  . TYR A 1 42 ? -0.775  -1.127  -2.596  1.00 0.00 ? 42  TYR A HE1  3  
ATOM   2948  H  HE2  . TYR A 1 42 ? -0.814  2.705   -4.471  1.00 0.00 ? 42  TYR A HE2  3  
ATOM   2949  H  HH   . TYR A 1 42 ? 1.185   1.129   -3.965  1.00 0.00 ? 42  TYR A HH   3  
ATOM   2950  N  N    . VAL A 1 43 ? -3.454  3.017   1.223   1.00 0.00 ? 43  VAL A N    3  
ATOM   2951  C  CA   . VAL A 1 43 ? -2.387  3.702   1.942   1.00 0.00 ? 43  VAL A CA   3  
ATOM   2952  C  C    . VAL A 1 43 ? -1.608  2.733   2.824   1.00 0.00 ? 43  VAL A C    3  
ATOM   2953  O  O    . VAL A 1 43 ? -2.098  1.656   3.166   1.00 0.00 ? 43  VAL A O    3  
ATOM   2954  C  CB   . VAL A 1 43 ? -2.943  4.842   2.817   1.00 0.00 ? 43  VAL A CB   3  
ATOM   2955  C  CG1  . VAL A 1 43 ? -3.748  5.819   1.974   1.00 0.00 ? 43  VAL A CG1  3  
ATOM   2956  C  CG2  . VAL A 1 43 ? -3.788  4.280   3.950   1.00 0.00 ? 43  VAL A CG2  3  
ATOM   2957  H  H    . VAL A 1 43 ? -4.367  3.370   1.271   1.00 0.00 ? 43  VAL A H    3  
ATOM   2958  H  HA   . VAL A 1 43 ? -1.715  4.131   1.213   1.00 0.00 ? 43  VAL A HA   3  
ATOM   2959  H  HB   . VAL A 1 43 ? -2.109  5.376   3.249   1.00 0.00 ? 43  VAL A HB   3  
ATOM   2960  H  HG11 . VAL A 1 43 ? -3.074  6.466   1.431   1.00 0.00 ? 43  VAL A HG11 3  
ATOM   2961  H  HG12 . VAL A 1 43 ? -4.363  5.270   1.275   1.00 0.00 ? 43  VAL A HG12 3  
ATOM   2962  H  HG13 . VAL A 1 43 ? -4.378  6.415   2.617   1.00 0.00 ? 43  VAL A HG13 3  
ATOM   2963  H  HG21 . VAL A 1 43 ? -4.609  4.952   4.153   1.00 0.00 ? 43  VAL A HG21 3  
ATOM   2964  H  HG22 . VAL A 1 43 ? -4.177  3.313   3.664   1.00 0.00 ? 43  VAL A HG22 3  
ATOM   2965  H  HG23 . VAL A 1 43 ? -3.180  4.175   4.836   1.00 0.00 ? 43  VAL A HG23 3  
ATOM   2966  N  N    . CYS A 1 44 ? -0.391  3.123   3.190   1.00 0.00 ? 44  CYS A N    3  
ATOM   2967  C  CA   . CYS A 1 44 ? 0.458   2.289   4.033   1.00 0.00 ? 44  CYS A CA   3  
ATOM   2968  C  C    . CYS A 1 44 ? -0.275  1.880   5.307   1.00 0.00 ? 44  CYS A C    3  
ATOM   2969  O  O    . CYS A 1 44 ? -1.274  2.492   5.687   1.00 0.00 ? 44  CYS A O    3  
ATOM   2970  C  CB   . CYS A 1 44 ? 1.746   3.033   4.389   1.00 0.00 ? 44  CYS A CB   3  
ATOM   2971  S  SG   . CYS A 1 44 ? 2.939   2.040   5.342   1.00 0.00 ? 44  CYS A SG   3  
ATOM   2972  H  H    . CYS A 1 44 ? -0.056  3.993   2.886   1.00 0.00 ? 44  CYS A H    3  
ATOM   2973  H  HA   . CYS A 1 44 ? 0.708   1.400   3.475   1.00 0.00 ? 44  CYS A HA   3  
ATOM   2974  H  HB2  . CYS A 1 44 ? 2.235   3.347   3.478   1.00 0.00 ? 44  CYS A HB2  3  
ATOM   2975  H  HB3  . CYS A 1 44 ? 1.499   3.905   4.977   1.00 0.00 ? 44  CYS A HB3  3  
ATOM   2976  N  N    . THR A 1 45 ? 0.229   0.840   5.965   1.00 0.00 ? 45  THR A N    3  
ATOM   2977  C  CA   . THR A 1 45 ? -0.377  0.347   7.195   1.00 0.00 ? 45  THR A CA   3  
ATOM   2978  C  C    . THR A 1 45 ? 0.286   0.966   8.421   1.00 0.00 ? 45  THR A C    3  
ATOM   2979  O  O    . THR A 1 45 ? -0.377  1.262   9.415   1.00 0.00 ? 45  THR A O    3  
ATOM   2980  C  CB   . THR A 1 45 ? -0.282  -1.187  7.293   1.00 0.00 ? 45  THR A CB   3  
ATOM   2981  O  OG1  . THR A 1 45 ? -0.847  -1.788  6.123   1.00 0.00 ? 45  THR A OG1  3  
ATOM   2982  C  CG2  . THR A 1 45 ? -1.006  -1.696  8.531   1.00 0.00 ? 45  THR A CG2  3  
ATOM   2983  H  H    . THR A 1 45 ? 1.027   0.394   5.612   1.00 0.00 ? 45  THR A H    3  
ATOM   2984  H  HA   . THR A 1 45 ? -1.422  0.623   7.186   1.00 0.00 ? 45  THR A HA   3  
ATOM   2985  H  HB   . THR A 1 45 ? 0.760   -1.464  7.365   1.00 0.00 ? 45  THR A HB   3  
ATOM   2986  H  HG1  . THR A 1 45 ? -1.669  -1.345  5.900   1.00 0.00 ? 45  THR A HG1  3  
ATOM   2987  H  HG21 . THR A 1 45 ? -0.282  -2.001  9.272   1.00 0.00 ? 45  THR A HG21 3  
ATOM   2988  H  HG22 . THR A 1 45 ? -1.626  -2.539  8.264   1.00 0.00 ? 45  THR A HG22 3  
ATOM   2989  H  HG23 . THR A 1 45 ? -1.625  -0.909  8.935   1.00 0.00 ? 45  THR A HG23 3  
ATOM   2990  N  N    . ASP A 1 46 ? 1.598   1.158   8.343   1.00 0.00 ? 46  ASP A N    3  
ATOM   2991  C  CA   . ASP A 1 46 ? 2.352   1.744   9.446   1.00 0.00 ? 46  ASP A CA   3  
ATOM   2992  C  C    . ASP A 1 46 ? 1.919   3.185   9.695   1.00 0.00 ? 46  ASP A C    3  
ATOM   2993  O  O    . ASP A 1 46 ? 1.363   3.505   10.746  1.00 0.00 ? 46  ASP A O    3  
ATOM   2994  C  CB   . ASP A 1 46 ? 3.852   1.692   9.151   1.00 0.00 ? 46  ASP A CB   3  
ATOM   2995  C  CG   . ASP A 1 46 ? 4.693   1.798   10.407  1.00 0.00 ? 46  ASP A CG   3  
ATOM   2996  O  OD1  . ASP A 1 46 ? 4.314   2.572   11.312  1.00 0.00 ? 46  ASP A OD1  3  
ATOM   2997  O  OD2  . ASP A 1 46 ? 5.730   1.107   10.487  1.00 0.00 ? 46  ASP A OD2  3  
ATOM   2998  H  H    . ASP A 1 46 ? 2.072   0.902   7.523   1.00 0.00 ? 46  ASP A H    3  
ATOM   2999  H  HA   . ASP A 1 46 ? 2.149   1.162   10.332  1.00 0.00 ? 46  ASP A HA   3  
ATOM   3000  H  HB2  . ASP A 1 46 ? 4.084   0.757   8.662   1.00 0.00 ? 46  ASP A HB2  3  
ATOM   3001  H  HB3  . ASP A 1 46 ? 4.111   2.511   8.495   1.00 0.00 ? 46  ASP A HB3  3  
ATOM   3002  N  N    . CYS A 1 47 ? 2.179   4.052   8.722   1.00 0.00 ? 47  CYS A N    3  
ATOM   3003  C  CA   . CYS A 1 47 ? 1.818   5.460   8.835   1.00 0.00 ? 47  CYS A CA   3  
ATOM   3004  C  C    . CYS A 1 47 ? 0.446   5.722   8.219   1.00 0.00 ? 47  CYS A C    3  
ATOM   3005  O  O    . CYS A 1 47 ? -0.472  6.183   8.895   1.00 0.00 ? 47  CYS A O    3  
ATOM   3006  C  CB   . CYS A 1 47 ? 2.871   6.335   8.153   1.00 0.00 ? 47  CYS A CB   3  
ATOM   3007  S  SG   . CYS A 1 47 ? 3.501   5.653   6.585   1.00 0.00 ? 47  CYS A SG   3  
ATOM   3008  H  H    . CYS A 1 47 ? 2.624   3.737   7.907   1.00 0.00 ? 47  CYS A H    3  
ATOM   3009  H  HA   . CYS A 1 47 ? 1.781   5.710   9.885   1.00 0.00 ? 47  CYS A HA   3  
ATOM   3010  H  HB2  . CYS A 1 47 ? 2.441   7.303   7.939   1.00 0.00 ? 47  CYS A HB2  3  
ATOM   3011  H  HB3  . CYS A 1 47 ? 3.712   6.459   8.819   1.00 0.00 ? 47  CYS A HB3  3  
ATOM   3012  N  N    . GLY A 1 48 ? 0.316   5.423   6.930   1.00 0.00 ? 48  GLY A N    3  
ATOM   3013  C  CA   . GLY A 1 48 ? -0.945  5.632   6.244   1.00 0.00 ? 48  GLY A CA   3  
ATOM   3014  C  C    . GLY A 1 48 ? -0.849  6.690   5.163   1.00 0.00 ? 48  GLY A C    3  
ATOM   3015  O  O    . GLY A 1 48 ? -1.635  7.638   5.139   1.00 0.00 ? 48  GLY A O    3  
ATOM   3016  H  H    . GLY A 1 48 ? 1.083   5.057   6.441   1.00 0.00 ? 48  GLY A H    3  
ATOM   3017  H  HA2  . GLY A 1 48 ? -1.257  4.701   5.794   1.00 0.00 ? 48  GLY A HA2  3  
ATOM   3018  H  HA3  . GLY A 1 48 ? -1.688  5.938   6.966   1.00 0.00 ? 48  GLY A HA3  3  
ATOM   3019  N  N    . THR A 1 49 ? 0.120   6.532   4.266   1.00 0.00 ? 49  THR A N    3  
ATOM   3020  C  CA   . THR A 1 49 ? 0.318   7.483   3.180   1.00 0.00 ? 49  THR A CA   3  
ATOM   3021  C  C    . THR A 1 49 ? -0.147  6.902   1.849   1.00 0.00 ? 49  THR A C    3  
ATOM   3022  O  O    . THR A 1 49 ? -0.114  5.690   1.645   1.00 0.00 ? 49  THR A O    3  
ATOM   3023  C  CB   . THR A 1 49 ? 1.797   7.896   3.058   1.00 0.00 ? 49  THR A CB   3  
ATOM   3024  O  OG1  . THR A 1 49 ? 1.934   8.948   2.096   1.00 0.00 ? 49  THR A OG1  3  
ATOM   3025  C  CG2  . THR A 1 49 ? 2.658   6.710   2.646   1.00 0.00 ? 49  THR A CG2  3  
ATOM   3026  H  H    . THR A 1 49 ? 0.714   5.757   4.339   1.00 0.00 ? 49  THR A H    3  
ATOM   3027  H  HA   . THR A 1 49 ? -0.264  8.366   3.399   1.00 0.00 ? 49  THR A HA   3  
ATOM   3028  H  HB   . THR A 1 49 ? 2.136   8.251   4.020   1.00 0.00 ? 49  THR A HB   3  
ATOM   3029  H  HG1  . THR A 1 49 ? 1.765   9.793   2.520   1.00 0.00 ? 49  THR A HG1  3  
ATOM   3030  H  HG21 . THR A 1 49 ? 2.031   5.942   2.219   1.00 0.00 ? 49  THR A HG21 3  
ATOM   3031  H  HG22 . THR A 1 49 ? 3.169   6.319   3.513   1.00 0.00 ? 49  THR A HG22 3  
ATOM   3032  H  HG23 . THR A 1 49 ? 3.383   7.030   1.914   1.00 0.00 ? 49  THR A HG23 3  
ATOM   3033  N  N    . ASN A 1 50 ? -0.580  7.777   0.946   1.00 0.00 ? 50  ASN A N    3  
ATOM   3034  C  CA   . ASN A 1 50 ? -1.052  7.350   -0.366  1.00 0.00 ? 50  ASN A CA   3  
ATOM   3035  C  C    . ASN A 1 50 ? 0.061   6.653   -1.144  1.00 0.00 ? 50  ASN A C    3  
ATOM   3036  O  O    . ASN A 1 50 ? 1.078   7.263   -1.476  1.00 0.00 ? 50  ASN A O    3  
ATOM   3037  C  CB   . ASN A 1 50 ? -1.569  8.551   -1.160  1.00 0.00 ? 50  ASN A CB   3  
ATOM   3038  C  CG   . ASN A 1 50 ? -2.858  9.110   -0.588  1.00 0.00 ? 50  ASN A CG   3  
ATOM   3039  O  OD1  . ASN A 1 50 ? -2.843  10.075  0.176   1.00 0.00 ? 50  ASN A OD1  3  
ATOM   3040  N  ND2  . ASN A 1 50 ? -3.980  8.505   -0.956  1.00 0.00 ? 50  ASN A ND2  3  
ATOM   3041  H  H    . ASN A 1 50 ? -0.582  8.731   1.168   1.00 0.00 ? 50  ASN A H    3  
ATOM   3042  H  HA   . ASN A 1 50 ? -1.862  6.652   -0.216  1.00 0.00 ? 50  ASN A HA   3  
ATOM   3043  H  HB2  . ASN A 1 50 ? -0.823  9.332   -1.147  1.00 0.00 ? 50  ASN A HB2  3  
ATOM   3044  H  HB3  . ASN A 1 50 ? -1.751  8.249   -2.181  1.00 0.00 ? 50  ASN A HB3  3  
ATOM   3045  H  HD21 . ASN A 1 50 ? -3.916  7.741   -1.568  1.00 0.00 ? 50  ASN A HD21 3  
ATOM   3046  H  HD22 . ASN A 1 50 ? -4.828  8.846   -0.602  1.00 0.00 ? 50  ASN A HD22 3  
ATOM   3047  N  N    . LEU A 1 51 ? -0.140  5.372   -1.433  1.00 0.00 ? 51  LEU A N    3  
ATOM   3048  C  CA   . LEU A 1 51 ? 0.845   4.591   -2.173  1.00 0.00 ? 51  LEU A CA   3  
ATOM   3049  C  C    . LEU A 1 51 ? 0.469   4.497   -3.648  1.00 0.00 ? 51  LEU A C    3  
ATOM   3050  O  O    . LEU A 1 51 ? 1.163   3.856   -4.437  1.00 0.00 ? 51  LEU A O    3  
ATOM   3051  C  CB   . LEU A 1 51 ? 0.966   3.188   -1.575  1.00 0.00 ? 51  LEU A CB   3  
ATOM   3052  C  CG   . LEU A 1 51 ? 1.200   3.119   -0.066  1.00 0.00 ? 51  LEU A CG   3  
ATOM   3053  C  CD1  . LEU A 1 51 ? 1.115   1.682   0.423   1.00 0.00 ? 51  LEU A CD1  3  
ATOM   3054  C  CD2  . LEU A 1 51 ? 2.548   3.728   0.293   1.00 0.00 ? 51  LEU A CD2  3  
ATOM   3055  H  H    . LEU A 1 51 ? -0.970  4.940   -1.142  1.00 0.00 ? 51  LEU A H    3  
ATOM   3056  H  HA   . LEU A 1 51 ? 1.797   5.093   -2.088  1.00 0.00 ? 51  LEU A HA   3  
ATOM   3057  H  HB2  . LEU A 1 51 ? 0.052   2.657   -1.792  1.00 0.00 ? 51  LEU A HB2  3  
ATOM   3058  H  HB3  . LEU A 1 51 ? 1.794   2.692   -2.062  1.00 0.00 ? 51  LEU A HB3  3  
ATOM   3059  H  HG   . LEU A 1 51 ? 0.431   3.688   0.438   1.00 0.00 ? 51  LEU A HG   3  
ATOM   3060  H  HD11 . LEU A 1 51 ? 2.005   1.148   0.126   1.00 0.00 ? 51  LEU A HD11 3  
ATOM   3061  H  HD12 . LEU A 1 51 ? 0.248   1.205   -0.010  1.00 0.00 ? 51  LEU A HD12 3  
ATOM   3062  H  HD13 . LEU A 1 51 ? 1.031   1.672   1.500   1.00 0.00 ? 51  LEU A HD13 3  
ATOM   3063  H  HD21 . LEU A 1 51 ? 2.536   4.047   1.325   1.00 0.00 ? 51  LEU A HD21 3  
ATOM   3064  H  HD22 . LEU A 1 51 ? 2.740   4.579   -0.344  1.00 0.00 ? 51  LEU A HD22 3  
ATOM   3065  H  HD23 . LEU A 1 51 ? 3.325   2.990   0.154   1.00 0.00 ? 51  LEU A HD23 3  
ATOM   3066  N  N    . LYS A 1 52 ? -0.633  5.142   -4.014  1.00 0.00 ? 52  LYS A N    3  
ATOM   3067  C  CA   . LYS A 1 52 ? -1.101  5.135   -5.395  1.00 0.00 ? 52  LYS A CA   3  
ATOM   3068  C  C    . LYS A 1 52 ? 0.062   5.318   -6.365  1.00 0.00 ? 52  LYS A C    3  
ATOM   3069  O  O    . LYS A 1 52 ? 0.241   4.526   -7.289  1.00 0.00 ? 52  LYS A O    3  
ATOM   3070  C  CB   . LYS A 1 52 ? -2.137  6.241   -5.610  1.00 0.00 ? 52  LYS A CB   3  
ATOM   3071  C  CG   . LYS A 1 52 ? -2.843  6.161   -6.952  1.00 0.00 ? 52  LYS A CG   3  
ATOM   3072  C  CD   . LYS A 1 52 ? -4.113  6.995   -6.965  1.00 0.00 ? 52  LYS A CD   3  
ATOM   3073  C  CE   . LYS A 1 52 ? -4.665  7.149   -8.374  1.00 0.00 ? 52  LYS A CE   3  
ATOM   3074  N  NZ   . LYS A 1 52 ? -6.147  7.299   -8.376  1.00 0.00 ? 52  LYS A NZ   3  
ATOM   3075  H  H    . LYS A 1 52 ? -1.145  5.636   -3.339  1.00 0.00 ? 52  LYS A H    3  
ATOM   3076  H  HA   . LYS A 1 52 ? -1.565  4.179   -5.584  1.00 0.00 ? 52  LYS A HA   3  
ATOM   3077  H  HB2  . LYS A 1 52 ? -2.881  6.177   -4.830  1.00 0.00 ? 52  LYS A HB2  3  
ATOM   3078  H  HB3  . LYS A 1 52 ? -1.641  7.199   -5.544  1.00 0.00 ? 52  LYS A HB3  3  
ATOM   3079  H  HG2  . LYS A 1 52 ? -2.178  6.526   -7.721  1.00 0.00 ? 52  LYS A HG2  3  
ATOM   3080  H  HG3  . LYS A 1 52 ? -3.097  5.130   -7.154  1.00 0.00 ? 52  LYS A HG3  3  
ATOM   3081  H  HD2  . LYS A 1 52 ? -4.858  6.510   -6.350  1.00 0.00 ? 52  LYS A HD2  3  
ATOM   3082  H  HD3  . LYS A 1 52 ? -3.895  7.974   -6.563  1.00 0.00 ? 52  LYS A HD3  3  
ATOM   3083  H  HE2  . LYS A 1 52 ? -4.223  8.023   -8.825  1.00 0.00 ? 52  LYS A HE2  3  
ATOM   3084  H  HE3  . LYS A 1 52 ? -4.399  6.274   -8.948  1.00 0.00 ? 52  LYS A HE3  3  
ATOM   3085  H  HZ1  . LYS A 1 52 ? -6.414  8.204   -7.939  1.00 0.00 ? 52  LYS A HZ1  3  
ATOM   3086  H  HZ2  . LYS A 1 52 ? -6.585  6.525   -7.838  1.00 0.00 ? 52  LYS A HZ2  3  
ATOM   3087  H  HZ3  . LYS A 1 52 ? -6.507  7.277   -9.351  1.00 0.00 ? 52  LYS A HZ3  3  
ATOM   3088  N  N    . GLN A 1 53 ? 0.850   6.366   -6.146  1.00 0.00 ? 53  GLN A N    3  
ATOM   3089  C  CA   . GLN A 1 53 ? 1.997   6.650   -7.000  1.00 0.00 ? 53  GLN A CA   3  
ATOM   3090  C  C    . GLN A 1 53 ? 3.265   6.017   -6.439  1.00 0.00 ? 53  GLN A C    3  
ATOM   3091  O  O    . GLN A 1 53 ? 3.845   5.117   -7.047  1.00 0.00 ? 53  GLN A O    3  
ATOM   3092  C  CB   . GLN A 1 53 ? 2.188   8.161   -7.146  1.00 0.00 ? 53  GLN A CB   3  
ATOM   3093  C  CG   . GLN A 1 53 ? 1.073   8.843   -7.923  1.00 0.00 ? 53  GLN A CG   3  
ATOM   3094  C  CD   . GLN A 1 53 ? 1.300   8.808   -9.421  1.00 0.00 ? 53  GLN A CD   3  
ATOM   3095  O  OE1  . GLN A 1 53 ? 0.449   8.342   -10.179 1.00 0.00 ? 53  GLN A OE1  3  
ATOM   3096  N  NE2  . GLN A 1 53 ? 2.453   9.302   -9.858  1.00 0.00 ? 53  GLN A NE2  3  
ATOM   3097  H  H    . GLN A 1 53 ? 0.656   6.961   -5.392  1.00 0.00 ? 53  GLN A H    3  
ATOM   3098  H  HA   . GLN A 1 53 ? 1.798   6.227   -7.973  1.00 0.00 ? 53  GLN A HA   3  
ATOM   3099  H  HB2  . GLN A 1 53 ? 2.234   8.603   -6.162  1.00 0.00 ? 53  GLN A HB2  3  
ATOM   3100  H  HB3  . GLN A 1 53 ? 3.120   8.346   -7.659  1.00 0.00 ? 53  GLN A HB3  3  
ATOM   3101  H  HG2  . GLN A 1 53 ? 0.141   8.344   -7.704  1.00 0.00 ? 53  GLN A HG2  3  
ATOM   3102  H  HG3  . GLN A 1 53 ? 1.011   9.874   -7.607  1.00 0.00 ? 53  GLN A HG3  3  
ATOM   3103  H  HE21 . GLN A 1 53 ? 3.085   9.656   -9.196  1.00 0.00 ? 53  GLN A HE21 3  
ATOM   3104  H  HE22 . GLN A 1 53 ? 2.627   9.291   -10.821 1.00 0.00 ? 53  GLN A HE22 3  
ATOM   3105  N  N    . LYS A 1 54 ? 3.692   6.493   -5.274  1.00 0.00 ? 54  LYS A N    3  
ATOM   3106  C  CA   . LYS A 1 54 ? 4.892   5.974   -4.628  1.00 0.00 ? 54  LYS A CA   3  
ATOM   3107  C  C    . LYS A 1 54 ? 5.025   4.471   -4.856  1.00 0.00 ? 54  LYS A C    3  
ATOM   3108  O  O    . LYS A 1 54 ? 5.988   4.009   -5.467  1.00 0.00 ? 54  LYS A O    3  
ATOM   3109  C  CB   . LYS A 1 54 ? 4.859   6.272   -3.128  1.00 0.00 ? 54  LYS A CB   3  
ATOM   3110  C  CG   . LYS A 1 54 ? 5.126   7.729   -2.791  1.00 0.00 ? 54  LYS A CG   3  
ATOM   3111  C  CD   . LYS A 1 54 ? 5.270   7.938   -1.293  1.00 0.00 ? 54  LYS A CD   3  
ATOM   3112  C  CE   . LYS A 1 54 ? 5.029   9.389   -0.907  1.00 0.00 ? 54  LYS A CE   3  
ATOM   3113  N  NZ   . LYS A 1 54 ? 3.607   9.786   -1.101  1.00 0.00 ? 54  LYS A NZ   3  
ATOM   3114  H  H    . LYS A 1 54 ? 3.188   7.212   -4.837  1.00 0.00 ? 54  LYS A H    3  
ATOM   3115  H  HA   . LYS A 1 54 ? 5.745   6.469   -5.066  1.00 0.00 ? 54  LYS A HA   3  
ATOM   3116  H  HB2  . LYS A 1 54 ? 3.885   6.009   -2.742  1.00 0.00 ? 54  LYS A HB2  3  
ATOM   3117  H  HB3  . LYS A 1 54 ? 5.607   5.668   -2.636  1.00 0.00 ? 54  LYS A HB3  3  
ATOM   3118  H  HG2  . LYS A 1 54 ? 6.040   8.039   -3.276  1.00 0.00 ? 54  LYS A HG2  3  
ATOM   3119  H  HG3  . LYS A 1 54 ? 4.303   8.330   -3.152  1.00 0.00 ? 54  LYS A HG3  3  
ATOM   3120  H  HD2  . LYS A 1 54 ? 4.551   7.317   -0.781  1.00 0.00 ? 54  LYS A HD2  3  
ATOM   3121  H  HD3  . LYS A 1 54 ? 6.270   7.656   -0.993  1.00 0.00 ? 54  LYS A HD3  3  
ATOM   3122  H  HE2  . LYS A 1 54 ? 5.292   9.520   0.132   1.00 0.00 ? 54  LYS A HE2  3  
ATOM   3123  H  HE3  . LYS A 1 54 ? 5.658   10.020  -1.519  1.00 0.00 ? 54  LYS A HE3  3  
ATOM   3124  H  HZ1  . LYS A 1 54 ? 3.294   9.534   -2.060  1.00 0.00 ? 54  LYS A HZ1  3  
ATOM   3125  H  HZ2  . LYS A 1 54 ? 3.503   10.813  -0.974  1.00 0.00 ? 54  LYS A HZ2  3  
ATOM   3126  H  HZ3  . LYS A 1 54 ? 3.002   9.298   -0.411  1.00 0.00 ? 54  LYS A HZ3  3  
ATOM   3127  N  N    . GLY A 1 55 ? 4.051   3.714   -4.361  1.00 0.00 ? 55  GLY A N    3  
ATOM   3128  C  CA   . GLY A 1 55 ? 4.079   2.272   -4.521  1.00 0.00 ? 55  GLY A CA   3  
ATOM   3129  C  C    . GLY A 1 55 ? 3.960   1.539   -3.200  1.00 0.00 ? 55  GLY A C    3  
ATOM   3130  O  O    . GLY A 1 55 ? 4.171   2.123   -2.137  1.00 0.00 ? 55  GLY A O    3  
ATOM   3131  H  H    . GLY A 1 55 ? 3.308   4.137   -3.882  1.00 0.00 ? 55  GLY A H    3  
ATOM   3132  H  HA2  . GLY A 1 55 ? 3.260   1.976   -5.160  1.00 0.00 ? 55  GLY A HA2  3  
ATOM   3133  H  HA3  . GLY A 1 55 ? 5.009   1.991   -4.993  1.00 0.00 ? 55  GLY A HA3  3  
ATOM   3134  N  N    . HIS A 1 56 ? 3.621   0.255   -3.266  1.00 0.00 ? 56  HIS A N    3  
ATOM   3135  C  CA   . HIS A 1 56 ? 3.474   -0.559  -2.064  1.00 0.00 ? 56  HIS A CA   3  
ATOM   3136  C  C    . HIS A 1 56 ? 4.324   -1.823  -2.157  1.00 0.00 ? 56  HIS A C    3  
ATOM   3137  O  O    . HIS A 1 56 ? 4.604   -2.316  -3.249  1.00 0.00 ? 56  HIS A O    3  
ATOM   3138  C  CB   . HIS A 1 56 ? 2.006   -0.932  -1.852  1.00 0.00 ? 56  HIS A CB   3  
ATOM   3139  C  CG   . HIS A 1 56 ? 1.603   -2.196  -2.546  1.00 0.00 ? 56  HIS A CG   3  
ATOM   3140  N  ND1  . HIS A 1 56 ? 0.912   -2.212  -3.740  1.00 0.00 ? 56  HIS A ND1  3  
ATOM   3141  C  CD2  . HIS A 1 56 ? 1.799   -3.493  -2.209  1.00 0.00 ? 56  HIS A CD2  3  
ATOM   3142  C  CE1  . HIS A 1 56 ? 0.699   -3.464  -4.106  1.00 0.00 ? 56  HIS A CE1  3  
ATOM   3143  N  NE2  . HIS A 1 56 ? 1.228   -4.260  -3.194  1.00 0.00 ? 56  HIS A NE2  3  
ATOM   3144  H  H    . HIS A 1 56 ? 3.466   -0.154  -4.142  1.00 0.00 ? 56  HIS A H    3  
ATOM   3145  H  HA   . HIS A 1 56 ? 3.812   0.027   -1.223  1.00 0.00 ? 56  HIS A HA   3  
ATOM   3146  H  HB2  . HIS A 1 56 ? 1.824   -1.062  -0.795  1.00 0.00 ? 56  HIS A HB2  3  
ATOM   3147  H  HB3  . HIS A 1 56 ? 1.381   -0.134  -2.225  1.00 0.00 ? 56  HIS A HB3  3  
ATOM   3148  H  HD1  . HIS A 1 56 ? 0.620   -1.424  -4.242  1.00 0.00 ? 56  HIS A HD1  3  
ATOM   3149  H  HD2  . HIS A 1 56 ? 2.309   -3.857  -1.328  1.00 0.00 ? 56  HIS A HD2  3  
ATOM   3150  H  HE1  . HIS A 1 56 ? 0.182   -3.782  -4.998  1.00 0.00 ? 56  HIS A HE1  3  
ATOM   3151  H  HE2  . HIS A 1 56 ? 1.138   -5.236  -3.177  1.00 0.00 ? 56  HIS A HE2  3  
ATOM   3152  N  N    . PHE A 1 57 ? 4.732   -2.341  -1.003  1.00 0.00 ? 57  PHE A N    3  
ATOM   3153  C  CA   . PHE A 1 57 ? 5.552   -3.546  -0.954  1.00 0.00 ? 57  PHE A CA   3  
ATOM   3154  C  C    . PHE A 1 57 ? 4.795   -4.692  -0.288  1.00 0.00 ? 57  PHE A C    3  
ATOM   3155  O  O    . PHE A 1 57 ? 3.718   -4.495  0.275   1.00 0.00 ? 57  PHE A O    3  
ATOM   3156  C  CB   . PHE A 1 57 ? 6.854   -3.272  -0.199  1.00 0.00 ? 57  PHE A CB   3  
ATOM   3157  C  CG   . PHE A 1 57 ? 7.963   -2.770  -1.078  1.00 0.00 ? 57  PHE A CG   3  
ATOM   3158  C  CD1  . PHE A 1 57 ? 7.836   -1.569  -1.758  1.00 0.00 ? 57  PHE A CD1  3  
ATOM   3159  C  CD2  . PHE A 1 57 ? 9.132   -3.499  -1.225  1.00 0.00 ? 57  PHE A CD2  3  
ATOM   3160  C  CE1  . PHE A 1 57 ? 8.855   -1.105  -2.568  1.00 0.00 ? 57  PHE A CE1  3  
ATOM   3161  C  CE2  . PHE A 1 57 ? 10.155  -3.040  -2.034  1.00 0.00 ? 57  PHE A CE2  3  
ATOM   3162  C  CZ   . PHE A 1 57 ? 10.016  -1.841  -2.706  1.00 0.00 ? 57  PHE A CZ   3  
ATOM   3163  H  H    . PHE A 1 57 ? 4.476   -1.902  -0.165  1.00 0.00 ? 57  PHE A H    3  
ATOM   3164  H  HA   . PHE A 1 57 ? 5.787   -3.828  -1.969  1.00 0.00 ? 57  PHE A HA   3  
ATOM   3165  H  HB2  . PHE A 1 57 ? 6.671   -2.527  0.561   1.00 0.00 ? 57  PHE A HB2  3  
ATOM   3166  H  HB3  . PHE A 1 57 ? 7.188   -4.185  0.271   1.00 0.00 ? 57  PHE A HB3  3  
ATOM   3167  H  HD1  . PHE A 1 57 ? 6.930   -0.992  -1.650  1.00 0.00 ? 57  PHE A HD1  3  
ATOM   3168  H  HD2  . PHE A 1 57 ? 9.242   -4.437  -0.700  1.00 0.00 ? 57  PHE A HD2  3  
ATOM   3169  H  HE1  . PHE A 1 57 ? 8.745   -0.168  -3.092  1.00 0.00 ? 57  PHE A HE1  3  
ATOM   3170  H  HE2  . PHE A 1 57 ? 11.061  -3.617  -2.139  1.00 0.00 ? 57  PHE A HE2  3  
ATOM   3171  H  HZ   . PHE A 1 57 ? 10.814  -1.481  -3.339  1.00 0.00 ? 57  PHE A HZ   3  
ATOM   3172  N  N    . PHE A 1 58 ? 5.367   -5.889  -0.357  1.00 0.00 ? 58  PHE A N    3  
ATOM   3173  C  CA   . PHE A 1 58 ? 4.747   -7.068  0.237   1.00 0.00 ? 58  PHE A CA   3  
ATOM   3174  C  C    . PHE A 1 58 ? 5.575   -7.585  1.410   1.00 0.00 ? 58  PHE A C    3  
ATOM   3175  O  O    . PHE A 1 58 ? 6.675   -8.106  1.226   1.00 0.00 ? 58  PHE A O    3  
ATOM   3176  C  CB   . PHE A 1 58 ? 4.585   -8.169  -0.812  1.00 0.00 ? 58  PHE A CB   3  
ATOM   3177  C  CG   . PHE A 1 58 ? 3.271   -8.116  -1.539  1.00 0.00 ? 58  PHE A CG   3  
ATOM   3178  C  CD1  . PHE A 1 58 ? 2.076   -8.111  -0.838  1.00 0.00 ? 58  PHE A CD1  3  
ATOM   3179  C  CD2  . PHE A 1 58 ? 3.232   -8.072  -2.923  1.00 0.00 ? 58  PHE A CD2  3  
ATOM   3180  C  CE1  . PHE A 1 58 ? 0.866   -8.061  -1.504  1.00 0.00 ? 58  PHE A CE1  3  
ATOM   3181  C  CE2  . PHE A 1 58 ? 2.024   -8.022  -3.594  1.00 0.00 ? 58  PHE A CE2  3  
ATOM   3182  C  CZ   . PHE A 1 58 ? 0.840   -8.018  -2.884  1.00 0.00 ? 58  PHE A CZ   3  
ATOM   3183  H  H    . PHE A 1 58 ? 6.226   -5.983  -0.820  1.00 0.00 ? 58  PHE A H    3  
ATOM   3184  H  HA   . PHE A 1 58 ? 3.772   -6.781  0.600   1.00 0.00 ? 58  PHE A HA   3  
ATOM   3185  H  HB2  . PHE A 1 58 ? 5.372   -8.077  -1.545  1.00 0.00 ? 58  PHE A HB2  3  
ATOM   3186  H  HB3  . PHE A 1 58 ? 4.659   -9.131  -0.328  1.00 0.00 ? 58  PHE A HB3  3  
ATOM   3187  H  HD1  . PHE A 1 58 ? 2.095   -8.145  0.242   1.00 0.00 ? 58  PHE A HD1  3  
ATOM   3188  H  HD2  . PHE A 1 58 ? 4.157   -8.076  -3.481  1.00 0.00 ? 58  PHE A HD2  3  
ATOM   3189  H  HE1  . PHE A 1 58 ? -0.058  -8.058  -0.945  1.00 0.00 ? 58  PHE A HE1  3  
ATOM   3190  H  HE2  . PHE A 1 58 ? 2.007   -7.988  -4.674  1.00 0.00 ? 58  PHE A HE2  3  
ATOM   3191  H  HZ   . PHE A 1 58 ? -0.104  -7.979  -3.406  1.00 0.00 ? 58  PHE A HZ   3  
ATOM   3192  N  N    . VAL A 1 59 ? 5.038   -7.437  2.617   1.00 0.00 ? 59  VAL A N    3  
ATOM   3193  C  CA   . VAL A 1 59 ? 5.726   -7.889  3.820   1.00 0.00 ? 59  VAL A CA   3  
ATOM   3194  C  C    . VAL A 1 59 ? 4.750   -8.518  4.808   1.00 0.00 ? 59  VAL A C    3  
ATOM   3195  O  O    . VAL A 1 59 ? 3.807   -7.869  5.261   1.00 0.00 ? 59  VAL A O    3  
ATOM   3196  C  CB   . VAL A 1 59 ? 6.465   -6.729  4.513   1.00 0.00 ? 59  VAL A CB   3  
ATOM   3197  C  CG1  . VAL A 1 59 ? 7.279   -7.242  5.691   1.00 0.00 ? 59  VAL A CG1  3  
ATOM   3198  C  CG2  . VAL A 1 59 ? 7.353   -5.995  3.521   1.00 0.00 ? 59  VAL A CG2  3  
ATOM   3199  H  H    . VAL A 1 59 ? 4.158   -7.014  2.700   1.00 0.00 ? 59  VAL A H    3  
ATOM   3200  H  HA   . VAL A 1 59 ? 6.456   -8.630  3.529   1.00 0.00 ? 59  VAL A HA   3  
ATOM   3201  H  HB   . VAL A 1 59 ? 5.729   -6.033  4.889   1.00 0.00 ? 59  VAL A HB   3  
ATOM   3202  H  HG11 . VAL A 1 59 ? 7.213   -6.538  6.508   1.00 0.00 ? 59  VAL A HG11 3  
ATOM   3203  H  HG12 . VAL A 1 59 ? 6.891   -8.200  6.008   1.00 0.00 ? 59  VAL A HG12 3  
ATOM   3204  H  HG13 . VAL A 1 59 ? 8.312   -7.352  5.394   1.00 0.00 ? 59  VAL A HG13 3  
ATOM   3205  H  HG21 . VAL A 1 59 ? 7.434   -4.958  3.810   1.00 0.00 ? 59  VAL A HG21 3  
ATOM   3206  H  HG22 . VAL A 1 59 ? 8.336   -6.444  3.515   1.00 0.00 ? 59  VAL A HG22 3  
ATOM   3207  H  HG23 . VAL A 1 59 ? 6.922   -6.061  2.533   1.00 0.00 ? 59  VAL A HG23 3  
ATOM   3208  N  N    . GLU A 1 60 ? 4.983   -9.784  5.137   1.00 0.00 ? 60  GLU A N    3  
ATOM   3209  C  CA   . GLU A 1 60 ? 4.123   -10.501 6.072   1.00 0.00 ? 60  GLU A CA   3  
ATOM   3210  C  C    . GLU A 1 60 ? 2.661   -10.414 5.642   1.00 0.00 ? 60  GLU A C    3  
ATOM   3211  O  O    . GLU A 1 60 ? 1.772   -10.204 6.467   1.00 0.00 ? 60  GLU A O    3  
ATOM   3212  C  CB   . GLU A 1 60 ? 4.285   -9.935  7.484   1.00 0.00 ? 60  GLU A CB   3  
ATOM   3213  C  CG   . GLU A 1 60 ? 5.699   -10.051 8.028   1.00 0.00 ? 60  GLU A CG   3  
ATOM   3214  C  CD   . GLU A 1 60 ? 5.734   -10.176 9.539   1.00 0.00 ? 60  GLU A CD   3  
ATOM   3215  O  OE1  . GLU A 1 60 ? 4.813   -9.651  10.199  1.00 0.00 ? 60  GLU A OE1  3  
ATOM   3216  O  OE2  . GLU A 1 60 ? 6.682   -10.798 10.061  1.00 0.00 ? 60  GLU A OE2  3  
ATOM   3217  H  H    . GLU A 1 60 ? 5.750   -10.248 4.742   1.00 0.00 ? 60  GLU A H    3  
ATOM   3218  H  HA   . GLU A 1 60 ? 4.424   -11.537 6.072   1.00 0.00 ? 60  GLU A HA   3  
ATOM   3219  H  HB2  . GLU A 1 60 ? 4.008   -8.891  7.475   1.00 0.00 ? 60  GLU A HB2  3  
ATOM   3220  H  HB3  . GLU A 1 60 ? 3.621   -10.468 8.150   1.00 0.00 ? 60  GLU A HB3  3  
ATOM   3221  H  HG2  . GLU A 1 60 ? 6.165   -10.925 7.599   1.00 0.00 ? 60  GLU A HG2  3  
ATOM   3222  H  HG3  . GLU A 1 60 ? 6.254   -9.171  7.741   1.00 0.00 ? 60  GLU A HG3  3  
ATOM   3223  N  N    . ASP A 1 61 ? 2.421   -10.577 4.345   1.00 0.00 ? 61  ASP A N    3  
ATOM   3224  C  CA   . ASP A 1 61 ? 1.068   -10.518 3.805   1.00 0.00 ? 61  ASP A CA   3  
ATOM   3225  C  C    . ASP A 1 61 ? 0.442   -9.150  4.055   1.00 0.00 ? 61  ASP A C    3  
ATOM   3226  O  O    . ASP A 1 61 ? -0.770  -9.036  4.237   1.00 0.00 ? 61  ASP A O    3  
ATOM   3227  C  CB   . ASP A 1 61 ? 0.199   -11.612 4.427   1.00 0.00 ? 61  ASP A CB   3  
ATOM   3228  C  CG   . ASP A 1 61 ? -1.070  -11.863 3.637   1.00 0.00 ? 61  ASP A CG   3  
ATOM   3229  O  OD1  . ASP A 1 61 ? -1.527  -10.935 2.937   1.00 0.00 ? 61  ASP A OD1  3  
ATOM   3230  O  OD2  . ASP A 1 61 ? -1.606  -12.988 3.718   1.00 0.00 ? 61  ASP A OD2  3  
ATOM   3231  H  H    . ASP A 1 61 ? 3.173   -10.742 3.738   1.00 0.00 ? 61  ASP A H    3  
ATOM   3232  H  HA   . ASP A 1 61 ? 1.130   -10.683 2.739   1.00 0.00 ? 61  ASP A HA   3  
ATOM   3233  H  HB2  . ASP A 1 61 ? 0.764   -12.533 4.467   1.00 0.00 ? 61  ASP A HB2  3  
ATOM   3234  H  HB3  . ASP A 1 61 ? -0.074  -11.319 5.430   1.00 0.00 ? 61  ASP A HB3  3  
ATOM   3235  N  N    . GLN A 1 62 ? 1.277   -8.116  4.064   1.00 0.00 ? 62  GLN A N    3  
ATOM   3236  C  CA   . GLN A 1 62 ? 0.804   -6.756  4.294   1.00 0.00 ? 62  GLN A CA   3  
ATOM   3237  C  C    . GLN A 1 62 ? 1.394   -5.794  3.268   1.00 0.00 ? 62  GLN A C    3  
ATOM   3238  O  O    . GLN A 1 62 ? 2.194   -6.190  2.420   1.00 0.00 ? 62  GLN A O    3  
ATOM   3239  C  CB   . GLN A 1 62 ? 1.169   -6.299  5.708   1.00 0.00 ? 62  GLN A CB   3  
ATOM   3240  C  CG   . GLN A 1 62 ? 0.357   -6.981  6.796   1.00 0.00 ? 62  GLN A CG   3  
ATOM   3241  C  CD   . GLN A 1 62 ? 1.113   -7.095  8.105   1.00 0.00 ? 62  GLN A CD   3  
ATOM   3242  O  OE1  . GLN A 1 62 ? 2.268   -7.522  8.132   1.00 0.00 ? 62  GLN A OE1  3  
ATOM   3243  N  NE2  . GLN A 1 62 ? 0.466   -6.712  9.199   1.00 0.00 ? 62  GLN A NE2  3  
ATOM   3244  H  H    . GLN A 1 62 ? 2.232   -8.271  3.913   1.00 0.00 ? 62  GLN A H    3  
ATOM   3245  H  HA   . GLN A 1 62 ? -0.270  -6.756  4.192   1.00 0.00 ? 62  GLN A HA   3  
ATOM   3246  H  HB2  . GLN A 1 62 ? 2.214   -6.509  5.883   1.00 0.00 ? 62  GLN A HB2  3  
ATOM   3247  H  HB3  . GLN A 1 62 ? 1.007   -5.234  5.782   1.00 0.00 ? 62  GLN A HB3  3  
ATOM   3248  H  HG2  . GLN A 1 62 ? -0.543  -6.409  6.968   1.00 0.00 ? 62  GLN A HG2  3  
ATOM   3249  H  HG3  . GLN A 1 62 ? 0.093   -7.974  6.462   1.00 0.00 ? 62  GLN A HG3  3  
ATOM   3250  H  HE21 . GLN A 1 62 ? -0.453  -6.384  9.101   1.00 0.00 ? 62  GLN A HE21 3  
ATOM   3251  H  HE22 . GLN A 1 62 ? 0.930   -6.776  10.058  1.00 0.00 ? 62  GLN A HE22 3  
ATOM   3252  N  N    . ILE A 1 63 ? 0.993   -4.530  3.351   1.00 0.00 ? 63  ILE A N    3  
ATOM   3253  C  CA   . ILE A 1 63 ? 1.483   -3.511  2.430   1.00 0.00 ? 63  ILE A CA   3  
ATOM   3254  C  C    . ILE A 1 63 ? 2.092   -2.335  3.184   1.00 0.00 ? 63  ILE A C    3  
ATOM   3255  O  O    . ILE A 1 63 ? 1.570   -1.906  4.214   1.00 0.00 ? 63  ILE A O    3  
ATOM   3256  C  CB   . ILE A 1 63 ? 0.358   -2.993  1.514   1.00 0.00 ? 63  ILE A CB   3  
ATOM   3257  C  CG1  . ILE A 1 63 ? -0.799  -2.446  2.352   1.00 0.00 ? 63  ILE A CG1  3  
ATOM   3258  C  CG2  . ILE A 1 63 ? -0.126  -4.101  0.591   1.00 0.00 ? 63  ILE A CG2  3  
ATOM   3259  C  CD1  . ILE A 1 63 ? -1.624  -1.400  1.633   1.00 0.00 ? 63  ILE A CD1  3  
ATOM   3260  H  H    . ILE A 1 63 ? 0.354   -4.275  4.048   1.00 0.00 ? 63  ILE A H    3  
ATOM   3261  H  HA   . ILE A 1 63 ? 2.245   -3.962  1.810   1.00 0.00 ? 63  ILE A HA   3  
ATOM   3262  H  HB   . ILE A 1 63 ? 0.759   -2.198  0.904   1.00 0.00 ? 63  ILE A HB   3  
ATOM   3263  H  HG12 . ILE A 1 63 ? -1.456  -3.258  2.621   1.00 0.00 ? 63  ILE A HG12 3  
ATOM   3264  H  HG13 . ILE A 1 63 ? -0.402  -1.996  3.251   1.00 0.00 ? 63  ILE A HG13 3  
ATOM   3265  H  HG21 . ILE A 1 63 ? -0.788  -4.758  1.135   1.00 0.00 ? 63  ILE A HG21 3  
ATOM   3266  H  HG22 . ILE A 1 63 ? -0.657  -3.667  -0.243  1.00 0.00 ? 63  ILE A HG22 3  
ATOM   3267  H  HG23 . ILE A 1 63 ? 0.721   -4.663  0.227   1.00 0.00 ? 63  ILE A HG23 3  
ATOM   3268  H  HD11 . ILE A 1 63 ? -1.100  -1.076  0.746   1.00 0.00 ? 63  ILE A HD11 3  
ATOM   3269  H  HD12 . ILE A 1 63 ? -2.578  -1.822  1.356   1.00 0.00 ? 63  ILE A HD12 3  
ATOM   3270  H  HD13 . ILE A 1 63 ? -1.781  -0.554  2.287   1.00 0.00 ? 63  ILE A HD13 3  
ATOM   3271  N  N    . TYR A 1 64 ? 3.199   -1.815  2.665   1.00 0.00 ? 64  TYR A N    3  
ATOM   3272  C  CA   . TYR A 1 64 ? 3.880   -0.688  3.289   1.00 0.00 ? 64  TYR A CA   3  
ATOM   3273  C  C    . TYR A 1 64 ? 4.595   0.163   2.244   1.00 0.00 ? 64  TYR A C    3  
ATOM   3274  O  O    . TYR A 1 64 ? 4.834   -0.281  1.121   1.00 0.00 ? 64  TYR A O    3  
ATOM   3275  C  CB   . TYR A 1 64 ? 4.883   -1.185  4.332   1.00 0.00 ? 64  TYR A CB   3  
ATOM   3276  C  CG   . TYR A 1 64 ? 4.275   -2.102  5.369   1.00 0.00 ? 64  TYR A CG   3  
ATOM   3277  C  CD1  . TYR A 1 64 ? 3.628   -1.587  6.485   1.00 0.00 ? 64  TYR A CD1  3  
ATOM   3278  C  CD2  . TYR A 1 64 ? 4.348   -3.482  5.233   1.00 0.00 ? 64  TYR A CD2  3  
ATOM   3279  C  CE1  . TYR A 1 64 ? 3.071   -2.420  7.436   1.00 0.00 ? 64  TYR A CE1  3  
ATOM   3280  C  CE2  . TYR A 1 64 ? 3.792   -4.323  6.177   1.00 0.00 ? 64  TYR A CE2  3  
ATOM   3281  C  CZ   . TYR A 1 64 ? 3.155   -3.788  7.277   1.00 0.00 ? 64  TYR A CZ   3  
ATOM   3282  O  OH   . TYR A 1 64 ? 2.602   -4.622  8.221   1.00 0.00 ? 64  TYR A OH   3  
ATOM   3283  H  H    . TYR A 1 64 ? 3.568   -2.200  1.842   1.00 0.00 ? 64  TYR A H    3  
ATOM   3284  H  HA   . TYR A 1 64 ? 3.135   -0.081  3.782   1.00 0.00 ? 64  TYR A HA   3  
ATOM   3285  H  HB2  . TYR A 1 64 ? 5.672   -1.727  3.833   1.00 0.00 ? 64  TYR A HB2  3  
ATOM   3286  H  HB3  . TYR A 1 64 ? 5.307   -0.335  4.847   1.00 0.00 ? 64  TYR A HB3  3  
ATOM   3287  H  HD1  . TYR A 1 64 ? 3.563   -0.515  6.607   1.00 0.00 ? 64  TYR A HD1  3  
ATOM   3288  H  HD2  . TYR A 1 64 ? 4.848   -3.899  4.370   1.00 0.00 ? 64  TYR A HD2  3  
ATOM   3289  H  HE1  . TYR A 1 64 ? 2.572   -2.001  8.297   1.00 0.00 ? 64  TYR A HE1  3  
ATOM   3290  H  HE2  . TYR A 1 64 ? 3.859   -5.394  6.054   1.00 0.00 ? 64  TYR A HE2  3  
ATOM   3291  H  HH   . TYR A 1 64 ? 3.280   -5.208  8.566   1.00 0.00 ? 64  TYR A HH   3  
ATOM   3292  N  N    . CYS A 1 65 ? 4.935   1.391   2.623   1.00 0.00 ? 65  CYS A N    3  
ATOM   3293  C  CA   . CYS A 1 65 ? 5.623   2.307   1.721   1.00 0.00 ? 65  CYS A CA   3  
ATOM   3294  C  C    . CYS A 1 65 ? 7.105   1.957   1.616   1.00 0.00 ? 65  CYS A C    3  
ATOM   3295  O  O    . CYS A 1 65 ? 7.733   1.573   2.603   1.00 0.00 ? 65  CYS A O    3  
ATOM   3296  C  CB   . CYS A 1 65 ? 5.462   3.749   2.205   1.00 0.00 ? 65  CYS A CB   3  
ATOM   3297  S  SG   . CYS A 1 65 ? 5.765   3.974   3.987   1.00 0.00 ? 65  CYS A SG   3  
ATOM   3298  H  H    . CYS A 1 65 ? 4.718   1.689   3.532   1.00 0.00 ? 65  CYS A H    3  
ATOM   3299  H  HA   . CYS A 1 65 ? 5.174   2.212   0.745   1.00 0.00 ? 65  CYS A HA   3  
ATOM   3300  H  HB2  . CYS A 1 65 ? 6.159   4.380   1.672   1.00 0.00 ? 65  CYS A HB2  3  
ATOM   3301  H  HB3  . CYS A 1 65 ? 4.455   4.080   1.997   1.00 0.00 ? 65  CYS A HB3  3  
ATOM   3302  N  N    . GLU A 1 66 ? 7.656   2.092   0.414   1.00 0.00 ? 66  GLU A N    3  
ATOM   3303  C  CA   . GLU A 1 66 ? 9.063   1.789   0.181   1.00 0.00 ? 66  GLU A CA   3  
ATOM   3304  C  C    . GLU A 1 66 ? 9.908   2.161   1.396   1.00 0.00 ? 66  GLU A C    3  
ATOM   3305  O  O    . GLU A 1 66 ? 10.775  1.397   1.821   1.00 0.00 ? 66  GLU A O    3  
ATOM   3306  C  CB   . GLU A 1 66 ? 9.570   2.536   -1.055  1.00 0.00 ? 66  GLU A CB   3  
ATOM   3307  C  CG   . GLU A 1 66 ? 11.068  2.404   -1.273  1.00 0.00 ? 66  GLU A CG   3  
ATOM   3308  C  CD   . GLU A 1 66 ? 11.531  3.066   -2.556  1.00 0.00 ? 66  GLU A CD   3  
ATOM   3309  O  OE1  . GLU A 1 66 ? 11.504  2.400   -3.612  1.00 0.00 ? 66  GLU A OE1  3  
ATOM   3310  O  OE2  . GLU A 1 66 ? 11.920  4.252   -2.504  1.00 0.00 ? 66  GLU A OE2  3  
ATOM   3311  H  H    . GLU A 1 66 ? 7.103   2.402   -0.333  1.00 0.00 ? 66  GLU A H    3  
ATOM   3312  H  HA   . GLU A 1 66 ? 9.149   0.727   0.009   1.00 0.00 ? 66  GLU A HA   3  
ATOM   3313  H  HB2  . GLU A 1 66 ? 9.064   2.149   -1.927  1.00 0.00 ? 66  GLU A HB2  3  
ATOM   3314  H  HB3  . GLU A 1 66 ? 9.334   3.584   -0.948  1.00 0.00 ? 66  GLU A HB3  3  
ATOM   3315  H  HG2  . GLU A 1 66 ? 11.582  2.866   -0.443  1.00 0.00 ? 66  GLU A HG2  3  
ATOM   3316  H  HG3  . GLU A 1 66 ? 11.322  1.355   -1.314  1.00 0.00 ? 66  GLU A HG3  3  
ATOM   3317  N  N    . LYS A 1 67 ? 9.649   3.340   1.951   1.00 0.00 ? 67  LYS A N    3  
ATOM   3318  C  CA   . LYS A 1 67 ? 10.384  3.815   3.117   1.00 0.00 ? 67  LYS A CA   3  
ATOM   3319  C  C    . LYS A 1 67 ? 10.299  2.809   4.260   1.00 0.00 ? 67  LYS A C    3  
ATOM   3320  O  O    . LYS A 1 67 ? 11.313  2.263   4.697   1.00 0.00 ? 67  LYS A O    3  
ATOM   3321  C  CB   . LYS A 1 67 ? 9.837   5.169   3.574   1.00 0.00 ? 67  LYS A CB   3  
ATOM   3322  C  CG   . LYS A 1 67 ? 10.401  5.636   4.904   1.00 0.00 ? 67  LYS A CG   3  
ATOM   3323  C  CD   . LYS A 1 67 ? 9.471   6.622   5.590   1.00 0.00 ? 67  LYS A CD   3  
ATOM   3324  C  CE   . LYS A 1 67 ? 9.760   8.052   5.160   1.00 0.00 ? 67  LYS A CE   3  
ATOM   3325  N  NZ   . LYS A 1 67 ? 10.934  8.621   5.879   1.00 0.00 ? 67  LYS A NZ   3  
ATOM   3326  H  H    . LYS A 1 67 ? 8.946   3.905   1.566   1.00 0.00 ? 67  LYS A H    3  
ATOM   3327  H  HA   . LYS A 1 67 ? 11.419  3.932   2.833   1.00 0.00 ? 67  LYS A HA   3  
ATOM   3328  H  HB2  . LYS A 1 67 ? 10.074  5.911   2.825   1.00 0.00 ? 67  LYS A HB2  3  
ATOM   3329  H  HB3  . LYS A 1 67 ? 8.763   5.096   3.668   1.00 0.00 ? 67  LYS A HB3  3  
ATOM   3330  H  HG2  . LYS A 1 67 ? 10.538  4.780   5.548   1.00 0.00 ? 67  LYS A HG2  3  
ATOM   3331  H  HG3  . LYS A 1 67 ? 11.355  6.115   4.732   1.00 0.00 ? 67  LYS A HG3  3  
ATOM   3332  H  HD2  . LYS A 1 67 ? 8.450   6.380   5.332   1.00 0.00 ? 67  LYS A HD2  3  
ATOM   3333  H  HD3  . LYS A 1 67 ? 9.602   6.543   6.660   1.00 0.00 ? 67  LYS A HD3  3  
ATOM   3334  H  HE2  . LYS A 1 67 ? 9.958   8.063   4.100   1.00 0.00 ? 67  LYS A HE2  3  
ATOM   3335  H  HE3  . LYS A 1 67 ? 8.892   8.660   5.370   1.00 0.00 ? 67  LYS A HE3  3  
ATOM   3336  H  HZ1  . LYS A 1 67 ? 11.678  8.878   5.199   1.00 0.00 ? 67  LYS A HZ1  3  
ATOM   3337  H  HZ2  . LYS A 1 67 ? 11.317  7.921   6.546   1.00 0.00 ? 67  LYS A HZ2  3  
ATOM   3338  H  HZ3  . LYS A 1 67 ? 10.653  9.471   6.407   1.00 0.00 ? 67  LYS A HZ3  3  
ATOM   3339  N  N    . HIS A 1 68 ? 9.083   2.566   4.740   1.00 0.00 ? 68  HIS A N    3  
ATOM   3340  C  CA   . HIS A 1 68 ? 8.867   1.623   5.831   1.00 0.00 ? 68  HIS A CA   3  
ATOM   3341  C  C    . HIS A 1 68 ? 9.273   0.211   5.419   1.00 0.00 ? 68  HIS A C    3  
ATOM   3342  O  O    . HIS A 1 68 ? 10.078  -0.434  6.089   1.00 0.00 ? 68  HIS A O    3  
ATOM   3343  C  CB   . HIS A 1 68 ? 7.400   1.638   6.263   1.00 0.00 ? 68  HIS A CB   3  
ATOM   3344  C  CG   . HIS A 1 68 ? 7.100   2.648   7.328   1.00 0.00 ? 68  HIS A CG   3  
ATOM   3345  N  ND1  . HIS A 1 68 ? 5.950   3.410   7.340   1.00 0.00 ? 68  HIS A ND1  3  
ATOM   3346  C  CD2  . HIS A 1 68 ? 7.806   3.018   8.422   1.00 0.00 ? 68  HIS A CD2  3  
ATOM   3347  C  CE1  . HIS A 1 68 ? 5.964   4.206   8.394   1.00 0.00 ? 68  HIS A CE1  3  
ATOM   3348  N  NE2  . HIS A 1 68 ? 7.079   3.987   9.067   1.00 0.00 ? 68  HIS A NE2  3  
ATOM   3349  H  H    . HIS A 1 68 ? 8.314   3.031   4.350   1.00 0.00 ? 68  HIS A H    3  
ATOM   3350  H  HA   . HIS A 1 68 ? 9.481   1.932   6.664   1.00 0.00 ? 68  HIS A HA   3  
ATOM   3351  H  HB2  . HIS A 1 68 ? 6.782   1.866   5.407   1.00 0.00 ? 68  HIS A HB2  3  
ATOM   3352  H  HB3  . HIS A 1 68 ? 7.133   0.663   6.645   1.00 0.00 ? 68  HIS A HB3  3  
ATOM   3353  H  HD2  . HIS A 1 68 ? 8.764   2.624   8.730   1.00 0.00 ? 68  HIS A HD2  3  
ATOM   3354  H  HE1  . HIS A 1 68 ? 5.194   4.915   8.661   1.00 0.00 ? 68  HIS A HE1  3  
ATOM   3355  H  HE2  . HIS A 1 68 ? 7.380   4.504   9.843   1.00 0.00 ? 68  HIS A HE2  3  
ATOM   3356  N  N    . ALA A 1 69 ? 8.709   -0.262  4.312   1.00 0.00 ? 69  ALA A N    3  
ATOM   3357  C  CA   . ALA A 1 69 ? 9.014   -1.596  3.810   1.00 0.00 ? 69  ALA A CA   3  
ATOM   3358  C  C    . ALA A 1 69 ? 10.473  -1.959  4.065   1.00 0.00 ? 69  ALA A C    3  
ATOM   3359  O  O    . ALA A 1 69 ? 10.768  -2.892  4.811   1.00 0.00 ? 69  ALA A O    3  
ATOM   3360  C  CB   . ALA A 1 69 ? 8.698   -1.685  2.324   1.00 0.00 ? 69  ALA A CB   3  
ATOM   3361  H  H    . ALA A 1 69 ? 8.075   0.300   3.821   1.00 0.00 ? 69  ALA A H    3  
ATOM   3362  H  HA   . ALA A 1 69 ? 8.381   -2.301  4.330   1.00 0.00 ? 69  ALA A HA   3  
ATOM   3363  H  HB1  . ALA A 1 69 ? 8.331   -0.730  1.977   1.00 0.00 ? 69  ALA A HB1  3  
ATOM   3364  H  HB2  . ALA A 1 69 ? 9.593   -1.947  1.781   1.00 0.00 ? 69  ALA A HB2  3  
ATOM   3365  H  HB3  . ALA A 1 69 ? 7.944   -2.441  2.162   1.00 0.00 ? 69  ALA A HB3  3  
ATOM   3366  N  N    . ARG A 1 70 ? 11.380  -1.216  3.440   1.00 0.00 ? 70  ARG A N    3  
ATOM   3367  C  CA   . ARG A 1 70 ? 12.809  -1.461  3.599   1.00 0.00 ? 70  ARG A CA   3  
ATOM   3368  C  C    . ARG A 1 70 ? 13.165  -1.668  5.068   1.00 0.00 ? 70  ARG A C    3  
ATOM   3369  O  O    . ARG A 1 70 ? 13.930  -2.569  5.410   1.00 0.00 ? 70  ARG A O    3  
ATOM   3370  C  CB   . ARG A 1 70 ? 13.615  -0.294  3.027   1.00 0.00 ? 70  ARG A CB   3  
ATOM   3371  C  CG   . ARG A 1 70 ? 13.548  -0.193  1.511   1.00 0.00 ? 70  ARG A CG   3  
ATOM   3372  C  CD   . ARG A 1 70 ? 14.762  0.528   0.947   1.00 0.00 ? 70  ARG A CD   3  
ATOM   3373  N  NE   . ARG A 1 70 ? 14.679  0.689   -0.502  1.00 0.00 ? 70  ARG A NE   3  
ATOM   3374  C  CZ   . ARG A 1 70 ? 15.421  1.550   -1.190  1.00 0.00 ? 70  ARG A CZ   3  
ATOM   3375  N  NH1  . ARG A 1 70 ? 16.297  2.323   -0.564  1.00 0.00 ? 70  ARG A NH1  3  
ATOM   3376  N  NH2  . ARG A 1 70 ? 15.288  1.638   -2.507  1.00 0.00 ? 70  ARG A NH2  3  
ATOM   3377  H  H    . ARG A 1 70 ? 11.083  -0.486  2.858   1.00 0.00 ? 70  ARG A H    3  
ATOM   3378  H  HA   . ARG A 1 70 ? 13.054  -2.359  3.052   1.00 0.00 ? 70  ARG A HA   3  
ATOM   3379  H  HB2  . ARG A 1 70 ? 13.238  0.628   3.444   1.00 0.00 ? 70  ARG A HB2  3  
ATOM   3380  H  HB3  . ARG A 1 70 ? 14.649  -0.412  3.312   1.00 0.00 ? 70  ARG A HB3  3  
ATOM   3381  H  HG2  . ARG A 1 70 ? 13.509  -1.188  1.095   1.00 0.00 ? 70  ARG A HG2  3  
ATOM   3382  H  HG3  . ARG A 1 70 ? 12.657  0.351   1.236   1.00 0.00 ? 70  ARG A HG3  3  
ATOM   3383  H  HD2  . ARG A 1 70 ? 14.830  1.504   1.404   1.00 0.00 ? 70  ARG A HD2  3  
ATOM   3384  H  HD3  . ARG A 1 70 ? 15.647  -0.043  1.187   1.00 0.00 ? 70  ARG A HD3  3  
ATOM   3385  H  HE   . ARG A 1 70 ? 14.038  0.127   -0.985  1.00 0.00 ? 70  ARG A HE   3  
ATOM   3386  H  HH11 . ARG A 1 70 ? 16.400  2.258   0.429   1.00 0.00 ? 70  ARG A HH11 3  
ATOM   3387  H  HH12 . ARG A 1 70 ? 16.855  2.970   -1.084  1.00 0.00 ? 70  ARG A HH12 3  
ATOM   3388  H  HH21 . ARG A 1 70 ? 14.628  1.056   -2.983  1.00 0.00 ? 70  ARG A HH21 3  
ATOM   3389  H  HH22 . ARG A 1 70 ? 15.846  2.286   -3.024  1.00 0.00 ? 70  ARG A HH22 3  
ATOM   3390  N  N    . GLU A 1 71 ? 12.606  -0.825  5.932   1.00 0.00 ? 71  GLU A N    3  
ATOM   3391  C  CA   . GLU A 1 71 ? 12.867  -0.915  7.363   1.00 0.00 ? 71  GLU A CA   3  
ATOM   3392  C  C    . GLU A 1 71 ? 12.409  -2.262  7.916   1.00 0.00 ? 71  GLU A C    3  
ATOM   3393  O  O    . GLU A 1 71 ? 12.962  -2.764  8.895   1.00 0.00 ? 71  GLU A O    3  
ATOM   3394  C  CB   . GLU A 1 71 ? 12.159  0.220   8.105   1.00 0.00 ? 71  GLU A CB   3  
ATOM   3395  C  CG   . GLU A 1 71 ? 12.598  1.605   7.660   1.00 0.00 ? 71  GLU A CG   3  
ATOM   3396  C  CD   . GLU A 1 71 ? 12.506  2.632   8.772   1.00 0.00 ? 71  GLU A CD   3  
ATOM   3397  O  OE1  . GLU A 1 71 ? 13.217  2.474   9.786   1.00 0.00 ? 71  GLU A OE1  3  
ATOM   3398  O  OE2  . GLU A 1 71 ? 11.722  3.594   8.628   1.00 0.00 ? 71  GLU A OE2  3  
ATOM   3399  H  H    . GLU A 1 71 ? 12.005  -0.127  5.598   1.00 0.00 ? 71  GLU A H    3  
ATOM   3400  H  HA   . GLU A 1 71 ? 13.932  -0.822  7.513   1.00 0.00 ? 71  GLU A HA   3  
ATOM   3401  H  HB2  . GLU A 1 71 ? 11.095  0.133   7.943   1.00 0.00 ? 71  GLU A HB2  3  
ATOM   3402  H  HB3  . GLU A 1 71 ? 12.361  0.124   9.162   1.00 0.00 ? 71  GLU A HB3  3  
ATOM   3403  H  HG2  . GLU A 1 71 ? 13.623  1.553   7.324   1.00 0.00 ? 71  GLU A HG2  3  
ATOM   3404  H  HG3  . GLU A 1 71 ? 11.968  1.923   6.843   1.00 0.00 ? 71  GLU A HG3  3  
ATOM   3405  N  N    . ARG A 1 72 ? 11.394  -2.841  7.283   1.00 0.00 ? 72  ARG A N    3  
ATOM   3406  C  CA   . ARG A 1 72 ? 10.860  -4.128  7.711   1.00 0.00 ? 72  ARG A CA   3  
ATOM   3407  C  C    . ARG A 1 72 ? 11.723  -5.274  7.193   1.00 0.00 ? 72  ARG A C    3  
ATOM   3408  O  O    . ARG A 1 72 ? 12.208  -6.100  7.967   1.00 0.00 ? 72  ARG A O    3  
ATOM   3409  C  CB   . ARG A 1 72 ? 9.421   -4.296  7.220   1.00 0.00 ? 72  ARG A CB   3  
ATOM   3410  C  CG   . ARG A 1 72 ? 8.409   -3.482  8.009   1.00 0.00 ? 72  ARG A CG   3  
ATOM   3411  C  CD   . ARG A 1 72 ? 7.005   -3.641  7.446   1.00 0.00 ? 72  ARG A CD   3  
ATOM   3412  N  NE   . ARG A 1 72 ? 6.278   -4.731  8.091   1.00 0.00 ? 72  ARG A NE   3  
ATOM   3413  C  CZ   . ARG A 1 72 ? 5.968   -4.746  9.382   1.00 0.00 ? 72  ARG A CZ   3  
ATOM   3414  N  NH1  . ARG A 1 72 ? 6.321   -3.735  10.164  1.00 0.00 ? 72  ARG A NH1  3  
ATOM   3415  N  NH2  . ARG A 1 72 ? 5.304   -5.774  9.895   1.00 0.00 ? 72  ARG A NH2  3  
ATOM   3416  H  H    . ARG A 1 72 ? 10.994  -2.391  6.509   1.00 0.00 ? 72  ARG A H    3  
ATOM   3417  H  HA   . ARG A 1 72 ? 10.867  -4.147  8.791   1.00 0.00 ? 72  ARG A HA   3  
ATOM   3418  H  HB2  . ARG A 1 72 ? 9.368   -3.990  6.185   1.00 0.00 ? 72  ARG A HB2  3  
ATOM   3419  H  HB3  . ARG A 1 72 ? 9.148   -5.338  7.293   1.00 0.00 ? 72  ARG A HB3  3  
ATOM   3420  H  HG2  . ARG A 1 72 ? 8.413   -3.817  9.036   1.00 0.00 ? 72  ARG A HG2  3  
ATOM   3421  H  HG3  . ARG A 1 72 ? 8.688   -2.440  7.967   1.00 0.00 ? 72  ARG A HG3  3  
ATOM   3422  H  HD2  . ARG A 1 72 ? 6.463   -2.720  7.600   1.00 0.00 ? 72  ARG A HD2  3  
ATOM   3423  H  HD3  . ARG A 1 72 ? 7.077   -3.844  6.388   1.00 0.00 ? 72  ARG A HD3  3  
ATOM   3424  H  HE   . ARG A 1 72 ? 6.007   -5.489  7.532   1.00 0.00 ? 72  ARG A HE   3  
ATOM   3425  H  HH11 . ARG A 1 72 ? 6.821   -2.958  9.780   1.00 0.00 ? 72  ARG A HH11 3  
ATOM   3426  H  HH12 . ARG A 1 72 ? 6.086   -3.748  11.136  1.00 0.00 ? 72  ARG A HH12 3  
ATOM   3427  H  HH21 . ARG A 1 72 ? 5.037   -6.539  9.309   1.00 0.00 ? 72  ARG A HH21 3  
ATOM   3428  H  HH22 . ARG A 1 72 ? 5.072   -5.785  10.867  1.00 0.00 ? 72  ARG A HH22 3  
ATOM   3429  N  N    . VAL A 1 73 ? 11.910  -5.320  5.878   1.00 0.00 ? 73  VAL A N    3  
ATOM   3430  C  CA   . VAL A 1 73 ? 12.715  -6.364  5.256   1.00 0.00 ? 73  VAL A CA   3  
ATOM   3431  C  C    . VAL A 1 73 ? 13.954  -6.673  6.089   1.00 0.00 ? 73  VAL A C    3  
ATOM   3432  O  O    . VAL A 1 73 ? 14.503  -7.772  6.019   1.00 0.00 ? 73  VAL A O    3  
ATOM   3433  C  CB   . VAL A 1 73 ? 13.152  -5.965  3.834   1.00 0.00 ? 73  VAL A CB   3  
ATOM   3434  C  CG1  . VAL A 1 73 ? 12.142  -5.012  3.213   1.00 0.00 ? 73  VAL A CG1  3  
ATOM   3435  C  CG2  . VAL A 1 73 ? 14.539  -5.342  3.859   1.00 0.00 ? 73  VAL A CG2  3  
ATOM   3436  H  H    . VAL A 1 73 ? 11.498  -4.634  5.312   1.00 0.00 ? 73  VAL A H    3  
ATOM   3437  H  HA   . VAL A 1 73 ? 12.109  -7.256  5.186   1.00 0.00 ? 73  VAL A HA   3  
ATOM   3438  H  HB   . VAL A 1 73 ? 13.192  -6.857  3.227   1.00 0.00 ? 73  VAL A HB   3  
ATOM   3439  H  HG11 . VAL A 1 73 ? 12.232  -4.040  3.676   1.00 0.00 ? 73  VAL A HG11 3  
ATOM   3440  H  HG12 . VAL A 1 73 ? 12.332  -4.926  2.153   1.00 0.00 ? 73  VAL A HG12 3  
ATOM   3441  H  HG13 . VAL A 1 73 ? 11.143  -5.393  3.370   1.00 0.00 ? 73  VAL A HG13 3  
ATOM   3442  H  HG21 . VAL A 1 73 ? 14.829  -5.071  2.855   1.00 0.00 ? 73  VAL A HG21 3  
ATOM   3443  H  HG22 . VAL A 1 73 ? 14.527  -4.458  4.480   1.00 0.00 ? 73  VAL A HG22 3  
ATOM   3444  H  HG23 . VAL A 1 73 ? 15.246  -6.053  4.259   1.00 0.00 ? 73  VAL A HG23 3  
ATOM   3445  N  N    . SER A 1 74 ? 14.389  -5.695  6.876   1.00 0.00 ? 74  SER A N    3  
ATOM   3446  C  CA   . SER A 1 74 ? 15.566  -5.860  7.721   1.00 0.00 ? 74  SER A CA   3  
ATOM   3447  C  C    . SER A 1 74 ? 15.459  -7.130  8.559   1.00 0.00 ? 74  SER A C    3  
ATOM   3448  O  O    . SER A 1 74 ? 16.400  -7.919  8.634   1.00 0.00 ? 74  SER A O    3  
ATOM   3449  C  CB   . SER A 1 74 ? 15.739  -4.645  8.635   1.00 0.00 ? 74  SER A CB   3  
ATOM   3450  O  OG   . SER A 1 74 ? 16.740  -4.879  9.610   1.00 0.00 ? 74  SER A OG   3  
ATOM   3451  H  H    . SER A 1 74 ? 13.908  -4.840  6.888   1.00 0.00 ? 74  SER A H    3  
ATOM   3452  H  HA   . SER A 1 74 ? 16.429  -5.940  7.076   1.00 0.00 ? 74  SER A HA   3  
ATOM   3453  H  HB2  . SER A 1 74 ? 16.024  -3.789  8.042   1.00 0.00 ? 74  SER A HB2  3  
ATOM   3454  H  HB3  . SER A 1 74 ? 14.805  -4.441  9.137   1.00 0.00 ? 74  SER A HB3  3  
ATOM   3455  H  HG   . SER A 1 74 ? 16.593  -4.305  10.365  1.00 0.00 ? 74  SER A HG   3  
ATOM   3456  N  N    . GLY A 1 75 ? 14.304  -7.321  9.190   1.00 0.00 ? 75  GLY A N    3  
ATOM   3457  C  CA   . GLY A 1 75 ? 14.094  -8.496  10.015  1.00 0.00 ? 75  GLY A CA   3  
ATOM   3458  C  C    . GLY A 1 75 ? 12.748  -8.482  10.712  1.00 0.00 ? 75  GLY A C    3  
ATOM   3459  O  O    . GLY A 1 75 ? 12.250  -7.434  11.125  1.00 0.00 ? 75  GLY A O    3  
ATOM   3460  H  H    . GLY A 1 75 ? 13.589  -6.657  9.094   1.00 0.00 ? 75  GLY A H    3  
ATOM   3461  H  HA2  . GLY A 1 75 ? 14.156  -9.375  9.392   1.00 0.00 ? 75  GLY A HA2  3  
ATOM   3462  H  HA3  . GLY A 1 75 ? 14.873  -8.541  10.762  1.00 0.00 ? 75  GLY A HA3  3  
ATOM   3463  N  N    . PRO A 1 76 ? 12.136  -9.667  10.850  1.00 0.00 ? 76  PRO A N    3  
ATOM   3464  C  CA   . PRO A 1 76 ? 10.831  -9.813  11.501  1.00 0.00 ? 76  PRO A CA   3  
ATOM   3465  C  C    . PRO A 1 76 ? 10.902  -9.564  13.004  1.00 0.00 ? 76  PRO A C    3  
ATOM   3466  O  O    . PRO A 1 76 ? 11.893  -9.899  13.652  1.00 0.00 ? 76  PRO A O    3  
ATOM   3467  C  CB   . PRO A 1 76 ? 10.454  -11.270 11.217  1.00 0.00 ? 76  PRO A CB   3  
ATOM   3468  C  CG   . PRO A 1 76 ? 11.756  -11.966 11.018  1.00 0.00 ? 76  PRO A CG   3  
ATOM   3469  C  CD   . PRO A 1 76 ? 12.672  -10.956 10.382  1.00 0.00 ? 76  PRO A CD   3  
ATOM   3470  H  HA   . PRO A 1 76 ? 10.094  -9.157  11.063  1.00 0.00 ? 76  PRO A HA   3  
ATOM   3471  H  HB2  . PRO A 1 76 ? 9.914   -11.675 12.061  1.00 0.00 ? 76  PRO A HB2  3  
ATOM   3472  H  HB3  . PRO A 1 76 ? 9.840   -11.320 10.331  1.00 0.00 ? 76  PRO A HB3  3  
ATOM   3473  H  HG2  . PRO A 1 76 ? 12.153  -12.284 11.970  1.00 0.00 ? 76  PRO A HG2  3  
ATOM   3474  H  HG3  . PRO A 1 76 ? 11.622  -12.814 10.363  1.00 0.00 ? 76  PRO A HG3  3  
ATOM   3475  H  HD2  . PRO A 1 76 ? 13.687  -11.100 10.724  1.00 0.00 ? 76  PRO A HD2  3  
ATOM   3476  H  HD3  . PRO A 1 76 ? 12.621  -11.026 9.305   1.00 0.00 ? 76  PRO A HD3  3  
ATOM   3477  N  N    . SER A 1 77 ? 9.844   -8.975  13.552  1.00 0.00 ? 77  SER A N    3  
ATOM   3478  C  CA   . SER A 1 77 ? 9.787   -8.678  14.978  1.00 0.00 ? 77  SER A CA   3  
ATOM   3479  C  C    . SER A 1 77 ? 10.144  -9.910  15.804  1.00 0.00 ? 77  SER A C    3  
ATOM   3480  O  O    . SER A 1 77 ? 10.952  -9.838  16.730  1.00 0.00 ? 77  SER A O    3  
ATOM   3481  C  CB   . SER A 1 77 ? 8.393   -8.178  15.362  1.00 0.00 ? 77  SER A CB   3  
ATOM   3482  O  OG   . SER A 1 77 ? 8.176   -6.860  14.888  1.00 0.00 ? 77  SER A OG   3  
ATOM   3483  H  H    . SER A 1 77 ? 9.084   -8.731  12.982  1.00 0.00 ? 77  SER A H    3  
ATOM   3484  H  HA   . SER A 1 77 ? 10.508  -7.900  15.184  1.00 0.00 ? 77  SER A HA   3  
ATOM   3485  H  HB2  . SER A 1 77 ? 7.649   -8.830  14.931  1.00 0.00 ? 77  SER A HB2  3  
ATOM   3486  H  HB3  . SER A 1 77 ? 8.296   -8.182  16.438  1.00 0.00 ? 77  SER A HB3  3  
ATOM   3487  H  HG   . SER A 1 77 ? 7.403   -6.488  15.320  1.00 0.00 ? 77  SER A HG   3  
ATOM   3488  N  N    . SER A 1 78 ? 9.534   -11.041 15.461  1.00 0.00 ? 78  SER A N    3  
ATOM   3489  C  CA   . SER A 1 78 ? 9.783   -12.289 16.173  1.00 0.00 ? 78  SER A CA   3  
ATOM   3490  C  C    . SER A 1 78 ? 9.368   -12.173 17.636  1.00 0.00 ? 78  SER A C    3  
ATOM   3491  O  O    . SER A 1 78 ? 10.069  -12.642 18.531  1.00 0.00 ? 78  SER A O    3  
ATOM   3492  C  CB   . SER A 1 78 ? 11.263  -12.668 16.079  1.00 0.00 ? 78  SER A CB   3  
ATOM   3493  O  OG   . SER A 1 78 ? 11.472  -14.010 16.481  1.00 0.00 ? 78  SER A OG   3  
ATOM   3494  H  H    . SER A 1 78 ? 8.900   -11.034 14.714  1.00 0.00 ? 78  SER A H    3  
ATOM   3495  H  HA   . SER A 1 78 ? 9.193   -13.061 15.703  1.00 0.00 ? 78  SER A HA   3  
ATOM   3496  H  HB2  . SER A 1 78 ? 11.597  -12.554 15.059  1.00 0.00 ? 78  SER A HB2  3  
ATOM   3497  H  HB3  . SER A 1 78 ? 11.839  -12.018 16.722  1.00 0.00 ? 78  SER A HB3  3  
ATOM   3498  H  HG   . SER A 1 78 ? 10.924  -14.205 17.245  1.00 0.00 ? 78  SER A HG   3  
ATOM   3499  N  N    . GLY A 1 79 ? 8.221   -11.542 17.871  1.00 0.00 ? 79  GLY A N    3  
ATOM   3500  C  CA   . GLY A 1 79 ? 7.731   -11.375 19.226  1.00 0.00 ? 79  GLY A CA   3  
ATOM   3501  C  C    . GLY A 1 79 ? 6.731   -10.241 19.345  1.00 0.00 ? 79  GLY A C    3  
ATOM   3502  O  O    . GLY A 1 79 ? 7.143   -9.092  19.496  1.00 0.00 ? 79  GLY A O    3  
ATOM   3503  H  H    . GLY A 1 79 ? 7.703   -11.188 17.117  1.00 0.00 ? 79  GLY A H    3  
ATOM   3504  H  HA2  . GLY A 1 79 ? 7.258   -12.292 19.543  1.00 0.00 ? 79  GLY A HA2  3  
ATOM   3505  H  HA3  . GLY A 1 79 ? 8.568   -11.170 19.877  1.00 0.00 ? 79  GLY A HA3  3  
HETATM 3506  ZN ZN   . ZN  B 2 .  ? -10.874 -0.416  2.994   1.00 0.00 ? 201 ZN  A ZN   3  
HETATM 3507  ZN ZN   . ZN  C 2 .  ? 4.509   3.658   5.931   1.00 0.00 ? 401 ZN  A ZN   3  
ATOM   3508  N  N    . GLY A 1 1  ? -11.010 -2.220  28.405  1.00 0.00 ? 1   GLY A N    4  
ATOM   3509  C  CA   . GLY A 1 1  ? -12.334 -2.287  27.814  1.00 0.00 ? 1   GLY A CA   4  
ATOM   3510  C  C    . GLY A 1 1  ? -12.293 -2.644  26.341  1.00 0.00 ? 1   GLY A C    4  
ATOM   3511  O  O    . GLY A 1 1  ? -11.643 -1.963  25.548  1.00 0.00 ? 1   GLY A O    4  
ATOM   3512  H  H1   . GLY A 1 1  ? -10.283 -2.765  28.037  1.00 0.00 ? 1   GLY A H1   4  
ATOM   3513  H  HA2  . GLY A 1 1  ? -12.913 -3.031  28.338  1.00 0.00 ? 1   GLY A HA2  4  
ATOM   3514  H  HA3  . GLY A 1 1  ? -12.814 -1.326  27.926  1.00 0.00 ? 1   GLY A HA3  4  
ATOM   3515  N  N    . SER A 1 2  ? -12.989 -3.715  25.974  1.00 0.00 ? 2   SER A N    4  
ATOM   3516  C  CA   . SER A 1 2  ? -13.025 -4.165  24.587  1.00 0.00 ? 2   SER A CA   4  
ATOM   3517  C  C    . SER A 1 2  ? -14.420 -4.658  24.213  1.00 0.00 ? 2   SER A C    4  
ATOM   3518  O  O    . SER A 1 2  ? -15.210 -5.035  25.078  1.00 0.00 ? 2   SER A O    4  
ATOM   3519  C  CB   . SER A 1 2  ? -12.000 -5.278  24.363  1.00 0.00 ? 2   SER A CB   4  
ATOM   3520  O  OG   . SER A 1 2  ? -11.977 -5.684  23.005  1.00 0.00 ? 2   SER A OG   4  
ATOM   3521  H  H    . SER A 1 2  ? -13.487 -4.217  26.653  1.00 0.00 ? 2   SER A H    4  
ATOM   3522  H  HA   . SER A 1 2  ? -12.773 -3.323  23.959  1.00 0.00 ? 2   SER A HA   4  
ATOM   3523  H  HB2  . SER A 1 2  ? -11.019 -4.921  24.636  1.00 0.00 ? 2   SER A HB2  4  
ATOM   3524  H  HB3  . SER A 1 2  ? -12.258 -6.129  24.976  1.00 0.00 ? 2   SER A HB3  4  
ATOM   3525  H  HG   . SER A 1 2  ? -11.620 -6.573  22.942  1.00 0.00 ? 2   SER A HG   4  
ATOM   3526  N  N    . SER A 1 3  ? -14.714 -4.653  22.917  1.00 0.00 ? 3   SER A N    4  
ATOM   3527  C  CA   . SER A 1 3  ? -16.014 -5.097  22.426  1.00 0.00 ? 3   SER A CA   4  
ATOM   3528  C  C    . SER A 1 3  ? -15.895 -5.675  21.020  1.00 0.00 ? 3   SER A C    4  
ATOM   3529  O  O    . SER A 1 3  ? -15.024 -5.281  20.245  1.00 0.00 ? 3   SER A O    4  
ATOM   3530  C  CB   . SER A 1 3  ? -17.007 -3.933  22.429  1.00 0.00 ? 3   SER A CB   4  
ATOM   3531  O  OG   . SER A 1 3  ? -16.809 -3.091  21.307  1.00 0.00 ? 3   SER A OG   4  
ATOM   3532  H  H    . SER A 1 3  ? -14.041 -4.342  22.275  1.00 0.00 ? 3   SER A H    4  
ATOM   3533  H  HA   . SER A 1 3  ? -16.373 -5.868  23.091  1.00 0.00 ? 3   SER A HA   4  
ATOM   3534  H  HB2  . SER A 1 3  ? -18.013 -4.323  22.399  1.00 0.00 ? 3   SER A HB2  4  
ATOM   3535  H  HB3  . SER A 1 3  ? -16.873 -3.351  23.329  1.00 0.00 ? 3   SER A HB3  4  
ATOM   3536  H  HG   . SER A 1 3  ? -17.205 -2.233  21.477  1.00 0.00 ? 3   SER A HG   4  
ATOM   3537  N  N    . GLY A 1 4  ? -16.778 -6.615  20.697  1.00 0.00 ? 4   GLY A N    4  
ATOM   3538  C  CA   . GLY A 1 4  ? -16.756 -7.235  19.384  1.00 0.00 ? 4   GLY A CA   4  
ATOM   3539  C  C    . GLY A 1 4  ? -18.148 -7.474  18.833  1.00 0.00 ? 4   GLY A C    4  
ATOM   3540  O  O    . GLY A 1 4  ? -19.124 -6.911  19.328  1.00 0.00 ? 4   GLY A O    4  
ATOM   3541  H  H    . GLY A 1 4  ? -17.450 -6.891  21.355  1.00 0.00 ? 4   GLY A H    4  
ATOM   3542  H  HA2  . GLY A 1 4  ? -16.216 -6.592  18.704  1.00 0.00 ? 4   GLY A HA2  4  
ATOM   3543  H  HA3  . GLY A 1 4  ? -16.242 -8.182  19.454  1.00 0.00 ? 4   GLY A HA3  4  
ATOM   3544  N  N    . SER A 1 5  ? -18.239 -8.311  17.804  1.00 0.00 ? 5   SER A N    4  
ATOM   3545  C  CA   . SER A 1 5  ? -19.521 -8.620  17.181  1.00 0.00 ? 5   SER A CA   4  
ATOM   3546  C  C    . SER A 1 5  ? -19.458 -9.951  16.439  1.00 0.00 ? 5   SER A C    4  
ATOM   3547  O  O    . SER A 1 5  ? -18.684 -10.113 15.496  1.00 0.00 ? 5   SER A O    4  
ATOM   3548  C  CB   . SER A 1 5  ? -19.924 -7.504  16.216  1.00 0.00 ? 5   SER A CB   4  
ATOM   3549  O  OG   . SER A 1 5  ? -20.114 -6.279  16.902  1.00 0.00 ? 5   SER A OG   4  
ATOM   3550  H  H    . SER A 1 5  ? -17.424 -8.729  17.454  1.00 0.00 ? 5   SER A H    4  
ATOM   3551  H  HA   . SER A 1 5  ? -20.261 -8.692  17.964  1.00 0.00 ? 5   SER A HA   4  
ATOM   3552  H  HB2  . SER A 1 5  ? -19.148 -7.372  15.477  1.00 0.00 ? 5   SER A HB2  4  
ATOM   3553  H  HB3  . SER A 1 5  ? -20.848 -7.774  15.724  1.00 0.00 ? 5   SER A HB3  4  
ATOM   3554  H  HG   . SER A 1 5  ? -20.922 -6.322  17.419  1.00 0.00 ? 5   SER A HG   4  
ATOM   3555  N  N    . SER A 1 6  ? -20.278 -10.903 16.874  1.00 0.00 ? 6   SER A N    4  
ATOM   3556  C  CA   . SER A 1 6  ? -20.313 -12.223 16.254  1.00 0.00 ? 6   SER A CA   4  
ATOM   3557  C  C    . SER A 1 6  ? -21.395 -12.290 15.181  1.00 0.00 ? 6   SER A C    4  
ATOM   3558  O  O    . SER A 1 6  ? -22.163 -11.346 14.997  1.00 0.00 ? 6   SER A O    4  
ATOM   3559  C  CB   . SER A 1 6  ? -20.562 -13.299 17.313  1.00 0.00 ? 6   SER A CB   4  
ATOM   3560  O  OG   . SER A 1 6  ? -20.228 -14.585 16.820  1.00 0.00 ? 6   SER A OG   4  
ATOM   3561  H  H    . SER A 1 6  ? -20.871 -10.713 17.631  1.00 0.00 ? 6   SER A H    4  
ATOM   3562  H  HA   . SER A 1 6  ? -19.353 -12.398 15.793  1.00 0.00 ? 6   SER A HA   4  
ATOM   3563  H  HB2  . SER A 1 6  ? -19.957 -13.092 18.182  1.00 0.00 ? 6   SER A HB2  4  
ATOM   3564  H  HB3  . SER A 1 6  ? -21.606 -13.293 17.590  1.00 0.00 ? 6   SER A HB3  4  
ATOM   3565  H  HG   . SER A 1 6  ? -19.273 -14.683 16.799  1.00 0.00 ? 6   SER A HG   4  
ATOM   3566  N  N    . GLY A 1 7  ? -21.449 -13.414 14.473  1.00 0.00 ? 7   GLY A N    4  
ATOM   3567  C  CA   . GLY A 1 7  ? -22.439 -13.585 13.426  1.00 0.00 ? 7   GLY A CA   4  
ATOM   3568  C  C    . GLY A 1 7  ? -22.111 -14.739 12.500  1.00 0.00 ? 7   GLY A C    4  
ATOM   3569  O  O    . GLY A 1 7  ? -21.063 -15.372 12.632  1.00 0.00 ? 7   GLY A O    4  
ATOM   3570  H  H    . GLY A 1 7  ? -20.811 -14.133 14.663  1.00 0.00 ? 7   GLY A H    4  
ATOM   3571  H  HA2  . GLY A 1 7  ? -23.401 -13.764 13.881  1.00 0.00 ? 7   GLY A HA2  4  
ATOM   3572  H  HA3  . GLY A 1 7  ? -22.491 -12.676 12.844  1.00 0.00 ? 7   GLY A HA3  4  
ATOM   3573  N  N    . SER A 1 8  ? -23.009 -15.017 11.561  1.00 0.00 ? 8   SER A N    4  
ATOM   3574  C  CA   . SER A 1 8  ? -22.813 -16.107 10.613  1.00 0.00 ? 8   SER A CA   4  
ATOM   3575  C  C    . SER A 1 8  ? -23.119 -15.651 9.189   1.00 0.00 ? 8   SER A C    4  
ATOM   3576  O  O    . SER A 1 8  ? -24.069 -14.903 8.957   1.00 0.00 ? 8   SER A O    4  
ATOM   3577  C  CB   . SER A 1 8  ? -23.700 -17.298 10.981  1.00 0.00 ? 8   SER A CB   4  
ATOM   3578  O  OG   . SER A 1 8  ? -23.174 -18.506 10.460  1.00 0.00 ? 8   SER A OG   4  
ATOM   3579  H  H    . SER A 1 8  ? -23.826 -14.477 11.506  1.00 0.00 ? 8   SER A H    4  
ATOM   3580  H  HA   . SER A 1 8  ? -21.778 -16.410 10.666  1.00 0.00 ? 8   SER A HA   4  
ATOM   3581  H  HB2  . SER A 1 8  ? -23.760 -17.380 12.056  1.00 0.00 ? 8   SER A HB2  4  
ATOM   3582  H  HB3  . SER A 1 8  ? -24.689 -17.145 10.575  1.00 0.00 ? 8   SER A HB3  4  
ATOM   3583  H  HG   . SER A 1 8  ? -23.804 -19.217 10.601  1.00 0.00 ? 8   SER A HG   4  
ATOM   3584  N  N    . ILE A 1 9  ? -22.308 -16.108 8.241   1.00 0.00 ? 9   ILE A N    4  
ATOM   3585  C  CA   . ILE A 1 9  ? -22.492 -15.749 6.841   1.00 0.00 ? 9   ILE A CA   4  
ATOM   3586  C  C    . ILE A 1 9  ? -23.063 -16.917 6.044   1.00 0.00 ? 9   ILE A C    4  
ATOM   3587  O  O    . ILE A 1 9  ? -22.594 -18.048 6.158   1.00 0.00 ? 9   ILE A O    4  
ATOM   3588  C  CB   . ILE A 1 9  ? -21.168 -15.301 6.195   1.00 0.00 ? 9   ILE A CB   4  
ATOM   3589  C  CG1  . ILE A 1 9  ? -20.590 -14.099 6.946   1.00 0.00 ? 9   ILE A CG1  4  
ATOM   3590  C  CG2  . ILE A 1 9  ? -21.381 -14.962 4.728   1.00 0.00 ? 9   ILE A CG2  4  
ATOM   3591  C  CD1  . ILE A 1 9  ? -19.091 -13.958 6.800   1.00 0.00 ? 9   ILE A CD1  4  
ATOM   3592  H  H    . ILE A 1 9  ? -21.569 -16.701 8.489   1.00 0.00 ? 9   ILE A H    4  
ATOM   3593  H  HA   . ILE A 1 9  ? -23.188 -14.923 6.798   1.00 0.00 ? 9   ILE A HA   4  
ATOM   3594  H  HB   . ILE A 1 9  ? -20.469 -16.121 6.253   1.00 0.00 ? 9   ILE A HB   4  
ATOM   3595  H  HG12 . ILE A 1 9  ? -21.046 -13.196 6.572   1.00 0.00 ? 9   ILE A HG12 4  
ATOM   3596  H  HG13 . ILE A 1 9  ? -20.814 -14.200 7.998   1.00 0.00 ? 9   ILE A HG13 4  
ATOM   3597  H  HG21 . ILE A 1 9  ? -21.519 -15.874 4.165   1.00 0.00 ? 9   ILE A HG21 4  
ATOM   3598  H  HG22 . ILE A 1 9  ? -22.259 -14.342 4.626   1.00 0.00 ? 9   ILE A HG22 4  
ATOM   3599  H  HG23 . ILE A 1 9  ? -20.519 -14.433 4.351   1.00 0.00 ? 9   ILE A HG23 4  
ATOM   3600  H  HD11 . ILE A 1 9  ? -18.666 -13.640 7.740   1.00 0.00 ? 9   ILE A HD11 4  
ATOM   3601  H  HD12 . ILE A 1 9  ? -18.666 -14.908 6.514   1.00 0.00 ? 9   ILE A HD12 4  
ATOM   3602  H  HD13 . ILE A 1 9  ? -18.872 -13.222 6.039   1.00 0.00 ? 9   ILE A HD13 4  
ATOM   3603  N  N    . GLY A 1 10 ? -24.079 -16.634 5.234   1.00 0.00 ? 10  GLY A N    4  
ATOM   3604  C  CA   . GLY A 1 10 ? -24.697 -17.671 4.428   1.00 0.00 ? 10  GLY A CA   4  
ATOM   3605  C  C    . GLY A 1 10 ? -24.611 -17.379 2.943   1.00 0.00 ? 10  GLY A C    4  
ATOM   3606  O  O    . GLY A 1 10 ? -24.160 -18.217 2.164   1.00 0.00 ? 10  GLY A O    4  
ATOM   3607  H  H    . GLY A 1 10 ? -24.412 -15.713 5.184   1.00 0.00 ? 10  GLY A H    4  
ATOM   3608  H  HA2  . GLY A 1 10 ? -24.203 -18.609 4.629   1.00 0.00 ? 10  GLY A HA2  4  
ATOM   3609  H  HA3  . GLY A 1 10 ? -25.737 -17.756 4.707   1.00 0.00 ? 10  GLY A HA3  4  
ATOM   3610  N  N    . ASN A 1 11 ? -25.048 -16.186 2.550   1.00 0.00 ? 11  ASN A N    4  
ATOM   3611  C  CA   . ASN A 1 11 ? -25.021 -15.787 1.148   1.00 0.00 ? 11  ASN A CA   4  
ATOM   3612  C  C    . ASN A 1 11 ? -23.589 -15.735 0.624   1.00 0.00 ? 11  ASN A C    4  
ATOM   3613  O  O    . ASN A 1 11 ? -22.634 -15.918 1.379   1.00 0.00 ? 11  ASN A O    4  
ATOM   3614  C  CB   . ASN A 1 11 ? -25.689 -14.422 0.972   1.00 0.00 ? 11  ASN A CB   4  
ATOM   3615  C  CG   . ASN A 1 11 ? -24.764 -13.275 1.328   1.00 0.00 ? 11  ASN A CG   4  
ATOM   3616  O  OD1  . ASN A 1 11 ? -23.851 -13.428 2.139   1.00 0.00 ? 11  ASN A OD1  4  
ATOM   3617  N  ND2  . ASN A 1 11 ? -24.997 -12.117 0.722   1.00 0.00 ? 11  ASN A ND2  4  
ATOM   3618  H  H    . ASN A 1 11 ? -25.397 -15.560 3.218   1.00 0.00 ? 11  ASN A H    4  
ATOM   3619  H  HA   . ASN A 1 11 ? -25.572 -16.524 0.583   1.00 0.00 ? 11  ASN A HA   4  
ATOM   3620  H  HB2  . ASN A 1 11 ? -25.993 -14.307 -0.059  1.00 0.00 ? 11  ASN A HB2  4  
ATOM   3621  H  HB3  . ASN A 1 11 ? -26.560 -14.369 1.607   1.00 0.00 ? 11  ASN A HB3  4  
ATOM   3622  H  HD21 . ASN A 1 11 ? -25.743 -12.068 0.087   1.00 0.00 ? 11  ASN A HD21 4  
ATOM   3623  H  HD22 . ASN A 1 11 ? -24.414 -11.358 0.933   1.00 0.00 ? 11  ASN A HD22 4  
ATOM   3624  N  N    . ALA A 1 12 ? -23.447 -15.485 -0.673  1.00 0.00 ? 12  ALA A N    4  
ATOM   3625  C  CA   . ALA A 1 12 ? -22.132 -15.406 -1.297  1.00 0.00 ? 12  ALA A CA   4  
ATOM   3626  C  C    . ALA A 1 12 ? -21.764 -13.963 -1.623  1.00 0.00 ? 12  ALA A C    4  
ATOM   3627  O  O    . ALA A 1 12 ? -22.501 -13.268 -2.323  1.00 0.00 ? 12  ALA A O    4  
ATOM   3628  C  CB   . ALA A 1 12 ? -22.094 -16.260 -2.556  1.00 0.00 ? 12  ALA A CB   4  
ATOM   3629  H  H    . ALA A 1 12 ? -24.246 -15.348 -1.223  1.00 0.00 ? 12  ALA A H    4  
ATOM   3630  H  HA   . ALA A 1 12 ? -21.408 -15.803 -0.601  1.00 0.00 ? 12  ALA A HA   4  
ATOM   3631  H  HB1  . ALA A 1 12 ? -21.683 -15.680 -3.370  1.00 0.00 ? 12  ALA A HB1  4  
ATOM   3632  H  HB2  . ALA A 1 12 ? -21.476 -17.128 -2.384  1.00 0.00 ? 12  ALA A HB2  4  
ATOM   3633  H  HB3  . ALA A 1 12 ? -23.096 -16.574 -2.808  1.00 0.00 ? 12  ALA A HB3  4  
ATOM   3634  N  N    . GLN A 1 13 ? -20.622 -13.518 -1.110  1.00 0.00 ? 13  GLN A N    4  
ATOM   3635  C  CA   . GLN A 1 13 ? -20.158 -12.156 -1.346  1.00 0.00 ? 13  GLN A CA   4  
ATOM   3636  C  C    . GLN A 1 13 ? -19.832 -11.940 -2.820  1.00 0.00 ? 13  GLN A C    4  
ATOM   3637  O  O    . GLN A 1 13 ? -19.098 -12.721 -3.426  1.00 0.00 ? 13  GLN A O    4  
ATOM   3638  C  CB   . GLN A 1 13 ? -18.925 -11.859 -0.490  1.00 0.00 ? 13  GLN A CB   4  
ATOM   3639  C  CG   . GLN A 1 13 ? -17.775 -12.826 -0.723  1.00 0.00 ? 13  GLN A CG   4  
ATOM   3640  C  CD   . GLN A 1 13 ? -17.936 -14.120 0.049   1.00 0.00 ? 13  GLN A CD   4  
ATOM   3641  O  OE1  . GLN A 1 13 ? -18.742 -14.208 0.976   1.00 0.00 ? 13  GLN A OE1  4  
ATOM   3642  N  NE2  . GLN A 1 13 ? -17.169 -15.135 -0.331  1.00 0.00 ? 13  GLN A NE2  4  
ATOM   3643  H  H    . GLN A 1 13 ? -20.078 -14.120 -0.561  1.00 0.00 ? 13  GLN A H    4  
ATOM   3644  H  HA   . GLN A 1 13 ? -20.952 -11.482 -1.063  1.00 0.00 ? 13  GLN A HA   4  
ATOM   3645  H  HB2  . GLN A 1 13 ? -18.579 -10.861 -0.713  1.00 0.00 ? 13  GLN A HB2  4  
ATOM   3646  H  HB3  . GLN A 1 13 ? -19.205 -11.911 0.552   1.00 0.00 ? 13  GLN A HB3  4  
ATOM   3647  H  HG2  . GLN A 1 13 ? -17.724 -13.057 -1.777  1.00 0.00 ? 13  GLN A HG2  4  
ATOM   3648  H  HG3  . GLN A 1 13 ? -16.856 -12.351 -0.414  1.00 0.00 ? 13  GLN A HG3  4  
ATOM   3649  H  HE21 . GLN A 1 13 ? -16.549 -14.992 -1.077  1.00 0.00 ? 13  GLN A HE21 4  
ATOM   3650  H  HE22 . GLN A 1 13 ? -17.251 -15.984 0.151   1.00 0.00 ? 13  GLN A HE22 4  
ATOM   3651  N  N    . LYS A 1 14 ? -20.382 -10.874 -3.393  1.00 0.00 ? 14  LYS A N    4  
ATOM   3652  C  CA   . LYS A 1 14 ? -20.150 -10.553 -4.796  1.00 0.00 ? 14  LYS A CA   4  
ATOM   3653  C  C    . LYS A 1 14 ? -19.256 -9.325  -4.932  1.00 0.00 ? 14  LYS A C    4  
ATOM   3654  O  O    . LYS A 1 14 ? -19.203 -8.697  -5.991  1.00 0.00 ? 14  LYS A O    4  
ATOM   3655  C  CB   . LYS A 1 14 ? -21.480 -10.311 -5.512  1.00 0.00 ? 14  LYS A CB   4  
ATOM   3656  C  CG   . LYS A 1 14 ? -22.315 -11.568 -5.686  1.00 0.00 ? 14  LYS A CG   4  
ATOM   3657  C  CD   . LYS A 1 14 ? -23.540 -11.309 -6.546  1.00 0.00 ? 14  LYS A CD   4  
ATOM   3658  C  CE   . LYS A 1 14 ? -24.709 -10.802 -5.714  1.00 0.00 ? 14  LYS A CE   4  
ATOM   3659  N  NZ   . LYS A 1 14 ? -26.008 -10.974 -6.420  1.00 0.00 ? 14  LYS A NZ   4  
ATOM   3660  H  H    . LYS A 1 14 ? -20.958 -10.288 -2.857  1.00 0.00 ? 14  LYS A H    4  
ATOM   3661  H  HA   . LYS A 1 14 ? -19.654 -11.397 -5.251  1.00 0.00 ? 14  LYS A HA   4  
ATOM   3662  H  HB2  . LYS A 1 14 ? -22.057 -9.597  -4.942  1.00 0.00 ? 14  LYS A HB2  4  
ATOM   3663  H  HB3  . LYS A 1 14 ? -21.279 -9.899  -6.490  1.00 0.00 ? 14  LYS A HB3  4  
ATOM   3664  H  HG2  . LYS A 1 14 ? -21.711 -12.328 -6.159  1.00 0.00 ? 14  LYS A HG2  4  
ATOM   3665  H  HG3  . LYS A 1 14 ? -22.636 -11.914 -4.713  1.00 0.00 ? 14  LYS A HG3  4  
ATOM   3666  H  HD2  . LYS A 1 14 ? -23.296 -10.567 -7.292  1.00 0.00 ? 14  LYS A HD2  4  
ATOM   3667  H  HD3  . LYS A 1 14 ? -23.829 -12.229 -7.033  1.00 0.00 ? 14  LYS A HD3  4  
ATOM   3668  H  HE2  . LYS A 1 14 ? -24.738 -11.352 -4.786  1.00 0.00 ? 14  LYS A HE2  4  
ATOM   3669  H  HE3  . LYS A 1 14 ? -24.557 -9.753  -5.506  1.00 0.00 ? 14  LYS A HE3  4  
ATOM   3670  H  HZ1  . LYS A 1 14 ? -26.281 -10.086 -6.888  1.00 0.00 ? 14  LYS A HZ1  4  
ATOM   3671  H  HZ2  . LYS A 1 14 ? -26.751 -11.238 -5.742  1.00 0.00 ? 14  LYS A HZ2  4  
ATOM   3672  H  HZ3  . LYS A 1 14 ? -25.929 -11.722 -7.139  1.00 0.00 ? 14  LYS A HZ3  4  
ATOM   3673  N  N    . LEU A 1 15 ? -18.554 -8.987  -3.856  1.00 0.00 ? 15  LEU A N    4  
ATOM   3674  C  CA   . LEU A 1 15 ? -17.660 -7.834  -3.856  1.00 0.00 ? 15  LEU A CA   4  
ATOM   3675  C  C    . LEU A 1 15 ? -16.428 -8.100  -2.997  1.00 0.00 ? 15  LEU A C    4  
ATOM   3676  O  O    . LEU A 1 15 ? -16.503 -8.720  -1.936  1.00 0.00 ? 15  LEU A O    4  
ATOM   3677  C  CB   . LEU A 1 15 ? -18.395 -6.594  -3.344  1.00 0.00 ? 15  LEU A CB   4  
ATOM   3678  C  CG   . LEU A 1 15 ? -19.742 -6.293  -4.002  1.00 0.00 ? 15  LEU A CG   4  
ATOM   3679  C  CD1  . LEU A 1 15 ? -20.542 -5.313  -3.157  1.00 0.00 ? 15  LEU A CD1  4  
ATOM   3680  C  CD2  . LEU A 1 15 ? -19.538 -5.745  -5.407  1.00 0.00 ? 15  LEU A CD2  4  
ATOM   3681  H  H    . LEU A 1 15 ? -18.638 -9.525  -3.042  1.00 0.00 ? 15  LEU A H    4  
ATOM   3682  H  HA   . LEU A 1 15 ? -17.344 -7.660  -4.874  1.00 0.00 ? 15  LEU A HA   4  
ATOM   3683  H  HB2  . LEU A 1 15 ? -18.566 -6.724  -2.287  1.00 0.00 ? 15  LEU A HB2  4  
ATOM   3684  H  HB3  . LEU A 1 15 ? -17.751 -5.741  -3.500  1.00 0.00 ? 15  LEU A HB3  4  
ATOM   3685  H  HG   . LEU A 1 15 ? -20.311 -7.209  -4.079  1.00 0.00 ? 15  LEU A HG   4  
ATOM   3686  H  HD11 . LEU A 1 15 ? -21.553 -5.675  -3.047  1.00 0.00 ? 15  LEU A HD11 4  
ATOM   3687  H  HD12 . LEU A 1 15 ? -20.555 -4.348  -3.641  1.00 0.00 ? 15  LEU A HD12 4  
ATOM   3688  H  HD13 . LEU A 1 15 ? -20.084 -5.221  -2.183  1.00 0.00 ? 15  LEU A HD13 4  
ATOM   3689  H  HD21 . LEU A 1 15 ? -19.284 -4.697  -5.351  1.00 0.00 ? 15  LEU A HD21 4  
ATOM   3690  H  HD22 . LEU A 1 15 ? -20.450 -5.864  -5.976  1.00 0.00 ? 15  LEU A HD22 4  
ATOM   3691  H  HD23 . LEU A 1 15 ? -18.738 -6.285  -5.892  1.00 0.00 ? 15  LEU A HD23 4  
ATOM   3692  N  N    . PRO A 1 16 ? -15.266 -7.618  -3.463  1.00 0.00 ? 16  PRO A N    4  
ATOM   3693  C  CA   . PRO A 1 16 ? -13.996 -7.789  -2.752  1.00 0.00 ? 16  PRO A CA   4  
ATOM   3694  C  C    . PRO A 1 16 ? -13.935 -6.967  -1.469  1.00 0.00 ? 16  PRO A C    4  
ATOM   3695  O  O    . PRO A 1 16 ? -13.585 -5.787  -1.493  1.00 0.00 ? 16  PRO A O    4  
ATOM   3696  C  CB   . PRO A 1 16 ? -12.956 -7.289  -3.757  1.00 0.00 ? 16  PRO A CB   4  
ATOM   3697  C  CG   . PRO A 1 16 ? -13.699 -6.338  -4.630  1.00 0.00 ? 16  PRO A CG   4  
ATOM   3698  C  CD   . PRO A 1 16 ? -15.103 -6.870  -4.721  1.00 0.00 ? 16  PRO A CD   4  
ATOM   3699  H  HA   . PRO A 1 16 ? -13.807 -8.827  -2.521  1.00 0.00 ? 16  PRO A HA   4  
ATOM   3700  H  HB2  . PRO A 1 16 ? -12.150 -6.797  -3.231  1.00 0.00 ? 16  PRO A HB2  4  
ATOM   3701  H  HB3  . PRO A 1 16 ? -12.568 -8.123  -4.323  1.00 0.00 ? 16  PRO A HB3  4  
ATOM   3702  H  HG2  . PRO A 1 16 ? -13.699 -5.355  -4.185  1.00 0.00 ? 16  PRO A HG2  4  
ATOM   3703  H  HG3  . PRO A 1 16 ? -13.246 -6.308  -5.610  1.00 0.00 ? 16  PRO A HG3  4  
ATOM   3704  H  HD2  . PRO A 1 16 ? -15.811 -6.057  -4.780  1.00 0.00 ? 16  PRO A HD2  4  
ATOM   3705  H  HD3  . PRO A 1 16 ? -15.204 -7.524  -5.574  1.00 0.00 ? 16  PRO A HD3  4  
ATOM   3706  N  N    . MET A 1 17 ? -14.277 -7.597  -0.350  1.00 0.00 ? 17  MET A N    4  
ATOM   3707  C  CA   . MET A 1 17 ? -14.259 -6.923  0.943   1.00 0.00 ? 17  MET A CA   4  
ATOM   3708  C  C    . MET A 1 17 ? -12.856 -6.429  1.279   1.00 0.00 ? 17  MET A C    4  
ATOM   3709  O  O    . MET A 1 17 ? -11.884 -7.181  1.189   1.00 0.00 ? 17  MET A O    4  
ATOM   3710  C  CB   . MET A 1 17 ? -14.758 -7.865  2.040   1.00 0.00 ? 17  MET A CB   4  
ATOM   3711  C  CG   . MET A 1 17 ? -13.751 -8.937  2.425   1.00 0.00 ? 17  MET A CG   4  
ATOM   3712  S  SD   . MET A 1 17 ? -14.536 -10.460 2.985   1.00 0.00 ? 17  MET A SD   4  
ATOM   3713  C  CE   . MET A 1 17 ? -15.815 -9.807  4.056   1.00 0.00 ? 17  MET A CE   4  
ATOM   3714  H  H    . MET A 1 17 ? -14.548 -8.538  -0.394  1.00 0.00 ? 17  MET A H    4  
ATOM   3715  H  HA   . MET A 1 17 ? -14.922 -6.073  0.882   1.00 0.00 ? 17  MET A HA   4  
ATOM   3716  H  HB2  . MET A 1 17 ? -14.986 -7.284  2.921   1.00 0.00 ? 17  MET A HB2  4  
ATOM   3717  H  HB3  . MET A 1 17 ? -15.657 -8.354  1.698   1.00 0.00 ? 17  MET A HB3  4  
ATOM   3718  H  HG2  . MET A 1 17 ? -13.137 -9.161  1.565   1.00 0.00 ? 17  MET A HG2  4  
ATOM   3719  H  HG3  . MET A 1 17 ? -13.127 -8.556  3.220   1.00 0.00 ? 17  MET A HG3  4  
ATOM   3720  H  HE1  . MET A 1 17 ? -16.403 -9.081  3.514   1.00 0.00 ? 17  MET A HE1  4  
ATOM   3721  H  HE2  . MET A 1 17 ? -16.453 -10.612 4.387   1.00 0.00 ? 17  MET A HE2  4  
ATOM   3722  H  HE3  . MET A 1 17 ? -15.359 -9.332  4.913   1.00 0.00 ? 17  MET A HE3  4  
ATOM   3723  N  N    . CYS A 1 18 ? -12.756 -5.162  1.665   1.00 0.00 ? 18  CYS A N    4  
ATOM   3724  C  CA   . CYS A 1 18 ? -11.471 -4.567  2.014   1.00 0.00 ? 18  CYS A CA   4  
ATOM   3725  C  C    . CYS A 1 18 ? -10.738 -5.422  3.043   1.00 0.00 ? 18  CYS A C    4  
ATOM   3726  O  O    . CYS A 1 18 ? -11.354 -6.197  3.776   1.00 0.00 ? 18  CYS A O    4  
ATOM   3727  C  CB   . CYS A 1 18 ? -11.672 -3.152  2.561   1.00 0.00 ? 18  CYS A CB   4  
ATOM   3728  S  SG   . CYS A 1 18 ? -10.122 -2.273  2.936   1.00 0.00 ? 18  CYS A SG   4  
ATOM   3729  H  H    . CYS A 1 18 ? -13.567 -4.612  1.717   1.00 0.00 ? 18  CYS A H    4  
ATOM   3730  H  HA   . CYS A 1 18 ? -10.875 -4.516  1.116   1.00 0.00 ? 18  CYS A HA   4  
ATOM   3731  H  HB2  . CYS A 1 18 ? -12.213 -2.567  1.832   1.00 0.00 ? 18  CYS A HB2  4  
ATOM   3732  H  HB3  . CYS A 1 18 ? -12.250 -3.205  3.472   1.00 0.00 ? 18  CYS A HB3  4  
ATOM   3733  N  N    . ASP A 1 19 ? -9.418  -5.276  3.093   1.00 0.00 ? 19  ASP A N    4  
ATOM   3734  C  CA   . ASP A 1 19 ? -8.600  -6.034  4.033   1.00 0.00 ? 19  ASP A CA   4  
ATOM   3735  C  C    . ASP A 1 19 ? -8.306  -5.211  5.283   1.00 0.00 ? 19  ASP A C    4  
ATOM   3736  O  O    . ASP A 1 19 ? -8.399  -5.710  6.405   1.00 0.00 ? 19  ASP A O    4  
ATOM   3737  C  CB   . ASP A 1 19 ? -7.290  -6.463  3.370   1.00 0.00 ? 19  ASP A CB   4  
ATOM   3738  C  CG   . ASP A 1 19 ? -6.509  -7.449  4.216   1.00 0.00 ? 19  ASP A CG   4  
ATOM   3739  O  OD1  . ASP A 1 19 ? -5.784  -7.004  5.131   1.00 0.00 ? 19  ASP A OD1  4  
ATOM   3740  O  OD2  . ASP A 1 19 ? -6.624  -8.667  3.965   1.00 0.00 ? 19  ASP A OD2  4  
ATOM   3741  H  H    . ASP A 1 19 ? -8.984  -4.643  2.483   1.00 0.00 ? 19  ASP A H    4  
ATOM   3742  H  HA   . ASP A 1 19 ? -9.153  -6.915  4.319   1.00 0.00 ? 19  ASP A HA   4  
ATOM   3743  H  HB2  . ASP A 1 19 ? -7.510  -6.928  2.420   1.00 0.00 ? 19  ASP A HB2  4  
ATOM   3744  H  HB3  . ASP A 1 19 ? -6.674  -5.591  3.206   1.00 0.00 ? 19  ASP A HB3  4  
ATOM   3745  N  N    . LYS A 1 20 ? -7.949  -3.946  5.083   1.00 0.00 ? 20  LYS A N    4  
ATOM   3746  C  CA   . LYS A 1 20 ? -7.641  -3.053  6.193   1.00 0.00 ? 20  LYS A CA   4  
ATOM   3747  C  C    . LYS A 1 20 ? -8.807  -2.982  7.174   1.00 0.00 ? 20  LYS A C    4  
ATOM   3748  O  O    . LYS A 1 20 ? -8.687  -3.396  8.328   1.00 0.00 ? 20  LYS A O    4  
ATOM   3749  C  CB   . LYS A 1 20 ? -7.315  -1.652  5.671   1.00 0.00 ? 20  LYS A CB   4  
ATOM   3750  C  CG   . LYS A 1 20 ? -6.709  -0.737  6.722   1.00 0.00 ? 20  LYS A CG   4  
ATOM   3751  C  CD   . LYS A 1 20 ? -5.750  0.265   6.103   1.00 0.00 ? 20  LYS A CD   4  
ATOM   3752  C  CE   . LYS A 1 20 ? -5.371  1.357   7.092   1.00 0.00 ? 20  LYS A CE   4  
ATOM   3753  N  NZ   . LYS A 1 20 ? -6.510  2.276   7.367   1.00 0.00 ? 20  LYS A NZ   4  
ATOM   3754  H  H    . LYS A 1 20 ? -7.893  -3.606  4.165   1.00 0.00 ? 20  LYS A H    4  
ATOM   3755  H  HA   . LYS A 1 20 ? -6.778  -3.447  6.707   1.00 0.00 ? 20  LYS A HA   4  
ATOM   3756  H  HB2  . LYS A 1 20 ? -6.614  -1.739  4.854   1.00 0.00 ? 20  LYS A HB2  4  
ATOM   3757  H  HB3  . LYS A 1 20 ? -8.224  -1.195  5.307   1.00 0.00 ? 20  LYS A HB3  4  
ATOM   3758  H  HG2  . LYS A 1 20 ? -7.503  -0.200  7.219   1.00 0.00 ? 20  LYS A HG2  4  
ATOM   3759  H  HG3  . LYS A 1 20 ? -6.173  -1.338  7.443   1.00 0.00 ? 20  LYS A HG3  4  
ATOM   3760  H  HD2  . LYS A 1 20 ? -4.853  -0.251  5.794   1.00 0.00 ? 20  LYS A HD2  4  
ATOM   3761  H  HD3  . LYS A 1 20 ? -6.222  0.718   5.243   1.00 0.00 ? 20  LYS A HD3  4  
ATOM   3762  H  HE2  . LYS A 1 20 ? -5.060  0.896   8.017   1.00 0.00 ? 20  LYS A HE2  4  
ATOM   3763  H  HE3  . LYS A 1 20 ? -4.550  1.927   6.681   1.00 0.00 ? 20  LYS A HE3  4  
ATOM   3764  H  HZ1  . LYS A 1 20 ? -7.374  1.919   6.913   1.00 0.00 ? 20  LYS A HZ1  4  
ATOM   3765  H  HZ2  . LYS A 1 20 ? -6.302  3.224   6.994   1.00 0.00 ? 20  LYS A HZ2  4  
ATOM   3766  H  HZ3  . LYS A 1 20 ? -6.673  2.347   8.392   1.00 0.00 ? 20  LYS A HZ3  4  
ATOM   3767  N  N    . CYS A 1 21 ? -9.936  -2.457  6.708   1.00 0.00 ? 21  CYS A N    4  
ATOM   3768  C  CA   . CYS A 1 21 ? -11.124 -2.333  7.544   1.00 0.00 ? 21  CYS A CA   4  
ATOM   3769  C  C    . CYS A 1 21 ? -11.911 -3.640  7.567   1.00 0.00 ? 21  CYS A C    4  
ATOM   3770  O  O    . CYS A 1 21 ? -12.146 -4.217  8.628   1.00 0.00 ? 21  CYS A O    4  
ATOM   3771  C  CB   . CYS A 1 21 ? -12.014 -1.198  7.035   1.00 0.00 ? 21  CYS A CB   4  
ATOM   3772  S  SG   . CYS A 1 21 ? -12.180 -1.138  5.222   1.00 0.00 ? 21  CYS A SG   4  
ATOM   3773  H  H    . CYS A 1 21 ? -9.970  -2.144  5.779   1.00 0.00 ? 21  CYS A H    4  
ATOM   3774  H  HA   . CYS A 1 21 ? -10.801 -2.104  8.548   1.00 0.00 ? 21  CYS A HA   4  
ATOM   3775  H  HB2  . CYS A 1 21 ? -13.005 -1.314  7.451   1.00 0.00 ? 21  CYS A HB2  4  
ATOM   3776  H  HB3  . CYS A 1 21 ? -11.602 -0.254  7.359   1.00 0.00 ? 21  CYS A HB3  4  
ATOM   3777  N  N    . GLY A 1 22 ? -12.317 -4.102  6.388   1.00 0.00 ? 22  GLY A N    4  
ATOM   3778  C  CA   . GLY A 1 22 ? -13.073 -5.337  6.295   1.00 0.00 ? 22  GLY A CA   4  
ATOM   3779  C  C    . GLY A 1 22 ? -14.528 -5.101  5.942   1.00 0.00 ? 22  GLY A C    4  
ATOM   3780  O  O    . GLY A 1 22 ? -15.422 -5.372  6.745   1.00 0.00 ? 22  GLY A O    4  
ATOM   3781  H  H    . GLY A 1 22 ? -12.101 -3.599  5.574   1.00 0.00 ? 22  GLY A H    4  
ATOM   3782  H  HA2  . GLY A 1 22 ? -12.626 -5.963  5.537   1.00 0.00 ? 22  GLY A HA2  4  
ATOM   3783  H  HA3  . GLY A 1 22 ? -13.023 -5.848  7.245   1.00 0.00 ? 22  GLY A HA3  4  
ATOM   3784  N  N    . THR A 1 23 ? -14.768 -4.592  4.738   1.00 0.00 ? 23  THR A N    4  
ATOM   3785  C  CA   . THR A 1 23 ? -16.125 -4.316  4.281   1.00 0.00 ? 23  THR A CA   4  
ATOM   3786  C  C    . THR A 1 23 ? -16.233 -4.448  2.767   1.00 0.00 ? 23  THR A C    4  
ATOM   3787  O  O    . THR A 1 23 ? -15.336 -4.035  2.032   1.00 0.00 ? 23  THR A O    4  
ATOM   3788  C  CB   . THR A 1 23 ? -16.581 -2.905  4.697   1.00 0.00 ? 23  THR A CB   4  
ATOM   3789  O  OG1  . THR A 1 23 ? -15.606 -1.937  4.295   1.00 0.00 ? 23  THR A OG1  4  
ATOM   3790  C  CG2  . THR A 1 23 ? -16.793 -2.825  6.201   1.00 0.00 ? 23  THR A CG2  4  
ATOM   3791  H  H    . THR A 1 23 ? -14.014 -4.397  4.143   1.00 0.00 ? 23  THR A H    4  
ATOM   3792  H  HA   . THR A 1 23 ? -16.785 -5.036  4.743   1.00 0.00 ? 23  THR A HA   4  
ATOM   3793  H  HB   . THR A 1 23 ? -17.519 -2.687  4.204   1.00 0.00 ? 23  THR A HB   4  
ATOM   3794  H  HG1  . THR A 1 23 ? -14.729 -2.250  4.528   1.00 0.00 ? 23  THR A HG1  4  
ATOM   3795  H  HG21 . THR A 1 23 ? -17.106 -3.790  6.572   1.00 0.00 ? 23  THR A HG21 4  
ATOM   3796  H  HG22 . THR A 1 23 ? -17.553 -2.091  6.419   1.00 0.00 ? 23  THR A HG22 4  
ATOM   3797  H  HG23 . THR A 1 23 ? -15.868 -2.539  6.679   1.00 0.00 ? 23  THR A HG23 4  
ATOM   3798  N  N    . GLY A 1 24 ? -17.338 -5.025  2.304   1.00 0.00 ? 24  GLY A N    4  
ATOM   3799  C  CA   . GLY A 1 24 ? -17.542 -5.200  0.878   1.00 0.00 ? 24  GLY A CA   4  
ATOM   3800  C  C    . GLY A 1 24 ? -17.320 -3.919  0.099   1.00 0.00 ? 24  GLY A C    4  
ATOM   3801  O  O    . GLY A 1 24 ? -18.011 -2.924  0.318   1.00 0.00 ? 24  GLY A O    4  
ATOM   3802  H  H    . GLY A 1 24 ? -18.019 -5.336  2.937   1.00 0.00 ? 24  GLY A H    4  
ATOM   3803  H  HA2  . GLY A 1 24 ? -16.857 -5.953  0.517   1.00 0.00 ? 24  GLY A HA2  4  
ATOM   3804  H  HA3  . GLY A 1 24 ? -18.554 -5.539  0.710   1.00 0.00 ? 24  GLY A HA3  4  
ATOM   3805  N  N    . ILE A 1 25 ? -16.352 -3.942  -0.811  1.00 0.00 ? 25  ILE A N    4  
ATOM   3806  C  CA   . ILE A 1 25 ? -16.041 -2.774  -1.624  1.00 0.00 ? 25  ILE A CA   4  
ATOM   3807  C  C    . ILE A 1 25 ? -17.068 -2.588  -2.736  1.00 0.00 ? 25  ILE A C    4  
ATOM   3808  O  O    . ILE A 1 25 ? -17.551 -3.559  -3.318  1.00 0.00 ? 25  ILE A O    4  
ATOM   3809  C  CB   . ILE A 1 25 ? -14.638 -2.881  -2.250  1.00 0.00 ? 25  ILE A CB   4  
ATOM   3810  C  CG1  . ILE A 1 25 ? -13.576 -3.012  -1.155  1.00 0.00 ? 25  ILE A CG1  4  
ATOM   3811  C  CG2  . ILE A 1 25 ? -14.355 -1.670  -3.127  1.00 0.00 ? 25  ILE A CG2  4  
ATOM   3812  C  CD1  . ILE A 1 25 ? -12.182 -3.249  -1.691  1.00 0.00 ? 25  ILE A CD1  4  
ATOM   3813  H  H    . ILE A 1 25 ? -15.836 -4.765  -0.939  1.00 0.00 ? 25  ILE A H    4  
ATOM   3814  H  HA   . ILE A 1 25 ? -16.061 -1.905  -0.981  1.00 0.00 ? 25  ILE A HA   4  
ATOM   3815  H  HB   . ILE A 1 25 ? -14.612 -3.761  -2.874  1.00 0.00 ? 25  ILE A HB   4  
ATOM   3816  H  HG12 . ILE A 1 25 ? -13.557 -2.106  -0.571  1.00 0.00 ? 25  ILE A HG12 4  
ATOM   3817  H  HG13 . ILE A 1 25 ? -13.832 -3.843  -0.514  1.00 0.00 ? 25  ILE A HG13 4  
ATOM   3818  H  HG21 . ILE A 1 25 ? -15.198 -0.996  -3.093  1.00 0.00 ? 25  ILE A HG21 4  
ATOM   3819  H  HG22 . ILE A 1 25 ? -13.474 -1.161  -2.764  1.00 0.00 ? 25  ILE A HG22 4  
ATOM   3820  H  HG23 . ILE A 1 25 ? -14.192 -1.992  -4.144  1.00 0.00 ? 25  ILE A HG23 4  
ATOM   3821  H  HD11 . ILE A 1 25 ? -12.066 -4.292  -1.945  1.00 0.00 ? 25  ILE A HD11 4  
ATOM   3822  H  HD12 . ILE A 1 25 ? -12.026 -2.644  -2.571  1.00 0.00 ? 25  ILE A HD12 4  
ATOM   3823  H  HD13 . ILE A 1 25 ? -11.456 -2.980  -0.937  1.00 0.00 ? 25  ILE A HD13 4  
ATOM   3824  N  N    . VAL A 1 26 ? -17.396 -1.333  -3.028  1.00 0.00 ? 26  VAL A N    4  
ATOM   3825  C  CA   . VAL A 1 26 ? -18.363 -1.019  -4.072  1.00 0.00 ? 26  VAL A CA   4  
ATOM   3826  C  C    . VAL A 1 26 ? -17.888 0.150   -4.928  1.00 0.00 ? 26  VAL A C    4  
ATOM   3827  O  O    . VAL A 1 26 ? -17.681 1.255   -4.429  1.00 0.00 ? 26  VAL A O    4  
ATOM   3828  C  CB   . VAL A 1 26 ? -19.742 -0.677  -3.476  1.00 0.00 ? 26  VAL A CB   4  
ATOM   3829  C  CG1  . VAL A 1 26 ? -19.626 0.476   -2.490  1.00 0.00 ? 26  VAL A CG1  4  
ATOM   3830  C  CG2  . VAL A 1 26 ? -20.733 -0.345  -4.582  1.00 0.00 ? 26  VAL A CG2  4  
ATOM   3831  H  H    . VAL A 1 26 ? -16.977 -0.601  -2.529  1.00 0.00 ? 26  VAL A H    4  
ATOM   3832  H  HA   . VAL A 1 26 ? -18.473 -1.891  -4.700  1.00 0.00 ? 26  VAL A HA   4  
ATOM   3833  H  HB   . VAL A 1 26 ? -20.106 -1.542  -2.943  1.00 0.00 ? 26  VAL A HB   4  
ATOM   3834  H  HG11 . VAL A 1 26 ? -20.572 0.615   -1.987  1.00 0.00 ? 26  VAL A HG11 4  
ATOM   3835  H  HG12 . VAL A 1 26 ? -18.860 0.252   -1.762  1.00 0.00 ? 26  VAL A HG12 4  
ATOM   3836  H  HG13 . VAL A 1 26 ? -19.365 1.379   -3.021  1.00 0.00 ? 26  VAL A HG13 4  
ATOM   3837  H  HG21 . VAL A 1 26 ? -20.224 0.185   -5.373  1.00 0.00 ? 26  VAL A HG21 4  
ATOM   3838  H  HG22 . VAL A 1 26 ? -21.154 -1.260  -4.974  1.00 0.00 ? 26  VAL A HG22 4  
ATOM   3839  H  HG23 . VAL A 1 26 ? -21.523 0.273   -4.184  1.00 0.00 ? 26  VAL A HG23 4  
ATOM   3840  N  N    . GLY A 1 27 ? -17.716 -0.103  -6.222  1.00 0.00 ? 27  GLY A N    4  
ATOM   3841  C  CA   . GLY A 1 27 ? -17.267 0.938   -7.128  1.00 0.00 ? 27  GLY A CA   4  
ATOM   3842  C  C    . GLY A 1 27 ? -15.768 0.900   -7.356  1.00 0.00 ? 27  GLY A C    4  
ATOM   3843  O  O    . GLY A 1 27 ? -15.204 -0.153  -7.650  1.00 0.00 ? 27  GLY A O    4  
ATOM   3844  H  H    . GLY A 1 27 ? -17.897 -1.004  -6.565  1.00 0.00 ? 27  GLY A H    4  
ATOM   3845  H  HA2  . GLY A 1 27 ? -17.768 0.815   -8.077  1.00 0.00 ? 27  GLY A HA2  4  
ATOM   3846  H  HA3  . GLY A 1 27 ? -17.532 1.899   -6.714  1.00 0.00 ? 27  GLY A HA3  4  
ATOM   3847  N  N    . VAL A 1 28 ? -15.122 2.054   -7.221  1.00 0.00 ? 28  VAL A N    4  
ATOM   3848  C  CA   . VAL A 1 28 ? -13.680 2.150   -7.415  1.00 0.00 ? 28  VAL A CA   4  
ATOM   3849  C  C    . VAL A 1 28 ? -12.926 1.516   -6.251  1.00 0.00 ? 28  VAL A C    4  
ATOM   3850  O  O    . VAL A 1 28 ? -13.336 1.631   -5.096  1.00 0.00 ? 28  VAL A O    4  
ATOM   3851  C  CB   . VAL A 1 28 ? -13.230 3.615   -7.567  1.00 0.00 ? 28  VAL A CB   4  
ATOM   3852  C  CG1  . VAL A 1 28 ? -13.637 4.428   -6.347  1.00 0.00 ? 28  VAL A CG1  4  
ATOM   3853  C  CG2  . VAL A 1 28 ? -11.728 3.690   -7.792  1.00 0.00 ? 28  VAL A CG2  4  
ATOM   3854  H  H    . VAL A 1 28 ? -15.627 2.860   -6.986  1.00 0.00 ? 28  VAL A H    4  
ATOM   3855  H  HA   . VAL A 1 28 ? -13.430 1.622   -8.324  1.00 0.00 ? 28  VAL A HA   4  
ATOM   3856  H  HB   . VAL A 1 28 ? -13.724 4.034   -8.432  1.00 0.00 ? 28  VAL A HB   4  
ATOM   3857  H  HG11 . VAL A 1 28 ? -13.714 5.470   -6.619  1.00 0.00 ? 28  VAL A HG11 4  
ATOM   3858  H  HG12 . VAL A 1 28 ? -14.591 4.078   -5.982  1.00 0.00 ? 28  VAL A HG12 4  
ATOM   3859  H  HG13 . VAL A 1 28 ? -12.891 4.313   -5.574  1.00 0.00 ? 28  VAL A HG13 4  
ATOM   3860  H  HG21 . VAL A 1 28 ? -11.337 2.695   -7.942  1.00 0.00 ? 28  VAL A HG21 4  
ATOM   3861  H  HG22 . VAL A 1 28 ? -11.523 4.293   -8.665  1.00 0.00 ? 28  VAL A HG22 4  
ATOM   3862  H  HG23 . VAL A 1 28 ? -11.256 4.136   -6.929  1.00 0.00 ? 28  VAL A HG23 4  
ATOM   3863  N  N    . PHE A 1 29 ? -11.821 0.848   -6.564  1.00 0.00 ? 29  PHE A N    4  
ATOM   3864  C  CA   . PHE A 1 29 ? -11.009 0.195   -5.544  1.00 0.00 ? 29  PHE A CA   4  
ATOM   3865  C  C    . PHE A 1 29 ? -9.667  -0.248  -6.119  1.00 0.00 ? 29  PHE A C    4  
ATOM   3866  O  O    . PHE A 1 29 ? -9.467  -0.244  -7.333  1.00 0.00 ? 29  PHE A O    4  
ATOM   3867  C  CB   . PHE A 1 29 ? -11.752 -1.012  -4.965  1.00 0.00 ? 29  PHE A CB   4  
ATOM   3868  C  CG   . PHE A 1 29 ? -12.079 -2.061  -5.988  1.00 0.00 ? 29  PHE A CG   4  
ATOM   3869  C  CD1  . PHE A 1 29 ? -11.114 -2.964  -6.407  1.00 0.00 ? 29  PHE A CD1  4  
ATOM   3870  C  CD2  . PHE A 1 29 ? -13.351 -2.146  -6.532  1.00 0.00 ? 29  PHE A CD2  4  
ATOM   3871  C  CE1  . PHE A 1 29 ? -11.412 -3.931  -7.348  1.00 0.00 ? 29  PHE A CE1  4  
ATOM   3872  C  CE2  . PHE A 1 29 ? -13.654 -3.111  -7.472  1.00 0.00 ? 29  PHE A CE2  4  
ATOM   3873  C  CZ   . PHE A 1 29 ? -12.684 -4.004  -7.882  1.00 0.00 ? 29  PHE A CZ   4  
ATOM   3874  H  H    . PHE A 1 29 ? -11.546 0.792   -7.503  1.00 0.00 ? 29  PHE A H    4  
ATOM   3875  H  HA   . PHE A 1 29 ? -10.831 0.909   -4.755  1.00 0.00 ? 29  PHE A HA   4  
ATOM   3876  H  HB2  . PHE A 1 29 ? -11.140 -1.471  -4.203  1.00 0.00 ? 29  PHE A HB2  4  
ATOM   3877  H  HB3  . PHE A 1 29 ? -12.678 -0.677  -4.523  1.00 0.00 ? 29  PHE A HB3  4  
ATOM   3878  H  HD1  . PHE A 1 29 ? -10.119 -2.907  -5.990  1.00 0.00 ? 29  PHE A HD1  4  
ATOM   3879  H  HD2  . PHE A 1 29 ? -14.111 -1.447  -6.213  1.00 0.00 ? 29  PHE A HD2  4  
ATOM   3880  H  HE1  . PHE A 1 29 ? -10.650 -4.628  -7.666  1.00 0.00 ? 29  PHE A HE1  4  
ATOM   3881  H  HE2  . PHE A 1 29 ? -14.649 -3.166  -7.889  1.00 0.00 ? 29  PHE A HE2  4  
ATOM   3882  H  HZ   . PHE A 1 29 ? -12.918 -4.760  -8.617  1.00 0.00 ? 29  PHE A HZ   4  
ATOM   3883  N  N    . VAL A 1 30 ? -8.749  -0.630  -5.236  1.00 0.00 ? 30  VAL A N    4  
ATOM   3884  C  CA   . VAL A 1 30 ? -7.425  -1.076  -5.654  1.00 0.00 ? 30  VAL A CA   4  
ATOM   3885  C  C    . VAL A 1 30 ? -7.279  -2.585  -5.497  1.00 0.00 ? 30  VAL A C    4  
ATOM   3886  O  O    . VAL A 1 30 ? -7.128  -3.094  -4.386  1.00 0.00 ? 30  VAL A O    4  
ATOM   3887  C  CB   . VAL A 1 30 ? -6.316  -0.377  -4.846  1.00 0.00 ? 30  VAL A CB   4  
ATOM   3888  C  CG1  . VAL A 1 30 ? -4.943  -0.834  -5.317  1.00 0.00 ? 30  VAL A CG1  4  
ATOM   3889  C  CG2  . VAL A 1 30 ? -6.450  1.134   -4.955  1.00 0.00 ? 30  VAL A CG2  4  
ATOM   3890  H  H    . VAL A 1 30 ? -8.967  -0.611  -4.281  1.00 0.00 ? 30  VAL A H    4  
ATOM   3891  H  HA   . VAL A 1 30 ? -7.299  -0.818  -6.696  1.00 0.00 ? 30  VAL A HA   4  
ATOM   3892  H  HB   . VAL A 1 30 ? -6.426  -0.653  -3.808  1.00 0.00 ? 30  VAL A HB   4  
ATOM   3893  H  HG11 . VAL A 1 30 ? -4.329  -1.067  -4.460  1.00 0.00 ? 30  VAL A HG11 4  
ATOM   3894  H  HG12 . VAL A 1 30 ? -5.049  -1.713  -5.936  1.00 0.00 ? 30  VAL A HG12 4  
ATOM   3895  H  HG13 . VAL A 1 30 ? -4.478  -0.045  -5.889  1.00 0.00 ? 30  VAL A HG13 4  
ATOM   3896  H  HG21 . VAL A 1 30 ? -5.485  1.593   -4.794  1.00 0.00 ? 30  VAL A HG21 4  
ATOM   3897  H  HG22 . VAL A 1 30 ? -6.812  1.394   -5.939  1.00 0.00 ? 30  VAL A HG22 4  
ATOM   3898  H  HG23 . VAL A 1 30 ? -7.147  1.489   -4.210  1.00 0.00 ? 30  VAL A HG23 4  
ATOM   3899  N  N    . LYS A 1 31 ? -7.324  -3.298  -6.618  1.00 0.00 ? 31  LYS A N    4  
ATOM   3900  C  CA   . LYS A 1 31 ? -7.195  -4.751  -6.607  1.00 0.00 ? 31  LYS A CA   4  
ATOM   3901  C  C    . LYS A 1 31 ? -5.740  -5.166  -6.416  1.00 0.00 ? 31  LYS A C    4  
ATOM   3902  O  O    . LYS A 1 31 ? -4.901  -4.947  -7.291  1.00 0.00 ? 31  LYS A O    4  
ATOM   3903  C  CB   . LYS A 1 31 ? -7.739  -5.341  -7.909  1.00 0.00 ? 31  LYS A CB   4  
ATOM   3904  C  CG   . LYS A 1 31 ? -7.932  -6.847  -7.860  1.00 0.00 ? 31  LYS A CG   4  
ATOM   3905  C  CD   . LYS A 1 31 ? -6.691  -7.585  -8.333  1.00 0.00 ? 31  LYS A CD   4  
ATOM   3906  C  CE   . LYS A 1 31 ? -6.768  -9.069  -8.010  1.00 0.00 ? 31  LYS A CE   4  
ATOM   3907  N  NZ   . LYS A 1 31 ? -5.884  -9.876  -8.897  1.00 0.00 ? 31  LYS A NZ   4  
ATOM   3908  H  H    . LYS A 1 31 ? -7.447  -2.836  -7.474  1.00 0.00 ? 31  LYS A H    4  
ATOM   3909  H  HA   . LYS A 1 31 ? -7.777  -5.129  -5.780  1.00 0.00 ? 31  LYS A HA   4  
ATOM   3910  H  HB2  . LYS A 1 31 ? -8.692  -4.884  -8.128  1.00 0.00 ? 31  LYS A HB2  4  
ATOM   3911  H  HB3  . LYS A 1 31 ? -7.048  -5.114  -8.709  1.00 0.00 ? 31  LYS A HB3  4  
ATOM   3912  H  HG2  . LYS A 1 31 ? -8.147  -7.140  -6.844  1.00 0.00 ? 31  LYS A HG2  4  
ATOM   3913  H  HG3  . LYS A 1 31 ? -8.764  -7.115  -8.497  1.00 0.00 ? 31  LYS A HG3  4  
ATOM   3914  H  HD2  . LYS A 1 31 ? -6.596  -7.465  -9.402  1.00 0.00 ? 31  LYS A HD2  4  
ATOM   3915  H  HD3  . LYS A 1 31 ? -5.824  -7.163  -7.843  1.00 0.00 ? 31  LYS A HD3  4  
ATOM   3916  H  HE2  . LYS A 1 31 ? -6.467  -9.217  -6.985  1.00 0.00 ? 31  LYS A HE2  4  
ATOM   3917  H  HE3  . LYS A 1 31 ? -7.789  -9.399  -8.136  1.00 0.00 ? 31  LYS A HE3  4  
ATOM   3918  H  HZ1  . LYS A 1 31 ? -5.066  -10.229 -8.360  1.00 0.00 ? 31  LYS A HZ1  4  
ATOM   3919  H  HZ2  . LYS A 1 31 ? -5.541  -9.292  -9.686  1.00 0.00 ? 31  LYS A HZ2  4  
ATOM   3920  H  HZ3  . LYS A 1 31 ? -6.409  -10.687 -9.282  1.00 0.00 ? 31  LYS A HZ3  4  
ATOM   3921  N  N    . LEU A 1 32 ? -5.447  -5.768  -5.268  1.00 0.00 ? 32  LEU A N    4  
ATOM   3922  C  CA   . LEU A 1 32 ? -4.093  -6.216  -4.963  1.00 0.00 ? 32  LEU A CA   4  
ATOM   3923  C  C    . LEU A 1 32 ? -3.807  -7.566  -5.613  1.00 0.00 ? 32  LEU A C    4  
ATOM   3924  O  O    . LEU A 1 32 ? -4.720  -8.248  -6.079  1.00 0.00 ? 32  LEU A O    4  
ATOM   3925  C  CB   . LEU A 1 32 ? -3.895  -6.313  -3.450  1.00 0.00 ? 32  LEU A CB   4  
ATOM   3926  C  CG   . LEU A 1 32 ? -3.979  -4.997  -2.676  1.00 0.00 ? 32  LEU A CG   4  
ATOM   3927  C  CD1  . LEU A 1 32 ? -3.989  -5.258  -1.178  1.00 0.00 ? 32  LEU A CD1  4  
ATOM   3928  C  CD2  . LEU A 1 32 ? -2.822  -4.083  -3.052  1.00 0.00 ? 32  LEU A CD2  4  
ATOM   3929  H  H    . LEU A 1 32 ? -6.157  -5.915  -4.610  1.00 0.00 ? 32  LEU A H    4  
ATOM   3930  H  HA   . LEU A 1 32 ? -3.405  -5.486  -5.362  1.00 0.00 ? 32  LEU A HA   4  
ATOM   3931  H  HB2  . LEU A 1 32 ? -4.653  -6.975  -3.059  1.00 0.00 ? 32  LEU A HB2  4  
ATOM   3932  H  HB3  . LEU A 1 32 ? -2.919  -6.741  -3.271  1.00 0.00 ? 32  LEU A HB3  4  
ATOM   3933  H  HG   . LEU A 1 32 ? -4.901  -4.494  -2.933  1.00 0.00 ? 32  LEU A HG   4  
ATOM   3934  H  HD11 . LEU A 1 32 ? -3.004  -5.080  -0.775  1.00 0.00 ? 32  LEU A HD11 4  
ATOM   3935  H  HD12 . LEU A 1 32 ? -4.274  -6.283  -0.993  1.00 0.00 ? 32  LEU A HD12 4  
ATOM   3936  H  HD13 . LEU A 1 32 ? -4.699  -4.596  -0.702  1.00 0.00 ? 32  LEU A HD13 4  
ATOM   3937  H  HD21 . LEU A 1 32 ? -3.084  -3.514  -3.932  1.00 0.00 ? 32  LEU A HD21 4  
ATOM   3938  H  HD22 . LEU A 1 32 ? -1.944  -4.679  -3.257  1.00 0.00 ? 32  LEU A HD22 4  
ATOM   3939  H  HD23 . LEU A 1 32 ? -2.616  -3.407  -2.235  1.00 0.00 ? 32  LEU A HD23 4  
ATOM   3940  N  N    . ARG A 1 33 ? -2.534  -7.947  -5.637  1.00 0.00 ? 33  ARG A N    4  
ATOM   3941  C  CA   . ARG A 1 33 ? -2.128  -9.217  -6.228  1.00 0.00 ? 33  ARG A CA   4  
ATOM   3942  C  C    . ARG A 1 33 ? -3.218  -10.271 -6.055  1.00 0.00 ? 33  ARG A C    4  
ATOM   3943  O  O    . ARG A 1 33 ? -3.897  -10.639 -7.013  1.00 0.00 ? 33  ARG A O    4  
ATOM   3944  C  CB   . ARG A 1 33 ? -0.825  -9.706  -5.593  1.00 0.00 ? 33  ARG A CB   4  
ATOM   3945  C  CG   . ARG A 1 33 ? -0.147  -10.820 -6.374  1.00 0.00 ? 33  ARG A CG   4  
ATOM   3946  C  CD   . ARG A 1 33 ? -0.605  -12.190 -5.901  1.00 0.00 ? 33  ARG A CD   4  
ATOM   3947  N  NE   . ARG A 1 33 ? -0.238  -13.245 -6.842  1.00 0.00 ? 33  ARG A NE   4  
ATOM   3948  C  CZ   . ARG A 1 33 ? 0.945   -13.848 -6.846  1.00 0.00 ? 33  ARG A CZ   4  
ATOM   3949  N  NH1  . ARG A 1 33 ? 1.872   -13.502 -5.963  1.00 0.00 ? 33  ARG A NH1  4  
ATOM   3950  N  NH2  . ARG A 1 33 ? 1.204   -14.799 -7.734  1.00 0.00 ? 33  ARG A NH2  4  
ATOM   3951  H  H    . ARG A 1 33 ? -1.851  -7.361  -5.250  1.00 0.00 ? 33  ARG A H    4  
ATOM   3952  H  HA   . ARG A 1 33 ? -1.965  -9.055  -7.283  1.00 0.00 ? 33  ARG A HA   4  
ATOM   3953  H  HB2  . ARG A 1 33 ? -0.138  -8.875  -5.524  1.00 0.00 ? 33  ARG A HB2  4  
ATOM   3954  H  HB3  . ARG A 1 33 ? -1.038  -10.070 -4.600  1.00 0.00 ? 33  ARG A HB3  4  
ATOM   3955  H  HG2  . ARG A 1 33 ? -0.391  -10.713 -7.421  1.00 0.00 ? 33  ARG A HG2  4  
ATOM   3956  H  HG3  . ARG A 1 33 ? 0.922   -10.741 -6.242  1.00 0.00 ? 33  ARG A HG3  4  
ATOM   3957  H  HD2  . ARG A 1 33 ? -0.146  -12.398 -4.946  1.00 0.00 ? 33  ARG A HD2  4  
ATOM   3958  H  HD3  . ARG A 1 33 ? -1.679  -12.177 -5.789  1.00 0.00 ? 33  ARG A HD3  4  
ATOM   3959  H  HE   . ARG A 1 33 ? -0.909  -13.516 -7.503  1.00 0.00 ? 33  ARG A HE   4  
ATOM   3960  H  HH11 . ARG A 1 33 ? 1.680   -12.786 -5.292  1.00 0.00 ? 33  ARG A HH11 4  
ATOM   3961  H  HH12 . ARG A 1 33 ? 2.762   -13.958 -5.968  1.00 0.00 ? 33  ARG A HH12 4  
ATOM   3962  H  HH21 . ARG A 1 33 ? 0.508   -15.063 -8.401  1.00 0.00 ? 33  ARG A HH21 4  
ATOM   3963  H  HH22 . ARG A 1 33 ? 2.095   -15.252 -7.737  1.00 0.00 ? 33  ARG A HH22 4  
ATOM   3964  N  N    . ASP A 1 34 ? -3.377  -10.752 -4.827  1.00 0.00 ? 34  ASP A N    4  
ATOM   3965  C  CA   . ASP A 1 34 ? -4.385  -11.763 -4.527  1.00 0.00 ? 34  ASP A CA   4  
ATOM   3966  C  C    . ASP A 1 34 ? -5.407  -11.232 -3.527  1.00 0.00 ? 34  ASP A C    4  
ATOM   3967  O  O    . ASP A 1 34 ? -6.353  -11.930 -3.162  1.00 0.00 ? 34  ASP A O    4  
ATOM   3968  C  CB   . ASP A 1 34 ? -3.722  -13.026 -3.976  1.00 0.00 ? 34  ASP A CB   4  
ATOM   3969  C  CG   . ASP A 1 34 ? -3.135  -12.816 -2.594  1.00 0.00 ? 34  ASP A CG   4  
ATOM   3970  O  OD1  . ASP A 1 34 ? -2.503  -11.762 -2.372  1.00 0.00 ? 34  ASP A OD1  4  
ATOM   3971  O  OD2  . ASP A 1 34 ? -3.307  -13.705 -1.734  1.00 0.00 ? 34  ASP A OD2  4  
ATOM   3972  H  H    . ASP A 1 34 ? -2.805  -10.419 -4.105  1.00 0.00 ? 34  ASP A H    4  
ATOM   3973  H  HA   . ASP A 1 34 ? -4.893  -12.007 -5.447  1.00 0.00 ? 34  ASP A HA   4  
ATOM   3974  H  HB2  . ASP A 1 34 ? -4.457  -13.815 -3.917  1.00 0.00 ? 34  ASP A HB2  4  
ATOM   3975  H  HB3  . ASP A 1 34 ? -2.928  -13.329 -4.642  1.00 0.00 ? 34  ASP A HB3  4  
ATOM   3976  N  N    . ARG A 1 35 ? -5.209  -9.994  -3.087  1.00 0.00 ? 35  ARG A N    4  
ATOM   3977  C  CA   . ARG A 1 35 ? -6.112  -9.370  -2.128  1.00 0.00 ? 35  ARG A CA   4  
ATOM   3978  C  C    . ARG A 1 35 ? -6.778  -8.136  -2.730  1.00 0.00 ? 35  ARG A C    4  
ATOM   3979  O  O    . ARG A 1 35 ? -6.472  -7.740  -3.855  1.00 0.00 ? 35  ARG A O    4  
ATOM   3980  C  CB   . ARG A 1 35 ? -5.353  -8.983  -0.857  1.00 0.00 ? 35  ARG A CB   4  
ATOM   3981  C  CG   . ARG A 1 35 ? -4.800  -10.175 -0.091  1.00 0.00 ? 35  ARG A CG   4  
ATOM   3982  C  CD   . ARG A 1 35 ? -5.819  -10.723 0.895   1.00 0.00 ? 35  ARG A CD   4  
ATOM   3983  N  NE   . ARG A 1 35 ? -5.181  -11.342 2.054   1.00 0.00 ? 35  ARG A NE   4  
ATOM   3984  C  CZ   . ARG A 1 35 ? -5.093  -12.656 2.230   1.00 0.00 ? 35  ARG A CZ   4  
ATOM   3985  N  NH1  . ARG A 1 35 ? -5.600  -13.485 1.327   1.00 0.00 ? 35  ARG A NH1  4  
ATOM   3986  N  NH2  . ARG A 1 35 ? -4.497  -13.144 3.310   1.00 0.00 ? 35  ARG A NH2  4  
ATOM   3987  H  H    . ARG A 1 35 ? -4.436  -9.487  -3.415  1.00 0.00 ? 35  ARG A H    4  
ATOM   3988  H  HA   . ARG A 1 35 ? -6.876  -10.090 -1.875  1.00 0.00 ? 35  ARG A HA   4  
ATOM   3989  H  HB2  . ARG A 1 35 ? -4.526  -8.342  -1.127  1.00 0.00 ? 35  ARG A HB2  4  
ATOM   3990  H  HB3  . ARG A 1 35 ? -6.020  -8.441  -0.205  1.00 0.00 ? 35  ARG A HB3  4  
ATOM   3991  H  HG2  . ARG A 1 35 ? -4.540  -10.953 -0.794  1.00 0.00 ? 35  ARG A HG2  4  
ATOM   3992  H  HG3  . ARG A 1 35 ? -3.918  -9.865  0.449   1.00 0.00 ? 35  ARG A HG3  4  
ATOM   3993  H  HD2  . ARG A 1 35 ? -6.447  -9.912  1.233   1.00 0.00 ? 35  ARG A HD2  4  
ATOM   3994  H  HD3  . ARG A 1 35 ? -6.426  -11.462 0.392   1.00 0.00 ? 35  ARG A HD3  4  
ATOM   3995  H  HE   . ARG A 1 35 ? -4.800  -10.749 2.733   1.00 0.00 ? 35  ARG A HE   4  
ATOM   3996  H  HH11 . ARG A 1 35 ? -6.049  -13.120 0.512   1.00 0.00 ? 35  ARG A HH11 4  
ATOM   3997  H  HH12 . ARG A 1 35 ? -5.531  -14.474 1.462   1.00 0.00 ? 35  ARG A HH12 4  
ATOM   3998  H  HH21 . ARG A 1 35 ? -4.113  -12.522 3.993   1.00 0.00 ? 35  ARG A HH21 4  
ATOM   3999  H  HH22 . ARG A 1 35 ? -4.431  -14.132 3.442   1.00 0.00 ? 35  ARG A HH22 4  
ATOM   4000  N  N    . HIS A 1 36 ? -7.690  -7.534  -1.974  1.00 0.00 ? 36  HIS A N    4  
ATOM   4001  C  CA   . HIS A 1 36 ? -8.400  -6.345  -2.434  1.00 0.00 ? 36  HIS A CA   4  
ATOM   4002  C  C    . HIS A 1 36 ? -8.557  -5.335  -1.301  1.00 0.00 ? 36  HIS A C    4  
ATOM   4003  O  O    . HIS A 1 36 ? -8.824  -5.706  -0.158  1.00 0.00 ? 36  HIS A O    4  
ATOM   4004  C  CB   . HIS A 1 36 ? -9.774  -6.727  -2.986  1.00 0.00 ? 36  HIS A CB   4  
ATOM   4005  C  CG   . HIS A 1 36 ? -9.713  -7.703  -4.120  1.00 0.00 ? 36  HIS A CG   4  
ATOM   4006  N  ND1  . HIS A 1 36 ? -9.352  -9.024  -3.958  1.00 0.00 ? 36  HIS A ND1  4  
ATOM   4007  C  CD2  . HIS A 1 36 ? -9.972  -7.545  -5.439  1.00 0.00 ? 36  HIS A CD2  4  
ATOM   4008  C  CE1  . HIS A 1 36 ? -9.390  -9.635  -5.129  1.00 0.00 ? 36  HIS A CE1  4  
ATOM   4009  N  NE2  . HIS A 1 36 ? -9.764  -8.760  -6.044  1.00 0.00 ? 36  HIS A NE2  4  
ATOM   4010  H  H    . HIS A 1 36 ? -7.891  -7.897  -1.087  1.00 0.00 ? 36  HIS A H    4  
ATOM   4011  H  HA   . HIS A 1 36 ? -7.817  -5.895  -3.223  1.00 0.00 ? 36  HIS A HA   4  
ATOM   4012  H  HB2  . HIS A 1 36 ? -10.360 -7.173  -2.196  1.00 0.00 ? 36  HIS A HB2  4  
ATOM   4013  H  HB3  . HIS A 1 36 ? -10.273 -5.837  -3.339  1.00 0.00 ? 36  HIS A HB3  4  
ATOM   4014  H  HD1  . HIS A 1 36 ? -9.103  -9.449  -3.112  1.00 0.00 ? 36  HIS A HD1  4  
ATOM   4015  H  HD2  . HIS A 1 36 ? -10.285 -6.632  -5.927  1.00 0.00 ? 36  HIS A HD2  4  
ATOM   4016  H  HE1  . HIS A 1 36 ? -9.155  -10.674 -5.308  1.00 0.00 ? 36  HIS A HE1  4  
ATOM   4017  H  HE2  . HIS A 1 36 ? -9.790  -8.928  -7.009  1.00 0.00 ? 36  HIS A HE2  4  
ATOM   4018  N  N    . ARG A 1 37 ? -8.388  -4.058  -1.627  1.00 0.00 ? 37  ARG A N    4  
ATOM   4019  C  CA   . ARG A 1 37 ? -8.509  -2.994  -0.637  1.00 0.00 ? 37  ARG A CA   4  
ATOM   4020  C  C    . ARG A 1 37 ? -9.199  -1.771  -1.234  1.00 0.00 ? 37  ARG A C    4  
ATOM   4021  O  O    . ARG A 1 37 ? -9.445  -1.711  -2.439  1.00 0.00 ? 37  ARG A O    4  
ATOM   4022  C  CB   . ARG A 1 37 ? -7.128  -2.605  -0.105  1.00 0.00 ? 37  ARG A CB   4  
ATOM   4023  C  CG   . ARG A 1 37 ? -6.704  -3.395  1.123   1.00 0.00 ? 37  ARG A CG   4  
ATOM   4024  C  CD   . ARG A 1 37 ? -5.661  -2.644  1.935   1.00 0.00 ? 37  ARG A CD   4  
ATOM   4025  N  NE   . ARG A 1 37 ? -5.074  -3.480  2.978   1.00 0.00 ? 37  ARG A NE   4  
ATOM   4026  C  CZ   . ARG A 1 37 ? -4.039  -4.289  2.777   1.00 0.00 ? 37  ARG A CZ   4  
ATOM   4027  N  NH1  . ARG A 1 37 ? -3.480  -4.369  1.577   1.00 0.00 ? 37  ARG A NH1  4  
ATOM   4028  N  NH2  . ARG A 1 37 ? -3.561  -5.019  3.777   1.00 0.00 ? 37  ARG A NH2  4  
ATOM   4029  H  H    . ARG A 1 37 ? -8.176  -3.824  -2.555  1.00 0.00 ? 37  ARG A H    4  
ATOM   4030  H  HA   . ARG A 1 37 ? -9.108  -3.368  0.180   1.00 0.00 ? 37  ARG A HA   4  
ATOM   4031  H  HB2  . ARG A 1 37 ? -6.396  -2.769  -0.881  1.00 0.00 ? 37  ARG A HB2  4  
ATOM   4032  H  HB3  . ARG A 1 37 ? -7.138  -1.557  0.154   1.00 0.00 ? 37  ARG A HB3  4  
ATOM   4033  H  HG2  . ARG A 1 37 ? -7.570  -3.569  1.744   1.00 0.00 ? 37  ARG A HG2  4  
ATOM   4034  H  HG3  . ARG A 1 37 ? -6.290  -4.340  0.806   1.00 0.00 ? 37  ARG A HG3  4  
ATOM   4035  H  HD2  . ARG A 1 37 ? -4.877  -2.312  1.270   1.00 0.00 ? 37  ARG A HD2  4  
ATOM   4036  H  HD3  . ARG A 1 37 ? -6.130  -1.787  2.395   1.00 0.00 ? 37  ARG A HD3  4  
ATOM   4037  H  HE   . ARG A 1 37 ? -5.471  -3.436  3.873   1.00 0.00 ? 37  ARG A HE   4  
ATOM   4038  H  HH11 . ARG A 1 37 ? -3.837  -3.820  0.823   1.00 0.00 ? 37  ARG A HH11 4  
ATOM   4039  H  HH12 . ARG A 1 37 ? -2.700  -4.978  1.429   1.00 0.00 ? 37  ARG A HH12 4  
ATOM   4040  H  HH21 . ARG A 1 37 ? -3.980  -4.960  4.683   1.00 0.00 ? 37  ARG A HH21 4  
ATOM   4041  H  HH22 . ARG A 1 37 ? -2.783  -5.627  3.624   1.00 0.00 ? 37  ARG A HH22 4  
ATOM   4042  N  N    . HIS A 1 38 ? -9.509  -0.798  -0.383  1.00 0.00 ? 38  HIS A N    4  
ATOM   4043  C  CA   . HIS A 1 38 ? -10.170 0.424   -0.826  1.00 0.00 ? 38  HIS A CA   4  
ATOM   4044  C  C    . HIS A 1 38 ? -9.159  1.413   -1.396  1.00 0.00 ? 38  HIS A C    4  
ATOM   4045  O  O    . HIS A 1 38 ? -7.952  1.300   -1.177  1.00 0.00 ? 38  HIS A O    4  
ATOM   4046  C  CB   . HIS A 1 38 ? -10.932 1.066   0.333   1.00 0.00 ? 38  HIS A CB   4  
ATOM   4047  C  CG   . HIS A 1 38 ? -12.269 0.441   0.591   1.00 0.00 ? 38  HIS A CG   4  
ATOM   4048  N  ND1  . HIS A 1 38 ? -12.542 -0.316  1.711   1.00 0.00 ? 38  HIS A ND1  4  
ATOM   4049  C  CD2  . HIS A 1 38 ? -13.412 0.465   -0.134  1.00 0.00 ? 38  HIS A CD2  4  
ATOM   4050  C  CE1  . HIS A 1 38 ? -13.796 -0.731  1.663   1.00 0.00 ? 38  HIS A CE1  4  
ATOM   4051  N  NE2  . HIS A 1 38 ? -14.345 -0.271  0.554   1.00 0.00 ? 38  HIS A NE2  4  
ATOM   4052  H  H    . HIS A 1 38 ? -9.287  -0.905  0.565   1.00 0.00 ? 38  HIS A H    4  
ATOM   4053  H  HA   . HIS A 1 38 ? -10.871 0.158   -1.603  1.00 0.00 ? 38  HIS A HA   4  
ATOM   4054  H  HB2  . HIS A 1 38 ? -10.345 0.975   1.235   1.00 0.00 ? 38  HIS A HB2  4  
ATOM   4055  H  HB3  . HIS A 1 38 ? -11.091 2.112   0.116   1.00 0.00 ? 38  HIS A HB3  4  
ATOM   4056  H  HD2  . HIS A 1 38 ? -13.562 0.968   -1.078  1.00 0.00 ? 38  HIS A HD2  4  
ATOM   4057  H  HE1  . HIS A 1 38 ? -14.288 -1.343  2.405   1.00 0.00 ? 38  HIS A HE1  4  
ATOM   4058  H  HE2  . HIS A 1 38 ? -15.241 -0.502  0.230   1.00 0.00 ? 38  HIS A HE2  4  
ATOM   4059  N  N    . PRO A 1 39 ? -9.659  2.407   -2.145  1.00 0.00 ? 39  PRO A N    4  
ATOM   4060  C  CA   . PRO A 1 39 ? -8.816  3.435   -2.762  1.00 0.00 ? 39  PRO A CA   4  
ATOM   4061  C  C    . PRO A 1 39 ? -8.212  4.384   -1.732  1.00 0.00 ? 39  PRO A C    4  
ATOM   4062  O  O    . PRO A 1 39 ? -7.322  5.173   -2.048  1.00 0.00 ? 39  PRO A O    4  
ATOM   4063  C  CB   . PRO A 1 39 ? -9.785  4.187   -3.677  1.00 0.00 ? 39  PRO A CB   4  
ATOM   4064  C  CG   . PRO A 1 39 ? -11.127 3.974   -3.066  1.00 0.00 ? 39  PRO A CG   4  
ATOM   4065  C  CD   . PRO A 1 39 ? -11.087 2.603   -2.448  1.00 0.00 ? 39  PRO A CD   4  
ATOM   4066  H  HA   . PRO A 1 39 ? -8.025  2.998   -3.353  1.00 0.00 ? 39  PRO A HA   4  
ATOM   4067  H  HB2  . PRO A 1 39 ? -9.523  5.235   -3.701  1.00 0.00 ? 39  PRO A HB2  4  
ATOM   4068  H  HB3  . PRO A 1 39 ? -9.737  3.776   -4.674  1.00 0.00 ? 39  PRO A HB3  4  
ATOM   4069  H  HG2  . PRO A 1 39 ? -11.308 4.721   -2.309  1.00 0.00 ? 39  PRO A HG2  4  
ATOM   4070  H  HG3  . PRO A 1 39 ? -11.889 4.018   -3.829  1.00 0.00 ? 39  PRO A HG3  4  
ATOM   4071  H  HD2  . PRO A 1 39 ? -11.679 2.579   -1.545  1.00 0.00 ? 39  PRO A HD2  4  
ATOM   4072  H  HD3  . PRO A 1 39 ? -11.437 1.862   -3.151  1.00 0.00 ? 39  PRO A HD3  4  
ATOM   4073  N  N    . GLU A 1 40 ? -8.702  4.302   -0.499  1.00 0.00 ? 40  GLU A N    4  
ATOM   4074  C  CA   . GLU A 1 40 ? -8.210  5.154   0.577   1.00 0.00 ? 40  GLU A CA   4  
ATOM   4075  C  C    . GLU A 1 40 ? -7.456  4.334   1.619   1.00 0.00 ? 40  GLU A C    4  
ATOM   4076  O  O    . GLU A 1 40 ? -6.574  4.846   2.310   1.00 0.00 ? 40  GLU A O    4  
ATOM   4077  C  CB   . GLU A 1 40 ? -9.371  5.898   1.240   1.00 0.00 ? 40  GLU A CB   4  
ATOM   4078  C  CG   . GLU A 1 40 ? -10.319 4.989   2.005   1.00 0.00 ? 40  GLU A CG   4  
ATOM   4079  C  CD   . GLU A 1 40 ? -11.013 5.701   3.150   1.00 0.00 ? 40  GLU A CD   4  
ATOM   4080  O  OE1  . GLU A 1 40 ? -10.381 5.872   4.213   1.00 0.00 ? 40  GLU A OE1  4  
ATOM   4081  O  OE2  . GLU A 1 40 ? -12.189 6.087   2.982   1.00 0.00 ? 40  GLU A OE2  4  
ATOM   4082  H  H    . GLU A 1 40 ? -9.412  3.653   -0.308  1.00 0.00 ? 40  GLU A H    4  
ATOM   4083  H  HA   . GLU A 1 40 ? -7.533  5.875   0.145   1.00 0.00 ? 40  GLU A HA   4  
ATOM   4084  H  HB2  . GLU A 1 40 ? -8.970  6.627   1.928   1.00 0.00 ? 40  GLU A HB2  4  
ATOM   4085  H  HB3  . GLU A 1 40 ? -9.937  6.411   0.476   1.00 0.00 ? 40  GLU A HB3  4  
ATOM   4086  H  HG2  . GLU A 1 40 ? -11.070 4.619   1.323   1.00 0.00 ? 40  GLU A HG2  4  
ATOM   4087  H  HG3  . GLU A 1 40 ? -9.757  4.158   2.404   1.00 0.00 ? 40  GLU A HG3  4  
ATOM   4088  N  N    . CYS A 1 41 ? -7.809  3.057   1.728   1.00 0.00 ? 41  CYS A N    4  
ATOM   4089  C  CA   . CYS A 1 41 ? -7.168  2.165   2.686   1.00 0.00 ? 41  CYS A CA   4  
ATOM   4090  C  C    . CYS A 1 41 ? -5.892  1.566   2.101   1.00 0.00 ? 41  CYS A C    4  
ATOM   4091  O  O    . CYS A 1 41 ? -5.172  0.830   2.777   1.00 0.00 ? 41  CYS A O    4  
ATOM   4092  C  CB   . CYS A 1 41 ? -8.128  1.047   3.095   1.00 0.00 ? 41  CYS A CB   4  
ATOM   4093  S  SG   . CYS A 1 41 ? -9.757  1.636   3.660   1.00 0.00 ? 41  CYS A SG   4  
ATOM   4094  H  H    . CYS A 1 41 ? -8.519  2.706   1.149   1.00 0.00 ? 41  CYS A H    4  
ATOM   4095  H  HA   . CYS A 1 41 ? -6.911  2.744   3.559   1.00 0.00 ? 41  CYS A HA   4  
ATOM   4096  H  HB2  . CYS A 1 41 ? -8.291  0.395   2.249   1.00 0.00 ? 41  CYS A HB2  4  
ATOM   4097  H  HB3  . CYS A 1 41 ? -7.686  0.479   3.900   1.00 0.00 ? 41  CYS A HB3  4  
ATOM   4098  N  N    . TYR A 1 42 ? -5.618  1.886   0.841   1.00 0.00 ? 42  TYR A N    4  
ATOM   4099  C  CA   . TYR A 1 42 ? -4.430  1.378   0.165   1.00 0.00 ? 42  TYR A CA   4  
ATOM   4100  C  C    . TYR A 1 42 ? -3.176  2.096   0.653   1.00 0.00 ? 42  TYR A C    4  
ATOM   4101  O  O    . TYR A 1 42 ? -2.092  1.927   0.094   1.00 0.00 ? 42  TYR A O    4  
ATOM   4102  C  CB   . TYR A 1 42 ? -4.570  1.545   -1.349  1.00 0.00 ? 42  TYR A CB   4  
ATOM   4103  C  CG   . TYR A 1 42 ? -3.306  1.222   -2.113  1.00 0.00 ? 42  TYR A CG   4  
ATOM   4104  C  CD1  . TYR A 1 42 ? -2.577  0.073   -1.834  1.00 0.00 ? 42  TYR A CD1  4  
ATOM   4105  C  CD2  . TYR A 1 42 ? -2.840  2.066   -3.114  1.00 0.00 ? 42  TYR A CD2  4  
ATOM   4106  C  CE1  . TYR A 1 42 ? -1.421  -0.226  -2.529  1.00 0.00 ? 42  TYR A CE1  4  
ATOM   4107  C  CE2  . TYR A 1 42 ? -1.686  1.775   -3.815  1.00 0.00 ? 42  TYR A CE2  4  
ATOM   4108  C  CZ   . TYR A 1 42 ? -0.980  0.627   -3.519  1.00 0.00 ? 42  TYR A CZ   4  
ATOM   4109  O  OH   . TYR A 1 42 ? 0.171   0.334   -4.214  1.00 0.00 ? 42  TYR A OH   4  
ATOM   4110  H  H    . TYR A 1 42 ? -6.229  2.477   0.354   1.00 0.00 ? 42  TYR A H    4  
ATOM   4111  H  HA   . TYR A 1 42 ? -4.342  0.326   0.394   1.00 0.00 ? 42  TYR A HA   4  
ATOM   4112  H  HB2  . TYR A 1 42 ? -5.349  0.889   -1.706  1.00 0.00 ? 42  TYR A HB2  4  
ATOM   4113  H  HB3  . TYR A 1 42 ? -4.839  2.568   -1.569  1.00 0.00 ? 42  TYR A HB3  4  
ATOM   4114  H  HD1  . TYR A 1 42 ? -2.925  -0.594  -1.058  1.00 0.00 ? 42  TYR A HD1  4  
ATOM   4115  H  HD2  . TYR A 1 42 ? -3.396  2.964   -3.343  1.00 0.00 ? 42  TYR A HD2  4  
ATOM   4116  H  HE1  . TYR A 1 42 ? -0.867  -1.125  -2.298  1.00 0.00 ? 42  TYR A HE1  4  
ATOM   4117  H  HE2  . TYR A 1 42 ? -1.341  2.443   -4.589  1.00 0.00 ? 42  TYR A HE2  4  
ATOM   4118  H  HH   . TYR A 1 42 ? 0.508   -0.518  -3.929  1.00 0.00 ? 42  TYR A HH   4  
ATOM   4119  N  N    . VAL A 1 43 ? -3.332  2.899   1.701   1.00 0.00 ? 43  VAL A N    4  
ATOM   4120  C  CA   . VAL A 1 43 ? -2.213  3.642   2.268   1.00 0.00 ? 43  VAL A CA   4  
ATOM   4121  C  C    . VAL A 1 43 ? -1.335  2.742   3.130   1.00 0.00 ? 43  VAL A C    4  
ATOM   4122  O  O    . VAL A 1 43 ? -1.758  1.667   3.556   1.00 0.00 ? 43  VAL A O    4  
ATOM   4123  C  CB   . VAL A 1 43 ? -2.701  4.830   3.117   1.00 0.00 ? 43  VAL A CB   4  
ATOM   4124  C  CG1  . VAL A 1 43 ? -3.446  5.835   2.252   1.00 0.00 ? 43  VAL A CG1  4  
ATOM   4125  C  CG2  . VAL A 1 43 ? -3.579  4.343   4.260   1.00 0.00 ? 43  VAL A CG2  4  
ATOM   4126  H  H    . VAL A 1 43 ? -4.220  2.992   2.104   1.00 0.00 ? 43  VAL A H    4  
ATOM   4127  H  HA   . VAL A 1 43 ? -1.621  4.029   1.451   1.00 0.00 ? 43  VAL A HA   4  
ATOM   4128  H  HB   . VAL A 1 43 ? -1.838  5.323   3.540   1.00 0.00 ? 43  VAL A HB   4  
ATOM   4129  H  HG11 . VAL A 1 43 ? -2.895  6.001   1.338   1.00 0.00 ? 43  VAL A HG11 4  
ATOM   4130  H  HG12 . VAL A 1 43 ? -4.428  5.450   2.017   1.00 0.00 ? 43  VAL A HG12 4  
ATOM   4131  H  HG13 . VAL A 1 43 ? -3.544  6.768   2.787   1.00 0.00 ? 43  VAL A HG13 4  
ATOM   4132  H  HG21 . VAL A 1 43 ? -3.874  3.321   4.075   1.00 0.00 ? 43  VAL A HG21 4  
ATOM   4133  H  HG22 . VAL A 1 43 ? -3.027  4.396   5.187   1.00 0.00 ? 43  VAL A HG22 4  
ATOM   4134  H  HG23 . VAL A 1 43 ? -4.459  4.965   4.329   1.00 0.00 ? 43  VAL A HG23 4  
ATOM   4135  N  N    . CYS A 1 44 ? -0.109  3.188   3.384   1.00 0.00 ? 44  CYS A N    4  
ATOM   4136  C  CA   . CYS A 1 44 ? 0.830   2.423   4.196   1.00 0.00 ? 44  CYS A CA   4  
ATOM   4137  C  C    . CYS A 1 44 ? 0.202   2.030   5.530   1.00 0.00 ? 44  CYS A C    4  
ATOM   4138  O  O    . CYS A 1 44 ? -0.688  2.715   6.037   1.00 0.00 ? 44  CYS A O    4  
ATOM   4139  C  CB   . CYS A 1 44 ? 2.104   3.235   4.439   1.00 0.00 ? 44  CYS A CB   4  
ATOM   4140  S  SG   . CYS A 1 44 ? 3.318   2.407   5.517   1.00 0.00 ? 44  CYS A SG   4  
ATOM   4141  H  H    . CYS A 1 44 ? 0.171   4.053   3.017   1.00 0.00 ? 44  CYS A H    4  
ATOM   4142  H  HA   . CYS A 1 44 ? 1.084   1.525   3.653   1.00 0.00 ? 44  CYS A HA   4  
ATOM   4143  H  HB2  . CYS A 1 44 ? 2.585   3.427   3.492   1.00 0.00 ? 44  CYS A HB2  4  
ATOM   4144  H  HB3  . CYS A 1 44 ? 1.840   4.175   4.901   1.00 0.00 ? 44  CYS A HB3  4  
ATOM   4145  N  N    . THR A 1 45 ? 0.670   0.922   6.095   1.00 0.00 ? 45  THR A N    4  
ATOM   4146  C  CA   . THR A 1 45 ? 0.155   0.436   7.369   1.00 0.00 ? 45  THR A CA   4  
ATOM   4147  C  C    . THR A 1 45 ? 0.892   1.076   8.540   1.00 0.00 ? 45  THR A C    4  
ATOM   4148  O  O    . THR A 1 45 ? 0.302   1.339   9.588   1.00 0.00 ? 45  THR A O    4  
ATOM   4149  C  CB   . THR A 1 45 ? 0.274   -1.096  7.476   1.00 0.00 ? 45  THR A CB   4  
ATOM   4150  O  OG1  . THR A 1 45 ? -0.460  -1.720  6.417   1.00 0.00 ? 45  THR A OG1  4  
ATOM   4151  C  CG2  . THR A 1 45 ? -0.246  -1.586  8.819   1.00 0.00 ? 45  THR A CG2  4  
ATOM   4152  H  H    . THR A 1 45 ? 1.380   0.419   5.643   1.00 0.00 ? 45  THR A H    4  
ATOM   4153  H  HA   . THR A 1 45 ? -0.891  0.700   7.428   1.00 0.00 ? 45  THR A HA   4  
ATOM   4154  H  HB   . THR A 1 45 ? 1.317   -1.367  7.390   1.00 0.00 ? 45  THR A HB   4  
ATOM   4155  H  HG1  . THR A 1 45 ? -0.370  -2.673  6.484   1.00 0.00 ? 45  THR A HG1  4  
ATOM   4156  H  HG21 . THR A 1 45 ? -0.599  -0.745  9.398   1.00 0.00 ? 45  THR A HG21 4  
ATOM   4157  H  HG22 . THR A 1 45 ? 0.550   -2.083  9.354   1.00 0.00 ? 45  THR A HG22 4  
ATOM   4158  H  HG23 . THR A 1 45 ? -1.058  -2.278  8.658   1.00 0.00 ? 45  THR A HG23 4  
ATOM   4159  N  N    . ASP A 1 46 ? 2.184   1.324   8.355   1.00 0.00 ? 46  ASP A N    4  
ATOM   4160  C  CA   . ASP A 1 46 ? 3.002   1.934   9.397   1.00 0.00 ? 46  ASP A CA   4  
ATOM   4161  C  C    . ASP A 1 46 ? 2.579   3.379   9.642   1.00 0.00 ? 46  ASP A C    4  
ATOM   4162  O  O    . ASP A 1 46 ? 2.087   3.719   10.719  1.00 0.00 ? 46  ASP A O    4  
ATOM   4163  C  CB   . ASP A 1 46 ? 4.481   1.882   9.010   1.00 0.00 ? 46  ASP A CB   4  
ATOM   4164  C  CG   . ASP A 1 46 ? 5.396   1.887   10.218  1.00 0.00 ? 46  ASP A CG   4  
ATOM   4165  O  OD1  . ASP A 1 46 ? 5.559   0.819   10.844  1.00 0.00 ? 46  ASP A OD1  4  
ATOM   4166  O  OD2  . ASP A 1 46 ? 5.948   2.961   10.540  1.00 0.00 ? 46  ASP A OD2  4  
ATOM   4167  H  H    . ASP A 1 46 ? 2.597   1.091   7.497   1.00 0.00 ? 46  ASP A H    4  
ATOM   4168  H  HA   . ASP A 1 46 ? 2.857   1.371   10.306  1.00 0.00 ? 46  ASP A HA   4  
ATOM   4169  H  HB2  . ASP A 1 46 ? 4.667   0.979   8.445   1.00 0.00 ? 46  ASP A HB2  4  
ATOM   4170  H  HB3  . ASP A 1 46 ? 4.717   2.740   8.397   1.00 0.00 ? 46  ASP A HB3  4  
ATOM   4171  N  N    . CYS A 1 47 ? 2.775   4.227   8.638   1.00 0.00 ? 47  CYS A N    4  
ATOM   4172  C  CA   . CYS A 1 47 ? 2.416   5.636   8.744   1.00 0.00 ? 47  CYS A CA   4  
ATOM   4173  C  C    . CYS A 1 47 ? 1.003   5.878   8.221   1.00 0.00 ? 47  CYS A C    4  
ATOM   4174  O  O    . CYS A 1 47 ? 0.112   6.276   8.971   1.00 0.00 ? 47  CYS A O    4  
ATOM   4175  C  CB   . CYS A 1 47 ? 3.413   6.498   7.969   1.00 0.00 ? 47  CYS A CB   4  
ATOM   4176  S  SG   . CYS A 1 47 ? 3.991   5.748   6.412   1.00 0.00 ? 47  CYS A SG   4  
ATOM   4177  H  H    . CYS A 1 47 ? 3.171   3.897   7.804   1.00 0.00 ? 47  CYS A H    4  
ATOM   4178  H  HA   . CYS A 1 47 ? 2.452   5.910   9.788   1.00 0.00 ? 47  CYS A HA   4  
ATOM   4179  H  HB2  . CYS A 1 47 ? 2.948   7.442   7.725   1.00 0.00 ? 47  CYS A HB2  4  
ATOM   4180  H  HB3  . CYS A 1 47 ? 4.279   6.679   8.588   1.00 0.00 ? 47  CYS A HB3  4  
ATOM   4181  N  N    . GLY A 1 48 ? 0.806   5.633   6.929   1.00 0.00 ? 48  GLY A N    4  
ATOM   4182  C  CA   . GLY A 1 48 ? -0.500  5.830   6.328   1.00 0.00 ? 48  GLY A CA   4  
ATOM   4183  C  C    . GLY A 1 48 ? -0.474  6.848   5.205   1.00 0.00 ? 48  GLY A C    4  
ATOM   4184  O  O    . GLY A 1 48 ? -1.258  7.798   5.199   1.00 0.00 ? 48  GLY A O    4  
ATOM   4185  H  H    . GLY A 1 48 ? 1.553   5.316   6.380   1.00 0.00 ? 48  GLY A H    4  
ATOM   4186  H  HA2  . GLY A 1 48 ? -0.850  4.886   5.936   1.00 0.00 ? 48  GLY A HA2  4  
ATOM   4187  H  HA3  . GLY A 1 48 ? -1.187  6.169   7.090   1.00 0.00 ? 48  GLY A HA3  4  
ATOM   4188  N  N    . THR A 1 49 ? 0.430   6.651   4.251   1.00 0.00 ? 49  THR A N    4  
ATOM   4189  C  CA   . THR A 1 49 ? 0.558   7.561   3.119   1.00 0.00 ? 49  THR A CA   4  
ATOM   4190  C  C    . THR A 1 49 ? -0.044  6.955   1.857   1.00 0.00 ? 49  THR A C    4  
ATOM   4191  O  O    . THR A 1 49 ? -0.231  5.743   1.767   1.00 0.00 ? 49  THR A O    4  
ATOM   4192  C  CB   . THR A 1 49 ? 2.031   7.921   2.851   1.00 0.00 ? 49  THR A CB   4  
ATOM   4193  O  OG1  . THR A 1 49 ? 2.110   8.967   1.877   1.00 0.00 ? 49  THR A OG1  4  
ATOM   4194  C  CG2  . THR A 1 49 ? 2.804   6.706   2.362   1.00 0.00 ? 49  THR A CG2  4  
ATOM   4195  H  H    . THR A 1 49 ? 1.026   5.876   4.311   1.00 0.00 ? 49  THR A H    4  
ATOM   4196  H  HA   . THR A 1 49 ? 0.025   8.469   3.360   1.00 0.00 ? 49  THR A HA   4  
ATOM   4197  H  HB   . THR A 1 49 ? 2.476   8.264   3.774   1.00 0.00 ? 49  THR A HB   4  
ATOM   4198  H  HG1  . THR A 1 49 ? 2.294   9.801   2.317   1.00 0.00 ? 49  THR A HG1  4  
ATOM   4199  H  HG21 . THR A 1 49 ? 3.074   6.844   1.325   1.00 0.00 ? 49  THR A HG21 4  
ATOM   4200  H  HG22 . THR A 1 49 ? 2.189   5.824   2.459   1.00 0.00 ? 49  THR A HG22 4  
ATOM   4201  H  HG23 . THR A 1 49 ? 3.700   6.587   2.953   1.00 0.00 ? 49  THR A HG23 4  
ATOM   4202  N  N    . ASN A 1 50 ? -0.343  7.807   0.882   1.00 0.00 ? 50  ASN A N    4  
ATOM   4203  C  CA   . ASN A 1 50 ? -0.924  7.355   -0.377  1.00 0.00 ? 50  ASN A CA   4  
ATOM   4204  C  C    . ASN A 1 50 ? 0.093   6.560   -1.190  1.00 0.00 ? 50  ASN A C    4  
ATOM   4205  O  O    . ASN A 1 50 ? 1.167   7.061   -1.523  1.00 0.00 ? 50  ASN A O    4  
ATOM   4206  C  CB   . ASN A 1 50 ? -1.422  8.551   -1.192  1.00 0.00 ? 50  ASN A CB   4  
ATOM   4207  C  CG   . ASN A 1 50 ? -2.456  8.154   -2.228  1.00 0.00 ? 50  ASN A CG   4  
ATOM   4208  O  OD1  . ASN A 1 50 ? -2.262  8.361   -3.426  1.00 0.00 ? 50  ASN A OD1  4  
ATOM   4209  N  ND2  . ASN A 1 50 ? -3.562  7.580   -1.770  1.00 0.00 ? 50  ASN A ND2  4  
ATOM   4210  H  H    . ASN A 1 50 ? -0.170  8.763   1.012   1.00 0.00 ? 50  ASN A H    4  
ATOM   4211  H  HA   . ASN A 1 50 ? -1.762  6.715   -0.145  1.00 0.00 ? 50  ASN A HA   4  
ATOM   4212  H  HB2  . ASN A 1 50 ? -1.869  9.272   -0.524  1.00 0.00 ? 50  ASN A HB2  4  
ATOM   4213  H  HB3  . ASN A 1 50 ? -0.585  9.006   -1.700  1.00 0.00 ? 50  ASN A HB3  4  
ATOM   4214  H  HD21 . ASN A 1 50 ? -3.648  7.446   -0.803  1.00 0.00 ? 50  ASN A HD21 4  
ATOM   4215  H  HD22 . ASN A 1 50 ? -4.247  7.313   -2.418  1.00 0.00 ? 50  ASN A HD22 4  
ATOM   4216  N  N    . LEU A 1 51 ? -0.254  5.317   -1.507  1.00 0.00 ? 51  LEU A N    4  
ATOM   4217  C  CA   . LEU A 1 51 ? 0.628   4.451   -2.282  1.00 0.00 ? 51  LEU A CA   4  
ATOM   4218  C  C    . LEU A 1 51 ? 0.101   4.267   -3.702  1.00 0.00 ? 51  LEU A C    4  
ATOM   4219  O  O    . LEU A 1 51 ? 0.598   3.431   -4.457  1.00 0.00 ? 51  LEU A O    4  
ATOM   4220  C  CB   . LEU A 1 51 ? 0.769   3.090   -1.598  1.00 0.00 ? 51  LEU A CB   4  
ATOM   4221  C  CG   . LEU A 1 51 ? 1.081   3.120   -0.102  1.00 0.00 ? 51  LEU A CG   4  
ATOM   4222  C  CD1  . LEU A 1 51 ? 1.045   1.715   0.480   1.00 0.00 ? 51  LEU A CD1  4  
ATOM   4223  C  CD2  . LEU A 1 51 ? 2.434   3.769   0.149   1.00 0.00 ? 51  LEU A CD2  4  
ATOM   4224  H  H    . LEU A 1 51 ? -1.122  4.973   -1.214  1.00 0.00 ? 51  LEU A H    4  
ATOM   4225  H  HA   . LEU A 1 51 ? 1.598   4.923   -2.330  1.00 0.00 ? 51  LEU A HA   4  
ATOM   4226  H  HB2  . LEU A 1 51 ? -0.158  2.555   -1.732  1.00 0.00 ? 51  LEU A HB2  4  
ATOM   4227  H  HB3  . LEU A 1 51 ? 1.567   2.554   -2.092  1.00 0.00 ? 51  LEU A HB3  4  
ATOM   4228  H  HG   . LEU A 1 51 ? 0.328   3.709   0.404   1.00 0.00 ? 51  LEU A HG   4  
ATOM   4229  H  HD11 . LEU A 1 51 ? 1.239   1.760   1.541   1.00 0.00 ? 51  LEU A HD11 4  
ATOM   4230  H  HD12 . LEU A 1 51 ? 1.800   1.109   0.001   1.00 0.00 ? 51  LEU A HD12 4  
ATOM   4231  H  HD13 . LEU A 1 51 ? 0.072   1.280   0.308   1.00 0.00 ? 51  LEU A HD13 4  
ATOM   4232  H  HD21 . LEU A 1 51 ? 3.169   3.334   -0.512  1.00 0.00 ? 51  LEU A HD21 4  
ATOM   4233  H  HD22 . LEU A 1 51 ? 2.729   3.602   1.175   1.00 0.00 ? 51  LEU A HD22 4  
ATOM   4234  H  HD23 . LEU A 1 51 ? 2.365   4.831   -0.038  1.00 0.00 ? 51  LEU A HD23 4  
ATOM   4235  N  N    . LYS A 1 52 ? -0.908  5.054   -4.059  1.00 0.00 ? 52  LYS A N    4  
ATOM   4236  C  CA   . LYS A 1 52 ? -1.502  4.982   -5.389  1.00 0.00 ? 52  LYS A CA   4  
ATOM   4237  C  C    . LYS A 1 52 ? -0.422  4.952   -6.466  1.00 0.00 ? 52  LYS A C    4  
ATOM   4238  O  O    . LYS A 1 52 ? -0.431  4.087   -7.341  1.00 0.00 ? 52  LYS A O    4  
ATOM   4239  C  CB   . LYS A 1 52 ? -2.434  6.174   -5.619  1.00 0.00 ? 52  LYS A CB   4  
ATOM   4240  C  CG   . LYS A 1 52 ? -3.207  6.098   -6.925  1.00 0.00 ? 52  LYS A CG   4  
ATOM   4241  C  CD   . LYS A 1 52 ? -4.331  7.120   -6.967  1.00 0.00 ? 52  LYS A CD   4  
ATOM   4242  C  CE   . LYS A 1 52 ? -3.799  8.523   -7.211  1.00 0.00 ? 52  LYS A CE   4  
ATOM   4243  N  NZ   . LYS A 1 52 ? -4.717  9.566   -6.675  1.00 0.00 ? 52  LYS A NZ   4  
ATOM   4244  H  H    . LYS A 1 52 ? -1.262  5.701   -3.412  1.00 0.00 ? 52  LYS A H    4  
ATOM   4245  H  HA   . LYS A 1 52 ? -2.076  4.070   -5.447  1.00 0.00 ? 52  LYS A HA   4  
ATOM   4246  H  HB2  . LYS A 1 52 ? -3.144  6.222   -4.807  1.00 0.00 ? 52  LYS A HB2  4  
ATOM   4247  H  HB3  . LYS A 1 52 ? -1.845  7.080   -5.626  1.00 0.00 ? 52  LYS A HB3  4  
ATOM   4248  H  HG2  . LYS A 1 52 ? -2.531  6.288   -7.745  1.00 0.00 ? 52  LYS A HG2  4  
ATOM   4249  H  HG3  . LYS A 1 52 ? -3.629  5.108   -7.025  1.00 0.00 ? 52  LYS A HG3  4  
ATOM   4250  H  HD2  . LYS A 1 52 ? -5.011  6.861   -7.765  1.00 0.00 ? 52  LYS A HD2  4  
ATOM   4251  H  HD3  . LYS A 1 52 ? -4.857  7.102   -6.023  1.00 0.00 ? 52  LYS A HD3  4  
ATOM   4252  H  HE2  . LYS A 1 52 ? -2.838  8.619   -6.729  1.00 0.00 ? 52  LYS A HE2  4  
ATOM   4253  H  HE3  . LYS A 1 52 ? -3.683  8.670   -8.275  1.00 0.00 ? 52  LYS A HE3  4  
ATOM   4254  H  HZ1  . LYS A 1 52 ? -5.306  9.166   -5.916  1.00 0.00 ? 52  LYS A HZ1  4  
ATOM   4255  H  HZ2  . LYS A 1 52 ? -5.338  9.918   -7.431  1.00 0.00 ? 52  LYS A HZ2  4  
ATOM   4256  H  HZ3  . LYS A 1 52 ? -4.169  10.362  -6.291  1.00 0.00 ? 52  LYS A HZ3  4  
ATOM   4257  N  N    . GLN A 1 53 ? 0.506   5.900   -6.394  1.00 0.00 ? 53  GLN A N    4  
ATOM   4258  C  CA   . GLN A 1 53 ? 1.592   5.981   -7.363  1.00 0.00 ? 53  GLN A CA   4  
ATOM   4259  C  C    . GLN A 1 53 ? 2.860   5.334   -6.815  1.00 0.00 ? 53  GLN A C    4  
ATOM   4260  O  O    . GLN A 1 53 ? 3.417   4.421   -7.424  1.00 0.00 ? 53  GLN A O    4  
ATOM   4261  C  CB   . GLN A 1 53 ? 1.869   7.440   -7.731  1.00 0.00 ? 53  GLN A CB   4  
ATOM   4262  C  CG   . GLN A 1 53 ? 0.754   8.084   -8.540  1.00 0.00 ? 53  GLN A CG   4  
ATOM   4263  C  CD   . GLN A 1 53 ? 1.188   9.375   -9.206  1.00 0.00 ? 53  GLN A CD   4  
ATOM   4264  O  OE1  . GLN A 1 53 ? 2.169   9.404   -9.951  1.00 0.00 ? 53  GLN A OE1  4  
ATOM   4265  N  NE2  . GLN A 1 53 ? 0.459   10.452  -8.942  1.00 0.00 ? 53  GLN A NE2  4  
ATOM   4266  H  H    . GLN A 1 53 ? 0.459   6.561   -5.673  1.00 0.00 ? 53  GLN A H    4  
ATOM   4267  H  HA   . GLN A 1 53 ? 1.285   5.447   -8.250  1.00 0.00 ? 53  GLN A HA   4  
ATOM   4268  H  HB2  . GLN A 1 53 ? 2.002   8.009   -6.824  1.00 0.00 ? 53  GLN A HB2  4  
ATOM   4269  H  HB3  . GLN A 1 53 ? 2.778   7.486   -8.312  1.00 0.00 ? 53  GLN A HB3  4  
ATOM   4270  H  HG2  . GLN A 1 53 ? 0.435   7.392   -9.305  1.00 0.00 ? 53  GLN A HG2  4  
ATOM   4271  H  HG3  . GLN A 1 53 ? -0.074  8.297   -7.880  1.00 0.00 ? 53  GLN A HG3  4  
ATOM   4272  H  HE21 . GLN A 1 53 ? -0.308  10.355  -8.338  1.00 0.00 ? 53  GLN A HE21 4  
ATOM   4273  H  HE22 . GLN A 1 53 ? 0.717   11.300  -9.358  1.00 0.00 ? 53  GLN A HE22 4  
ATOM   4274  N  N    . LYS A 1 54 ? 3.311   5.813   -5.660  1.00 0.00 ? 54  LYS A N    4  
ATOM   4275  C  CA   . LYS A 1 54 ? 4.513   5.281   -5.028  1.00 0.00 ? 54  LYS A CA   4  
ATOM   4276  C  C    . LYS A 1 54 ? 4.525   3.757   -5.078  1.00 0.00 ? 54  LYS A C    4  
ATOM   4277  O  O    . LYS A 1 54 ? 5.521   3.147   -5.464  1.00 0.00 ? 54  LYS A O    4  
ATOM   4278  C  CB   . LYS A 1 54 ? 4.602   5.755   -3.576  1.00 0.00 ? 54  LYS A CB   4  
ATOM   4279  C  CG   . LYS A 1 54 ? 4.873   7.243   -3.437  1.00 0.00 ? 54  LYS A CG   4  
ATOM   4280  C  CD   . LYS A 1 54 ? 4.951   7.662   -1.978  1.00 0.00 ? 54  LYS A CD   4  
ATOM   4281  C  CE   . LYS A 1 54 ? 5.012   9.175   -1.836  1.00 0.00 ? 54  LYS A CE   4  
ATOM   4282  N  NZ   . LYS A 1 54 ? 3.701   9.814   -2.139  1.00 0.00 ? 54  LYS A NZ   4  
ATOM   4283  H  H    . LYS A 1 54 ? 2.823   6.542   -5.222  1.00 0.00 ? 54  LYS A H    4  
ATOM   4284  H  HA   . LYS A 1 54 ? 5.367   5.654   -5.573  1.00 0.00 ? 54  LYS A HA   4  
ATOM   4285  H  HB2  . LYS A 1 54 ? 3.669   5.533   -3.079  1.00 0.00 ? 54  LYS A HB2  4  
ATOM   4286  H  HB3  . LYS A 1 54 ? 5.399   5.218   -3.083  1.00 0.00 ? 54  LYS A HB3  4  
ATOM   4287  H  HG2  . LYS A 1 54 ? 5.812   7.475   -3.918  1.00 0.00 ? 54  LYS A HG2  4  
ATOM   4288  H  HG3  . LYS A 1 54 ? 4.075   7.792   -3.918  1.00 0.00 ? 54  LYS A HG3  4  
ATOM   4289  H  HD2  . LYS A 1 54 ? 4.076   7.298   -1.461  1.00 0.00 ? 54  LYS A HD2  4  
ATOM   4290  H  HD3  . LYS A 1 54 ? 5.839   7.232   -1.536  1.00 0.00 ? 54  LYS A HD3  4  
ATOM   4291  H  HE2  . LYS A 1 54 ? 5.295   9.417   -0.823  1.00 0.00 ? 54  LYS A HE2  4  
ATOM   4292  H  HE3  . LYS A 1 54 ? 5.756   9.559   -2.518  1.00 0.00 ? 54  LYS A HE3  4  
ATOM   4293  H  HZ1  . LYS A 1 54 ? 3.161   9.223   -2.803  1.00 0.00 ? 54  LYS A HZ1  4  
ATOM   4294  H  HZ2  . LYS A 1 54 ? 3.850   10.749  -2.568  1.00 0.00 ? 54  LYS A HZ2  4  
ATOM   4295  H  HZ3  . LYS A 1 54 ? 3.149   9.929   -1.265  1.00 0.00 ? 54  LYS A HZ3  4  
ATOM   4296  N  N    . GLY A 1 55 ? 3.410   3.147   -4.687  1.00 0.00 ? 55  GLY A N    4  
ATOM   4297  C  CA   . GLY A 1 55 ? 3.314   1.699   -4.696  1.00 0.00 ? 55  GLY A CA   4  
ATOM   4298  C  C    . GLY A 1 55 ? 3.487   1.098   -3.316  1.00 0.00 ? 55  GLY A C    4  
ATOM   4299  O  O    . GLY A 1 55 ? 4.072   1.719   -2.428  1.00 0.00 ? 55  GLY A O    4  
ATOM   4300  H  H    . GLY A 1 55 ? 2.646   3.685   -4.389  1.00 0.00 ? 55  GLY A H    4  
ATOM   4301  H  HA2  . GLY A 1 55 ? 2.346   1.416   -5.082  1.00 0.00 ? 55  GLY A HA2  4  
ATOM   4302  H  HA3  . GLY A 1 55 ? 4.079   1.303   -5.347  1.00 0.00 ? 55  GLY A HA3  4  
ATOM   4303  N  N    . HIS A 1 56 ? 2.975   -0.115  -3.132  1.00 0.00 ? 56  HIS A N    4  
ATOM   4304  C  CA   . HIS A 1 56 ? 3.075   -0.801  -1.848  1.00 0.00 ? 56  HIS A CA   4  
ATOM   4305  C  C    . HIS A 1 56 ? 3.948   -2.046  -1.964  1.00 0.00 ? 56  HIS A C    4  
ATOM   4306  O  O    . HIS A 1 56 ? 4.149   -2.577  -3.057  1.00 0.00 ? 56  HIS A O    4  
ATOM   4307  C  CB   . HIS A 1 56 ? 1.684   -1.184  -1.341  1.00 0.00 ? 56  HIS A CB   4  
ATOM   4308  C  CG   . HIS A 1 56 ? 1.300   -2.597  -1.658  1.00 0.00 ? 56  HIS A CG   4  
ATOM   4309  N  ND1  . HIS A 1 56 ? 0.691   -2.965  -2.839  1.00 0.00 ? 56  HIS A ND1  4  
ATOM   4310  C  CD2  . HIS A 1 56 ? 1.443   -3.735  -0.939  1.00 0.00 ? 56  HIS A CD2  4  
ATOM   4311  C  CE1  . HIS A 1 56 ? 0.474   -4.268  -2.833  1.00 0.00 ? 56  HIS A CE1  4  
ATOM   4312  N  NE2  . HIS A 1 56 ? 0.922   -4.759  -1.691  1.00 0.00 ? 56  HIS A NE2  4  
ATOM   4313  H  H    . HIS A 1 56 ? 2.520   -0.560  -3.877  1.00 0.00 ? 56  HIS A H    4  
ATOM   4314  H  HA   . HIS A 1 56 ? 3.530   -0.121  -1.144  1.00 0.00 ? 56  HIS A HA   4  
ATOM   4315  H  HB2  . HIS A 1 56 ? 1.654   -1.065  -0.268  1.00 0.00 ? 56  HIS A HB2  4  
ATOM   4316  H  HB3  . HIS A 1 56 ? 0.951   -0.531  -1.792  1.00 0.00 ? 56  HIS A HB3  4  
ATOM   4317  H  HD1  . HIS A 1 56 ? 0.452   -2.361  -3.572  1.00 0.00 ? 56  HIS A HD1  4  
ATOM   4318  H  HD2  . HIS A 1 56 ? 1.884   -3.823  0.044   1.00 0.00 ? 56  HIS A HD2  4  
ATOM   4319  H  HE1  . HIS A 1 56 ? 0.011   -4.836  -3.626  1.00 0.00 ? 56  HIS A HE1  4  
ATOM   4320  H  HE2  . HIS A 1 56 ? 0.809   -5.686  -1.393  1.00 0.00 ? 56  HIS A HE2  4  
ATOM   4321  N  N    . PHE A 1 57 ? 4.466   -2.507  -0.830  1.00 0.00 ? 57  PHE A N    4  
ATOM   4322  C  CA   . PHE A 1 57 ? 5.320   -3.689  -0.805  1.00 0.00 ? 57  PHE A CA   4  
ATOM   4323  C  C    . PHE A 1 57 ? 4.702   -4.788  0.055   1.00 0.00 ? 57  PHE A C    4  
ATOM   4324  O  O    . PHE A 1 57 ? 3.827   -4.527  0.881   1.00 0.00 ? 57  PHE A O    4  
ATOM   4325  C  CB   . PHE A 1 57 ? 6.709   -3.330  -0.273  1.00 0.00 ? 57  PHE A CB   4  
ATOM   4326  C  CG   . PHE A 1 57 ? 7.593   -2.677  -1.297  1.00 0.00 ? 57  PHE A CG   4  
ATOM   4327  C  CD1  . PHE A 1 57 ? 7.434   -1.338  -1.615  1.00 0.00 ? 57  PHE A CD1  4  
ATOM   4328  C  CD2  . PHE A 1 57 ? 8.582   -3.402  -1.941  1.00 0.00 ? 57  PHE A CD2  4  
ATOM   4329  C  CE1  . PHE A 1 57 ? 8.245   -0.735  -2.558  1.00 0.00 ? 57  PHE A CE1  4  
ATOM   4330  C  CE2  . PHE A 1 57 ? 9.397   -2.805  -2.884  1.00 0.00 ? 57  PHE A CE2  4  
ATOM   4331  C  CZ   . PHE A 1 57 ? 9.229   -1.469  -3.192  1.00 0.00 ? 57  PHE A CZ   4  
ATOM   4332  H  H    . PHE A 1 57 ? 4.270   -2.041  0.009   1.00 0.00 ? 57  PHE A H    4  
ATOM   4333  H  HA   . PHE A 1 57 ? 5.414   -4.051  -1.817  1.00 0.00 ? 57  PHE A HA   4  
ATOM   4334  H  HB2  . PHE A 1 57 ? 6.603   -2.647  0.557   1.00 0.00 ? 57  PHE A HB2  4  
ATOM   4335  H  HB3  . PHE A 1 57 ? 7.200   -4.229  0.066   1.00 0.00 ? 57  PHE A HB3  4  
ATOM   4336  H  HD1  . PHE A 1 57 ? 6.666   -0.762  -1.120  1.00 0.00 ? 57  PHE A HD1  4  
ATOM   4337  H  HD2  . PHE A 1 57 ? 8.715   -4.448  -1.700  1.00 0.00 ? 57  PHE A HD2  4  
ATOM   4338  H  HE1  . PHE A 1 57 ? 8.112   0.309   -2.797  1.00 0.00 ? 57  PHE A HE1  4  
ATOM   4339  H  HE2  . PHE A 1 57 ? 10.165  -3.382  -3.378  1.00 0.00 ? 57  PHE A HE2  4  
ATOM   4340  H  HZ   . PHE A 1 57 ? 9.864   -1.001  -3.929  1.00 0.00 ? 57  PHE A HZ   4  
ATOM   4341  N  N    . PHE A 1 58 ? 5.164   -6.018  -0.146  1.00 0.00 ? 58  PHE A N    4  
ATOM   4342  C  CA   . PHE A 1 58 ? 4.656   -7.158  0.609   1.00 0.00 ? 58  PHE A CA   4  
ATOM   4343  C  C    . PHE A 1 58 ? 5.642   -7.572  1.698   1.00 0.00 ? 58  PHE A C    4  
ATOM   4344  O  O    . PHE A 1 58 ? 6.751   -8.022  1.408   1.00 0.00 ? 58  PHE A O    4  
ATOM   4345  C  CB   . PHE A 1 58 ? 4.387   -8.337  -0.327  1.00 0.00 ? 58  PHE A CB   4  
ATOM   4346  C  CG   . PHE A 1 58 ? 3.000   -8.341  -0.903  1.00 0.00 ? 58  PHE A CG   4  
ATOM   4347  C  CD1  . PHE A 1 58 ? 1.894   -8.193  -0.082  1.00 0.00 ? 58  PHE A CD1  4  
ATOM   4348  C  CD2  . PHE A 1 58 ? 2.803   -8.493  -2.266  1.00 0.00 ? 58  PHE A CD2  4  
ATOM   4349  C  CE1  . PHE A 1 58 ? 0.616   -8.196  -0.610  1.00 0.00 ? 58  PHE A CE1  4  
ATOM   4350  C  CE2  . PHE A 1 58 ? 1.528   -8.496  -2.800  1.00 0.00 ? 58  PHE A CE2  4  
ATOM   4351  C  CZ   . PHE A 1 58 ? 0.433   -8.348  -1.970  1.00 0.00 ? 58  PHE A CZ   4  
ATOM   4352  H  H    . PHE A 1 58 ? 5.862   -6.162  -0.818  1.00 0.00 ? 58  PHE A H    4  
ATOM   4353  H  HA   . PHE A 1 58 ? 3.729   -6.860  1.075   1.00 0.00 ? 58  PHE A HA   4  
ATOM   4354  H  HB2  . PHE A 1 58 ? 5.087   -8.303  -1.148  1.00 0.00 ? 58  PHE A HB2  4  
ATOM   4355  H  HB3  . PHE A 1 58 ? 4.523   -9.259  0.219   1.00 0.00 ? 58  PHE A HB3  4  
ATOM   4356  H  HD1  . PHE A 1 58 ? 2.036   -8.074  0.983   1.00 0.00 ? 58  PHE A HD1  4  
ATOM   4357  H  HD2  . PHE A 1 58 ? 3.658   -8.609  -2.916  1.00 0.00 ? 58  PHE A HD2  4  
ATOM   4358  H  HE1  . PHE A 1 58 ? -0.237  -8.080  0.042   1.00 0.00 ? 58  PHE A HE1  4  
ATOM   4359  H  HE2  . PHE A 1 58 ? 1.387   -8.615  -3.863  1.00 0.00 ? 58  PHE A HE2  4  
ATOM   4360  H  HZ   . PHE A 1 58 ? -0.564  -8.350  -2.385  1.00 0.00 ? 58  PHE A HZ   4  
ATOM   4361  N  N    . VAL A 1 59 ? 5.231   -7.415  2.952   1.00 0.00 ? 59  VAL A N    4  
ATOM   4362  C  CA   . VAL A 1 59 ? 6.077   -7.772  4.084   1.00 0.00 ? 59  VAL A CA   4  
ATOM   4363  C  C    . VAL A 1 59 ? 5.253   -8.373  5.218   1.00 0.00 ? 59  VAL A C    4  
ATOM   4364  O  O    . VAL A 1 59 ? 4.404   -7.702  5.804   1.00 0.00 ? 59  VAL A O    4  
ATOM   4365  C  CB   . VAL A 1 59 ? 6.848   -6.550  4.617   1.00 0.00 ? 59  VAL A CB   4  
ATOM   4366  C  CG1  . VAL A 1 59 ? 7.651   -6.923  5.854   1.00 0.00 ? 59  VAL A CG1  4  
ATOM   4367  C  CG2  . VAL A 1 59 ? 7.752   -5.978  3.536   1.00 0.00 ? 59  VAL A CG2  4  
ATOM   4368  H  H    . VAL A 1 59 ? 4.337   -7.051  3.119   1.00 0.00 ? 59  VAL A H    4  
ATOM   4369  H  HA   . VAL A 1 59 ? 6.795   -8.505  3.747   1.00 0.00 ? 59  VAL A HA   4  
ATOM   4370  H  HB   . VAL A 1 59 ? 6.131   -5.791  4.896   1.00 0.00 ? 59  VAL A HB   4  
ATOM   4371  H  HG11 . VAL A 1 59 ? 8.439   -7.608  5.577   1.00 0.00 ? 59  VAL A HG11 4  
ATOM   4372  H  HG12 . VAL A 1 59 ? 8.083   -6.031  6.285   1.00 0.00 ? 59  VAL A HG12 4  
ATOM   4373  H  HG13 . VAL A 1 59 ? 7.002   -7.395  6.576   1.00 0.00 ? 59  VAL A HG13 4  
ATOM   4374  H  HG21 . VAL A 1 59 ? 8.737   -6.410  3.626   1.00 0.00 ? 59  VAL A HG21 4  
ATOM   4375  H  HG22 . VAL A 1 59 ? 7.344   -6.213  2.563   1.00 0.00 ? 59  VAL A HG22 4  
ATOM   4376  H  HG23 . VAL A 1 59 ? 7.816   -4.906  3.649   1.00 0.00 ? 59  VAL A HG23 4  
ATOM   4377  N  N    . GLU A 1 60 ? 5.510   -9.642  5.521   1.00 0.00 ? 60  GLU A N    4  
ATOM   4378  C  CA   . GLU A 1 60 ? 4.791   -10.333 6.584   1.00 0.00 ? 60  GLU A CA   4  
ATOM   4379  C  C    . GLU A 1 60 ? 3.284   -10.281 6.346   1.00 0.00 ? 60  GLU A C    4  
ATOM   4380  O  O    . GLU A 1 60 ? 2.506   -10.057 7.273   1.00 0.00 ? 60  GLU A O    4  
ATOM   4381  C  CB   . GLU A 1 60 ? 5.125   -9.713  7.943   1.00 0.00 ? 60  GLU A CB   4  
ATOM   4382  C  CG   . GLU A 1 60 ? 6.608   -9.735  8.274   1.00 0.00 ? 60  GLU A CG   4  
ATOM   4383  C  CD   . GLU A 1 60 ? 7.182   -11.138 8.284   1.00 0.00 ? 60  GLU A CD   4  
ATOM   4384  O  OE1  . GLU A 1 60 ? 7.311   -11.735 7.194   1.00 0.00 ? 60  GLU A OE1  4  
ATOM   4385  O  OE2  . GLU A 1 60 ? 7.504   -11.639 9.382   1.00 0.00 ? 60  GLU A OE2  4  
ATOM   4386  H  H    . GLU A 1 60 ? 6.198   -10.124 5.017   1.00 0.00 ? 60  GLU A H    4  
ATOM   4387  H  HA   . GLU A 1 60 ? 5.108   -11.365 6.583   1.00 0.00 ? 60  GLU A HA   4  
ATOM   4388  H  HB2  . GLU A 1 60 ? 4.791   -8.686  7.948   1.00 0.00 ? 60  GLU A HB2  4  
ATOM   4389  H  HB3  . GLU A 1 60 ? 4.598   -10.257 8.712   1.00 0.00 ? 60  GLU A HB3  4  
ATOM   4390  H  HG2  . GLU A 1 60 ? 7.137   -9.151  7.536   1.00 0.00 ? 60  GLU A HG2  4  
ATOM   4391  H  HG3  . GLU A 1 60 ? 6.752   -9.296  9.250   1.00 0.00 ? 60  GLU A HG3  4  
ATOM   4392  N  N    . ASP A 1 61 ? 2.882   -10.488 5.097   1.00 0.00 ? 61  ASP A N    4  
ATOM   4393  C  CA   . ASP A 1 61 ? 1.469   -10.465 4.736   1.00 0.00 ? 61  ASP A CA   4  
ATOM   4394  C  C    . ASP A 1 61 ? 0.859   -9.096  5.014   1.00 0.00 ? 61  ASP A C    4  
ATOM   4395  O  O    . ASP A 1 61 ? -0.321  -8.988  5.348   1.00 0.00 ? 61  ASP A O    4  
ATOM   4396  C  CB   . ASP A 1 61 ? 0.706   -11.544 5.506   1.00 0.00 ? 61  ASP A CB   4  
ATOM   4397  C  CG   . ASP A 1 61 ? -0.679  -11.788 4.941   1.00 0.00 ? 61  ASP A CG   4  
ATOM   4398  O  OD1  . ASP A 1 61 ? -0.798  -12.581 3.984   1.00 0.00 ? 61  ASP A OD1  4  
ATOM   4399  O  OD2  . ASP A 1 61 ? -1.645  -11.186 5.456   1.00 0.00 ? 61  ASP A OD2  4  
ATOM   4400  H  H    . ASP A 1 61 ? 3.551   -10.661 4.402   1.00 0.00 ? 61  ASP A H    4  
ATOM   4401  H  HA   . ASP A 1 61 ? 1.394   -10.670 3.678   1.00 0.00 ? 61  ASP A HA   4  
ATOM   4402  H  HB2  . ASP A 1 61 ? 1.261   -12.470 5.461   1.00 0.00 ? 61  ASP A HB2  4  
ATOM   4403  H  HB3  . ASP A 1 61 ? 0.607   -11.238 6.537   1.00 0.00 ? 61  ASP A HB3  4  
ATOM   4404  N  N    . GLN A 1 62 ? 1.671   -8.052  4.876   1.00 0.00 ? 62  GLN A N    4  
ATOM   4405  C  CA   . GLN A 1 62 ? 1.210   -6.690  5.115   1.00 0.00 ? 62  GLN A CA   4  
ATOM   4406  C  C    . GLN A 1 62 ? 1.659   -5.759  3.994   1.00 0.00 ? 62  GLN A C    4  
ATOM   4407  O  O    . GLN A 1 62 ? 2.358   -6.176  3.070   1.00 0.00 ? 62  GLN A O    4  
ATOM   4408  C  CB   . GLN A 1 62 ? 1.735   -6.180  6.459   1.00 0.00 ? 62  GLN A CB   4  
ATOM   4409  C  CG   . GLN A 1 62 ? 0.956   -6.701  7.655   1.00 0.00 ? 62  GLN A CG   4  
ATOM   4410  C  CD   . GLN A 1 62 ? 0.994   -5.752  8.836   1.00 0.00 ? 62  GLN A CD   4  
ATOM   4411  O  OE1  . GLN A 1 62 ? 1.666   -6.012  9.834   1.00 0.00 ? 62  GLN A OE1  4  
ATOM   4412  N  NE2  . GLN A 1 62 ? 0.272   -4.643  8.728   1.00 0.00 ? 62  GLN A NE2  4  
ATOM   4413  H  H    . GLN A 1 62 ? 2.601   -8.203  4.608   1.00 0.00 ? 62  GLN A H    4  
ATOM   4414  H  HA   . GLN A 1 62 ? 0.131   -6.705  5.144   1.00 0.00 ? 62  GLN A HA   4  
ATOM   4415  H  HB2  . GLN A 1 62 ? 2.766   -6.483  6.567   1.00 0.00 ? 62  GLN A HB2  4  
ATOM   4416  H  HB3  . GLN A 1 62 ? 1.683   -5.101  6.466   1.00 0.00 ? 62  GLN A HB3  4  
ATOM   4417  H  HG2  . GLN A 1 62 ? -0.074  -6.845  7.362   1.00 0.00 ? 62  GLN A HG2  4  
ATOM   4418  H  HG3  . GLN A 1 62 ? 1.378   -7.648  7.958   1.00 0.00 ? 62  GLN A HG3  4  
ATOM   4419  H  HE21 . GLN A 1 62 ? -0.240  -4.503  7.904   1.00 0.00 ? 62  GLN A HE21 4  
ATOM   4420  H  HE22 . GLN A 1 62 ? 0.278   -4.012  9.477   1.00 0.00 ? 62  GLN A HE22 4  
ATOM   4421  N  N    . ILE A 1 63 ? 1.253   -4.497  4.081   1.00 0.00 ? 63  ILE A N    4  
ATOM   4422  C  CA   . ILE A 1 63 ? 1.614   -3.507  3.074   1.00 0.00 ? 63  ILE A CA   4  
ATOM   4423  C  C    . ILE A 1 63 ? 2.244   -2.275  3.715   1.00 0.00 ? 63  ILE A C    4  
ATOM   4424  O  O    . ILE A 1 63 ? 1.794   -1.808  4.761   1.00 0.00 ? 63  ILE A O    4  
ATOM   4425  C  CB   . ILE A 1 63 ? 0.390   -3.072  2.247   1.00 0.00 ? 63  ILE A CB   4  
ATOM   4426  C  CG1  . ILE A 1 63 ? -0.708  -2.532  3.166   1.00 0.00 ? 63  ILE A CG1  4  
ATOM   4427  C  CG2  . ILE A 1 63 ? -0.131  -4.238  1.419   1.00 0.00 ? 63  ILE A CG2  4  
ATOM   4428  C  CD1  . ILE A 1 63 ? -1.616  -1.525  2.495   1.00 0.00 ? 63  ILE A CD1  4  
ATOM   4429  H  H    . ILE A 1 63 ? 0.698   -4.224  4.841   1.00 0.00 ? 63  ILE A H    4  
ATOM   4430  H  HA   . ILE A 1 63 ? 2.333   -3.959  2.406   1.00 0.00 ? 63  ILE A HA   4  
ATOM   4431  H  HB   . ILE A 1 63 ? 0.699   -2.291  1.570   1.00 0.00 ? 63  ILE A HB   4  
ATOM   4432  H  HG12 . ILE A 1 63 ? -1.318  -3.352  3.508   1.00 0.00 ? 63  ILE A HG12 4  
ATOM   4433  H  HG13 . ILE A 1 63 ? -0.249  -2.050  4.018   1.00 0.00 ? 63  ILE A HG13 4  
ATOM   4434  H  HG21 . ILE A 1 63 ? -0.547  -3.865  0.495   1.00 0.00 ? 63  ILE A HG21 4  
ATOM   4435  H  HG22 . ILE A 1 63 ? 0.681   -4.915  1.201   1.00 0.00 ? 63  ILE A HG22 4  
ATOM   4436  H  HG23 . ILE A 1 63 ? -0.896  -4.760  1.974   1.00 0.00 ? 63  ILE A HG23 4  
ATOM   4437  H  HD11 . ILE A 1 63 ? -2.631  -1.894  2.505   1.00 0.00 ? 63  ILE A HD11 4  
ATOM   4438  H  HD12 . ILE A 1 63 ? -1.567  -0.586  3.026   1.00 0.00 ? 63  ILE A HD12 4  
ATOM   4439  H  HD13 . ILE A 1 63 ? -1.298  -1.378  1.473   1.00 0.00 ? 63  ILE A HD13 4  
ATOM   4440  N  N    . TYR A 1 64 ? 3.287   -1.753  3.079   1.00 0.00 ? 64  TYR A N    4  
ATOM   4441  C  CA   . TYR A 1 64 ? 3.980   -0.574  3.587   1.00 0.00 ? 64  TYR A CA   4  
ATOM   4442  C  C    . TYR A 1 64 ? 4.567   0.248   2.444   1.00 0.00 ? 64  TYR A C    4  
ATOM   4443  O  O    . TYR A 1 64 ? 4.531   -0.165  1.285   1.00 0.00 ? 64  TYR A O    4  
ATOM   4444  C  CB   . TYR A 1 64 ? 5.090   -0.988  4.556   1.00 0.00 ? 64  TYR A CB   4  
ATOM   4445  C  CG   . TYR A 1 64 ? 4.630   -1.946  5.631   1.00 0.00 ? 64  TYR A CG   4  
ATOM   4446  C  CD1  . TYR A 1 64 ? 4.113   -1.477  6.832   1.00 0.00 ? 64  TYR A CD1  4  
ATOM   4447  C  CD2  . TYR A 1 64 ? 4.713   -3.321  5.446   1.00 0.00 ? 64  TYR A CD2  4  
ATOM   4448  C  CE1  . TYR A 1 64 ? 3.692   -2.349  7.818   1.00 0.00 ? 64  TYR A CE1  4  
ATOM   4449  C  CE2  . TYR A 1 64 ? 4.293   -4.200  6.425   1.00 0.00 ? 64  TYR A CE2  4  
ATOM   4450  C  CZ   . TYR A 1 64 ? 3.784   -3.709  7.609   1.00 0.00 ? 64  TYR A CZ   4  
ATOM   4451  O  OH   . TYR A 1 64 ? 3.366   -4.581  8.588   1.00 0.00 ? 64  TYR A OH   4  
ATOM   4452  H  H    . TYR A 1 64 ? 3.600   -2.170  2.250   1.00 0.00 ? 64  TYR A H    4  
ATOM   4453  H  HA   . TYR A 1 64 ? 3.260   0.031   4.118   1.00 0.00 ? 64  TYR A HA   4  
ATOM   4454  H  HB2  . TYR A 1 64 ? 5.882   -1.468  4.001   1.00 0.00 ? 64  TYR A HB2  4  
ATOM   4455  H  HB3  . TYR A 1 64 ? 5.481   -0.106  5.042   1.00 0.00 ? 64  TYR A HB3  4  
ATOM   4456  H  HD1  . TYR A 1 64 ? 4.042   -0.411  6.992   1.00 0.00 ? 64  TYR A HD1  4  
ATOM   4457  H  HD2  . TYR A 1 64 ? 5.113   -3.702  4.517   1.00 0.00 ? 64  TYR A HD2  4  
ATOM   4458  H  HE1  . TYR A 1 64 ? 3.293   -1.965  8.745   1.00 0.00 ? 64  TYR A HE1  4  
ATOM   4459  H  HE2  . TYR A 1 64 ? 4.366   -5.265  6.263   1.00 0.00 ? 64  TYR A HE2  4  
ATOM   4460  H  HH   . TYR A 1 64 ? 3.266   -5.460  8.212   1.00 0.00 ? 64  TYR A HH   4  
ATOM   4461  N  N    . CYS A 1 65 ? 5.108   1.414   2.780   1.00 0.00 ? 65  CYS A N    4  
ATOM   4462  C  CA   . CYS A 1 65 ? 5.704   2.296   1.784   1.00 0.00 ? 65  CYS A CA   4  
ATOM   4463  C  C    . CYS A 1 65 ? 7.194   2.009   1.625   1.00 0.00 ? 65  CYS A C    4  
ATOM   4464  O  O    . CYS A 1 65 ? 7.896   1.763   2.605   1.00 0.00 ? 65  CYS A O    4  
ATOM   4465  C  CB   . CYS A 1 65 ? 5.494   3.760   2.178   1.00 0.00 ? 65  CYS A CB   4  
ATOM   4466  S  SG   . CYS A 1 65 ? 6.025   4.156   3.875   1.00 0.00 ? 65  CYS A SG   4  
ATOM   4467  H  H    . CYS A 1 65 ? 5.106   1.689   3.722   1.00 0.00 ? 65  CYS A H    4  
ATOM   4468  H  HA   . CYS A 1 65 ? 5.212   2.112   0.841   1.00 0.00 ? 65  CYS A HA   4  
ATOM   4469  H  HB2  . CYS A 1 65 ? 6.055   4.390   1.503   1.00 0.00 ? 65  CYS A HB2  4  
ATOM   4470  H  HB3  . CYS A 1 65 ? 4.444   3.999   2.097   1.00 0.00 ? 65  CYS A HB3  4  
ATOM   4471  N  N    . GLU A 1 66 ? 7.668   2.044   0.384   1.00 0.00 ? 66  GLU A N    4  
ATOM   4472  C  CA   . GLU A 1 66 ? 9.075   1.787   0.097   1.00 0.00 ? 66  GLU A CA   4  
ATOM   4473  C  C    . GLU A 1 66 ? 9.963   2.303   1.225   1.00 0.00 ? 66  GLU A C    4  
ATOM   4474  O  O    . GLU A 1 66 ? 10.944  1.660   1.602   1.00 0.00 ? 66  GLU A O    4  
ATOM   4475  C  CB   . GLU A 1 66 ? 9.477   2.444   -1.225  1.00 0.00 ? 66  GLU A CB   4  
ATOM   4476  C  CG   . GLU A 1 66 ? 10.967  2.371   -1.513  1.00 0.00 ? 66  GLU A CG   4  
ATOM   4477  C  CD   . GLU A 1 66 ? 11.384  3.265   -2.664  1.00 0.00 ? 66  GLU A CD   4  
ATOM   4478  O  OE1  . GLU A 1 66 ? 11.333  2.804   -3.823  1.00 0.00 ? 66  GLU A OE1  4  
ATOM   4479  O  OE2  . GLU A 1 66 ? 11.762  4.427   -2.405  1.00 0.00 ? 66  GLU A OE2  4  
ATOM   4480  H  H    . GLU A 1 66 ? 7.059   2.246   -0.356  1.00 0.00 ? 66  GLU A H    4  
ATOM   4481  H  HA   . GLU A 1 66 ? 9.206   0.719   0.011   1.00 0.00 ? 66  GLU A HA   4  
ATOM   4482  H  HB2  . GLU A 1 66 ? 8.951   1.956   -2.031  1.00 0.00 ? 66  GLU A HB2  4  
ATOM   4483  H  HB3  . GLU A 1 66 ? 9.189   3.485   -1.198  1.00 0.00 ? 66  GLU A HB3  4  
ATOM   4484  H  HG2  . GLU A 1 66 ? 11.507  2.673   -0.628  1.00 0.00 ? 66  GLU A HG2  4  
ATOM   4485  H  HG3  . GLU A 1 66 ? 11.223  1.350   -1.758  1.00 0.00 ? 66  GLU A HG3  4  
ATOM   4486  N  N    . LYS A 1 67 ? 9.614   3.467   1.760   1.00 0.00 ? 67  LYS A N    4  
ATOM   4487  C  CA   . LYS A 1 67 ? 10.377  4.071   2.846   1.00 0.00 ? 67  LYS A CA   4  
ATOM   4488  C  C    . LYS A 1 67 ? 10.483  3.118   4.032   1.00 0.00 ? 67  LYS A C    4  
ATOM   4489  O  O    . LYS A 1 67 ? 11.568  2.900   4.572   1.00 0.00 ? 67  LYS A O    4  
ATOM   4490  C  CB   . LYS A 1 67 ? 9.724   5.383   3.288   1.00 0.00 ? 67  LYS A CB   4  
ATOM   4491  C  CG   . LYS A 1 67 ? 10.402  6.026   4.485   1.00 0.00 ? 67  LYS A CG   4  
ATOM   4492  C  CD   . LYS A 1 67 ? 9.494   7.039   5.162   1.00 0.00 ? 67  LYS A CD   4  
ATOM   4493  C  CE   . LYS A 1 67 ? 9.596   8.407   4.505   1.00 0.00 ? 67  LYS A CE   4  
ATOM   4494  N  NZ   . LYS A 1 67 ? 9.000   8.412   3.140   1.00 0.00 ? 67  LYS A NZ   4  
ATOM   4495  H  H    . LYS A 1 67 ? 8.821   3.932   1.417   1.00 0.00 ? 67  LYS A H    4  
ATOM   4496  H  HA   . LYS A 1 67 ? 11.370  4.280   2.477   1.00 0.00 ? 67  LYS A HA   4  
ATOM   4497  H  HB2  . LYS A 1 67 ? 9.754   6.081   2.465   1.00 0.00 ? 67  LYS A HB2  4  
ATOM   4498  H  HB3  . LYS A 1 67 ? 8.693   5.188   3.546   1.00 0.00 ? 67  LYS A HB3  4  
ATOM   4499  H  HG2  . LYS A 1 67 ? 10.660  5.257   5.198   1.00 0.00 ? 67  LYS A HG2  4  
ATOM   4500  H  HG3  . LYS A 1 67 ? 11.300  6.527   4.152   1.00 0.00 ? 67  LYS A HG3  4  
ATOM   4501  H  HD2  . LYS A 1 67 ? 8.472   6.696   5.095   1.00 0.00 ? 67  LYS A HD2  4  
ATOM   4502  H  HD3  . LYS A 1 67 ? 9.778   7.127   6.201   1.00 0.00 ? 67  LYS A HD3  4  
ATOM   4503  H  HE2  . LYS A 1 67 ? 9.076   9.126   5.118   1.00 0.00 ? 67  LYS A HE2  4  
ATOM   4504  H  HE3  . LYS A 1 67 ? 10.638  8.681   4.434   1.00 0.00 ? 67  LYS A HE3  4  
ATOM   4505  H  HZ1  . LYS A 1 67 ? 8.145   7.821   3.122   1.00 0.00 ? 67  LYS A HZ1  4  
ATOM   4506  H  HZ2  . LYS A 1 67 ? 9.682   8.037   2.451   1.00 0.00 ? 67  LYS A HZ2  4  
ATOM   4507  H  HZ3  . LYS A 1 67 ? 8.744   9.382   2.865   1.00 0.00 ? 67  LYS A HZ3  4  
ATOM   4508  N  N    . HIS A 1 68 ? 9.349   2.552   4.434   1.00 0.00 ? 68  HIS A N    4  
ATOM   4509  C  CA   . HIS A 1 68 ? 9.315   1.621   5.555   1.00 0.00 ? 68  HIS A CA   4  
ATOM   4510  C  C    . HIS A 1 68 ? 9.645   0.204   5.095   1.00 0.00 ? 68  HIS A C    4  
ATOM   4511  O  O    . HIS A 1 68 ? 10.485  -0.472  5.689   1.00 0.00 ? 68  HIS A O    4  
ATOM   4512  C  CB   . HIS A 1 68 ? 7.940   1.644   6.224   1.00 0.00 ? 68  HIS A CB   4  
ATOM   4513  C  CG   . HIS A 1 68 ? 7.788   2.732   7.243   1.00 0.00 ? 68  HIS A CG   4  
ATOM   4514  N  ND1  . HIS A 1 68 ? 6.660   3.518   7.342   1.00 0.00 ? 68  HIS A ND1  4  
ATOM   4515  C  CD2  . HIS A 1 68 ? 8.630   3.161   8.212   1.00 0.00 ? 68  HIS A CD2  4  
ATOM   4516  C  CE1  . HIS A 1 68 ? 6.815   4.384   8.327   1.00 0.00 ? 68  HIS A CE1  4  
ATOM   4517  N  NE2  . HIS A 1 68 ? 8.003   4.188   8.872   1.00 0.00 ? 68  HIS A NE2  4  
ATOM   4518  H  H    . HIS A 1 68 ? 8.516   2.766   3.964   1.00 0.00 ? 68  HIS A H    4  
ATOM   4519  H  HA   . HIS A 1 68 ? 10.059  1.936   6.271   1.00 0.00 ? 68  HIS A HA   4  
ATOM   4520  H  HB2  . HIS A 1 68 ? 7.182   1.791   5.468   1.00 0.00 ? 68  HIS A HB2  4  
ATOM   4521  H  HB3  . HIS A 1 68 ? 7.771   0.699   6.719   1.00 0.00 ? 68  HIS A HB3  4  
ATOM   4522  H  HD2  . HIS A 1 68 ? 9.615   2.768   8.427   1.00 0.00 ? 68  HIS A HD2  4  
ATOM   4523  H  HE1  . HIS A 1 68 ? 6.094   5.127   8.636   1.00 0.00 ? 68  HIS A HE1  4  
ATOM   4524  H  HE2  . HIS A 1 68 ? 8.405   4.751   9.565   1.00 0.00 ? 68  HIS A HE2  4  
ATOM   4525  N  N    . ALA A 1 69 ? 8.978   -0.240  4.035   1.00 0.00 ? 69  ALA A N    4  
ATOM   4526  C  CA   . ALA A 1 69 ? 9.202   -1.575  3.495   1.00 0.00 ? 69  ALA A CA   4  
ATOM   4527  C  C    . ALA A 1 69 ? 10.691  -1.893  3.418   1.00 0.00 ? 69  ALA A C    4  
ATOM   4528  O  O    . ALA A 1 69 ? 11.126  -2.972  3.821   1.00 0.00 ? 69  ALA A O    4  
ATOM   4529  C  CB   . ALA A 1 69 ? 8.561   -1.703  2.121   1.00 0.00 ? 69  ALA A CB   4  
ATOM   4530  H  H    . ALA A 1 69 ? 8.320   0.346   3.605   1.00 0.00 ? 69  ALA A H    4  
ATOM   4531  H  HA   . ALA A 1 69 ? 8.725   -2.286  4.155   1.00 0.00 ? 69  ALA A HA   4  
ATOM   4532  H  HB1  . ALA A 1 69 ? 9.173   -2.337  1.497   1.00 0.00 ? 69  ALA A HB1  4  
ATOM   4533  H  HB2  . ALA A 1 69 ? 7.577   -2.137  2.222   1.00 0.00 ? 69  ALA A HB2  4  
ATOM   4534  H  HB3  . ALA A 1 69 ? 8.478   -0.725  1.670   1.00 0.00 ? 69  ALA A HB3  4  
ATOM   4535  N  N    . ARG A 1 70 ? 11.467  -0.949  2.897   1.00 0.00 ? 70  ARG A N    4  
ATOM   4536  C  CA   . ARG A 1 70 ? 12.908  -1.130  2.765   1.00 0.00 ? 70  ARG A CA   4  
ATOM   4537  C  C    . ARG A 1 70 ? 13.557  -1.334  4.131   1.00 0.00 ? 70  ARG A C    4  
ATOM   4538  O  O    . ARG A 1 70 ? 14.511  -2.099  4.266   1.00 0.00 ? 70  ARG A O    4  
ATOM   4539  C  CB   . ARG A 1 70 ? 13.534  0.079   2.067   1.00 0.00 ? 70  ARG A CB   4  
ATOM   4540  C  CG   . ARG A 1 70 ? 13.605  1.319   2.943   1.00 0.00 ? 70  ARG A CG   4  
ATOM   4541  C  CD   . ARG A 1 70 ? 14.522  2.373   2.343   1.00 0.00 ? 70  ARG A CD   4  
ATOM   4542  N  NE   . ARG A 1 70 ? 15.916  2.167   2.727   1.00 0.00 ? 70  ARG A NE   4  
ATOM   4543  C  CZ   . ARG A 1 70 ? 16.881  3.050   2.493   1.00 0.00 ? 70  ARG A CZ   4  
ATOM   4544  N  NH1  . ARG A 1 70 ? 16.604  4.192   1.879   1.00 0.00 ? 70  ARG A NH1  4  
ATOM   4545  N  NH2  . ARG A 1 70 ? 18.126  2.791   2.873   1.00 0.00 ? 70  ARG A NH2  4  
ATOM   4546  H  H    . ARG A 1 70 ? 11.061  -0.110  2.593   1.00 0.00 ? 70  ARG A H    4  
ATOM   4547  H  HA   . ARG A 1 70 ? 13.078  -2.010  2.163   1.00 0.00 ? 70  ARG A HA   4  
ATOM   4548  H  HB2  . ARG A 1 70 ? 14.537  -0.177  1.761   1.00 0.00 ? 70  ARG A HB2  4  
ATOM   4549  H  HB3  . ARG A 1 70 ? 12.948  0.316   1.191   1.00 0.00 ? 70  ARG A HB3  4  
ATOM   4550  H  HG2  . ARG A 1 70 ? 12.613  1.736   3.042   1.00 0.00 ? 70  ARG A HG2  4  
ATOM   4551  H  HG3  . ARG A 1 70 ? 13.979  1.039   3.916   1.00 0.00 ? 70  ARG A HG3  4  
ATOM   4552  H  HD2  . ARG A 1 70 ? 14.446  2.327   1.267   1.00 0.00 ? 70  ARG A HD2  4  
ATOM   4553  H  HD3  . ARG A 1 70 ? 14.203  3.345   2.686   1.00 0.00 ? 70  ARG A HD3  4  
ATOM   4554  H  HE   . ARG A 1 70 ? 16.143  1.330   3.183   1.00 0.00 ? 70  ARG A HE   4  
ATOM   4555  H  HH11 . ARG A 1 70 ? 15.667  4.390   1.592   1.00 0.00 ? 70  ARG A HH11 4  
ATOM   4556  H  HH12 . ARG A 1 70 ? 17.332  4.855   1.704   1.00 0.00 ? 70  ARG A HH12 4  
ATOM   4557  H  HH21 . ARG A 1 70 ? 18.338  1.931   3.337   1.00 0.00 ? 70  ARG A HH21 4  
ATOM   4558  H  HH22 . ARG A 1 70 ? 18.851  3.456   2.696   1.00 0.00 ? 70  ARG A HH22 4  
ATOM   4559  N  N    . GLU A 1 71 ? 13.032  -0.645  5.139   1.00 0.00 ? 71  GLU A N    4  
ATOM   4560  C  CA   . GLU A 1 71 ? 13.562  -0.751  6.493   1.00 0.00 ? 71  GLU A CA   4  
ATOM   4561  C  C    . GLU A 1 71 ? 13.143  -2.067  7.141   1.00 0.00 ? 71  GLU A C    4  
ATOM   4562  O  O    . GLU A 1 71 ? 13.870  -2.627  7.961   1.00 0.00 ? 71  GLU A O    4  
ATOM   4563  C  CB   . GLU A 1 71 ? 13.082  0.426   7.346   1.00 0.00 ? 71  GLU A CB   4  
ATOM   4564  C  CG   . GLU A 1 71 ? 13.606  1.772   6.876   1.00 0.00 ? 71  GLU A CG   4  
ATOM   4565  C  CD   . GLU A 1 71 ? 13.525  2.838   7.952   1.00 0.00 ? 71  GLU A CD   4  
ATOM   4566  O  OE1  . GLU A 1 71 ? 12.455  2.963   8.585   1.00 0.00 ? 71  GLU A OE1  4  
ATOM   4567  O  OE2  . GLU A 1 71 ? 14.532  3.546   8.162   1.00 0.00 ? 71  GLU A OE2  4  
ATOM   4568  H  H    . GLU A 1 71 ? 12.272  -0.051  4.968   1.00 0.00 ? 71  GLU A H    4  
ATOM   4569  H  HA   . GLU A 1 71 ? 14.640  -0.721  6.431   1.00 0.00 ? 71  GLU A HA   4  
ATOM   4570  H  HB2  . GLU A 1 71 ? 12.003  0.454   7.323   1.00 0.00 ? 71  GLU A HB2  4  
ATOM   4571  H  HB3  . GLU A 1 71 ? 13.407  0.272   8.364   1.00 0.00 ? 71  GLU A HB3  4  
ATOM   4572  H  HG2  . GLU A 1 71 ? 14.638  1.659   6.581   1.00 0.00 ? 71  GLU A HG2  4  
ATOM   4573  H  HG3  . GLU A 1 71 ? 13.023  2.095   6.026   1.00 0.00 ? 71  GLU A HG3  4  
ATOM   4574  N  N    . ARG A 1 72 ? 11.965  -2.555  6.765   1.00 0.00 ? 72  ARG A N    4  
ATOM   4575  C  CA   . ARG A 1 72 ? 11.447  -3.805  7.310   1.00 0.00 ? 72  ARG A CA   4  
ATOM   4576  C  C    . ARG A 1 72 ? 12.214  -5.000  6.751   1.00 0.00 ? 72  ARG A C    4  
ATOM   4577  O  O    . ARG A 1 72 ? 12.786  -5.790  7.503   1.00 0.00 ? 72  ARG A O    4  
ATOM   4578  C  CB   . ARG A 1 72 ? 9.958   -3.946  6.991   1.00 0.00 ? 72  ARG A CB   4  
ATOM   4579  C  CG   . ARG A 1 72 ? 9.064   -3.070  7.855   1.00 0.00 ? 72  ARG A CG   4  
ATOM   4580  C  CD   . ARG A 1 72 ? 7.630   -3.575  7.865   1.00 0.00 ? 72  ARG A CD   4  
ATOM   4581  N  NE   . ARG A 1 72 ? 6.829   -2.928  8.899   1.00 0.00 ? 72  ARG A NE   4  
ATOM   4582  C  CZ   . ARG A 1 72 ? 6.778   -3.346  10.159  1.00 0.00 ? 72  ARG A CZ   4  
ATOM   4583  N  NH1  . ARG A 1 72 ? 7.479   -4.406  10.538  1.00 0.00 ? 72  ARG A NH1  4  
ATOM   4584  N  NH2  . ARG A 1 72 ? 6.025   -2.703  11.043  1.00 0.00 ? 72  ARG A NH2  4  
ATOM   4585  H  H    . ARG A 1 72 ? 11.431  -2.063  6.107   1.00 0.00 ? 72  ARG A H    4  
ATOM   4586  H  HA   . ARG A 1 72 ? 11.576  -3.778  8.382   1.00 0.00 ? 72  ARG A HA   4  
ATOM   4587  H  HB2  . ARG A 1 72 ? 9.795   -3.679  5.957   1.00 0.00 ? 72  ARG A HB2  4  
ATOM   4588  H  HB3  . ARG A 1 72 ? 9.667   -4.975  7.139   1.00 0.00 ? 72  ARG A HB3  4  
ATOM   4589  H  HG2  . ARG A 1 72 ? 9.442   -3.073  8.866   1.00 0.00 ? 72  ARG A HG2  4  
ATOM   4590  H  HG3  . ARG A 1 72 ? 9.080   -2.063  7.465   1.00 0.00 ? 72  ARG A HG3  4  
ATOM   4591  H  HD2  . ARG A 1 72 ? 7.186   -3.376  6.901   1.00 0.00 ? 72  ARG A HD2  4  
ATOM   4592  H  HD3  . ARG A 1 72 ? 7.640   -4.640  8.043   1.00 0.00 ? 72  ARG A HD3  4  
ATOM   4593  H  HE   . ARG A 1 72 ? 6.303   -2.143  8.641   1.00 0.00 ? 72  ARG A HE   4  
ATOM   4594  H  HH11 . ARG A 1 72 ? 8.048   -4.891  9.874   1.00 0.00 ? 72  ARG A HH11 4  
ATOM   4595  H  HH12 . ARG A 1 72 ? 7.440   -4.718  11.488  1.00 0.00 ? 72  ARG A HH12 4  
ATOM   4596  H  HH21 . ARG A 1 72 ? 5.495   -1.904  10.761  1.00 0.00 ? 72  ARG A HH21 4  
ATOM   4597  H  HH22 . ARG A 1 72 ? 5.987   -3.019  11.990  1.00 0.00 ? 72  ARG A HH22 4  
ATOM   4598  N  N    . VAL A 1 73 ? 12.220  -5.127  5.428   1.00 0.00 ? 73  VAL A N    4  
ATOM   4599  C  CA   . VAL A 1 73 ? 12.915  -6.225  4.769   1.00 0.00 ? 73  VAL A CA   4  
ATOM   4600  C  C    . VAL A 1 73 ? 14.341  -6.365  5.291   1.00 0.00 ? 73  VAL A C    4  
ATOM   4601  O  O    . VAL A 1 73 ? 14.868  -7.472  5.397   1.00 0.00 ? 73  VAL A O    4  
ATOM   4602  C  CB   . VAL A 1 73 ? 12.957  -6.027  3.242   1.00 0.00 ? 73  VAL A CB   4  
ATOM   4603  C  CG1  . VAL A 1 73 ? 13.398  -4.613  2.898   1.00 0.00 ? 73  VAL A CG1  4  
ATOM   4604  C  CG2  . VAL A 1 73 ? 13.876  -7.053  2.597   1.00 0.00 ? 73  VAL A CG2  4  
ATOM   4605  H  H    . VAL A 1 73 ? 11.745  -4.465  4.883   1.00 0.00 ? 73  VAL A H    4  
ATOM   4606  H  HA   . VAL A 1 73 ? 12.375  -7.137  4.978   1.00 0.00 ? 73  VAL A HA   4  
ATOM   4607  H  HB   . VAL A 1 73 ? 11.959  -6.174  2.853   1.00 0.00 ? 73  VAL A HB   4  
ATOM   4608  H  HG11 . VAL A 1 73 ? 13.707  -4.104  3.799   1.00 0.00 ? 73  VAL A HG11 4  
ATOM   4609  H  HG12 . VAL A 1 73 ? 14.225  -4.652  2.204   1.00 0.00 ? 73  VAL A HG12 4  
ATOM   4610  H  HG13 . VAL A 1 73 ? 12.575  -4.078  2.448   1.00 0.00 ? 73  VAL A HG13 4  
ATOM   4611  H  HG21 . VAL A 1 73 ? 13.836  -6.946  1.523   1.00 0.00 ? 73  VAL A HG21 4  
ATOM   4612  H  HG22 . VAL A 1 73 ? 14.889  -6.894  2.937   1.00 0.00 ? 73  VAL A HG22 4  
ATOM   4613  H  HG23 . VAL A 1 73 ? 13.556  -8.047  2.872   1.00 0.00 ? 73  VAL A HG23 4  
ATOM   4614  N  N    . SER A 1 74 ? 14.960  -5.234  5.616   1.00 0.00 ? 74  SER A N    4  
ATOM   4615  C  CA   . SER A 1 74 ? 16.327  -5.230  6.124   1.00 0.00 ? 74  SER A CA   4  
ATOM   4616  C  C    . SER A 1 74 ? 17.241  -6.062  5.231   1.00 0.00 ? 74  SER A C    4  
ATOM   4617  O  O    . SER A 1 74 ? 18.101  -6.797  5.715   1.00 0.00 ? 74  SER A O    4  
ATOM   4618  C  CB   . SER A 1 74 ? 16.363  -5.771  7.555   1.00 0.00 ? 74  SER A CB   4  
ATOM   4619  O  OG   . SER A 1 74 ? 15.807  -4.839  8.467   1.00 0.00 ? 74  SER A OG   4  
ATOM   4620  H  H    . SER A 1 74 ? 14.486  -4.383  5.509   1.00 0.00 ? 74  SER A H    4  
ATOM   4621  H  HA   . SER A 1 74 ? 16.676  -4.208  6.126   1.00 0.00 ? 74  SER A HA   4  
ATOM   4622  H  HB2  . SER A 1 74 ? 15.795  -6.687  7.605   1.00 0.00 ? 74  SER A HB2  4  
ATOM   4623  H  HB3  . SER A 1 74 ? 17.387  -5.966  7.837   1.00 0.00 ? 74  SER A HB3  4  
ATOM   4624  H  HG   . SER A 1 74 ? 15.395  -5.310  9.195   1.00 0.00 ? 74  SER A HG   4  
ATOM   4625  N  N    . GLY A 1 75 ? 17.049  -5.940  3.920   1.00 0.00 ? 75  GLY A N    4  
ATOM   4626  C  CA   . GLY A 1 75 ? 17.863  -6.686  2.979   1.00 0.00 ? 75  GLY A CA   4  
ATOM   4627  C  C    . GLY A 1 75 ? 19.158  -5.975  2.641   1.00 0.00 ? 75  GLY A C    4  
ATOM   4628  O  O    . GLY A 1 75 ? 19.500  -4.949  3.230   1.00 0.00 ? 75  GLY A O    4  
ATOM   4629  H  H    . GLY A 1 75 ? 16.349  -5.339  3.591   1.00 0.00 ? 75  GLY A H    4  
ATOM   4630  H  HA2  . GLY A 1 75 ? 18.095  -7.651  3.405   1.00 0.00 ? 75  GLY A HA2  4  
ATOM   4631  H  HA3  . GLY A 1 75 ? 17.299  -6.832  2.069   1.00 0.00 ? 75  GLY A HA3  4  
ATOM   4632  N  N    . PRO A 1 76 ? 19.905  -6.525  1.673   1.00 0.00 ? 76  PRO A N    4  
ATOM   4633  C  CA   . PRO A 1 76 ? 21.183  -5.953  1.237   1.00 0.00 ? 76  PRO A CA   4  
ATOM   4634  C  C    . PRO A 1 76 ? 21.003  -4.638  0.486   1.00 0.00 ? 76  PRO A C    4  
ATOM   4635  O  O    . PRO A 1 76 ? 20.327  -4.585  -0.541  1.00 0.00 ? 76  PRO A O    4  
ATOM   4636  C  CB   . PRO A 1 76 ? 21.752  -7.026  0.306   1.00 0.00 ? 76  PRO A CB   4  
ATOM   4637  C  CG   . PRO A 1 76 ? 20.560  -7.765  -0.195  1.00 0.00 ? 76  PRO A CG   4  
ATOM   4638  C  CD   . PRO A 1 76 ? 19.560  -7.747  0.928   1.00 0.00 ? 76  PRO A CD   4  
ATOM   4639  H  HA   . PRO A 1 76 ? 21.854  -5.803  2.069   1.00 0.00 ? 76  PRO A HA   4  
ATOM   4640  H  HB2  . PRO A 1 76 ? 22.294  -6.555  -0.502  1.00 0.00 ? 76  PRO A HB2  4  
ATOM   4641  H  HB3  . PRO A 1 76 ? 22.414  -7.675  0.860   1.00 0.00 ? 76  PRO A HB3  4  
ATOM   4642  H  HG2  . PRO A 1 76 ? 20.157  -7.267  -1.064  1.00 0.00 ? 76  PRO A HG2  4  
ATOM   4643  H  HG3  . PRO A 1 76 ? 20.833  -8.782  -0.437  1.00 0.00 ? 76  PRO A HG3  4  
ATOM   4644  H  HD2  . PRO A 1 76 ? 18.555  -7.690  0.537   1.00 0.00 ? 76  PRO A HD2  4  
ATOM   4645  H  HD3  . PRO A 1 76 ? 19.675  -8.623  1.550   1.00 0.00 ? 76  PRO A HD3  4  
ATOM   4646  N  N    . SER A 1 77 ? 21.613  -3.578  1.006   1.00 0.00 ? 77  SER A N    4  
ATOM   4647  C  CA   . SER A 1 77 ? 21.518  -2.261  0.387   1.00 0.00 ? 77  SER A CA   4  
ATOM   4648  C  C    . SER A 1 77 ? 22.807  -1.470  0.590   1.00 0.00 ? 77  SER A C    4  
ATOM   4649  O  O    . SER A 1 77 ? 23.616  -1.794  1.459   1.00 0.00 ? 77  SER A O    4  
ATOM   4650  C  CB   . SER A 1 77 ? 20.333  -1.486  0.967   1.00 0.00 ? 77  SER A CB   4  
ATOM   4651  O  OG   . SER A 1 77 ? 20.476  -1.308  2.365   1.00 0.00 ? 77  SER A OG   4  
ATOM   4652  H  H    . SER A 1 77 ? 22.138  -3.683  1.827   1.00 0.00 ? 77  SER A H    4  
ATOM   4653  H  HA   . SER A 1 77 ? 21.360  -2.403  -0.672  1.00 0.00 ? 77  SER A HA   4  
ATOM   4654  H  HB2  . SER A 1 77 ? 20.276  -0.516  0.497   1.00 0.00 ? 77  SER A HB2  4  
ATOM   4655  H  HB3  . SER A 1 77 ? 19.421  -2.032  0.776   1.00 0.00 ? 77  SER A HB3  4  
ATOM   4656  H  HG   . SER A 1 77 ? 21.203  -0.705  2.539   1.00 0.00 ? 77  SER A HG   4  
ATOM   4657  N  N    . SER A 1 78 ? 22.990  -0.431  -0.218  1.00 0.00 ? 78  SER A N    4  
ATOM   4658  C  CA   . SER A 1 78 ? 24.182  0.405   -0.130  1.00 0.00 ? 78  SER A CA   4  
ATOM   4659  C  C    . SER A 1 78 ? 24.091  1.356   1.059   1.00 0.00 ? 78  SER A C    4  
ATOM   4660  O  O    . SER A 1 78 ? 25.057  1.533   1.801   1.00 0.00 ? 78  SER A O    4  
ATOM   4661  C  CB   . SER A 1 78 ? 24.367  1.203   -1.423  1.00 0.00 ? 78  SER A CB   4  
ATOM   4662  O  OG   . SER A 1 78 ? 24.343  0.351   -2.555  1.00 0.00 ? 78  SER A OG   4  
ATOM   4663  H  H    . SER A 1 78 ? 22.308  -0.223  -0.891  1.00 0.00 ? 78  SER A H    4  
ATOM   4664  H  HA   . SER A 1 78 ? 25.033  -0.245  0.007   1.00 0.00 ? 78  SER A HA   4  
ATOM   4665  H  HB2  . SER A 1 78 ? 23.571  1.926   -1.514  1.00 0.00 ? 78  SER A HB2  4  
ATOM   4666  H  HB3  . SER A 1 78 ? 25.317  1.716   -1.393  1.00 0.00 ? 78  SER A HB3  4  
ATOM   4667  H  HG   . SER A 1 78 ? 25.174  0.426   -3.030  1.00 0.00 ? 78  SER A HG   4  
ATOM   4668  N  N    . GLY A 1 79 ? 22.923  1.967   1.234   1.00 0.00 ? 79  GLY A N    4  
ATOM   4669  C  CA   . GLY A 1 79 ? 22.727  2.892   2.334   1.00 0.00 ? 79  GLY A CA   4  
ATOM   4670  C  C    . GLY A 1 79 ? 21.594  2.474   3.249   1.00 0.00 ? 79  GLY A C    4  
ATOM   4671  O  O    . GLY A 1 79 ? 20.568  3.151   3.280   1.00 0.00 ? 79  GLY A O    4  
ATOM   4672  H  H    . GLY A 1 79 ? 22.188  1.787   0.610   1.00 0.00 ? 79  GLY A H    4  
ATOM   4673  H  HA2  . GLY A 1 79 ? 23.639  2.949   2.909   1.00 0.00 ? 79  GLY A HA2  4  
ATOM   4674  H  HA3  . GLY A 1 79 ? 22.506  3.870   1.931   1.00 0.00 ? 79  GLY A HA3  4  
HETATM 4675  ZN ZN   . ZN  B 2 .  ? -11.206 -0.235  3.314   1.00 0.00 ? 201 ZN  A ZN   4  
HETATM 4676  ZN ZN   . ZN  C 2 .  ? 5.145   3.765   6.010   1.00 0.00 ? 401 ZN  A ZN   4  
ATOM   4677  N  N    . GLY A 1 1  ? -30.267 -2.582  34.952  1.00 0.00 ? 1   GLY A N    5  
ATOM   4678  C  CA   . GLY A 1 1  ? -29.436 -3.639  34.408  1.00 0.00 ? 1   GLY A CA   5  
ATOM   4679  C  C    . GLY A 1 1  ? -30.059 -4.301  33.195  1.00 0.00 ? 1   GLY A C    5  
ATOM   4680  O  O    . GLY A 1 1  ? -31.215 -4.722  33.235  1.00 0.00 ? 1   GLY A O    5  
ATOM   4681  H  H1   . GLY A 1 1  ? -30.925 -2.134  34.379  1.00 0.00 ? 1   GLY A H1   5  
ATOM   4682  H  HA2  . GLY A 1 1  ? -28.480 -3.222  34.127  1.00 0.00 ? 1   GLY A HA2  5  
ATOM   4683  H  HA3  . GLY A 1 1  ? -29.280 -4.387  35.172  1.00 0.00 ? 1   GLY A HA3  5  
ATOM   4684  N  N    . SER A 1 2  ? -29.292 -4.391  32.113  1.00 0.00 ? 2   SER A N    5  
ATOM   4685  C  CA   . SER A 1 2  ? -29.778 -5.001  30.881  1.00 0.00 ? 2   SER A CA   5  
ATOM   4686  C  C    . SER A 1 2  ? -28.663 -5.772  30.180  1.00 0.00 ? 2   SER A C    5  
ATOM   4687  O  O    . SER A 1 2  ? -27.500 -5.370  30.213  1.00 0.00 ? 2   SER A O    5  
ATOM   4688  C  CB   . SER A 1 2  ? -30.340 -3.930  29.944  1.00 0.00 ? 2   SER A CB   5  
ATOM   4689  O  OG   . SER A 1 2  ? -31.515 -3.348  30.481  1.00 0.00 ? 2   SER A OG   5  
ATOM   4690  H  H    . SER A 1 2  ? -28.379 -4.036  32.144  1.00 0.00 ? 2   SER A H    5  
ATOM   4691  H  HA   . SER A 1 2  ? -30.568 -5.690  31.141  1.00 0.00 ? 2   SER A HA   5  
ATOM   4692  H  HB2  . SER A 1 2  ? -29.602 -3.156  29.803  1.00 0.00 ? 2   SER A HB2  5  
ATOM   4693  H  HB3  . SER A 1 2  ? -30.578 -4.379  28.990  1.00 0.00 ? 2   SER A HB3  5  
ATOM   4694  H  HG   . SER A 1 2  ? -31.976 -2.863  29.793  1.00 0.00 ? 2   SER A HG   5  
ATOM   4695  N  N    . SER A 1 3  ? -29.028 -6.882  29.547  1.00 0.00 ? 3   SER A N    5  
ATOM   4696  C  CA   . SER A 1 3  ? -28.059 -7.713  28.841  1.00 0.00 ? 3   SER A CA   5  
ATOM   4697  C  C    . SER A 1 3  ? -28.764 -8.738  27.959  1.00 0.00 ? 3   SER A C    5  
ATOM   4698  O  O    . SER A 1 3  ? -29.935 -9.053  28.167  1.00 0.00 ? 3   SER A O    5  
ATOM   4699  C  CB   . SER A 1 3  ? -27.143 -8.425  29.839  1.00 0.00 ? 3   SER A CB   5  
ATOM   4700  O  OG   . SER A 1 3  ? -25.903 -8.761  29.242  1.00 0.00 ? 3   SER A OG   5  
ATOM   4701  H  H    . SER A 1 3  ? -29.971 -7.150  29.557  1.00 0.00 ? 3   SER A H    5  
ATOM   4702  H  HA   . SER A 1 3  ? -27.462 -7.066  28.215  1.00 0.00 ? 3   SER A HA   5  
ATOM   4703  H  HB2  . SER A 1 3  ? -26.959 -7.776  30.681  1.00 0.00 ? 3   SER A HB2  5  
ATOM   4704  H  HB3  . SER A 1 3  ? -27.623 -9.331  30.180  1.00 0.00 ? 3   SER A HB3  5  
ATOM   4705  H  HG   . SER A 1 3  ? -26.058 -9.310  28.469  1.00 0.00 ? 3   SER A HG   5  
ATOM   4706  N  N    . GLY A 1 4  ? -28.040 -9.257  26.971  1.00 0.00 ? 4   GLY A N    5  
ATOM   4707  C  CA   . GLY A 1 4  ? -28.612 -10.241 26.071  1.00 0.00 ? 4   GLY A CA   5  
ATOM   4708  C  C    . GLY A 1 4  ? -28.369 -9.904  24.613  1.00 0.00 ? 4   GLY A C    5  
ATOM   4709  O  O    . GLY A 1 4  ? -28.611 -8.777  24.181  1.00 0.00 ? 4   GLY A O    5  
ATOM   4710  H  H    . GLY A 1 4  ? -27.111 -8.968  26.852  1.00 0.00 ? 4   GLY A H    5  
ATOM   4711  H  HA2  . GLY A 1 4  ? -28.174 -11.205 26.284  1.00 0.00 ? 4   GLY A HA2  5  
ATOM   4712  H  HA3  . GLY A 1 4  ? -29.677 -10.295 26.243  1.00 0.00 ? 4   GLY A HA3  5  
ATOM   4713  N  N    . SER A 1 5  ? -27.887 -10.882 23.853  1.00 0.00 ? 5   SER A N    5  
ATOM   4714  C  CA   . SER A 1 5  ? -27.605 -10.682 22.436  1.00 0.00 ? 5   SER A CA   5  
ATOM   4715  C  C    . SER A 1 5  ? -27.537 -12.017 21.702  1.00 0.00 ? 5   SER A C    5  
ATOM   4716  O  O    . SER A 1 5  ? -27.204 -13.046 22.290  1.00 0.00 ? 5   SER A O    5  
ATOM   4717  C  CB   . SER A 1 5  ? -26.290 -9.921  22.259  1.00 0.00 ? 5   SER A CB   5  
ATOM   4718  O  OG   . SER A 1 5  ? -26.220 -9.316  20.979  1.00 0.00 ? 5   SER A OG   5  
ATOM   4719  H  H    . SER A 1 5  ? -27.714 -11.759 24.256  1.00 0.00 ? 5   SER A H    5  
ATOM   4720  H  HA   . SER A 1 5  ? -28.410 -10.095 22.018  1.00 0.00 ? 5   SER A HA   5  
ATOM   4721  H  HB2  . SER A 1 5  ? -26.217 -9.152  23.012  1.00 0.00 ? 5   SER A HB2  5  
ATOM   4722  H  HB3  . SER A 1 5  ? -25.463 -10.609 22.364  1.00 0.00 ? 5   SER A HB3  5  
ATOM   4723  H  HG   . SER A 1 5  ? -27.087 -9.335  20.568  1.00 0.00 ? 5   SER A HG   5  
ATOM   4724  N  N    . SER A 1 6  ? -27.856 -11.993 20.412  1.00 0.00 ? 6   SER A N    5  
ATOM   4725  C  CA   . SER A 1 6  ? -27.835 -13.201 19.596  1.00 0.00 ? 6   SER A CA   5  
ATOM   4726  C  C    . SER A 1 6  ? -27.677 -12.857 18.118  1.00 0.00 ? 6   SER A C    5  
ATOM   4727  O  O    . SER A 1 6  ? -27.900 -11.719 17.707  1.00 0.00 ? 6   SER A O    5  
ATOM   4728  C  CB   . SER A 1 6  ? -29.117 -14.008 19.809  1.00 0.00 ? 6   SER A CB   5  
ATOM   4729  O  OG   . SER A 1 6  ? -28.991 -14.882 20.918  1.00 0.00 ? 6   SER A OG   5  
ATOM   4730  H  H    . SER A 1 6  ? -28.113 -11.142 19.999  1.00 0.00 ? 6   SER A H    5  
ATOM   4731  H  HA   . SER A 1 6  ? -26.989 -13.797 19.907  1.00 0.00 ? 6   SER A HA   5  
ATOM   4732  H  HB2  . SER A 1 6  ? -29.939 -13.332 19.990  1.00 0.00 ? 6   SER A HB2  5  
ATOM   4733  H  HB3  . SER A 1 6  ? -29.321 -14.595 18.925  1.00 0.00 ? 6   SER A HB3  5  
ATOM   4734  H  HG   . SER A 1 6  ? -29.561 -14.580 21.630  1.00 0.00 ? 6   SER A HG   5  
ATOM   4735  N  N    . GLY A 1 7  ? -27.291 -13.850 17.323  1.00 0.00 ? 7   GLY A N    5  
ATOM   4736  C  CA   . GLY A 1 7  ? -27.110 -13.633 15.899  1.00 0.00 ? 7   GLY A CA   5  
ATOM   4737  C  C    . GLY A 1 7  ? -26.708 -14.898 15.167  1.00 0.00 ? 7   GLY A C    5  
ATOM   4738  O  O    . GLY A 1 7  ? -26.423 -15.920 15.790  1.00 0.00 ? 7   GLY A O    5  
ATOM   4739  H  H    . GLY A 1 7  ? -27.128 -14.737 17.706  1.00 0.00 ? 7   GLY A H    5  
ATOM   4740  H  HA2  . GLY A 1 7  ? -28.036 -13.266 15.482  1.00 0.00 ? 7   GLY A HA2  5  
ATOM   4741  H  HA3  . GLY A 1 7  ? -26.342 -12.888 15.756  1.00 0.00 ? 7   GLY A HA3  5  
ATOM   4742  N  N    . SER A 1 8  ? -26.686 -14.829 13.840  1.00 0.00 ? 8   SER A N    5  
ATOM   4743  C  CA   . SER A 1 8  ? -26.321 -15.980 13.021  1.00 0.00 ? 8   SER A CA   5  
ATOM   4744  C  C    . SER A 1 8  ? -25.139 -15.648 12.115  1.00 0.00 ? 8   SER A C    5  
ATOM   4745  O  O    . SER A 1 8  ? -25.147 -14.638 11.411  1.00 0.00 ? 8   SER A O    5  
ATOM   4746  C  CB   . SER A 1 8  ? -27.515 -16.431 12.177  1.00 0.00 ? 8   SER A CB   5  
ATOM   4747  O  OG   . SER A 1 8  ? -27.364 -17.777 11.760  1.00 0.00 ? 8   SER A OG   5  
ATOM   4748  H  H    . SER A 1 8  ? -26.923 -13.986 13.401  1.00 0.00 ? 8   SER A H    5  
ATOM   4749  H  HA   . SER A 1 8  ? -26.036 -16.782 13.685  1.00 0.00 ? 8   SER A HA   5  
ATOM   4750  H  HB2  . SER A 1 8  ? -28.418 -16.347 12.762  1.00 0.00 ? 8   SER A HB2  5  
ATOM   4751  H  HB3  . SER A 1 8  ? -27.592 -15.802 11.302  1.00 0.00 ? 8   SER A HB3  5  
ATOM   4752  H  HG   . SER A 1 8  ? -28.148 -18.276 12.000  1.00 0.00 ? 8   SER A HG   5  
ATOM   4753  N  N    . ILE A 1 9  ? -24.125 -16.506 12.138  1.00 0.00 ? 9   ILE A N    5  
ATOM   4754  C  CA   . ILE A 1 9  ? -22.937 -16.306 11.318  1.00 0.00 ? 9   ILE A CA   5  
ATOM   4755  C  C    . ILE A 1 9  ? -22.808 -17.397 10.260  1.00 0.00 ? 9   ILE A C    5  
ATOM   4756  O  O    . ILE A 1 9  ? -22.988 -18.579 10.548  1.00 0.00 ? 9   ILE A O    5  
ATOM   4757  C  CB   . ILE A 1 9  ? -21.658 -16.286 12.176  1.00 0.00 ? 9   ILE A CB   5  
ATOM   4758  C  CG1  . ILE A 1 9  ? -20.436 -15.994 11.302  1.00 0.00 ? 9   ILE A CG1  5  
ATOM   4759  C  CG2  . ILE A 1 9  ? -21.489 -17.610 12.907  1.00 0.00 ? 9   ILE A CG2  5  
ATOM   4760  C  CD1  . ILE A 1 9  ? -19.271 -15.409 12.069  1.00 0.00 ? 9   ILE A CD1  5  
ATOM   4761  H  H    . ILE A 1 9  ? -24.178 -17.293 12.719  1.00 0.00 ? 9   ILE A H    5  
ATOM   4762  H  HA   . ILE A 1 9  ? -23.030 -15.349 10.824  1.00 0.00 ? 9   ILE A HA   5  
ATOM   4763  H  HB   . ILE A 1 9  ? -21.758 -15.505 12.914  1.00 0.00 ? 9   ILE A HB   5  
ATOM   4764  H  HG12 . ILE A 1 9  ? -20.103 -16.911 10.843  1.00 0.00 ? 9   ILE A HG12 5  
ATOM   4765  H  HG13 . ILE A 1 9  ? -20.714 -15.290 10.531  1.00 0.00 ? 9   ILE A HG13 5  
ATOM   4766  H  HG21 . ILE A 1 9  ? -22.279 -17.722 13.635  1.00 0.00 ? 9   ILE A HG21 5  
ATOM   4767  H  HG22 . ILE A 1 9  ? -21.538 -18.421 12.197  1.00 0.00 ? 9   ILE A HG22 5  
ATOM   4768  H  HG23 . ILE A 1 9  ? -20.533 -17.626 13.407  1.00 0.00 ? 9   ILE A HG23 5  
ATOM   4769  H  HD11 . ILE A 1 9  ? -18.627 -14.870 11.390  1.00 0.00 ? 9   ILE A HD11 5  
ATOM   4770  H  HD12 . ILE A 1 9  ? -19.640 -14.735 12.828  1.00 0.00 ? 9   ILE A HD12 5  
ATOM   4771  H  HD13 . ILE A 1 9  ? -18.712 -16.206 12.538  1.00 0.00 ? 9   ILE A HD13 5  
ATOM   4772  N  N    . GLY A 1 10 ? -22.495 -16.990 9.033   1.00 0.00 ? 10  GLY A N    5  
ATOM   4773  C  CA   . GLY A 1 10 ? -22.346 -17.945 7.951   1.00 0.00 ? 10  GLY A CA   5  
ATOM   4774  C  C    . GLY A 1 10 ? -22.935 -17.441 6.648   1.00 0.00 ? 10  GLY A C    5  
ATOM   4775  O  O    . GLY A 1 10 ? -24.116 -17.646 6.373   1.00 0.00 ? 10  GLY A O    5  
ATOM   4776  H  H    . GLY A 1 10 ? -22.364 -16.034 8.862   1.00 0.00 ? 10  GLY A H    5  
ATOM   4777  H  HA2  . GLY A 1 10 ? -21.295 -18.146 7.805   1.00 0.00 ? 10  GLY A HA2  5  
ATOM   4778  H  HA3  . GLY A 1 10 ? -22.843 -18.863 8.226   1.00 0.00 ? 10  GLY A HA3  5  
ATOM   4779  N  N    . ASN A 1 11 ? -22.110 -16.777 5.845   1.00 0.00 ? 11  ASN A N    5  
ATOM   4780  C  CA   . ASN A 1 11 ? -22.556 -16.240 4.565   1.00 0.00 ? 11  ASN A CA   5  
ATOM   4781  C  C    . ASN A 1 11 ? -21.366 -15.884 3.679   1.00 0.00 ? 11  ASN A C    5  
ATOM   4782  O  O    . ASN A 1 11 ? -20.241 -15.750 4.159   1.00 0.00 ? 11  ASN A O    5  
ATOM   4783  C  CB   . ASN A 1 11 ? -23.431 -15.004 4.784   1.00 0.00 ? 11  ASN A CB   5  
ATOM   4784  C  CG   . ASN A 1 11 ? -22.656 -13.846 5.381   1.00 0.00 ? 11  ASN A CG   5  
ATOM   4785  O  OD1  . ASN A 1 11 ? -22.396 -12.847 4.710   1.00 0.00 ? 11  ASN A OD1  5  
ATOM   4786  N  ND2  . ASN A 1 11 ? -22.283 -13.974 6.649   1.00 0.00 ? 11  ASN A ND2  5  
ATOM   4787  H  H    . ASN A 1 11 ? -21.178 -16.645 6.119   1.00 0.00 ? 11  ASN A H    5  
ATOM   4788  H  HA   . ASN A 1 11 ? -23.142 -17.002 4.072   1.00 0.00 ? 11  ASN A HA   5  
ATOM   4789  H  HB2  . ASN A 1 11 ? -23.841 -14.688 3.836   1.00 0.00 ? 11  ASN A HB2  5  
ATOM   4790  H  HB3  . ASN A 1 11 ? -24.240 -15.257 5.454   1.00 0.00 ? 11  ASN A HB3  5  
ATOM   4791  H  HD21 . ASN A 1 11 ? -22.526 -14.798 7.122   1.00 0.00 ? 11  ASN A HD21 5  
ATOM   4792  H  HD22 . ASN A 1 11 ? -21.781 -13.240 7.060   1.00 0.00 ? 11  ASN A HD22 5  
ATOM   4793  N  N    . ALA A 1 12 ? -21.624 -15.731 2.384   1.00 0.00 ? 12  ALA A N    5  
ATOM   4794  C  CA   . ALA A 1 12 ? -20.575 -15.388 1.432   1.00 0.00 ? 12  ALA A CA   5  
ATOM   4795  C  C    . ALA A 1 12 ? -20.597 -13.898 1.105   1.00 0.00 ? 12  ALA A C    5  
ATOM   4796  O  O    . ALA A 1 12 ? -21.498 -13.175 1.527   1.00 0.00 ? 12  ALA A O    5  
ATOM   4797  C  CB   . ALA A 1 12 ? -20.726 -16.211 0.162   1.00 0.00 ? 12  ALA A CB   5  
ATOM   4798  H  H    . ALA A 1 12 ? -22.542 -15.851 2.062   1.00 0.00 ? 12  ALA A H    5  
ATOM   4799  H  HA   . ALA A 1 12 ? -19.623 -15.634 1.881   1.00 0.00 ? 12  ALA A HA   5  
ATOM   4800  H  HB1  . ALA A 1 12 ? -21.356 -17.066 0.360   1.00 0.00 ? 12  ALA A HB1  5  
ATOM   4801  H  HB2  . ALA A 1 12 ? -21.175 -15.603 -0.610  1.00 0.00 ? 12  ALA A HB2  5  
ATOM   4802  H  HB3  . ALA A 1 12 ? -19.754 -16.549 -0.165  1.00 0.00 ? 12  ALA A HB3  5  
ATOM   4803  N  N    . GLN A 1 13 ? -19.599 -13.448 0.352   1.00 0.00 ? 13  GLN A N    5  
ATOM   4804  C  CA   . GLN A 1 13 ? -19.503 -12.044 -0.029  1.00 0.00 ? 13  GLN A CA   5  
ATOM   4805  C  C    . GLN A 1 13 ? -19.201 -11.903 -1.518  1.00 0.00 ? 13  GLN A C    5  
ATOM   4806  O  O    . GLN A 1 13 ? -18.142 -12.318 -1.989  1.00 0.00 ? 13  GLN A O    5  
ATOM   4807  C  CB   . GLN A 1 13 ? -18.420 -11.343 0.792   1.00 0.00 ? 13  GLN A CB   5  
ATOM   4808  C  CG   . GLN A 1 13 ? -18.494 -9.826  0.727   1.00 0.00 ? 13  GLN A CG   5  
ATOM   4809  C  CD   . GLN A 1 13 ? -19.894 -9.298  0.971   1.00 0.00 ? 13  GLN A CD   5  
ATOM   4810  O  OE1  . GLN A 1 13 ? -20.720 -9.253  0.059   1.00 0.00 ? 13  GLN A OE1  5  
ATOM   4811  N  NE2  . GLN A 1 13 ? -20.169 -8.897  2.206   1.00 0.00 ? 13  GLN A NE2  5  
ATOM   4812  H  H    . GLN A 1 13 ? -18.910 -14.074 0.047   1.00 0.00 ? 13  GLN A H    5  
ATOM   4813  H  HA   . GLN A 1 13 ? -20.456 -11.579 0.177   1.00 0.00 ? 13  GLN A HA   5  
ATOM   4814  H  HB2  . GLN A 1 13 ? -18.517 -11.643 1.824   1.00 0.00 ? 13  GLN A HB2  5  
ATOM   4815  H  HB3  . GLN A 1 13 ? -17.452 -11.650 0.425   1.00 0.00 ? 13  GLN A HB3  5  
ATOM   4816  H  HG2  . GLN A 1 13 ? -17.835 -9.413  1.477   1.00 0.00 ? 13  GLN A HG2  5  
ATOM   4817  H  HG3  . GLN A 1 13 ? -18.169 -9.504  -0.252  1.00 0.00 ? 13  GLN A HG3  5  
ATOM   4818  H  HE21 . GLN A 1 13 ? -19.461 -8.961  2.882   1.00 0.00 ? 13  GLN A HE21 5  
ATOM   4819  H  HE22 . GLN A 1 13 ? -21.066 -8.551  2.392   1.00 0.00 ? 13  GLN A HE22 5  
ATOM   4820  N  N    . LYS A 1 14 ? -20.138 -11.316 -2.254  1.00 0.00 ? 14  LYS A N    5  
ATOM   4821  C  CA   . LYS A 1 14 ? -19.973 -11.120 -3.689  1.00 0.00 ? 14  LYS A CA   5  
ATOM   4822  C  C    . LYS A 1 14 ? -19.150 -9.868  -3.976  1.00 0.00 ? 14  LYS A C    5  
ATOM   4823  O  O    . LYS A 1 14 ? -19.167 -9.343  -5.090  1.00 0.00 ? 14  LYS A O    5  
ATOM   4824  C  CB   . LYS A 1 14 ? -21.339 -11.012 -4.371  1.00 0.00 ? 14  LYS A CB   5  
ATOM   4825  C  CG   . LYS A 1 14 ? -21.343 -11.503 -5.808  1.00 0.00 ? 14  LYS A CG   5  
ATOM   4826  C  CD   . LYS A 1 14 ? -22.735 -11.444 -6.414  1.00 0.00 ? 14  LYS A CD   5  
ATOM   4827  C  CE   . LYS A 1 14 ? -23.632 -12.540 -5.858  1.00 0.00 ? 14  LYS A CE   5  
ATOM   4828  N  NZ   . LYS A 1 14 ? -25.072 -12.168 -5.930  1.00 0.00 ? 14  LYS A NZ   5  
ATOM   4829  H  H    . LYS A 1 14 ? -20.962 -11.007 -1.821  1.00 0.00 ? 14  LYS A H    5  
ATOM   4830  H  HA   . LYS A 1 14 ? -19.451 -11.978 -4.084  1.00 0.00 ? 14  LYS A HA   5  
ATOM   4831  H  HB2  . LYS A 1 14 ? -22.055 -11.596 -3.811  1.00 0.00 ? 14  LYS A HB2  5  
ATOM   4832  H  HB3  . LYS A 1 14 ? -21.650 -9.977  -4.366  1.00 0.00 ? 14  LYS A HB3  5  
ATOM   4833  H  HG2  . LYS A 1 14 ? -20.681 -10.882 -6.393  1.00 0.00 ? 14  LYS A HG2  5  
ATOM   4834  H  HG3  . LYS A 1 14 ? -20.993 -12.526 -5.830  1.00 0.00 ? 14  LYS A HG3  5  
ATOM   4835  H  HD2  . LYS A 1 14 ? -23.176 -10.485 -6.189  1.00 0.00 ? 14  LYS A HD2  5  
ATOM   4836  H  HD3  . LYS A 1 14 ? -22.657 -11.565 -7.485  1.00 0.00 ? 14  LYS A HD3  5  
ATOM   4837  H  HE2  . LYS A 1 14 ? -23.473 -13.442 -6.428  1.00 0.00 ? 14  LYS A HE2  5  
ATOM   4838  H  HE3  . LYS A 1 14 ? -23.365 -12.715 -4.826  1.00 0.00 ? 14  LYS A HE3  5  
ATOM   4839  H  HZ1  . LYS A 1 14 ? -25.643 -12.999 -6.184  1.00 0.00 ? 14  LYS A HZ1  5  
ATOM   4840  H  HZ2  . LYS A 1 14 ? -25.214 -11.431 -6.650  1.00 0.00 ? 14  LYS A HZ2  5  
ATOM   4841  H  HZ3  . LYS A 1 14 ? -25.394 -11.806 -5.010  1.00 0.00 ? 14  LYS A HZ3  5  
ATOM   4842  N  N    . LEU A 1 15 ? -18.429 -9.395  -2.965  1.00 0.00 ? 15  LEU A N    5  
ATOM   4843  C  CA   . LEU A 1 15 ? -17.598 -8.206  -3.109  1.00 0.00 ? 15  LEU A CA   5  
ATOM   4844  C  C    . LEU A 1 15 ? -16.263 -8.384  -2.392  1.00 0.00 ? 15  LEU A C    5  
ATOM   4845  O  O    . LEU A 1 15 ? -16.185 -8.965  -1.309  1.00 0.00 ? 15  LEU A O    5  
ATOM   4846  C  CB   . LEU A 1 15 ? -18.326 -6.980  -2.555  1.00 0.00 ? 15  LEU A CB   5  
ATOM   4847  C  CG   . LEU A 1 15 ? -19.728 -6.725  -3.111  1.00 0.00 ? 15  LEU A CG   5  
ATOM   4848  C  CD1  . LEU A 1 15 ? -20.441 -5.660  -2.292  1.00 0.00 ? 15  LEU A CD1  5  
ATOM   4849  C  CD2  . LEU A 1 15 ? -19.655 -6.314  -4.574  1.00 0.00 ? 15  LEU A CD2  5  
ATOM   4850  H  H    . LEU A 1 15 ? -18.457 -9.857  -2.101  1.00 0.00 ? 15  LEU A H    5  
ATOM   4851  H  HA   . LEU A 1 15 ? -17.410 -8.058  -4.162  1.00 0.00 ? 15  LEU A HA   5  
ATOM   4852  H  HB2  . LEU A 1 15 ? -18.412 -7.101  -1.486  1.00 0.00 ? 15  LEU A HB2  5  
ATOM   4853  H  HB3  . LEU A 1 15 ? -17.721 -6.111  -2.770  1.00 0.00 ? 15  LEU A HB3  5  
ATOM   4854  H  HG   . LEU A 1 15 ? -20.305 -7.637  -3.047  1.00 0.00 ? 15  LEU A HG   5  
ATOM   4855  H  HD11 . LEU A 1 15 ? -20.061 -5.669  -1.282  1.00 0.00 ? 15  LEU A HD11 5  
ATOM   4856  H  HD12 . LEU A 1 15 ? -21.502 -5.867  -2.279  1.00 0.00 ? 15  LEU A HD12 5  
ATOM   4857  H  HD13 . LEU A 1 15 ? -20.269 -4.690  -2.734  1.00 0.00 ? 15  LEU A HD13 5  
ATOM   4858  H  HD21 . LEU A 1 15 ? -18.987 -6.979  -5.102  1.00 0.00 ? 15  LEU A HD21 5  
ATOM   4859  H  HD22 . LEU A 1 15 ? -19.284 -5.302  -4.646  1.00 0.00 ? 15  LEU A HD22 5  
ATOM   4860  H  HD23 . LEU A 1 15 ? -20.640 -6.369  -5.013  1.00 0.00 ? 15  LEU A HD23 5  
ATOM   4861  N  N    . PRO A 1 16 ? -15.187 -7.871  -3.007  1.00 0.00 ? 16  PRO A N    5  
ATOM   4862  C  CA   . PRO A 1 16 ? -13.836 -7.959  -2.445  1.00 0.00 ? 16  PRO A CA   5  
ATOM   4863  C  C    . PRO A 1 16 ? -13.666 -7.086  -1.207  1.00 0.00 ? 16  PRO A C    5  
ATOM   4864  O  O    . PRO A 1 16 ? -13.311 -5.912  -1.308  1.00 0.00 ? 16  PRO A O    5  
ATOM   4865  C  CB   . PRO A 1 16 ? -12.945 -7.454  -3.582  1.00 0.00 ? 16  PRO A CB   5  
ATOM   4866  C  CG   . PRO A 1 16 ? -13.829 -6.571  -4.393  1.00 0.00 ? 16  PRO A CG   5  
ATOM   4867  C  CD   . PRO A 1 16 ? -15.207 -7.166  -4.300  1.00 0.00 ? 16  PRO A CD   5  
ATOM   4868  H  HA   . PRO A 1 16 ? -13.573 -8.979  -2.204  1.00 0.00 ? 16  PRO A HA   5  
ATOM   4869  H  HB2  . PRO A 1 16 ? -12.108 -6.908  -3.171  1.00 0.00 ? 16  PRO A HB2  5  
ATOM   4870  H  HB3  . PRO A 1 16 ? -12.586 -8.292  -4.162  1.00 0.00 ? 16  PRO A HB3  5  
ATOM   4871  H  HG2  . PRO A 1 16 ? -13.824 -5.572  -3.984  1.00 0.00 ? 16  PRO A HG2  5  
ATOM   4872  H  HG3  . PRO A 1 16 ? -13.495 -6.559  -5.419  1.00 0.00 ? 16  PRO A HG3  5  
ATOM   4873  H  HD2  . PRO A 1 16 ? -15.955 -6.387  -4.302  1.00 0.00 ? 16  PRO A HD2  5  
ATOM   4874  H  HD3  . PRO A 1 16 ? -15.375 -7.856  -5.113  1.00 0.00 ? 16  PRO A HD3  5  
ATOM   4875  N  N    . MET A 1 17 ? -13.922 -7.667  -0.039  1.00 0.00 ? 17  MET A N    5  
ATOM   4876  C  CA   . MET A 1 17 ? -13.794 -6.940  1.219   1.00 0.00 ? 17  MET A CA   5  
ATOM   4877  C  C    . MET A 1 17 ? -12.391 -6.364  1.375   1.00 0.00 ? 17  MET A C    5  
ATOM   4878  O  O    . MET A 1 17 ? -11.400 -7.018  1.048   1.00 0.00 ? 17  MET A O    5  
ATOM   4879  C  CB   . MET A 1 17 ? -14.114 -7.861  2.399   1.00 0.00 ? 17  MET A CB   5  
ATOM   4880  C  CG   . MET A 1 17 ? -13.014 -8.867  2.700   1.00 0.00 ? 17  MET A CG   5  
ATOM   4881  S  SD   . MET A 1 17 ? -13.174 -9.601  4.339   1.00 0.00 ? 17  MET A SD   5  
ATOM   4882  C  CE   . MET A 1 17 ? -14.896 -10.094 4.322   1.00 0.00 ? 17  MET A CE   5  
ATOM   4883  H  H    . MET A 1 17 ? -14.201 -8.606  -0.022  1.00 0.00 ? 17  MET A H    5  
ATOM   4884  H  HA   . MET A 1 17 ? -14.505 -6.128  1.206   1.00 0.00 ? 17  MET A HA   5  
ATOM   4885  H  HB2  . MET A 1 17 ? -14.270 -7.257  3.280   1.00 0.00 ? 17  MET A HB2  5  
ATOM   4886  H  HB3  . MET A 1 17 ? -15.020 -8.406  2.180   1.00 0.00 ? 17  MET A HB3  5  
ATOM   4887  H  HG2  . MET A 1 17 ? -13.054 -9.655  1.963   1.00 0.00 ? 17  MET A HG2  5  
ATOM   4888  H  HG3  . MET A 1 17 ? -12.060 -8.365  2.636   1.00 0.00 ? 17  MET A HG3  5  
ATOM   4889  H  HE1  . MET A 1 17 ? -15.236 -10.250 5.335   1.00 0.00 ? 17  MET A HE1  5  
ATOM   4890  H  HE2  . MET A 1 17 ? -15.488 -9.319  3.859   1.00 0.00 ? 17  MET A HE2  5  
ATOM   4891  H  HE3  . MET A 1 17 ? -15.002 -11.012 3.762   1.00 0.00 ? 17  MET A HE3  5  
ATOM   4892  N  N    . CYS A 1 18 ? -12.313 -5.135  1.875   1.00 0.00 ? 18  CYS A N    5  
ATOM   4893  C  CA   . CYS A 1 18 ? -11.031 -4.470  2.073   1.00 0.00 ? 18  CYS A CA   5  
ATOM   4894  C  C    . CYS A 1 18 ? -10.170 -5.234  3.075   1.00 0.00 ? 18  CYS A C    5  
ATOM   4895  O  O    . CYS A 1 18 ? -10.648 -5.646  4.132   1.00 0.00 ? 18  CYS A O    5  
ATOM   4896  C  CB   . CYS A 1 18 ? -11.247 -3.035  2.559   1.00 0.00 ? 18  CYS A CB   5  
ATOM   4897  S  SG   . CYS A 1 18 ? -9.706  -2.112  2.859   1.00 0.00 ? 18  CYS A SG   5  
ATOM   4898  H  H    . CYS A 1 18 ? -13.138 -4.664  2.117   1.00 0.00 ? 18  CYS A H    5  
ATOM   4899  H  HA   . CYS A 1 18 ? -10.519 -4.445  1.123   1.00 0.00 ? 18  CYS A HA   5  
ATOM   4900  H  HB2  . CYS A 1 18 ? -11.814 -2.493  1.816   1.00 0.00 ? 18  CYS A HB2  5  
ATOM   4901  H  HB3  . CYS A 1 18 ? -11.804 -3.057  3.484   1.00 0.00 ? 18  CYS A HB3  5  
ATOM   4902  N  N    . ASP A 1 19 ? -8.900  -5.419  2.735   1.00 0.00 ? 19  ASP A N    5  
ATOM   4903  C  CA   . ASP A 1 19 ? -7.971  -6.132  3.605   1.00 0.00 ? 19  ASP A CA   5  
ATOM   4904  C  C    . ASP A 1 19 ? -7.578  -5.271  4.802   1.00 0.00 ? 19  ASP A C    5  
ATOM   4905  O  O    . ASP A 1 19 ? -7.418  -5.773  5.915   1.00 0.00 ? 19  ASP A O    5  
ATOM   4906  C  CB   . ASP A 1 19 ? -6.722  -6.544  2.825   1.00 0.00 ? 19  ASP A CB   5  
ATOM   4907  C  CG   . ASP A 1 19 ? -6.865  -7.909  2.182   1.00 0.00 ? 19  ASP A CG   5  
ATOM   4908  O  OD1  . ASP A 1 19 ? -6.883  -8.915  2.923   1.00 0.00 ? 19  ASP A OD1  5  
ATOM   4909  O  OD2  . ASP A 1 19 ? -6.959  -7.973  0.939   1.00 0.00 ? 19  ASP A OD2  5  
ATOM   4910  H  H    . ASP A 1 19 ? -8.578  -5.066  1.879   1.00 0.00 ? 19  ASP A H    5  
ATOM   4911  H  HA   . ASP A 1 19 ? -8.469  -7.020  3.964   1.00 0.00 ? 19  ASP A HA   5  
ATOM   4912  H  HB2  . ASP A 1 19 ? -6.536  -5.818  2.046   1.00 0.00 ? 19  ASP A HB2  5  
ATOM   4913  H  HB3  . ASP A 1 19 ? -5.877  -6.568  3.497   1.00 0.00 ? 19  ASP A HB3  5  
ATOM   4914  N  N    . LYS A 1 20 ? -7.423  -3.973  4.565   1.00 0.00 ? 20  LYS A N    5  
ATOM   4915  C  CA   . LYS A 1 20 ? -7.049  -3.042  5.623   1.00 0.00 ? 20  LYS A CA   5  
ATOM   4916  C  C    . LYS A 1 20 ? -8.034  -3.114  6.785   1.00 0.00 ? 20  LYS A C    5  
ATOM   4917  O  O    . LYS A 1 20 ? -7.676  -3.521  7.891   1.00 0.00 ? 20  LYS A O    5  
ATOM   4918  C  CB   . LYS A 1 20 ? -6.992  -1.614  5.076   1.00 0.00 ? 20  LYS A CB   5  
ATOM   4919  C  CG   . LYS A 1 20 ? -6.701  -0.567  6.137   1.00 0.00 ? 20  LYS A CG   5  
ATOM   4920  C  CD   . LYS A 1 20 ? -5.215  -0.263  6.228   1.00 0.00 ? 20  LYS A CD   5  
ATOM   4921  C  CE   . LYS A 1 20 ? -4.949  0.977   7.067   1.00 0.00 ? 20  LYS A CE   5  
ATOM   4922  N  NZ   . LYS A 1 20 ? -5.474  0.831   8.453   1.00 0.00 ? 20  LYS A NZ   5  
ATOM   4923  H  H    . LYS A 1 20 ? -7.565  -3.633  3.657   1.00 0.00 ? 20  LYS A H    5  
ATOM   4924  H  HA   . LYS A 1 20 ? -6.069  -3.321  5.979   1.00 0.00 ? 20  LYS A HA   5  
ATOM   4925  H  HB2  . LYS A 1 20 ? -6.219  -1.559  4.324   1.00 0.00 ? 20  LYS A HB2  5  
ATOM   4926  H  HB3  . LYS A 1 20 ? -7.943  -1.378  4.620   1.00 0.00 ? 20  LYS A HB3  5  
ATOM   4927  H  HG2  . LYS A 1 20 ? -7.228  0.342   5.889   1.00 0.00 ? 20  LYS A HG2  5  
ATOM   4928  H  HG3  . LYS A 1 20 ? -7.043  -0.934  7.095   1.00 0.00 ? 20  LYS A HG3  5  
ATOM   4929  H  HD2  . LYS A 1 20 ? -4.711  -1.105  6.680   1.00 0.00 ? 20  LYS A HD2  5  
ATOM   4930  H  HD3  . LYS A 1 20 ? -4.828  -0.103  5.231   1.00 0.00 ? 20  LYS A HD3  5  
ATOM   4931  H  HE2  . LYS A 1 20 ? -3.884  1.145   7.111   1.00 0.00 ? 20  LYS A HE2  5  
ATOM   4932  H  HE3  . LYS A 1 20 ? -5.428  1.823   6.597   1.00 0.00 ? 20  LYS A HE3  5  
ATOM   4933  H  HZ1  . LYS A 1 20 ? -5.777  1.757   8.819   1.00 0.00 ? 20  LYS A HZ1  5  
ATOM   4934  H  HZ2  . LYS A 1 20 ? -4.734  0.450   9.077   1.00 0.00 ? 20  LYS A HZ2  5  
ATOM   4935  H  HZ3  . LYS A 1 20 ? -6.287  0.184   8.462   1.00 0.00 ? 20  LYS A HZ3  5  
ATOM   4936  N  N    . CYS A 1 21 ? -9.276  -2.717  6.528   1.00 0.00 ? 21  CYS A N    5  
ATOM   4937  C  CA   . CYS A 1 21 ? -10.313 -2.738  7.552   1.00 0.00 ? 21  CYS A CA   5  
ATOM   4938  C  C    . CYS A 1 21 ? -10.998 -4.101  7.606   1.00 0.00 ? 21  CYS A C    5  
ATOM   4939  O  O    . CYS A 1 21 ? -10.857 -4.840  8.579   1.00 0.00 ? 21  CYS A O    5  
ATOM   4940  C  CB   . CYS A 1 21 ? -11.349 -1.645  7.280   1.00 0.00 ? 21  CYS A CB   5  
ATOM   4941  S  SG   . CYS A 1 21 ? -11.671 -1.349  5.511   1.00 0.00 ? 21  CYS A SG   5  
ATOM   4942  H  H    . CYS A 1 21 ? -9.501  -2.403  5.626   1.00 0.00 ? 21  CYS A H    5  
ATOM   4943  H  HA   . CYS A 1 21 ? -9.843  -2.547  8.504   1.00 0.00 ? 21  CYS A HA   5  
ATOM   4944  H  HB2  . CYS A 1 21 ? -12.285 -1.925  7.741   1.00 0.00 ? 21  CYS A HB2  5  
ATOM   4945  H  HB3  . CYS A 1 21 ? -11.004 -0.717  7.712   1.00 0.00 ? 21  CYS A HB3  5  
ATOM   4946  N  N    . GLY A 1 22 ? -11.740 -4.427  6.552   1.00 0.00 ? 22  GLY A N    5  
ATOM   4947  C  CA   . GLY A 1 22 ? -12.434 -5.700  6.499   1.00 0.00 ? 22  GLY A CA   5  
ATOM   4948  C  C    . GLY A 1 22 ? -13.920 -5.539  6.241   1.00 0.00 ? 22  GLY A C    5  
ATOM   4949  O  O    . GLY A 1 22 ? -14.747 -5.929  7.066   1.00 0.00 ? 22  GLY A O    5  
ATOM   4950  H  H    . GLY A 1 22 ? -11.816 -3.798  5.804   1.00 0.00 ? 22  GLY A H    5  
ATOM   4951  H  HA2  . GLY A 1 22 ? -12.005 -6.299  5.710   1.00 0.00 ? 22  GLY A HA2  5  
ATOM   4952  H  HA3  . GLY A 1 22 ? -12.298 -6.211  7.440   1.00 0.00 ? 22  GLY A HA3  5  
ATOM   4953  N  N    . THR A 1 23 ? -14.260 -4.961  5.093   1.00 0.00 ? 23  THR A N    5  
ATOM   4954  C  CA   . THR A 1 23 ? -15.656 -4.747  4.730   1.00 0.00 ? 23  THR A CA   5  
ATOM   4955  C  C    . THR A 1 23 ? -15.845 -4.801  3.218   1.00 0.00 ? 23  THR A C    5  
ATOM   4956  O  O    . THR A 1 23 ? -15.086 -4.193  2.466   1.00 0.00 ? 23  THR A O    5  
ATOM   4957  C  CB   . THR A 1 23 ? -16.170 -3.392  5.252   1.00 0.00 ? 23  THR A CB   5  
ATOM   4958  O  OG1  . THR A 1 23 ? -15.405 -2.325  4.681   1.00 0.00 ? 23  THR A OG1  5  
ATOM   4959  C  CG2  . THR A 1 23 ? -16.085 -3.329  6.770   1.00 0.00 ? 23  THR A CG2  5  
ATOM   4960  H  H    . THR A 1 23 ? -13.555 -4.672  4.477   1.00 0.00 ? 23  THR A H    5  
ATOM   4961  H  HA   . THR A 1 23 ? -16.243 -5.531  5.185   1.00 0.00 ? 23  THR A HA   5  
ATOM   4962  H  HB   . THR A 1 23 ? -17.205 -3.280  4.959   1.00 0.00 ? 23  THR A HB   5  
ATOM   4963  H  HG1  . THR A 1 23 ? -14.682 -2.098  5.271   1.00 0.00 ? 23  THR A HG1  5  
ATOM   4964  H  HG21 . THR A 1 23 ? -15.051 -3.245  7.069   1.00 0.00 ? 23  THR A HG21 5  
ATOM   4965  H  HG22 . THR A 1 23 ? -16.510 -4.228  7.192   1.00 0.00 ? 23  THR A HG22 5  
ATOM   4966  H  HG23 . THR A 1 23 ? -16.633 -2.470  7.125   1.00 0.00 ? 23  THR A HG23 5  
ATOM   4967  N  N    . GLY A 1 24 ? -16.864 -5.535  2.780   1.00 0.00 ? 24  GLY A N    5  
ATOM   4968  C  CA   . GLY A 1 24 ? -17.135 -5.654  1.359   1.00 0.00 ? 24  GLY A CA   5  
ATOM   4969  C  C    . GLY A 1 24 ? -16.944 -4.344  0.621   1.00 0.00 ? 24  GLY A C    5  
ATOM   4970  O  O    . GLY A 1 24 ? -17.538 -3.328  0.983   1.00 0.00 ? 24  GLY A O    5  
ATOM   4971  H  H    . GLY A 1 24 ? -17.436 -5.998  3.427   1.00 0.00 ? 24  GLY A H    5  
ATOM   4972  H  HA2  . GLY A 1 24 ? -16.470 -6.393  0.938   1.00 0.00 ? 24  GLY A HA2  5  
ATOM   4973  H  HA3  . GLY A 1 24 ? -18.154 -5.984  1.226   1.00 0.00 ? 24  GLY A HA3  5  
ATOM   4974  N  N    . ILE A 1 25 ? -16.114 -4.367  -0.416  1.00 0.00 ? 25  ILE A N    5  
ATOM   4975  C  CA   . ILE A 1 25 ? -15.847 -3.172  -1.207  1.00 0.00 ? 25  ILE A CA   5  
ATOM   4976  C  C    . ILE A 1 25 ? -16.905 -2.980  -2.288  1.00 0.00 ? 25  ILE A C    5  
ATOM   4977  O  O    . ILE A 1 25 ? -17.373 -3.946  -2.892  1.00 0.00 ? 25  ILE A O    5  
ATOM   4978  C  CB   . ILE A 1 25 ? -14.458 -3.233  -1.868  1.00 0.00 ? 25  ILE A CB   5  
ATOM   4979  C  CG1  . ILE A 1 25 ? -13.366 -3.341  -0.802  1.00 0.00 ? 25  ILE A CG1  5  
ATOM   4980  C  CG2  . ILE A 1 25 ? -14.233 -2.008  -2.743  1.00 0.00 ? 25  ILE A CG2  5  
ATOM   4981  C  CD1  . ILE A 1 25 ? -12.003 -3.681  -1.365  1.00 0.00 ? 25  ILE A CD1  5  
ATOM   4982  H  H    . ILE A 1 25 ? -15.671 -5.207  -0.656  1.00 0.00 ? 25  ILE A H    5  
ATOM   4983  H  HA   . ILE A 1 25 ? -15.870 -2.320  -0.542  1.00 0.00 ? 25  ILE A HA   5  
ATOM   4984  H  HB   . ILE A 1 25 ? -14.423 -4.108  -2.500  1.00 0.00 ? 25  ILE A HB   5  
ATOM   4985  H  HG12 . ILE A 1 25 ? -13.284 -2.399  -0.284  1.00 0.00 ? 25  ILE A HG12 5  
ATOM   4986  H  HG13 . ILE A 1 25 ? -13.637 -4.113  -0.097  1.00 0.00 ? 25  ILE A HG13 5  
ATOM   4987  H  HG21 . ILE A 1 25 ? -15.094 -1.359  -2.680  1.00 0.00 ? 25  ILE A HG21 5  
ATOM   4988  H  HG22 . ILE A 1 25 ? -13.358 -1.478  -2.401  1.00 0.00 ? 25  ILE A HG22 5  
ATOM   4989  H  HG23 . ILE A 1 25 ? -14.090 -2.318  -3.767  1.00 0.00 ? 25  ILE A HG23 5  
ATOM   4990  H  HD11 . ILE A 1 25 ? -11.488 -2.771  -1.636  1.00 0.00 ? 25  ILE A HD11 5  
ATOM   4991  H  HD12 . ILE A 1 25 ? -11.429 -4.214  -0.623  1.00 0.00 ? 25  ILE A HD12 5  
ATOM   4992  H  HD13 . ILE A 1 25 ? -12.121 -4.301  -2.242  1.00 0.00 ? 25  ILE A HD13 5  
ATOM   4993  N  N    . VAL A 1 26 ? -17.277 -1.727  -2.530  1.00 0.00 ? 26  VAL A N    5  
ATOM   4994  C  CA   . VAL A 1 26 ? -18.278 -1.408  -3.541  1.00 0.00 ? 26  VAL A CA   5  
ATOM   4995  C  C    . VAL A 1 26 ? -17.796 -0.288  -4.457  1.00 0.00 ? 26  VAL A C    5  
ATOM   4996  O  O    . VAL A 1 26 ? -17.466 0.804   -3.998  1.00 0.00 ? 26  VAL A O    5  
ATOM   4997  C  CB   . VAL A 1 26 ? -19.613 -0.991  -2.897  1.00 0.00 ? 26  VAL A CB   5  
ATOM   4998  C  CG1  . VAL A 1 26 ? -19.431 0.259   -2.050  1.00 0.00 ? 26  VAL A CG1  5  
ATOM   4999  C  CG2  . VAL A 1 26 ? -20.674 -0.771  -3.966  1.00 0.00 ? 26  VAL A CG2  5  
ATOM   5000  H  H    . VAL A 1 26 ? -16.868 -1.000  -2.016  1.00 0.00 ? 26  VAL A H    5  
ATOM   5001  H  HA   . VAL A 1 26 ? -18.449 -2.295  -4.133  1.00 0.00 ? 26  VAL A HA   5  
ATOM   5002  H  HB   . VAL A 1 26 ? -19.944 -1.791  -2.251  1.00 0.00 ? 26  VAL A HB   5  
ATOM   5003  H  HG11 . VAL A 1 26 ? -19.791 0.071   -1.049  1.00 0.00 ? 26  VAL A HG11 5  
ATOM   5004  H  HG12 . VAL A 1 26 ? -18.383 0.520   -2.014  1.00 0.00 ? 26  VAL A HG12 5  
ATOM   5005  H  HG13 . VAL A 1 26 ? -19.990 1.074   -2.486  1.00 0.00 ? 26  VAL A HG13 5  
ATOM   5006  H  HG21 . VAL A 1 26 ? -20.364 -1.249  -4.883  1.00 0.00 ? 26  VAL A HG21 5  
ATOM   5007  H  HG22 . VAL A 1 26 ? -21.611 -1.196  -3.637  1.00 0.00 ? 26  VAL A HG22 5  
ATOM   5008  H  HG23 . VAL A 1 26 ? -20.799 0.288   -4.136  1.00 0.00 ? 26  VAL A HG23 5  
ATOM   5009  N  N    . GLY A 1 27 ? -17.758 -0.569  -5.756  1.00 0.00 ? 27  GLY A N    5  
ATOM   5010  C  CA   . GLY A 1 27 ? -17.316 0.425   -6.717  1.00 0.00 ? 27  GLY A CA   5  
ATOM   5011  C  C    . GLY A 1 27 ? -15.815 0.399   -6.929  1.00 0.00 ? 27  GLY A C    5  
ATOM   5012  O  O    . GLY A 1 27 ? -15.198 -0.666  -6.916  1.00 0.00 ? 27  GLY A O    5  
ATOM   5013  H  H    . GLY A 1 27 ? -18.033 -1.457  -6.065  1.00 0.00 ? 27  GLY A H    5  
ATOM   5014  H  HA2  . GLY A 1 27 ? -17.806 0.241   -7.661  1.00 0.00 ? 27  GLY A HA2  5  
ATOM   5015  H  HA3  . GLY A 1 27 ? -17.600 1.405   -6.361  1.00 0.00 ? 27  GLY A HA3  5  
ATOM   5016  N  N    . VAL A 1 28 ? -15.226 1.574   -7.126  1.00 0.00 ? 28  VAL A N    5  
ATOM   5017  C  CA   . VAL A 1 28 ? -13.788 1.681   -7.343  1.00 0.00 ? 28  VAL A CA   5  
ATOM   5018  C  C    . VAL A 1 28 ? -13.010 1.124   -6.156  1.00 0.00 ? 28  VAL A C    5  
ATOM   5019  O  O    . VAL A 1 28 ? -13.434 1.251   -5.007  1.00 0.00 ? 28  VAL A O    5  
ATOM   5020  C  CB   . VAL A 1 28 ? -13.364 3.143   -7.580  1.00 0.00 ? 28  VAL A CB   5  
ATOM   5021  C  CG1  . VAL A 1 28 ? -13.861 4.033   -6.451  1.00 0.00 ? 28  VAL A CG1  5  
ATOM   5022  C  CG2  . VAL A 1 28 ? -11.853 3.242   -7.723  1.00 0.00 ? 28  VAL A CG2  5  
ATOM   5023  H  H    . VAL A 1 28 ? -15.771 2.388   -7.125  1.00 0.00 ? 28  VAL A H    5  
ATOM   5024  H  HA   . VAL A 1 28 ? -13.540 1.108   -8.225  1.00 0.00 ? 28  VAL A HA   5  
ATOM   5025  H  HB   . VAL A 1 28 ? -13.814 3.482   -8.501  1.00 0.00 ? 28  VAL A HB   5  
ATOM   5026  H  HG11 . VAL A 1 28 ? -14.176 4.984   -6.856  1.00 0.00 ? 28  VAL A HG11 5  
ATOM   5027  H  HG12 . VAL A 1 28 ? -14.694 3.556   -5.957  1.00 0.00 ? 28  VAL A HG12 5  
ATOM   5028  H  HG13 . VAL A 1 28 ? -13.063 4.192   -5.741  1.00 0.00 ? 28  VAL A HG13 5  
ATOM   5029  H  HG21 . VAL A 1 28 ? -11.608 4.037   -8.411  1.00 0.00 ? 28  VAL A HG21 5  
ATOM   5030  H  HG22 . VAL A 1 28 ? -11.413 3.452   -6.759  1.00 0.00 ? 28  VAL A HG22 5  
ATOM   5031  H  HG23 . VAL A 1 28 ? -11.464 2.307   -8.099  1.00 0.00 ? 28  VAL A HG23 5  
ATOM   5032  N  N    . PHE A 1 29 ? -11.869 0.506   -6.441  1.00 0.00 ? 29  PHE A N    5  
ATOM   5033  C  CA   . PHE A 1 29 ? -11.031 -0.072  -5.397  1.00 0.00 ? 29  PHE A CA   5  
ATOM   5034  C  C    . PHE A 1 29 ? -9.647  -0.418  -5.940  1.00 0.00 ? 29  PHE A C    5  
ATOM   5035  O  O    . PHE A 1 29 ? -9.415  -0.381  -7.148  1.00 0.00 ? 29  PHE A O    5  
ATOM   5036  C  CB   . PHE A 1 29 ? -11.692 -1.324  -4.817  1.00 0.00 ? 29  PHE A CB   5  
ATOM   5037  C  CG   . PHE A 1 29 ? -11.982 -2.379  -5.846  1.00 0.00 ? 29  PHE A CG   5  
ATOM   5038  C  CD1  . PHE A 1 29 ? -10.951 -3.076  -6.454  1.00 0.00 ? 29  PHE A CD1  5  
ATOM   5039  C  CD2  . PHE A 1 29 ? -13.288 -2.674  -6.205  1.00 0.00 ? 29  PHE A CD2  5  
ATOM   5040  C  CE1  . PHE A 1 29 ? -11.215 -4.048  -7.400  1.00 0.00 ? 29  PHE A CE1  5  
ATOM   5041  C  CE2  . PHE A 1 29 ? -13.558 -3.645  -7.151  1.00 0.00 ? 29  PHE A CE2  5  
ATOM   5042  C  CZ   . PHE A 1 29 ? -12.520 -4.332  -7.750  1.00 0.00 ? 29  PHE A CZ   5  
ATOM   5043  H  H    . PHE A 1 29 ? -11.583 0.437   -7.377  1.00 0.00 ? 29  PHE A H    5  
ATOM   5044  H  HA   . PHE A 1 29 ? -10.923 0.664   -4.615  1.00 0.00 ? 29  PHE A HA   5  
ATOM   5045  H  HB2  . PHE A 1 29 ? -11.038 -1.756  -4.075  1.00 0.00 ? 29  PHE A HB2  5  
ATOM   5046  H  HB3  . PHE A 1 29 ? -12.625 -1.046  -4.352  1.00 0.00 ? 29  PHE A HB3  5  
ATOM   5047  H  HD1  . PHE A 1 29 ? -9.928  -2.854  -6.181  1.00 0.00 ? 29  PHE A HD1  5  
ATOM   5048  H  HD2  . PHE A 1 29 ? -14.100 -2.137  -5.739  1.00 0.00 ? 29  PHE A HD2  5  
ATOM   5049  H  HE1  . PHE A 1 29 ? -10.400 -4.583  -7.866  1.00 0.00 ? 29  PHE A HE1  5  
ATOM   5050  H  HE2  . PHE A 1 29 ? -14.579 -3.865  -7.423  1.00 0.00 ? 29  PHE A HE2  5  
ATOM   5051  H  HZ   . PHE A 1 29 ? -12.729 -5.091  -8.489  1.00 0.00 ? 29  PHE A HZ   5  
ATOM   5052  N  N    . VAL A 1 30 ? -8.731  -0.755  -5.037  1.00 0.00 ? 30  VAL A N    5  
ATOM   5053  C  CA   . VAL A 1 30 ? -7.371  -1.108  -5.424  1.00 0.00 ? 30  VAL A CA   5  
ATOM   5054  C  C    . VAL A 1 30 ? -7.189  -2.621  -5.471  1.00 0.00 ? 30  VAL A C    5  
ATOM   5055  O  O    . VAL A 1 30 ? -7.041  -3.273  -4.437  1.00 0.00 ? 30  VAL A O    5  
ATOM   5056  C  CB   . VAL A 1 30 ? -6.337  -0.508  -4.452  1.00 0.00 ? 30  VAL A CB   5  
ATOM   5057  C  CG1  . VAL A 1 30 ? -4.938  -1.002  -4.789  1.00 0.00 ? 30  VAL A CG1  5  
ATOM   5058  C  CG2  . VAL A 1 30 ? -6.397  1.012   -4.484  1.00 0.00 ? 30  VAL A CG2  5  
ATOM   5059  H  H    . VAL A 1 30 ? -8.977  -0.766  -4.088  1.00 0.00 ? 30  VAL A H    5  
ATOM   5060  H  HA   . VAL A 1 30 ? -7.187  -0.702  -6.408  1.00 0.00 ? 30  VAL A HA   5  
ATOM   5061  H  HB   . VAL A 1 30 ? -6.580  -0.836  -3.452  1.00 0.00 ? 30  VAL A HB   5  
ATOM   5062  H  HG11 . VAL A 1 30 ? -4.574  -1.624  -3.985  1.00 0.00 ? 30  VAL A HG11 5  
ATOM   5063  H  HG12 . VAL A 1 30 ? -4.969  -1.575  -5.704  1.00 0.00 ? 30  VAL A HG12 5  
ATOM   5064  H  HG13 . VAL A 1 30 ? -4.279  -0.156  -4.915  1.00 0.00 ? 30  VAL A HG13 5  
ATOM   5065  H  HG21 . VAL A 1 30 ? -5.847  1.410   -3.645  1.00 0.00 ? 30  VAL A HG21 5  
ATOM   5066  H  HG22 . VAL A 1 30 ? -5.959  1.371   -5.404  1.00 0.00 ? 30  VAL A HG22 5  
ATOM   5067  H  HG23 . VAL A 1 30 ? -7.426  1.333   -4.426  1.00 0.00 ? 30  VAL A HG23 5  
ATOM   5068  N  N    . LYS A 1 31 ? -7.200  -3.176  -6.678  1.00 0.00 ? 31  LYS A N    5  
ATOM   5069  C  CA   . LYS A 1 31 ? -7.034  -4.612  -6.863  1.00 0.00 ? 31  LYS A CA   5  
ATOM   5070  C  C    . LYS A 1 31 ? -5.567  -5.012  -6.735  1.00 0.00 ? 31  LYS A C    5  
ATOM   5071  O  O    . LYS A 1 31 ? -4.770  -4.786  -7.646  1.00 0.00 ? 31  LYS A O    5  
ATOM   5072  C  CB   . LYS A 1 31 ? -7.572  -5.037  -8.231  1.00 0.00 ? 31  LYS A CB   5  
ATOM   5073  C  CG   . LYS A 1 31 ? -7.836  -6.529  -8.345  1.00 0.00 ? 31  LYS A CG   5  
ATOM   5074  C  CD   . LYS A 1 31 ? -6.573  -7.292  -8.706  1.00 0.00 ? 31  LYS A CD   5  
ATOM   5075  C  CE   . LYS A 1 31 ? -6.690  -8.765  -8.346  1.00 0.00 ? 31  LYS A CE   5  
ATOM   5076  N  NZ   . LYS A 1 31 ? -7.353  -9.549  -9.424  1.00 0.00 ? 31  LYS A NZ   5  
ATOM   5077  H  H    . LYS A 1 31 ? -7.321  -2.604  -7.466  1.00 0.00 ? 31  LYS A H    5  
ATOM   5078  H  HA   . LYS A 1 31 ? -7.600  -5.113  -6.092  1.00 0.00 ? 31  LYS A HA   5  
ATOM   5079  H  HB2  . LYS A 1 31 ? -8.497  -4.513  -8.419  1.00 0.00 ? 31  LYS A HB2  5  
ATOM   5080  H  HB3  . LYS A 1 31 ? -6.852  -4.762  -8.989  1.00 0.00 ? 31  LYS A HB3  5  
ATOM   5081  H  HG2  . LYS A 1 31 ? -8.205  -6.893  -7.398  1.00 0.00 ? 31  LYS A HG2  5  
ATOM   5082  H  HG3  . LYS A 1 31 ? -8.579  -6.696  -9.112  1.00 0.00 ? 31  LYS A HG3  5  
ATOM   5083  H  HD2  . LYS A 1 31 ? -6.401  -7.206  -9.769  1.00 0.00 ? 31  LYS A HD2  5  
ATOM   5084  H  HD3  . LYS A 1 31 ? -5.738  -6.865  -8.169  1.00 0.00 ? 31  LYS A HD3  5  
ATOM   5085  H  HE2  . LYS A 1 31 ? -5.700  -9.162  -8.181  1.00 0.00 ? 31  LYS A HE2  5  
ATOM   5086  H  HE3  . LYS A 1 31 ? -7.270  -8.855  -7.439  1.00 0.00 ? 31  LYS A HE3  5  
ATOM   5087  H  HZ1  . LYS A 1 31 ? -8.204  -9.051  -9.757  1.00 0.00 ? 31  LYS A HZ1  5  
ATOM   5088  H  HZ2  . LYS A 1 31 ? -7.631  -10.485 -9.067  1.00 0.00 ? 31  LYS A HZ2  5  
ATOM   5089  H  HZ3  . LYS A 1 31 ? -6.703  -9.676  -10.226 1.00 0.00 ? 31  LYS A HZ3  5  
ATOM   5090  N  N    . LEU A 1 32 ? -5.218  -5.608  -5.600  1.00 0.00 ? 32  LEU A N    5  
ATOM   5091  C  CA   . LEU A 1 32 ? -3.847  -6.041  -5.354  1.00 0.00 ? 32  LEU A CA   5  
ATOM   5092  C  C    . LEU A 1 32 ? -3.578  -7.394  -6.005  1.00 0.00 ? 32  LEU A C    5  
ATOM   5093  O  O    . LEU A 1 32 ? -4.507  -8.121  -6.356  1.00 0.00 ? 32  LEU A O    5  
ATOM   5094  C  CB   . LEU A 1 32 ? -3.580  -6.123  -3.850  1.00 0.00 ? 32  LEU A CB   5  
ATOM   5095  C  CG   . LEU A 1 32 ? -3.288  -4.798  -3.147  1.00 0.00 ? 32  LEU A CG   5  
ATOM   5096  C  CD1  . LEU A 1 32 ? -2.064  -4.130  -3.753  1.00 0.00 ? 32  LEU A CD1  5  
ATOM   5097  C  CD2  . LEU A 1 32 ? -4.495  -3.875  -3.225  1.00 0.00 ? 32  LEU A CD2  5  
ATOM   5098  H  H    . LEU A 1 32 ? -5.898  -5.761  -4.911  1.00 0.00 ? 32  LEU A H    5  
ATOM   5099  H  HA   . LEU A 1 32 ? -3.185  -5.307  -5.789  1.00 0.00 ? 32  LEU A HA   5  
ATOM   5100  H  HB2  . LEU A 1 32 ? -4.449  -6.560  -3.383  1.00 0.00 ? 32  LEU A HB2  5  
ATOM   5101  H  HB3  . LEU A 1 32 ? -2.729  -6.773  -3.701  1.00 0.00 ? 32  LEU A HB3  5  
ATOM   5102  H  HG   . LEU A 1 32 ? -3.079  -4.989  -2.103  1.00 0.00 ? 32  LEU A HG   5  
ATOM   5103  H  HD11 . LEU A 1 32 ? -1.755  -4.675  -4.633  1.00 0.00 ? 32  LEU A HD11 5  
ATOM   5104  H  HD12 . LEU A 1 32 ? -1.260  -4.126  -3.032  1.00 0.00 ? 32  LEU A HD12 5  
ATOM   5105  H  HD13 . LEU A 1 32 ? -2.306  -3.113  -4.026  1.00 0.00 ? 32  LEU A HD13 5  
ATOM   5106  H  HD21 . LEU A 1 32 ? -4.316  -2.997  -2.621  1.00 0.00 ? 32  LEU A HD21 5  
ATOM   5107  H  HD22 . LEU A 1 32 ? -5.369  -4.393  -2.857  1.00 0.00 ? 32  LEU A HD22 5  
ATOM   5108  H  HD23 . LEU A 1 32 ? -4.656  -3.579  -4.251  1.00 0.00 ? 32  LEU A HD23 5  
ATOM   5109  N  N    . ARG A 1 33 ? -2.301  -7.726  -6.161  1.00 0.00 ? 33  ARG A N    5  
ATOM   5110  C  CA   . ARG A 1 33 ? -1.909  -8.992  -6.768  1.00 0.00 ? 33  ARG A CA   5  
ATOM   5111  C  C    . ARG A 1 33 ? -2.922  -10.087 -6.444  1.00 0.00 ? 33  ARG A C    5  
ATOM   5112  O  O    . ARG A 1 33 ? -3.711  -10.489 -7.299  1.00 0.00 ? 33  ARG A O    5  
ATOM   5113  C  CB   . ARG A 1 33 ? -0.520  -9.408  -6.281  1.00 0.00 ? 33  ARG A CB   5  
ATOM   5114  C  CG   . ARG A 1 33 ? 0.614   -8.657  -6.961  1.00 0.00 ? 33  ARG A CG   5  
ATOM   5115  C  CD   . ARG A 1 33 ? 1.972   -9.147  -6.483  1.00 0.00 ? 33  ARG A CD   5  
ATOM   5116  N  NE   . ARG A 1 33 ? 3.014   -8.934  -7.484  1.00 0.00 ? 33  ARG A NE   5  
ATOM   5117  C  CZ   . ARG A 1 33 ? 3.854   -7.905  -7.464  1.00 0.00 ? 33  ARG A CZ   5  
ATOM   5118  N  NH1  . ARG A 1 33 ? 3.775   -7.000  -6.498  1.00 0.00 ? 33  ARG A NH1  5  
ATOM   5119  N  NH2  . ARG A 1 33 ? 4.775   -7.781  -8.410  1.00 0.00 ? 33  ARG A NH2  5  
ATOM   5120  H  H    . ARG A 1 33 ? -1.605  -7.105  -5.861  1.00 0.00 ? 33  ARG A H    5  
ATOM   5121  H  HA   . ARG A 1 33 ? -1.879  -8.852  -7.838  1.00 0.00 ? 33  ARG A HA   5  
ATOM   5122  H  HB2  . ARG A 1 33 ? -0.454  -9.228  -5.218  1.00 0.00 ? 33  ARG A HB2  5  
ATOM   5123  H  HB3  . ARG A 1 33 ? -0.387  -10.463 -6.468  1.00 0.00 ? 33  ARG A HB3  5  
ATOM   5124  H  HG2  . ARG A 1 33 ? 0.544   -8.809  -8.028  1.00 0.00 ? 33  ARG A HG2  5  
ATOM   5125  H  HG3  . ARG A 1 33 ? 0.521   -7.605  -6.738  1.00 0.00 ? 33  ARG A HG3  5  
ATOM   5126  H  HD2  . ARG A 1 33 ? 2.236   -8.611  -5.583  1.00 0.00 ? 33  ARG A HD2  5  
ATOM   5127  H  HD3  . ARG A 1 33 ? 1.903   -10.202 -6.267  1.00 0.00 ? 33  ARG A HD3  5  
ATOM   5128  H  HE   . ARG A 1 33 ? 3.090   -9.591  -8.207  1.00 0.00 ? 33  ARG A HE   5  
ATOM   5129  H  HH11 . ARG A 1 33 ? 3.082   -7.092  -5.783  1.00 0.00 ? 33  ARG A HH11 5  
ATOM   5130  H  HH12 . ARG A 1 33 ? 4.409   -6.227  -6.485  1.00 0.00 ? 33  ARG A HH12 5  
ATOM   5131  H  HH21 . ARG A 1 33 ? 4.838   -8.461  -9.139  1.00 0.00 ? 33  ARG A HH21 5  
ATOM   5132  H  HH22 . ARG A 1 33 ? 5.407   -7.006  -8.394  1.00 0.00 ? 33  ARG A HH22 5  
ATOM   5133  N  N    . ASP A 1 34 ? -2.893  -10.564 -5.205  1.00 0.00 ? 34  ASP A N    5  
ATOM   5134  C  CA   . ASP A 1 34 ? -3.808  -11.612 -4.768  1.00 0.00 ? 34  ASP A CA   5  
ATOM   5135  C  C    . ASP A 1 34 ? -4.704  -11.114 -3.638  1.00 0.00 ? 34  ASP A C    5  
ATOM   5136  O  O    . ASP A 1 34 ? -5.389  -11.900 -2.984  1.00 0.00 ? 34  ASP A O    5  
ATOM   5137  C  CB   . ASP A 1 34 ? -3.026  -12.844 -4.309  1.00 0.00 ? 34  ASP A CB   5  
ATOM   5138  C  CG   . ASP A 1 34 ? -1.872  -13.174 -5.235  1.00 0.00 ? 34  ASP A CG   5  
ATOM   5139  O  OD1  . ASP A 1 34 ? -2.116  -13.355 -6.446  1.00 0.00 ? 34  ASP A OD1  5  
ATOM   5140  O  OD2  . ASP A 1 34 ? -0.724  -13.254 -4.749  1.00 0.00 ? 34  ASP A OD2  5  
ATOM   5141  H  H    . ASP A 1 34 ? -2.240  -10.203 -4.569  1.00 0.00 ? 34  ASP A H    5  
ATOM   5142  H  HA   . ASP A 1 34 ? -4.428  -11.883 -5.609  1.00 0.00 ? 34  ASP A HA   5  
ATOM   5143  H  HB2  . ASP A 1 34 ? -2.629  -12.663 -3.321  1.00 0.00 ? 34  ASP A HB2  5  
ATOM   5144  H  HB3  . ASP A 1 34 ? -3.692  -13.693 -4.276  1.00 0.00 ? 34  ASP A HB3  5  
ATOM   5145  N  N    . ARG A 1 35 ? -4.693  -9.804  -3.415  1.00 0.00 ? 35  ARG A N    5  
ATOM   5146  C  CA   . ARG A 1 35 ? -5.503  -9.201  -2.363  1.00 0.00 ? 35  ARG A CA   5  
ATOM   5147  C  C    . ARG A 1 35 ? -6.330  -8.041  -2.911  1.00 0.00 ? 35  ARG A C    5  
ATOM   5148  O  O    . ARG A 1 35 ? -6.192  -7.661  -4.074  1.00 0.00 ? 35  ARG A O    5  
ATOM   5149  C  CB   . ARG A 1 35 ? -4.611  -8.710  -1.221  1.00 0.00 ? 35  ARG A CB   5  
ATOM   5150  C  CG   . ARG A 1 35 ? -4.052  -9.831  -0.361  1.00 0.00 ? 35  ARG A CG   5  
ATOM   5151  C  CD   . ARG A 1 35 ? -5.136  -10.475 0.489   1.00 0.00 ? 35  ARG A CD   5  
ATOM   5152  N  NE   . ARG A 1 35 ? -4.662  -11.684 1.157   1.00 0.00 ? 35  ARG A NE   5  
ATOM   5153  C  CZ   . ARG A 1 35 ? -5.459  -12.681 1.526   1.00 0.00 ? 35  ARG A CZ   5  
ATOM   5154  N  NH1  . ARG A 1 35 ? -6.763  -12.613 1.293   1.00 0.00 ? 35  ARG A NH1  5  
ATOM   5155  N  NH2  . ARG A 1 35 ? -4.953  -13.749 2.130   1.00 0.00 ? 35  ARG A NH2  5  
ATOM   5156  H  H    . ARG A 1 35 ? -4.126  -9.229  -3.970  1.00 0.00 ? 35  ARG A H    5  
ATOM   5157  H  HA   . ARG A 1 35 ? -6.173  -9.958  -1.985  1.00 0.00 ? 35  ARG A HA   5  
ATOM   5158  H  HB2  . ARG A 1 35 ? -3.781  -8.159  -1.639  1.00 0.00 ? 35  ARG A HB2  5  
ATOM   5159  H  HB3  . ARG A 1 35 ? -5.187  -8.053  -0.588  1.00 0.00 ? 35  ARG A HB3  5  
ATOM   5160  H  HG2  . ARG A 1 35 ? -3.619  -10.584 -1.003  1.00 0.00 ? 35  ARG A HG2  5  
ATOM   5161  H  HG3  . ARG A 1 35 ? -3.289  -9.428  0.288   1.00 0.00 ? 35  ARG A HG3  5  
ATOM   5162  H  HD2  . ARG A 1 35 ? -5.458  -9.765  1.237   1.00 0.00 ? 35  ARG A HD2  5  
ATOM   5163  H  HD3  . ARG A 1 35 ? -5.970  -10.730 -0.147  1.00 0.00 ? 35  ARG A HD3  5  
ATOM   5164  H  HE   . ARG A 1 35 ? -3.702  -11.755 1.340   1.00 0.00 ? 35  ARG A HE   5  
ATOM   5165  H  HH11 . ARG A 1 35 ? -7.147  -11.810 0.837   1.00 0.00 ? 35  ARG A HH11 5  
ATOM   5166  H  HH12 . ARG A 1 35 ? -7.361  -13.365 1.570   1.00 0.00 ? 35  ARG A HH12 5  
ATOM   5167  H  HH21 . ARG A 1 35 ? -3.971  -13.804 2.307   1.00 0.00 ? 35  ARG A HH21 5  
ATOM   5168  H  HH22 . ARG A 1 35 ? -5.554  -14.498 2.407   1.00 0.00 ? 35  ARG A HH22 5  
ATOM   5169  N  N    . HIS A 1 36 ? -7.191  -7.484  -2.065  1.00 0.00 ? 36  HIS A N    5  
ATOM   5170  C  CA   . HIS A 1 36 ? -8.041  -6.368  -2.464  1.00 0.00 ? 36  HIS A CA   5  
ATOM   5171  C  C    . HIS A 1 36 ? -8.213  -5.379  -1.316  1.00 0.00 ? 36  HIS A C    5  
ATOM   5172  O  O    . HIS A 1 36 ? -8.440  -5.774  -0.172  1.00 0.00 ? 36  HIS A O    5  
ATOM   5173  C  CB   . HIS A 1 36 ? -9.407  -6.878  -2.923  1.00 0.00 ? 36  HIS A CB   5  
ATOM   5174  C  CG   . HIS A 1 36 ? -9.344  -7.736  -4.149  1.00 0.00 ? 36  HIS A CG   5  
ATOM   5175  N  ND1  . HIS A 1 36 ? -9.203  -9.107  -4.101  1.00 0.00 ? 36  HIS A ND1  5  
ATOM   5176  C  CD2  . HIS A 1 36 ? -9.407  -7.412  -5.462  1.00 0.00 ? 36  HIS A CD2  5  
ATOM   5177  C  CE1  . HIS A 1 36 ? -9.180  -9.588  -5.331  1.00 0.00 ? 36  HIS A CE1  5  
ATOM   5178  N  NE2  . HIS A 1 36 ? -9.302  -8.580  -6.176  1.00 0.00 ? 36  HIS A NE2  5  
ATOM   5179  H  H    . HIS A 1 36 ? -7.255  -7.831  -1.151  1.00 0.00 ? 36  HIS A H    5  
ATOM   5180  H  HA   . HIS A 1 36 ? -7.559  -5.863  -3.288  1.00 0.00 ? 36  HIS A HA   5  
ATOM   5181  H  HB2  . HIS A 1 36 ? -9.850  -7.463  -2.131  1.00 0.00 ? 36  HIS A HB2  5  
ATOM   5182  H  HB3  . HIS A 1 36 ? -10.045 -6.033  -3.141  1.00 0.00 ? 36  HIS A HB3  5  
ATOM   5183  H  HD1  . HIS A 1 36 ? -9.130  -9.647  -3.287  1.00 0.00 ? 36  HIS A HD1  5  
ATOM   5184  H  HD2  . HIS A 1 36 ? -9.518  -6.418  -5.872  1.00 0.00 ? 36  HIS A HD2  5  
ATOM   5185  H  HE1  . HIS A 1 36 ? -9.079  -10.629 -5.602  1.00 0.00 ? 36  HIS A HE1  5  
ATOM   5186  H  HE2  . HIS A 1 36 ? -9.229  -8.648  -7.150  1.00 0.00 ? 36  HIS A HE2  5  
ATOM   5187  N  N    . ARG A 1 37 ? -8.105  -4.091  -1.628  1.00 0.00 ? 37  ARG A N    5  
ATOM   5188  C  CA   . ARG A 1 37 ? -8.247  -3.046  -0.621  1.00 0.00 ? 37  ARG A CA   5  
ATOM   5189  C  C    . ARG A 1 37 ? -8.996  -1.844  -1.188  1.00 0.00 ? 37  ARG A C    5  
ATOM   5190  O  O    . ARG A 1 37 ? -9.229  -1.756  -2.394  1.00 0.00 ? 37  ARG A O    5  
ATOM   5191  C  CB   . ARG A 1 37 ? -6.873  -2.610  -0.111  1.00 0.00 ? 37  ARG A CB   5  
ATOM   5192  C  CG   . ARG A 1 37 ? -6.280  -3.552  0.924   1.00 0.00 ? 37  ARG A CG   5  
ATOM   5193  C  CD   . ARG A 1 37 ? -5.315  -2.827  1.850   1.00 0.00 ? 37  ARG A CD   5  
ATOM   5194  N  NE   . ARG A 1 37 ? -4.620  -3.748  2.745   1.00 0.00 ? 37  ARG A NE   5  
ATOM   5195  C  CZ   . ARG A 1 37 ? -3.991  -3.364  3.850   1.00 0.00 ? 37  ARG A CZ   5  
ATOM   5196  N  NH1  . ARG A 1 37 ? -3.970  -2.083  4.194   1.00 0.00 ? 37  ARG A NH1  5  
ATOM   5197  N  NH2  . ARG A 1 37 ? -3.380  -4.261  4.614   1.00 0.00 ? 37  ARG A NH2  5  
ATOM   5198  H  H    . ARG A 1 37 ? -7.924  -3.838  -2.557  1.00 0.00 ? 37  ARG A H    5  
ATOM   5199  H  HA   . ARG A 1 37 ? -8.814  -3.454  0.202   1.00 0.00 ? 37  ARG A HA   5  
ATOM   5200  H  HB2  . ARG A 1 37 ? -6.191  -2.555  -0.947  1.00 0.00 ? 37  ARG A HB2  5  
ATOM   5201  H  HB3  . ARG A 1 37 ? -6.962  -1.631  0.335   1.00 0.00 ? 37  ARG A HB3  5  
ATOM   5202  H  HG2  . ARG A 1 37 ? -7.080  -3.972  1.515   1.00 0.00 ? 37  ARG A HG2  5  
ATOM   5203  H  HG3  . ARG A 1 37 ? -5.751  -4.344  0.415   1.00 0.00 ? 37  ARG A HG3  5  
ATOM   5204  H  HD2  . ARG A 1 37 ? -4.586  -2.304  1.249   1.00 0.00 ? 37  ARG A HD2  5  
ATOM   5205  H  HD3  . ARG A 1 37 ? -5.871  -2.115  2.441   1.00 0.00 ? 37  ARG A HD3  5  
ATOM   5206  H  HE   . ARG A 1 37 ? -4.622  -4.699  2.510   1.00 0.00 ? 37  ARG A HE   5  
ATOM   5207  H  HH11 . ARG A 1 37 ? -4.430  -1.405  3.621   1.00 0.00 ? 37  ARG A HH11 5  
ATOM   5208  H  HH12 . ARG A 1 37 ? -3.497  -1.797  5.028   1.00 0.00 ? 37  ARG A HH12 5  
ATOM   5209  H  HH21 . ARG A 1 37 ? -3.394  -5.227  4.358   1.00 0.00 ? 37  ARG A HH21 5  
ATOM   5210  H  HH22 . ARG A 1 37 ? -2.907  -3.971  5.445   1.00 0.00 ? 37  ARG A HH22 5  
ATOM   5211  N  N    . HIS A 1 38 ? -9.372  -0.919  -0.310  1.00 0.00 ? 38  HIS A N    5  
ATOM   5212  C  CA   . HIS A 1 38 ? -10.095 0.278   -0.723  1.00 0.00 ? 38  HIS A CA   5  
ATOM   5213  C  C    . HIS A 1 38 ? -9.150  1.289   -1.365  1.00 0.00 ? 38  HIS A C    5  
ATOM   5214  O  O    . HIS A 1 38 ? -7.931  1.224   -1.206  1.00 0.00 ? 38  HIS A O    5  
ATOM   5215  C  CB   . HIS A 1 38 ? -10.801 0.912   0.476   1.00 0.00 ? 38  HIS A CB   5  
ATOM   5216  C  CG   . HIS A 1 38 ? -12.134 0.301   0.778   1.00 0.00 ? 38  HIS A CG   5  
ATOM   5217  N  ND1  . HIS A 1 38 ? -12.428 -0.308  1.980   1.00 0.00 ? 38  HIS A ND1  5  
ATOM   5218  C  CD2  . HIS A 1 38 ? -13.256 0.208   0.027   1.00 0.00 ? 38  HIS A CD2  5  
ATOM   5219  C  CE1  . HIS A 1 38 ? -13.673 -0.750  1.955   1.00 0.00 ? 38  HIS A CE1  5  
ATOM   5220  N  NE2  . HIS A 1 38 ? -14.198 -0.449  0.780   1.00 0.00 ? 38  HIS A NE2  5  
ATOM   5221  H  H    . HIS A 1 38 ? -9.157  -1.046  0.638   1.00 0.00 ? 38  HIS A H    5  
ATOM   5222  H  HA   . HIS A 1 38 ? -10.836 -0.016  -1.451  1.00 0.00 ? 38  HIS A HA   5  
ATOM   5223  H  HB2  . HIS A 1 38 ? -10.179 0.800   1.352   1.00 0.00 ? 38  HIS A HB2  5  
ATOM   5224  H  HB3  . HIS A 1 38 ? -10.954 1.964   0.281   1.00 0.00 ? 38  HIS A HB3  5  
ATOM   5225  H  HD2  . HIS A 1 38 ? -13.388 0.581   -0.979  1.00 0.00 ? 38  HIS A HD2  5  
ATOM   5226  H  HE1  . HIS A 1 38 ? -14.176 -1.269  2.756   1.00 0.00 ? 38  HIS A HE1  5  
ATOM   5227  H  HE2  . HIS A 1 38 ? -15.080 -0.737  0.466   1.00 0.00 ? 38  HIS A HE2  5  
ATOM   5228  N  N    . PRO A 1 39 ? -9.723  2.247   -2.108  1.00 0.00 ? 39  PRO A N    5  
ATOM   5229  C  CA   . PRO A 1 39 ? -8.950  3.290   -2.789  1.00 0.00 ? 39  PRO A CA   5  
ATOM   5230  C  C    . PRO A 1 39 ? -8.330  4.283   -1.812  1.00 0.00 ? 39  PRO A C    5  
ATOM   5231  O  O    . PRO A 1 39 ? -7.523  5.127   -2.200  1.00 0.00 ? 39  PRO A O    5  
ATOM   5232  C  CB   . PRO A 1 39 ? -9.991  3.985   -3.670  1.00 0.00 ? 39  PRO A CB   5  
ATOM   5233  C  CG   . PRO A 1 39 ? -11.291 3.739   -2.986  1.00 0.00 ? 39  PRO A CG   5  
ATOM   5234  C  CD   . PRO A 1 39 ? -11.171 2.386   -2.341  1.00 0.00 ? 39  PRO A CD   5  
ATOM   5235  H  HA   . PRO A 1 39 ? -8.175  2.867   -3.411  1.00 0.00 ? 39  PRO A HA   5  
ATOM   5236  H  HB2  . PRO A 1 39 ? -9.769  5.041   -3.729  1.00 0.00 ? 39  PRO A HB2  5  
ATOM   5237  H  HB3  . PRO A 1 39 ? -9.978  3.553   -4.659  1.00 0.00 ? 39  PRO A HB3  5  
ATOM   5238  H  HG2  . PRO A 1 39 ? -11.462 4.497   -2.237  1.00 0.00 ? 39  PRO A HG2  5  
ATOM   5239  H  HG3  . PRO A 1 39 ? -12.093 3.739   -3.710  1.00 0.00 ? 39  PRO A HG3  5  
ATOM   5240  H  HD2  . PRO A 1 39 ? -11.715 2.362   -1.409  1.00 0.00 ? 39  PRO A HD2  5  
ATOM   5241  H  HD3  . PRO A 1 39 ? -11.529 1.616   -3.009  1.00 0.00 ? 39  PRO A HD3  5  
ATOM   5242  N  N    . GLU A 1 40 ? -8.712  4.175   -0.544  1.00 0.00 ? 40  GLU A N    5  
ATOM   5243  C  CA   . GLU A 1 40 ? -8.193  5.065   0.488   1.00 0.00 ? 40  GLU A CA   5  
ATOM   5244  C  C    . GLU A 1 40 ? -7.371  4.289   1.513   1.00 0.00 ? 40  GLU A C    5  
ATOM   5245  O  O    . GLU A 1 40 ? -6.456  4.833   2.132   1.00 0.00 ? 40  GLU A O    5  
ATOM   5246  C  CB   . GLU A 1 40 ? -9.341  5.797   1.187   1.00 0.00 ? 40  GLU A CB   5  
ATOM   5247  C  CG   . GLU A 1 40 ? -10.234 4.882   2.009   1.00 0.00 ? 40  GLU A CG   5  
ATOM   5248  C  CD   . GLU A 1 40 ? -10.970 5.621   3.110   1.00 0.00 ? 40  GLU A CD   5  
ATOM   5249  O  OE1  . GLU A 1 40 ? -11.681 6.598   2.795   1.00 0.00 ? 40  GLU A OE1  5  
ATOM   5250  O  OE2  . GLU A 1 40 ? -10.835 5.222   4.285   1.00 0.00 ? 40  GLU A OE2  5  
ATOM   5251  H  H    . GLU A 1 40 ? -9.359  3.482   -0.296  1.00 0.00 ? 40  GLU A H    5  
ATOM   5252  H  HA   . GLU A 1 40 ? -7.555  5.792   0.008   1.00 0.00 ? 40  GLU A HA   5  
ATOM   5253  H  HB2  . GLU A 1 40 ? -8.927  6.547   1.844   1.00 0.00 ? 40  GLU A HB2  5  
ATOM   5254  H  HB3  . GLU A 1 40 ? -9.950  6.283   0.440   1.00 0.00 ? 40  GLU A HB3  5  
ATOM   5255  H  HG2  . GLU A 1 40 ? -10.962 4.427   1.354   1.00 0.00 ? 40  GLU A HG2  5  
ATOM   5256  H  HG3  . GLU A 1 40 ? -9.624  4.112   2.458   1.00 0.00 ? 40  GLU A HG3  5  
ATOM   5257  N  N    . CYS A 1 41 ? -7.704  3.015   1.687   1.00 0.00 ? 41  CYS A N    5  
ATOM   5258  C  CA   . CYS A 1 41 ? -6.999  2.162   2.636   1.00 0.00 ? 41  CYS A CA   5  
ATOM   5259  C  C    . CYS A 1 41 ? -5.710  1.619   2.027   1.00 0.00 ? 41  CYS A C    5  
ATOM   5260  O  O    . CYS A 1 41 ? -4.962  0.890   2.678   1.00 0.00 ? 41  CYS A O    5  
ATOM   5261  C  CB   . CYS A 1 41 ? -7.895  1.004   3.077   1.00 0.00 ? 41  CYS A CB   5  
ATOM   5262  S  SG   . CYS A 1 41 ? -9.510  1.523   3.741   1.00 0.00 ? 41  CYS A SG   5  
ATOM   5263  H  H    . CYS A 1 41 ? -8.443  2.638   1.164   1.00 0.00 ? 41  CYS A H    5  
ATOM   5264  H  HA   . CYS A 1 41 ? -6.750  2.761   3.499   1.00 0.00 ? 41  CYS A HA   5  
ATOM   5265  H  HB2  . CYS A 1 41 ? -8.081  0.360   2.229   1.00 0.00 ? 41  CYS A HB2  5  
ATOM   5266  H  HB3  . CYS A 1 41 ? -7.389  0.439   3.846   1.00 0.00 ? 41  CYS A HB3  5  
ATOM   5267  N  N    . TYR A 1 42 ? -5.457  1.980   0.773   1.00 0.00 ? 42  TYR A N    5  
ATOM   5268  C  CA   . TYR A 1 42 ? -4.260  1.528   0.074   1.00 0.00 ? 42  TYR A CA   5  
ATOM   5269  C  C    . TYR A 1 42 ? -3.024  2.268   0.576   1.00 0.00 ? 42  TYR A C    5  
ATOM   5270  O  O    . TYR A 1 42 ? -1.939  2.147   0.006   1.00 0.00 ? 42  TYR A O    5  
ATOM   5271  C  CB   . TYR A 1 42 ? -4.416  1.735   -1.433  1.00 0.00 ? 42  TYR A CB   5  
ATOM   5272  C  CG   . TYR A 1 42 ? -3.155  1.448   -2.217  1.00 0.00 ? 42  TYR A CG   5  
ATOM   5273  C  CD1  . TYR A 1 42 ? -2.449  0.266   -2.028  1.00 0.00 ? 42  TYR A CD1  5  
ATOM   5274  C  CD2  . TYR A 1 42 ? -2.668  2.360   -3.145  1.00 0.00 ? 42  TYR A CD2  5  
ATOM   5275  C  CE1  . TYR A 1 42 ? -1.296  0.000   -2.741  1.00 0.00 ? 42  TYR A CE1  5  
ATOM   5276  C  CE2  . TYR A 1 42 ? -1.517  2.102   -3.864  1.00 0.00 ? 42  TYR A CE2  5  
ATOM   5277  C  CZ   . TYR A 1 42 ? -0.834  0.921   -3.658  1.00 0.00 ? 42  TYR A CZ   5  
ATOM   5278  O  OH   . TYR A 1 42 ? 0.313   0.661   -4.371  1.00 0.00 ? 42  TYR A OH   5  
ATOM   5279  H  H    . TYR A 1 42 ? -6.091  2.563   0.306   1.00 0.00 ? 42  TYR A H    5  
ATOM   5280  H  HA   . TYR A 1 42 ? -4.139  0.473   0.272   1.00 0.00 ? 42  TYR A HA   5  
ATOM   5281  H  HB2  . TYR A 1 42 ? -5.190  1.080   -1.801  1.00 0.00 ? 42  TYR A HB2  5  
ATOM   5282  H  HB3  . TYR A 1 42 ? -4.698  2.760   -1.622  1.00 0.00 ? 42  TYR A HB3  5  
ATOM   5283  H  HD1  . TYR A 1 42 ? -2.814  -0.453  -1.309  1.00 0.00 ? 42  TYR A HD1  5  
ATOM   5284  H  HD2  . TYR A 1 42 ? -3.204  3.284   -3.304  1.00 0.00 ? 42  TYR A HD2  5  
ATOM   5285  H  HE1  . TYR A 1 42 ? -0.762  -0.925  -2.581  1.00 0.00 ? 42  TYR A HE1  5  
ATOM   5286  H  HE2  . TYR A 1 42 ? -1.154  2.823   -4.582  1.00 0.00 ? 42  TYR A HE2  5  
ATOM   5287  H  HH   . TYR A 1 42 ? 1.049   1.137   -3.978  1.00 0.00 ? 42  TYR A HH   5  
ATOM   5288  N  N    . VAL A 1 43 ? -3.196  3.035   1.648   1.00 0.00 ? 43  VAL A N    5  
ATOM   5289  C  CA   . VAL A 1 43 ? -2.095  3.795   2.229   1.00 0.00 ? 43  VAL A CA   5  
ATOM   5290  C  C    . VAL A 1 43 ? -1.254  2.923   3.153   1.00 0.00 ? 43  VAL A C    5  
ATOM   5291  O  O    . VAL A 1 43 ? -1.730  1.916   3.680   1.00 0.00 ? 43  VAL A O    5  
ATOM   5292  C  CB   . VAL A 1 43 ? -2.609  5.014   3.018   1.00 0.00 ? 43  VAL A CB   5  
ATOM   5293  C  CG1  . VAL A 1 43 ? -3.388  5.950   2.106   1.00 0.00 ? 43  VAL A CG1  5  
ATOM   5294  C  CG2  . VAL A 1 43 ? -3.466  4.565   4.192   1.00 0.00 ? 43  VAL A CG2  5  
ATOM   5295  H  H    . VAL A 1 43 ? -4.084  3.091   2.058   1.00 0.00 ? 43  VAL A H    5  
ATOM   5296  H  HA   . VAL A 1 43 ? -1.473  4.152   1.421   1.00 0.00 ? 43  VAL A HA   5  
ATOM   5297  H  HB   . VAL A 1 43 ? -1.757  5.551   3.406   1.00 0.00 ? 43  VAL A HB   5  
ATOM   5298  H  HG11 . VAL A 1 43 ? -4.005  6.604   2.705   1.00 0.00 ? 43  VAL A HG11 5  
ATOM   5299  H  HG12 . VAL A 1 43 ? -2.697  6.541   1.522   1.00 0.00 ? 43  VAL A HG12 5  
ATOM   5300  H  HG13 . VAL A 1 43 ? -4.015  5.370   1.445   1.00 0.00 ? 43  VAL A HG13 5  
ATOM   5301  H  HG21 . VAL A 1 43 ? -4.280  5.261   4.330   1.00 0.00 ? 43  VAL A HG21 5  
ATOM   5302  H  HG22 . VAL A 1 43 ? -3.865  3.581   3.992   1.00 0.00 ? 43  VAL A HG22 5  
ATOM   5303  H  HG23 . VAL A 1 43 ? -2.863  4.533   5.087   1.00 0.00 ? 43  VAL A HG23 5  
ATOM   5304  N  N    . CYS A 1 44 ? 0.001   3.315   3.348   1.00 0.00 ? 44  CYS A N    5  
ATOM   5305  C  CA   . CYS A 1 44 ? 0.911   2.570   4.210   1.00 0.00 ? 44  CYS A CA   5  
ATOM   5306  C  C    . CYS A 1 44 ? 0.285   2.326   5.580   1.00 0.00 ? 44  CYS A C    5  
ATOM   5307  O  O    . CYS A 1 44 ? -0.604  3.062   6.009   1.00 0.00 ? 44  CYS A O    5  
ATOM   5308  C  CB   . CYS A 1 44 ? 2.232   3.326   4.367   1.00 0.00 ? 44  CYS A CB   5  
ATOM   5309  S  SG   . CYS A 1 44 ? 3.441   2.494   5.447   1.00 0.00 ? 44  CYS A SG   5  
ATOM   5310  H  H    . CYS A 1 44 ? 0.323   4.126   2.901   1.00 0.00 ? 44  CYS A H    5  
ATOM   5311  H  HA   . CYS A 1 44 ? 1.105   1.617   3.742   1.00 0.00 ? 44  CYS A HA   5  
ATOM   5312  H  HB2  . CYS A 1 44 ? 2.688   3.444   3.395   1.00 0.00 ? 44  CYS A HB2  5  
ATOM   5313  H  HB3  . CYS A 1 44 ? 2.032   4.301   4.786   1.00 0.00 ? 44  CYS A HB3  5  
ATOM   5314  N  N    . THR A 1 45 ? 0.757   1.288   6.264   1.00 0.00 ? 45  THR A N    5  
ATOM   5315  C  CA   . THR A 1 45 ? 0.244   0.946   7.584   1.00 0.00 ? 45  THR A CA   5  
ATOM   5316  C  C    . THR A 1 45 ? 1.043   1.641   8.681   1.00 0.00 ? 45  THR A C    5  
ATOM   5317  O  O    . THR A 1 45 ? 0.494   2.023   9.714   1.00 0.00 ? 45  THR A O    5  
ATOM   5318  C  CB   . THR A 1 45 ? 0.280   -0.575  7.824   1.00 0.00 ? 45  THR A CB   5  
ATOM   5319  O  OG1  . THR A 1 45 ? -0.317  -1.260  6.717   1.00 0.00 ? 45  THR A OG1  5  
ATOM   5320  C  CG2  . THR A 1 45 ? -0.454  -0.938  9.106   1.00 0.00 ? 45  THR A CG2  5  
ATOM   5321  H  H    . THR A 1 45 ? 1.466   0.739   5.868   1.00 0.00 ? 45  THR A H    5  
ATOM   5322  H  HA   . THR A 1 45 ? -0.784  1.274   7.638   1.00 0.00 ? 45  THR A HA   5  
ATOM   5323  H  HB   . THR A 1 45 ? 1.311   -0.886  7.917   1.00 0.00 ? 45  THR A HB   5  
ATOM   5324  H  HG1  . THR A 1 45 ? -0.642  -0.618  6.081   1.00 0.00 ? 45  THR A HG1  5  
ATOM   5325  H  HG21 . THR A 1 45 ? -0.256  -1.970  9.355   1.00 0.00 ? 45  THR A HG21 5  
ATOM   5326  H  HG22 . THR A 1 45 ? -1.516  -0.799  8.965   1.00 0.00 ? 45  THR A HG22 5  
ATOM   5327  H  HG23 . THR A 1 45 ? -0.112  -0.303  9.909   1.00 0.00 ? 45  THR A HG23 5  
ATOM   5328  N  N    . ASP A 1 46 ? 2.341   1.801   8.449   1.00 0.00 ? 46  ASP A N    5  
ATOM   5329  C  CA   . ASP A 1 46 ? 3.216   2.452   9.418   1.00 0.00 ? 46  ASP A CA   5  
ATOM   5330  C  C    . ASP A 1 46 ? 2.867   3.930   9.558   1.00 0.00 ? 46  ASP A C    5  
ATOM   5331  O  O    . ASP A 1 46 ? 2.412   4.375   10.612  1.00 0.00 ? 46  ASP A O    5  
ATOM   5332  C  CB   . ASP A 1 46 ? 4.679   2.298   9.000   1.00 0.00 ? 46  ASP A CB   5  
ATOM   5333  C  CG   . ASP A 1 46 ? 5.636   2.502   10.157  1.00 0.00 ? 46  ASP A CG   5  
ATOM   5334  O  OD1  . ASP A 1 46 ? 5.681   3.626   10.700  1.00 0.00 ? 46  ASP A OD1  5  
ATOM   5335  O  OD2  . ASP A 1 46 ? 6.341   1.537   10.521  1.00 0.00 ? 46  ASP A OD2  5  
ATOM   5336  H  H    . ASP A 1 46 ? 2.720   1.474   7.606   1.00 0.00 ? 46  ASP A H    5  
ATOM   5337  H  HA   . ASP A 1 46 ? 3.071   1.969   10.372  1.00 0.00 ? 46  ASP A HA   5  
ATOM   5338  H  HB2  . ASP A 1 46 ? 4.831   1.305   8.602   1.00 0.00 ? 46  ASP A HB2  5  
ATOM   5339  H  HB3  . ASP A 1 46 ? 4.907   3.026   8.235   1.00 0.00 ? 46  ASP A HB3  5  
ATOM   5340  N  N    . CYS A 1 47 ? 3.084   4.688   8.487   1.00 0.00 ? 47  CYS A N    5  
ATOM   5341  C  CA   . CYS A 1 47 ? 2.794   6.117   8.490   1.00 0.00 ? 47  CYS A CA   5  
ATOM   5342  C  C    . CYS A 1 47 ? 1.375   6.385   7.998   1.00 0.00 ? 47  CYS A C    5  
ATOM   5343  O  O    . CYS A 1 47 ? 0.548   6.937   8.723   1.00 0.00 ? 47  CYS A O    5  
ATOM   5344  C  CB   . CYS A 1 47 ? 3.800   6.864   7.612   1.00 0.00 ? 47  CYS A CB   5  
ATOM   5345  S  SG   . CYS A 1 47 ? 4.234   5.993   6.072   1.00 0.00 ? 47  CYS A SG   5  
ATOM   5346  H  H    . CYS A 1 47 ? 3.448   4.276   7.675   1.00 0.00 ? 47  CYS A H    5  
ATOM   5347  H  HA   . CYS A 1 47 ? 2.882   6.472   9.506   1.00 0.00 ? 47  CYS A HA   5  
ATOM   5348  H  HB2  . CYS A 1 47 ? 3.385   7.824   7.340   1.00 0.00 ? 47  CYS A HB2  5  
ATOM   5349  H  HB3  . CYS A 1 47 ? 4.711   7.017   8.172   1.00 0.00 ? 47  CYS A HB3  5  
ATOM   5350  N  N    . GLY A 1 48 ? 1.100   5.990   6.758   1.00 0.00 ? 48  GLY A N    5  
ATOM   5351  C  CA   . GLY A 1 48 ? -0.219  6.195   6.189   1.00 0.00 ? 48  GLY A CA   5  
ATOM   5352  C  C    . GLY A 1 48 ? -0.198  7.138   5.002   1.00 0.00 ? 48  GLY A C    5  
ATOM   5353  O  O    . GLY A 1 48 ? -0.980  8.087   4.939   1.00 0.00 ? 48  GLY A O    5  
ATOM   5354  H  H    . GLY A 1 48 ? 1.798   5.555   6.226   1.00 0.00 ? 48  GLY A H    5  
ATOM   5355  H  HA2  . GLY A 1 48 ? -0.615  5.242   5.872   1.00 0.00 ? 48  GLY A HA2  5  
ATOM   5356  H  HA3  . GLY A 1 48 ? -0.866  6.608   6.950   1.00 0.00 ? 48  GLY A HA3  5  
ATOM   5357  N  N    . THR A 1 49 ? 0.700   6.878   4.058   1.00 0.00 ? 49  THR A N    5  
ATOM   5358  C  CA   . THR A 1 49 ? 0.822   7.711   2.869   1.00 0.00 ? 49  THR A CA   5  
ATOM   5359  C  C    . THR A 1 49 ? 0.186   7.039   1.658   1.00 0.00 ? 49  THR A C    5  
ATOM   5360  O  O    . THR A 1 49 ? 0.107   5.813   1.587   1.00 0.00 ? 49  THR A O    5  
ATOM   5361  C  CB   . THR A 1 49 ? 2.297   8.025   2.551   1.00 0.00 ? 49  THR A CB   5  
ATOM   5362  O  OG1  . THR A 1 49 ? 2.376   9.026   1.530   1.00 0.00 ? 49  THR A OG1  5  
ATOM   5363  C  CG2  . THR A 1 49 ? 3.031   6.772   2.098   1.00 0.00 ? 49  THR A CG2  5  
ATOM   5364  H  H    . THR A 1 49 ? 1.296   6.107   4.165   1.00 0.00 ? 49  THR A H    5  
ATOM   5365  H  HA   . THR A 1 49 ? 0.311   8.644   3.061   1.00 0.00 ? 49  THR A HA   5  
ATOM   5366  H  HB   . THR A 1 49 ? 2.771   8.398   3.448   1.00 0.00 ? 49  THR A HB   5  
ATOM   5367  H  HG1  . THR A 1 49 ? 1.781   8.798   0.812   1.00 0.00 ? 49  THR A HG1  5  
ATOM   5368  H  HG21 . THR A 1 49 ? 3.329   6.882   1.066   1.00 0.00 ? 49  THR A HG21 5  
ATOM   5369  H  HG22 . THR A 1 49 ? 2.379   5.917   2.196   1.00 0.00 ? 49  THR A HG22 5  
ATOM   5370  H  HG23 . THR A 1 49 ? 3.908   6.628   2.712   1.00 0.00 ? 49  THR A HG23 5  
ATOM   5371  N  N    . ASN A 1 50 ? -0.266  7.849   0.706   1.00 0.00 ? 50  ASN A N    5  
ATOM   5372  C  CA   . ASN A 1 50 ? -0.896  7.331   -0.503  1.00 0.00 ? 50  ASN A CA   5  
ATOM   5373  C  C    . ASN A 1 50 ? 0.128   6.637   -1.396  1.00 0.00 ? 50  ASN A C    5  
ATOM   5374  O  O    . ASN A 1 50 ? 1.003   7.283   -1.973  1.00 0.00 ? 50  ASN A O    5  
ATOM   5375  C  CB   . ASN A 1 50 ? -1.577  8.464   -1.274  1.00 0.00 ? 50  ASN A CB   5  
ATOM   5376  C  CG   . ASN A 1 50 ? -2.869  8.913   -0.619  1.00 0.00 ? 50  ASN A CG   5  
ATOM   5377  O  OD1  . ASN A 1 50 ? -2.872  9.814   0.220   1.00 0.00 ? 50  ASN A OD1  5  
ATOM   5378  N  ND2  . ASN A 1 50 ? -3.976  8.286   -1.001  1.00 0.00 ? 50  ASN A ND2  5  
ATOM   5379  H  H    . ASN A 1 50 ? -0.175  8.818   0.819   1.00 0.00 ? 50  ASN A H    5  
ATOM   5380  H  HA   . ASN A 1 50 ? -1.643  6.610   -0.205  1.00 0.00 ? 50  ASN A HA   5  
ATOM   5381  H  HB2  . ASN A 1 50 ? -0.908  9.310   -1.323  1.00 0.00 ? 50  ASN A HB2  5  
ATOM   5382  H  HB3  . ASN A 1 50 ? -1.800  8.127   -2.275  1.00 0.00 ? 50  ASN A HB3  5  
ATOM   5383  H  HD21 . ASN A 1 50 ? -3.898  7.578   -1.674  1.00 0.00 ? 50  ASN A HD21 5  
ATOM   5384  H  HD22 . ASN A 1 50 ? -4.825  8.557   -0.594  1.00 0.00 ? 50  ASN A HD22 5  
ATOM   5385  N  N    . LEU A 1 51 ? 0.013   5.318   -1.505  1.00 0.00 ? 51  LEU A N    5  
ATOM   5386  C  CA   . LEU A 1 51 ? 0.928   4.536   -2.328  1.00 0.00 ? 51  LEU A CA   5  
ATOM   5387  C  C    . LEU A 1 51 ? 0.425   4.445   -3.766  1.00 0.00 ? 51  LEU A C    5  
ATOM   5388  O  O    . LEU A 1 51 ? 0.887   3.611   -4.545  1.00 0.00 ? 51  LEU A O    5  
ATOM   5389  C  CB   . LEU A 1 51 ? 1.097   3.132   -1.745  1.00 0.00 ? 51  LEU A CB   5  
ATOM   5390  C  CG   . LEU A 1 51 ? 1.343   3.057   -0.238  1.00 0.00 ? 51  LEU A CG   5  
ATOM   5391  C  CD1  . LEU A 1 51 ? 1.339   1.610   0.232   1.00 0.00 ? 51  LEU A CD1  5  
ATOM   5392  C  CD2  . LEU A 1 51 ? 2.658   3.732   0.122   1.00 0.00 ? 51  LEU A CD2  5  
ATOM   5393  H  H    . LEU A 1 51 ? -0.705  4.859   -1.021  1.00 0.00 ? 51  LEU A H    5  
ATOM   5394  H  HA   . LEU A 1 51 ? 1.885   5.035   -2.326  1.00 0.00 ? 51  LEU A HA   5  
ATOM   5395  H  HB2  . LEU A 1 51 ? 0.199   2.574   -1.961  1.00 0.00 ? 51  LEU A HB2  5  
ATOM   5396  H  HB3  . LEU A 1 51 ? 1.936   2.667   -2.242  1.00 0.00 ? 51  LEU A HB3  5  
ATOM   5397  H  HG   . LEU A 1 51 ? 0.547   3.577   0.277   1.00 0.00 ? 51  LEU A HG   5  
ATOM   5398  H  HD11 . LEU A 1 51 ? 2.335   1.203   0.152   1.00 0.00 ? 51  LEU A HD11 5  
ATOM   5399  H  HD12 . LEU A 1 51 ? 0.663   1.034   -0.382  1.00 0.00 ? 51  LEU A HD12 5  
ATOM   5400  H  HD13 . LEU A 1 51 ? 1.013   1.567   1.262   1.00 0.00 ? 51  LEU A HD13 5  
ATOM   5401  H  HD21 . LEU A 1 51 ? 3.418   2.981   0.277   1.00 0.00 ? 51  LEU A HD21 5  
ATOM   5402  H  HD22 . LEU A 1 51 ? 2.531   4.307   1.028   1.00 0.00 ? 51  LEU A HD22 5  
ATOM   5403  H  HD23 . LEU A 1 51 ? 2.958   4.388   -0.682  1.00 0.00 ? 51  LEU A HD23 5  
ATOM   5404  N  N    . LYS A 1 52 ? -0.523  5.309   -4.111  1.00 0.00 ? 52  LYS A N    5  
ATOM   5405  C  CA   . LYS A 1 52 ? -1.087  5.329   -5.456  1.00 0.00 ? 52  LYS A CA   5  
ATOM   5406  C  C    . LYS A 1 52 ? 0.014   5.260   -6.509  1.00 0.00 ? 52  LYS A C    5  
ATOM   5407  O  O    . LYS A 1 52 ? -0.019  4.410   -7.398  1.00 0.00 ? 52  LYS A O    5  
ATOM   5408  C  CB   . LYS A 1 52 ? -1.924  6.594   -5.660  1.00 0.00 ? 52  LYS A CB   5  
ATOM   5409  C  CG   . LYS A 1 52 ? -3.049  6.423   -6.666  1.00 0.00 ? 52  LYS A CG   5  
ATOM   5410  C  CD   . LYS A 1 52 ? -4.178  7.407   -6.413  1.00 0.00 ? 52  LYS A CD   5  
ATOM   5411  C  CE   . LYS A 1 52 ? -5.174  7.422   -7.563  1.00 0.00 ? 52  LYS A CE   5  
ATOM   5412  N  NZ   . LYS A 1 52 ? -6.026  6.201   -7.574  1.00 0.00 ? 52  LYS A NZ   5  
ATOM   5413  H  H    . LYS A 1 52 ? -0.851  5.950   -3.445  1.00 0.00 ? 52  LYS A H    5  
ATOM   5414  H  HA   . LYS A 1 52 ? -1.725  4.465   -5.561  1.00 0.00 ? 52  LYS A HA   5  
ATOM   5415  H  HB2  . LYS A 1 52 ? -2.356  6.883   -4.714  1.00 0.00 ? 52  LYS A HB2  5  
ATOM   5416  H  HB3  . LYS A 1 52 ? -1.277  7.387   -6.007  1.00 0.00 ? 52  LYS A HB3  5  
ATOM   5417  H  HG2  . LYS A 1 52 ? -2.659  6.587   -7.660  1.00 0.00 ? 52  LYS A HG2  5  
ATOM   5418  H  HG3  . LYS A 1 52 ? -3.437  5.417   -6.591  1.00 0.00 ? 52  LYS A HG3  5  
ATOM   5419  H  HD2  . LYS A 1 52 ? -4.695  7.124   -5.508  1.00 0.00 ? 52  LYS A HD2  5  
ATOM   5420  H  HD3  . LYS A 1 52 ? -3.761  8.398   -6.296  1.00 0.00 ? 52  LYS A HD3  5  
ATOM   5421  H  HE2  . LYS A 1 52 ? -5.806  8.291   -7.464  1.00 0.00 ? 52  LYS A HE2  5  
ATOM   5422  H  HE3  . LYS A 1 52 ? -4.628  7.478   -8.493  1.00 0.00 ? 52  LYS A HE3  5  
ATOM   5423  H  HZ1  . LYS A 1 52 ? -7.019  6.458   -7.404  1.00 0.00 ? 52  LYS A HZ1  5  
ATOM   5424  H  HZ2  . LYS A 1 52 ? -5.718  5.543   -6.831  1.00 0.00 ? 52  LYS A HZ2  5  
ATOM   5425  H  HZ3  . LYS A 1 52 ? -5.955  5.724   -8.496  1.00 0.00 ? 52  LYS A HZ3  5  
ATOM   5426  N  N    . GLN A 1 53 ? 0.988   6.157   -6.400  1.00 0.00 ? 53  GLN A N    5  
ATOM   5427  C  CA   . GLN A 1 53 ? 2.099   6.196   -7.344  1.00 0.00 ? 53  GLN A CA   5  
ATOM   5428  C  C    . GLN A 1 53 ? 3.403   5.785   -6.667  1.00 0.00 ? 53  GLN A C    5  
ATOM   5429  O  O    . GLN A 1 53 ? 4.239   5.108   -7.265  1.00 0.00 ? 53  GLN A O    5  
ATOM   5430  C  CB   . GLN A 1 53 ? 2.241   7.597   -7.941  1.00 0.00 ? 53  GLN A CB   5  
ATOM   5431  C  CG   . GLN A 1 53 ? 1.043   8.028   -8.772  1.00 0.00 ? 53  GLN A CG   5  
ATOM   5432  C  CD   . GLN A 1 53 ? 0.982   9.529   -8.974  1.00 0.00 ? 53  GLN A CD   5  
ATOM   5433  O  OE1  . GLN A 1 53 ? 0.619   10.275  -8.064  1.00 0.00 ? 53  GLN A OE1  5  
ATOM   5434  N  NE2  . GLN A 1 53 ? 1.339   9.981   -10.170 1.00 0.00 ? 53  GLN A NE2  5  
ATOM   5435  H  H    . GLN A 1 53 ? 0.959   6.809   -5.670  1.00 0.00 ? 53  GLN A H    5  
ATOM   5436  H  HA   . GLN A 1 53 ? 1.884   5.496   -8.137  1.00 0.00 ? 53  GLN A HA   5  
ATOM   5437  H  HB2  . GLN A 1 53 ? 2.369   8.307   -7.137  1.00 0.00 ? 53  GLN A HB2  5  
ATOM   5438  H  HB3  . GLN A 1 53 ? 3.116   7.619   -8.573  1.00 0.00 ? 53  GLN A HB3  5  
ATOM   5439  H  HG2  . GLN A 1 53 ? 1.103   7.552   -9.740  1.00 0.00 ? 53  GLN A HG2  5  
ATOM   5440  H  HG3  . GLN A 1 53 ? 0.141   7.709   -8.271  1.00 0.00 ? 53  GLN A HG3  5  
ATOM   5441  H  HE21 . GLN A 1 53 ? 1.616   9.328   -10.847 1.00 0.00 ? 53  GLN A HE21 5  
ATOM   5442  H  HE22 . GLN A 1 53 ? 1.308   10.946  -10.329 1.00 0.00 ? 53  GLN A HE22 5  
ATOM   5443  N  N    . LYS A 1 54 ? 3.569   6.198   -5.415  1.00 0.00 ? 54  LYS A N    5  
ATOM   5444  C  CA   . LYS A 1 54 ? 4.770   5.873   -4.655  1.00 0.00 ? 54  LYS A CA   5  
ATOM   5445  C  C    . LYS A 1 54 ? 5.080   4.382   -4.739  1.00 0.00 ? 54  LYS A C    5  
ATOM   5446  O  O    . LYS A 1 54 ? 6.216   3.988   -5.001  1.00 0.00 ? 54  LYS A O    5  
ATOM   5447  C  CB   . LYS A 1 54 ? 4.600   6.288   -3.192  1.00 0.00 ? 54  LYS A CB   5  
ATOM   5448  C  CG   . LYS A 1 54 ? 4.325   7.770   -3.008  1.00 0.00 ? 54  LYS A CG   5  
ATOM   5449  C  CD   . LYS A 1 54 ? 4.365   8.167   -1.541  1.00 0.00 ? 54  LYS A CD   5  
ATOM   5450  C  CE   . LYS A 1 54 ? 3.924   9.609   -1.342  1.00 0.00 ? 54  LYS A CE   5  
ATOM   5451  N  NZ   . LYS A 1 54 ? 5.059   10.561  -1.489  1.00 0.00 ? 54  LYS A NZ   5  
ATOM   5452  H  H    . LYS A 1 54 ? 2.866   6.735   -4.992  1.00 0.00 ? 54  LYS A H    5  
ATOM   5453  H  HA   . LYS A 1 54 ? 5.594   6.425   -5.083  1.00 0.00 ? 54  LYS A HA   5  
ATOM   5454  H  HB2  . LYS A 1 54 ? 3.776   5.735   -2.767  1.00 0.00 ? 54  LYS A HB2  5  
ATOM   5455  H  HB3  . LYS A 1 54 ? 5.504   6.041   -2.653  1.00 0.00 ? 54  LYS A HB3  5  
ATOM   5456  H  HG2  . LYS A 1 54 ? 5.075   8.335   -3.542  1.00 0.00 ? 54  LYS A HG2  5  
ATOM   5457  H  HG3  . LYS A 1 54 ? 3.347   7.998   -3.407  1.00 0.00 ? 54  LYS A HG3  5  
ATOM   5458  H  HD2  . LYS A 1 54 ? 3.703   7.520   -0.984  1.00 0.00 ? 54  LYS A HD2  5  
ATOM   5459  H  HD3  . LYS A 1 54 ? 5.375   8.054   -1.174  1.00 0.00 ? 54  LYS A HD3  5  
ATOM   5460  H  HE2  . LYS A 1 54 ? 3.169   9.846   -2.076  1.00 0.00 ? 54  LYS A HE2  5  
ATOM   5461  H  HE3  . LYS A 1 54 ? 3.506   9.710   -0.351  1.00 0.00 ? 54  LYS A HE3  5  
ATOM   5462  H  HZ1  . LYS A 1 54 ? 5.156   10.850  -2.484  1.00 0.00 ? 54  LYS A HZ1  5  
ATOM   5463  H  HZ2  . LYS A 1 54 ? 5.945   10.111  -1.183  1.00 0.00 ? 54  LYS A HZ2  5  
ATOM   5464  H  HZ3  . LYS A 1 54 ? 4.894   11.407  -0.908  1.00 0.00 ? 54  LYS A HZ3  5  
ATOM   5465  N  N    . GLY A 1 55 ? 4.062   3.557   -4.516  1.00 0.00 ? 55  GLY A N    5  
ATOM   5466  C  CA   . GLY A 1 55 ? 4.247   2.119   -4.572  1.00 0.00 ? 55  GLY A CA   5  
ATOM   5467  C  C    . GLY A 1 55 ? 3.994   1.448   -3.236  1.00 0.00 ? 55  GLY A C    5  
ATOM   5468  O  O    . GLY A 1 55 ? 4.181   2.058   -2.183  1.00 0.00 ? 55  GLY A O    5  
ATOM   5469  H  H    . GLY A 1 55 ? 3.178   3.928   -4.311  1.00 0.00 ? 55  GLY A H    5  
ATOM   5470  H  HA2  . GLY A 1 55 ? 3.567   1.708   -5.304  1.00 0.00 ? 55  GLY A HA2  5  
ATOM   5471  H  HA3  . GLY A 1 55 ? 5.261   1.909   -4.880  1.00 0.00 ? 55  GLY A HA3  5  
ATOM   5472  N  N    . HIS A 1 56 ? 3.566   0.191   -3.278  1.00 0.00 ? 56  HIS A N    5  
ATOM   5473  C  CA   . HIS A 1 56 ? 3.285   -0.563  -2.061  1.00 0.00 ? 56  HIS A CA   5  
ATOM   5474  C  C    . HIS A 1 56 ? 4.134   -1.829  -1.998  1.00 0.00 ? 56  HIS A C    5  
ATOM   5475  O  O    . HIS A 1 56 ? 4.735   -2.236  -2.993  1.00 0.00 ? 56  HIS A O    5  
ATOM   5476  C  CB   . HIS A 1 56 ? 1.802   -0.925  -1.991  1.00 0.00 ? 56  HIS A CB   5  
ATOM   5477  C  CG   . HIS A 1 56 ? 1.465   -2.209  -2.686  1.00 0.00 ? 56  HIS A CG   5  
ATOM   5478  N  ND1  . HIS A 1 56 ? 1.019   -2.264  -3.989  1.00 0.00 ? 56  HIS A ND1  5  
ATOM   5479  C  CD2  . HIS A 1 56 ? 1.514   -3.490  -2.251  1.00 0.00 ? 56  HIS A CD2  5  
ATOM   5480  C  CE1  . HIS A 1 56 ? 0.806   -3.524  -4.326  1.00 0.00 ? 56  HIS A CE1  5  
ATOM   5481  N  NE2  . HIS A 1 56 ? 1.099   -4.288  -3.289  1.00 0.00 ? 56  HIS A NE2  5  
ATOM   5482  H  H    . HIS A 1 56 ? 3.436   -0.241  -4.148  1.00 0.00 ? 56  HIS A H    5  
ATOM   5483  H  HA   . HIS A 1 56 ? 3.534   0.065   -1.219  1.00 0.00 ? 56  HIS A HA   5  
ATOM   5484  H  HB2  . HIS A 1 56 ? 1.511   -1.023  -0.956  1.00 0.00 ? 56  HIS A HB2  5  
ATOM   5485  H  HB3  . HIS A 1 56 ? 1.223   -0.137  -2.450  1.00 0.00 ? 56  HIS A HB3  5  
ATOM   5486  H  HD1  . HIS A 1 56 ? 0.877   -1.495  -4.579  1.00 0.00 ? 56  HIS A HD1  5  
ATOM   5487  H  HD2  . HIS A 1 56 ? 1.822   -3.823  -1.270  1.00 0.00 ? 56  HIS A HD2  5  
ATOM   5488  H  HE1  . HIS A 1 56 ? 0.453   -3.871  -5.285  1.00 0.00 ? 56  HIS A HE1  5  
ATOM   5489  H  HE2  . HIS A 1 56 ? 0.949   -5.255  -3.240  1.00 0.00 ? 56  HIS A HE2  5  
ATOM   5490  N  N    . PHE A 1 57 ? 4.180   -2.447  -0.823  1.00 0.00 ? 57  PHE A N    5  
ATOM   5491  C  CA   . PHE A 1 57 ? 4.957   -3.666  -0.630  1.00 0.00 ? 57  PHE A CA   5  
ATOM   5492  C  C    . PHE A 1 57 ? 4.168   -4.691  0.178   1.00 0.00 ? 57  PHE A C    5  
ATOM   5493  O  O    . PHE A 1 57 ? 3.348   -4.334  1.024   1.00 0.00 ? 57  PHE A O    5  
ATOM   5494  C  CB   . PHE A 1 57 ? 6.276   -3.348  0.078   1.00 0.00 ? 57  PHE A CB   5  
ATOM   5495  C  CG   . PHE A 1 57 ? 7.401   -3.031  -0.865  1.00 0.00 ? 57  PHE A CG   5  
ATOM   5496  C  CD1  . PHE A 1 57 ? 7.323   -1.939  -1.715  1.00 0.00 ? 57  PHE A CD1  5  
ATOM   5497  C  CD2  . PHE A 1 57 ? 8.537   -3.822  -0.901  1.00 0.00 ? 57  PHE A CD2  5  
ATOM   5498  C  CE1  . PHE A 1 57 ? 8.356   -1.645  -2.585  1.00 0.00 ? 57  PHE A CE1  5  
ATOM   5499  C  CE2  . PHE A 1 57 ? 9.574   -3.533  -1.768  1.00 0.00 ? 57  PHE A CE2  5  
ATOM   5500  C  CZ   . PHE A 1 57 ? 9.484   -2.443  -2.610  1.00 0.00 ? 57  PHE A CZ   5  
ATOM   5501  H  H    . PHE A 1 57 ? 3.680   -2.073  -0.067  1.00 0.00 ? 57  PHE A H    5  
ATOM   5502  H  HA   . PHE A 1 57 ? 5.171   -4.079  -1.603  1.00 0.00 ? 57  PHE A HA   5  
ATOM   5503  H  HB2  . PHE A 1 57 ? 6.134   -2.495  0.724   1.00 0.00 ? 57  PHE A HB2  5  
ATOM   5504  H  HB3  . PHE A 1 57 ? 6.571   -4.199  0.673   1.00 0.00 ? 57  PHE A HB3  5  
ATOM   5505  H  HD1  . PHE A 1 57 ? 6.442   -1.314  -1.696  1.00 0.00 ? 57  PHE A HD1  5  
ATOM   5506  H  HD2  . PHE A 1 57 ? 8.609   -4.676  -0.241  1.00 0.00 ? 57  PHE A HD2  5  
ATOM   5507  H  HE1  . PHE A 1 57 ? 8.283   -0.792  -3.242  1.00 0.00 ? 57  PHE A HE1  5  
ATOM   5508  H  HE2  . PHE A 1 57 ? 10.455  -4.159  -1.784  1.00 0.00 ? 57  PHE A HE2  5  
ATOM   5509  H  HZ   . PHE A 1 57 ? 10.292  -2.215  -3.288  1.00 0.00 ? 57  PHE A HZ   5  
ATOM   5510  N  N    . PHE A 1 58 ? 4.420   -5.968  -0.090  1.00 0.00 ? 58  PHE A N    5  
ATOM   5511  C  CA   . PHE A 1 58 ? 3.733   -7.047  0.610   1.00 0.00 ? 58  PHE A CA   5  
ATOM   5512  C  C    . PHE A 1 58 ? 4.561   -7.543  1.792   1.00 0.00 ? 58  PHE A C    5  
ATOM   5513  O  O    . PHE A 1 58 ? 5.620   -8.145  1.613   1.00 0.00 ? 58  PHE A O    5  
ATOM   5514  C  CB   . PHE A 1 58 ? 3.447   -8.205  -0.349  1.00 0.00 ? 58  PHE A CB   5  
ATOM   5515  C  CG   . PHE A 1 58 ? 2.145   -8.067  -1.084  1.00 0.00 ? 58  PHE A CG   5  
ATOM   5516  C  CD1  . PHE A 1 58 ? 0.958   -7.893  -0.391  1.00 0.00 ? 58  PHE A CD1  5  
ATOM   5517  C  CD2  . PHE A 1 58 ? 2.107   -8.112  -2.468  1.00 0.00 ? 58  PHE A CD2  5  
ATOM   5518  C  CE1  . PHE A 1 58 ? -0.243  -7.766  -1.064  1.00 0.00 ? 58  PHE A CE1  5  
ATOM   5519  C  CE2  . PHE A 1 58 ? 0.910   -7.984  -3.147  1.00 0.00 ? 58  PHE A CE2  5  
ATOM   5520  C  CZ   . PHE A 1 58 ? -0.266  -7.812  -2.444  1.00 0.00 ? 58  PHE A CZ   5  
ATOM   5521  H  H    . PHE A 1 58 ? 5.085   -6.190  -0.776  1.00 0.00 ? 58  PHE A H    5  
ATOM   5522  H  HA   . PHE A 1 58 ? 2.797   -6.658  0.979   1.00 0.00 ? 58  PHE A HA   5  
ATOM   5523  H  HB2  . PHE A 1 58 ? 4.237   -8.259  -1.082  1.00 0.00 ? 58  PHE A HB2  5  
ATOM   5524  H  HB3  . PHE A 1 58 ? 3.418   -9.127  0.211   1.00 0.00 ? 58  PHE A HB3  5  
ATOM   5525  H  HD1  . PHE A 1 58 ? 0.975   -7.857  0.690   1.00 0.00 ? 58  PHE A HD1  5  
ATOM   5526  H  HD2  . PHE A 1 58 ? 3.026   -8.247  -3.019  1.00 0.00 ? 58  PHE A HD2  5  
ATOM   5527  H  HE1  . PHE A 1 58 ? -1.160  -7.631  -0.511  1.00 0.00 ? 58  PHE A HE1  5  
ATOM   5528  H  HE2  . PHE A 1 58 ? 0.894   -8.022  -4.226  1.00 0.00 ? 58  PHE A HE2  5  
ATOM   5529  H  HZ   . PHE A 1 58 ? -1.203  -7.712  -2.972  1.00 0.00 ? 58  PHE A HZ   5  
ATOM   5530  N  N    . VAL A 1 59 ? 4.070   -7.285  3.000   1.00 0.00 ? 59  VAL A N    5  
ATOM   5531  C  CA   . VAL A 1 59 ? 4.763   -7.705  4.212   1.00 0.00 ? 59  VAL A CA   5  
ATOM   5532  C  C    . VAL A 1 59 ? 3.776   -8.180  5.273   1.00 0.00 ? 59  VAL A C    5  
ATOM   5533  O  O    . VAL A 1 59 ? 3.047   -7.381  5.858   1.00 0.00 ? 59  VAL A O    5  
ATOM   5534  C  CB   . VAL A 1 59 ? 5.616   -6.563  4.795   1.00 0.00 ? 59  VAL A CB   5  
ATOM   5535  C  CG1  . VAL A 1 59 ? 6.281   -7.001  6.091   1.00 0.00 ? 59  VAL A CG1  5  
ATOM   5536  C  CG2  . VAL A 1 59 ? 6.654   -6.103  3.783   1.00 0.00 ? 59  VAL A CG2  5  
ATOM   5537  H  H    . VAL A 1 59 ? 3.222   -6.801  3.078   1.00 0.00 ? 59  VAL A H    5  
ATOM   5538  H  HA   . VAL A 1 59 ? 5.421   -8.522  3.955   1.00 0.00 ? 59  VAL A HA   5  
ATOM   5539  H  HB   . VAL A 1 59 ? 4.964   -5.730  5.015   1.00 0.00 ? 59  VAL A HB   5  
ATOM   5540  H  HG11 . VAL A 1 59 ? 5.569   -7.542  6.696   1.00 0.00 ? 59  VAL A HG11 5  
ATOM   5541  H  HG12 . VAL A 1 59 ? 7.123   -7.639  5.866   1.00 0.00 ? 59  VAL A HG12 5  
ATOM   5542  H  HG13 . VAL A 1 59 ? 6.623   -6.131  6.632   1.00 0.00 ? 59  VAL A HG13 5  
ATOM   5543  H  HG21 . VAL A 1 59 ? 7.624   -6.483  4.065   1.00 0.00 ? 59  VAL A HG21 5  
ATOM   5544  H  HG22 . VAL A 1 59 ? 6.392   -6.476  2.803   1.00 0.00 ? 59  VAL A HG22 5  
ATOM   5545  H  HG23 . VAL A 1 59 ? 6.682   -5.023  3.760   1.00 0.00 ? 59  VAL A HG23 5  
ATOM   5546  N  N    . GLU A 1 60 ? 3.760   -9.487  5.515   1.00 0.00 ? 60  GLU A N    5  
ATOM   5547  C  CA   . GLU A 1 60 ? 2.862   -10.069 6.506   1.00 0.00 ? 60  GLU A CA   5  
ATOM   5548  C  C    . GLU A 1 60 ? 1.405   -9.879  6.096   1.00 0.00 ? 60  GLU A C    5  
ATOM   5549  O  O    . GLU A 1 60 ? 0.547   -9.592  6.931   1.00 0.00 ? 60  GLU A O    5  
ATOM   5550  C  CB   . GLU A 1 60 ? 3.104   -9.438  7.879   1.00 0.00 ? 60  GLU A CB   5  
ATOM   5551  C  CG   . GLU A 1 60 ? 4.514   -9.649  8.405   1.00 0.00 ? 60  GLU A CG   5  
ATOM   5552  C  CD   . GLU A 1 60 ? 4.803   -8.824  9.644   1.00 0.00 ? 60  GLU A CD   5  
ATOM   5553  O  OE1  . GLU A 1 60 ? 4.234   -9.135  10.711  1.00 0.00 ? 60  GLU A OE1  5  
ATOM   5554  O  OE2  . GLU A 1 60 ? 5.601   -7.868  9.546   1.00 0.00 ? 60  GLU A OE2  5  
ATOM   5555  H  H    . GLU A 1 60 ? 4.366   -10.074 5.016   1.00 0.00 ? 60  GLU A H    5  
ATOM   5556  H  HA   . GLU A 1 60 ? 3.072   -11.126 6.563   1.00 0.00 ? 60  GLU A HA   5  
ATOM   5557  H  HB2  . GLU A 1 60 ? 2.922   -8.376  7.811   1.00 0.00 ? 60  GLU A HB2  5  
ATOM   5558  H  HB3  . GLU A 1 60 ? 2.410   -9.868  8.586   1.00 0.00 ? 60  GLU A HB3  5  
ATOM   5559  H  HG2  . GLU A 1 60 ? 4.641   -10.693 8.650   1.00 0.00 ? 60  GLU A HG2  5  
ATOM   5560  H  HG3  . GLU A 1 60 ? 5.218   -9.373  7.634   1.00 0.00 ? 60  GLU A HG3  5  
ATOM   5561  N  N    . ASP A 1 61 ? 1.133   -10.040 4.806   1.00 0.00 ? 61  ASP A N    5  
ATOM   5562  C  CA   . ASP A 1 61 ? -0.221  -9.887  4.285   1.00 0.00 ? 61  ASP A CA   5  
ATOM   5563  C  C    . ASP A 1 61 ? -0.714  -8.455  4.466   1.00 0.00 ? 61  ASP A C    5  
ATOM   5564  O  O    . ASP A 1 61 ? -1.906  -8.220  4.660   1.00 0.00 ? 61  ASP A O    5  
ATOM   5565  C  CB   . ASP A 1 61 ? -1.172  -10.860 4.983   1.00 0.00 ? 61  ASP A CB   5  
ATOM   5566  C  CG   . ASP A 1 61 ? -2.366  -11.222 4.121   1.00 0.00 ? 61  ASP A CG   5  
ATOM   5567  O  OD1  . ASP A 1 61 ? -3.310  -10.408 4.043   1.00 0.00 ? 61  ASP A OD1  5  
ATOM   5568  O  OD2  . ASP A 1 61 ? -2.355  -12.318 3.524   1.00 0.00 ? 61  ASP A OD2  5  
ATOM   5569  H  H    . ASP A 1 61 ? 1.860   -10.268 4.189   1.00 0.00 ? 61  ASP A H    5  
ATOM   5570  H  HA   . ASP A 1 61 ? -0.198  -10.116 3.230   1.00 0.00 ? 61  ASP A HA   5  
ATOM   5571  H  HB2  . ASP A 1 61 ? -0.637  -11.767 5.224   1.00 0.00 ? 61  ASP A HB2  5  
ATOM   5572  H  HB3  . ASP A 1 61 ? -1.533  -10.407 5.895   1.00 0.00 ? 61  ASP A HB3  5  
ATOM   5573  N  N    . GLN A 1 62 ? 0.211   -7.503  4.402   1.00 0.00 ? 62  GLN A N    5  
ATOM   5574  C  CA   . GLN A 1 62 ? -0.130  -6.094  4.561   1.00 0.00 ? 62  GLN A CA   5  
ATOM   5575  C  C    . GLN A 1 62 ? 0.539   -5.247  3.483   1.00 0.00 ? 62  GLN A C    5  
ATOM   5576  O  O    . GLN A 1 62 ? 1.311   -5.756  2.671   1.00 0.00 ? 62  GLN A O    5  
ATOM   5577  C  CB   . GLN A 1 62 ? 0.287   -5.600  5.947   1.00 0.00 ? 62  GLN A CB   5  
ATOM   5578  C  CG   . GLN A 1 62 ? -0.507  -6.228  7.081   1.00 0.00 ? 62  GLN A CG   5  
ATOM   5579  C  CD   . GLN A 1 62 ? -1.932  -5.715  7.150   1.00 0.00 ? 62  GLN A CD   5  
ATOM   5580  O  OE1  . GLN A 1 62 ? -2.797  -6.148  6.388   1.00 0.00 ? 62  GLN A OE1  5  
ATOM   5581  N  NE2  . GLN A 1 62 ? -2.184  -4.787  8.065   1.00 0.00 ? 62  GLN A NE2  5  
ATOM   5582  H  H    . GLN A 1 62 ? 1.145   -7.754  4.245   1.00 0.00 ? 62  GLN A H    5  
ATOM   5583  H  HA   . GLN A 1 62 ? -1.201  -6.000  4.462   1.00 0.00 ? 62  GLN A HA   5  
ATOM   5584  H  HB2  . GLN A 1 62 ? 1.332   -5.828  6.098   1.00 0.00 ? 62  GLN A HB2  5  
ATOM   5585  H  HB3  . GLN A 1 62 ? 0.150   -4.530  5.991   1.00 0.00 ? 62  GLN A HB3  5  
ATOM   5586  H  HG2  . GLN A 1 62 ? -0.533  -7.298  6.936   1.00 0.00 ? 62  GLN A HG2  5  
ATOM   5587  H  HG3  . GLN A 1 62 ? -0.014  -6.004  8.015   1.00 0.00 ? 62  GLN A HG3  5  
ATOM   5588  H  HE21 . GLN A 1 62 ? -1.445  -4.488  8.637   1.00 0.00 ? 62  GLN A HE21 5  
ATOM   5589  H  HE22 . GLN A 1 62 ? -3.096  -4.437  8.131   1.00 0.00 ? 62  GLN A HE22 5  
ATOM   5590  N  N    . ILE A 1 63 ? 0.238   -3.953  3.483   1.00 0.00 ? 63  ILE A N    5  
ATOM   5591  C  CA   . ILE A 1 63 ? 0.811   -3.036  2.506   1.00 0.00 ? 63  ILE A CA   5  
ATOM   5592  C  C    . ILE A 1 63 ? 1.568   -1.904  3.192   1.00 0.00 ? 63  ILE A C    5  
ATOM   5593  O  O    . ILE A 1 63 ? 1.130   -1.383  4.218   1.00 0.00 ? 63  ILE A O    5  
ATOM   5594  C  CB   . ILE A 1 63 ? -0.275  -2.434  1.595   1.00 0.00 ? 63  ILE A CB   5  
ATOM   5595  C  CG1  . ILE A 1 63 ? -1.325  -1.700  2.432   1.00 0.00 ? 63  ILE A CG1  5  
ATOM   5596  C  CG2  . ILE A 1 63 ? -0.926  -3.523  0.755   1.00 0.00 ? 63  ILE A CG2  5  
ATOM   5597  C  CD1  . ILE A 1 63 ? -2.046  -0.607  1.675   1.00 0.00 ? 63  ILE A CD1  5  
ATOM   5598  H  H    . ILE A 1 63 ? -0.384  -3.607  4.156   1.00 0.00 ? 63  ILE A H    5  
ATOM   5599  H  HA   . ILE A 1 63 ? 1.500   -3.594  1.890   1.00 0.00 ? 63  ILE A HA   5  
ATOM   5600  H  HB   . ILE A 1 63 ? 0.197   -1.731  0.926   1.00 0.00 ? 63  ILE A HB   5  
ATOM   5601  H  HG12 . ILE A 1 63 ? -2.063  -2.408  2.774   1.00 0.00 ? 63  ILE A HG12 5  
ATOM   5602  H  HG13 . ILE A 1 63 ? -0.841  -1.249  3.287   1.00 0.00 ? 63  ILE A HG13 5  
ATOM   5603  H  HG21 . ILE A 1 63 ? -1.575  -4.119  1.380   1.00 0.00 ? 63  ILE A HG21 5  
ATOM   5604  H  HG22 . ILE A 1 63 ? -1.506  -3.069  -0.035  1.00 0.00 ? 63  ILE A HG22 5  
ATOM   5605  H  HG23 . ILE A 1 63 ? -0.162  -4.152  0.326   1.00 0.00 ? 63  ILE A HG23 5  
ATOM   5606  H  HD11 . ILE A 1 63 ? -3.106  -0.815  1.664   1.00 0.00 ? 63  ILE A HD11 5  
ATOM   5607  H  HD12 . ILE A 1 63 ? -1.869  0.343   2.156   1.00 0.00 ? 63  ILE A HD12 5  
ATOM   5608  H  HD13 . ILE A 1 63 ? -1.677  -0.570  0.659   1.00 0.00 ? 63  ILE A HD13 5  
ATOM   5609  N  N    . TYR A 1 64 ? 2.705   -1.528  2.619   1.00 0.00 ? 64  TYR A N    5  
ATOM   5610  C  CA   . TYR A 1 64 ? 3.524   -0.457  3.175   1.00 0.00 ? 64  TYR A CA   5  
ATOM   5611  C  C    . TYR A 1 64 ? 4.211   0.336   2.067   1.00 0.00 ? 64  TYR A C    5  
ATOM   5612  O  O    . TYR A 1 64 ? 4.100   0.001   0.887   1.00 0.00 ? 64  TYR A O    5  
ATOM   5613  C  CB   . TYR A 1 64 ? 4.571   -1.032  4.130   1.00 0.00 ? 64  TYR A CB   5  
ATOM   5614  C  CG   . TYR A 1 64 ? 3.997   -1.980  5.159   1.00 0.00 ? 64  TYR A CG   5  
ATOM   5615  C  CD1  . TYR A 1 64 ? 3.793   -3.322  4.859   1.00 0.00 ? 64  TYR A CD1  5  
ATOM   5616  C  CD2  . TYR A 1 64 ? 3.660   -1.535  6.431   1.00 0.00 ? 64  TYR A CD2  5  
ATOM   5617  C  CE1  . TYR A 1 64 ? 3.268   -4.191  5.795   1.00 0.00 ? 64  TYR A CE1  5  
ATOM   5618  C  CE2  . TYR A 1 64 ? 3.136   -2.397  7.374   1.00 0.00 ? 64  TYR A CE2  5  
ATOM   5619  C  CZ   . TYR A 1 64 ? 2.941   -3.724  7.051   1.00 0.00 ? 64  TYR A CZ   5  
ATOM   5620  O  OH   . TYR A 1 64 ? 2.420   -4.587  7.988   1.00 0.00 ? 64  TYR A OH   5  
ATOM   5621  H  H    . TYR A 1 64 ? 3.002   -1.981  1.802   1.00 0.00 ? 64  TYR A H    5  
ATOM   5622  H  HA   . TYR A 1 64 ? 2.874   0.206   3.727   1.00 0.00 ? 64  TYR A HA   5  
ATOM   5623  H  HB2  . TYR A 1 64 ? 5.312   -1.572  3.559   1.00 0.00 ? 64  TYR A HB2  5  
ATOM   5624  H  HB3  . TYR A 1 64 ? 5.052   -0.221  4.658   1.00 0.00 ? 64  TYR A HB3  5  
ATOM   5625  H  HD1  . TYR A 1 64 ? 4.051   -3.684  3.874   1.00 0.00 ? 64  TYR A HD1  5  
ATOM   5626  H  HD2  . TYR A 1 64 ? 3.814   -0.495  6.681   1.00 0.00 ? 64  TYR A HD2  5  
ATOM   5627  H  HE1  . TYR A 1 64 ? 3.116   -5.230  5.543   1.00 0.00 ? 64  TYR A HE1  5  
ATOM   5628  H  HE2  . TYR A 1 64 ? 2.880   -2.032  8.358   1.00 0.00 ? 64  TYR A HE2  5  
ATOM   5629  H  HH   . TYR A 1 64 ? 1.474   -4.442  8.065   1.00 0.00 ? 64  TYR A HH   5  
ATOM   5630  N  N    . CYS A 1 65 ? 4.921   1.389   2.456   1.00 0.00 ? 65  CYS A N    5  
ATOM   5631  C  CA   . CYS A 1 65 ? 5.627   2.232   1.498   1.00 0.00 ? 65  CYS A CA   5  
ATOM   5632  C  C    . CYS A 1 65 ? 7.102   1.848   1.420   1.00 0.00 ? 65  CYS A C    5  
ATOM   5633  O  O    . CYS A 1 65 ? 7.725   1.529   2.432   1.00 0.00 ? 65  CYS A O    5  
ATOM   5634  C  CB   . CYS A 1 65 ? 5.492   3.705   1.887   1.00 0.00 ? 65  CYS A CB   5  
ATOM   5635  S  SG   . CYS A 1 65 ? 6.000   4.073   3.597   1.00 0.00 ? 65  CYS A SG   5  
ATOM   5636  H  H    . CYS A 1 65 ? 4.972   1.606   3.411   1.00 0.00 ? 65  CYS A H    5  
ATOM   5637  H  HA   . CYS A 1 65 ? 5.177   2.081   0.529   1.00 0.00 ? 65  CYS A HA   5  
ATOM   5638  H  HB2  . CYS A 1 65 ? 6.106   4.301   1.227   1.00 0.00 ? 65  CYS A HB2  5  
ATOM   5639  H  HB3  . CYS A 1 65 ? 4.460   4.005   1.778   1.00 0.00 ? 65  CYS A HB3  5  
ATOM   5640  N  N    . GLU A 1 66 ? 7.653   1.882   0.210   1.00 0.00 ? 66  GLU A N    5  
ATOM   5641  C  CA   . GLU A 1 66 ? 9.054   1.537   0.000   1.00 0.00 ? 66  GLU A CA   5  
ATOM   5642  C  C    . GLU A 1 66 ? 9.901   1.946   1.202   1.00 0.00 ? 66  GLU A C    5  
ATOM   5643  O  O    . GLU A 1 66 ? 10.743  1.181   1.672   1.00 0.00 ? 66  GLU A O    5  
ATOM   5644  C  CB   . GLU A 1 66 ? 9.585   2.214   -1.266  1.00 0.00 ? 66  GLU A CB   5  
ATOM   5645  C  CG   . GLU A 1 66 ? 11.078  2.030   -1.473  1.00 0.00 ? 66  GLU A CG   5  
ATOM   5646  C  CD   . GLU A 1 66 ? 11.611  2.848   -2.634  1.00 0.00 ? 66  GLU A CD   5  
ATOM   5647  O  OE1  . GLU A 1 66 ? 11.208  4.023   -2.765  1.00 0.00 ? 66  GLU A OE1  5  
ATOM   5648  O  OE2  . GLU A 1 66 ? 12.429  2.313   -3.411  1.00 0.00 ? 66  GLU A OE2  5  
ATOM   5649  H  H    . GLU A 1 66 ? 7.104   2.144   -0.558  1.00 0.00 ? 66  GLU A H    5  
ATOM   5650  H  HA   . GLU A 1 66 ? 9.117   0.466   -0.122  1.00 0.00 ? 66  GLU A HA   5  
ATOM   5651  H  HB2  . GLU A 1 66 ? 9.070   1.803   -2.122  1.00 0.00 ? 66  GLU A HB2  5  
ATOM   5652  H  HB3  . GLU A 1 66 ? 9.378   3.272   -1.206  1.00 0.00 ? 66  GLU A HB3  5  
ATOM   5653  H  HG2  . GLU A 1 66 ? 11.594  2.333   -0.574  1.00 0.00 ? 66  GLU A HG2  5  
ATOM   5654  H  HG3  . GLU A 1 66 ? 11.277  0.986   -1.666  1.00 0.00 ? 66  GLU A HG3  5  
ATOM   5655  N  N    . LYS A 1 67 ? 9.672   3.159   1.694   1.00 0.00 ? 67  LYS A N    5  
ATOM   5656  C  CA   . LYS A 1 67 ? 10.412  3.672   2.841   1.00 0.00 ? 67  LYS A CA   5  
ATOM   5657  C  C    . LYS A 1 67 ? 10.379  2.678   3.998   1.00 0.00 ? 67  LYS A C    5  
ATOM   5658  O  O    . LYS A 1 67 ? 11.415  2.156   4.410   1.00 0.00 ? 67  LYS A O    5  
ATOM   5659  C  CB   . LYS A 1 67 ? 9.830   5.014   3.290   1.00 0.00 ? 67  LYS A CB   5  
ATOM   5660  C  CG   . LYS A 1 67 ? 10.441  5.541   4.577   1.00 0.00 ? 67  LYS A CG   5  
ATOM   5661  C  CD   . LYS A 1 67 ? 9.651   6.716   5.129   1.00 0.00 ? 67  LYS A CD   5  
ATOM   5662  C  CE   . LYS A 1 67 ? 10.146  8.037   4.561   1.00 0.00 ? 67  LYS A CE   5  
ATOM   5663  N  NZ   . LYS A 1 67 ? 9.579   8.307   3.210   1.00 0.00 ? 67  LYS A NZ   5  
ATOM   5664  H  H    . LYS A 1 67 ? 8.988   3.723   1.276   1.00 0.00 ? 67  LYS A H    5  
ATOM   5665  H  HA   . LYS A 1 67 ? 11.437  3.817   2.536   1.00 0.00 ? 67  LYS A HA   5  
ATOM   5666  H  HB2  . LYS A 1 67 ? 9.997   5.744   2.512   1.00 0.00 ? 67  LYS A HB2  5  
ATOM   5667  H  HB3  . LYS A 1 67 ? 8.767   4.899   3.442   1.00 0.00 ? 67  LYS A HB3  5  
ATOM   5668  H  HG2  . LYS A 1 67 ? 10.449  4.750   5.312   1.00 0.00 ? 67  LYS A HG2  5  
ATOM   5669  H  HG3  . LYS A 1 67 ? 11.454  5.862   4.379   1.00 0.00 ? 67  LYS A HG3  5  
ATOM   5670  H  HD2  . LYS A 1 67 ? 8.610   6.593   4.869   1.00 0.00 ? 67  LYS A HD2  5  
ATOM   5671  H  HD3  . LYS A 1 67 ? 9.756   6.735   6.205   1.00 0.00 ? 67  LYS A HD3  5  
ATOM   5672  H  HE2  . LYS A 1 67 ? 9.856   8.833   5.229   1.00 0.00 ? 67  LYS A HE2  5  
ATOM   5673  H  HE3  . LYS A 1 67 ? 11.223  8.002   4.489   1.00 0.00 ? 67  LYS A HE3  5  
ATOM   5674  H  HZ1  . LYS A 1 67 ? 8.841   9.037   3.272   1.00 0.00 ? 67  LYS A HZ1  5  
ATOM   5675  H  HZ2  . LYS A 1 67 ? 9.160   7.439   2.819   1.00 0.00 ? 67  LYS A HZ2  5  
ATOM   5676  H  HZ3  . LYS A 1 67 ? 10.327  8.638   2.568   1.00 0.00 ? 67  LYS A HZ3  5  
ATOM   5677  N  N    . HIS A 1 68 ? 9.183   2.421   4.518   1.00 0.00 ? 68  HIS A N    5  
ATOM   5678  C  CA   . HIS A 1 68 ? 9.015   1.488   5.626   1.00 0.00 ? 68  HIS A CA   5  
ATOM   5679  C  C    . HIS A 1 68 ? 9.264   0.053   5.171   1.00 0.00 ? 68  HIS A C    5  
ATOM   5680  O  O    . HIS A 1 68 ? 10.098  -0.652  5.738   1.00 0.00 ? 68  HIS A O    5  
ATOM   5681  C  CB   . HIS A 1 68 ? 7.611   1.612   6.217   1.00 0.00 ? 68  HIS A CB   5  
ATOM   5682  C  CG   . HIS A 1 68 ? 7.500   2.658   7.283   1.00 0.00 ? 68  HIS A CG   5  
ATOM   5683  N  ND1  . HIS A 1 68 ? 6.761   3.813   7.132   1.00 0.00 ? 68  HIS A ND1  5  
ATOM   5684  C  CD2  . HIS A 1 68 ? 8.038   2.718   8.524   1.00 0.00 ? 68  HIS A CD2  5  
ATOM   5685  C  CE1  . HIS A 1 68 ? 6.851   4.538   8.232   1.00 0.00 ? 68  HIS A CE1  5  
ATOM   5686  N  NE2  . HIS A 1 68 ? 7.620   3.896   9.093   1.00 0.00 ? 68  HIS A NE2  5  
ATOM   5687  H  H    . HIS A 1 68 ? 8.395   2.869   4.146   1.00 0.00 ? 68  HIS A H    5  
ATOM   5688  H  HA   . HIS A 1 68 ? 9.739   1.742   6.386   1.00 0.00 ? 68  HIS A HA   5  
ATOM   5689  H  HB2  . HIS A 1 68 ? 6.917   1.868   5.429   1.00 0.00 ? 68  HIS A HB2  5  
ATOM   5690  H  HB3  . HIS A 1 68 ? 7.324   0.665   6.649   1.00 0.00 ? 68  HIS A HB3  5  
ATOM   5691  H  HD2  . HIS A 1 68 ? 8.678   1.978   8.982   1.00 0.00 ? 68  HIS A HD2  5  
ATOM   5692  H  HE1  . HIS A 1 68 ? 6.376   5.493   8.400   1.00 0.00 ? 68  HIS A HE1  5  
ATOM   5693  H  HE2  . HIS A 1 68 ? 7.921   4.252   9.955   1.00 0.00 ? 68  HIS A HE2  5  
ATOM   5694  N  N    . ALA A 1 69 ? 8.534   -0.372  4.145   1.00 0.00 ? 69  ALA A N    5  
ATOM   5695  C  CA   . ALA A 1 69 ? 8.676   -1.721  3.614   1.00 0.00 ? 69  ALA A CA   5  
ATOM   5696  C  C    . ALA A 1 69 ? 10.122  -2.197  3.702   1.00 0.00 ? 69  ALA A C    5  
ATOM   5697  O  O    . ALA A 1 69 ? 10.418  -3.193  4.362   1.00 0.00 ? 69  ALA A O    5  
ATOM   5698  C  CB   . ALA A 1 69 ? 8.188   -1.776  2.174   1.00 0.00 ? 69  ALA A CB   5  
ATOM   5699  H  H    . ALA A 1 69 ? 7.885   0.238   3.735   1.00 0.00 ? 69  ALA A H    5  
ATOM   5700  H  HA   . ALA A 1 69 ? 8.054   -2.380  4.204   1.00 0.00 ? 69  ALA A HA   5  
ATOM   5701  H  HB1  . ALA A 1 69 ? 8.342   -2.769  1.779   1.00 0.00 ? 69  ALA A HB1  5  
ATOM   5702  H  HB2  . ALA A 1 69 ? 7.136   -1.534  2.141   1.00 0.00 ? 69  ALA A HB2  5  
ATOM   5703  H  HB3  . ALA A 1 69 ? 8.740   -1.062  1.580   1.00 0.00 ? 69  ALA A HB3  5  
ATOM   5704  N  N    . ARG A 1 70 ? 11.018  -1.479  3.034   1.00 0.00 ? 70  ARG A N    5  
ATOM   5705  C  CA   . ARG A 1 70 ? 12.433  -1.829  3.036   1.00 0.00 ? 70  ARG A CA   5  
ATOM   5706  C  C    . ARG A 1 70 ? 12.924  -2.100  4.455   1.00 0.00 ? 70  ARG A C    5  
ATOM   5707  O  O    . ARG A 1 70 ? 13.622  -3.082  4.703   1.00 0.00 ? 70  ARG A O    5  
ATOM   5708  C  CB   . ARG A 1 70 ? 13.259  -0.707  2.404   1.00 0.00 ? 70  ARG A CB   5  
ATOM   5709  C  CG   . ARG A 1 70 ? 13.103  -0.611  0.895   1.00 0.00 ? 70  ARG A CG   5  
ATOM   5710  C  CD   . ARG A 1 70 ? 14.158  0.296   0.283   1.00 0.00 ? 70  ARG A CD   5  
ATOM   5711  N  NE   . ARG A 1 70 ? 14.086  0.313   -1.176  1.00 0.00 ? 70  ARG A NE   5  
ATOM   5712  C  CZ   . ARG A 1 70 ? 14.621  -0.626  -1.949  1.00 0.00 ? 70  ARG A CZ   5  
ATOM   5713  N  NH1  . ARG A 1 70 ? 15.265  -1.650  -1.405  1.00 0.00 ? 70  ARG A NH1  5  
ATOM   5714  N  NH2  . ARG A 1 70 ? 14.513  -0.541  -3.269  1.00 0.00 ? 70  ARG A NH2  5  
ATOM   5715  H  H    . ARG A 1 70 ? 10.721  -0.695  2.526   1.00 0.00 ? 70  ARG A H    5  
ATOM   5716  H  HA   . ARG A 1 70 ? 12.554  -2.727  2.449   1.00 0.00 ? 70  ARG A HA   5  
ATOM   5717  H  HB2  . ARG A 1 70 ? 12.956  0.235   2.836   1.00 0.00 ? 70  ARG A HB2  5  
ATOM   5718  H  HB3  . ARG A 1 70 ? 14.302  -0.876  2.626   1.00 0.00 ? 70  ARG A HB3  5  
ATOM   5719  H  HG2  . ARG A 1 70 ? 13.201  -1.598  0.469   1.00 0.00 ? 70  ARG A HG2  5  
ATOM   5720  H  HG3  . ARG A 1 70 ? 12.124  -0.214  0.669   1.00 0.00 ? 70  ARG A HG3  5  
ATOM   5721  H  HD2  . ARG A 1 70 ? 14.010  1.300   0.652   1.00 0.00 ? 70  ARG A HD2  5  
ATOM   5722  H  HD3  . ARG A 1 70 ? 15.134  -0.056  0.582   1.00 0.00 ? 70  ARG A HD3  5  
ATOM   5723  H  HE   . ARG A 1 70 ? 13.615  1.060   -1.599  1.00 0.00 ? 70  ARG A HE   5  
ATOM   5724  H  HH11 . ARG A 1 70 ? 15.347  -1.716  -0.411  1.00 0.00 ? 70  ARG A HH11 5  
ATOM   5725  H  HH12 . ARG A 1 70 ? 15.666  -2.355  -1.989  1.00 0.00 ? 70  ARG A HH12 5  
ATOM   5726  H  HH21 . ARG A 1 70 ? 14.029  0.229   -3.682  1.00 0.00 ? 70  ARG A HH21 5  
ATOM   5727  H  HH22 . ARG A 1 70 ? 14.917  -1.247  -3.849  1.00 0.00 ? 70  ARG A HH22 5  
ATOM   5728  N  N    . GLU A 1 71 ? 12.554  -1.221  5.381   1.00 0.00 ? 71  GLU A N    5  
ATOM   5729  C  CA   . GLU A 1 71 ? 12.959  -1.365  6.775   1.00 0.00 ? 71  GLU A CA   5  
ATOM   5730  C  C    . GLU A 1 71 ? 12.417  -2.663  7.367   1.00 0.00 ? 71  GLU A C    5  
ATOM   5731  O  O    . GLU A 1 71 ? 13.098  -3.336  8.141   1.00 0.00 ? 71  GLU A O    5  
ATOM   5732  C  CB   . GLU A 1 71 ? 12.467  -0.172  7.598   1.00 0.00 ? 71  GLU A CB   5  
ATOM   5733  C  CG   . GLU A 1 71 ? 13.026  1.161   7.130   1.00 0.00 ? 71  GLU A CG   5  
ATOM   5734  C  CD   . GLU A 1 71 ? 14.334  1.516   7.809   1.00 0.00 ? 71  GLU A CD   5  
ATOM   5735  O  OE1  . GLU A 1 71 ? 15.364  0.893   7.473   1.00 0.00 ? 71  GLU A OE1  5  
ATOM   5736  O  OE2  . GLU A 1 71 ? 14.329  2.415   8.676   1.00 0.00 ? 71  GLU A OE2  5  
ATOM   5737  H  H    . GLU A 1 71 ? 11.997  -0.458  5.121   1.00 0.00 ? 71  GLU A H    5  
ATOM   5738  H  HA   . GLU A 1 71 ? 14.037  -1.392  6.806   1.00 0.00 ? 71  GLU A HA   5  
ATOM   5739  H  HB2  . GLU A 1 71 ? 11.390  -0.129  7.539   1.00 0.00 ? 71  GLU A HB2  5  
ATOM   5740  H  HB3  . GLU A 1 71 ? 12.756  -0.318  8.628   1.00 0.00 ? 71  GLU A HB3  5  
ATOM   5741  H  HG2  . GLU A 1 71 ? 13.192  1.113   6.064   1.00 0.00 ? 71  GLU A HG2  5  
ATOM   5742  H  HG3  . GLU A 1 71 ? 12.304  1.935   7.346   1.00 0.00 ? 71  GLU A HG3  5  
ATOM   5743  N  N    . ARG A 1 72 ? 11.188  -3.007  6.998   1.00 0.00 ? 72  ARG A N    5  
ATOM   5744  C  CA   . ARG A 1 72 ? 10.553  -4.223  7.493   1.00 0.00 ? 72  ARG A CA   5  
ATOM   5745  C  C    . ARG A 1 72 ? 11.243  -5.463  6.932   1.00 0.00 ? 72  ARG A C    5  
ATOM   5746  O  O    . ARG A 1 72 ? 11.710  -6.320  7.683   1.00 0.00 ? 72  ARG A O    5  
ATOM   5747  C  CB   . ARG A 1 72 ? 9.070   -4.238  7.120   1.00 0.00 ? 72  ARG A CB   5  
ATOM   5748  C  CG   . ARG A 1 72 ? 8.211   -3.348  8.003   1.00 0.00 ? 72  ARG A CG   5  
ATOM   5749  C  CD   . ARG A 1 72 ? 6.731   -3.528  7.703   1.00 0.00 ? 72  ARG A CD   5  
ATOM   5750  N  NE   . ARG A 1 72 ? 5.895   -2.661  8.530   1.00 0.00 ? 72  ARG A NE   5  
ATOM   5751  C  CZ   . ARG A 1 72 ? 5.695   -2.855  9.829   1.00 0.00 ? 72  ARG A CZ   5  
ATOM   5752  N  NH1  . ARG A 1 72 ? 6.268   -3.880  10.445  1.00 0.00 ? 72  ARG A NH1  5  
ATOM   5753  N  NH2  . ARG A 1 72 ? 4.922   -2.023  10.514  1.00 0.00 ? 72  ARG A NH2  5  
ATOM   5754  H  H    . ARG A 1 72 ? 10.695  -2.429  6.378   1.00 0.00 ? 72  ARG A H    5  
ATOM   5755  H  HA   . ARG A 1 72 ? 10.645  -4.230  8.569   1.00 0.00 ? 72  ARG A HA   5  
ATOM   5756  H  HB2  . ARG A 1 72 ? 8.964   -3.904  6.098   1.00 0.00 ? 72  ARG A HB2  5  
ATOM   5757  H  HB3  . ARG A 1 72 ? 8.702   -5.250  7.199   1.00 0.00 ? 72  ARG A HB3  5  
ATOM   5758  H  HG2  . ARG A 1 72 ? 8.390   -3.601  9.037   1.00 0.00 ? 72  ARG A HG2  5  
ATOM   5759  H  HG3  . ARG A 1 72 ? 8.482   -2.317  7.830   1.00 0.00 ? 72  ARG A HG3  5  
ATOM   5760  H  HD2  . ARG A 1 72 ? 6.557   -3.293  6.663   1.00 0.00 ? 72  ARG A HD2  5  
ATOM   5761  H  HD3  . ARG A 1 72 ? 6.462   -4.557  7.890   1.00 0.00 ? 72  ARG A HD3  5  
ATOM   5762  H  HE   . ARG A 1 72 ? 5.463   -1.898  8.095   1.00 0.00 ? 72  ARG A HE   5  
ATOM   5763  H  HH11 . ARG A 1 72 ? 6.853   -4.508  9.932   1.00 0.00 ? 72  ARG A HH11 5  
ATOM   5764  H  HH12 . ARG A 1 72 ? 6.117   -4.023  11.424  1.00 0.00 ? 72  ARG A HH12 5  
ATOM   5765  H  HH21 . ARG A 1 72 ? 4.489   -1.249  10.053  1.00 0.00 ? 72  ARG A HH21 5  
ATOM   5766  H  HH22 . ARG A 1 72 ? 4.772   -2.170  11.491  1.00 0.00 ? 72  ARG A HH22 5  
ATOM   5767  N  N    . VAL A 1 73 ? 11.302  -5.553  5.607   1.00 0.00 ? 73  VAL A N    5  
ATOM   5768  C  CA   . VAL A 1 73 ? 11.935  -6.687  4.945   1.00 0.00 ? 73  VAL A CA   5  
ATOM   5769  C  C    . VAL A 1 73 ? 13.414  -6.777  5.302   1.00 0.00 ? 73  VAL A C    5  
ATOM   5770  O  O    . VAL A 1 73 ? 13.988  -7.865  5.348   1.00 0.00 ? 73  VAL A O    5  
ATOM   5771  C  CB   . VAL A 1 73 ? 11.791  -6.595  3.415   1.00 0.00 ? 73  VAL A CB   5  
ATOM   5772  C  CG1  . VAL A 1 73 ? 12.356  -5.279  2.903   1.00 0.00 ? 73  VAL A CG1  5  
ATOM   5773  C  CG2  . VAL A 1 73 ? 12.477  -7.776  2.744   1.00 0.00 ? 73  VAL A CG2  5  
ATOM   5774  H  H    . VAL A 1 73 ? 10.912  -4.838  5.062   1.00 0.00 ? 73  VAL A H    5  
ATOM   5775  H  HA   . VAL A 1 73 ? 11.439  -7.587  5.279   1.00 0.00 ? 73  VAL A HA   5  
ATOM   5776  H  HB   . VAL A 1 73 ? 10.740  -6.630  3.169   1.00 0.00 ? 73  VAL A HB   5  
ATOM   5777  H  HG11 . VAL A 1 73 ? 13.262  -5.043  3.441   1.00 0.00 ? 73  VAL A HG11 5  
ATOM   5778  H  HG12 . VAL A 1 73 ? 12.574  -5.366  1.849   1.00 0.00 ? 73  VAL A HG12 5  
ATOM   5779  H  HG13 . VAL A 1 73 ? 11.632  -4.493  3.058   1.00 0.00 ? 73  VAL A HG13 5  
ATOM   5780  H  HG21 . VAL A 1 73 ? 11.967  -8.689  3.014   1.00 0.00 ? 73  VAL A HG21 5  
ATOM   5781  H  HG22 . VAL A 1 73 ? 12.445  -7.650  1.671   1.00 0.00 ? 73  VAL A HG22 5  
ATOM   5782  H  HG23 . VAL A 1 73 ? 13.505  -7.828  3.069   1.00 0.00 ? 73  VAL A HG23 5  
ATOM   5783  N  N    . SER A 1 74 ? 14.027  -5.624  5.553   1.00 0.00 ? 74  SER A N    5  
ATOM   5784  C  CA   . SER A 1 74 ? 15.442  -5.572  5.903   1.00 0.00 ? 74  SER A CA   5  
ATOM   5785  C  C    . SER A 1 74 ? 15.627  -5.529  7.416   1.00 0.00 ? 74  SER A C    5  
ATOM   5786  O  O    . SER A 1 74 ? 16.698  -5.185  7.913   1.00 0.00 ? 74  SER A O    5  
ATOM   5787  C  CB   . SER A 1 74 ? 16.102  -4.349  5.263   1.00 0.00 ? 74  SER A CB   5  
ATOM   5788  O  OG   . SER A 1 74 ? 17.510  -4.390  5.416   1.00 0.00 ? 74  SER A OG   5  
ATOM   5789  H  H    . SER A 1 74 ? 13.516  -4.790  5.500   1.00 0.00 ? 74  SER A H    5  
ATOM   5790  H  HA   . SER A 1 74 ? 15.912  -6.465  5.519   1.00 0.00 ? 74  SER A HA   5  
ATOM   5791  H  HB2  . SER A 1 74 ? 15.867  -4.326  4.209   1.00 0.00 ? 74  SER A HB2  5  
ATOM   5792  H  HB3  . SER A 1 74 ? 15.726  -3.452  5.734   1.00 0.00 ? 74  SER A HB3  5  
ATOM   5793  H  HG   . SER A 1 74 ? 17.756  -3.950  6.233   1.00 0.00 ? 74  SER A HG   5  
ATOM   5794  N  N    . GLY A 1 75 ? 14.572  -5.882  8.145   1.00 0.00 ? 75  GLY A N    5  
ATOM   5795  C  CA   . GLY A 1 75 ? 14.637  -5.878  9.595   1.00 0.00 ? 75  GLY A CA   5  
ATOM   5796  C  C    . GLY A 1 75 ? 15.631  -6.887  10.134  1.00 0.00 ? 75  GLY A C    5  
ATOM   5797  O  O    . GLY A 1 75 ? 16.267  -7.626  9.382   1.00 0.00 ? 75  GLY A O    5  
ATOM   5798  H  H    . GLY A 1 75 ? 13.743  -6.147  7.695   1.00 0.00 ? 75  GLY A H    5  
ATOM   5799  H  HA2  . GLY A 1 75 ? 14.923  -4.892  9.929   1.00 0.00 ? 75  GLY A HA2  5  
ATOM   5800  H  HA3  . GLY A 1 75 ? 13.658  -6.110  9.988   1.00 0.00 ? 75  GLY A HA3  5  
ATOM   5801  N  N    . PRO A 1 76 ? 15.778  -6.926  11.466  1.00 0.00 ? 76  PRO A N    5  
ATOM   5802  C  CA   . PRO A 1 76 ? 16.702  -7.847  12.135  1.00 0.00 ? 76  PRO A CA   5  
ATOM   5803  C  C    . PRO A 1 76 ? 16.241  -9.297  12.045  1.00 0.00 ? 76  PRO A C    5  
ATOM   5804  O  O    . PRO A 1 76 ? 15.324  -9.712  12.754  1.00 0.00 ? 76  PRO A O    5  
ATOM   5805  C  CB   . PRO A 1 76 ? 16.688  -7.370  13.589  1.00 0.00 ? 76  PRO A CB   5  
ATOM   5806  C  CG   . PRO A 1 76 ? 15.370  -6.697  13.755  1.00 0.00 ? 76  PRO A CG   5  
ATOM   5807  C  CD   . PRO A 1 76 ? 15.053  -6.073  12.423  1.00 0.00 ? 76  PRO A CD   5  
ATOM   5808  H  HA   . PRO A 1 76 ? 17.703  -7.763  11.736  1.00 0.00 ? 76  PRO A HA   5  
ATOM   5809  H  HB2  . PRO A 1 76 ? 16.785  -8.220  14.250  1.00 0.00 ? 76  PRO A HB2  5  
ATOM   5810  H  HB3  . PRO A 1 76 ? 17.505  -6.683  13.754  1.00 0.00 ? 76  PRO A HB3  5  
ATOM   5811  H  HG2  . PRO A 1 76 ? 14.617  -7.425  14.017  1.00 0.00 ? 76  PRO A HG2  5  
ATOM   5812  H  HG3  . PRO A 1 76 ? 15.439  -5.936  14.517  1.00 0.00 ? 76  PRO A HG3  5  
ATOM   5813  H  HD2  . PRO A 1 76 ? 13.990  -6.102  12.237  1.00 0.00 ? 76  PRO A HD2  5  
ATOM   5814  H  HD3  . PRO A 1 76 ? 15.417  -5.057  12.387  1.00 0.00 ? 76  PRO A HD3  5  
ATOM   5815  N  N    . SER A 1 77 ? 16.882  -10.065 11.170  1.00 0.00 ? 77  SER A N    5  
ATOM   5816  C  CA   . SER A 1 77 ? 16.535  -11.469 10.986  1.00 0.00 ? 77  SER A CA   5  
ATOM   5817  C  C    . SER A 1 77 ? 17.075  -12.317 12.133  1.00 0.00 ? 77  SER A C    5  
ATOM   5818  O  O    . SER A 1 77 ? 16.316  -12.980 12.840  1.00 0.00 ? 77  SER A O    5  
ATOM   5819  C  CB   . SER A 1 77 ? 17.086  -11.982 9.654   1.00 0.00 ? 77  SER A CB   5  
ATOM   5820  O  OG   . SER A 1 77 ? 16.551  -13.255 9.337   1.00 0.00 ? 77  SER A OG   5  
ATOM   5821  H  H    . SER A 1 77 ? 17.605  -9.676  10.633  1.00 0.00 ? 77  SER A H    5  
ATOM   5822  H  HA   . SER A 1 77 ? 15.458  -11.545 10.973  1.00 0.00 ? 77  SER A HA   5  
ATOM   5823  H  HB2  . SER A 1 77 ? 16.825  -11.289 8.868   1.00 0.00 ? 77  SER A HB2  5  
ATOM   5824  H  HB3  . SER A 1 77 ? 18.162  -12.063 9.720   1.00 0.00 ? 77  SER A HB3  5  
ATOM   5825  H  HG   . SER A 1 77 ? 17.118  -13.940 9.699   1.00 0.00 ? 77  SER A HG   5  
ATOM   5826  N  N    . SER A 1 78 ? 18.392  -12.291 12.311  1.00 0.00 ? 78  SER A N    5  
ATOM   5827  C  CA   . SER A 1 78 ? 19.035  -13.060 13.370  1.00 0.00 ? 78  SER A CA   5  
ATOM   5828  C  C    . SER A 1 78 ? 19.986  -12.181 14.179  1.00 0.00 ? 78  SER A C    5  
ATOM   5829  O  O    . SER A 1 78 ? 20.687  -11.334 13.627  1.00 0.00 ? 78  SER A O    5  
ATOM   5830  C  CB   . SER A 1 78 ? 19.799  -14.245 12.777  1.00 0.00 ? 78  SER A CB   5  
ATOM   5831  O  OG   . SER A 1 78 ? 18.934  -15.344 12.545  1.00 0.00 ? 78  SER A OG   5  
ATOM   5832  H  H    . SER A 1 78 ? 18.944  -11.742 11.715  1.00 0.00 ? 78  SER A H    5  
ATOM   5833  H  HA   . SER A 1 78 ? 18.262  -13.432 14.026  1.00 0.00 ? 78  SER A HA   5  
ATOM   5834  H  HB2  . SER A 1 78 ? 20.245  -13.949 11.839  1.00 0.00 ? 78  SER A HB2  5  
ATOM   5835  H  HB3  . SER A 1 78 ? 20.574  -14.551 13.464  1.00 0.00 ? 78  SER A HB3  5  
ATOM   5836  H  HG   . SER A 1 78 ? 18.056  -15.021 12.332  1.00 0.00 ? 78  SER A HG   5  
ATOM   5837  N  N    . GLY A 1 79 ? 20.003  -12.391 15.492  1.00 0.00 ? 79  GLY A N    5  
ATOM   5838  C  CA   . GLY A 1 79 ? 20.869  -11.612 16.356  1.00 0.00 ? 79  GLY A CA   5  
ATOM   5839  C  C    . GLY A 1 79 ? 20.189  -11.211 17.650  1.00 0.00 ? 79  GLY A C    5  
ATOM   5840  O  O    . GLY A 1 79 ? 19.519  -12.045 18.258  1.00 0.00 ? 79  GLY A O    5  
ATOM   5841  H  H    . GLY A 1 79 ? 19.422  -13.080 15.876  1.00 0.00 ? 79  GLY A H    5  
ATOM   5842  H  HA2  . GLY A 1 79 ? 21.747  -12.196 16.589  1.00 0.00 ? 79  GLY A HA2  5  
ATOM   5843  H  HA3  . GLY A 1 79 ? 21.173  -10.718 15.831  1.00 0.00 ? 79  GLY A HA3  5  
HETATM 5844  ZN ZN   . ZN  B 2 .  ? -11.028 -0.301  3.518   1.00 0.00 ? 201 ZN  A ZN   5  
HETATM 5845  ZN ZN   . ZN  C 2 .  ? 5.246   3.917   5.794   1.00 0.00 ? 401 ZN  A ZN   5  
ATOM   5846  N  N    . GLY A 1 1  ? -19.928 8.229   -3.847  1.00 0.00 ? 1   GLY A N    6  
ATOM   5847  C  CA   . GLY A 1 1  ? -21.163 8.698   -3.246  1.00 0.00 ? 1   GLY A CA   6  
ATOM   5848  C  C    . GLY A 1 1  ? -22.005 7.566   -2.692  1.00 0.00 ? 1   GLY A C    6  
ATOM   5849  O  O    . GLY A 1 1  ? -22.029 6.470   -3.253  1.00 0.00 ? 1   GLY A O    6  
ATOM   5850  H  H1   . GLY A 1 1  ? -19.265 7.760   -3.298  1.00 0.00 ? 1   GLY A H1   6  
ATOM   5851  H  HA2  . GLY A 1 1  ? -20.924 9.381   -2.444  1.00 0.00 ? 1   GLY A HA2  6  
ATOM   5852  H  HA3  . GLY A 1 1  ? -21.736 9.225   -3.994  1.00 0.00 ? 1   GLY A HA3  6  
ATOM   5853  N  N    . SER A 1 2  ? -22.696 7.830   -1.588  1.00 0.00 ? 2   SER A N    6  
ATOM   5854  C  CA   . SER A 1 2  ? -23.538 6.822   -0.955  1.00 0.00 ? 2   SER A CA   6  
ATOM   5855  C  C    . SER A 1 2  ? -25.016 7.127   -1.185  1.00 0.00 ? 2   SER A C    6  
ATOM   5856  O  O    . SER A 1 2  ? -25.395 8.275   -1.418  1.00 0.00 ? 2   SER A O    6  
ATOM   5857  C  CB   . SER A 1 2  ? -23.248 6.753   0.546   1.00 0.00 ? 2   SER A CB   6  
ATOM   5858  O  OG   . SER A 1 2  ? -23.741 7.902   1.214   1.00 0.00 ? 2   SER A OG   6  
ATOM   5859  H  H    . SER A 1 2  ? -22.635 8.723   -1.188  1.00 0.00 ? 2   SER A H    6  
ATOM   5860  H  HA   . SER A 1 2  ? -23.306 5.867   -1.402  1.00 0.00 ? 2   SER A HA   6  
ATOM   5861  H  HB2  . SER A 1 2  ? -23.723 5.878   0.962   1.00 0.00 ? 2   SER A HB2  6  
ATOM   5862  H  HB3  . SER A 1 2  ? -22.180 6.692   0.701   1.00 0.00 ? 2   SER A HB3  6  
ATOM   5863  H  HG   . SER A 1 2  ? -23.235 8.672   0.944   1.00 0.00 ? 2   SER A HG   6  
ATOM   5864  N  N    . SER A 1 3  ? -25.845 6.090   -1.118  1.00 0.00 ? 3   SER A N    6  
ATOM   5865  C  CA   . SER A 1 3  ? -27.280 6.245   -1.322  1.00 0.00 ? 3   SER A CA   6  
ATOM   5866  C  C    . SER A 1 3  ? -27.976 6.631   -0.021  1.00 0.00 ? 3   SER A C    6  
ATOM   5867  O  O    . SER A 1 3  ? -28.692 7.630   0.041   1.00 0.00 ? 3   SER A O    6  
ATOM   5868  C  CB   . SER A 1 3  ? -27.881 4.949   -1.870  1.00 0.00 ? 3   SER A CB   6  
ATOM   5869  O  OG   . SER A 1 3  ? -29.297 4.984   -1.824  1.00 0.00 ? 3   SER A OG   6  
ATOM   5870  H  H    . SER A 1 3  ? -25.482 5.200   -0.928  1.00 0.00 ? 3   SER A H    6  
ATOM   5871  H  HA   . SER A 1 3  ? -27.429 7.034   -2.044  1.00 0.00 ? 3   SER A HA   6  
ATOM   5872  H  HB2  . SER A 1 3  ? -27.570 4.816   -2.895  1.00 0.00 ? 3   SER A HB2  6  
ATOM   5873  H  HB3  . SER A 1 3  ? -27.534 4.116   -1.277  1.00 0.00 ? 3   SER A HB3  6  
ATOM   5874  H  HG   . SER A 1 3  ? -29.645 5.067   -2.715  1.00 0.00 ? 3   SER A HG   6  
ATOM   5875  N  N    . GLY A 1 4  ? -27.759 5.832   1.019   1.00 0.00 ? 4   GLY A N    6  
ATOM   5876  C  CA   . GLY A 1 4  ? -28.371 6.105   2.306   1.00 0.00 ? 4   GLY A CA   6  
ATOM   5877  C  C    . GLY A 1 4  ? -29.872 6.298   2.205   1.00 0.00 ? 4   GLY A C    6  
ATOM   5878  O  O    . GLY A 1 4  ? -30.344 7.388   1.885   1.00 0.00 ? 4   GLY A O    6  
ATOM   5879  H  H    . GLY A 1 4  ? -27.178 5.049   0.912   1.00 0.00 ? 4   GLY A H    6  
ATOM   5880  H  HA2  . GLY A 1 4  ? -28.169 5.280   2.972   1.00 0.00 ? 4   GLY A HA2  6  
ATOM   5881  H  HA3  . GLY A 1 4  ? -27.932 7.002   2.717   1.00 0.00 ? 4   GLY A HA3  6  
ATOM   5882  N  N    . SER A 1 5  ? -30.623 5.235   2.476   1.00 0.00 ? 5   SER A N    6  
ATOM   5883  C  CA   . SER A 1 5  ? -32.078 5.291   2.409   1.00 0.00 ? 5   SER A CA   6  
ATOM   5884  C  C    . SER A 1 5  ? -32.705 4.232   3.311   1.00 0.00 ? 5   SER A C    6  
ATOM   5885  O  O    . SER A 1 5  ? -32.184 3.124   3.440   1.00 0.00 ? 5   SER A O    6  
ATOM   5886  C  CB   . SER A 1 5  ? -32.551 5.093   0.967   1.00 0.00 ? 5   SER A CB   6  
ATOM   5887  O  OG   . SER A 1 5  ? -32.425 6.290   0.220   1.00 0.00 ? 5   SER A OG   6  
ATOM   5888  H  H    . SER A 1 5  ? -30.187 4.393   2.726   1.00 0.00 ? 5   SER A H    6  
ATOM   5889  H  HA   . SER A 1 5  ? -32.389 6.267   2.750   1.00 0.00 ? 5   SER A HA   6  
ATOM   5890  H  HB2  . SER A 1 5  ? -31.955 4.325   0.498   1.00 0.00 ? 5   SER A HB2  6  
ATOM   5891  H  HB3  . SER A 1 5  ? -33.589 4.792   0.970   1.00 0.00 ? 5   SER A HB3  6  
ATOM   5892  H  HG   . SER A 1 5  ? -33.159 6.874   0.424   1.00 0.00 ? 5   SER A HG   6  
ATOM   5893  N  N    . SER A 1 6  ? -33.825 4.582   3.934   1.00 0.00 ? 6   SER A N    6  
ATOM   5894  C  CA   . SER A 1 6  ? -34.522 3.664   4.828   1.00 0.00 ? 6   SER A CA   6  
ATOM   5895  C  C    . SER A 1 6  ? -35.214 2.557   4.038   1.00 0.00 ? 6   SER A C    6  
ATOM   5896  O  O    . SER A 1 6  ? -35.868 2.815   3.029   1.00 0.00 ? 6   SER A O    6  
ATOM   5897  C  CB   . SER A 1 6  ? -35.548 4.422   5.672   1.00 0.00 ? 6   SER A CB   6  
ATOM   5898  O  OG   . SER A 1 6  ? -36.497 5.081   4.852   1.00 0.00 ? 6   SER A OG   6  
ATOM   5899  H  H    . SER A 1 6  ? -34.191 5.480   3.791   1.00 0.00 ? 6   SER A H    6  
ATOM   5900  H  HA   . SER A 1 6  ? -33.788 3.219   5.483   1.00 0.00 ? 6   SER A HA   6  
ATOM   5901  H  HB2  . SER A 1 6  ? -36.067 3.726   6.314   1.00 0.00 ? 6   SER A HB2  6  
ATOM   5902  H  HB3  . SER A 1 6  ? -35.039 5.159   6.277   1.00 0.00 ? 6   SER A HB3  6  
ATOM   5903  H  HG   . SER A 1 6  ? -36.422 4.757   3.951   1.00 0.00 ? 6   SER A HG   6  
ATOM   5904  N  N    . GLY A 1 7  ? -35.064 1.322   4.507   1.00 0.00 ? 7   GLY A N    6  
ATOM   5905  C  CA   . GLY A 1 7  ? -35.679 0.193   3.834   1.00 0.00 ? 7   GLY A CA   6  
ATOM   5906  C  C    . GLY A 1 7  ? -35.063 -1.131  4.241   1.00 0.00 ? 7   GLY A C    6  
ATOM   5907  O  O    . GLY A 1 7  ? -34.683 -1.317  5.397   1.00 0.00 ? 7   GLY A O    6  
ATOM   5908  H  H    . GLY A 1 7  ? -34.530 1.176   5.317   1.00 0.00 ? 7   GLY A H    6  
ATOM   5909  H  HA2  . GLY A 1 7  ? -36.732 0.177   4.071   1.00 0.00 ? 7   GLY A HA2  6  
ATOM   5910  H  HA3  . GLY A 1 7  ? -35.562 0.318   2.767   1.00 0.00 ? 7   GLY A HA3  6  
ATOM   5911  N  N    . SER A 1 8  ? -34.965 -2.053  3.289   1.00 0.00 ? 8   SER A N    6  
ATOM   5912  C  CA   . SER A 1 8  ? -34.396 -3.369  3.556   1.00 0.00 ? 8   SER A CA   6  
ATOM   5913  C  C    . SER A 1 8  ? -32.945 -3.439  3.087   1.00 0.00 ? 8   SER A C    6  
ATOM   5914  O  O    . SER A 1 8  ? -32.531 -2.689  2.203   1.00 0.00 ? 8   SER A O    6  
ATOM   5915  C  CB   . SER A 1 8  ? -35.221 -4.455  2.863   1.00 0.00 ? 8   SER A CB   6  
ATOM   5916  O  OG   . SER A 1 8  ? -36.376 -4.777  3.618   1.00 0.00 ? 8   SER A OG   6  
ATOM   5917  H  H    . SER A 1 8  ? -35.285 -1.845  2.387   1.00 0.00 ? 8   SER A H    6  
ATOM   5918  H  HA   . SER A 1 8  ? -34.425 -3.533  4.623   1.00 0.00 ? 8   SER A HA   6  
ATOM   5919  H  HB2  . SER A 1 8  ? -35.528 -4.104  1.890   1.00 0.00 ? 8   SER A HB2  6  
ATOM   5920  H  HB3  . SER A 1 8  ? -34.618 -5.345  2.752   1.00 0.00 ? 8   SER A HB3  6  
ATOM   5921  H  HG   . SER A 1 8  ? -36.367 -4.287  4.443   1.00 0.00 ? 8   SER A HG   6  
ATOM   5922  N  N    . ILE A 1 9  ? -32.180 -4.346  3.686   1.00 0.00 ? 9   ILE A N    6  
ATOM   5923  C  CA   . ILE A 1 9  ? -30.777 -4.515  3.329   1.00 0.00 ? 9   ILE A CA   6  
ATOM   5924  C  C    . ILE A 1 9  ? -30.562 -5.802  2.540   1.00 0.00 ? 9   ILE A C    6  
ATOM   5925  O  O    . ILE A 1 9  ? -31.297 -6.774  2.705   1.00 0.00 ? 9   ILE A O    6  
ATOM   5926  C  CB   . ILE A 1 9  ? -29.877 -4.536  4.579   1.00 0.00 ? 9   ILE A CB   6  
ATOM   5927  C  CG1  . ILE A 1 9  ? -30.246 -5.716  5.480   1.00 0.00 ? 9   ILE A CG1  6  
ATOM   5928  C  CG2  . ILE A 1 9  ? -29.997 -3.224  5.340   1.00 0.00 ? 9   ILE A CG2  6  
ATOM   5929  C  CD1  . ILE A 1 9  ? -29.550 -7.005  5.103   1.00 0.00 ? 9   ILE A CD1  6  
ATOM   5930  H  H    . ILE A 1 9  ? -32.568 -4.914  4.383   1.00 0.00 ? 9   ILE A H    6  
ATOM   5931  H  HA   . ILE A 1 9  ? -30.486 -3.675  2.714   1.00 0.00 ? 9   ILE A HA   6  
ATOM   5932  H  HB   . ILE A 1 9  ? -28.853 -4.645  4.256   1.00 0.00 ? 9   ILE A HB   6  
ATOM   5933  H  HG12 . ILE A 1 9  ? -29.978 -5.481  6.498   1.00 0.00 ? 9   ILE A HG12 6  
ATOM   5934  H  HG13 . ILE A 1 9  ? -31.312 -5.884  5.422   1.00 0.00 ? 9   ILE A HG13 6  
ATOM   5935  H  HG21 . ILE A 1 9  ? -31.025 -2.895  5.329   1.00 0.00 ? 9   ILE A HG21 6  
ATOM   5936  H  HG22 . ILE A 1 9  ? -29.677 -3.370  6.361   1.00 0.00 ? 9   ILE A HG22 6  
ATOM   5937  H  HG23 . ILE A 1 9  ? -29.374 -2.477  4.870   1.00 0.00 ? 9   ILE A HG23 6  
ATOM   5938  H  HD11 . ILE A 1 9  ? -29.267 -7.538  5.999   1.00 0.00 ? 9   ILE A HD11 6  
ATOM   5939  H  HD12 . ILE A 1 9  ? -30.217 -7.617  4.515   1.00 0.00 ? 9   ILE A HD12 6  
ATOM   5940  H  HD13 . ILE A 1 9  ? -28.665 -6.780  4.525   1.00 0.00 ? 9   ILE A HD13 6  
ATOM   5941  N  N    . GLY A 1 10 ? -29.546 -5.801  1.682   1.00 0.00 ? 10  GLY A N    6  
ATOM   5942  C  CA   . GLY A 1 10 ? -29.251 -6.974  0.880   1.00 0.00 ? 10  GLY A CA   6  
ATOM   5943  C  C    . GLY A 1 10 ? -28.689 -6.620  -0.482  1.00 0.00 ? 10  GLY A C    6  
ATOM   5944  O  O    . GLY A 1 10 ? -29.159 -5.686  -1.131  1.00 0.00 ? 10  GLY A O    6  
ATOM   5945  H  H    . GLY A 1 10 ? -28.993 -4.997  1.591   1.00 0.00 ? 10  GLY A H    6  
ATOM   5946  H  HA2  . GLY A 1 10 ? -28.532 -7.585  1.407   1.00 0.00 ? 10  GLY A HA2  6  
ATOM   5947  H  HA3  . GLY A 1 10 ? -30.160 -7.542  0.745   1.00 0.00 ? 10  GLY A HA3  6  
ATOM   5948  N  N    . ASN A 1 11 ? -27.679 -7.366  -0.917  1.00 0.00 ? 11  ASN A N    6  
ATOM   5949  C  CA   . ASN A 1 11 ? -27.051 -7.124  -2.211  1.00 0.00 ? 11  ASN A CA   6  
ATOM   5950  C  C    . ASN A 1 11 ? -26.857 -8.431  -2.974  1.00 0.00 ? 11  ASN A C    6  
ATOM   5951  O  O    . ASN A 1 11 ? -26.021 -9.256  -2.609  1.00 0.00 ? 11  ASN A O    6  
ATOM   5952  C  CB   . ASN A 1 11 ? -25.704 -6.424  -2.024  1.00 0.00 ? 11  ASN A CB   6  
ATOM   5953  C  CG   . ASN A 1 11 ? -25.835 -5.103  -1.292  1.00 0.00 ? 11  ASN A CG   6  
ATOM   5954  O  OD1  . ASN A 1 11 ? -26.910 -4.505  -1.255  1.00 0.00 ? 11  ASN A OD1  6  
ATOM   5955  N  ND2  . ASN A 1 11 ? -24.738 -4.641  -0.703  1.00 0.00 ? 11  ASN A ND2  6  
ATOM   5956  H  H    . ASN A 1 11 ? -27.348 -8.097  -0.355  1.00 0.00 ? 11  ASN A H    6  
ATOM   5957  H  HA   . ASN A 1 11 ? -27.705 -6.481  -2.781  1.00 0.00 ? 11  ASN A HA   6  
ATOM   5958  H  HB2  . ASN A 1 11 ? -25.048 -7.066  -1.454  1.00 0.00 ? 11  ASN A HB2  6  
ATOM   5959  H  HB3  . ASN A 1 11 ? -25.265 -6.237  -2.992  1.00 0.00 ? 11  ASN A HB3  6  
ATOM   5960  H  HD21 . ASN A 1 11 ? -23.916 -5.171  -0.774  1.00 0.00 ? 11  ASN A HD21 6  
ATOM   5961  H  HD22 . ASN A 1 11 ? -24.794 -3.789  -0.222  1.00 0.00 ? 11  ASN A HD22 6  
ATOM   5962  N  N    . ALA A 1 12 ? -27.636 -8.610  -4.036  1.00 0.00 ? 12  ALA A N    6  
ATOM   5963  C  CA   . ALA A 1 12 ? -27.548 -9.814  -4.853  1.00 0.00 ? 12  ALA A CA   6  
ATOM   5964  C  C    . ALA A 1 12 ? -26.126 -10.031 -5.360  1.00 0.00 ? 12  ALA A C    6  
ATOM   5965  O  O    . ALA A 1 12 ? -25.530 -11.084 -5.130  1.00 0.00 ? 12  ALA A O    6  
ATOM   5966  C  CB   . ALA A 1 12 ? -28.519 -9.732  -6.021  1.00 0.00 ? 12  ALA A CB   6  
ATOM   5967  H  H    . ALA A 1 12 ? -28.283 -7.916  -4.277  1.00 0.00 ? 12  ALA A H    6  
ATOM   5968  H  HA   . ALA A 1 12 ? -27.832 -10.656 -4.238  1.00 0.00 ? 12  ALA A HA   6  
ATOM   5969  H  HB1  . ALA A 1 12 ? -29.467 -10.163 -5.731  1.00 0.00 ? 12  ALA A HB1  6  
ATOM   5970  H  HB2  . ALA A 1 12 ? -28.663 -8.698  -6.298  1.00 0.00 ? 12  ALA A HB2  6  
ATOM   5971  H  HB3  . ALA A 1 12 ? -28.118 -10.278 -6.862  1.00 0.00 ? 12  ALA A HB3  6  
ATOM   5972  N  N    . GLN A 1 13 ? -25.589 -9.030  -6.050  1.00 0.00 ? 13  GLN A N    6  
ATOM   5973  C  CA   . GLN A 1 13 ? -24.237 -9.114  -6.590  1.00 0.00 ? 13  GLN A CA   6  
ATOM   5974  C  C    . GLN A 1 13 ? -23.201 -9.090  -5.470  1.00 0.00 ? 13  GLN A C    6  
ATOM   5975  O  O    . GLN A 1 13 ? -23.183 -8.176  -4.646  1.00 0.00 ? 13  GLN A O    6  
ATOM   5976  C  CB   . GLN A 1 13 ? -23.981 -7.961  -7.562  1.00 0.00 ? 13  GLN A CB   6  
ATOM   5977  C  CG   . GLN A 1 13 ? -24.831 -8.027  -8.821  1.00 0.00 ? 13  GLN A CG   6  
ATOM   5978  C  CD   . GLN A 1 13 ? -24.967 -6.680  -9.504  1.00 0.00 ? 13  GLN A CD   6  
ATOM   5979  O  OE1  . GLN A 1 13 ? -25.173 -5.657  -8.850  1.00 0.00 ? 13  GLN A OE1  6  
ATOM   5980  N  NE2  . GLN A 1 13 ? -24.853 -6.673  -10.827 1.00 0.00 ? 13  GLN A NE2  6  
ATOM   5981  H  H    . GLN A 1 13 ? -26.114 -8.217  -6.199  1.00 0.00 ? 13  GLN A H    6  
ATOM   5982  H  HA   . GLN A 1 13 ? -24.151 -10.048 -7.123  1.00 0.00 ? 13  GLN A HA   6  
ATOM   5983  H  HB2  . GLN A 1 13 ? -24.192 -7.028  -7.059  1.00 0.00 ? 13  GLN A HB2  6  
ATOM   5984  H  HB3  . GLN A 1 13 ? -22.942 -7.976  -7.854  1.00 0.00 ? 13  GLN A HB3  6  
ATOM   5985  H  HG2  . GLN A 1 13 ? -24.374 -8.719  -9.512  1.00 0.00 ? 13  GLN A HG2  6  
ATOM   5986  H  HG3  . GLN A 1 13 ? -25.816 -8.382  -8.556  1.00 0.00 ? 13  GLN A HG3  6  
ATOM   5987  H  HE21 . GLN A 1 13 ? -24.691 -7.527  -11.282 1.00 0.00 ? 13  GLN A HE21 6  
ATOM   5988  H  HE22 . GLN A 1 13 ? -24.938 -5.817  -11.294 1.00 0.00 ? 13  GLN A HE22 6  
ATOM   5989  N  N    . LYS A 1 14 ? -22.340 -10.101 -5.447  1.00 0.00 ? 14  LYS A N    6  
ATOM   5990  C  CA   . LYS A 1 14 ? -21.300 -10.197 -4.430  1.00 0.00 ? 14  LYS A CA   6  
ATOM   5991  C  C    . LYS A 1 14 ? -20.292 -9.061  -4.573  1.00 0.00 ? 14  LYS A C    6  
ATOM   5992  O  O    . LYS A 1 14 ? -20.112 -8.511  -5.660  1.00 0.00 ? 14  LYS A O    6  
ATOM   5993  C  CB   . LYS A 1 14 ? -20.582 -11.545 -4.531  1.00 0.00 ? 14  LYS A CB   6  
ATOM   5994  C  CG   . LYS A 1 14 ? -19.941 -11.992 -3.228  1.00 0.00 ? 14  LYS A CG   6  
ATOM   5995  C  CD   . LYS A 1 14 ? -19.318 -13.372 -3.358  1.00 0.00 ? 14  LYS A CD   6  
ATOM   5996  C  CE   . LYS A 1 14 ? -20.322 -14.469 -3.039  1.00 0.00 ? 14  LYS A CE   6  
ATOM   5997  N  NZ   . LYS A 1 14 ? -19.844 -15.806 -3.489  1.00 0.00 ? 14  LYS A NZ   6  
ATOM   5998  H  H    . LYS A 1 14 ? -22.405 -10.800 -6.132  1.00 0.00 ? 14  LYS A H    6  
ATOM   5999  H  HA   . LYS A 1 14 ? -21.773 -10.123 -3.463  1.00 0.00 ? 14  LYS A HA   6  
ATOM   6000  H  HB2  . LYS A 1 14 ? -21.295 -12.297 -4.834  1.00 0.00 ? 14  LYS A HB2  6  
ATOM   6001  H  HB3  . LYS A 1 14 ? -19.808 -11.472 -5.281  1.00 0.00 ? 14  LYS A HB3  6  
ATOM   6002  H  HG2  . LYS A 1 14 ? -19.171 -11.286 -2.955  1.00 0.00 ? 14  LYS A HG2  6  
ATOM   6003  H  HG3  . LYS A 1 14 ? -20.697 -12.020 -2.457  1.00 0.00 ? 14  LYS A HG3  6  
ATOM   6004  H  HD2  . LYS A 1 14 ? -18.966 -13.505 -4.370  1.00 0.00 ? 14  LYS A HD2  6  
ATOM   6005  H  HD3  . LYS A 1 14 ? -18.486 -13.447 -2.672  1.00 0.00 ? 14  LYS A HD3  6  
ATOM   6006  H  HE2  . LYS A 1 14 ? -20.482 -14.493 -1.972  1.00 0.00 ? 14  LYS A HE2  6  
ATOM   6007  H  HE3  . LYS A 1 14 ? -21.253 -14.242 -3.538  1.00 0.00 ? 14  LYS A HE3  6  
ATOM   6008  H  HZ1  . LYS A 1 14 ? -20.411 -16.556 -3.044  1.00 0.00 ? 14  LYS A HZ1  6  
ATOM   6009  H  HZ2  . LYS A 1 14 ? -18.847 -15.937 -3.223  1.00 0.00 ? 14  LYS A HZ2  6  
ATOM   6010  H  HZ3  . LYS A 1 14 ? -19.929 -15.887 -4.522  1.00 0.00 ? 14  LYS A HZ3  6  
ATOM   6011  N  N    . LEU A 1 15 ? -19.637 -8.715  -3.470  1.00 0.00 ? 15  LEU A N    6  
ATOM   6012  C  CA   . LEU A 1 15 ? -18.646 -7.644  -3.473  1.00 0.00 ? 15  LEU A CA   6  
ATOM   6013  C  C    . LEU A 1 15 ? -17.425 -8.031  -2.645  1.00 0.00 ? 15  LEU A C    6  
ATOM   6014  O  O    . LEU A 1 15 ? -17.533 -8.646  -1.584  1.00 0.00 ? 15  LEU A O    6  
ATOM   6015  C  CB   . LEU A 1 15 ? -19.259 -6.354  -2.927  1.00 0.00 ? 15  LEU A CB   6  
ATOM   6016  C  CG   . LEU A 1 15 ? -20.556 -5.892  -3.593  1.00 0.00 ? 15  LEU A CG   6  
ATOM   6017  C  CD1  . LEU A 1 15 ? -21.212 -4.789  -2.777  1.00 0.00 ? 15  LEU A CD1  6  
ATOM   6018  C  CD2  . LEU A 1 15 ? -20.286 -5.418  -5.014  1.00 0.00 ? 15  LEU A CD2  6  
ATOM   6019  H  H    . LEU A 1 15 ? -19.824 -9.189  -2.634  1.00 0.00 ? 15  LEU A H    6  
ATOM   6020  H  HA   . LEU A 1 15 ? -18.337 -7.482  -4.495  1.00 0.00 ? 15  LEU A HA   6  
ATOM   6021  H  HB2  . LEU A 1 15 ? -19.462 -6.502  -1.877  1.00 0.00 ? 15  LEU A HB2  6  
ATOM   6022  H  HB3  . LEU A 1 15 ? -18.528 -5.566  -3.043  1.00 0.00 ? 15  LEU A HB3  6  
ATOM   6023  H  HG   . LEU A 1 15 ? -21.244 -6.724  -3.642  1.00 0.00 ? 15  LEU A HG   6  
ATOM   6024  H  HD11 . LEU A 1 15 ? -21.544 -4.002  -3.437  1.00 0.00 ? 15  LEU A HD11 6  
ATOM   6025  H  HD12 . LEU A 1 15 ? -20.498 -4.390  -2.072  1.00 0.00 ? 15  LEU A HD12 6  
ATOM   6026  H  HD13 . LEU A 1 15 ? -22.059 -5.193  -2.241  1.00 0.00 ? 15  LEU A HD13 6  
ATOM   6027  H  HD21 . LEU A 1 15 ? -21.213 -5.395  -5.567  1.00 0.00 ? 15  LEU A HD21 6  
ATOM   6028  H  HD22 . LEU A 1 15 ? -19.596 -6.097  -5.495  1.00 0.00 ? 15  LEU A HD22 6  
ATOM   6029  H  HD23 . LEU A 1 15 ? -19.857 -4.427  -4.987  1.00 0.00 ? 15  LEU A HD23 6  
ATOM   6030  N  N    . PRO A 1 16 ? -16.234 -7.660  -3.138  1.00 0.00 ? 16  PRO A N    6  
ATOM   6031  C  CA   . PRO A 1 16 ? -14.969 -7.955  -2.459  1.00 0.00 ? 16  PRO A CA   6  
ATOM   6032  C  C    . PRO A 1 16 ? -14.798 -7.149  -1.176  1.00 0.00 ? 16  PRO A C    6  
ATOM   6033  O  O    . PRO A 1 16 ? -14.667 -5.926  -1.214  1.00 0.00 ? 16  PRO A O    6  
ATOM   6034  C  CB   . PRO A 1 16 ? -13.911 -7.553  -3.488  1.00 0.00 ? 16  PRO A CB   6  
ATOM   6035  C  CG   . PRO A 1 16 ? -14.580 -6.530  -4.340  1.00 0.00 ? 16  PRO A CG   6  
ATOM   6036  C  CD   . PRO A 1 16 ? -16.030 -6.925  -4.398  1.00 0.00 ? 16  PRO A CD   6  
ATOM   6037  H  HA   . PRO A 1 16 ? -14.875 -9.008  -2.236  1.00 0.00 ? 16  PRO A HA   6  
ATOM   6038  H  HB2  . PRO A 1 16 ? -13.049 -7.142  -2.981  1.00 0.00 ? 16  PRO A HB2  6  
ATOM   6039  H  HB3  . PRO A 1 16 ? -13.618 -8.416  -4.066  1.00 0.00 ? 16  PRO A HB3  6  
ATOM   6040  H  HG2  . PRO A 1 16 ? -14.475 -5.553  -3.893  1.00 0.00 ? 16  PRO A HG2  6  
ATOM   6041  H  HG3  . PRO A 1 16 ? -14.150 -6.539  -5.331  1.00 0.00 ? 16  PRO A HG3  6  
ATOM   6042  H  HD2  . PRO A 1 16 ? -16.659 -6.047  -4.438  1.00 0.00 ? 16  PRO A HD2  6  
ATOM   6043  H  HD3  . PRO A 1 16 ? -16.214 -7.562  -5.250  1.00 0.00 ? 16  PRO A HD3  6  
ATOM   6044  N  N    . MET A 1 17 ? -14.801 -7.842  -0.042  1.00 0.00 ? 17  MET A N    6  
ATOM   6045  C  CA   . MET A 1 17 ? -14.645 -7.188  1.253   1.00 0.00 ? 17  MET A CA   6  
ATOM   6046  C  C    . MET A 1 17 ? -13.233 -6.634  1.415   1.00 0.00 ? 17  MET A C    6  
ATOM   6047  O  O    . MET A 1 17 ? -12.249 -7.334  1.176   1.00 0.00 ? 17  MET A O    6  
ATOM   6048  C  CB   . MET A 1 17 ? -14.952 -8.171  2.384   1.00 0.00 ? 17  MET A CB   6  
ATOM   6049  C  CG   . MET A 1 17 ? -16.426 -8.234  2.751   1.00 0.00 ? 17  MET A CG   6  
ATOM   6050  S  SD   . MET A 1 17 ? -16.726 -9.168  4.264   1.00 0.00 ? 17  MET A SD   6  
ATOM   6051  C  CE   . MET A 1 17 ? -17.796 -8.038  5.151   1.00 0.00 ? 17  MET A CE   6  
ATOM   6052  H  H    . MET A 1 17 ? -14.910 -8.815  -0.076  1.00 0.00 ? 17  MET A H    6  
ATOM   6053  H  HA   . MET A 1 17 ? -15.348 -6.370  1.298   1.00 0.00 ? 17  MET A HA   6  
ATOM   6054  H  HB2  . MET A 1 17 ? -14.636 -9.159  2.083   1.00 0.00 ? 17  MET A HB2  6  
ATOM   6055  H  HB3  . MET A 1 17 ? -14.398 -7.876  3.263   1.00 0.00 ? 17  MET A HB3  6  
ATOM   6056  H  HG2  . MET A 1 17 ? -16.794 -7.228  2.887   1.00 0.00 ? 17  MET A HG2  6  
ATOM   6057  H  HG3  . MET A 1 17 ? -16.964 -8.705  1.941   1.00 0.00 ? 17  MET A HG3  6  
ATOM   6058  H  HE1  . MET A 1 17 ? -17.656 -8.169  6.214   1.00 0.00 ? 17  MET A HE1  6  
ATOM   6059  H  HE2  . MET A 1 17 ? -17.553 -7.022  4.879   1.00 0.00 ? 17  MET A HE2  6  
ATOM   6060  H  HE3  . MET A 1 17 ? -18.826 -8.243  4.896   1.00 0.00 ? 17  MET A HE3  6  
ATOM   6061  N  N    . CYS A 1 18 ? -13.141 -5.372  1.821   1.00 0.00 ? 18  CYS A N    6  
ATOM   6062  C  CA   . CYS A 1 18 ? -11.850 -4.722  2.014   1.00 0.00 ? 18  CYS A CA   6  
ATOM   6063  C  C    . CYS A 1 18 ? -10.991 -5.504  3.004   1.00 0.00 ? 18  CYS A C    6  
ATOM   6064  O  O    . CYS A 1 18 ? -11.492 -6.354  3.741   1.00 0.00 ? 18  CYS A O    6  
ATOM   6065  C  CB   . CYS A 1 18 ? -12.047 -3.289  2.512   1.00 0.00 ? 18  CYS A CB   6  
ATOM   6066  S  SG   . CYS A 1 18 ? -10.503 -2.330  2.644   1.00 0.00 ? 18  CYS A SG   6  
ATOM   6067  H  H    . CYS A 1 18 ? -13.962 -4.864  1.995   1.00 0.00 ? 18  CYS A H    6  
ATOM   6068  H  HA   . CYS A 1 18 ? -11.346 -4.697  1.061   1.00 0.00 ? 18  CYS A HA   6  
ATOM   6069  H  HB2  . CYS A 1 18 ? -12.701 -2.766  1.830   1.00 0.00 ? 18  CYS A HB2  6  
ATOM   6070  H  HB3  . CYS A 1 18 ? -12.503 -3.316  3.491   1.00 0.00 ? 18  CYS A HB3  6  
ATOM   6071  N  N    . ASP A 1 19 ? -9.696  -5.209  3.016   1.00 0.00 ? 19  ASP A N    6  
ATOM   6072  C  CA   . ASP A 1 19 ? -8.767  -5.882  3.916   1.00 0.00 ? 19  ASP A CA   6  
ATOM   6073  C  C    . ASP A 1 19 ? -8.501  -5.034  5.155   1.00 0.00 ? 19  ASP A C    6  
ATOM   6074  O  O    . ASP A 1 19 ? -8.472  -5.544  6.276   1.00 0.00 ? 19  ASP A O    6  
ATOM   6075  C  CB   . ASP A 1 19 ? -7.451  -6.181  3.195   1.00 0.00 ? 19  ASP A CB   6  
ATOM   6076  C  CG   . ASP A 1 19 ? -6.392  -6.734  4.128   1.00 0.00 ? 19  ASP A CG   6  
ATOM   6077  O  OD1  . ASP A 1 19 ? -6.763  -7.279  5.189   1.00 0.00 ? 19  ASP A OD1  6  
ATOM   6078  O  OD2  . ASP A 1 19 ? -5.193  -6.621  3.798   1.00 0.00 ? 19  ASP A OD2  6  
ATOM   6079  H  H    . ASP A 1 19 ? -9.357  -4.522  2.404   1.00 0.00 ? 19  ASP A H    6  
ATOM   6080  H  HA   . ASP A 1 19 ? -9.218  -6.814  4.222   1.00 0.00 ? 19  ASP A HA   6  
ATOM   6081  H  HB2  . ASP A 1 19 ? -7.632  -6.907  2.416   1.00 0.00 ? 19  ASP A HB2  6  
ATOM   6082  H  HB3  . ASP A 1 19 ? -7.076  -5.270  2.752   1.00 0.00 ? 19  ASP A HB3  6  
ATOM   6083  N  N    . LYS A 1 20 ? -8.305  -3.736  4.947   1.00 0.00 ? 20  LYS A N    6  
ATOM   6084  C  CA   . LYS A 1 20 ? -8.041  -2.816  6.047   1.00 0.00 ? 20  LYS A CA   6  
ATOM   6085  C  C    . LYS A 1 20 ? -9.257  -2.697  6.961   1.00 0.00 ? 20  LYS A C    6  
ATOM   6086  O  O    . LYS A 1 20 ? -9.243  -3.177  8.095   1.00 0.00 ? 20  LYS A O    6  
ATOM   6087  C  CB   . LYS A 1 20 ? -7.661  -1.437  5.504   1.00 0.00 ? 20  LYS A CB   6  
ATOM   6088  C  CG   . LYS A 1 20 ? -7.201  -0.466  6.579   1.00 0.00 ? 20  LYS A CG   6  
ATOM   6089  C  CD   . LYS A 1 20 ? -6.099  0.448   6.069   1.00 0.00 ? 20  LYS A CD   6  
ATOM   6090  C  CE   . LYS A 1 20 ? -5.866  1.619   7.012   1.00 0.00 ? 20  LYS A CE   6  
ATOM   6091  N  NZ   . LYS A 1 20 ? -4.432  2.016   7.060   1.00 0.00 ? 20  LYS A NZ   6  
ATOM   6092  H  H    . LYS A 1 20 ? -8.340  -3.389  4.031   1.00 0.00 ? 20  LYS A H    6  
ATOM   6093  H  HA   . LYS A 1 20 ? -7.214  -3.210  6.618   1.00 0.00 ? 20  LYS A HA   6  
ATOM   6094  H  HB2  . LYS A 1 20 ? -6.862  -1.553  4.787   1.00 0.00 ? 20  LYS A HB2  6  
ATOM   6095  H  HB3  . LYS A 1 20 ? -8.520  -1.009  5.007   1.00 0.00 ? 20  LYS A HB3  6  
ATOM   6096  H  HG2  . LYS A 1 20 ? -8.040  0.138   6.889   1.00 0.00 ? 20  LYS A HG2  6  
ATOM   6097  H  HG3  . LYS A 1 20 ? -6.827  -1.029  7.423   1.00 0.00 ? 20  LYS A HG3  6  
ATOM   6098  H  HD2  . LYS A 1 20 ? -5.184  -0.118  5.983   1.00 0.00 ? 20  LYS A HD2  6  
ATOM   6099  H  HD3  . LYS A 1 20 ? -6.381  0.830   5.098   1.00 0.00 ? 20  LYS A HD3  6  
ATOM   6100  H  HE2  . LYS A 1 20 ? -6.452  2.459   6.673   1.00 0.00 ? 20  LYS A HE2  6  
ATOM   6101  H  HE3  . LYS A 1 20 ? -6.186  1.334   8.004   1.00 0.00 ? 20  LYS A HE3  6  
ATOM   6102  H  HZ1  . LYS A 1 20 ? -4.095  2.251   6.104   1.00 0.00 ? 20  LYS A HZ1  6  
ATOM   6103  H  HZ2  . LYS A 1 20 ? -3.857  1.234   7.435   1.00 0.00 ? 20  LYS A HZ2  6  
ATOM   6104  H  HZ3  . LYS A 1 20 ? -4.311  2.847   7.673   1.00 0.00 ? 20  LYS A HZ3  6  
ATOM   6105  N  N    . CYS A 1 21 ? -10.307 -2.056  6.460   1.00 0.00 ? 21  CYS A N    6  
ATOM   6106  C  CA   . CYS A 1 21 ? -11.532 -1.875  7.230   1.00 0.00 ? 21  CYS A CA   6  
ATOM   6107  C  C    . CYS A 1 21 ? -12.337 -3.170  7.285   1.00 0.00 ? 21  CYS A C    6  
ATOM   6108  O  O    . CYS A 1 21 ? -12.800 -3.581  8.348   1.00 0.00 ? 21  CYS A O    6  
ATOM   6109  C  CB   . CYS A 1 21 ? -12.382 -0.759  6.620   1.00 0.00 ? 21  CYS A CB   6  
ATOM   6110  S  SG   . CYS A 1 21 ? -12.559 -0.863  4.810   1.00 0.00 ? 21  CYS A SG   6  
ATOM   6111  H  H    . CYS A 1 21 ? -10.258 -1.696  5.549   1.00 0.00 ? 21  CYS A H    6  
ATOM   6112  H  HA   . CYS A 1 21 ? -11.254 -1.596  8.235   1.00 0.00 ? 21  CYS A HA   6  
ATOM   6113  H  HB2  . CYS A 1 21 ? -13.373 -0.797  7.049   1.00 0.00 ? 21  CYS A HB2  6  
ATOM   6114  H  HB3  . CYS A 1 21 ? -11.931 0.194   6.853   1.00 0.00 ? 21  CYS A HB3  6  
ATOM   6115  N  N    . GLY A 1 22 ? -12.498 -3.810  6.130   1.00 0.00 ? 22  GLY A N    6  
ATOM   6116  C  CA   . GLY A 1 22 ? -13.246 -5.052  6.068   1.00 0.00 ? 22  GLY A CA   6  
ATOM   6117  C  C    . GLY A 1 22 ? -14.713 -4.830  5.755   1.00 0.00 ? 22  GLY A C    6  
ATOM   6118  O  O    . GLY A 1 22 ? -15.589 -5.269  6.501   1.00 0.00 ? 22  GLY A O    6  
ATOM   6119  H  H    . GLY A 1 22 ? -12.105 -3.436  5.314   1.00 0.00 ? 22  GLY A H    6  
ATOM   6120  H  HA2  . GLY A 1 22 ? -12.817 -5.681  5.303   1.00 0.00 ? 22  GLY A HA2  6  
ATOM   6121  H  HA3  . GLY A 1 22 ? -13.166 -5.555  7.021   1.00 0.00 ? 22  GLY A HA3  6  
ATOM   6122  N  N    . THR A 1 23 ? -14.983 -4.145  4.649   1.00 0.00 ? 23  THR A N    6  
ATOM   6123  C  CA   . THR A 1 23 ? -16.353 -3.862  4.240   1.00 0.00 ? 23  THR A CA   6  
ATOM   6124  C  C    . THR A 1 23 ? -16.536 -4.081  2.742   1.00 0.00 ? 23  THR A C    6  
ATOM   6125  O  O    . THR A 1 23 ? -15.694 -3.681  1.939   1.00 0.00 ? 23  THR A O    6  
ATOM   6126  C  CB   . THR A 1 23 ? -16.757 -2.418  4.589   1.00 0.00 ? 23  THR A CB   6  
ATOM   6127  O  OG1  . THR A 1 23 ? -15.867 -1.493  3.955   1.00 0.00 ? 23  THR A OG1  6  
ATOM   6128  C  CG2  . THR A 1 23 ? -16.736 -2.199  6.094   1.00 0.00 ? 23  THR A CG2  6  
ATOM   6129  H  H    . THR A 1 23 ? -14.242 -3.821  4.095   1.00 0.00 ? 23  THR A H    6  
ATOM   6130  H  HA   . THR A 1 23 ? -17.006 -4.536  4.774   1.00 0.00 ? 23  THR A HA   6  
ATOM   6131  H  HB   . THR A 1 23 ? -17.762 -2.244  4.229   1.00 0.00 ? 23  THR A HB   6  
ATOM   6132  H  HG1  . THR A 1 23 ? -15.364 -1.023  4.624   1.00 0.00 ? 23  THR A HG1  6  
ATOM   6133  H  HG21 . THR A 1 23 ? -15.832 -2.623  6.507   1.00 0.00 ? 23  THR A HG21 6  
ATOM   6134  H  HG22 . THR A 1 23 ? -17.595 -2.678  6.540   1.00 0.00 ? 23  THR A HG22 6  
ATOM   6135  H  HG23 . THR A 1 23 ? -16.764 -1.140  6.304   1.00 0.00 ? 23  THR A HG23 6  
ATOM   6136  N  N    . GLY A 1 24 ? -17.643 -4.717  2.372   1.00 0.00 ? 24  GLY A N    6  
ATOM   6137  C  CA   . GLY A 1 24 ? -17.916 -4.977  0.971   1.00 0.00 ? 24  GLY A CA   6  
ATOM   6138  C  C    . GLY A 1 24 ? -17.650 -3.769  0.094   1.00 0.00 ? 24  GLY A C    6  
ATOM   6139  O  O    . GLY A 1 24 ? -18.397 -2.791  0.130   1.00 0.00 ? 24  GLY A O    6  
ATOM   6140  H  H    . GLY A 1 24 ? -18.280 -5.013  3.057   1.00 0.00 ? 24  GLY A H    6  
ATOM   6141  H  HA2  . GLY A 1 24 ? -17.294 -5.794  0.639   1.00 0.00 ? 24  GLY A HA2  6  
ATOM   6142  H  HA3  . GLY A 1 24 ? -18.953 -5.262  0.865   1.00 0.00 ? 24  GLY A HA3  6  
ATOM   6143  N  N    . ILE A 1 25 ? -16.581 -3.836  -0.692  1.00 0.00 ? 25  ILE A N    6  
ATOM   6144  C  CA   . ILE A 1 25 ? -16.218 -2.739  -1.581  1.00 0.00 ? 25  ILE A CA   6  
ATOM   6145  C  C    . ILE A 1 25 ? -17.247 -2.569  -2.693  1.00 0.00 ? 25  ILE A C    6  
ATOM   6146  O  O    . ILE A 1 25 ? -17.711 -3.547  -3.279  1.00 0.00 ? 25  ILE A O    6  
ATOM   6147  C  CB   . ILE A 1 25 ? -14.830 -2.961  -2.210  1.00 0.00 ? 25  ILE A CB   6  
ATOM   6148  C  CG1  . ILE A 1 25 ? -13.753 -2.999  -1.124  1.00 0.00 ? 25  ILE A CG1  6  
ATOM   6149  C  CG2  . ILE A 1 25 ? -14.527 -1.868  -3.224  1.00 0.00 ? 25  ILE A CG2  6  
ATOM   6150  C  CD1  . ILE A 1 25 ? -12.543 -3.824  -1.501  1.00 0.00 ? 25  ILE A CD1  6  
ATOM   6151  H  H    . ILE A 1 25 ? -16.025 -4.642  -0.676  1.00 0.00 ? 25  ILE A H    6  
ATOM   6152  H  HA   . ILE A 1 25 ? -16.184 -1.832  -0.994  1.00 0.00 ? 25  ILE A HA   6  
ATOM   6153  H  HB   . ILE A 1 25 ? -14.841 -3.907  -2.729  1.00 0.00 ? 25  ILE A HB   6  
ATOM   6154  H  HG12 . ILE A 1 25 ? -13.418 -1.994  -0.921  1.00 0.00 ? 25  ILE A HG12 6  
ATOM   6155  H  HG13 . ILE A 1 25 ? -14.176 -3.421  -0.223  1.00 0.00 ? 25  ILE A HG13 6  
ATOM   6156  H  HG21 . ILE A 1 25 ? -14.279 -2.317  -4.175  1.00 0.00 ? 25  ILE A HG21 6  
ATOM   6157  H  HG22 . ILE A 1 25 ? -15.395 -1.236  -3.342  1.00 0.00 ? 25  ILE A HG22 6  
ATOM   6158  H  HG23 . ILE A 1 25 ? -13.694 -1.275  -2.878  1.00 0.00 ? 25  ILE A HG23 6  
ATOM   6159  H  HD11 . ILE A 1 25 ? -11.695 -3.513  -0.908  1.00 0.00 ? 25  ILE A HD11 6  
ATOM   6160  H  HD12 . ILE A 1 25 ? -12.747 -4.868  -1.319  1.00 0.00 ? 25  ILE A HD12 6  
ATOM   6161  H  HD13 . ILE A 1 25 ? -12.321 -3.679  -2.549  1.00 0.00 ? 25  ILE A HD13 6  
ATOM   6162  N  N    . VAL A 1 26 ? -17.597 -1.319  -2.982  1.00 0.00 ? 26  VAL A N    6  
ATOM   6163  C  CA   . VAL A 1 26 ? -18.569 -1.020  -4.026  1.00 0.00 ? 26  VAL A CA   6  
ATOM   6164  C  C    . VAL A 1 26 ? -18.048 0.059   -4.969  1.00 0.00 ? 26  VAL A C    6  
ATOM   6165  O  O    . VAL A 1 26 ? -17.804 1.192   -4.559  1.00 0.00 ? 26  VAL A O    6  
ATOM   6166  C  CB   . VAL A 1 26 ? -19.911 -0.558  -3.428  1.00 0.00 ? 26  VAL A CB   6  
ATOM   6167  C  CG1  . VAL A 1 26 ? -19.717 0.688   -2.578  1.00 0.00 ? 26  VAL A CG1  6  
ATOM   6168  C  CG2  . VAL A 1 26 ? -20.928 -0.307  -4.532  1.00 0.00 ? 26  VAL A CG2  6  
ATOM   6169  H  H    . VAL A 1 26 ? -17.192 -0.582  -2.480  1.00 0.00 ? 26  VAL A H    6  
ATOM   6170  H  HA   . VAL A 1 26 ? -18.743 -1.925  -4.590  1.00 0.00 ? 26  VAL A HA   6  
ATOM   6171  H  HB   . VAL A 1 26 ? -20.289 -1.345  -2.793  1.00 0.00 ? 26  VAL A HB   6  
ATOM   6172  H  HG11 . VAL A 1 26 ? -19.546 1.539   -3.222  1.00 0.00 ? 26  VAL A HG11 6  
ATOM   6173  H  HG12 . VAL A 1 26 ? -20.600 0.859   -1.981  1.00 0.00 ? 26  VAL A HG12 6  
ATOM   6174  H  HG13 . VAL A 1 26 ? -18.864 0.552   -1.930  1.00 0.00 ? 26  VAL A HG13 6  
ATOM   6175  H  HG21 . VAL A 1 26 ? -21.150 0.749   -4.582  1.00 0.00 ? 26  VAL A HG21 6  
ATOM   6176  H  HG22 . VAL A 1 26 ? -20.521 -0.634  -5.478  1.00 0.00 ? 26  VAL A HG22 6  
ATOM   6177  H  HG23 . VAL A 1 26 ? -21.833 -0.857  -4.321  1.00 0.00 ? 26  VAL A HG23 6  
ATOM   6178  N  N    . GLY A 1 27 ? -17.879 -0.303  -6.238  1.00 0.00 ? 27  GLY A N    6  
ATOM   6179  C  CA   . GLY A 1 27 ? -17.387 0.645   -7.220  1.00 0.00 ? 27  GLY A CA   6  
ATOM   6180  C  C    . GLY A 1 27 ? -15.897 0.508   -7.463  1.00 0.00 ? 27  GLY A C    6  
ATOM   6181  O  O    . GLY A 1 27 ? -15.393 -0.596  -7.668  1.00 0.00 ? 27  GLY A O    6  
ATOM   6182  H  H    . GLY A 1 27 ? -18.090 -1.221  -6.508  1.00 0.00 ? 27  GLY A H    6  
ATOM   6183  H  HA2  . GLY A 1 27 ? -17.909 0.485   -8.152  1.00 0.00 ? 27  GLY A HA2  6  
ATOM   6184  H  HA3  . GLY A 1 27 ? -17.593 1.646   -6.872  1.00 0.00 ? 27  GLY A HA3  6  
ATOM   6185  N  N    . VAL A 1 28 ? -15.190 1.634   -7.442  1.00 0.00 ? 28  VAL A N    6  
ATOM   6186  C  CA   . VAL A 1 28 ? -13.749 1.635   -7.662  1.00 0.00 ? 28  VAL A CA   6  
ATOM   6187  C  C    . VAL A 1 28 ? -13.010 1.045   -6.466  1.00 0.00 ? 28  VAL A C    6  
ATOM   6188  O  O    . VAL A 1 28 ? -13.431 1.207   -5.320  1.00 0.00 ? 28  VAL A O    6  
ATOM   6189  C  CB   . VAL A 1 28 ? -13.223 3.059   -7.925  1.00 0.00 ? 28  VAL A CB   6  
ATOM   6190  C  CG1  . VAL A 1 28 ? -13.572 3.980   -6.767  1.00 0.00 ? 28  VAL A CG1  6  
ATOM   6191  C  CG2  . VAL A 1 28 ? -11.721 3.035   -8.164  1.00 0.00 ? 28  VAL A CG2  6  
ATOM   6192  H  H    . VAL A 1 28 ? -15.649 2.483   -7.273  1.00 0.00 ? 28  VAL A H    6  
ATOM   6193  H  HA   . VAL A 1 28 ? -13.543 1.031   -8.533  1.00 0.00 ? 28  VAL A HA   6  
ATOM   6194  H  HB   . VAL A 1 28 ? -13.702 3.438   -8.816  1.00 0.00 ? 28  VAL A HB   6  
ATOM   6195  H  HG11 . VAL A 1 28 ? -13.011 4.899   -6.856  1.00 0.00 ? 28  VAL A HG11 6  
ATOM   6196  H  HG12 . VAL A 1 28 ? -14.630 4.199   -6.787  1.00 0.00 ? 28  VAL A HG12 6  
ATOM   6197  H  HG13 . VAL A 1 28 ? -13.322 3.496   -5.834  1.00 0.00 ? 28  VAL A HG13 6  
ATOM   6198  H  HG21 . VAL A 1 28 ? -11.208 3.327   -7.260  1.00 0.00 ? 28  VAL A HG21 6  
ATOM   6199  H  HG22 . VAL A 1 28 ? -11.416 2.037   -8.445  1.00 0.00 ? 28  VAL A HG22 6  
ATOM   6200  H  HG23 . VAL A 1 28 ? -11.471 3.723   -8.958  1.00 0.00 ? 28  VAL A HG23 6  
ATOM   6201  N  N    . PHE A 1 29 ? -11.904 0.361   -6.739  1.00 0.00 ? 29  PHE A N    6  
ATOM   6202  C  CA   . PHE A 1 29 ? -11.105 -0.254  -5.685  1.00 0.00 ? 29  PHE A CA   6  
ATOM   6203  C  C    . PHE A 1 29 ? -9.756  -0.718  -6.226  1.00 0.00 ? 29  PHE A C    6  
ATOM   6204  O  O    . PHE A 1 29 ? -9.577  -0.866  -7.436  1.00 0.00 ? 29  PHE A O    6  
ATOM   6205  C  CB   . PHE A 1 29 ? -11.856 -1.437  -5.072  1.00 0.00 ? 29  PHE A CB   6  
ATOM   6206  C  CG   . PHE A 1 29 ? -12.170 -2.525  -6.059  1.00 0.00 ? 29  PHE A CG   6  
ATOM   6207  C  CD1  . PHE A 1 29 ? -11.209 -3.458  -6.411  1.00 0.00 ? 29  PHE A CD1  6  
ATOM   6208  C  CD2  . PHE A 1 29 ? -13.427 -2.613  -6.636  1.00 0.00 ? 29  PHE A CD2  6  
ATOM   6209  C  CE1  . PHE A 1 29 ? -11.494 -4.461  -7.319  1.00 0.00 ? 29  PHE A CE1  6  
ATOM   6210  C  CE2  . PHE A 1 29 ? -13.719 -3.614  -7.544  1.00 0.00 ? 29  PHE A CE2  6  
ATOM   6211  C  CZ   . PHE A 1 29 ? -12.751 -4.537  -7.887  1.00 0.00 ? 29  PHE A CZ   6  
ATOM   6212  H  H    . PHE A 1 29 ? -11.619 0.267   -7.672  1.00 0.00 ? 29  PHE A H    6  
ATOM   6213  H  HA   . PHE A 1 29 ? -10.937 0.490   -4.922  1.00 0.00 ? 29  PHE A HA   6  
ATOM   6214  H  HB2  . PHE A 1 29 ? -11.254 -1.868  -4.285  1.00 0.00 ? 29  PHE A HB2  6  
ATOM   6215  H  HB3  . PHE A 1 29 ? -12.788 -1.086  -4.655  1.00 0.00 ? 29  PHE A HB3  6  
ATOM   6216  H  HD1  . PHE A 1 29 ? -10.225 -3.399  -5.967  1.00 0.00 ? 29  PHE A HD1  6  
ATOM   6217  H  HD2  . PHE A 1 29 ? -14.184 -1.891  -6.370  1.00 0.00 ? 29  PHE A HD2  6  
ATOM   6218  H  HE1  . PHE A 1 29 ? -10.735 -5.181  -7.584  1.00 0.00 ? 29  PHE A HE1  6  
ATOM   6219  H  HE2  . PHE A 1 29 ? -14.702 -3.671  -7.987  1.00 0.00 ? 29  PHE A HE2  6  
ATOM   6220  H  HZ   . PHE A 1 29 ? -12.977 -5.320  -8.596  1.00 0.00 ? 29  PHE A HZ   6  
ATOM   6221  N  N    . VAL A 1 30 ? -8.809  -0.947  -5.322  1.00 0.00 ? 30  VAL A N    6  
ATOM   6222  C  CA   . VAL A 1 30 ? -7.476  -1.395  -5.707  1.00 0.00 ? 30  VAL A CA   6  
ATOM   6223  C  C    . VAL A 1 30 ? -7.333  -2.903  -5.536  1.00 0.00 ? 30  VAL A C    6  
ATOM   6224  O  O    . VAL A 1 30 ? -7.153  -3.400  -4.424  1.00 0.00 ? 30  VAL A O    6  
ATOM   6225  C  CB   . VAL A 1 30 ? -6.386  -0.690  -4.878  1.00 0.00 ? 30  VAL A CB   6  
ATOM   6226  C  CG1  . VAL A 1 30 ? -5.007  -1.199  -5.267  1.00 0.00 ? 30  VAL A CG1  6  
ATOM   6227  C  CG2  . VAL A 1 30 ? -6.476  0.818   -5.054  1.00 0.00 ? 30  VAL A CG2  6  
ATOM   6228  H  H    . VAL A 1 30 ? -9.012  -0.812  -4.373  1.00 0.00 ? 30  VAL A H    6  
ATOM   6229  H  HA   . VAL A 1 30 ? -7.327  -1.144  -6.747  1.00 0.00 ? 30  VAL A HA   6  
ATOM   6230  H  HB   . VAL A 1 30 ? -6.550  -0.920  -3.836  1.00 0.00 ? 30  VAL A HB   6  
ATOM   6231  H  HG11 . VAL A 1 30 ? -4.300  -0.953  -4.488  1.00 0.00 ? 30  VAL A HG11 6  
ATOM   6232  H  HG12 . VAL A 1 30 ? -5.042  -2.271  -5.398  1.00 0.00 ? 30  VAL A HG12 6  
ATOM   6233  H  HG13 . VAL A 1 30 ? -4.698  -0.734  -6.191  1.00 0.00 ? 30  VAL A HG13 6  
ATOM   6234  H  HG21 . VAL A 1 30 ? -6.177  1.305   -4.138  1.00 0.00 ? 30  VAL A HG21 6  
ATOM   6235  H  HG22 . VAL A 1 30 ? -5.820  1.127   -5.856  1.00 0.00 ? 30  VAL A HG22 6  
ATOM   6236  H  HG23 . VAL A 1 30 ? -7.492  1.094   -5.295  1.00 0.00 ? 30  VAL A HG23 6  
ATOM   6237  N  N    . LYS A 1 31 ? -7.413  -3.629  -6.647  1.00 0.00 ? 31  LYS A N    6  
ATOM   6238  C  CA   . LYS A 1 31 ? -7.291  -5.082  -6.622  1.00 0.00 ? 31  LYS A CA   6  
ATOM   6239  C  C    . LYS A 1 31 ? -5.833  -5.502  -6.468  1.00 0.00 ? 31  LYS A C    6  
ATOM   6240  O  O    . LYS A 1 31 ? -5.026  -5.330  -7.382  1.00 0.00 ? 31  LYS A O    6  
ATOM   6241  C  CB   . LYS A 1 31 ? -7.874  -5.684  -7.903  1.00 0.00 ? 31  LYS A CB   6  
ATOM   6242  C  CG   . LYS A 1 31 ? -8.245  -7.151  -7.770  1.00 0.00 ? 31  LYS A CG   6  
ATOM   6243  C  CD   . LYS A 1 31 ? -7.087  -8.056  -8.157  1.00 0.00 ? 31  LYS A CD   6  
ATOM   6244  C  CE   . LYS A 1 31 ? -7.449  -9.525  -7.992  1.00 0.00 ? 31  LYS A CE   6  
ATOM   6245  N  NZ   . LYS A 1 31 ? -8.020  -10.099 -9.242  1.00 0.00 ? 31  LYS A NZ   6  
ATOM   6246  H  H    . LYS A 1 31 ? -7.558  -3.176  -7.504  1.00 0.00 ? 31  LYS A H    6  
ATOM   6247  H  HA   . LYS A 1 31 ? -7.851  -5.448  -5.775  1.00 0.00 ? 31  LYS A HA   6  
ATOM   6248  H  HB2  . LYS A 1 31 ? -8.762  -5.133  -8.174  1.00 0.00 ? 31  LYS A HB2  6  
ATOM   6249  H  HB3  . LYS A 1 31 ? -7.145  -5.589  -8.695  1.00 0.00 ? 31  LYS A HB3  6  
ATOM   6250  H  HG2  . LYS A 1 31 ? -8.518  -7.353  -6.745  1.00 0.00 ? 31  LYS A HG2  6  
ATOM   6251  H  HG3  . LYS A 1 31 ? -9.085  -7.360  -8.417  1.00 0.00 ? 31  LYS A HG3  6  
ATOM   6252  H  HD2  . LYS A 1 31 ? -6.829  -7.875  -9.190  1.00 0.00 ? 31  LYS A HD2  6  
ATOM   6253  H  HD3  . LYS A 1 31 ? -6.239  -7.831  -7.527  1.00 0.00 ? 31  LYS A HD3  6  
ATOM   6254  H  HE2  . LYS A 1 31 ? -6.558  -10.074 -7.729  1.00 0.00 ? 31  LYS A HE2  6  
ATOM   6255  H  HE3  . LYS A 1 31 ? -8.176  -9.616  -7.199  1.00 0.00 ? 31  LYS A HE3  6  
ATOM   6256  H  HZ1  . LYS A 1 31 ? -8.054  -11.136 -9.175  1.00 0.00 ? 31  LYS A HZ1  6  
ATOM   6257  H  HZ2  . LYS A 1 31 ? -7.433  -9.834  -10.058 1.00 0.00 ? 31  LYS A HZ2  6  
ATOM   6258  H  HZ3  . LYS A 1 31 ? -8.985  -9.740  -9.392  1.00 0.00 ? 31  LYS A HZ3  6  
ATOM   6259  N  N    . LEU A 1 32 ? -5.502  -6.055  -5.306  1.00 0.00 ? 32  LEU A N    6  
ATOM   6260  C  CA   . LEU A 1 32 ? -4.140  -6.502  -5.032  1.00 0.00 ? 32  LEU A CA   6  
ATOM   6261  C  C    . LEU A 1 32 ? -3.895  -7.889  -5.617  1.00 0.00 ? 32  LEU A C    6  
ATOM   6262  O  O    . LEU A 1 32 ? -4.832  -8.580  -6.016  1.00 0.00 ? 32  LEU A O    6  
ATOM   6263  C  CB   . LEU A 1 32 ? -3.882  -6.519  -3.525  1.00 0.00 ? 32  LEU A CB   6  
ATOM   6264  C  CG   . LEU A 1 32 ? -3.658  -5.157  -2.867  1.00 0.00 ? 32  LEU A CG   6  
ATOM   6265  C  CD1  . LEU A 1 32 ? -3.567  -5.302  -1.356  1.00 0.00 ? 32  LEU A CD1  6  
ATOM   6266  C  CD2  . LEU A 1 32 ? -2.402  -4.498  -3.418  1.00 0.00 ? 32  LEU A CD2  6  
ATOM   6267  H  H    . LEU A 1 32 ? -6.188  -6.166  -4.616  1.00 0.00 ? 32  LEU A H    6  
ATOM   6268  H  HA   . LEU A 1 32 ? -3.462  -5.803  -5.498  1.00 0.00 ? 32  LEU A HA   6  
ATOM   6269  H  HB2  . LEU A 1 32 ? -4.733  -6.980  -3.048  1.00 0.00 ? 32  LEU A HB2  6  
ATOM   6270  H  HB3  . LEU A 1 32 ? -3.002  -7.121  -3.347  1.00 0.00 ? 32  LEU A HB3  6  
ATOM   6271  H  HG   . LEU A 1 32 ? -4.499  -4.514  -3.090  1.00 0.00 ? 32  LEU A HG   6  
ATOM   6272  H  HD11 . LEU A 1 32 ? -4.506  -5.014  -0.909  1.00 0.00 ? 32  LEU A HD11 6  
ATOM   6273  H  HD12 . LEU A 1 32 ? -2.779  -4.666  -0.980  1.00 0.00 ? 32  LEU A HD12 6  
ATOM   6274  H  HD13 . LEU A 1 32 ? -3.348  -6.330  -1.106  1.00 0.00 ? 32  LEU A HD13 6  
ATOM   6275  H  HD21 . LEU A 1 32 ? -1.603  -5.223  -3.455  1.00 0.00 ? 32  LEU A HD21 6  
ATOM   6276  H  HD22 . LEU A 1 32 ? -2.114  -3.678  -2.776  1.00 0.00 ? 32  LEU A HD22 6  
ATOM   6277  H  HD23 . LEU A 1 32 ? -2.597  -4.126  -4.412  1.00 0.00 ? 32  LEU A HD23 6  
ATOM   6278  N  N    . ARG A 1 33 ? -2.629  -8.291  -5.663  1.00 0.00 ? 33  ARG A N    6  
ATOM   6279  C  CA   . ARG A 1 33 ? -2.260  -9.596  -6.198  1.00 0.00 ? 33  ARG A CA   6  
ATOM   6280  C  C    . ARG A 1 33 ? -3.358  -10.622 -5.933  1.00 0.00 ? 33  ARG A C    6  
ATOM   6281  O  O    . ARG A 1 33 ? -4.096  -11.005 -6.841  1.00 0.00 ? 33  ARG A O    6  
ATOM   6282  C  CB   . ARG A 1 33 ? -0.943  -10.071 -5.580  1.00 0.00 ? 33  ARG A CB   6  
ATOM   6283  C  CG   . ARG A 1 33 ? 0.288   -9.445  -6.215  1.00 0.00 ? 33  ARG A CG   6  
ATOM   6284  C  CD   . ARG A 1 33 ? 1.560   -9.869  -5.498  1.00 0.00 ? 33  ARG A CD   6  
ATOM   6285  N  NE   . ARG A 1 33 ? 2.732   -9.783  -6.366  1.00 0.00 ? 33  ARG A NE   6  
ATOM   6286  C  CZ   . ARG A 1 33 ? 3.969   -9.610  -5.916  1.00 0.00 ? 33  ARG A CZ   6  
ATOM   6287  N  NH1  . ARG A 1 33 ? 4.195   -9.504  -4.613  1.00 0.00 ? 33  ARG A NH1  6  
ATOM   6288  N  NH2  . ARG A 1 33 ? 4.983   -9.542  -6.768  1.00 0.00 ? 33  ARG A NH2  6  
ATOM   6289  H  H    . ARG A 1 33 ? -1.925  -7.695  -5.330  1.00 0.00 ? 33  ARG A H    6  
ATOM   6290  H  HA   . ARG A 1 33 ? -2.130  -9.493  -7.265  1.00 0.00 ? 33  ARG A HA   6  
ATOM   6291  H  HB2  . ARG A 1 33 ? -0.943  -9.825  -4.528  1.00 0.00 ? 33  ARG A HB2  6  
ATOM   6292  H  HB3  . ARG A 1 33 ? -0.874  -11.142 -5.691  1.00 0.00 ? 33  ARG A HB3  6  
ATOM   6293  H  HG2  . ARG A 1 33 ? 0.348   -9.757  -7.247  1.00 0.00 ? 33  ARG A HG2  6  
ATOM   6294  H  HG3  . ARG A 1 33 ? 0.199   -8.370  -6.166  1.00 0.00 ? 33  ARG A HG3  6  
ATOM   6295  H  HD2  . ARG A 1 33 ? 1.709   -9.224  -4.645  1.00 0.00 ? 33  ARG A HD2  6  
ATOM   6296  H  HD3  . ARG A 1 33 ? 1.446   -10.889 -5.163  1.00 0.00 ? 33  ARG A HD3  6  
ATOM   6297  H  HE   . ARG A 1 33 ? 2.587   -9.859  -7.332  1.00 0.00 ? 33  ARG A HE   6  
ATOM   6298  H  HH11 . ARG A 1 33 ? 3.433   -9.556  -3.969  1.00 0.00 ? 33  ARG A HH11 6  
ATOM   6299  H  HH12 . ARG A 1 33 ? 5.128   -9.374  -4.277  1.00 0.00 ? 33  ARG A HH12 6  
ATOM   6300  H  HH21 . ARG A 1 33 ? 4.817   -9.621  -7.750  1.00 0.00 ? 33  ARG A HH21 6  
ATOM   6301  H  HH22 . ARG A 1 33 ? 5.914   -9.411  -6.428  1.00 0.00 ? 33  ARG A HH22 6  
ATOM   6302  N  N    . ASP A 1 34 ? -3.459  -11.063 -4.684  1.00 0.00 ? 34  ASP A N    6  
ATOM   6303  C  CA   . ASP A 1 34 ? -4.467  -12.045 -4.299  1.00 0.00 ? 34  ASP A CA   6  
ATOM   6304  C  C    . ASP A 1 34 ? -5.423  -11.464 -3.262  1.00 0.00 ? 34  ASP A C    6  
ATOM   6305  O  O    . ASP A 1 34 ? -6.302  -12.160 -2.755  1.00 0.00 ? 34  ASP A O    6  
ATOM   6306  C  CB   . ASP A 1 34 ? -3.798  -13.304 -3.745  1.00 0.00 ? 34  ASP A CB   6  
ATOM   6307  C  CG   . ASP A 1 34 ? -2.611  -13.744 -4.580  1.00 0.00 ? 34  ASP A CG   6  
ATOM   6308  O  OD1  . ASP A 1 34 ? -2.831  -14.337 -5.657  1.00 0.00 ? 34  ASP A OD1  6  
ATOM   6309  O  OD2  . ASP A 1 34 ? -1.463  -13.496 -4.157  1.00 0.00 ? 34  ASP A OD2  6  
ATOM   6310  H  H    . ASP A 1 34 ? -2.841  -10.720 -4.004  1.00 0.00 ? 34  ASP A H    6  
ATOM   6311  H  HA   . ASP A 1 34 ? -5.030  -12.306 -5.182  1.00 0.00 ? 34  ASP A HA   6  
ATOM   6312  H  HB2  . ASP A 1 34 ? -3.454  -13.109 -2.740  1.00 0.00 ? 34  ASP A HB2  6  
ATOM   6313  H  HB3  . ASP A 1 34 ? -4.519  -14.107 -3.725  1.00 0.00 ? 34  ASP A HB3  6  
ATOM   6314  N  N    . ARG A 1 35 ? -5.243  -10.184 -2.951  1.00 0.00 ? 35  ARG A N    6  
ATOM   6315  C  CA   . ARG A 1 35 ? -6.088  -9.510  -1.972  1.00 0.00 ? 35  ARG A CA   6  
ATOM   6316  C  C    . ARG A 1 35 ? -6.792  -8.309  -2.597  1.00 0.00 ? 35  ARG A C    6  
ATOM   6317  O  O    . ARG A 1 35 ? -6.530  -7.951  -3.746  1.00 0.00 ? 35  ARG A O    6  
ATOM   6318  C  CB   . ARG A 1 35 ? -5.255  -9.058  -0.772  1.00 0.00 ? 35  ARG A CB   6  
ATOM   6319  C  CG   . ARG A 1 35 ? -4.622  -10.207 -0.003  1.00 0.00 ? 35  ARG A CG   6  
ATOM   6320  C  CD   . ARG A 1 35 ? -5.665  -11.008 0.760   1.00 0.00 ? 35  ARG A CD   6  
ATOM   6321  N  NE   . ARG A 1 35 ? -6.301  -10.219 1.810   1.00 0.00 ? 35  ARG A NE   6  
ATOM   6322  C  CZ   . ARG A 1 35 ? -7.214  -10.705 2.644   1.00 0.00 ? 35  ARG A CZ   6  
ATOM   6323  N  NH1  . ARG A 1 35 ? -7.595  -11.971 2.550   1.00 0.00 ? 35  ARG A NH1  6  
ATOM   6324  N  NH2  . ARG A 1 35 ? -7.748  -9.923  3.574   1.00 0.00 ? 35  ARG A NH2  6  
ATOM   6325  H  H    . ARG A 1 35 ? -4.525  -9.681  -3.389  1.00 0.00 ? 35  ARG A H    6  
ATOM   6326  H  HA   . ARG A 1 35 ? -6.834  -10.215 -1.637  1.00 0.00 ? 35  ARG A HA   6  
ATOM   6327  H  HB2  . ARG A 1 35 ? -4.465  -8.409  -1.120  1.00 0.00 ? 35  ARG A HB2  6  
ATOM   6328  H  HB3  . ARG A 1 35 ? -5.890  -8.508  -0.095  1.00 0.00 ? 35  ARG A HB3  6  
ATOM   6329  H  HG2  . ARG A 1 35 ? -4.120  -10.862 -0.701  1.00 0.00 ? 35  ARG A HG2  6  
ATOM   6330  H  HG3  . ARG A 1 35 ? -3.904  -9.806  0.697   1.00 0.00 ? 35  ARG A HG3  6  
ATOM   6331  H  HD2  . ARG A 1 35 ? -6.421  -11.342 0.065   1.00 0.00 ? 35  ARG A HD2  6  
ATOM   6332  H  HD3  . ARG A 1 35 ? -5.184  -11.865 1.207   1.00 0.00 ? 35  ARG A HD3  6  
ATOM   6333  H  HE   . ARG A 1 35 ? -6.034  -9.280  1.897   1.00 0.00 ? 35  ARG A HE   6  
ATOM   6334  H  HH11 . ARG A 1 35 ? -7.194  -12.562 1.851   1.00 0.00 ? 35  ARG A HH11 6  
ATOM   6335  H  HH12 . ARG A 1 35 ? -8.282  -12.335 3.180   1.00 0.00 ? 35  ARG A HH12 6  
ATOM   6336  H  HH21 . ARG A 1 35 ? -7.463  -8.968  3.648   1.00 0.00 ? 35  ARG A HH21 6  
ATOM   6337  H  HH22 . ARG A 1 35 ? -8.434  -10.290 4.201   1.00 0.00 ? 35  ARG A HH22 6  
ATOM   6338  N  N    . HIS A 1 36 ? -7.687  -7.691  -1.834  1.00 0.00 ? 36  HIS A N    6  
ATOM   6339  C  CA   . HIS A 1 36 ? -8.429  -6.530  -2.312  1.00 0.00 ? 36  HIS A CA   6  
ATOM   6340  C  C    . HIS A 1 36 ? -8.458  -5.430  -1.255  1.00 0.00 ? 36  HIS A C    6  
ATOM   6341  O  O    . HIS A 1 36 ? -8.391  -5.705  -0.057  1.00 0.00 ? 36  HIS A O    6  
ATOM   6342  C  CB   . HIS A 1 36 ? -9.856  -6.929  -2.688  1.00 0.00 ? 36  HIS A CB   6  
ATOM   6343  C  CG   . HIS A 1 36 ? -9.924  -7.942  -3.790  1.00 0.00 ? 36  HIS A CG   6  
ATOM   6344  N  ND1  . HIS A 1 36 ? -9.755  -9.294  -3.580  1.00 0.00 ? 36  HIS A ND1  6  
ATOM   6345  C  CD2  . HIS A 1 36 ? -10.146 -7.793  -5.117  1.00 0.00 ? 36  HIS A CD2  6  
ATOM   6346  C  CE1  . HIS A 1 36 ? -9.868  -9.933  -4.731  1.00 0.00 ? 36  HIS A CE1  6  
ATOM   6347  N  NE2  . HIS A 1 36 ? -10.106 -9.045  -5.679  1.00 0.00 ? 36  HIS A NE2  6  
ATOM   6348  H  H    . HIS A 1 36 ? -7.852  -8.023  -0.927  1.00 0.00 ? 36  HIS A H    6  
ATOM   6349  H  HA   . HIS A 1 36 ? -7.926  -6.154  -3.191  1.00 0.00 ? 36  HIS A HA   6  
ATOM   6350  H  HB2  . HIS A 1 36 ? -10.346 -7.349  -1.822  1.00 0.00 ? 36  HIS A HB2  6  
ATOM   6351  H  HB3  . HIS A 1 36 ? -10.396 -6.050  -3.011  1.00 0.00 ? 36  HIS A HB3  6  
ATOM   6352  H  HD1  . HIS A 1 36 ? -9.577  -9.722  -2.717  1.00 0.00 ? 36  HIS A HD1  6  
ATOM   6353  H  HD2  . HIS A 1 36 ? -10.321 -6.862  -5.638  1.00 0.00 ? 36  HIS A HD2  6  
ATOM   6354  H  HE1  . HIS A 1 36 ? -9.782  -11.000 -4.873  1.00 0.00 ? 36  HIS A HE1  6  
ATOM   6355  H  HE2  . HIS A 1 36 ? -10.147 -9.241  -6.638  1.00 0.00 ? 36  HIS A HE2  6  
ATOM   6356  N  N    . ARG A 1 37 ? -8.557  -4.184  -1.707  1.00 0.00 ? 37  ARG A N    6  
ATOM   6357  C  CA   . ARG A 1 37 ? -8.593  -3.043  -0.800  1.00 0.00 ? 37  ARG A CA   6  
ATOM   6358  C  C    . ARG A 1 37 ? -9.271  -1.846  -1.459  1.00 0.00 ? 37  ARG A C    6  
ATOM   6359  O  O    . ARG A 1 37 ? -9.536  -1.853  -2.662  1.00 0.00 ? 37  ARG A O    6  
ATOM   6360  C  CB   . ARG A 1 37 ? -7.175  -2.664  -0.367  1.00 0.00 ? 37  ARG A CB   6  
ATOM   6361  C  CG   . ARG A 1 37 ? -6.768  -3.258  0.971   1.00 0.00 ? 37  ARG A CG   6  
ATOM   6362  C  CD   . ARG A 1 37 ? -5.833  -2.330  1.731   1.00 0.00 ? 37  ARG A CD   6  
ATOM   6363  N  NE   . ARG A 1 37 ? -4.437  -2.743  1.612   1.00 0.00 ? 37  ARG A NE   6  
ATOM   6364  C  CZ   . ARG A 1 37 ? -3.706  -2.553  0.519   1.00 0.00 ? 37  ARG A CZ   6  
ATOM   6365  N  NH1  . ARG A 1 37 ? -4.235  -1.961  -0.542  1.00 0.00 ? 37  ARG A NH1  6  
ATOM   6366  N  NH2  . ARG A 1 37 ? -2.442  -2.957  0.487   1.00 0.00 ? 37  ARG A NH2  6  
ATOM   6367  H  H    . ARG A 1 37 ? -8.606  -4.028  -2.673  1.00 0.00 ? 37  ARG A H    6  
ATOM   6368  H  HA   . ARG A 1 37 ? -9.161  -3.329  0.071   1.00 0.00 ? 37  ARG A HA   6  
ATOM   6369  H  HB2  . ARG A 1 37 ? -6.478  -3.010  -1.116  1.00 0.00 ? 37  ARG A HB2  6  
ATOM   6370  H  HB3  . ARG A 1 37 ? -7.109  -1.589  -0.294  1.00 0.00 ? 37  ARG A HB3  6  
ATOM   6371  H  HG2  . ARG A 1 37 ? -7.655  -3.423  1.566   1.00 0.00 ? 37  ARG A HG2  6  
ATOM   6372  H  HG3  . ARG A 1 37 ? -6.267  -4.199  0.800   1.00 0.00 ? 37  ARG A HG3  6  
ATOM   6373  H  HD2  . ARG A 1 37 ? -5.938  -1.331  1.335   1.00 0.00 ? 37  ARG A HD2  6  
ATOM   6374  H  HD3  . ARG A 1 37 ? -6.112  -2.335  2.774   1.00 0.00 ? 37  ARG A HD3  6  
ATOM   6375  H  HE   . ARG A 1 37 ? -4.026  -3.183  2.384   1.00 0.00 ? 37  ARG A HE   6  
ATOM   6376  H  HH11 . ARG A 1 37 ? -5.187  -1.655  -0.521  1.00 0.00 ? 37  ARG A HH11 6  
ATOM   6377  H  HH12 . ARG A 1 37 ? -3.682  -1.818  -1.363  1.00 0.00 ? 37  ARG A HH12 6  
ATOM   6378  H  HH21 . ARG A 1 37 ? -2.039  -3.404  1.285   1.00 0.00 ? 37  ARG A HH21 6  
ATOM   6379  H  HH22 . ARG A 1 37 ? -1.892  -2.814  -0.336  1.00 0.00 ? 37  ARG A HH22 6  
ATOM   6380  N  N    . HIS A 1 38 ? -9.551  -0.818  -0.663  1.00 0.00 ? 38  HIS A N    6  
ATOM   6381  C  CA   . HIS A 1 38 ? -10.199 0.386   -1.169  1.00 0.00 ? 38  HIS A CA   6  
ATOM   6382  C  C    . HIS A 1 38 ? -9.172  1.352   -1.753  1.00 0.00 ? 38  HIS A C    6  
ATOM   6383  O  O    . HIS A 1 38 ? -7.970  1.237   -1.513  1.00 0.00 ? 38  HIS A O    6  
ATOM   6384  C  CB   . HIS A 1 38 ? -10.986 1.074   -0.054  1.00 0.00 ? 38  HIS A CB   6  
ATOM   6385  C  CG   . HIS A 1 38 ? -12.355 0.503   0.153   1.00 0.00 ? 38  HIS A CG   6  
ATOM   6386  N  ND1  . HIS A 1 38 ? -12.685 -0.290  1.232   1.00 0.00 ? 38  HIS A ND1  6  
ATOM   6387  C  CD2  . HIS A 1 38 ? -13.483 0.616   -0.587  1.00 0.00 ? 38  HIS A CD2  6  
ATOM   6388  C  CE1  . HIS A 1 38 ? -13.955 -0.642  1.145   1.00 0.00 ? 38  HIS A CE1  6  
ATOM   6389  N  NE2  . HIS A 1 38 ? -14.463 -0.104  0.050   1.00 0.00 ? 38  HIS A NE2  6  
ATOM   6390  H  H    . HIS A 1 38 ? -9.316  -0.872  0.286   1.00 0.00 ? 38  HIS A H    6  
ATOM   6391  H  HA   . HIS A 1 38 ? -10.883 0.092   -1.951  1.00 0.00 ? 38  HIS A HA   6  
ATOM   6392  H  HB2  . HIS A 1 38 ? -10.443 0.976   0.875   1.00 0.00 ? 38  HIS A HB2  6  
ATOM   6393  H  HB3  . HIS A 1 38 ? -11.096 2.123   -0.292  1.00 0.00 ? 38  HIS A HB3  6  
ATOM   6394  H  HD2  . HIS A 1 38 ? -13.592 1.170   -1.509  1.00 0.00 ? 38  HIS A HD2  6  
ATOM   6395  H  HE1  . HIS A 1 38 ? -14.489 -1.262  1.849   1.00 0.00 ? 38  HIS A HE1  6  
ATOM   6396  H  HE2  . HIS A 1 38 ? -15.362 -0.276  -0.298  1.00 0.00 ? 38  HIS A HE2  6  
ATOM   6397  N  N    . PRO A 1 39 ? -9.654  2.326   -2.539  1.00 0.00 ? 39  PRO A N    6  
ATOM   6398  C  CA   . PRO A 1 39 ? -8.795  3.330   -3.173  1.00 0.00 ? 39  PRO A CA   6  
ATOM   6399  C  C    . PRO A 1 39 ? -8.199  4.305   -2.163  1.00 0.00 ? 39  PRO A C    6  
ATOM   6400  O  O    . PRO A 1 39 ? -7.362  5.137   -2.510  1.00 0.00 ? 39  PRO A O    6  
ATOM   6401  C  CB   . PRO A 1 39 ? -9.745  4.060   -4.125  1.00 0.00 ? 39  PRO A CB   6  
ATOM   6402  C  CG   . PRO A 1 39 ? -11.097 3.874   -3.527  1.00 0.00 ? 39  PRO A CG   6  
ATOM   6403  C  CD   . PRO A 1 39 ? -11.076 2.523   -2.868  1.00 0.00 ? 39  PRO A CD   6  
ATOM   6404  H  HA   . PRO A 1 39 ? -7.998  2.869   -3.740  1.00 0.00 ? 39  PRO A HA   6  
ATOM   6405  H  HB2  . PRO A 1 39 ? -9.474  5.105   -4.176  1.00 0.00 ? 39  PRO A HB2  6  
ATOM   6406  H  HB3  . PRO A 1 39 ? -9.684  3.619   -5.109  1.00 0.00 ? 39  PRO A HB3  6  
ATOM   6407  H  HG2  . PRO A 1 39 ? -11.284 4.646   -2.796  1.00 0.00 ? 39  PRO A HG2  6  
ATOM   6408  H  HG3  . PRO A 1 39 ? -11.848 3.901   -4.303  1.00 0.00 ? 39  PRO A HG3  6  
ATOM   6409  H  HD2  . PRO A 1 39 ? -11.681 2.530   -1.974  1.00 0.00 ? 39  PRO A HD2  6  
ATOM   6410  H  HD3  . PRO A 1 39 ? -11.421 1.763   -3.554  1.00 0.00 ? 39  PRO A HD3  6  
ATOM   6411  N  N    . GLU A 1 40 ? -8.636  4.195   -0.913  1.00 0.00 ? 40  GLU A N    6  
ATOM   6412  C  CA   . GLU A 1 40 ? -8.146  5.068   0.147   1.00 0.00 ? 40  GLU A CA   6  
ATOM   6413  C  C    . GLU A 1 40 ? -7.439  4.262   1.233   1.00 0.00 ? 40  GLU A C    6  
ATOM   6414  O  O    . GLU A 1 40 ? -6.513  4.750   1.881   1.00 0.00 ? 40  GLU A O    6  
ATOM   6415  C  CB   . GLU A 1 40 ? -9.301  5.864   0.758   1.00 0.00 ? 40  GLU A CB   6  
ATOM   6416  C  CG   . GLU A 1 40 ? -10.244 6.458   -0.274  1.00 0.00 ? 40  GLU A CG   6  
ATOM   6417  C  CD   . GLU A 1 40 ? -11.139 7.536   0.305   1.00 0.00 ? 40  GLU A CD   6  
ATOM   6418  O  OE1  . GLU A 1 40 ? -11.894 7.235   1.254   1.00 0.00 ? 40  GLU A OE1  6  
ATOM   6419  O  OE2  . GLU A 1 40 ? -11.085 8.681   -0.190  1.00 0.00 ? 40  GLU A OE2  6  
ATOM   6420  H  H    . GLU A 1 40 ? -9.305  3.511   -0.698  1.00 0.00 ? 40  GLU A H    6  
ATOM   6421  H  HA   . GLU A 1 40 ? -7.439  5.756   -0.291  1.00 0.00 ? 40  GLU A HA   6  
ATOM   6422  H  HB2  . GLU A 1 40 ? -9.870  5.211   1.404   1.00 0.00 ? 40  GLU A HB2  6  
ATOM   6423  H  HB3  . GLU A 1 40 ? -8.893  6.671   1.348   1.00 0.00 ? 40  GLU A HB3  6  
ATOM   6424  H  HG2  . GLU A 1 40 ? -9.659  6.888   -1.073  1.00 0.00 ? 40  GLU A HG2  6  
ATOM   6425  H  HG3  . GLU A 1 40 ? -10.867 5.668   -0.670  1.00 0.00 ? 40  GLU A HG3  6  
ATOM   6426  N  N    . CYS A 1 41 ? -7.882  3.024   1.425   1.00 0.00 ? 41  CYS A N    6  
ATOM   6427  C  CA   . CYS A 1 41 ? -7.294  2.149   2.432   1.00 0.00 ? 41  CYS A CA   6  
ATOM   6428  C  C    . CYS A 1 41 ? -5.962  1.582   1.949   1.00 0.00 ? 41  CYS A C    6  
ATOM   6429  O  O    . CYS A 1 41 ? -5.288  0.849   2.673   1.00 0.00 ? 41  CYS A O    6  
ATOM   6430  C  CB   . CYS A 1 41 ? -8.254  1.007   2.769   1.00 0.00 ? 41  CYS A CB   6  
ATOM   6431  S  SG   . CYS A 1 41 ? -9.894  1.558   3.341   1.00 0.00 ? 41  CYS A SG   6  
ATOM   6432  H  H    . CYS A 1 41 ? -8.623  2.691   0.877   1.00 0.00 ? 41  CYS A H    6  
ATOM   6433  H  HA   . CYS A 1 41 ? -7.120  2.735   3.321   1.00 0.00 ? 41  CYS A HA   6  
ATOM   6434  H  HB2  . CYS A 1 41 ? -8.402  0.399   1.888   1.00 0.00 ? 41  CYS A HB2  6  
ATOM   6435  H  HB3  . CYS A 1 41 ? -7.820  0.400   3.550   1.00 0.00 ? 41  CYS A HB3  6  
ATOM   6436  N  N    . TYR A 1 42 ? -5.589  1.927   0.722   1.00 0.00 ? 42  TYR A N    6  
ATOM   6437  C  CA   . TYR A 1 42 ? -4.339  1.451   0.141   1.00 0.00 ? 42  TYR A CA   6  
ATOM   6438  C  C    . TYR A 1 42 ? -3.144  2.177   0.750   1.00 0.00 ? 42  TYR A C    6  
ATOM   6439  O  O    . TYR A 1 42 ? -2.032  2.117   0.225   1.00 0.00 ? 42  TYR A O    6  
ATOM   6440  C  CB   . TYR A 1 42 ? -4.350  1.648   -1.376  1.00 0.00 ? 42  TYR A CB   6  
ATOM   6441  C  CG   . TYR A 1 42 ? -3.035  1.308   -2.040  1.00 0.00 ? 42  TYR A CG   6  
ATOM   6442  C  CD1  . TYR A 1 42 ? -2.271  0.233   -1.603  1.00 0.00 ? 42  TYR A CD1  6  
ATOM   6443  C  CD2  . TYR A 1 42 ? -2.556  2.063   -3.104  1.00 0.00 ? 42  TYR A CD2  6  
ATOM   6444  C  CE1  . TYR A 1 42 ? -1.068  -0.081  -2.206  1.00 0.00 ? 42  TYR A CE1  6  
ATOM   6445  C  CE2  . TYR A 1 42 ? -1.355  1.755   -3.714  1.00 0.00 ? 42  TYR A CE2  6  
ATOM   6446  C  CZ   . TYR A 1 42 ? -0.615  0.683   -3.262  1.00 0.00 ? 42  TYR A CZ   6  
ATOM   6447  O  OH   . TYR A 1 42 ? 0.582   0.374   -3.866  1.00 0.00 ? 42  TYR A OH   6  
ATOM   6448  H  H    . TYR A 1 42 ? -6.169  2.514   0.193   1.00 0.00 ? 42  TYR A H    6  
ATOM   6449  H  HA   . TYR A 1 42 ? -4.254  0.396   0.356   1.00 0.00 ? 42  TYR A HA   6  
ATOM   6450  H  HB2  . TYR A 1 42 ? -5.112  1.018   -1.809  1.00 0.00 ? 42  TYR A HB2  6  
ATOM   6451  H  HB3  . TYR A 1 42 ? -4.576  2.681   -1.596  1.00 0.00 ? 42  TYR A HB3  6  
ATOM   6452  H  HD1  . TYR A 1 42 ? -2.629  -0.363  -0.776  1.00 0.00 ? 42  TYR A HD1  6  
ATOM   6453  H  HD2  . TYR A 1 42 ? -3.138  2.902   -3.456  1.00 0.00 ? 42  TYR A HD2  6  
ATOM   6454  H  HE1  . TYR A 1 42 ? -0.488  -0.920  -1.853  1.00 0.00 ? 42  TYR A HE1  6  
ATOM   6455  H  HE2  . TYR A 1 42 ? -1.000  2.353   -4.540  1.00 0.00 ? 42  TYR A HE2  6  
ATOM   6456  H  HH   . TYR A 1 42 ? 1.237   1.037   -3.635  1.00 0.00 ? 42  TYR A HH   6  
ATOM   6457  N  N    . VAL A 1 43 ? -3.381  2.863   1.864   1.00 0.00 ? 43  VAL A N    6  
ATOM   6458  C  CA   . VAL A 1 43 ? -2.325  3.599   2.548   1.00 0.00 ? 43  VAL A CA   6  
ATOM   6459  C  C    . VAL A 1 43 ? -1.443  2.663   3.365   1.00 0.00 ? 43  VAL A C    6  
ATOM   6460  O  O    . VAL A 1 43 ? -1.878  1.590   3.785   1.00 0.00 ? 43  VAL A O    6  
ATOM   6461  C  CB   . VAL A 1 43 ? -2.907  4.680   3.478   1.00 0.00 ? 43  VAL A CB   6  
ATOM   6462  C  CG1  . VAL A 1 43 ? -3.728  5.684   2.683   1.00 0.00 ? 43  VAL A CG1  6  
ATOM   6463  C  CG2  . VAL A 1 43 ? -3.747  4.043   4.575   1.00 0.00 ? 43  VAL A CG2  6  
ATOM   6464  H  H    . VAL A 1 43 ? -4.288  2.873   2.235   1.00 0.00 ? 43  VAL A H    6  
ATOM   6465  H  HA   . VAL A 1 43 ? -1.719  4.088   1.799   1.00 0.00 ? 43  VAL A HA   6  
ATOM   6466  H  HB   . VAL A 1 43 ? -2.086  5.207   3.943   1.00 0.00 ? 43  VAL A HB   6  
ATOM   6467  H  HG11 . VAL A 1 43 ? -3.779  5.369   1.651   1.00 0.00 ? 43  VAL A HG11 6  
ATOM   6468  H  HG12 . VAL A 1 43 ? -4.725  5.741   3.094   1.00 0.00 ? 43  VAL A HG12 6  
ATOM   6469  H  HG13 . VAL A 1 43 ? -3.260  6.656   2.739   1.00 0.00 ? 43  VAL A HG13 6  
ATOM   6470  H  HG21 . VAL A 1 43 ? -4.333  3.238   4.157   1.00 0.00 ? 43  VAL A HG21 6  
ATOM   6471  H  HG22 . VAL A 1 43 ? -3.097  3.653   5.346   1.00 0.00 ? 43  VAL A HG22 6  
ATOM   6472  H  HG23 . VAL A 1 43 ? -4.405  4.785   5.002   1.00 0.00 ? 43  VAL A HG23 6  
ATOM   6473  N  N    . CYS A 1 44 ? -0.199  3.076   3.588   1.00 0.00 ? 44  CYS A N    6  
ATOM   6474  C  CA   . CYS A 1 44 ? 0.747   2.274   4.356   1.00 0.00 ? 44  CYS A CA   6  
ATOM   6475  C  C    . CYS A 1 44 ? 0.150   1.866   5.699   1.00 0.00 ? 44  CYS A C    6  
ATOM   6476  O  O    . CYS A 1 44 ? -0.817  2.466   6.171   1.00 0.00 ? 44  CYS A O    6  
ATOM   6477  C  CB   . CYS A 1 44 ? 2.045   3.054   4.578   1.00 0.00 ? 44  CYS A CB   6  
ATOM   6478  S  SG   . CYS A 1 44 ? 3.262   2.189   5.622   1.00 0.00 ? 44  CYS A SG   6  
ATOM   6479  H  H    . CYS A 1 44 ? 0.090   3.941   3.228   1.00 0.00 ? 44  CYS A H    6  
ATOM   6480  H  HA   . CYS A 1 44 ? 0.965   1.383   3.787   1.00 0.00 ? 44  CYS A HA   6  
ATOM   6481  H  HB2  . CYS A 1 44 ? 2.510   3.244   3.621   1.00 0.00 ? 44  CYS A HB2  6  
ATOM   6482  H  HB3  . CYS A 1 44 ? 1.813   3.995   5.053   1.00 0.00 ? 44  CYS A HB3  6  
ATOM   6483  N  N    . THR A 1 45 ? 0.732   0.840   6.312   1.00 0.00 ? 45  THR A N    6  
ATOM   6484  C  CA   . THR A 1 45 ? 0.258   0.350   7.600   1.00 0.00 ? 45  THR A CA   6  
ATOM   6485  C  C    . THR A 1 45 ? 0.969   1.053   8.751   1.00 0.00 ? 45  THR A C    6  
ATOM   6486  O  O    . THR A 1 45 ? 0.357   1.369   9.771   1.00 0.00 ? 45  THR A O    6  
ATOM   6487  C  CB   . THR A 1 45 ? 0.466   -1.170  7.735   1.00 0.00 ? 45  THR A CB   6  
ATOM   6488  O  OG1  . THR A 1 45 ? -0.227  -1.854  6.685   1.00 0.00 ? 45  THR A OG1  6  
ATOM   6489  C  CG2  . THR A 1 45 ? -0.029  -1.667  9.084   1.00 0.00 ? 45  THR A CG2  6  
ATOM   6490  H  H    . THR A 1 45 ? 1.498   0.403   5.886   1.00 0.00 ? 45  THR A H    6  
ATOM   6491  H  HA   . THR A 1 45 ? -0.801  0.555   7.666   1.00 0.00 ? 45  THR A HA   6  
ATOM   6492  H  HB   . THR A 1 45 ? 1.523   -1.382  7.656   1.00 0.00 ? 45  THR A HB   6  
ATOM   6493  H  HG1  . THR A 1 45 ? -0.370  -1.252  5.950   1.00 0.00 ? 45  THR A HG1  6  
ATOM   6494  H  HG21 . THR A 1 45 ? -0.989  -2.147  8.961   1.00 0.00 ? 45  THR A HG21 6  
ATOM   6495  H  HG22 . THR A 1 45 ? -0.129  -0.832  9.761   1.00 0.00 ? 45  THR A HG22 6  
ATOM   6496  H  HG23 . THR A 1 45 ? 0.678   -2.376  9.488   1.00 0.00 ? 45  THR A HG23 6  
ATOM   6497  N  N    . ASP A 1 46 ? 2.264   1.294   8.581   1.00 0.00 ? 46  ASP A N    6  
ATOM   6498  C  CA   . ASP A 1 46 ? 3.059   1.961   9.605   1.00 0.00 ? 46  ASP A CA   6  
ATOM   6499  C  C    . ASP A 1 46 ? 2.587   3.398   9.809   1.00 0.00 ? 46  ASP A C    6  
ATOM   6500  O  O    . ASP A 1 46 ? 2.044   3.741   10.860  1.00 0.00 ? 46  ASP A O    6  
ATOM   6501  C  CB   . ASP A 1 46 ? 4.540   1.947   9.222   1.00 0.00 ? 46  ASP A CB   6  
ATOM   6502  C  CG   . ASP A 1 46 ? 5.448   2.181   10.413  1.00 0.00 ? 46  ASP A CG   6  
ATOM   6503  O  OD1  . ASP A 1 46 ? 5.766   1.201   11.118  1.00 0.00 ? 46  ASP A OD1  6  
ATOM   6504  O  OD2  . ASP A 1 46 ? 5.840   3.345   10.641  1.00 0.00 ? 46  ASP A OD2  6  
ATOM   6505  H  H    . ASP A 1 46 ? 2.696   1.017   7.745   1.00 0.00 ? 46  ASP A H    6  
ATOM   6506  H  HA   . ASP A 1 46 ? 2.931   1.419   10.530  1.00 0.00 ? 46  ASP A HA   6  
ATOM   6507  H  HB2  . ASP A 1 46 ? 4.784   0.988   8.790   1.00 0.00 ? 46  ASP A HB2  6  
ATOM   6508  H  HB3  . ASP A 1 46 ? 4.724   2.723   8.494   1.00 0.00 ? 46  ASP A HB3  6  
ATOM   6509  N  N    . CYS A 1 47 ? 2.799   4.234   8.798   1.00 0.00 ? 47  CYS A N    6  
ATOM   6510  C  CA   . CYS A 1 47 ? 2.397   5.633   8.866   1.00 0.00 ? 47  CYS A CA   6  
ATOM   6511  C  C    . CYS A 1 47 ? 0.977   5.818   8.341   1.00 0.00 ? 47  CYS A C    6  
ATOM   6512  O  O    . CYS A 1 47 ? 0.090   6.269   9.064   1.00 0.00 ? 47  CYS A O    6  
ATOM   6513  C  CB   . CYS A 1 47 ? 3.367   6.503   8.063   1.00 0.00 ? 47  CYS A CB   6  
ATOM   6514  S  SG   . CYS A 1 47 ? 3.913   5.755   6.495   1.00 0.00 ? 47  CYS A SG   6  
ATOM   6515  H  H    . CYS A 1 47 ? 3.237   3.901   7.986   1.00 0.00 ? 47  CYS A H    6  
ATOM   6516  H  HA   . CYS A 1 47 ? 2.427   5.938   9.901   1.00 0.00 ? 47  CYS A HA   6  
ATOM   6517  H  HB2  . CYS A 1 47 ? 2.886   7.442   7.828   1.00 0.00 ? 47  CYS A HB2  6  
ATOM   6518  H  HB3  . CYS A 1 47 ? 4.246   6.695   8.660   1.00 0.00 ? 47  CYS A HB3  6  
ATOM   6519  N  N    . GLY A 1 48 ? 0.769   5.465   7.076   1.00 0.00 ? 48  GLY A N    6  
ATOM   6520  C  CA   . GLY A 1 48 ? -0.545  5.598   6.475   1.00 0.00 ? 48  GLY A CA   6  
ATOM   6521  C  C    . GLY A 1 48 ? -0.588  6.673   5.406   1.00 0.00 ? 48  GLY A C    6  
ATOM   6522  O  O    . GLY A 1 48 ? -1.379  7.613   5.490   1.00 0.00 ? 48  GLY A O    6  
ATOM   6523  H  H    . GLY A 1 48 ? 1.514   5.111   6.546   1.00 0.00 ? 48  GLY A H    6  
ATOM   6524  H  HA2  . GLY A 1 48 ? -0.824  4.654   6.032   1.00 0.00 ? 48  GLY A HA2  6  
ATOM   6525  H  HA3  . GLY A 1 48 ? -1.258  5.847   7.247   1.00 0.00 ? 48  GLY A HA3  6  
ATOM   6526  N  N    . THR A 1 49 ? 0.267   6.536   4.397   1.00 0.00 ? 49  THR A N    6  
ATOM   6527  C  CA   . THR A 1 49 ? 0.327   7.504   3.309   1.00 0.00 ? 49  THR A CA   6  
ATOM   6528  C  C    . THR A 1 49 ? -0.122  6.879   1.993   1.00 0.00 ? 49  THR A C    6  
ATOM   6529  O  O    . THR A 1 49 ? 0.027   5.676   1.783   1.00 0.00 ? 49  THR A O    6  
ATOM   6530  C  CB   . THR A 1 49 ? 1.749   8.070   3.137   1.00 0.00 ? 49  THR A CB   6  
ATOM   6531  O  OG1  . THR A 1 49 ? 1.719   9.221   2.286   1.00 0.00 ? 49  THR A OG1  6  
ATOM   6532  C  CG2  . THR A 1 49 ? 2.681   7.022   2.549   1.00 0.00 ? 49  THR A CG2  6  
ATOM   6533  H  H    . THR A 1 49 ? 0.873   5.765   4.386   1.00 0.00 ? 49  THR A H    6  
ATOM   6534  H  HA   . THR A 1 49 ? -0.337  8.321   3.553   1.00 0.00 ? 49  THR A HA   6  
ATOM   6535  H  HB   . THR A 1 49 ? 2.124   8.359   4.109   1.00 0.00 ? 49  THR A HB   6  
ATOM   6536  H  HG1  . THR A 1 49 ? 0.867   9.656   2.367   1.00 0.00 ? 49  THR A HG1  6  
ATOM   6537  H  HG21 . THR A 1 49 ? 3.698   7.384   2.584   1.00 0.00 ? 49  THR A HG21 6  
ATOM   6538  H  HG22 . THR A 1 49 ? 2.403   6.827   1.524   1.00 0.00 ? 49  THR A HG22 6  
ATOM   6539  H  HG23 . THR A 1 49 ? 2.604   6.110   3.122   1.00 0.00 ? 49  THR A HG23 6  
ATOM   6540  N  N    . ASN A 1 50 ? -0.671  7.705   1.108   1.00 0.00 ? 50  ASN A N    6  
ATOM   6541  C  CA   . ASN A 1 50 ? -1.141  7.233   -0.189  1.00 0.00 ? 50  ASN A CA   6  
ATOM   6542  C  C    . ASN A 1 50 ? -0.014  6.553   -0.962  1.00 0.00 ? 50  ASN A C    6  
ATOM   6543  O  O    . ASN A 1 50 ? 0.914   7.211   -1.434  1.00 0.00 ? 50  ASN A O    6  
ATOM   6544  C  CB   . ASN A 1 50 ? -1.704  8.397   -1.006  1.00 0.00 ? 50  ASN A CB   6  
ATOM   6545  C  CG   . ASN A 1 50 ? -3.151  8.697   -0.665  1.00 0.00 ? 50  ASN A CG   6  
ATOM   6546  O  OD1  . ASN A 1 50 ? -3.465  9.756   -0.122  1.00 0.00 ? 50  ASN A OD1  6  
ATOM   6547  N  ND2  . ASN A 1 50 ? -4.039  7.763   -0.983  1.00 0.00 ? 50  ASN A ND2  6  
ATOM   6548  H  H    . ASN A 1 50 ? -0.762  8.654   1.332   1.00 0.00 ? 50  ASN A H    6  
ATOM   6549  H  HA   . ASN A 1 50 ? -1.927  6.514   -0.015  1.00 0.00 ? 50  ASN A HA   6  
ATOM   6550  H  HB2  . ASN A 1 50 ? -1.117  9.283   -0.810  1.00 0.00 ? 50  ASN A HB2  6  
ATOM   6551  H  HB3  . ASN A 1 50 ? -1.643  8.156   -2.057  1.00 0.00 ? 50  ASN A HB3  6  
ATOM   6552  H  HD21 . ASN A 1 50 ? -3.716  6.944   -1.414  1.00 0.00 ? 50  ASN A HD21 6  
ATOM   6553  H  HD22 . ASN A 1 50 ? -4.981  7.930   -0.774  1.00 0.00 ? 50  ASN A HD22 6  
ATOM   6554  N  N    . LEU A 1 51 ? -0.102  5.234   -1.087  1.00 0.00 ? 51  LEU A N    6  
ATOM   6555  C  CA   . LEU A 1 51 ? 0.909   4.464   -1.803  1.00 0.00 ? 51  LEU A CA   6  
ATOM   6556  C  C    . LEU A 1 51 ? 0.559   4.347   -3.283  1.00 0.00 ? 51  LEU A C    6  
ATOM   6557  O  O    . LEU A 1 51 ? 1.103   3.505   -3.997  1.00 0.00 ? 51  LEU A O    6  
ATOM   6558  C  CB   . LEU A 1 51 ? 1.047   3.070   -1.188  1.00 0.00 ? 51  LEU A CB   6  
ATOM   6559  C  CG   . LEU A 1 51 ? 1.255   3.021   0.326   1.00 0.00 ? 51  LEU A CG   6  
ATOM   6560  C  CD1  . LEU A 1 51 ? 1.113   1.596   0.839   1.00 0.00 ? 51  LEU A CD1  6  
ATOM   6561  C  CD2  . LEU A 1 51 ? 2.617   3.590   0.696   1.00 0.00 ? 51  LEU A CD2  6  
ATOM   6562  H  H    . LEU A 1 51 ? -0.865  4.765   -0.689  1.00 0.00 ? 51  LEU A H    6  
ATOM   6563  H  HA   . LEU A 1 51 ? 1.851   4.984   -1.708  1.00 0.00 ? 51  LEU A HA   6  
ATOM   6564  H  HB2  . LEU A 1 51 ? 0.148   2.518   -1.416  1.00 0.00 ? 51  LEU A HB2  6  
ATOM   6565  H  HB3  . LEU A 1 51 ? 1.893   2.585   -1.655  1.00 0.00 ? 51  LEU A HB3  6  
ATOM   6566  H  HG   . LEU A 1 51 ? 0.498   3.625   0.806   1.00 0.00 ? 51  LEU A HG   6  
ATOM   6567  H  HD11 . LEU A 1 51 ? 2.086   1.130   0.879   1.00 0.00 ? 51  LEU A HD11 6  
ATOM   6568  H  HD12 . LEU A 1 51 ? 0.473   1.036   0.173   1.00 0.00 ? 51  LEU A HD12 6  
ATOM   6569  H  HD13 . LEU A 1 51 ? 0.679   1.611   1.828   1.00 0.00 ? 51  LEU A HD13 6  
ATOM   6570  H  HD21 . LEU A 1 51 ? 2.486   4.448   1.337   1.00 0.00 ? 51  LEU A HD21 6  
ATOM   6571  H  HD22 . LEU A 1 51 ? 3.138   3.889   -0.203  1.00 0.00 ? 51  LEU A HD22 6  
ATOM   6572  H  HD23 . LEU A 1 51 ? 3.193   2.837   1.213   1.00 0.00 ? 51  LEU A HD23 6  
ATOM   6573  N  N    . LYS A 1 52 ? -0.353  5.200   -3.738  1.00 0.00 ? 52  LYS A N    6  
ATOM   6574  C  CA   . LYS A 1 52 ? -0.774  5.196   -5.134  1.00 0.00 ? 52  LYS A CA   6  
ATOM   6575  C  C    . LYS A 1 52 ? 0.412   5.438   -6.062  1.00 0.00 ? 52  LYS A C    6  
ATOM   6576  O  O    . LYS A 1 52 ? 0.720   4.610   -6.918  1.00 0.00 ? 52  LYS A O    6  
ATOM   6577  C  CB   . LYS A 1 52 ? -1.844  6.265   -5.368  1.00 0.00 ? 52  LYS A CB   6  
ATOM   6578  C  CG   . LYS A 1 52 ? -2.346  6.321   -6.800  1.00 0.00 ? 52  LYS A CG   6  
ATOM   6579  C  CD   . LYS A 1 52 ? -1.539  7.300   -7.636  1.00 0.00 ? 52  LYS A CD   6  
ATOM   6580  C  CE   . LYS A 1 52 ? -1.972  8.737   -7.384  1.00 0.00 ? 52  LYS A CE   6  
ATOM   6581  N  NZ   . LYS A 1 52 ? -3.331  9.010   -7.928  1.00 0.00 ? 52  LYS A NZ   6  
ATOM   6582  H  H    . LYS A 1 52 ? -0.751  5.849   -3.120  1.00 0.00 ? 52  LYS A H    6  
ATOM   6583  H  HA   . LYS A 1 52 ? -1.194  4.226   -5.351  1.00 0.00 ? 52  LYS A HA   6  
ATOM   6584  H  HB2  . LYS A 1 52 ? -2.686  6.063   -4.721  1.00 0.00 ? 52  LYS A HB2  6  
ATOM   6585  H  HB3  . LYS A 1 52 ? -1.432  7.232   -5.115  1.00 0.00 ? 52  LYS A HB3  6  
ATOM   6586  H  HG2  . LYS A 1 52 ? -2.264  5.338   -7.239  1.00 0.00 ? 52  LYS A HG2  6  
ATOM   6587  H  HG3  . LYS A 1 52 ? -3.381  6.632   -6.798  1.00 0.00 ? 52  LYS A HG3  6  
ATOM   6588  H  HD2  . LYS A 1 52 ? -0.494  7.202   -7.382  1.00 0.00 ? 52  LYS A HD2  6  
ATOM   6589  H  HD3  . LYS A 1 52 ? -1.680  7.069   -8.682  1.00 0.00 ? 52  LYS A HD3  6  
ATOM   6590  H  HE2  . LYS A 1 52 ? -1.976  8.916   -6.320  1.00 0.00 ? 52  LYS A HE2  6  
ATOM   6591  H  HE3  . LYS A 1 52 ? -1.264  9.400   -7.858  1.00 0.00 ? 52  LYS A HE3  6  
ATOM   6592  H  HZ1  . LYS A 1 52 ? -3.928  8.162   -7.840  1.00 0.00 ? 52  LYS A HZ1  6  
ATOM   6593  H  HZ2  . LYS A 1 52 ? -3.268  9.272   -8.932  1.00 0.00 ? 52  LYS A HZ2  6  
ATOM   6594  H  HZ3  . LYS A 1 52 ? -3.776  9.790   -7.404  1.00 0.00 ? 52  LYS A HZ3  6  
ATOM   6595  N  N    . GLN A 1 53 ? 1.074   6.577   -5.883  1.00 0.00 ? 53  GLN A N    6  
ATOM   6596  C  CA   . GLN A 1 53 ? 2.227   6.926   -6.705  1.00 0.00 ? 53  GLN A CA   6  
ATOM   6597  C  C    . GLN A 1 53 ? 3.478   6.197   -6.224  1.00 0.00 ? 53  GLN A C    6  
ATOM   6598  O  O    . GLN A 1 53 ? 4.038   5.365   -6.938  1.00 0.00 ? 53  GLN A O    6  
ATOM   6599  C  CB   . GLN A 1 53 ? 2.461   8.437   -6.677  1.00 0.00 ? 53  GLN A CB   6  
ATOM   6600  C  CG   . GLN A 1 53 ? 1.641   9.198   -7.708  1.00 0.00 ? 53  GLN A CG   6  
ATOM   6601  C  CD   . GLN A 1 53 ? 1.579   10.685  -7.421  1.00 0.00 ? 53  GLN A CD   6  
ATOM   6602  O  OE1  . GLN A 1 53 ? 1.820   11.123  -6.295  1.00 0.00 ? 53  GLN A OE1  6  
ATOM   6603  N  NE2  . GLN A 1 53 ? 1.255   11.472  -8.440  1.00 0.00 ? 53  GLN A NE2  6  
ATOM   6604  H  H    . GLN A 1 53 ? 0.780   7.196   -5.184  1.00 0.00 ? 53  GLN A H    6  
ATOM   6605  H  HA   . GLN A 1 53 ? 2.016   6.622   -7.719  1.00 0.00 ? 53  GLN A HA   6  
ATOM   6606  H  HB2  . GLN A 1 53 ? 2.205   8.811   -5.698  1.00 0.00 ? 53  GLN A HB2  6  
ATOM   6607  H  HB3  . GLN A 1 53 ? 3.506   8.631   -6.867  1.00 0.00 ? 53  GLN A HB3  6  
ATOM   6608  H  HG2  . GLN A 1 53 ? 2.087   9.054   -8.681  1.00 0.00 ? 53  GLN A HG2  6  
ATOM   6609  H  HG3  . GLN A 1 53 ? 0.636   8.804   -7.711  1.00 0.00 ? 53  GLN A HG3  6  
ATOM   6610  H  HE21 . GLN A 1 53 ? 1.075   11.053  -9.309  1.00 0.00 ? 53  GLN A HE21 6  
ATOM   6611  H  HE22 . GLN A 1 53 ? 1.207   12.437  -8.283  1.00 0.00 ? 53  GLN A HE22 6  
ATOM   6612  N  N    . LYS A 1 54 ? 3.912   6.516   -5.010  1.00 0.00 ? 54  LYS A N    6  
ATOM   6613  C  CA   . LYS A 1 54 ? 5.097   5.892   -4.432  1.00 0.00 ? 54  LYS A CA   6  
ATOM   6614  C  C    . LYS A 1 54 ? 5.081   4.383   -4.655  1.00 0.00 ? 54  LYS A C    6  
ATOM   6615  O  O    . LYS A 1 54 ? 5.989   3.827   -5.271  1.00 0.00 ? 54  LYS A O    6  
ATOM   6616  C  CB   . LYS A 1 54 ? 5.180   6.196   -2.934  1.00 0.00 ? 54  LYS A CB   6  
ATOM   6617  C  CG   . LYS A 1 54 ? 5.286   7.678   -2.620  1.00 0.00 ? 54  LYS A CG   6  
ATOM   6618  C  CD   . LYS A 1 54 ? 5.257   7.933   -1.122  1.00 0.00 ? 54  LYS A CD   6  
ATOM   6619  C  CE   . LYS A 1 54 ? 4.730   9.324   -0.804  1.00 0.00 ? 54  LYS A CE   6  
ATOM   6620  N  NZ   . LYS A 1 54 ? 5.737   10.380  -1.098  1.00 0.00 ? 54  LYS A NZ   6  
ATOM   6621  H  H    . LYS A 1 54 ? 3.423   7.187   -4.488  1.00 0.00 ? 54  LYS A H    6  
ATOM   6622  H  HA   . LYS A 1 54 ? 5.964   6.307   -4.923  1.00 0.00 ? 54  LYS A HA   6  
ATOM   6623  H  HB2  . LYS A 1 54 ? 4.295   5.809   -2.451  1.00 0.00 ? 54  LYS A HB2  6  
ATOM   6624  H  HB3  . LYS A 1 54 ? 6.048   5.700   -2.526  1.00 0.00 ? 54  LYS A HB3  6  
ATOM   6625  H  HG2  . LYS A 1 54 ? 6.214   8.057   -3.021  1.00 0.00 ? 54  LYS A HG2  6  
ATOM   6626  H  HG3  . LYS A 1 54 ? 4.455   8.195   -3.080  1.00 0.00 ? 54  LYS A HG3  6  
ATOM   6627  H  HD2  . LYS A 1 54 ? 4.617   7.202   -0.653  1.00 0.00 ? 54  LYS A HD2  6  
ATOM   6628  H  HD3  . LYS A 1 54 ? 6.261   7.840   -0.731  1.00 0.00 ? 54  LYS A HD3  6  
ATOM   6629  H  HE2  . LYS A 1 54 ? 3.847   9.505   -1.398  1.00 0.00 ? 54  LYS A HE2  6  
ATOM   6630  H  HE3  . LYS A 1 54 ? 4.472   9.365   0.244   1.00 0.00 ? 54  LYS A HE3  6  
ATOM   6631  H  HZ1  . LYS A 1 54 ? 5.577   10.771  -2.048  1.00 0.00 ? 54  LYS A HZ1  6  
ATOM   6632  H  HZ2  . LYS A 1 54 ? 6.696   9.981   -1.057  1.00 0.00 ? 54  LYS A HZ2  6  
ATOM   6633  H  HZ3  . LYS A 1 54 ? 5.663   11.149  -0.401  1.00 0.00 ? 54  LYS A HZ3  6  
ATOM   6634  N  N    . GLY A 1 55 ? 4.041   3.726   -4.151  1.00 0.00 ? 55  GLY A N    6  
ATOM   6635  C  CA   . GLY A 1 55 ? 3.925   2.288   -4.307  1.00 0.00 ? 55  GLY A CA   6  
ATOM   6636  C  C    . GLY A 1 55 ? 3.894   1.561   -2.977  1.00 0.00 ? 55  GLY A C    6  
ATOM   6637  O  O    . GLY A 1 55 ? 4.123   2.162   -1.927  1.00 0.00 ? 55  GLY A O    6  
ATOM   6638  H  H    . GLY A 1 55 ? 3.346   4.222   -3.668  1.00 0.00 ? 55  GLY A H    6  
ATOM   6639  H  HA2  . GLY A 1 55 ? 3.017   2.067   -4.848  1.00 0.00 ? 55  GLY A HA2  6  
ATOM   6640  H  HA3  . GLY A 1 55 ? 4.769   1.930   -4.879  1.00 0.00 ? 55  GLY A HA3  6  
ATOM   6641  N  N    . HIS A 1 56 ? 3.607   0.263   -3.020  1.00 0.00 ? 56  HIS A N    6  
ATOM   6642  C  CA   . HIS A 1 56 ? 3.545   -0.546  -1.809  1.00 0.00 ? 56  HIS A CA   6  
ATOM   6643  C  C    . HIS A 1 56 ? 4.401   -1.802  -1.949  1.00 0.00 ? 56  HIS A C    6  
ATOM   6644  O  O    . HIS A 1 56 ? 4.674   -2.258  -3.060  1.00 0.00 ? 56  HIS A O    6  
ATOM   6645  C  CB   . HIS A 1 56 ? 2.098   -0.934  -1.502  1.00 0.00 ? 56  HIS A CB   6  
ATOM   6646  C  CG   . HIS A 1 56 ? 1.676   -2.224  -2.135  1.00 0.00 ? 56  HIS A CG   6  
ATOM   6647  N  ND1  . HIS A 1 56 ? 1.113   -2.297  -3.392  1.00 0.00 ? 56  HIS A ND1  6  
ATOM   6648  C  CD2  . HIS A 1 56 ? 1.740   -3.497  -1.678  1.00 0.00 ? 56  HIS A CD2  6  
ATOM   6649  C  CE1  . HIS A 1 56 ? 0.847   -3.559  -3.680  1.00 0.00 ? 56  HIS A CE1  6  
ATOM   6650  N  NE2  . HIS A 1 56 ? 1.219   -4.307  -2.657  1.00 0.00 ? 56  HIS A NE2  6  
ATOM   6651  H  H    . HIS A 1 56 ? 3.434   -0.159  -3.887  1.00 0.00 ? 56  HIS A H    6  
ATOM   6652  H  HA   . HIS A 1 56 ? 3.930   0.047   -0.993  1.00 0.00 ? 56  HIS A HA   6  
ATOM   6653  H  HB2  . HIS A 1 56 ? 1.978   -1.034  -0.434  1.00 0.00 ? 56  HIS A HB2  6  
ATOM   6654  H  HB3  . HIS A 1 56 ? 1.440   -0.156  -1.862  1.00 0.00 ? 56  HIS A HB3  6  
ATOM   6655  H  HD1  . HIS A 1 56 ? 0.934   -1.537  -3.984  1.00 0.00 ? 56  HIS A HD1  6  
ATOM   6656  H  HD2  . HIS A 1 56 ? 2.128   -3.816  -0.722  1.00 0.00 ? 56  HIS A HD2  6  
ATOM   6657  H  HE1  . HIS A 1 56 ? 0.403   -3.918  -4.596  1.00 0.00 ? 56  HIS A HE1  6  
ATOM   6658  H  HE2  . HIS A 1 56 ? 1.055   -5.269  -2.573  1.00 0.00 ? 56  HIS A HE2  6  
ATOM   6659  N  N    . PHE A 1 57 ? 4.822   -2.355  -0.817  1.00 0.00 ? 57  PHE A N    6  
ATOM   6660  C  CA   . PHE A 1 57 ? 5.649   -3.556  -0.814  1.00 0.00 ? 57  PHE A CA   6  
ATOM   6661  C  C    . PHE A 1 57 ? 4.970   -4.682  -0.040  1.00 0.00 ? 57  PHE A C    6  
ATOM   6662  O  O    . PHE A 1 57 ? 3.989   -4.458  0.671   1.00 0.00 ? 57  PHE A O    6  
ATOM   6663  C  CB   . PHE A 1 57 ? 7.019   -3.257  -0.203  1.00 0.00 ? 57  PHE A CB   6  
ATOM   6664  C  CG   . PHE A 1 57 ? 7.976   -2.612  -1.165  1.00 0.00 ? 57  PHE A CG   6  
ATOM   6665  C  CD1  . PHE A 1 57 ? 7.710   -1.360  -1.694  1.00 0.00 ? 57  PHE A CD1  6  
ATOM   6666  C  CD2  . PHE A 1 57 ? 9.143   -3.259  -1.540  1.00 0.00 ? 57  PHE A CD2  6  
ATOM   6667  C  CE1  . PHE A 1 57 ? 8.589   -0.765  -2.579  1.00 0.00 ? 57  PHE A CE1  6  
ATOM   6668  C  CE2  . PHE A 1 57 ? 10.026  -2.669  -2.425  1.00 0.00 ? 57  PHE A CE2  6  
ATOM   6669  C  CZ   . PHE A 1 57 ? 9.749   -1.420  -2.944  1.00 0.00 ? 57  PHE A CZ   6  
ATOM   6670  H  H    . PHE A 1 57 ? 4.572   -1.945  0.038   1.00 0.00 ? 57  PHE A H    6  
ATOM   6671  H  HA   . PHE A 1 57 ? 5.781   -3.869  -1.839  1.00 0.00 ? 57  PHE A HA   6  
ATOM   6672  H  HB2  . PHE A 1 57 ? 6.893   -2.589  0.636   1.00 0.00 ? 57  PHE A HB2  6  
ATOM   6673  H  HB3  . PHE A 1 57 ? 7.462   -4.180  0.139   1.00 0.00 ? 57  PHE A HB3  6  
ATOM   6674  H  HD1  . PHE A 1 57 ? 6.804   -0.846  -1.408  1.00 0.00 ? 57  PHE A HD1  6  
ATOM   6675  H  HD2  . PHE A 1 57 ? 9.361   -4.237  -1.133  1.00 0.00 ? 57  PHE A HD2  6  
ATOM   6676  H  HE1  . PHE A 1 57 ? 8.370   0.212   -2.984  1.00 0.00 ? 57  PHE A HE1  6  
ATOM   6677  H  HE2  . PHE A 1 57 ? 10.932  -3.184  -2.708  1.00 0.00 ? 57  PHE A HE2  6  
ATOM   6678  H  HZ   . PHE A 1 57 ? 10.436  -0.958  -3.636  1.00 0.00 ? 57  PHE A HZ   6  
ATOM   6679  N  N    . PHE A 1 58 ? 5.497   -5.893  -0.184  1.00 0.00 ? 58  PHE A N    6  
ATOM   6680  C  CA   . PHE A 1 58 ? 4.942   -7.055  0.500   1.00 0.00 ? 58  PHE A CA   6  
ATOM   6681  C  C    . PHE A 1 58 ? 5.915   -7.586  1.548   1.00 0.00 ? 58  PHE A C    6  
ATOM   6682  O  O    . PHE A 1 58 ? 6.970   -8.127  1.215   1.00 0.00 ? 58  PHE A O    6  
ATOM   6683  C  CB   . PHE A 1 58 ? 4.611   -8.157  -0.509  1.00 0.00 ? 58  PHE A CB   6  
ATOM   6684  C  CG   . PHE A 1 58 ? 3.224   -8.053  -1.077  1.00 0.00 ? 58  PHE A CG   6  
ATOM   6685  C  CD1  . PHE A 1 58 ? 2.116   -8.298  -0.282  1.00 0.00 ? 58  PHE A CD1  6  
ATOM   6686  C  CD2  . PHE A 1 58 ? 3.029   -7.711  -2.405  1.00 0.00 ? 58  PHE A CD2  6  
ATOM   6687  C  CE1  . PHE A 1 58 ? 0.838   -8.203  -0.802  1.00 0.00 ? 58  PHE A CE1  6  
ATOM   6688  C  CE2  . PHE A 1 58 ? 1.754   -7.614  -2.930  1.00 0.00 ? 58  PHE A CE2  6  
ATOM   6689  C  CZ   . PHE A 1 58 ? 0.657   -7.862  -2.128  1.00 0.00 ? 58  PHE A CZ   6  
ATOM   6690  H  H    . PHE A 1 58 ? 6.279   -6.008  -0.765  1.00 0.00 ? 58  PHE A H    6  
ATOM   6691  H  HA   . PHE A 1 58 ? 4.033   -6.746  0.993   1.00 0.00 ? 58  PHE A HA   6  
ATOM   6692  H  HB2  . PHE A 1 58 ? 5.310   -8.105  -1.330  1.00 0.00 ? 58  PHE A HB2  6  
ATOM   6693  H  HB3  . PHE A 1 58 ? 4.701   -9.118  -0.025  1.00 0.00 ? 58  PHE A HB3  6  
ATOM   6694  H  HD1  . PHE A 1 58 ? 2.256   -8.566  0.756   1.00 0.00 ? 58  PHE A HD1  6  
ATOM   6695  H  HD2  . PHE A 1 58 ? 3.886   -7.519  -3.035  1.00 0.00 ? 58  PHE A HD2  6  
ATOM   6696  H  HE1  . PHE A 1 58 ? -0.017  -8.397  -0.171  1.00 0.00 ? 58  PHE A HE1  6  
ATOM   6697  H  HE2  . PHE A 1 58 ? 1.615   -7.347  -3.967  1.00 0.00 ? 58  PHE A HE2  6  
ATOM   6698  H  HZ   . PHE A 1 58 ? -0.340  -7.786  -2.535  1.00 0.00 ? 58  PHE A HZ   6  
ATOM   6699  N  N    . VAL A 1 59 ? 5.553   -7.426  2.817   1.00 0.00 ? 59  VAL A N    6  
ATOM   6700  C  CA   . VAL A 1 59 ? 6.393   -7.889  3.916   1.00 0.00 ? 59  VAL A CA   6  
ATOM   6701  C  C    . VAL A 1 59 ? 5.552   -8.500  5.031   1.00 0.00 ? 59  VAL A C    6  
ATOM   6702  O  O    . VAL A 1 59 ? 4.696   -7.833  5.611   1.00 0.00 ? 59  VAL A O    6  
ATOM   6703  C  CB   . VAL A 1 59 ? 7.240   -6.741  4.497   1.00 0.00 ? 59  VAL A CB   6  
ATOM   6704  C  CG1  . VAL A 1 59 ? 8.107   -7.243  5.641   1.00 0.00 ? 59  VAL A CG1  6  
ATOM   6705  C  CG2  . VAL A 1 59 ? 8.094   -6.107  3.409   1.00 0.00 ? 59  VAL A CG2  6  
ATOM   6706  H  H    . VAL A 1 59 ? 4.701   -6.987  3.020   1.00 0.00 ? 59  VAL A H    6  
ATOM   6707  H  HA   . VAL A 1 59 ? 7.063   -8.643  3.529   1.00 0.00 ? 59  VAL A HA   6  
ATOM   6708  H  HB   . VAL A 1 59 ? 6.571   -5.988  4.885   1.00 0.00 ? 59  VAL A HB   6  
ATOM   6709  H  HG11 . VAL A 1 59 ? 7.508   -7.847  6.308   1.00 0.00 ? 59  VAL A HG11 6  
ATOM   6710  H  HG12 . VAL A 1 59 ? 8.917   -7.838  5.246   1.00 0.00 ? 59  VAL A HG12 6  
ATOM   6711  H  HG13 . VAL A 1 59 ? 8.510   -6.401  6.184   1.00 0.00 ? 59  VAL A HG13 6  
ATOM   6712  H  HG21 . VAL A 1 59 ? 9.138   -6.283  3.623   1.00 0.00 ? 59  VAL A HG21 6  
ATOM   6713  H  HG22 . VAL A 1 59 ? 7.844   -6.544  2.453   1.00 0.00 ? 59  VAL A HG22 6  
ATOM   6714  H  HG23 . VAL A 1 59 ? 7.907   -5.044  3.378   1.00 0.00 ? 59  VAL A HG23 6  
ATOM   6715  N  N    . GLU A 1 60 ? 5.802   -9.772  5.325   1.00 0.00 ? 60  GLU A N    6  
ATOM   6716  C  CA   . GLU A 1 60 ? 5.067   -10.473 6.371   1.00 0.00 ? 60  GLU A CA   6  
ATOM   6717  C  C    . GLU A 1 60 ? 3.565   -10.416 6.111   1.00 0.00 ? 60  GLU A C    6  
ATOM   6718  O  O    . GLU A 1 60 ? 2.775   -10.174 7.024   1.00 0.00 ? 60  GLU A O    6  
ATOM   6719  C  CB   . GLU A 1 60 ? 5.383   -9.867  7.740   1.00 0.00 ? 60  GLU A CB   6  
ATOM   6720  C  CG   . GLU A 1 60 ? 6.846   -9.981  8.134   1.00 0.00 ? 60  GLU A CG   6  
ATOM   6721  C  CD   . GLU A 1 60 ? 7.176   -9.193  9.387   1.00 0.00 ? 60  GLU A CD   6  
ATOM   6722  O  OE1  . GLU A 1 60 ? 7.136   -7.946  9.331   1.00 0.00 ? 60  GLU A OE1  6  
ATOM   6723  O  OE2  . GLU A 1 60 ? 7.474   -9.823  10.423  1.00 0.00 ? 60  GLU A OE2  6  
ATOM   6724  H  H    . GLU A 1 60 ? 6.497   -10.250 4.826   1.00 0.00 ? 60  GLU A H    6  
ATOM   6725  H  HA   . GLU A 1 60 ? 5.383   -11.505 6.363   1.00 0.00 ? 60  GLU A HA   6  
ATOM   6726  H  HB2  . GLU A 1 60 ? 5.114   -8.821  7.728   1.00 0.00 ? 60  GLU A HB2  6  
ATOM   6727  H  HB3  . GLU A 1 60 ? 4.790   -10.372 8.489   1.00 0.00 ? 60  GLU A HB3  6  
ATOM   6728  H  HG2  . GLU A 1 60 ? 7.079   -11.020 8.309   1.00 0.00 ? 60  GLU A HG2  6  
ATOM   6729  H  HG3  . GLU A 1 60 ? 7.454   -9.609  7.322   1.00 0.00 ? 60  GLU A HG3  6  
ATOM   6730  N  N    . ASP A 1 61 ? 3.178   -10.639 4.860   1.00 0.00 ? 61  ASP A N    6  
ATOM   6731  C  CA   . ASP A 1 61 ? 1.770   -10.614 4.479   1.00 0.00 ? 61  ASP A CA   6  
ATOM   6732  C  C    . ASP A 1 61 ? 1.149   -9.254  4.783   1.00 0.00 ? 61  ASP A C    6  
ATOM   6733  O  O    . ASP A 1 61 ? -0.036  -9.160  5.102   1.00 0.00 ? 61  ASP A O    6  
ATOM   6734  C  CB   . ASP A 1 61 ? 1.002   -11.714 5.212   1.00 0.00 ? 61  ASP A CB   6  
ATOM   6735  C  CG   . ASP A 1 61 ? -0.369  -11.960 4.613   1.00 0.00 ? 61  ASP A CG   6  
ATOM   6736  O  OD1  . ASP A 1 61 ? -0.551  -11.678 3.411   1.00 0.00 ? 61  ASP A OD1  6  
ATOM   6737  O  OD2  . ASP A 1 61 ? -1.262  -12.434 5.348   1.00 0.00 ? 61  ASP A OD2  6  
ATOM   6738  H  H    . ASP A 1 61 ? 3.855   -10.826 4.177   1.00 0.00 ? 61  ASP A H    6  
ATOM   6739  H  HA   . ASP A 1 61 ? 1.711   -10.793 3.416   1.00 0.00 ? 61  ASP A HA   6  
ATOM   6740  H  HB2  . ASP A 1 61 ? 1.566   -12.634 5.161   1.00 0.00 ? 61  ASP A HB2  6  
ATOM   6741  H  HB3  . ASP A 1 61 ? 0.878   -11.430 6.246   1.00 0.00 ? 61  ASP A HB3  6  
ATOM   6742  N  N    . GLN A 1 62 ? 1.958   -8.204  4.682   1.00 0.00 ? 62  GLN A N    6  
ATOM   6743  C  CA   . GLN A 1 62 ? 1.488   -6.850  4.948   1.00 0.00 ? 62  GLN A CA   6  
ATOM   6744  C  C    . GLN A 1 62 ? 1.932   -5.893  3.846   1.00 0.00 ? 62  GLN A C    6  
ATOM   6745  O  O    . GLN A 1 62 ? 2.657   -6.280  2.930   1.00 0.00 ? 62  GLN A O    6  
ATOM   6746  C  CB   . GLN A 1 62 ? 2.007   -6.363  6.302   1.00 0.00 ? 62  GLN A CB   6  
ATOM   6747  C  CG   . GLN A 1 62 ? 1.215   -6.898  7.485   1.00 0.00 ? 62  GLN A CG   6  
ATOM   6748  C  CD   . GLN A 1 62 ? -0.147  -6.245  7.618   1.00 0.00 ? 62  GLN A CD   6  
ATOM   6749  O  OE1  . GLN A 1 62 ? -1.179  -6.903  7.480   1.00 0.00 ? 62  GLN A OE1  6  
ATOM   6750  N  NE2  . GLN A 1 62 ? -0.157  -4.945  7.888   1.00 0.00 ? 62  GLN A NE2  6  
ATOM   6751  H  H    . GLN A 1 62 ? 2.892   -8.343  4.423   1.00 0.00 ? 62  GLN A H    6  
ATOM   6752  H  HA   . GLN A 1 62 ? 0.409   -6.873  4.974   1.00 0.00 ? 62  GLN A HA   6  
ATOM   6753  H  HB2  . GLN A 1 62 ? 3.034   -6.675  6.413   1.00 0.00 ? 62  GLN A HB2  6  
ATOM   6754  H  HB3  . GLN A 1 62 ? 1.962   -5.285  6.325   1.00 0.00 ? 62  GLN A HB3  6  
ATOM   6755  H  HG2  . GLN A 1 62 ? 1.076   -7.961  7.358   1.00 0.00 ? 62  GLN A HG2  6  
ATOM   6756  H  HG3  . GLN A 1 62 ? 1.776   -6.715  8.389   1.00 0.00 ? 62  GLN A HG3  6  
ATOM   6757  H  HE21 . GLN A 1 62 ? 0.704   -4.486  7.983   1.00 0.00 ? 62  GLN A HE21 6  
ATOM   6758  H  HE22 . GLN A 1 62 ? -1.023  -4.498  7.978   1.00 0.00 ? 62  GLN A HE22 6  
ATOM   6759  N  N    . ILE A 1 63 ? 1.491   -4.643  3.942   1.00 0.00 ? 63  ILE A N    6  
ATOM   6760  C  CA   . ILE A 1 63 ? 1.844   -3.631  2.954   1.00 0.00 ? 63  ILE A CA   6  
ATOM   6761  C  C    . ILE A 1 63 ? 2.497   -2.422  3.614   1.00 0.00 ? 63  ILE A C    6  
ATOM   6762  O  O    . ILE A 1 63 ? 2.079   -1.987  4.688   1.00 0.00 ? 63  ILE A O    6  
ATOM   6763  C  CB   . ILE A 1 63 ? 0.610   -3.165  2.159   1.00 0.00 ? 63  ILE A CB   6  
ATOM   6764  C  CG1  . ILE A 1 63 ? -0.467  -2.640  3.111   1.00 0.00 ? 63  ILE A CG1  6  
ATOM   6765  C  CG2  . ILE A 1 63 ? 0.065   -4.304  1.311   1.00 0.00 ? 63  ILE A CG2  6  
ATOM   6766  C  CD1  . ILE A 1 63 ? -1.342  -1.568  2.499   1.00 0.00 ? 63  ILE A CD1  6  
ATOM   6767  H  H    . ILE A 1 63 ? 0.916   -4.395  4.695   1.00 0.00 ? 63  ILE A H    6  
ATOM   6768  H  HA   . ILE A 1 63 ? 2.547   -4.073  2.262   1.00 0.00 ? 63  ILE A HA   6  
ATOM   6769  H  HB   . ILE A 1 63 ? 0.915   -2.369  1.498   1.00 0.00 ? 63  ILE A HB   6  
ATOM   6770  H  HG12 . ILE A 1 63 ? -1.104  -3.457  3.410   1.00 0.00 ? 63  ILE A HG12 6  
ATOM   6771  H  HG13 . ILE A 1 63 ? 0.009   -2.221  3.986   1.00 0.00 ? 63  ILE A HG13 6  
ATOM   6772  H  HG21 . ILE A 1 63 ? -0.695  -4.834  1.866   1.00 0.00 ? 63  ILE A HG21 6  
ATOM   6773  H  HG22 . ILE A 1 63 ? -0.365  -3.904  0.405   1.00 0.00 ? 63  ILE A HG22 6  
ATOM   6774  H  HG23 . ILE A 1 63 ? 0.867   -4.983  1.061   1.00 0.00 ? 63  ILE A HG23 6  
ATOM   6775  H  HD11 . ILE A 1 63 ? -1.221  -0.647  3.050   1.00 0.00 ? 63  ILE A HD11 6  
ATOM   6776  H  HD12 . ILE A 1 63 ? -1.057  -1.414  1.470   1.00 0.00 ? 63  ILE A HD12 6  
ATOM   6777  H  HD13 . ILE A 1 63 ? -2.376  -1.879  2.544   1.00 0.00 ? 63  ILE A HD13 6  
ATOM   6778  N  N    . TYR A 1 64 ? 3.522   -1.881  2.965   1.00 0.00 ? 64  TYR A N    6  
ATOM   6779  C  CA   . TYR A 1 64 ? 4.233   -0.721  3.490   1.00 0.00 ? 64  TYR A CA   6  
ATOM   6780  C  C    . TYR A 1 64 ? 4.777   0.143   2.356   1.00 0.00 ? 64  TYR A C    6  
ATOM   6781  O  O    . TYR A 1 64 ? 4.904   -0.312  1.219   1.00 0.00 ? 64  TYR A O    6  
ATOM   6782  C  CB   . TYR A 1 64 ? 5.377   -1.167  4.401   1.00 0.00 ? 64  TYR A CB   6  
ATOM   6783  C  CG   . TYR A 1 64 ? 4.938   -2.083  5.521   1.00 0.00 ? 64  TYR A CG   6  
ATOM   6784  C  CD1  . TYR A 1 64 ? 4.380   -1.570  6.685   1.00 0.00 ? 64  TYR A CD1  6  
ATOM   6785  C  CD2  . TYR A 1 64 ? 5.082   -3.461  5.415   1.00 0.00 ? 64  TYR A CD2  6  
ATOM   6786  C  CE1  . TYR A 1 64 ? 3.978   -2.403  7.712   1.00 0.00 ? 64  TYR A CE1  6  
ATOM   6787  C  CE2  . TYR A 1 64 ? 4.682   -4.301  6.436   1.00 0.00 ? 64  TYR A CE2  6  
ATOM   6788  C  CZ   . TYR A 1 64 ? 4.130   -3.768  7.582   1.00 0.00 ? 64  TYR A CZ   6  
ATOM   6789  O  OH   . TYR A 1 64 ? 3.731   -4.601  8.601   1.00 0.00 ? 64  TYR A OH   6  
ATOM   6790  H  H    . TYR A 1 64 ? 3.809   -2.272  2.114   1.00 0.00 ? 64  TYR A H    6  
ATOM   6791  H  HA   . TYR A 1 64 ? 3.532   -0.137  4.068   1.00 0.00 ? 64  TYR A HA   6  
ATOM   6792  H  HB2  . TYR A 1 64 ? 6.113   -1.694  3.812   1.00 0.00 ? 64  TYR A HB2  6  
ATOM   6793  H  HB3  . TYR A 1 64 ? 5.836   -0.296  4.845   1.00 0.00 ? 64  TYR A HB3  6  
ATOM   6794  H  HD1  . TYR A 1 64 ? 4.262   -0.501  6.784   1.00 0.00 ? 64  TYR A HD1  6  
ATOM   6795  H  HD2  . TYR A 1 64 ? 5.515   -3.876  4.516   1.00 0.00 ? 64  TYR A HD2  6  
ATOM   6796  H  HE1  . TYR A 1 64 ? 3.546   -1.986  8.609   1.00 0.00 ? 64  TYR A HE1  6  
ATOM   6797  H  HE2  . TYR A 1 64 ? 4.801   -5.370  6.335   1.00 0.00 ? 64  TYR A HE2  6  
ATOM   6798  H  HH   . TYR A 1 64 ? 2.972   -5.115  8.316   1.00 0.00 ? 64  TYR A HH   6  
ATOM   6799  N  N    . CYS A 1 65 ? 5.098   1.392   2.675   1.00 0.00 ? 65  CYS A N    6  
ATOM   6800  C  CA   . CYS A 1 65 ? 5.629   2.322   1.685   1.00 0.00 ? 65  CYS A CA   6  
ATOM   6801  C  C    . CYS A 1 65 ? 7.091   2.011   1.376   1.00 0.00 ? 65  CYS A C    6  
ATOM   6802  O  O    . CYS A 1 65 ? 7.861   1.653   2.267   1.00 0.00 ? 65  CYS A O    6  
ATOM   6803  C  CB   . CYS A 1 65 ? 5.498   3.762   2.186   1.00 0.00 ? 65  CYS A CB   6  
ATOM   6804  S  SG   . CYS A 1 65 ? 6.166   4.031   3.859   1.00 0.00 ? 65  CYS A SG   6  
ATOM   6805  H  H    . CYS A 1 65 ? 4.974   1.697   3.599   1.00 0.00 ? 65  CYS A H    6  
ATOM   6806  H  HA   . CYS A 1 65 ? 5.051   2.210   0.781   1.00 0.00 ? 65  CYS A HA   6  
ATOM   6807  H  HB2  . CYS A 1 65 ? 6.028   4.419   1.512   1.00 0.00 ? 65  CYS A HB2  6  
ATOM   6808  H  HB3  . CYS A 1 65 ? 4.453   4.036   2.200   1.00 0.00 ? 65  CYS A HB3  6  
ATOM   6809  N  N    . GLU A 1 66 ? 7.464   2.150   0.108   1.00 0.00 ? 66  GLU A N    6  
ATOM   6810  C  CA   . GLU A 1 66 ? 8.832   1.883   -0.319  1.00 0.00 ? 66  GLU A CA   6  
ATOM   6811  C  C    . GLU A 1 66 ? 9.828   2.274   0.770   1.00 0.00 ? 66  GLU A C    6  
ATOM   6812  O  O    . GLU A 1 66 ? 10.756  1.525   1.076   1.00 0.00 ? 66  GLU A O    6  
ATOM   6813  C  CB   . GLU A 1 66 ? 9.146   2.644   -1.608  1.00 0.00 ? 66  GLU A CB   6  
ATOM   6814  C  CG   . GLU A 1 66 ? 10.606  2.567   -2.021  1.00 0.00 ? 66  GLU A CG   6  
ATOM   6815  C  CD   . GLU A 1 66 ? 10.825  2.962   -3.469  1.00 0.00 ? 66  GLU A CD   6  
ATOM   6816  O  OE1  . GLU A 1 66 ? 10.729  2.079   -4.346  1.00 0.00 ? 66  GLU A OE1  6  
ATOM   6817  O  OE2  . GLU A 1 66 ? 11.092  4.155   -3.723  1.00 0.00 ? 66  GLU A OE2  6  
ATOM   6818  H  H    . GLU A 1 66 ? 6.804   2.438   -0.556  1.00 0.00 ? 66  GLU A H    6  
ATOM   6819  H  HA   . GLU A 1 66 ? 8.921   0.823   -0.506  1.00 0.00 ? 66  GLU A HA   6  
ATOM   6820  H  HB2  . GLU A 1 66 ? 8.545   2.236   -2.408  1.00 0.00 ? 66  GLU A HB2  6  
ATOM   6821  H  HB3  . GLU A 1 66 ? 8.887   3.683   -1.470  1.00 0.00 ? 66  GLU A HB3  6  
ATOM   6822  H  HG2  . GLU A 1 66 ? 11.180  3.231   -1.392  1.00 0.00 ? 66  GLU A HG2  6  
ATOM   6823  H  HG3  . GLU A 1 66 ? 10.953  1.553   -1.883  1.00 0.00 ? 66  GLU A HG3  6  
ATOM   6824  N  N    . LYS A 1 67 ? 9.627   3.451   1.352   1.00 0.00 ? 67  LYS A N    6  
ATOM   6825  C  CA   . LYS A 1 67 ? 10.505  3.944   2.407   1.00 0.00 ? 67  LYS A CA   6  
ATOM   6826  C  C    . LYS A 1 67 ? 10.559  2.961   3.572   1.00 0.00 ? 67  LYS A C    6  
ATOM   6827  O  O    . LYS A 1 67 ? 11.619  2.422   3.894   1.00 0.00 ? 67  LYS A O    6  
ATOM   6828  C  CB   . LYS A 1 67 ? 10.025  5.310   2.901   1.00 0.00 ? 67  LYS A CB   6  
ATOM   6829  C  CG   . LYS A 1 67 ? 10.749  5.796   4.145   1.00 0.00 ? 67  LYS A CG   6  
ATOM   6830  C  CD   . LYS A 1 67 ? 9.875   6.723   4.973   1.00 0.00 ? 67  LYS A CD   6  
ATOM   6831  C  CE   . LYS A 1 67 ? 10.667  7.386   6.089   1.00 0.00 ? 67  LYS A CE   6  
ATOM   6832  N  NZ   . LYS A 1 67 ? 11.581  8.441   5.570   1.00 0.00 ? 67  LYS A NZ   6  
ATOM   6833  H  H    . LYS A 1 67 ? 8.869   4.003   1.064   1.00 0.00 ? 67  LYS A H    6  
ATOM   6834  H  HA   . LYS A 1 67 ? 11.496  4.048   1.992   1.00 0.00 ? 67  LYS A HA   6  
ATOM   6835  H  HB2  . LYS A 1 67 ? 10.175  6.037   2.116   1.00 0.00 ? 67  LYS A HB2  6  
ATOM   6836  H  HB3  . LYS A 1 67 ? 8.970   5.249   3.125   1.00 0.00 ? 67  LYS A HB3  6  
ATOM   6837  H  HG2  . LYS A 1 67 ? 11.022  4.942   4.747   1.00 0.00 ? 67  LYS A HG2  6  
ATOM   6838  H  HG3  . LYS A 1 67 ? 11.641  6.328   3.846   1.00 0.00 ? 67  LYS A HG3  6  
ATOM   6839  H  HD2  . LYS A 1 67 ? 9.469   7.490   4.331   1.00 0.00 ? 67  LYS A HD2  6  
ATOM   6840  H  HD3  . LYS A 1 67 ? 9.068   6.149   5.407   1.00 0.00 ? 67  LYS A HD3  6  
ATOM   6841  H  HE2  . LYS A 1 67 ? 9.976   7.832   6.787   1.00 0.00 ? 67  LYS A HE2  6  
ATOM   6842  H  HE3  . LYS A 1 67 ? 11.252  6.632   6.594   1.00 0.00 ? 67  LYS A HE3  6  
ATOM   6843  H  HZ1  . LYS A 1 67 ? 11.161  9.381   5.717   1.00 0.00 ? 67  LYS A HZ1  6  
ATOM   6844  H  HZ2  . LYS A 1 67 ? 11.744  8.303   4.552   1.00 0.00 ? 67  LYS A HZ2  6  
ATOM   6845  H  HZ3  . LYS A 1 67 ? 12.494  8.399   6.066   1.00 0.00 ? 67  LYS A HZ3  6  
ATOM   6846  N  N    . HIS A 1 68 ? 9.410   2.730   4.200   1.00 0.00 ? 68  HIS A N    6  
ATOM   6847  C  CA   . HIS A 1 68 ? 9.327   1.809   5.328   1.00 0.00 ? 68  HIS A CA   6  
ATOM   6848  C  C    . HIS A 1 68 ? 9.730   0.398   4.909   1.00 0.00 ? 68  HIS A C    6  
ATOM   6849  O  O    . HIS A 1 68 ? 10.632  -0.200  5.495   1.00 0.00 ? 68  HIS A O    6  
ATOM   6850  C  CB   . HIS A 1 68 ? 7.910   1.798   5.901   1.00 0.00 ? 68  HIS A CB   6  
ATOM   6851  C  CG   . HIS A 1 68 ? 7.676   2.851   6.940   1.00 0.00 ? 68  HIS A CG   6  
ATOM   6852  N  ND1  . HIS A 1 68 ? 6.446   3.436   7.155   1.00 0.00 ? 68  HIS A ND1  6  
ATOM   6853  C  CD2  . HIS A 1 68 ? 8.523   3.422   7.828   1.00 0.00 ? 68  HIS A CD2  6  
ATOM   6854  C  CE1  . HIS A 1 68 ? 6.547   4.323   8.129   1.00 0.00 ? 68  HIS A CE1  6  
ATOM   6855  N  NE2  . HIS A 1 68 ? 7.798   4.334   8.555   1.00 0.00 ? 68  HIS A NE2  6  
ATOM   6856  H  H    . HIS A 1 68 ? 8.600   3.189   3.897   1.00 0.00 ? 68  HIS A H    6  
ATOM   6857  H  HA   . HIS A 1 68 ? 10.011  2.154   6.088   1.00 0.00 ? 68  HIS A HA   6  
ATOM   6858  H  HB2  . HIS A 1 68 ? 7.204   1.960   5.101   1.00 0.00 ? 68  HIS A HB2  6  
ATOM   6859  H  HB3  . HIS A 1 68 ? 7.719   0.836   6.354   1.00 0.00 ? 68  HIS A HB3  6  
ATOM   6860  H  HD2  . HIS A 1 68 ? 9.576   3.203   7.944   1.00 0.00 ? 68  HIS A HD2  6  
ATOM   6861  H  HE1  . HIS A 1 68 ? 5.745   4.936   8.512   1.00 0.00 ? 68  HIS A HE1  6  
ATOM   6862  H  HE2  . HIS A 1 68 ? 8.164   4.961   9.212   1.00 0.00 ? 68  HIS A HE2  6  
ATOM   6863  N  N    . ALA A 1 69 ? 9.055   -0.127  3.892   1.00 0.00 ? 69  ALA A N    6  
ATOM   6864  C  CA   . ALA A 1 69 ? 9.344   -1.466  3.394   1.00 0.00 ? 69  ALA A CA   6  
ATOM   6865  C  C    . ALA A 1 69 ? 10.835  -1.774  3.480   1.00 0.00 ? 69  ALA A C    6  
ATOM   6866  O  O    . ALA A 1 69 ? 11.250  -2.687  4.194   1.00 0.00 ? 69  ALA A O    6  
ATOM   6867  C  CB   . ALA A 1 69 ? 8.854   -1.614  1.961   1.00 0.00 ? 69  ALA A CB   6  
ATOM   6868  H  H    . ALA A 1 69 ? 8.347   0.399   3.466   1.00 0.00 ? 69  ALA A H    6  
ATOM   6869  H  HA   . ALA A 1 69 ? 8.805   -2.174  4.008   1.00 0.00 ? 69  ALA A HA   6  
ATOM   6870  H  HB1  . ALA A 1 69 ? 8.041   -0.924  1.787   1.00 0.00 ? 69  ALA A HB1  6  
ATOM   6871  H  HB2  . ALA A 1 69 ? 9.663   -1.397  1.280   1.00 0.00 ? 69  ALA A HB2  6  
ATOM   6872  H  HB3  . ALA A 1 69 ? 8.509   -2.624  1.801   1.00 0.00 ? 69  ALA A HB3  6  
ATOM   6873  N  N    . ARG A 1 70 ? 11.636  -1.008  2.747   1.00 0.00 ? 70  ARG A N    6  
ATOM   6874  C  CA   . ARG A 1 70 ? 13.081  -1.201  2.739   1.00 0.00 ? 70  ARG A CA   6  
ATOM   6875  C  C    . ARG A 1 70 ? 13.613  -1.381  4.157   1.00 0.00 ? 70  ARG A C    6  
ATOM   6876  O  O    . ARG A 1 70 ? 14.344  -2.330  4.440   1.00 0.00 ? 70  ARG A O    6  
ATOM   6877  C  CB   . ARG A 1 70 ? 13.772  -0.010  2.071   1.00 0.00 ? 70  ARG A CB   6  
ATOM   6878  C  CG   . ARG A 1 70 ? 13.466  0.118   0.588   1.00 0.00 ? 70  ARG A CG   6  
ATOM   6879  C  CD   . ARG A 1 70 ? 13.935  1.455   0.036   1.00 0.00 ? 70  ARG A CD   6  
ATOM   6880  N  NE   . ARG A 1 70 ? 15.385  1.606   0.126   1.00 0.00 ? 70  ARG A NE   6  
ATOM   6881  C  CZ   . ARG A 1 70 ? 16.228  1.181   -0.808  1.00 0.00 ? 70  ARG A CZ   6  
ATOM   6882  N  NH1  . ARG A 1 70 ? 15.767  0.582   -1.898  1.00 0.00 ? 70  ARG A NH1  6  
ATOM   6883  N  NH2  . ARG A 1 70 ? 17.534  1.355   -0.654  1.00 0.00 ? 70  ARG A NH2  6  
ATOM   6884  H  H    . ARG A 1 70 ? 11.246  -0.296  2.197   1.00 0.00 ? 70  ARG A H    6  
ATOM   6885  H  HA   . ARG A 1 70 ? 13.293  -2.094  2.171   1.00 0.00 ? 70  ARG A HA   6  
ATOM   6886  H  HB2  . ARG A 1 70 ? 13.454  0.898   2.561   1.00 0.00 ? 70  ARG A HB2  6  
ATOM   6887  H  HB3  . ARG A 1 70 ? 14.840  -0.118  2.188   1.00 0.00 ? 70  ARG A HB3  6  
ATOM   6888  H  HG2  . ARG A 1 70 ? 13.970  -0.675  0.055   1.00 0.00 ? 70  ARG A HG2  6  
ATOM   6889  H  HG3  . ARG A 1 70 ? 12.399  0.032   0.441   1.00 0.00 ? 70  ARG A HG3  6  
ATOM   6890  H  HD2  . ARG A 1 70 ? 13.639  1.526   -1.000  1.00 0.00 ? 70  ARG A HD2  6  
ATOM   6891  H  HD3  . ARG A 1 70 ? 13.464  2.247   0.599   1.00 0.00 ? 70  ARG A HD3  6  
ATOM   6892  H  HE   . ARG A 1 70 ? 15.746  2.046   0.923   1.00 0.00 ? 70  ARG A HE   6  
ATOM   6893  H  HH11 . ARG A 1 70 ? 14.783  0.450   -2.017  1.00 0.00 ? 70  ARG A HH11 6  
ATOM   6894  H  HH12 . ARG A 1 70 ? 16.404  0.264   -2.601  1.00 0.00 ? 70  ARG A HH12 6  
ATOM   6895  H  HH21 . ARG A 1 70 ? 17.885  1.806   0.166   1.00 0.00 ? 70  ARG A HH21 6  
ATOM   6896  H  HH22 . ARG A 1 70 ? 18.167  1.034   -1.358  1.00 0.00 ? 70  ARG A HH22 6  
ATOM   6897  N  N    . GLU A 1 71 ? 13.242  -0.463  5.044   1.00 0.00 ? 71  GLU A N    6  
ATOM   6898  C  CA   . GLU A 1 71 ? 13.684  -0.521  6.433   1.00 0.00 ? 71  GLU A CA   6  
ATOM   6899  C  C    . GLU A 1 71 ? 13.377  -1.885  7.045   1.00 0.00 ? 71  GLU A C    6  
ATOM   6900  O  O    . GLU A 1 71 ? 14.199  -2.455  7.763   1.00 0.00 ? 71  GLU A O    6  
ATOM   6901  C  CB   . GLU A 1 71 ? 13.010  0.581   7.252   1.00 0.00 ? 71  GLU A CB   6  
ATOM   6902  C  CG   . GLU A 1 71 ? 13.322  1.984   6.758   1.00 0.00 ? 71  GLU A CG   6  
ATOM   6903  C  CD   . GLU A 1 71 ? 12.429  3.036   7.386   1.00 0.00 ? 71  GLU A CD   6  
ATOM   6904  O  OE1  . GLU A 1 71 ? 11.916  2.790   8.499   1.00 0.00 ? 71  GLU A OE1  6  
ATOM   6905  O  OE2  . GLU A 1 71 ? 12.243  4.104   6.767   1.00 0.00 ? 71  GLU A OE2  6  
ATOM   6906  H  H    . GLU A 1 71 ? 12.659  0.270   4.759   1.00 0.00 ? 71  GLU A H    6  
ATOM   6907  H  HA   . GLU A 1 71 ? 14.752  -0.366  6.448   1.00 0.00 ? 71  GLU A HA   6  
ATOM   6908  H  HB2  . GLU A 1 71 ? 11.940  0.438   7.215   1.00 0.00 ? 71  GLU A HB2  6  
ATOM   6909  H  HB3  . GLU A 1 71 ? 13.339  0.502   8.278   1.00 0.00 ? 71  GLU A HB3  6  
ATOM   6910  H  HG2  . GLU A 1 71 ? 14.349  2.216   6.998   1.00 0.00 ? 71  GLU A HG2  6  
ATOM   6911  H  HG3  . GLU A 1 71 ? 13.188  2.012   5.687   1.00 0.00 ? 71  GLU A HG3  6  
ATOM   6912  N  N    . ARG A 1 72 ? 12.187  -2.402  6.756   1.00 0.00 ? 72  ARG A N    6  
ATOM   6913  C  CA   . ARG A 1 72 ? 11.770  -3.698  7.279   1.00 0.00 ? 72  ARG A CA   6  
ATOM   6914  C  C    . ARG A 1 72 ? 12.674  -4.811  6.758   1.00 0.00 ? 72  ARG A C    6  
ATOM   6915  O  O    . ARG A 1 72 ? 13.283  -5.546  7.536   1.00 0.00 ? 72  ARG A O    6  
ATOM   6916  C  CB   . ARG A 1 72 ? 10.317  -3.984  6.892   1.00 0.00 ? 72  ARG A CB   6  
ATOM   6917  C  CG   . ARG A 1 72 ? 9.303   -3.412  7.869   1.00 0.00 ? 72  ARG A CG   6  
ATOM   6918  C  CD   . ARG A 1 72 ? 7.982   -4.161  7.803   1.00 0.00 ? 72  ARG A CD   6  
ATOM   6919  N  NE   . ARG A 1 72 ? 7.141   -3.892  8.966   1.00 0.00 ? 72  ARG A NE   6  
ATOM   6920  C  CZ   . ARG A 1 72 ? 7.330   -4.454  10.155  1.00 0.00 ? 72  ARG A CZ   6  
ATOM   6921  N  NH1  . ARG A 1 72 ? 8.325   -5.311  10.337  1.00 0.00 ? 72  ARG A NH1  6  
ATOM   6922  N  NH2  . ARG A 1 72 ? 6.522   -4.158  11.166  1.00 0.00 ? 72  ARG A NH2  6  
ATOM   6923  H  H    . ARG A 1 72 ? 11.575  -1.901  6.178   1.00 0.00 ? 72  ARG A H    6  
ATOM   6924  H  HA   . ARG A 1 72 ? 11.846  -3.661  8.355   1.00 0.00 ? 72  ARG A HA   6  
ATOM   6925  H  HB2  . ARG A 1 72 ? 10.125  -3.557  5.918   1.00 0.00 ? 72  ARG A HB2  6  
ATOM   6926  H  HB3  . ARG A 1 72 ? 10.174  -5.052  6.843   1.00 0.00 ? 72  ARG A HB3  6  
ATOM   6927  H  HG2  . ARG A 1 72 ? 9.699   -3.490  8.871   1.00 0.00 ? 72  ARG A HG2  6  
ATOM   6928  H  HG3  . ARG A 1 72 ? 9.131   -2.373  7.628   1.00 0.00 ? 72  ARG A HG3  6  
ATOM   6929  H  HD2  . ARG A 1 72 ? 7.454   -3.856  6.912   1.00 0.00 ? 72  ARG A HD2  6  
ATOM   6930  H  HD3  . ARG A 1 72 ? 8.186   -5.220  7.755   1.00 0.00 ? 72  ARG A HD3  6  
ATOM   6931  H  HE   . ARG A 1 72 ? 6.399   -3.262  8.855   1.00 0.00 ? 72  ARG A HE   6  
ATOM   6932  H  HH11 . ARG A 1 72 ? 8.936   -5.534  9.577   1.00 0.00 ? 72  ARG A HH11 6  
ATOM   6933  H  HH12 . ARG A 1 72 ? 8.466   -5.732  11.233  1.00 0.00 ? 72  ARG A HH12 6  
ATOM   6934  H  HH21 . ARG A 1 72 ? 5.771   -3.513  11.033  1.00 0.00 ? 72  ARG A HH21 6  
ATOM   6935  H  HH22 . ARG A 1 72 ? 6.665   -4.582  12.060  1.00 0.00 ? 72  ARG A HH22 6  
ATOM   6936  N  N    . VAL A 1 73 ? 12.757  -4.930  5.437   1.00 0.00 ? 73  VAL A N    6  
ATOM   6937  C  CA   . VAL A 1 73 ? 13.587  -5.953  4.812   1.00 0.00 ? 73  VAL A CA   6  
ATOM   6938  C  C    . VAL A 1 73 ? 14.939  -6.063  5.507   1.00 0.00 ? 73  VAL A C    6  
ATOM   6939  O  O    . VAL A 1 73 ? 15.340  -7.144  5.940   1.00 0.00 ? 73  VAL A O    6  
ATOM   6940  C  CB   . VAL A 1 73 ? 13.813  -5.658  3.318   1.00 0.00 ? 73  VAL A CB   6  
ATOM   6941  C  CG1  . VAL A 1 73 ? 14.723  -6.707  2.697   1.00 0.00 ? 73  VAL A CG1  6  
ATOM   6942  C  CG2  . VAL A 1 73 ? 12.483  -5.591  2.582   1.00 0.00 ? 73  VAL A CG2  6  
ATOM   6943  H  H    . VAL A 1 73 ? 12.248  -4.315  4.869   1.00 0.00 ? 73  VAL A H    6  
ATOM   6944  H  HA   . VAL A 1 73 ? 13.072  -6.899  4.897   1.00 0.00 ? 73  VAL A HA   6  
ATOM   6945  H  HB   . VAL A 1 73 ? 14.297  -4.696  3.231   1.00 0.00 ? 73  VAL A HB   6  
ATOM   6946  H  HG11 . VAL A 1 73 ? 14.131  -7.393  2.108   1.00 0.00 ? 73  VAL A HG11 6  
ATOM   6947  H  HG12 . VAL A 1 73 ? 15.451  -6.222  2.064   1.00 0.00 ? 73  VAL A HG12 6  
ATOM   6948  H  HG13 . VAL A 1 73 ? 15.230  -7.251  3.480   1.00 0.00 ? 73  VAL A HG13 6  
ATOM   6949  H  HG21 . VAL A 1 73 ? 11.996  -6.553  2.632   1.00 0.00 ? 73  VAL A HG21 6  
ATOM   6950  H  HG22 . VAL A 1 73 ? 11.853  -4.844  3.043   1.00 0.00 ? 73  VAL A HG22 6  
ATOM   6951  H  HG23 . VAL A 1 73 ? 12.655  -5.327  1.549   1.00 0.00 ? 73  VAL A HG23 6  
ATOM   6952  N  N    . SER A 1 74 ? 15.639  -4.938  5.610   1.00 0.00 ? 74  SER A N    6  
ATOM   6953  C  CA   . SER A 1 74 ? 16.949  -4.908  6.250   1.00 0.00 ? 74  SER A CA   6  
ATOM   6954  C  C    . SER A 1 74 ? 16.834  -5.224  7.738   1.00 0.00 ? 74  SER A C    6  
ATOM   6955  O  O    . SER A 1 74 ? 17.400  -6.204  8.222   1.00 0.00 ? 74  SER A O    6  
ATOM   6956  C  CB   . SER A 1 74 ? 17.603  -3.538  6.057   1.00 0.00 ? 74  SER A CB   6  
ATOM   6957  O  OG   . SER A 1 74 ? 19.015  -3.631  6.138   1.00 0.00 ? 74  SER A OG   6  
ATOM   6958  H  H    . SER A 1 74 ? 15.265  -4.108  5.245   1.00 0.00 ? 74  SER A H    6  
ATOM   6959  H  HA   . SER A 1 74 ? 17.564  -5.660  5.781   1.00 0.00 ? 74  SER A HA   6  
ATOM   6960  H  HB2  . SER A 1 74 ? 17.335  -3.148  5.087   1.00 0.00 ? 74  SER A HB2  6  
ATOM   6961  H  HB3  . SER A 1 74 ? 17.253  -2.864  6.826   1.00 0.00 ? 74  SER A HB3  6  
ATOM   6962  H  HG   . SER A 1 74 ? 19.283  -4.546  6.021   1.00 0.00 ? 74  SER A HG   6  
ATOM   6963  N  N    . GLY A 1 75 ? 16.096  -4.386  8.460   1.00 0.00 ? 75  GLY A N    6  
ATOM   6964  C  CA   . GLY A 1 75 ? 15.920  -4.592  9.886   1.00 0.00 ? 75  GLY A CA   6  
ATOM   6965  C  C    . GLY A 1 75 ? 15.747  -6.055  10.243  1.00 0.00 ? 75  GLY A C    6  
ATOM   6966  O  O    . GLY A 1 75 ? 15.292  -6.864  9.434   1.00 0.00 ? 75  GLY A O    6  
ATOM   6967  H  H    . GLY A 1 75 ? 15.668  -3.621  8.021   1.00 0.00 ? 75  GLY A H    6  
ATOM   6968  H  HA2  . GLY A 1 75 ? 16.785  -4.205  10.404  1.00 0.00 ? 75  GLY A HA2  6  
ATOM   6969  H  HA3  . GLY A 1 75 ? 15.045  -4.048  10.211  1.00 0.00 ? 75  GLY A HA3  6  
ATOM   6970  N  N    . PRO A 1 76 ? 16.117  -6.413  11.481  1.00 0.00 ? 76  PRO A N    6  
ATOM   6971  C  CA   . PRO A 1 76 ? 16.010  -7.790  11.972  1.00 0.00 ? 76  PRO A CA   6  
ATOM   6972  C  C    . PRO A 1 76 ? 14.562  -8.223  12.173  1.00 0.00 ? 76  PRO A C    6  
ATOM   6973  O  O    . PRO A 1 76 ? 13.633  -7.463  11.900  1.00 0.00 ? 76  PRO A O    6  
ATOM   6974  C  CB   . PRO A 1 76 ? 16.747  -7.747  13.313  1.00 0.00 ? 76  PRO A CB   6  
ATOM   6975  C  CG   . PRO A 1 76 ? 16.647  -6.328  13.755  1.00 0.00 ? 76  PRO A CG   6  
ATOM   6976  C  CD   . PRO A 1 76 ? 16.667  -5.501  12.498  1.00 0.00 ? 76  PRO A CD   6  
ATOM   6977  H  HA   . PRO A 1 76 ? 16.504  -8.487  11.310  1.00 0.00 ? 76  PRO A HA   6  
ATOM   6978  H  HB2  . PRO A 1 76 ? 16.264  -8.414  14.013  1.00 0.00 ? 76  PRO A HB2  6  
ATOM   6979  H  HB3  . PRO A 1 76 ? 17.775  -8.046  13.173  1.00 0.00 ? 76  PRO A HB3  6  
ATOM   6980  H  HG2  . PRO A 1 76 ? 15.723  -6.174  14.290  1.00 0.00 ? 76  PRO A HG2  6  
ATOM   6981  H  HG3  . PRO A 1 76 ? 17.492  -6.079  14.380  1.00 0.00 ? 76  PRO A HG3  6  
ATOM   6982  H  HD2  . PRO A 1 76 ? 16.042  -4.628  12.612  1.00 0.00 ? 76  PRO A HD2  6  
ATOM   6983  H  HD3  . PRO A 1 76 ? 17.679  -5.215  12.251  1.00 0.00 ? 76  PRO A HD3  6  
ATOM   6984  N  N    . SER A 1 77 ? 14.377  -9.449  12.654  1.00 0.00 ? 77  SER A N    6  
ATOM   6985  C  CA   . SER A 1 77 ? 13.041  -9.984  12.889  1.00 0.00 ? 77  SER A CA   6  
ATOM   6986  C  C    . SER A 1 77 ? 12.809  -10.233 14.376  1.00 0.00 ? 77  SER A C    6  
ATOM   6987  O  O    . SER A 1 77 ? 13.744  -10.530 15.120  1.00 0.00 ? 77  SER A O    6  
ATOM   6988  C  CB   . SER A 1 77 ? 12.844  -11.284 12.106  1.00 0.00 ? 77  SER A CB   6  
ATOM   6989  O  OG   . SER A 1 77 ? 11.670  -11.958 12.523  1.00 0.00 ? 77  SER A OG   6  
ATOM   6990  H  H    . SER A 1 77 ? 15.158  -10.007 12.852  1.00 0.00 ? 77  SER A H    6  
ATOM   6991  H  HA   . SER A 1 77 ? 12.325  -9.253  12.543  1.00 0.00 ? 77  SER A HA   6  
ATOM   6992  H  HB2  . SER A 1 77 ? 12.760  -11.058 11.054  1.00 0.00 ? 77  SER A HB2  6  
ATOM   6993  H  HB3  . SER A 1 77 ? 13.694  -11.931 12.269  1.00 0.00 ? 77  SER A HB3  6  
ATOM   6994  H  HG   . SER A 1 77 ? 11.051  -11.324 12.895  1.00 0.00 ? 77  SER A HG   6  
ATOM   6995  N  N    . SER A 1 78 ? 11.556  -10.110 14.802  1.00 0.00 ? 78  SER A N    6  
ATOM   6996  C  CA   . SER A 1 78 ? 11.201  -10.317 16.201  1.00 0.00 ? 78  SER A CA   6  
ATOM   6997  C  C    . SER A 1 78 ? 11.462  -11.761 16.620  1.00 0.00 ? 78  SER A C    6  
ATOM   6998  O  O    . SER A 1 78 ? 11.792  -12.609 15.792  1.00 0.00 ? 78  SER A O    6  
ATOM   6999  C  CB   . SER A 1 78 ? 9.730   -9.965  16.433  1.00 0.00 ? 78  SER A CB   6  
ATOM   7000  O  OG   . SER A 1 78 ? 9.561   -8.570  16.610  1.00 0.00 ? 78  SER A OG   6  
ATOM   7001  H  H    . SER A 1 78 ? 10.855  -9.870  14.161  1.00 0.00 ? 78  SER A H    6  
ATOM   7002  H  HA   . SER A 1 78 ? 11.817  -9.664  16.800  1.00 0.00 ? 78  SER A HA   6  
ATOM   7003  H  HB2  . SER A 1 78 ? 9.148   -10.281 15.581  1.00 0.00 ? 78  SER A HB2  6  
ATOM   7004  H  HB3  . SER A 1 78 ? 9.377   -10.474 17.319  1.00 0.00 ? 78  SER A HB3  6  
ATOM   7005  H  HG   . SER A 1 78 ? 10.211  -8.099  16.083  1.00 0.00 ? 78  SER A HG   6  
ATOM   7006  N  N    . GLY A 1 79 ? 11.312  -12.032 17.913  1.00 0.00 ? 79  GLY A N    6  
ATOM   7007  C  CA   . GLY A 1 79 ? 11.536  -13.373 18.420  1.00 0.00 ? 79  GLY A CA   6  
ATOM   7008  C  C    . GLY A 1 79 ? 11.011  -14.443 17.483  1.00 0.00 ? 79  GLY A C    6  
ATOM   7009  O  O    . GLY A 1 79 ? 10.163  -15.234 17.893  1.00 0.00 ? 79  GLY A O    6  
ATOM   7010  H  H    . GLY A 1 79 ? 11.048  -11.316 18.527  1.00 0.00 ? 79  GLY A H    6  
ATOM   7011  H  HA2  . GLY A 1 79 ? 12.596  -13.521 18.560  1.00 0.00 ? 79  GLY A HA2  6  
ATOM   7012  H  HA3  . GLY A 1 79 ? 11.040  -13.472 19.374  1.00 0.00 ? 79  GLY A HA3  6  
HETATM 7013  ZN ZN   . ZN  B 2 .  ? -11.434 -0.206  2.897   1.00 0.00 ? 201 ZN  A ZN   6  
HETATM 7014  ZN ZN   . ZN  C 2 .  ? 4.950   3.780   5.830   1.00 0.00 ? 401 ZN  A ZN   6  
ATOM   7015  N  N    . GLY A 1 1  ? -16.202 10.597  21.191  1.00 0.00 ? 1   GLY A N    7  
ATOM   7016  C  CA   . GLY A 1 1  ? -16.277 9.300   20.544  1.00 0.00 ? 1   GLY A CA   7  
ATOM   7017  C  C    . GLY A 1 1  ? -17.665 8.694   20.619  1.00 0.00 ? 1   GLY A C    7  
ATOM   7018  O  O    . GLY A 1 1  ? -18.296 8.700   21.675  1.00 0.00 ? 1   GLY A O    7  
ATOM   7019  H  H1   . GLY A 1 1  ? -16.733 11.345  20.848  1.00 0.00 ? 1   GLY A H1   7  
ATOM   7020  H  HA2  . GLY A 1 1  ? -16.000 9.411   19.506  1.00 0.00 ? 1   GLY A HA2  7  
ATOM   7021  H  HA3  . GLY A 1 1  ? -15.578 8.630   21.023  1.00 0.00 ? 1   GLY A HA3  7  
ATOM   7022  N  N    . SER A 1 2  ? -18.142 8.172   19.494  1.00 0.00 ? 2   SER A N    7  
ATOM   7023  C  CA   . SER A 1 2  ? -19.466 7.565   19.435  1.00 0.00 ? 2   SER A CA   7  
ATOM   7024  C  C    . SER A 1 2  ? -19.527 6.498   18.346  1.00 0.00 ? 2   SER A C    7  
ATOM   7025  O  O    . SER A 1 2  ? -19.342 6.790   17.164  1.00 0.00 ? 2   SER A O    7  
ATOM   7026  C  CB   . SER A 1 2  ? -20.530 8.634   19.177  1.00 0.00 ? 2   SER A CB   7  
ATOM   7027  O  OG   . SER A 1 2  ? -20.234 9.375   18.005  1.00 0.00 ? 2   SER A OG   7  
ATOM   7028  H  H    . SER A 1 2  ? -17.591 8.198   18.683  1.00 0.00 ? 2   SER A H    7  
ATOM   7029  H  HA   . SER A 1 2  ? -19.660 7.099   20.389  1.00 0.00 ? 2   SER A HA   7  
ATOM   7030  H  HB2  . SER A 1 2  ? -21.492 8.159   19.054  1.00 0.00 ? 2   SER A HB2  7  
ATOM   7031  H  HB3  . SER A 1 2  ? -20.567 9.311   20.017  1.00 0.00 ? 2   SER A HB3  7  
ATOM   7032  H  HG   . SER A 1 2  ? -20.288 8.798   17.240  1.00 0.00 ? 2   SER A HG   7  
ATOM   7033  N  N    . SER A 1 3  ? -19.787 5.259   18.753  1.00 0.00 ? 3   SER A N    7  
ATOM   7034  C  CA   . SER A 1 3  ? -19.868 4.147   17.814  1.00 0.00 ? 3   SER A CA   7  
ATOM   7035  C  C    . SER A 1 3  ? -20.514 2.930   18.468  1.00 0.00 ? 3   SER A C    7  
ATOM   7036  O  O    . SER A 1 3  ? -20.503 2.789   19.690  1.00 0.00 ? 3   SER A O    7  
ATOM   7037  C  CB   . SER A 1 3  ? -18.474 3.784   17.299  1.00 0.00 ? 3   SER A CB   7  
ATOM   7038  O  OG   . SER A 1 3  ? -18.537 2.721   16.363  1.00 0.00 ? 3   SER A OG   7  
ATOM   7039  H  H    . SER A 1 3  ? -19.925 5.090   19.709  1.00 0.00 ? 3   SER A H    7  
ATOM   7040  H  HA   . SER A 1 3  ? -20.480 4.460   16.981  1.00 0.00 ? 3   SER A HA   7  
ATOM   7041  H  HB2  . SER A 1 3  ? -18.035 4.645   16.818  1.00 0.00 ? 3   SER A HB2  7  
ATOM   7042  H  HB3  . SER A 1 3  ? -17.854 3.480   18.130  1.00 0.00 ? 3   SER A HB3  7  
ATOM   7043  H  HG   . SER A 1 3  ? -18.134 1.937   16.742  1.00 0.00 ? 3   SER A HG   7  
ATOM   7044  N  N    . GLY A 1 4  ? -21.077 2.051   17.644  1.00 0.00 ? 4   GLY A N    7  
ATOM   7045  C  CA   . GLY A 1 4  ? -21.721 0.857   18.159  1.00 0.00 ? 4   GLY A CA   7  
ATOM   7046  C  C    . GLY A 1 4  ? -22.735 0.281   17.191  1.00 0.00 ? 4   GLY A C    7  
ATOM   7047  O  O    . GLY A 1 4  ? -23.399 1.020   16.465  1.00 0.00 ? 4   GLY A O    7  
ATOM   7048  H  H    . GLY A 1 4  ? -21.056 2.216   16.678  1.00 0.00 ? 4   GLY A H    7  
ATOM   7049  H  HA2  . GLY A 1 4  ? -20.965 0.112   18.359  1.00 0.00 ? 4   GLY A HA2  7  
ATOM   7050  H  HA3  . GLY A 1 4  ? -22.223 1.103   19.084  1.00 0.00 ? 4   GLY A HA3  7  
ATOM   7051  N  N    . SER A 1 5  ? -22.853 -1.043  17.179  1.00 0.00 ? 5   SER A N    7  
ATOM   7052  C  CA   . SER A 1 5  ? -23.789 -1.719  16.288  1.00 0.00 ? 5   SER A CA   7  
ATOM   7053  C  C    . SER A 1 5  ? -24.346 -2.980  16.941  1.00 0.00 ? 5   SER A C    7  
ATOM   7054  O  O    . SER A 1 5  ? -23.609 -3.754  17.552  1.00 0.00 ? 5   SER A O    7  
ATOM   7055  C  CB   . SER A 1 5  ? -23.103 -2.075  14.967  1.00 0.00 ? 5   SER A CB   7  
ATOM   7056  O  OG   . SER A 1 5  ? -23.027 -0.948  14.112  1.00 0.00 ? 5   SER A OG   7  
ATOM   7057  H  H    . SER A 1 5  ? -22.295 -1.578  17.781  1.00 0.00 ? 5   SER A H    7  
ATOM   7058  H  HA   . SER A 1 5  ? -24.605 -1.040  16.088  1.00 0.00 ? 5   SER A HA   7  
ATOM   7059  H  HB2  . SER A 1 5  ? -22.103 -2.428  15.168  1.00 0.00 ? 5   SER A HB2  7  
ATOM   7060  H  HB3  . SER A 1 5  ? -23.666 -2.852  14.471  1.00 0.00 ? 5   SER A HB3  7  
ATOM   7061  H  HG   . SER A 1 5  ? -22.275 -0.405  14.363  1.00 0.00 ? 5   SER A HG   7  
ATOM   7062  N  N    . SER A 1 6  ? -25.653 -3.180  16.807  1.00 0.00 ? 6   SER A N    7  
ATOM   7063  C  CA   . SER A 1 6  ? -26.312 -4.345  17.387  1.00 0.00 ? 6   SER A CA   7  
ATOM   7064  C  C    . SER A 1 6  ? -27.035 -5.151  16.312  1.00 0.00 ? 6   SER A C    7  
ATOM   7065  O  O    . SER A 1 6  ? -27.642 -4.589  15.402  1.00 0.00 ? 6   SER A O    7  
ATOM   7066  C  CB   . SER A 1 6  ? -27.303 -3.911  18.468  1.00 0.00 ? 6   SER A CB   7  
ATOM   7067  O  OG   . SER A 1 6  ? -26.627 -3.410  19.608  1.00 0.00 ? 6   SER A OG   7  
ATOM   7068  H  H    . SER A 1 6  ? -26.188 -2.527  16.308  1.00 0.00 ? 6   SER A H    7  
ATOM   7069  H  HA   . SER A 1 6  ? -25.551 -4.966  17.836  1.00 0.00 ? 6   SER A HA   7  
ATOM   7070  H  HB2  . SER A 1 6  ? -27.944 -3.137  18.075  1.00 0.00 ? 6   SER A HB2  7  
ATOM   7071  H  HB3  . SER A 1 6  ? -27.903 -4.760  18.764  1.00 0.00 ? 6   SER A HB3  7  
ATOM   7072  H  HG   . SER A 1 6  ? -25.910 -2.836  19.329  1.00 0.00 ? 6   SER A HG   7  
ATOM   7073  N  N    . GLY A 1 7  ? -26.963 -6.474  16.425  1.00 0.00 ? 7   GLY A N    7  
ATOM   7074  C  CA   . GLY A 1 7  ? -27.614 -7.338  15.457  1.00 0.00 ? 7   GLY A CA   7  
ATOM   7075  C  C    . GLY A 1 7  ? -26.710 -8.455  14.977  1.00 0.00 ? 7   GLY A C    7  
ATOM   7076  O  O    . GLY A 1 7  ? -25.522 -8.482  15.296  1.00 0.00 ? 7   GLY A O    7  
ATOM   7077  H  H    . GLY A 1 7  ? -26.464 -6.867  17.172  1.00 0.00 ? 7   GLY A H    7  
ATOM   7078  H  HA2  . GLY A 1 7  ? -28.494 -7.770  15.911  1.00 0.00 ? 7   GLY A HA2  7  
ATOM   7079  H  HA3  . GLY A 1 7  ? -27.915 -6.743  14.607  1.00 0.00 ? 7   GLY A HA3  7  
ATOM   7080  N  N    . SER A 1 8  ? -27.274 -9.382  14.208  1.00 0.00 ? 8   SER A N    7  
ATOM   7081  C  CA   . SER A 1 8  ? -26.512 -10.510 13.687  1.00 0.00 ? 8   SER A CA   7  
ATOM   7082  C  C    . SER A 1 8  ? -25.898 -10.172 12.332  1.00 0.00 ? 8   SER A C    7  
ATOM   7083  O  O    . SER A 1 8  ? -26.604 -9.797  11.395  1.00 0.00 ? 8   SER A O    7  
ATOM   7084  C  CB   . SER A 1 8  ? -27.408 -11.744 13.561  1.00 0.00 ? 8   SER A CB   7  
ATOM   7085  O  OG   . SER A 1 8  ? -27.853 -12.184 14.832  1.00 0.00 ? 8   SER A OG   7  
ATOM   7086  H  H    . SER A 1 8  ? -28.226 -9.305  13.989  1.00 0.00 ? 8   SER A H    7  
ATOM   7087  H  HA   . SER A 1 8  ? -25.717 -10.724 14.386  1.00 0.00 ? 8   SER A HA   7  
ATOM   7088  H  HB2  . SER A 1 8  ? -28.269 -11.499 12.957  1.00 0.00 ? 8   SER A HB2  7  
ATOM   7089  H  HB3  . SER A 1 8  ? -26.853 -12.542 13.090  1.00 0.00 ? 8   SER A HB3  7  
ATOM   7090  H  HG   . SER A 1 8  ? -27.255 -11.860 15.510  1.00 0.00 ? 8   SER A HG   7  
ATOM   7091  N  N    . ILE A 1 9  ? -24.580 -10.308 12.236  1.00 0.00 ? 9   ILE A N    7  
ATOM   7092  C  CA   . ILE A 1 9  ? -23.871 -10.019 10.996  1.00 0.00 ? 9   ILE A CA   7  
ATOM   7093  C  C    . ILE A 1 9  ? -23.299 -11.291 10.380  1.00 0.00 ? 9   ILE A C    7  
ATOM   7094  O  O    . ILE A 1 9  ? -22.291 -11.820 10.845  1.00 0.00 ? 9   ILE A O    7  
ATOM   7095  C  CB   . ILE A 1 9  ? -22.728 -9.013  11.223  1.00 0.00 ? 9   ILE A CB   7  
ATOM   7096  C  CG1  . ILE A 1 9  ? -23.276 -7.706  11.799  1.00 0.00 ? 9   ILE A CG1  7  
ATOM   7097  C  CG2  . ILE A 1 9  ? -21.984 -8.753  9.921   1.00 0.00 ? 9   ILE A CG2  7  
ATOM   7098  C  CD1  . ILE A 1 9  ? -22.214 -6.828  12.423  1.00 0.00 ? 9   ILE A CD1  7  
ATOM   7099  H  H    . ILE A 1 9  ? -24.073 -10.611 13.017  1.00 0.00 ? 9   ILE A H    7  
ATOM   7100  H  HA   . ILE A 1 9  ? -24.576 -9.582  10.303  1.00 0.00 ? 9   ILE A HA   7  
ATOM   7101  H  HB   . ILE A 1 9  ? -22.032 -9.444  11.926  1.00 0.00 ? 9   ILE A HB   7  
ATOM   7102  H  HG12 . ILE A 1 9  ? -23.750 -7.142  11.011  1.00 0.00 ? 9   ILE A HG12 7  
ATOM   7103  H  HG13 . ILE A 1 9  ? -24.007 -7.936  12.561  1.00 0.00 ? 9   ILE A HG13 7  
ATOM   7104  H  HG21 . ILE A 1 9  ? -21.598 -7.744  9.922   1.00 0.00 ? 9   ILE A HG21 7  
ATOM   7105  H  HG22 . ILE A 1 9  ? -21.166 -9.451  9.829   1.00 0.00 ? 9   ILE A HG22 7  
ATOM   7106  H  HG23 . ILE A 1 9  ? -22.661 -8.878  9.089   1.00 0.00 ? 9   ILE A HG23 7  
ATOM   7107  H  HD11 . ILE A 1 9  ? -22.569 -5.809  12.469  1.00 0.00 ? 9   ILE A HD11 7  
ATOM   7108  H  HD12 . ILE A 1 9  ? -21.996 -7.179  13.420  1.00 0.00 ? 9   ILE A HD12 7  
ATOM   7109  H  HD13 . ILE A 1 9  ? -21.316 -6.868  11.823  1.00 0.00 ? 9   ILE A HD13 7  
ATOM   7110  N  N    . GLY A 1 10 ? -23.950 -11.777 9.327   1.00 0.00 ? 10  GLY A N    7  
ATOM   7111  C  CA   . GLY A 1 10 ? -23.491 -12.983 8.662   1.00 0.00 ? 10  GLY A CA   7  
ATOM   7112  C  C    . GLY A 1 10 ? -24.275 -13.284 7.401   1.00 0.00 ? 10  GLY A C    7  
ATOM   7113  O  O    . GLY A 1 10 ? -25.149 -14.150 7.397   1.00 0.00 ? 10  GLY A O    7  
ATOM   7114  H  H    . GLY A 1 10 ? -24.749 -11.313 8.999   1.00 0.00 ? 10  GLY A H    7  
ATOM   7115  H  HA2  . GLY A 1 10 ? -22.448 -12.865 8.406   1.00 0.00 ? 10  GLY A HA2  7  
ATOM   7116  H  HA3  . GLY A 1 10 ? -23.592 -13.816 9.343   1.00 0.00 ? 10  GLY A HA3  7  
ATOM   7117  N  N    . ASN A 1 11 ? -23.963 -12.567 6.326   1.00 0.00 ? 11  ASN A N    7  
ATOM   7118  C  CA   . ASN A 1 11 ? -24.647 -12.760 5.053   1.00 0.00 ? 11  ASN A CA   7  
ATOM   7119  C  C    . ASN A 1 11 ? -23.643 -12.958 3.921   1.00 0.00 ? 11  ASN A C    7  
ATOM   7120  O  O    . ASN A 1 11 ? -22.541 -12.412 3.953   1.00 0.00 ? 11  ASN A O    7  
ATOM   7121  C  CB   . ASN A 1 11 ? -25.549 -11.562 4.747   1.00 0.00 ? 11  ASN A CB   7  
ATOM   7122  C  CG   . ASN A 1 11 ? -24.878 -10.239 5.062   1.00 0.00 ? 11  ASN A CG   7  
ATOM   7123  O  OD1  . ASN A 1 11 ? -25.371 -9.459  5.877   1.00 0.00 ? 11  ASN A OD1  7  
ATOM   7124  N  ND2  . ASN A 1 11 ? -23.748 -9.980  4.415   1.00 0.00 ? 11  ASN A ND2  7  
ATOM   7125  H  H    . ASN A 1 11 ? -23.257 -11.890 6.391   1.00 0.00 ? 11  ASN A H    7  
ATOM   7126  H  HA   . ASN A 1 11 ? -25.257 -13.647 5.136   1.00 0.00 ? 11  ASN A HA   7  
ATOM   7127  H  HB2  . ASN A 1 11 ? -25.806 -11.572 3.698   1.00 0.00 ? 11  ASN A HB2  7  
ATOM   7128  H  HB3  . ASN A 1 11 ? -26.450 -11.638 5.336   1.00 0.00 ? 11  ASN A HB3  7  
ATOM   7129  H  HD21 . ASN A 1 11 ? -23.414 -10.648 3.780   1.00 0.00 ? 11  ASN A HD21 7  
ATOM   7130  H  HD22 . ASN A 1 11 ? -23.293 -9.132  4.600   1.00 0.00 ? 11  ASN A HD22 7  
ATOM   7131  N  N    . ALA A 1 12 ? -24.034 -13.742 2.921   1.00 0.00 ? 12  ALA A N    7  
ATOM   7132  C  CA   . ALA A 1 12 ? -23.171 -14.009 1.778   1.00 0.00 ? 12  ALA A CA   7  
ATOM   7133  C  C    . ALA A 1 12 ? -22.741 -12.713 1.099   1.00 0.00 ? 12  ALA A C    7  
ATOM   7134  O  O    . ALA A 1 12 ? -23.573 -11.969 0.581   1.00 0.00 ? 12  ALA A O    7  
ATOM   7135  C  CB   . ALA A 1 12 ? -23.878 -14.919 0.784   1.00 0.00 ? 12  ALA A CB   7  
ATOM   7136  H  H    . ALA A 1 12 ? -24.925 -14.148 2.953   1.00 0.00 ? 12  ALA A H    7  
ATOM   7137  H  HA   . ALA A 1 12 ? -22.291 -14.524 2.137   1.00 0.00 ? 12  ALA A HA   7  
ATOM   7138  H  HB1  . ALA A 1 12 ? -23.859 -14.463 -0.196  1.00 0.00 ? 12  ALA A HB1  7  
ATOM   7139  H  HB2  . ALA A 1 12 ? -23.373 -15.873 0.747   1.00 0.00 ? 12  ALA A HB2  7  
ATOM   7140  H  HB3  . ALA A 1 12 ? -24.901 -15.064 1.095   1.00 0.00 ? 12  ALA A HB3  7  
ATOM   7141  N  N    . GLN A 1 13 ? -21.438 -12.450 1.107   1.00 0.00 ? 13  GLN A N    7  
ATOM   7142  C  CA   . GLN A 1 13 ? -20.899 -11.243 0.492   1.00 0.00 ? 13  GLN A CA   7  
ATOM   7143  C  C    . GLN A 1 13 ? -20.185 -11.569 -0.815  1.00 0.00 ? 13  GLN A C    7  
ATOM   7144  O  O    . GLN A 1 13 ? -19.183 -12.284 -0.826  1.00 0.00 ? 13  GLN A O    7  
ATOM   7145  C  CB   . GLN A 1 13 ? -19.936 -10.543 1.453   1.00 0.00 ? 13  GLN A CB   7  
ATOM   7146  C  CG   . GLN A 1 13 ? -20.598 -10.058 2.733   1.00 0.00 ? 13  GLN A CG   7  
ATOM   7147  C  CD   . GLN A 1 13 ? -21.577 -8.926  2.491   1.00 0.00 ? 13  GLN A CD   7  
ATOM   7148  O  OE1  . GLN A 1 13 ? -22.483 -9.039  1.664   1.00 0.00 ? 13  GLN A OE1  7  
ATOM   7149  N  NE2  . GLN A 1 13 ? -21.401 -7.826  3.214   1.00 0.00 ? 13  GLN A NE2  7  
ATOM   7150  H  H    . GLN A 1 13 ? -20.825 -13.083 1.535   1.00 0.00 ? 13  GLN A H    7  
ATOM   7151  H  HA   . GLN A 1 13 ? -21.726 -10.582 0.281   1.00 0.00 ? 13  GLN A HA   7  
ATOM   7152  H  HB2  . GLN A 1 13 ? -19.148 -11.231 1.718   1.00 0.00 ? 13  GLN A HB2  7  
ATOM   7153  H  HB3  . GLN A 1 13 ? -19.504 -9.689  0.952   1.00 0.00 ? 13  GLN A HB3  7  
ATOM   7154  H  HG2  . GLN A 1 13 ? -21.130 -10.884 3.182   1.00 0.00 ? 13  GLN A HG2  7  
ATOM   7155  H  HG3  . GLN A 1 13 ? -19.832 -9.714  3.411   1.00 0.00 ? 13  GLN A HG3  7  
ATOM   7156  H  HE21 . GLN A 1 13 ? -20.657 -7.807  3.852   1.00 0.00 ? 13  GLN A HE21 7  
ATOM   7157  H  HE22 . GLN A 1 13 ? -22.018 -7.079  3.077   1.00 0.00 ? 13  GLN A HE22 7  
ATOM   7158  N  N    . LYS A 1 14 ? -20.707 -11.041 -1.917  1.00 0.00 ? 14  LYS A N    7  
ATOM   7159  C  CA   . LYS A 1 14 ? -20.120 -11.274 -3.230  1.00 0.00 ? 14  LYS A CA   7  
ATOM   7160  C  C    . LYS A 1 14 ? -19.156 -10.153 -3.603  1.00 0.00 ? 14  LYS A C    7  
ATOM   7161  O  O    . LYS A 1 14 ? -18.810 -9.980  -4.772  1.00 0.00 ? 14  LYS A O    7  
ATOM   7162  C  CB   . LYS A 1 14 ? -21.218 -11.390 -4.290  1.00 0.00 ? 14  LYS A CB   7  
ATOM   7163  C  CG   . LYS A 1 14 ? -22.065 -12.643 -4.154  1.00 0.00 ? 14  LYS A CG   7  
ATOM   7164  C  CD   . LYS A 1 14 ? -23.143 -12.476 -3.097  1.00 0.00 ? 14  LYS A CD   7  
ATOM   7165  C  CE   . LYS A 1 14 ? -24.275 -11.587 -3.591  1.00 0.00 ? 14  LYS A CE   7  
ATOM   7166  N  NZ   . LYS A 1 14 ? -25.211 -11.220 -2.493  1.00 0.00 ? 14  LYS A NZ   7  
ATOM   7167  H  H    . LYS A 1 14 ? -21.508 -10.479 -1.844  1.00 0.00 ? 14  LYS A H    7  
ATOM   7168  H  HA   . LYS A 1 14 ? -19.573 -12.204 -3.189  1.00 0.00 ? 14  LYS A HA   7  
ATOM   7169  H  HB2  . LYS A 1 14 ? -21.868 -10.531 -4.212  1.00 0.00 ? 14  LYS A HB2  7  
ATOM   7170  H  HB3  . LYS A 1 14 ? -20.759 -11.395 -5.268  1.00 0.00 ? 14  LYS A HB3  7  
ATOM   7171  H  HG2  . LYS A 1 14 ? -22.535 -12.853 -5.103  1.00 0.00 ? 14  LYS A HG2  7  
ATOM   7172  H  HG3  . LYS A 1 14 ? -21.426 -13.470 -3.876  1.00 0.00 ? 14  LYS A HG3  7  
ATOM   7173  H  HD2  . LYS A 1 14 ? -23.546 -13.447 -2.849  1.00 0.00 ? 14  LYS A HD2  7  
ATOM   7174  H  HD3  . LYS A 1 14 ? -22.705 -12.030 -2.215  1.00 0.00 ? 14  LYS A HD3  7  
ATOM   7175  H  HE2  . LYS A 1 14 ? -23.851 -10.686 -4.007  1.00 0.00 ? 14  LYS A HE2  7  
ATOM   7176  H  HE3  . LYS A 1 14 ? -24.821 -12.115 -4.358  1.00 0.00 ? 14  LYS A HE3  7  
ATOM   7177  H  HZ1  . LYS A 1 14 ? -26.101 -11.751 -2.590  1.00 0.00 ? 14  LYS A HZ1  7  
ATOM   7178  H  HZ2  . LYS A 1 14 ? -25.423 -10.203 -2.529  1.00 0.00 ? 14  LYS A HZ2  7  
ATOM   7179  H  HZ3  . LYS A 1 14 ? -24.786 -11.443 -1.571  1.00 0.00 ? 14  LYS A HZ3  7  
ATOM   7180  N  N    . LEU A 1 15 ? -18.723 -9.394  -2.602  1.00 0.00 ? 15  LEU A N    7  
ATOM   7181  C  CA   . LEU A 1 15 ? -17.797 -8.289  -2.824  1.00 0.00 ? 15  LEU A CA   7  
ATOM   7182  C  C    . LEU A 1 15 ? -16.475 -8.534  -2.104  1.00 0.00 ? 15  LEU A C    7  
ATOM   7183  O  O    . LEU A 1 15 ? -16.419 -9.187  -1.061  1.00 0.00 ? 15  LEU A O    7  
ATOM   7184  C  CB   . LEU A 1 15 ? -18.416 -6.975  -2.345  1.00 0.00 ? 15  LEU A CB   7  
ATOM   7185  C  CG   . LEU A 1 15 ? -19.811 -6.655  -2.882  1.00 0.00 ? 15  LEU A CG   7  
ATOM   7186  C  CD1  . LEU A 1 15 ? -20.351 -5.385  -2.243  1.00 0.00 ? 15  LEU A CD1  7  
ATOM   7187  C  CD2  . LEU A 1 15 ? -19.781 -6.520  -4.398  1.00 0.00 ? 15  LEU A CD2  7  
ATOM   7188  H  H    . LEU A 1 15 ? -19.034 -9.580  -1.691  1.00 0.00 ? 15  LEU A H    7  
ATOM   7189  H  HA   . LEU A 1 15 ? -17.608 -8.223  -3.885  1.00 0.00 ? 15  LEU A HA   7  
ATOM   7190  H  HB2  . LEU A 1 15 ? -18.477 -7.011  -1.268  1.00 0.00 ? 15  LEU A HB2  7  
ATOM   7191  H  HB3  . LEU A 1 15 ? -17.755 -6.172  -2.639  1.00 0.00 ? 15  LEU A HB3  7  
ATOM   7192  H  HG   . LEU A 1 15 ? -20.482 -7.465  -2.631  1.00 0.00 ? 15  LEU A HG   7  
ATOM   7193  H  HD11 . LEU A 1 15 ? -19.672 -5.052  -1.473  1.00 0.00 ? 15  LEU A HD11 7  
ATOM   7194  H  HD12 . LEU A 1 15 ? -21.319 -5.584  -1.808  1.00 0.00 ? 15  LEU A HD12 7  
ATOM   7195  H  HD13 . LEU A 1 15 ? -20.447 -4.616  -2.996  1.00 0.00 ? 15  LEU A HD13 7  
ATOM   7196  H  HD21 . LEU A 1 15 ? -20.768 -6.266  -4.756  1.00 0.00 ? 15  LEU A HD21 7  
ATOM   7197  H  HD22 . LEU A 1 15 ? -19.469 -7.457  -4.836  1.00 0.00 ? 15  LEU A HD22 7  
ATOM   7198  H  HD23 . LEU A 1 15 ? -19.086 -5.742  -4.676  1.00 0.00 ? 15  LEU A HD23 7  
ATOM   7199  N  N    . PRO A 1 16 ? -15.384 -7.996  -2.670  1.00 0.00 ? 16  PRO A N    7  
ATOM   7200  C  CA   . PRO A 1 16 ? -14.042 -8.140  -2.097  1.00 0.00 ? 16  PRO A CA   7  
ATOM   7201  C  C    . PRO A 1 16 ? -13.878 -7.354  -0.801  1.00 0.00 ? 16  PRO A C    7  
ATOM   7202  O  O    . PRO A 1 16 ? -13.767 -6.128  -0.818  1.00 0.00 ? 16  PRO A O    7  
ATOM   7203  C  CB   . PRO A 1 16 ? -13.129 -7.573  -3.186  1.00 0.00 ? 16  PRO A CB   7  
ATOM   7204  C  CG   . PRO A 1 16 ? -13.990 -6.625  -3.947  1.00 0.00 ? 16  PRO A CG   7  
ATOM   7205  C  CD   . PRO A 1 16 ? -15.377 -7.206  -3.912  1.00 0.00 ? 16  PRO A CD   7  
ATOM   7206  H  HA   . PRO A 1 16 ? -13.795 -9.177  -1.921  1.00 0.00 ? 16  PRO A HA   7  
ATOM   7207  H  HB2  . PRO A 1 16 ? -12.290 -7.067  -2.729  1.00 0.00 ? 16  PRO A HB2  7  
ATOM   7208  H  HB3  . PRO A 1 16 ? -12.773 -8.375  -3.816  1.00 0.00 ? 16  PRO A HB3  7  
ATOM   7209  H  HG2  . PRO A 1 16 ? -13.977 -5.656  -3.473  1.00 0.00 ? 16  PRO A HG2  7  
ATOM   7210  H  HG3  . PRO A 1 16 ? -13.641 -6.550  -4.966  1.00 0.00 ? 16  PRO A HG3  7  
ATOM   7211  H  HD2  . PRO A 1 16 ? -16.114 -6.418  -3.872  1.00 0.00 ? 16  PRO A HD2  7  
ATOM   7212  H  HD3  . PRO A 1 16 ? -15.543 -7.838  -4.771  1.00 0.00 ? 16  PRO A HD3  7  
ATOM   7213  N  N    . MET A 1 17 ? -13.862 -8.067  0.321   1.00 0.00 ? 17  MET A N    7  
ATOM   7214  C  CA   . MET A 1 17 ? -13.709 -7.434  1.626   1.00 0.00 ? 17  MET A CA   7  
ATOM   7215  C  C    . MET A 1 17 ? -12.395 -6.662  1.705   1.00 0.00 ? 17  MET A C    7  
ATOM   7216  O  O    . MET A 1 17 ? -11.368 -7.111  1.195   1.00 0.00 ? 17  MET A O    7  
ATOM   7217  C  CB   . MET A 1 17 ? -13.763 -8.486  2.735   1.00 0.00 ? 17  MET A CB   7  
ATOM   7218  C  CG   . MET A 1 17 ? -15.163 -8.726  3.277   1.00 0.00 ? 17  MET A CG   7  
ATOM   7219  S  SD   . MET A 1 17 ? -15.819 -7.299  4.164   1.00 0.00 ? 17  MET A SD   7  
ATOM   7220  C  CE   . MET A 1 17 ? -16.632 -8.101  5.543   1.00 0.00 ? 17  MET A CE   7  
ATOM   7221  H  H    . MET A 1 17 ? -13.955 -9.041  0.270   1.00 0.00 ? 17  MET A H    7  
ATOM   7222  H  HA   . MET A 1 17 ? -14.528 -6.743  1.757   1.00 0.00 ? 17  MET A HA   7  
ATOM   7223  H  HB2  . MET A 1 17 ? -13.385 -9.420  2.349   1.00 0.00 ? 17  MET A HB2  7  
ATOM   7224  H  HB3  . MET A 1 17 ? -13.135 -8.163  3.553   1.00 0.00 ? 17  MET A HB3  7  
ATOM   7225  H  HG2  . MET A 1 17 ? -15.821 -8.951  2.451   1.00 0.00 ? 17  MET A HG2  7  
ATOM   7226  H  HG3  . MET A 1 17 ? -15.133 -9.569  3.951   1.00 0.00 ? 17  MET A HG3  7  
ATOM   7227  H  HE1  . MET A 1 17 ? -16.853 -7.370  6.306   1.00 0.00 ? 17  MET A HE1  7  
ATOM   7228  H  HE2  . MET A 1 17 ? -17.551 -8.556  5.203   1.00 0.00 ? 17  MET A HE2  7  
ATOM   7229  H  HE3  . MET A 1 17 ? -15.982 -8.862  5.950   1.00 0.00 ? 17  MET A HE3  7  
ATOM   7230  N  N    . CYS A 1 18 ? -12.436 -5.500  2.347   1.00 0.00 ? 18  CYS A N    7  
ATOM   7231  C  CA   . CYS A 1 18 ? -11.249 -4.664  2.492   1.00 0.00 ? 18  CYS A CA   7  
ATOM   7232  C  C    . CYS A 1 18 ? -10.277 -5.272  3.499   1.00 0.00 ? 18  CYS A C    7  
ATOM   7233  O  O    . CYS A 1 18 ? -10.678 -5.721  4.572   1.00 0.00 ? 18  CYS A O    7  
ATOM   7234  C  CB   . CYS A 1 18 ? -11.644 -3.254  2.935   1.00 0.00 ? 18  CYS A CB   7  
ATOM   7235  S  SG   . CYS A 1 18 ? -10.280 -2.048  2.880   1.00 0.00 ? 18  CYS A SG   7  
ATOM   7236  H  H    . CYS A 1 18 ? -13.284 -5.195  2.732   1.00 0.00 ? 18  CYS A H    7  
ATOM   7237  H  HA   . CYS A 1 18 ? -10.764 -4.608  1.530   1.00 0.00 ? 18  CYS A HA   7  
ATOM   7238  H  HB2  . CYS A 1 18 ? -12.430 -2.889  2.289   1.00 0.00 ? 18  CYS A HB2  7  
ATOM   7239  H  HB3  . CYS A 1 18 ? -12.009 -3.293  3.951   1.00 0.00 ? 18  CYS A HB3  7  
ATOM   7240  N  N    . ASP A 1 19 ? -8.997  -5.281  3.144   1.00 0.00 ? 19  ASP A N    7  
ATOM   7241  C  CA   . ASP A 1 19 ? -7.966  -5.832  4.016   1.00 0.00 ? 19  ASP A CA   7  
ATOM   7242  C  C    . ASP A 1 19 ? -7.636  -4.862  5.147   1.00 0.00 ? 19  ASP A C    7  
ATOM   7243  O  O    . ASP A 1 19 ? -7.300  -5.277  6.257   1.00 0.00 ? 19  ASP A O    7  
ATOM   7244  C  CB   . ASP A 1 19 ? -6.703  -6.147  3.213   1.00 0.00 ? 19  ASP A CB   7  
ATOM   7245  C  CG   . ASP A 1 19 ? -6.674  -7.579  2.717   1.00 0.00 ? 19  ASP A CG   7  
ATOM   7246  O  OD1  . ASP A 1 19 ? -6.862  -8.497  3.542   1.00 0.00 ? 19  ASP A OD1  7  
ATOM   7247  O  OD2  . ASP A 1 19 ? -6.465  -7.782  1.503   1.00 0.00 ? 19  ASP A OD2  7  
ATOM   7248  H  H    . ASP A 1 19 ? -8.739  -4.908  2.275   1.00 0.00 ? 19  ASP A H    7  
ATOM   7249  H  HA   . ASP A 1 19 ? -8.347  -6.747  4.444   1.00 0.00 ? 19  ASP A HA   7  
ATOM   7250  H  HB2  . ASP A 1 19 ? -6.654  -5.488  2.358   1.00 0.00 ? 19  ASP A HB2  7  
ATOM   7251  H  HB3  . ASP A 1 19 ? -5.837  -5.984  3.837   1.00 0.00 ? 19  ASP A HB3  7  
ATOM   7252  N  N    . LYS A 1 20 ? -7.732  -3.569  4.858   1.00 0.00 ? 20  LYS A N    7  
ATOM   7253  C  CA   . LYS A 1 20 ? -7.445  -2.539  5.849   1.00 0.00 ? 20  LYS A CA   7  
ATOM   7254  C  C    . LYS A 1 20 ? -8.496  -2.539  6.954   1.00 0.00 ? 20  LYS A C    7  
ATOM   7255  O  O    . LYS A 1 20 ? -8.189  -2.802  8.117   1.00 0.00 ? 20  LYS A O    7  
ATOM   7256  C  CB   . LYS A 1 20 ? -7.390  -1.163  5.183   1.00 0.00 ? 20  LYS A CB   7  
ATOM   7257  C  CG   . LYS A 1 20 ? -7.077  -0.032  6.148   1.00 0.00 ? 20  LYS A CG   7  
ATOM   7258  C  CD   . LYS A 1 20 ? -5.584  0.237   6.227   1.00 0.00 ? 20  LYS A CD   7  
ATOM   7259  C  CE   . LYS A 1 20 ? -5.297  1.689   6.576   1.00 0.00 ? 20  LYS A CE   7  
ATOM   7260  N  NZ   . LYS A 1 20 ? -5.688  2.612   5.475   1.00 0.00 ? 20  LYS A NZ   7  
ATOM   7261  H  H    . LYS A 1 20 ? -8.005  -3.301  3.955   1.00 0.00 ? 20  LYS A H    7  
ATOM   7262  H  HA   . LYS A 1 20 ? -6.482  -2.758  6.285   1.00 0.00 ? 20  LYS A HA   7  
ATOM   7263  H  HB2  . LYS A 1 20 ? -6.627  -1.176  4.418   1.00 0.00 ? 20  LYS A HB2  7  
ATOM   7264  H  HB3  . LYS A 1 20 ? -8.346  -0.961  4.722   1.00 0.00 ? 20  LYS A HB3  7  
ATOM   7265  H  HG2  . LYS A 1 20 ? -7.576  0.865   5.812   1.00 0.00 ? 20  LYS A HG2  7  
ATOM   7266  H  HG3  . LYS A 1 20 ? -7.438  -0.300  7.131   1.00 0.00 ? 20  LYS A HG3  7  
ATOM   7267  H  HD2  . LYS A 1 20 ? -5.152  -0.396  6.988   1.00 0.00 ? 20  LYS A HD2  7  
ATOM   7268  H  HD3  . LYS A 1 20 ? -5.135  0.010   5.270   1.00 0.00 ? 20  LYS A HD3  7  
ATOM   7269  H  HE2  . LYS A 1 20 ? -5.851  1.948   7.465   1.00 0.00 ? 20  LYS A HE2  7  
ATOM   7270  H  HE3  . LYS A 1 20 ? -4.239  1.798   6.766   1.00 0.00 ? 20  LYS A HE3  7  
ATOM   7271  H  HZ1  . LYS A 1 20 ? -5.756  2.090   4.578   1.00 0.00 ? 20  LYS A HZ1  7  
ATOM   7272  H  HZ2  . LYS A 1 20 ? -4.980  3.366   5.371   1.00 0.00 ? 20  LYS A HZ2  7  
ATOM   7273  H  HZ3  . LYS A 1 20 ? -6.611  3.045   5.682   1.00 0.00 ? 20  LYS A HZ3  7  
ATOM   7274  N  N    . CYS A 1 21 ? -9.738  -2.244  6.584   1.00 0.00 ? 21  CYS A N    7  
ATOM   7275  C  CA   . CYS A 1 21 ? -10.835 -2.211  7.543   1.00 0.00 ? 21  CYS A CA   7  
ATOM   7276  C  C    . CYS A 1 21 ? -11.500 -3.580  7.657   1.00 0.00 ? 21  CYS A C    7  
ATOM   7277  O  O    . CYS A 1 21 ? -11.377 -4.259  8.675   1.00 0.00 ? 21  CYS A O    7  
ATOM   7278  C  CB   . CYS A 1 21 ? -11.869 -1.162  7.130   1.00 0.00 ? 21  CYS A CB   7  
ATOM   7279  S  SG   . CYS A 1 21 ? -12.009 -0.925  5.329   1.00 0.00 ? 21  CYS A SG   7  
ATOM   7280  H  H    . CYS A 1 21 ? -9.921  -2.043  5.641   1.00 0.00 ? 21  CYS A H    7  
ATOM   7281  H  HA   . CYS A 1 21 ? -10.427 -1.942  8.505   1.00 0.00 ? 21  CYS A HA   7  
ATOM   7282  H  HB2  . CYS A 1 21 ? -12.840 -1.461  7.497   1.00 0.00 ? 21  CYS A HB2  7  
ATOM   7283  H  HB3  . CYS A 1 21 ? -11.602 -0.212  7.567   1.00 0.00 ? 21  CYS A HB3  7  
ATOM   7284  N  N    . GLY A 1 22 ? -12.205 -3.979  6.602   1.00 0.00 ? 22  GLY A N    7  
ATOM   7285  C  CA   . GLY A 1 22 ? -12.878 -5.264  6.603   1.00 0.00 ? 22  GLY A CA   7  
ATOM   7286  C  C    . GLY A 1 22 ? -14.346 -5.150  6.242   1.00 0.00 ? 22  GLY A C    7  
ATOM   7287  O  O    . GLY A 1 22 ? -15.206 -5.720  6.915   1.00 0.00 ? 22  GLY A O    7  
ATOM   7288  H  H    . GLY A 1 22 ? -12.268 -3.396  5.817   1.00 0.00 ? 22  GLY A H    7  
ATOM   7289  H  HA2  . GLY A 1 22 ? -12.392 -5.914  5.891   1.00 0.00 ? 22  GLY A HA2  7  
ATOM   7290  H  HA3  . GLY A 1 22 ? -12.795 -5.700  7.588   1.00 0.00 ? 22  GLY A HA3  7  
ATOM   7291  N  N    . THR A 1 23 ? -14.635 -4.411  5.176   1.00 0.00 ? 23  THR A N    7  
ATOM   7292  C  CA   . THR A 1 23 ? -16.009 -4.221  4.728   1.00 0.00 ? 23  THR A CA   7  
ATOM   7293  C  C    . THR A 1 23 ? -16.122 -4.384  3.216   1.00 0.00 ? 23  THR A C    7  
ATOM   7294  O  O    . THR A 1 23 ? -15.337 -3.814  2.460   1.00 0.00 ? 23  THR A O    7  
ATOM   7295  C  CB   . THR A 1 23 ? -16.543 -2.831  5.124   1.00 0.00 ? 23  THR A CB   7  
ATOM   7296  O  OG1  . THR A 1 23 ? -15.729 -1.809  4.537   1.00 0.00 ? 23  THR A OG1  7  
ATOM   7297  C  CG2  . THR A 1 23 ? -16.559 -2.668  6.636   1.00 0.00 ? 23  THR A CG2  7  
ATOM   7298  H  H    . THR A 1 23 ? -13.907 -3.982  4.680   1.00 0.00 ? 23  THR A H    7  
ATOM   7299  H  HA   . THR A 1 23 ? -16.623 -4.969  5.208   1.00 0.00 ? 23  THR A HA   7  
ATOM   7300  H  HB   . THR A 1 23 ? -17.553 -2.732  4.754   1.00 0.00 ? 23  THR A HB   7  
ATOM   7301  H  HG1  . THR A 1 23 ? -15.783 -1.866  3.580   1.00 0.00 ? 23  THR A HG1  7  
ATOM   7302  H  HG21 . THR A 1 23 ? -16.154 -1.702  6.899   1.00 0.00 ? 23  THR A HG21 7  
ATOM   7303  H  HG22 . THR A 1 23 ? -15.960 -3.445  7.088   1.00 0.00 ? 23  THR A HG22 7  
ATOM   7304  H  HG23 . THR A 1 23 ? -17.574 -2.742  6.994   1.00 0.00 ? 23  THR A HG23 7  
ATOM   7305  N  N    . GLY A 1 24 ? -17.105 -5.168  2.782   1.00 0.00 ? 24  GLY A N    7  
ATOM   7306  C  CA   . GLY A 1 24 ? -17.302 -5.392  1.362   1.00 0.00 ? 24  GLY A CA   7  
ATOM   7307  C  C    . GLY A 1 24 ? -17.110 -4.130  0.544   1.00 0.00 ? 24  GLY A C    7  
ATOM   7308  O  O    . GLY A 1 24 ? -17.731 -3.103  0.820   1.00 0.00 ? 24  GLY A O    7  
ATOM   7309  H  H    . GLY A 1 24 ? -17.700 -5.597  3.431   1.00 0.00 ? 24  GLY A H    7  
ATOM   7310  H  HA2  . GLY A 1 24 ? -16.598 -6.137  1.024   1.00 0.00 ? 24  GLY A HA2  7  
ATOM   7311  H  HA3  . GLY A 1 24 ? -18.305 -5.760  1.203   1.00 0.00 ? 24  GLY A HA3  7  
ATOM   7312  N  N    . ILE A 1 25 ? -16.248 -4.206  -0.464  1.00 0.00 ? 25  ILE A N    7  
ATOM   7313  C  CA   . ILE A 1 25 ? -15.976 -3.060  -1.324  1.00 0.00 ? 25  ILE A CA   7  
ATOM   7314  C  C    . ILE A 1 25 ? -16.964 -2.997  -2.484  1.00 0.00 ? 25  ILE A C    7  
ATOM   7315  O  O    . ILE A 1 25 ? -17.524 -4.014  -2.893  1.00 0.00 ? 25  ILE A O    7  
ATOM   7316  C  CB   . ILE A 1 25 ? -14.544 -3.106  -1.887  1.00 0.00 ? 25  ILE A CB   7  
ATOM   7317  C  CG1  . ILE A 1 25 ? -13.526 -3.177  -0.746  1.00 0.00 ? 25  ILE A CG1  7  
ATOM   7318  C  CG2  . ILE A 1 25 ? -14.280 -1.892  -2.765  1.00 0.00 ? 25  ILE A CG2  7  
ATOM   7319  C  CD1  . ILE A 1 25 ? -12.169 -3.687  -1.177  1.00 0.00 ? 25  ILE A CD1  7  
ATOM   7320  H  H    . ILE A 1 25 ? -15.785 -5.052  -0.634  1.00 0.00 ? 25  ILE A H    7  
ATOM   7321  H  HA   . ILE A 1 25 ? -16.079 -2.165  -0.728  1.00 0.00 ? 25  ILE A HA   7  
ATOM   7322  H  HB   . ILE A 1 25 ? -14.449 -3.990  -2.499  1.00 0.00 ? 25  ILE A HB   7  
ATOM   7323  H  HG12 . ILE A 1 25 ? -13.392 -2.191  -0.330  1.00 0.00 ? 25  ILE A HG12 7  
ATOM   7324  H  HG13 . ILE A 1 25 ? -13.902 -3.838  0.021   1.00 0.00 ? 25  ILE A HG13 7  
ATOM   7325  H  HG21 . ILE A 1 25 ? -13.223 -1.669  -2.763  1.00 0.00 ? 25  ILE A HG21 7  
ATOM   7326  H  HG22 . ILE A 1 25 ? -14.602 -2.101  -3.774  1.00 0.00 ? 25  ILE A HG22 7  
ATOM   7327  H  HG23 . ILE A 1 25 ? -14.827 -1.044  -2.381  1.00 0.00 ? 25  ILE A HG23 7  
ATOM   7328  H  HD11 . ILE A 1 25 ? -11.490 -3.657  -0.338  1.00 0.00 ? 25  ILE A HD11 7  
ATOM   7329  H  HD12 . ILE A 1 25 ? -12.261 -4.702  -1.532  1.00 0.00 ? 25  ILE A HD12 7  
ATOM   7330  H  HD13 . ILE A 1 25 ? -11.786 -3.062  -1.972  1.00 0.00 ? 25  ILE A HD13 7  
ATOM   7331  N  N    . VAL A 1 26 ? -17.173 -1.795  -3.012  1.00 0.00 ? 26  VAL A N    7  
ATOM   7332  C  CA   . VAL A 1 26 ? -18.091 -1.598  -4.127  1.00 0.00 ? 26  VAL A CA   7  
ATOM   7333  C  C    . VAL A 1 26 ? -17.579 -0.522  -5.078  1.00 0.00 ? 26  VAL A C    7  
ATOM   7334  O  O    . VAL A 1 26 ? -17.199 0.568   -4.652  1.00 0.00 ? 26  VAL A O    7  
ATOM   7335  C  CB   . VAL A 1 26 ? -19.497 -1.206  -3.635  1.00 0.00 ? 26  VAL A CB   7  
ATOM   7336  C  CG1  . VAL A 1 26 ? -19.454 0.130   -2.907  1.00 0.00 ? 26  VAL A CG1  7  
ATOM   7337  C  CG2  . VAL A 1 26 ? -20.474 -1.157  -4.799  1.00 0.00 ? 26  VAL A CG2  7  
ATOM   7338  H  H    . VAL A 1 26 ? -16.697 -1.022  -2.642  1.00 0.00 ? 26  VAL A H    7  
ATOM   7339  H  HA   . VAL A 1 26 ? -18.169 -2.532  -4.664  1.00 0.00 ? 26  VAL A HA   7  
ATOM   7340  H  HB   . VAL A 1 26 ? -19.835 -1.959  -2.938  1.00 0.00 ? 26  VAL A HB   7  
ATOM   7341  H  HG11 . VAL A 1 26 ? -19.344 0.928   -3.627  1.00 0.00 ? 26  VAL A HG11 7  
ATOM   7342  H  HG12 . VAL A 1 26 ? -20.371 0.267   -2.353  1.00 0.00 ? 26  VAL A HG12 7  
ATOM   7343  H  HG13 . VAL A 1 26 ? -18.616 0.142   -2.227  1.00 0.00 ? 26  VAL A HG13 7  
ATOM   7344  H  HG21 . VAL A 1 26 ? -21.315 -0.533  -4.536  1.00 0.00 ? 26  VAL A HG21 7  
ATOM   7345  H  HG22 . VAL A 1 26 ? -19.980 -0.747  -5.668  1.00 0.00 ? 26  VAL A HG22 7  
ATOM   7346  H  HG23 . VAL A 1 26 ? -20.821 -2.155  -5.020  1.00 0.00 ? 26  VAL A HG23 7  
ATOM   7347  N  N    . GLY A 1 27 ? -17.571 -0.836  -6.370  1.00 0.00 ? 27  GLY A N    7  
ATOM   7348  C  CA   . GLY A 1 27 ? -17.103 0.114   -7.361  1.00 0.00 ? 27  GLY A CA   7  
ATOM   7349  C  C    . GLY A 1 27 ? -15.591 0.176   -7.438  1.00 0.00 ? 27  GLY A C    7  
ATOM   7350  O  O    . GLY A 1 27 ? -14.913 -0.843  -7.305  1.00 0.00 ? 27  GLY A O    7  
ATOM   7351  H  H    . GLY A 1 27 ? -17.885 -1.721  -6.652  1.00 0.00 ? 27  GLY A H    7  
ATOM   7352  H  HA2  . GLY A 1 27 ? -17.491 -0.170  -8.328  1.00 0.00 ? 27  GLY A HA2  7  
ATOM   7353  H  HA3  . GLY A 1 27 ? -17.479 1.095   -7.109  1.00 0.00 ? 27  GLY A HA3  7  
ATOM   7354  N  N    . VAL A 1 28 ? -15.059 1.375   -7.654  1.00 0.00 ? 28  VAL A N    7  
ATOM   7355  C  CA   . VAL A 1 28 ? -13.616 1.565   -7.749  1.00 0.00 ? 28  VAL A CA   7  
ATOM   7356  C  C    . VAL A 1 28 ? -12.910 1.046   -6.501  1.00 0.00 ? 28  VAL A C    7  
ATOM   7357  O  O    . VAL A 1 28 ? -13.389 1.230   -5.382  1.00 0.00 ? 28  VAL A O    7  
ATOM   7358  C  CB   . VAL A 1 28 ? -13.258 3.050   -7.947  1.00 0.00 ? 28  VAL A CB   7  
ATOM   7359  C  CG1  . VAL A 1 28 ? -13.847 3.896   -6.828  1.00 0.00 ? 28  VAL A CG1  7  
ATOM   7360  C  CG2  . VAL A 1 28 ? -11.749 3.228   -8.024  1.00 0.00 ? 28  VAL A CG2  7  
ATOM   7361  H  H    . VAL A 1 28 ? -15.651 2.150   -7.752  1.00 0.00 ? 28  VAL A H    7  
ATOM   7362  H  HA   . VAL A 1 28 ? -13.262 1.013   -8.607  1.00 0.00 ? 28  VAL A HA   7  
ATOM   7363  H  HB   . VAL A 1 28 ? -13.687 3.381   -8.882  1.00 0.00 ? 28  VAL A HB   7  
ATOM   7364  H  HG11 . VAL A 1 28 ? -13.090 4.077   -6.079  1.00 0.00 ? 28  VAL A HG11 7  
ATOM   7365  H  HG12 . VAL A 1 28 ? -14.190 4.838   -7.230  1.00 0.00 ? 28  VAL A HG12 7  
ATOM   7366  H  HG13 . VAL A 1 28 ? -14.677 3.371   -6.380  1.00 0.00 ? 28  VAL A HG13 7  
ATOM   7367  H  HG21 . VAL A 1 28 ? -11.414 3.819   -7.185  1.00 0.00 ? 28  VAL A HG21 7  
ATOM   7368  H  HG22 . VAL A 1 28 ? -11.270 2.260   -7.997  1.00 0.00 ? 28  VAL A HG22 7  
ATOM   7369  H  HG23 . VAL A 1 28 ? -11.492 3.731   -8.945  1.00 0.00 ? 28  VAL A HG23 7  
ATOM   7370  N  N    . PHE A 1 29 ? -11.768 0.397   -6.701  1.00 0.00 ? 29  PHE A N    7  
ATOM   7371  C  CA   . PHE A 1 29 ? -10.995 -0.150  -5.593  1.00 0.00 ? 29  PHE A CA   7  
ATOM   7372  C  C    . PHE A 1 29 ? -9.598  -0.555  -6.052  1.00 0.00 ? 29  PHE A C    7  
ATOM   7373  O  O    . PHE A 1 29 ? -9.305  -0.572  -7.247  1.00 0.00 ? 29  PHE A O    7  
ATOM   7374  C  CB   . PHE A 1 29 ? -11.715 -1.357  -4.987  1.00 0.00 ? 29  PHE A CB   7  
ATOM   7375  C  CG   . PHE A 1 29 ? -12.049 -2.422  -5.992  1.00 0.00 ? 29  PHE A CG   7  
ATOM   7376  C  CD1  . PHE A 1 29 ? -11.044 -3.096  -6.667  1.00 0.00 ? 29  PHE A CD1  7  
ATOM   7377  C  CD2  . PHE A 1 29 ? -13.369 -2.748  -6.263  1.00 0.00 ? 29  PHE A CD2  7  
ATOM   7378  C  CE1  . PHE A 1 29 ? -11.348 -4.077  -7.592  1.00 0.00 ? 29  PHE A CE1  7  
ATOM   7379  C  CE2  . PHE A 1 29 ? -13.678 -3.728  -7.187  1.00 0.00 ? 29  PHE A CE2  7  
ATOM   7380  C  CZ   . PHE A 1 29 ? -12.667 -4.392  -7.853  1.00 0.00 ? 29  PHE A CZ   7  
ATOM   7381  H  H    . PHE A 1 29 ? -11.438 0.283   -7.617  1.00 0.00 ? 29  PHE A H    7  
ATOM   7382  H  HA   . PHE A 1 29 ? -10.905 0.619   -4.841  1.00 0.00 ? 29  PHE A HA   7  
ATOM   7383  H  HB2  . PHE A 1 29 ? -11.086 -1.801  -4.231  1.00 0.00 ? 29  PHE A HB2  7  
ATOM   7384  H  HB3  . PHE A 1 29 ? -12.637 -1.026  -4.533  1.00 0.00 ? 29  PHE A HB3  7  
ATOM   7385  H  HD1  . PHE A 1 29 ? -10.012 -2.849  -6.464  1.00 0.00 ? 29  PHE A HD1  7  
ATOM   7386  H  HD2  . PHE A 1 29 ? -14.161 -2.229  -5.743  1.00 0.00 ? 29  PHE A HD2  7  
ATOM   7387  H  HE1  . PHE A 1 29 ? -10.555 -4.594  -8.112  1.00 0.00 ? 29  PHE A HE1  7  
ATOM   7388  H  HE2  . PHE A 1 29 ? -14.711 -3.973  -7.389  1.00 0.00 ? 29  PHE A HE2  7  
ATOM   7389  H  HZ   . PHE A 1 29 ? -12.907 -5.159  -8.575  1.00 0.00 ? 29  PHE A HZ   7  
ATOM   7390  N  N    . VAL A 1 30 ? -8.737  -0.881  -5.092  1.00 0.00 ? 30  VAL A N    7  
ATOM   7391  C  CA   . VAL A 1 30 ? -7.370  -1.287  -5.396  1.00 0.00 ? 30  VAL A CA   7  
ATOM   7392  C  C    . VAL A 1 30 ? -7.211  -2.800  -5.296  1.00 0.00 ? 30  VAL A C    7  
ATOM   7393  O  O    . VAL A 1 30 ? -7.107  -3.354  -4.201  1.00 0.00 ? 30  VAL A O    7  
ATOM   7394  C  CB   . VAL A 1 30 ? -6.360  -0.612  -4.450  1.00 0.00 ? 30  VAL A CB   7  
ATOM   7395  C  CG1  . VAL A 1 30 ? -4.972  -1.202  -4.641  1.00 0.00 ? 30  VAL A CG1  7  
ATOM   7396  C  CG2  . VAL A 1 30 ? -6.345  0.893   -4.674  1.00 0.00 ? 30  VAL A CG2  7  
ATOM   7397  H  H    . VAL A 1 30 ? -9.029  -0.849  -4.157  1.00 0.00 ? 30  VAL A H    7  
ATOM   7398  H  HA   . VAL A 1 30 ? -7.147  -0.978  -6.407  1.00 0.00 ? 30  VAL A HA   7  
ATOM   7399  H  HB   . VAL A 1 30 ? -6.670  -0.800  -3.432  1.00 0.00 ? 30  VAL A HB   7  
ATOM   7400  H  HG11 . VAL A 1 30 ? -4.987  -1.897  -5.468  1.00 0.00 ? 30  VAL A HG11 7  
ATOM   7401  H  HG12 . VAL A 1 30 ? -4.269  -0.409  -4.848  1.00 0.00 ? 30  VAL A HG12 7  
ATOM   7402  H  HG13 . VAL A 1 30 ? -4.674  -1.721  -3.741  1.00 0.00 ? 30  VAL A HG13 7  
ATOM   7403  H  HG21 . VAL A 1 30 ? -7.356  1.246   -4.812  1.00 0.00 ? 30  VAL A HG21 7  
ATOM   7404  H  HG22 . VAL A 1 30 ? -5.908  1.381   -3.814  1.00 0.00 ? 30  VAL A HG22 7  
ATOM   7405  H  HG23 . VAL A 1 30 ? -5.760  1.120   -5.552  1.00 0.00 ? 30  VAL A HG23 7  
ATOM   7406  N  N    . LYS A 1 31 ? -7.193  -3.465  -6.446  1.00 0.00 ? 31  LYS A N    7  
ATOM   7407  C  CA   . LYS A 1 31 ? -7.044  -4.915  -6.489  1.00 0.00 ? 31  LYS A CA   7  
ATOM   7408  C  C    . LYS A 1 31 ? -5.574  -5.314  -6.402  1.00 0.00 ? 31  LYS A C    7  
ATOM   7409  O  O    . LYS A 1 31 ? -4.817  -5.147  -7.360  1.00 0.00 ? 31  LYS A O    7  
ATOM   7410  C  CB   . LYS A 1 31 ? -7.660  -5.473  -7.775  1.00 0.00 ? 31  LYS A CB   7  
ATOM   7411  C  CG   . LYS A 1 31 ? -7.911  -6.970  -7.728  1.00 0.00 ? 31  LYS A CG   7  
ATOM   7412  C  CD   . LYS A 1 31 ? -6.662  -7.757  -8.089  1.00 0.00 ? 31  LYS A CD   7  
ATOM   7413  C  CE   . LYS A 1 31 ? -6.801  -9.225  -7.716  1.00 0.00 ? 31  LYS A CE   7  
ATOM   7414  N  NZ   . LYS A 1 31 ? -7.486  -10.006 -8.783  1.00 0.00 ? 31  LYS A NZ   7  
ATOM   7415  H  H    . LYS A 1 31 ? -7.280  -2.968  -7.287  1.00 0.00 ? 31  LYS A H    7  
ATOM   7416  H  HA   . LYS A 1 31 ? -7.568  -5.328  -5.641  1.00 0.00 ? 31  LYS A HA   7  
ATOM   7417  H  HB2  . LYS A 1 31 ? -8.602  -4.976  -7.953  1.00 0.00 ? 31  LYS A HB2  7  
ATOM   7418  H  HB3  . LYS A 1 31 ? -6.992  -5.267  -8.599  1.00 0.00 ? 31  LYS A HB3  7  
ATOM   7419  H  HG2  . LYS A 1 31 ? -8.220  -7.244  -6.731  1.00 0.00 ? 31  LYS A HG2  7  
ATOM   7420  H  HG3  . LYS A 1 31 ? -8.696  -7.216  -8.430  1.00 0.00 ? 31  LYS A HG3  7  
ATOM   7421  H  HD2  . LYS A 1 31 ? -6.494  -7.682  -9.153  1.00 0.00 ? 31  LYS A HD2  7  
ATOM   7422  H  HD3  . LYS A 1 31 ? -5.818  -7.338  -7.559  1.00 0.00 ? 31  LYS A HD3  7  
ATOM   7423  H  HE2  . LYS A 1 31 ? -5.816  -9.637  -7.556  1.00 0.00 ? 31  LYS A HE2  7  
ATOM   7424  H  HE3  . LYS A 1 31 ? -7.374  -9.298  -6.804  1.00 0.00 ? 31  LYS A HE3  7  
ATOM   7425  H  HZ1  . LYS A 1 31 ? -7.781  -9.373  -9.554  1.00 0.00 ? 31  LYS A HZ1  7  
ATOM   7426  H  HZ2  . LYS A 1 31 ? -8.327  -10.478 -8.396  1.00 0.00 ? 31  LYS A HZ2  7  
ATOM   7427  H  HZ3  . LYS A 1 31 ? -6.842  -10.727 -9.167  1.00 0.00 ? 31  LYS A HZ3  7  
ATOM   7428  N  N    . LEU A 1 32 ? -5.177  -5.844  -5.251  1.00 0.00 ? 32  LEU A N    7  
ATOM   7429  C  CA   . LEU A 1 32 ? -3.798  -6.269  -5.039  1.00 0.00 ? 32  LEU A CA   7  
ATOM   7430  C  C    . LEU A 1 32 ? -3.575  -7.681  -5.573  1.00 0.00 ? 32  LEU A C    7  
ATOM   7431  O  O    . LEU A 1 32 ? -4.528  -8.430  -5.791  1.00 0.00 ? 32  LEU A O    7  
ATOM   7432  C  CB   . LEU A 1 32 ? -3.448  -6.213  -3.551  1.00 0.00 ? 32  LEU A CB   7  
ATOM   7433  C  CG   . LEU A 1 32 ? -3.270  -4.815  -2.956  1.00 0.00 ? 32  LEU A CG   7  
ATOM   7434  C  CD1  . LEU A 1 32 ? -2.162  -4.065  -3.679  1.00 0.00 ? 32  LEU A CD1  7  
ATOM   7435  C  CD2  . LEU A 1 32 ? -4.575  -4.037  -3.023  1.00 0.00 ? 32  LEU A CD2  7  
ATOM   7436  H  H    . LEU A 1 32 ? -5.826  -5.952  -4.525  1.00 0.00 ? 32  LEU A H    7  
ATOM   7437  H  HA   . LEU A 1 32 ? -3.155  -5.588  -5.578  1.00 0.00 ? 32  LEU A HA   7  
ATOM   7438  H  HB2  . LEU A 1 32 ? -4.240  -6.705  -3.007  1.00 0.00 ? 32  LEU A HB2  7  
ATOM   7439  H  HB3  . LEU A 1 32 ? -2.524  -6.755  -3.409  1.00 0.00 ? 32  LEU A HB3  7  
ATOM   7440  H  HG   . LEU A 1 32 ? -2.986  -4.907  -1.917  1.00 0.00 ? 32  LEU A HG   7  
ATOM   7441  H  HD11 . LEU A 1 32 ? -2.394  -4.007  -4.732  1.00 0.00 ? 32  LEU A HD11 7  
ATOM   7442  H  HD12 . LEU A 1 32 ? -1.226  -4.588  -3.546  1.00 0.00 ? 32  LEU A HD12 7  
ATOM   7443  H  HD13 . LEU A 1 32 ? -2.078  -3.068  -3.273  1.00 0.00 ? 32  LEU A HD13 7  
ATOM   7444  H  HD21 . LEU A 1 32 ? -5.396  -4.688  -2.763  1.00 0.00 ? 32  LEU A HD21 7  
ATOM   7445  H  HD22 . LEU A 1 32 ? -4.719  -3.659  -4.025  1.00 0.00 ? 32  LEU A HD22 7  
ATOM   7446  H  HD23 . LEU A 1 32 ? -4.537  -3.211  -2.328  1.00 0.00 ? 32  LEU A HD23 7  
ATOM   7447  N  N    . ARG A 1 33 ? -2.312  -8.038  -5.778  1.00 0.00 ? 33  ARG A N    7  
ATOM   7448  C  CA   . ARG A 1 33 ? -1.964  -9.360  -6.284  1.00 0.00 ? 33  ARG A CA   7  
ATOM   7449  C  C    . ARG A 1 33 ? -2.961  -10.408 -5.799  1.00 0.00 ? 33  ARG A C    7  
ATOM   7450  O  O    . ARG A 1 33 ? -3.796  -10.888 -6.566  1.00 0.00 ? 33  ARG A O    7  
ATOM   7451  C  CB   . ARG A 1 33 ? -0.550  -9.743  -5.843  1.00 0.00 ? 33  ARG A CB   7  
ATOM   7452  C  CG   . ARG A 1 33 ? 0.034   -10.911 -6.620  1.00 0.00 ? 33  ARG A CG   7  
ATOM   7453  C  CD   . ARG A 1 33 ? 1.271   -11.472 -5.936  1.00 0.00 ? 33  ARG A CD   7  
ATOM   7454  N  NE   . ARG A 1 33 ? 1.677   -12.755 -6.503  1.00 0.00 ? 33  ARG A NE   7  
ATOM   7455  C  CZ   . ARG A 1 33 ? 1.108   -13.912 -6.184  1.00 0.00 ? 33  ARG A CZ   7  
ATOM   7456  N  NH1  . ARG A 1 33 ? 0.115   -13.947 -5.306  1.00 0.00 ? 33  ARG A NH1  7  
ATOM   7457  N  NH2  . ARG A 1 33 ? 1.533   -15.038 -6.743  1.00 0.00 ? 33  ARG A NH2  7  
ATOM   7458  H  H    . ARG A 1 33 ? -1.596  -7.397  -5.585  1.00 0.00 ? 33  ARG A H    7  
ATOM   7459  H  HA   . ARG A 1 33 ? -1.997  -9.322  -7.363  1.00 0.00 ? 33  ARG A HA   7  
ATOM   7460  H  HB2  . ARG A 1 33 ? 0.099   -8.890  -5.976  1.00 0.00 ? 33  ARG A HB2  7  
ATOM   7461  H  HB3  . ARG A 1 33 ? -0.572  -10.009 -4.797  1.00 0.00 ? 33  ARG A HB3  7  
ATOM   7462  H  HG2  . ARG A 1 33 ? -0.708  -11.692 -6.692  1.00 0.00 ? 33  ARG A HG2  7  
ATOM   7463  H  HG3  . ARG A 1 33 ? 0.303   -10.575 -7.610  1.00 0.00 ? 33  ARG A HG3  7  
ATOM   7464  H  HD2  . ARG A 1 33 ? 2.081   -10.767 -6.050  1.00 0.00 ? 33  ARG A HD2  7  
ATOM   7465  H  HD3  . ARG A 1 33 ? 1.056   -11.605 -4.886  1.00 0.00 ? 33  ARG A HD3  7  
ATOM   7466  H  HE   . ARG A 1 33 ? 2.409   -12.753 -7.154  1.00 0.00 ? 33  ARG A HE   7  
ATOM   7467  H  HH11 . ARG A 1 33 ? -0.208  -13.100 -4.884  1.00 0.00 ? 33  ARG A HH11 7  
ATOM   7468  H  HH12 . ARG A 1 33 ? -0.312  -14.820 -5.069  1.00 0.00 ? 33  ARG A HH12 7  
ATOM   7469  H  HH21 . ARG A 1 33 ? 2.281   -15.016 -7.405  1.00 0.00 ? 33  ARG A HH21 7  
ATOM   7470  H  HH22 . ARG A 1 33 ? 1.105   -15.908 -6.502  1.00 0.00 ? 33  ARG A HH22 7  
ATOM   7471  N  N    . ASP A 1 34 ? -2.868  -10.758 -4.521  1.00 0.00 ? 34  ASP A N    7  
ATOM   7472  C  CA   . ASP A 1 34 ? -3.762  -11.749 -3.932  1.00 0.00 ? 34  ASP A CA   7  
ATOM   7473  C  C    . ASP A 1 34 ? -4.595  -11.131 -2.813  1.00 0.00 ? 34  ASP A C    7  
ATOM   7474  O  O    . ASP A 1 34 ? -5.239  -11.842 -2.041  1.00 0.00 ? 34  ASP A O    7  
ATOM   7475  C  CB   . ASP A 1 34 ? -2.960  -12.934 -3.393  1.00 0.00 ? 34  ASP A CB   7  
ATOM   7476  C  CG   . ASP A 1 34 ? -3.802  -14.187 -3.252  1.00 0.00 ? 34  ASP A CG   7  
ATOM   7477  O  OD1  . ASP A 1 34 ? -4.517  -14.533 -4.216  1.00 0.00 ? 34  ASP A OD1  7  
ATOM   7478  O  OD2  . ASP A 1 34 ? -3.746  -14.821 -2.178  1.00 0.00 ? 34  ASP A OD2  7  
ATOM   7479  H  H    . ASP A 1 34 ? -2.181  -10.340 -3.959  1.00 0.00 ? 34  ASP A H    7  
ATOM   7480  H  HA   . ASP A 1 34 ? -4.426  -12.098 -4.707  1.00 0.00 ? 34  ASP A HA   7  
ATOM   7481  H  HB2  . ASP A 1 34 ? -2.144  -13.146 -4.069  1.00 0.00 ? 34  ASP A HB2  7  
ATOM   7482  H  HB3  . ASP A 1 34 ? -2.561  -12.679 -2.422  1.00 0.00 ? 34  ASP A HB3  7  
ATOM   7483  N  N    . ARG A 1 35 ? -4.577  -9.805  -2.731  1.00 0.00 ? 35  ARG A N    7  
ATOM   7484  C  CA   . ARG A 1 35 ? -5.329  -9.092  -1.705  1.00 0.00 ? 35  ARG A CA   7  
ATOM   7485  C  C    . ARG A 1 35 ? -6.193  -7.998  -2.326  1.00 0.00 ? 35  ARG A C    7  
ATOM   7486  O  O    . ARG A 1 35 ? -6.100  -7.724  -3.523  1.00 0.00 ? 35  ARG A O    7  
ATOM   7487  C  CB   . ARG A 1 35 ? -4.376  -8.482  -0.676  1.00 0.00 ? 35  ARG A CB   7  
ATOM   7488  C  CG   . ARG A 1 35 ? -3.706  -9.512  0.219   1.00 0.00 ? 35  ARG A CG   7  
ATOM   7489  C  CD   . ARG A 1 35 ? -4.693  -10.125 1.200   1.00 0.00 ? 35  ARG A CD   7  
ATOM   7490  N  NE   . ARG A 1 35 ? -4.307  -11.477 1.593   1.00 0.00 ? 35  ARG A NE   7  
ATOM   7491  C  CZ   . ARG A 1 35 ? -5.171  -12.475 1.741   1.00 0.00 ? 35  ARG A CZ   7  
ATOM   7492  N  NH1  . ARG A 1 35 ? -6.464  -12.273 1.529   1.00 0.00 ? 35  ARG A NH1  7  
ATOM   7493  N  NH2  . ARG A 1 35 ? -4.742  -13.678 2.101   1.00 0.00 ? 35  ARG A NH2  7  
ATOM   7494  H  H    . ARG A 1 35 ? -4.044  -9.293  -3.375  1.00 0.00 ? 35  ARG A H    7  
ATOM   7495  H  HA   . ARG A 1 35 ? -5.971  -9.805  -1.210  1.00 0.00 ? 35  ARG A HA   7  
ATOM   7496  H  HB2  . ARG A 1 35 ? -3.604  -7.934  -1.197  1.00 0.00 ? 35  ARG A HB2  7  
ATOM   7497  H  HB3  . ARG A 1 35 ? -4.931  -7.800  -0.050  1.00 0.00 ? 35  ARG A HB3  7  
ATOM   7498  H  HG2  . ARG A 1 35 ? -3.293  -10.297 -0.397  1.00 0.00 ? 35  ARG A HG2  7  
ATOM   7499  H  HG3  . ARG A 1 35 ? -2.913  -9.032  0.773   1.00 0.00 ? 35  ARG A HG3  7  
ATOM   7500  H  HD2  . ARG A 1 35 ? -4.738  -9.503  2.081   1.00 0.00 ? 35  ARG A HD2  7  
ATOM   7501  H  HD3  . ARG A 1 35 ? -5.667  -10.160 0.734   1.00 0.00 ? 35  ARG A HD3  7  
ATOM   7502  H  HE   . ARG A 1 35 ? -3.356  -11.648 1.755   1.00 0.00 ? 35  ARG A HE   7  
ATOM   7503  H  HH11 . ARG A 1 35 ? -6.790  -11.368 1.256   1.00 0.00 ? 35  ARG A HH11 7  
ATOM   7504  H  HH12 . ARG A 1 35 ? -7.112  -13.027 1.640   1.00 0.00 ? 35  ARG A HH12 7  
ATOM   7505  H  HH21 . ARG A 1 35 ? -3.767  -13.834 2.262   1.00 0.00 ? 35  ARG A HH21 7  
ATOM   7506  H  HH22 . ARG A 1 35 ? -5.393  -14.428 2.212   1.00 0.00 ? 35  ARG A HH22 7  
ATOM   7507  N  N    . HIS A 1 36 ? -7.033  -7.377  -1.504  1.00 0.00 ? 36  HIS A N    7  
ATOM   7508  C  CA   . HIS A 1 36 ? -7.913  -6.313  -1.972  1.00 0.00 ? 36  HIS A CA   7  
ATOM   7509  C  C    . HIS A 1 36 ? -8.072  -5.231  -0.908  1.00 0.00 ? 36  HIS A C    7  
ATOM   7510  O  O    . HIS A 1 36 ? -8.247  -5.530  0.273   1.00 0.00 ? 36  HIS A O    7  
ATOM   7511  C  CB   . HIS A 1 36 ? -9.283  -6.882  -2.345  1.00 0.00 ? 36  HIS A CB   7  
ATOM   7512  C  CG   . HIS A 1 36 ? -9.244  -7.821  -3.512  1.00 0.00 ? 36  HIS A CG   7  
ATOM   7513  N  ND1  . HIS A 1 36 ? -8.905  -9.152  -3.395  1.00 0.00 ? 36  HIS A ND1  7  
ATOM   7514  C  CD2  . HIS A 1 36 ? -9.505  -7.614  -4.823  1.00 0.00 ? 36  HIS A CD2  7  
ATOM   7515  C  CE1  . HIS A 1 36 ? -8.958  -9.723  -4.585  1.00 0.00 ? 36  HIS A CE1  7  
ATOM   7516  N  NE2  . HIS A 1 36 ? -9.320  -8.811  -5.469  1.00 0.00 ? 36  HIS A NE2  7  
ATOM   7517  H  H    . HIS A 1 36 ? -7.061  -7.641  -0.561  1.00 0.00 ? 36  HIS A H    7  
ATOM   7518  H  HA   . HIS A 1 36 ? -7.465  -5.874  -2.850  1.00 0.00 ? 36  HIS A HA   7  
ATOM   7519  H  HB2  . HIS A 1 36 ? -9.683  -7.422  -1.499  1.00 0.00 ? 36  HIS A HB2  7  
ATOM   7520  H  HB3  . HIS A 1 36 ? -9.948  -6.068  -2.595  1.00 0.00 ? 36  HIS A HB3  7  
ATOM   7521  H  HD1  . HIS A 1 36 ? -8.661  -9.610  -2.565  1.00 0.00 ? 36  HIS A HD1  7  
ATOM   7522  H  HD2  . HIS A 1 36 ? -9.804  -6.680  -5.279  1.00 0.00 ? 36  HIS A HD2  7  
ATOM   7523  H  HE1  . HIS A 1 36 ? -8.743  -10.759 -4.800  1.00 0.00 ? 36  HIS A HE1  7  
ATOM   7524  H  HE2  . HIS A 1 36 ? -9.354  -8.947  -6.439  1.00 0.00 ? 36  HIS A HE2  7  
ATOM   7525  N  N    . ARG A 1 37 ? -8.008  -3.974  -1.335  1.00 0.00 ? 37  ARG A N    7  
ATOM   7526  C  CA   . ARG A 1 37 ? -8.142  -2.848  -0.418  1.00 0.00 ? 37  ARG A CA   7  
ATOM   7527  C  C    . ARG A 1 37 ? -8.829  -1.670  -1.101  1.00 0.00 ? 37  ARG A C    7  
ATOM   7528  O  O    . ARG A 1 37 ? -8.817  -1.556  -2.327  1.00 0.00 ? 37  ARG A O    7  
ATOM   7529  C  CB   . ARG A 1 37 ? -6.768  -2.420  0.102   1.00 0.00 ? 37  ARG A CB   7  
ATOM   7530  C  CG   . ARG A 1 37 ? -6.301  -3.212  1.312   1.00 0.00 ? 37  ARG A CG   7  
ATOM   7531  C  CD   . ARG A 1 37 ? -5.214  -2.473  2.076   1.00 0.00 ? 37  ARG A CD   7  
ATOM   7532  N  NE   . ARG A 1 37 ? -4.583  -3.319  3.086   1.00 0.00 ? 37  ARG A NE   7  
ATOM   7533  C  CZ   . ARG A 1 37 ? -3.822  -2.848  4.068   1.00 0.00 ? 37  ARG A CZ   7  
ATOM   7534  N  NH1  . ARG A 1 37 ? -3.600  -1.545  4.172   1.00 0.00 ? 37  ARG A NH1  7  
ATOM   7535  N  NH2  . ARG A 1 37 ? -3.282  -3.681  4.948   1.00 0.00 ? 37  ARG A NH2  7  
ATOM   7536  H  H    . ARG A 1 37 ? -7.866  -3.799  -2.288  1.00 0.00 ? 37  ARG A H    7  
ATOM   7537  H  HA   . ARG A 1 37 ? -8.748  -3.170  0.416   1.00 0.00 ? 37  ARG A HA   7  
ATOM   7538  H  HB2  . ARG A 1 37 ? -6.041  -2.549  -0.686  1.00 0.00 ? 37  ARG A HB2  7  
ATOM   7539  H  HB3  . ARG A 1 37 ? -6.810  -1.377  0.376   1.00 0.00 ? 37  ARG A HB3  7  
ATOM   7540  H  HG2  . ARG A 1 37 ? -7.142  -3.374  1.971   1.00 0.00 ? 37  ARG A HG2  7  
ATOM   7541  H  HG3  . ARG A 1 37 ? -5.913  -4.164  0.980   1.00 0.00 ? 37  ARG A HG3  7  
ATOM   7542  H  HD2  . ARG A 1 37 ? -4.461  -2.143  1.376   1.00 0.00 ? 37  ARG A HD2  7  
ATOM   7543  H  HD3  . ARG A 1 37 ? -5.654  -1.615  2.562   1.00 0.00 ? 37  ARG A HD3  7  
ATOM   7544  H  HE   . ARG A 1 37 ? -4.734  -4.285  3.027   1.00 0.00 ? 37  ARG A HE   7  
ATOM   7545  H  HH11 . ARG A 1 37 ? -4.006  -0.915  3.511   1.00 0.00 ? 37  ARG A HH11 7  
ATOM   7546  H  HH12 . ARG A 1 37 ? -3.028  -1.193  4.913   1.00 0.00 ? 37  ARG A HH12 7  
ATOM   7547  H  HH21 . ARG A 1 37 ? -3.448  -4.664  4.873   1.00 0.00 ? 37  ARG A HH21 7  
ATOM   7548  H  HH22 . ARG A 1 37 ? -2.710  -3.326  5.687   1.00 0.00 ? 37  ARG A HH22 7  
ATOM   7549  N  N    . HIS A 1 38 ? -9.428  -0.795  -0.300  1.00 0.00 ? 38  HIS A N    7  
ATOM   7550  C  CA   . HIS A 1 38 ? -10.120 0.376   -0.827  1.00 0.00 ? 38  HIS A CA   7  
ATOM   7551  C  C    . HIS A 1 38 ? -9.136  1.340   -1.481  1.00 0.00 ? 38  HIS A C    7  
ATOM   7552  O  O    . HIS A 1 38 ? -7.925  1.271   -1.267  1.00 0.00 ? 38  HIS A O    7  
ATOM   7553  C  CB   . HIS A 1 38 ? -10.885 1.088   0.289   1.00 0.00 ? 38  HIS A CB   7  
ATOM   7554  C  CG   . HIS A 1 38 ? -12.231 0.493   0.566   1.00 0.00 ? 38  HIS A CG   7  
ATOM   7555  N  ND1  . HIS A 1 38 ? -12.577 -0.049  1.786   1.00 0.00 ? 38  HIS A ND1  7  
ATOM   7556  C  CD2  . HIS A 1 38 ? -13.320 0.359   -0.226  1.00 0.00 ? 38  HIS A CD2  7  
ATOM   7557  C  CE1  . HIS A 1 38 ? -13.821 -0.492  1.731   1.00 0.00 ? 38  HIS A CE1  7  
ATOM   7558  N  NE2  . HIS A 1 38 ? -14.294 -0.257  0.521   1.00 0.00 ? 38  HIS A NE2  7  
ATOM   7559  H  H    . HIS A 1 38 ? -9.403  -0.939  0.669   1.00 0.00 ? 38  HIS A H    7  
ATOM   7560  H  HA   . HIS A 1 38 ? -10.823 0.037   -1.574  1.00 0.00 ? 38  HIS A HA   7  
ATOM   7561  H  HB2  . HIS A 1 38 ? -10.307 1.039   1.200   1.00 0.00 ? 38  HIS A HB2  7  
ATOM   7562  H  HB3  . HIS A 1 38 ? -11.029 2.123   0.014   1.00 0.00 ? 38  HIS A HB3  7  
ATOM   7563  H  HD2  . HIS A 1 38 ? -13.408 0.676   -1.256  1.00 0.00 ? 38  HIS A HD2  7  
ATOM   7564  H  HE1  . HIS A 1 38 ? -14.359 -0.967  2.538   1.00 0.00 ? 38  HIS A HE1  7  
ATOM   7565  H  HE2  . HIS A 1 38 ? -15.162 -0.562  0.186   1.00 0.00 ? 38  HIS A HE2  7  
ATOM   7566  N  N    . PRO A 1 39 ? -9.665  2.262   -2.299  1.00 0.00 ? 39  PRO A N    7  
ATOM   7567  C  CA   . PRO A 1 39 ? -8.850  3.258   -3.002  1.00 0.00 ? 39  PRO A CA   7  
ATOM   7568  C  C    . PRO A 1 39 ? -8.259  4.297   -2.054  1.00 0.00 ? 39  PRO A C    7  
ATOM   7569  O  O    . PRO A 1 39 ? -7.406  5.093   -2.445  1.00 0.00 ? 39  PRO A O    7  
ATOM   7570  C  CB   . PRO A 1 39 ? -9.844  3.916   -3.963  1.00 0.00 ? 39  PRO A CB   7  
ATOM   7571  C  CG   . PRO A 1 39 ? -11.175 3.721   -3.323  1.00 0.00 ? 39  PRO A CG   7  
ATOM   7572  C  CD   . PRO A 1 39 ? -11.099 2.404   -2.602  1.00 0.00 ? 39  PRO A CD   7  
ATOM   7573  H  HA   . PRO A 1 39 ? -8.055  2.794   -3.566  1.00 0.00 ? 39  PRO A HA   7  
ATOM   7574  H  HB2  . PRO A 1 39 ? -9.605  4.965   -4.069  1.00 0.00 ? 39  PRO A HB2  7  
ATOM   7575  H  HB3  . PRO A 1 39 ? -9.794  3.430   -4.926  1.00 0.00 ? 39  PRO A HB3  7  
ATOM   7576  H  HG2  . PRO A 1 39 ? -11.367 4.521   -2.624  1.00 0.00 ? 39  PRO A HG2  7  
ATOM   7577  H  HG3  . PRO A 1 39 ? -11.944 3.690   -4.080  1.00 0.00 ? 39  PRO A HG3  7  
ATOM   7578  H  HD2  . PRO A 1 39 ? -11.683 2.436   -1.694  1.00 0.00 ? 39  PRO A HD2  7  
ATOM   7579  H  HD3  . PRO A 1 39 ? -11.438 1.603   -3.242  1.00 0.00 ? 39  PRO A HD3  7  
ATOM   7580  N  N    . GLU A 1 40 ? -8.718  4.281   -0.806  1.00 0.00 ? 40  GLU A N    7  
ATOM   7581  C  CA   . GLU A 1 40 ? -8.234  5.223   0.197   1.00 0.00 ? 40  GLU A CA   7  
ATOM   7582  C  C    . GLU A 1 40 ? -7.393  4.510   1.251   1.00 0.00 ? 40  GLU A C    7  
ATOM   7583  O  O    . GLU A 1 40 ? -6.461  5.087   1.813   1.00 0.00 ? 40  GLU A O    7  
ATOM   7584  C  CB   . GLU A 1 40 ? -9.409  5.939   0.865   1.00 0.00 ? 40  GLU A CB   7  
ATOM   7585  C  CG   . GLU A 1 40 ? -10.234 5.041   1.772   1.00 0.00 ? 40  GLU A CG   7  
ATOM   7586  C  CD   . GLU A 1 40 ? -11.018 5.821   2.809   1.00 0.00 ? 40  GLU A CD   7  
ATOM   7587  O  OE1  . GLU A 1 40 ? -11.772 6.736   2.417   1.00 0.00 ? 40  GLU A OE1  7  
ATOM   7588  O  OE2  . GLU A 1 40 ? -10.878 5.517   4.012   1.00 0.00 ? 40  GLU A OE2  7  
ATOM   7589  H  H    . GLU A 1 40 ? -9.398  3.622   -0.555  1.00 0.00 ? 40  GLU A H    7  
ATOM   7590  H  HA   . GLU A 1 40 ? -7.618  5.953   -0.305  1.00 0.00 ? 40  GLU A HA   7  
ATOM   7591  H  HB2  . GLU A 1 40 ? -9.027  6.759   1.455   1.00 0.00 ? 40  GLU A HB2  7  
ATOM   7592  H  HB3  . GLU A 1 40 ? -10.059 6.333   0.097   1.00 0.00 ? 40  GLU A HB3  7  
ATOM   7593  H  HG2  . GLU A 1 40 ? -10.928 4.479   1.166   1.00 0.00 ? 40  GLU A HG2  7  
ATOM   7594  H  HG3  . GLU A 1 40 ? -9.569  4.359   2.282   1.00 0.00 ? 40  GLU A HG3  7  
ATOM   7595  N  N    . CYS A 1 41 ? -7.728  3.251   1.515   1.00 0.00 ? 41  CYS A N    7  
ATOM   7596  C  CA   . CYS A 1 41 ? -7.006  2.458   2.502   1.00 0.00 ? 41  CYS A CA   7  
ATOM   7597  C  C    . CYS A 1 41 ? -5.661  1.995   1.949   1.00 0.00 ? 41  CYS A C    7  
ATOM   7598  O  O    . CYS A 1 41 ? -4.735  1.701   2.706   1.00 0.00 ? 41  CYS A O    7  
ATOM   7599  C  CB   . CYS A 1 41 ? -7.841  1.247   2.924   1.00 0.00 ? 41  CYS A CB   7  
ATOM   7600  S  SG   . CYS A 1 41 ? -9.491  1.670   3.569   1.00 0.00 ? 41  CYS A SG   7  
ATOM   7601  H  H    . CYS A 1 41 ? -8.481  2.846   1.034   1.00 0.00 ? 41  CYS A H    7  
ATOM   7602  H  HA   . CYS A 1 41 ? -6.831  3.082   3.366   1.00 0.00 ? 41  CYS A HA   7  
ATOM   7603  H  HB2  . CYS A 1 41 ? -7.979  0.600   2.070   1.00 0.00 ? 41  CYS A HB2  7  
ATOM   7604  H  HB3  . CYS A 1 41 ? -7.313  0.708   3.697   1.00 0.00 ? 41  CYS A HB3  7  
ATOM   7605  N  N    . TYR A 1 42 ? -5.562  1.933   0.626   1.00 0.00 ? 42  TYR A N    7  
ATOM   7606  C  CA   . TYR A 1 42 ? -4.332  1.504   -0.028  1.00 0.00 ? 42  TYR A CA   7  
ATOM   7607  C  C    . TYR A 1 42 ? -3.113  2.142   0.630   1.00 0.00 ? 42  TYR A C    7  
ATOM   7608  O  O    . TYR A 1 42 ? -1.995  1.640   0.513   1.00 0.00 ? 42  TYR A O    7  
ATOM   7609  C  CB   . TYR A 1 42 ? -4.369  1.862   -1.515  1.00 0.00 ? 42  TYR A CB   7  
ATOM   7610  C  CG   . TYR A 1 42 ? -3.069  1.586   -2.237  1.00 0.00 ? 42  TYR A CG   7  
ATOM   7611  C  CD1  . TYR A 1 42 ? -2.375  0.401   -2.030  1.00 0.00 ? 42  TYR A CD1  7  
ATOM   7612  C  CD2  . TYR A 1 42 ? -2.535  2.512   -3.125  1.00 0.00 ? 42  TYR A CD2  7  
ATOM   7613  C  CE1  . TYR A 1 42 ? -1.186  0.145   -2.687  1.00 0.00 ? 42  TYR A CE1  7  
ATOM   7614  C  CE2  . TYR A 1 42 ? -1.348  2.264   -3.787  1.00 0.00 ? 42  TYR A CE2  7  
ATOM   7615  C  CZ   . TYR A 1 42 ? -0.677  1.079   -3.564  1.00 0.00 ? 42  TYR A CZ   7  
ATOM   7616  O  OH   . TYR A 1 42 ? 0.506   0.829   -4.221  1.00 0.00 ? 42  TYR A OH   7  
ATOM   7617  H  H    . TYR A 1 42 ? -6.334  2.180   0.076   1.00 0.00 ? 42  TYR A H    7  
ATOM   7618  H  HA   . TYR A 1 42 ? -4.260  0.430   0.071   1.00 0.00 ? 42  TYR A HA   7  
ATOM   7619  H  HB2  . TYR A 1 42 ? -5.144  1.287   -1.998  1.00 0.00 ? 42  TYR A HB2  7  
ATOM   7620  H  HB3  . TYR A 1 42 ? -4.590  2.914   -1.619  1.00 0.00 ? 42  TYR A HB3  7  
ATOM   7621  H  HD1  . TYR A 1 42 ? -2.776  -0.329  -1.342  1.00 0.00 ? 42  TYR A HD1  7  
ATOM   7622  H  HD2  . TYR A 1 42 ? -3.062  3.439   -3.296  1.00 0.00 ? 42  TYR A HD2  7  
ATOM   7623  H  HE1  . TYR A 1 42 ? -0.661  -0.783  -2.513  1.00 0.00 ? 42  TYR A HE1  7  
ATOM   7624  H  HE2  . TYR A 1 42 ? -0.949  2.996   -4.474  1.00 0.00 ? 42  TYR A HE2  7  
ATOM   7625  H  HH   . TYR A 1 42 ? 1.215   1.323   -3.802  1.00 0.00 ? 42  TYR A HH   7  
ATOM   7626  N  N    . VAL A 1 43 ? -3.337  3.254   1.323   1.00 0.00 ? 43  VAL A N    7  
ATOM   7627  C  CA   . VAL A 1 43 ? -2.259  3.962   2.003   1.00 0.00 ? 43  VAL A CA   7  
ATOM   7628  C  C    . VAL A 1 43 ? -1.468  3.023   2.906   1.00 0.00 ? 43  VAL A C    7  
ATOM   7629  O  O    . VAL A 1 43 ? -1.965  1.974   3.317   1.00 0.00 ? 43  VAL A O    7  
ATOM   7630  C  CB   . VAL A 1 43 ? -2.799  5.132   2.846   1.00 0.00 ? 43  VAL A CB   7  
ATOM   7631  C  CG1  . VAL A 1 43 ? -3.636  6.068   1.986   1.00 0.00 ? 43  VAL A CG1  7  
ATOM   7632  C  CG2  . VAL A 1 43 ? -3.609  4.611   4.023   1.00 0.00 ? 43  VAL A CG2  7  
ATOM   7633  H  H    . VAL A 1 43 ? -4.250  3.606   1.380   1.00 0.00 ? 43  VAL A H    7  
ATOM   7634  H  HA   . VAL A 1 43 ? -1.597  4.364   1.249   1.00 0.00 ? 43  VAL A HA   7  
ATOM   7635  H  HB   . VAL A 1 43 ? -1.959  5.690   3.232   1.00 0.00 ? 43  VAL A HB   7  
ATOM   7636  H  HG11 . VAL A 1 43 ? -4.329  5.489   1.394   1.00 0.00 ? 43  VAL A HG11 7  
ATOM   7637  H  HG12 . VAL A 1 43 ? -4.184  6.748   2.622   1.00 0.00 ? 43  VAL A HG12 7  
ATOM   7638  H  HG13 . VAL A 1 43 ? -2.987  6.631   1.331   1.00 0.00 ? 43  VAL A HG13 7  
ATOM   7639  H  HG21 . VAL A 1 43 ? -3.889  3.584   3.840   1.00 0.00 ? 43  VAL A HG21 7  
ATOM   7640  H  HG22 . VAL A 1 43 ? -3.013  4.666   4.923   1.00 0.00 ? 43  VAL A HG22 7  
ATOM   7641  H  HG23 . VAL A 1 43 ? -4.498  5.211   4.144   1.00 0.00 ? 43  VAL A HG23 7  
ATOM   7642  N  N    . CYS A 1 44 ? -0.233  3.406   3.212   1.00 0.00 ? 44  CYS A N    7  
ATOM   7643  C  CA   . CYS A 1 44 ? 0.629   2.598   4.067   1.00 0.00 ? 44  CYS A CA   7  
ATOM   7644  C  C    . CYS A 1 44 ? -0.079  2.240   5.370   1.00 0.00 ? 44  CYS A C    7  
ATOM   7645  O  O    . CYS A 1 44 ? -0.945  2.977   5.843   1.00 0.00 ? 44  CYS A O    7  
ATOM   7646  C  CB   . CYS A 1 44 ? 1.928   3.347   4.369   1.00 0.00 ? 44  CYS A CB   7  
ATOM   7647  S  SG   . CYS A 1 44 ? 3.053   2.460   5.495   1.00 0.00 ? 44  CYS A SG   7  
ATOM   7648  H  H    . CYS A 1 44 ? 0.108   4.253   2.854   1.00 0.00 ? 44  CYS A H    7  
ATOM   7649  H  HA   . CYS A 1 44 ? 0.864   1.688   3.537   1.00 0.00 ? 44  CYS A HA   7  
ATOM   7650  H  HB2  . CYS A 1 44 ? 2.459   3.519   3.444   1.00 0.00 ? 44  CYS A HB2  7  
ATOM   7651  H  HB3  . CYS A 1 44 ? 1.690   4.297   4.824   1.00 0.00 ? 44  CYS A HB3  7  
ATOM   7652  N  N    . THR A 1 45 ? 0.295   1.102   5.947   1.00 0.00 ? 45  THR A N    7  
ATOM   7653  C  CA   . THR A 1 45 ? -0.305  0.644   7.194   1.00 0.00 ? 45  THR A CA   7  
ATOM   7654  C  C    . THR A 1 45 ? 0.439   1.207   8.400   1.00 0.00 ? 45  THR A C    7  
ATOM   7655  O  O    . THR A 1 45 ? -0.162  1.482   9.439   1.00 0.00 ? 45  THR A O    7  
ATOM   7656  C  CB   . THR A 1 45 ? -0.313  -0.894  7.282   1.00 0.00 ? 45  THR A CB   7  
ATOM   7657  O  OG1  . THR A 1 45 ? -1.026  -1.444  6.169   1.00 0.00 ? 45  THR A OG1  7  
ATOM   7658  C  CG2  . THR A 1 45 ? -0.954  -1.358  8.581   1.00 0.00 ? 45  THR A CG2  7  
ATOM   7659  H  H    . THR A 1 45 ? 0.990   0.558   5.521   1.00 0.00 ? 45  THR A H    7  
ATOM   7660  H  HA   . THR A 1 45 ? -1.327  0.991   7.220   1.00 0.00 ? 45  THR A HA   7  
ATOM   7661  H  HB   . THR A 1 45 ? 0.708   -1.246  7.256   1.00 0.00 ? 45  THR A HB   7  
ATOM   7662  H  HG1  . THR A 1 45 ? -1.102  -2.396  6.276   1.00 0.00 ? 45  THR A HG1  7  
ATOM   7663  H  HG21 . THR A 1 45 ? -0.589  -2.343  8.831   1.00 0.00 ? 45  THR A HG21 7  
ATOM   7664  H  HG22 . THR A 1 45 ? -2.027  -1.391  8.461   1.00 0.00 ? 45  THR A HG22 7  
ATOM   7665  H  HG23 . THR A 1 45 ? -0.701  -0.669  9.373   1.00 0.00 ? 45  THR A HG23 7  
ATOM   7666  N  N    . ASP A 1 46 ? 1.749   1.376   8.255   1.00 0.00 ? 46  ASP A N    7  
ATOM   7667  C  CA   . ASP A 1 46 ? 2.574   1.908   9.333   1.00 0.00 ? 46  ASP A CA   7  
ATOM   7668  C  C    . ASP A 1 46 ? 2.239   3.372   9.602   1.00 0.00 ? 46  ASP A C    7  
ATOM   7669  O  O    . ASP A 1 46 ? 1.786   3.726   10.691  1.00 0.00 ? 46  ASP A O    7  
ATOM   7670  C  CB   . ASP A 1 46 ? 4.057   1.767   8.986   1.00 0.00 ? 46  ASP A CB   7  
ATOM   7671  C  CG   . ASP A 1 46 ? 4.942   1.763   10.217  1.00 0.00 ? 46  ASP A CG   7  
ATOM   7672  O  OD1  . ASP A 1 46 ? 4.495   1.257   11.267  1.00 0.00 ? 46  ASP A OD1  7  
ATOM   7673  O  OD2  . ASP A 1 46 ? 6.082   2.267   10.130  1.00 0.00 ? 46  ASP A OD2  7  
ATOM   7674  H  H    . ASP A 1 46 ? 2.170   1.138   7.403   1.00 0.00 ? 46  ASP A H    7  
ATOM   7675  H  HA   . ASP A 1 46 ? 2.367   1.335   10.224  1.00 0.00 ? 46  ASP A HA   7  
ATOM   7676  H  HB2  . ASP A 1 46 ? 4.209   0.839   8.454   1.00 0.00 ? 46  ASP A HB2  7  
ATOM   7677  H  HB3  . ASP A 1 46 ? 4.352   2.592   8.354   1.00 0.00 ? 46  ASP A HB3  7  
ATOM   7678  N  N    . CYS A 1 47 ? 2.467   4.219   8.604   1.00 0.00 ? 47  CYS A N    7  
ATOM   7679  C  CA   . CYS A 1 47 ? 2.191   5.645   8.732   1.00 0.00 ? 47  CYS A CA   7  
ATOM   7680  C  C    . CYS A 1 47 ? 0.818   5.987   8.161   1.00 0.00 ? 47  CYS A C    7  
ATOM   7681  O  O    . CYS A 1 47 ? -0.076  6.422   8.885   1.00 0.00 ? 47  CYS A O    7  
ATOM   7682  C  CB   . CYS A 1 47 ? 3.270   6.460   8.018   1.00 0.00 ? 47  CYS A CB   7  
ATOM   7683  S  SG   . CYS A 1 47 ? 3.869   5.708   6.470   1.00 0.00 ? 47  CYS A SG   7  
ATOM   7684  H  H    . CYS A 1 47 ? 2.829   3.876   7.759   1.00 0.00 ? 47  CYS A H    7  
ATOM   7685  H  HA   . CYS A 1 47 ? 2.202   5.892   9.783   1.00 0.00 ? 47  CYS A HA   7  
ATOM   7686  H  HB2  . CYS A 1 47 ? 2.872   7.435   7.776   1.00 0.00 ? 47  CYS A HB2  7  
ATOM   7687  H  HB3  . CYS A 1 47 ? 4.118   6.577   8.677   1.00 0.00 ? 47  CYS A HB3  7  
ATOM   7688  N  N    . GLY A 1 48 ? 0.659   5.785   6.856   1.00 0.00 ? 48  GLY A N    7  
ATOM   7689  C  CA   . GLY A 1 48 ? -0.607  6.077   6.210   1.00 0.00 ? 48  GLY A CA   7  
ATOM   7690  C  C    . GLY A 1 48 ? -0.460  7.058   5.063   1.00 0.00 ? 48  GLY A C    7  
ATOM   7691  O  O    . GLY A 1 48 ? -1.231  8.011   4.948   1.00 0.00 ? 48  GLY A O    7  
ATOM   7692  H  H    . GLY A 1 48 ? 1.407   5.436   6.329   1.00 0.00 ? 48  GLY A H    7  
ATOM   7693  H  HA2  . GLY A 1 48 ? -1.027  5.157   5.831   1.00 0.00 ? 48  GLY A HA2  7  
ATOM   7694  H  HA3  . GLY A 1 48 ? -1.284  6.495   6.941   1.00 0.00 ? 48  GLY A HA3  7  
ATOM   7695  N  N    . THR A 1 49 ? 0.534   6.825   4.211   1.00 0.00 ? 49  THR A N    7  
ATOM   7696  C  CA   . THR A 1 49 ? 0.781   7.697   3.070   1.00 0.00 ? 49  THR A CA   7  
ATOM   7697  C  C    . THR A 1 49 ? 0.243   7.083   1.783   1.00 0.00 ? 49  THR A C    7  
ATOM   7698  O  O    . THR A 1 49 ? 0.326   5.873   1.579   1.00 0.00 ? 49  THR A O    7  
ATOM   7699  C  CB   . THR A 1 49 ? 2.285   7.984   2.898   1.00 0.00 ? 49  THR A CB   7  
ATOM   7700  O  OG1  . THR A 1 49 ? 2.478   9.021   1.930   1.00 0.00 ? 49  THR A OG1  7  
ATOM   7701  C  CG2  . THR A 1 49 ? 3.029   6.730   2.462   1.00 0.00 ? 49  THR A CG2  7  
ATOM   7702  H  H    . THR A 1 49 ? 1.114   6.049   4.356   1.00 0.00 ? 49  THR A H    7  
ATOM   7703  H  HA   . THR A 1 49 ? 0.276   8.634   3.250   1.00 0.00 ? 49  THR A HA   7  
ATOM   7704  H  HB   . THR A 1 49 ? 2.685   8.309   3.848   1.00 0.00 ? 49  THR A HB   7  
ATOM   7705  H  HG1  . THR A 1 49 ? 1.755   9.007   1.298   1.00 0.00 ? 49  THR A HG1  7  
ATOM   7706  H  HG21 . THR A 1 49 ? 2.483   5.856   2.785   1.00 0.00 ? 49  THR A HG21 7  
ATOM   7707  H  HG22 . THR A 1 49 ? 4.014   6.724   2.905   1.00 0.00 ? 49  THR A HG22 7  
ATOM   7708  H  HG23 . THR A 1 49 ? 3.118   6.721   1.386   1.00 0.00 ? 49  THR A HG23 7  
ATOM   7709  N  N    . ASN A 1 50 ? -0.310  7.926   0.917   1.00 0.00 ? 50  ASN A N    7  
ATOM   7710  C  CA   . ASN A 1 50 ? -0.863  7.466   -0.352  1.00 0.00 ? 50  ASN A CA   7  
ATOM   7711  C  C    . ASN A 1 50 ? 0.205   6.769   -1.190  1.00 0.00 ? 50  ASN A C    7  
ATOM   7712  O  O    . ASN A 1 50 ? 1.128   7.409   -1.697  1.00 0.00 ? 50  ASN A O    7  
ATOM   7713  C  CB   . ASN A 1 50 ? -1.451  8.643   -1.133  1.00 0.00 ? 50  ASN A CB   7  
ATOM   7714  C  CG   . ASN A 1 50 ? -2.520  8.207   -2.117  1.00 0.00 ? 50  ASN A CG   7  
ATOM   7715  O  OD1  . ASN A 1 50 ? -2.296  8.195   -3.328  1.00 0.00 ? 50  ASN A OD1  7  
ATOM   7716  N  ND2  . ASN A 1 50 ? -3.689  7.846   -1.600  1.00 0.00 ? 50  ASN A ND2  7  
ATOM   7717  H  H    . ASN A 1 50 ? -0.347  8.881   1.136   1.00 0.00 ? 50  ASN A H    7  
ATOM   7718  H  HA   . ASN A 1 50 ? -1.650  6.760   -0.134  1.00 0.00 ? 50  ASN A HA   7  
ATOM   7719  H  HB2  . ASN A 1 50 ? -1.893  9.342   -0.438  1.00 0.00 ? 50  ASN A HB2  7  
ATOM   7720  H  HB3  . ASN A 1 50 ? -0.662  9.135   -1.680  1.00 0.00 ? 50  ASN A HB3  7  
ATOM   7721  H  HD21 . ASN A 1 50 ? -3.795  7.881   -0.626  1.00 0.00 ? 50  ASN A HD21 7  
ATOM   7722  H  HD22 . ASN A 1 50 ? -4.397  7.560   -2.213  1.00 0.00 ? 50  ASN A HD22 7  
ATOM   7723  N  N    . LEU A 1 51 ? 0.073   5.455   -1.332  1.00 0.00 ? 51  LEU A N    7  
ATOM   7724  C  CA   . LEU A 1 51 ? 1.026   4.670   -2.109  1.00 0.00 ? 51  LEU A CA   7  
ATOM   7725  C  C    . LEU A 1 51 ? 0.614   4.609   -3.576  1.00 0.00 ? 51  LEU A C    7  
ATOM   7726  O  O    . LEU A 1 51 ? 1.102   3.773   -4.336  1.00 0.00 ? 51  LEU A O    7  
ATOM   7727  C  CB   . LEU A 1 51 ? 1.135   3.254   -1.539  1.00 0.00 ? 51  LEU A CB   7  
ATOM   7728  C  CG   . LEU A 1 51 ? 1.320   3.152   -0.025  1.00 0.00 ? 51  LEU A CG   7  
ATOM   7729  C  CD1  . LEU A 1 51 ? 1.315   1.697   0.417   1.00 0.00 ? 51  LEU A CD1  7  
ATOM   7730  C  CD2  . LEU A 1 51 ? 2.610   3.837   0.403   1.00 0.00 ? 51  LEU A CD2  7  
ATOM   7731  H  H    . LEU A 1 51 ? -0.682  5.001   -0.904  1.00 0.00 ? 51  LEU A H    7  
ATOM   7732  H  HA   . LEU A 1 51 ? 1.989   5.153   -2.038  1.00 0.00 ? 51  LEU A HA   7  
ATOM   7733  H  HB2  . LEU A 1 51 ? 0.233   2.723   -1.799  1.00 0.00 ? 51  LEU A HB2  7  
ATOM   7734  H  HB3  . LEU A 1 51 ? 1.981   2.774   -2.010  1.00 0.00 ? 51  LEU A HB3  7  
ATOM   7735  H  HG   . LEU A 1 51 ? 0.496   3.652   0.466   1.00 0.00 ? 51  LEU A HG   7  
ATOM   7736  H  HD11 . LEU A 1 51 ? 0.401   1.225   0.090   1.00 0.00 ? 51  LEU A HD11 7  
ATOM   7737  H  HD12 . LEU A 1 51 ? 1.381   1.648   1.494   1.00 0.00 ? 51  LEU A HD12 7  
ATOM   7738  H  HD13 . LEU A 1 51 ? 2.161   1.186   -0.019  1.00 0.00 ? 51  LEU A HD13 7  
ATOM   7739  H  HD21 . LEU A 1 51 ? 2.696   3.802   1.479   1.00 0.00 ? 51  LEU A HD21 7  
ATOM   7740  H  HD22 . LEU A 1 51 ? 2.595   4.868   0.077   1.00 0.00 ? 51  LEU A HD22 7  
ATOM   7741  H  HD23 . LEU A 1 51 ? 3.452   3.330   -0.044  1.00 0.00 ? 51  LEU A HD23 7  
ATOM   7742  N  N    . LYS A 1 52 ? -0.287  5.504   -3.969  1.00 0.00 ? 52  LYS A N    7  
ATOM   7743  C  CA   . LYS A 1 52 ? -0.763  5.556   -5.346  1.00 0.00 ? 52  LYS A CA   7  
ATOM   7744  C  C    . LYS A 1 52 ? 0.379   5.875   -6.305  1.00 0.00 ? 52  LYS A C    7  
ATOM   7745  O  O    . LYS A 1 52 ? 0.540   5.217   -7.332  1.00 0.00 ? 52  LYS A O    7  
ATOM   7746  C  CB   . LYS A 1 52 ? -1.869  6.605   -5.486  1.00 0.00 ? 52  LYS A CB   7  
ATOM   7747  C  CG   . LYS A 1 52 ? -2.626  6.520   -6.800  1.00 0.00 ? 52  LYS A CG   7  
ATOM   7748  C  CD   . LYS A 1 52 ? -3.912  7.328   -6.756  1.00 0.00 ? 52  LYS A CD   7  
ATOM   7749  C  CE   . LYS A 1 52 ? -3.630  8.822   -6.723  1.00 0.00 ? 52  LYS A CE   7  
ATOM   7750  N  NZ   . LYS A 1 52 ? -3.260  9.346   -8.067  1.00 0.00 ? 52  LYS A NZ   7  
ATOM   7751  H  H    . LYS A 1 52 ? -0.639  6.146   -3.317  1.00 0.00 ? 52  LYS A H    7  
ATOM   7752  H  HA   . LYS A 1 52 ? -1.166  4.586   -5.595  1.00 0.00 ? 52  LYS A HA   7  
ATOM   7753  H  HB2  . LYS A 1 52 ? -2.575  6.476   -4.678  1.00 0.00 ? 52  LYS A HB2  7  
ATOM   7754  H  HB3  . LYS A 1 52 ? -1.427  7.588   -5.412  1.00 0.00 ? 52  LYS A HB3  7  
ATOM   7755  H  HG2  . LYS A 1 52 ? -2.000  6.903   -7.591  1.00 0.00 ? 52  LYS A HG2  7  
ATOM   7756  H  HG3  . LYS A 1 52 ? -2.868  5.485   -6.998  1.00 0.00 ? 52  LYS A HG3  7  
ATOM   7757  H  HD2  . LYS A 1 52 ? -4.499  7.103   -7.634  1.00 0.00 ? 52  LYS A HD2  7  
ATOM   7758  H  HD3  . LYS A 1 52 ? -4.468  7.056   -5.869  1.00 0.00 ? 52  LYS A HD3  7  
ATOM   7759  H  HE2  . LYS A 1 52 ? -4.515  9.335   -6.378  1.00 0.00 ? 52  LYS A HE2  7  
ATOM   7760  H  HE3  . LYS A 1 52 ? -2.817  9.007   -6.037  1.00 0.00 ? 52  LYS A HE3  7  
ATOM   7761  H  HZ1  . LYS A 1 52 ? -3.449  8.627   -8.795  1.00 0.00 ? 52  LYS A HZ1  7  
ATOM   7762  H  HZ2  . LYS A 1 52 ? -2.249  9.588   -8.090  1.00 0.00 ? 52  LYS A HZ2  7  
ATOM   7763  H  HZ3  . LYS A 1 52 ? -3.815  10.198  -8.284  1.00 0.00 ? 52  LYS A HZ3  7  
ATOM   7764  N  N    . GLN A 1 53 ? 1.168   6.888   -5.962  1.00 0.00 ? 53  GLN A N    7  
ATOM   7765  C  CA   . GLN A 1 53 ? 2.295   7.293   -6.794  1.00 0.00 ? 53  GLN A CA   7  
ATOM   7766  C  C    . GLN A 1 53 ? 3.600   6.708   -6.264  1.00 0.00 ? 53  GLN A C    7  
ATOM   7767  O  O    . GLN A 1 53 ? 4.445   6.248   -7.033  1.00 0.00 ? 53  GLN A O    7  
ATOM   7768  C  CB   . GLN A 1 53 ? 2.392   8.819   -6.851  1.00 0.00 ? 53  GLN A CB   7  
ATOM   7769  C  CG   . GLN A 1 53 ? 1.187   9.481   -7.497  1.00 0.00 ? 53  GLN A CG   7  
ATOM   7770  C  CD   . GLN A 1 53 ? 1.142   10.977  -7.254  1.00 0.00 ? 53  GLN A CD   7  
ATOM   7771  O  OE1  . GLN A 1 53 ? 2.167   11.658  -7.312  1.00 0.00 ? 53  GLN A OE1  7  
ATOM   7772  N  NE2  . GLN A 1 53 ? -0.048  11.497  -6.980  1.00 0.00 ? 53  GLN A NE2  7  
ATOM   7773  H  H    . GLN A 1 53 ? 0.988   7.374   -5.132  1.00 0.00 ? 53  GLN A H    7  
ATOM   7774  H  HA   . GLN A 1 53 ? 2.125   6.915   -7.790  1.00 0.00 ? 53  GLN A HA   7  
ATOM   7775  H  HB2  . GLN A 1 53 ? 2.489   9.199   -5.845  1.00 0.00 ? 53  GLN A HB2  7  
ATOM   7776  H  HB3  . GLN A 1 53 ? 3.271   9.091   -7.416  1.00 0.00 ? 53  GLN A HB3  7  
ATOM   7777  H  HG2  . GLN A 1 53 ? 1.224   9.307   -8.563  1.00 0.00 ? 53  GLN A HG2  7  
ATOM   7778  H  HG3  . GLN A 1 53 ? 0.289   9.038   -7.093  1.00 0.00 ? 53  GLN A HG3  7  
ATOM   7779  H  HE21 . GLN A 1 53 ? -0.821  10.894  -6.949  1.00 0.00 ? 53  GLN A HE21 7  
ATOM   7780  H  HE22 . GLN A 1 53 ? -0.106  12.461  -6.817  1.00 0.00 ? 53  GLN A HE22 7  
ATOM   7781  N  N    . LYS A 1 54 ? 3.760   6.729   -4.945  1.00 0.00 ? 54  LYS A N    7  
ATOM   7782  C  CA   . LYS A 1 54 ? 4.961   6.200   -4.311  1.00 0.00 ? 54  LYS A CA   7  
ATOM   7783  C  C    . LYS A 1 54 ? 5.101   4.704   -4.572  1.00 0.00 ? 54  LYS A C    7  
ATOM   7784  O  O    . LYS A 1 54 ? 6.116   4.248   -5.098  1.00 0.00 ? 54  LYS A O    7  
ATOM   7785  C  CB   . LYS A 1 54 ? 4.925   6.464   -2.804  1.00 0.00 ? 54  LYS A CB   7  
ATOM   7786  C  CG   . LYS A 1 54 ? 4.723   7.927   -2.447  1.00 0.00 ? 54  LYS A CG   7  
ATOM   7787  C  CD   . LYS A 1 54 ? 4.613   8.124   -0.944  1.00 0.00 ? 54  LYS A CD   7  
ATOM   7788  C  CE   . LYS A 1 54 ? 5.972   8.386   -0.315  1.00 0.00 ? 54  LYS A CE   7  
ATOM   7789  N  NZ   . LYS A 1 54 ? 5.853   9.106   0.983   1.00 0.00 ? 54  LYS A NZ   7  
ATOM   7790  H  H    . LYS A 1 54 ? 3.051   7.109   -4.384  1.00 0.00 ? 54  LYS A H    7  
ATOM   7791  H  HA   . LYS A 1 54 ? 5.813   6.709   -4.736  1.00 0.00 ? 54  LYS A HA   7  
ATOM   7792  H  HB2  . LYS A 1 54 ? 4.117   5.894   -2.370  1.00 0.00 ? 54  LYS A HB2  7  
ATOM   7793  H  HB3  . LYS A 1 54 ? 5.859   6.135   -2.370  1.00 0.00 ? 54  LYS A HB3  7  
ATOM   7794  H  HG2  . LYS A 1 54 ? 5.564   8.497   -2.813  1.00 0.00 ? 54  LYS A HG2  7  
ATOM   7795  H  HG3  . LYS A 1 54 ? 3.815   8.280   -2.915  1.00 0.00 ? 54  LYS A HG3  7  
ATOM   7796  H  HD2  . LYS A 1 54 ? 3.969   8.968   -0.747  1.00 0.00 ? 54  LYS A HD2  7  
ATOM   7797  H  HD3  . LYS A 1 54 ? 4.187   7.233   -0.503  1.00 0.00 ? 54  LYS A HD3  7  
ATOM   7798  H  HE2  . LYS A 1 54 ? 6.466   7.441   -0.148  1.00 0.00 ? 54  LYS A HE2  7  
ATOM   7799  H  HE3  . LYS A 1 54 ? 6.560   8.984   -0.996  1.00 0.00 ? 54  LYS A HE3  7  
ATOM   7800  H  HZ1  . LYS A 1 54 ? 5.051   9.767   0.952   1.00 0.00 ? 54  LYS A HZ1  7  
ATOM   7801  H  HZ2  . LYS A 1 54 ? 6.723   9.643   1.175   1.00 0.00 ? 54  LYS A HZ2  7  
ATOM   7802  H  HZ3  . LYS A 1 54 ? 5.700   8.427   1.756   1.00 0.00 ? 54  LYS A HZ3  7  
ATOM   7803  N  N    . GLY A 1 55 ? 4.074   3.944   -4.203  1.00 0.00 ? 55  GLY A N    7  
ATOM   7804  C  CA   . GLY A 1 55 ? 4.103   2.508   -4.407  1.00 0.00 ? 55  GLY A CA   7  
ATOM   7805  C  C    . GLY A 1 55 ? 3.925   1.735   -3.116  1.00 0.00 ? 55  GLY A C    7  
ATOM   7806  O  O    . GLY A 1 55 ? 4.143   2.271   -2.028  1.00 0.00 ? 55  GLY A O    7  
ATOM   7807  H  H    . GLY A 1 55 ? 3.291   4.363   -3.789  1.00 0.00 ? 55  GLY A H    7  
ATOM   7808  H  HA2  . GLY A 1 55 ? 3.310   2.237   -5.089  1.00 0.00 ? 55  GLY A HA2  7  
ATOM   7809  H  HA3  . GLY A 1 55 ? 5.051   2.237   -4.848  1.00 0.00 ? 55  GLY A HA3  7  
ATOM   7810  N  N    . HIS A 1 56 ? 3.528   0.472   -3.233  1.00 0.00 ? 56  HIS A N    7  
ATOM   7811  C  CA   . HIS A 1 56 ? 3.320   -0.376  -2.065  1.00 0.00 ? 56  HIS A CA   7  
ATOM   7812  C  C    . HIS A 1 56 ? 4.153   -1.650  -2.163  1.00 0.00 ? 56  HIS A C    7  
ATOM   7813  O  O    . HIS A 1 56 ? 4.599   -2.031  -3.246  1.00 0.00 ? 56  HIS A O    7  
ATOM   7814  C  CB   . HIS A 1 56 ? 1.839   -0.731  -1.923  1.00 0.00 ? 56  HIS A CB   7  
ATOM   7815  C  CG   . HIS A 1 56 ? 1.424   -1.909  -2.748  1.00 0.00 ? 56  HIS A CG   7  
ATOM   7816  N  ND1  . HIS A 1 56 ? 0.828   -1.788  -3.986  1.00 0.00 ? 56  HIS A ND1  7  
ATOM   7817  C  CD2  . HIS A 1 56 ? 1.522   -3.237  -2.509  1.00 0.00 ? 56  HIS A CD2  7  
ATOM   7818  C  CE1  . HIS A 1 56 ? 0.576   -2.991  -4.471  1.00 0.00 ? 56  HIS A CE1  7  
ATOM   7819  N  NE2  . HIS A 1 56 ? 0.989   -3.888  -3.594  1.00 0.00 ? 56  HIS A NE2  7  
ATOM   7820  H  H    . HIS A 1 56 ? 3.371   0.102   -4.127  1.00 0.00 ? 56  HIS A H    7  
ATOM   7821  H  HA   . HIS A 1 56 ? 3.634   0.178   -1.193  1.00 0.00 ? 56  HIS A HA   7  
ATOM   7822  H  HB2  . HIS A 1 56 ? 1.629   -0.960  -0.888  1.00 0.00 ? 56  HIS A HB2  7  
ATOM   7823  H  HB3  . HIS A 1 56 ? 1.242   0.117   -2.227  1.00 0.00 ? 56  HIS A HB3  7  
ATOM   7824  H  HD1  . HIS A 1 56 ? 0.618   -0.945  -4.440  1.00 0.00 ? 56  HIS A HD1  7  
ATOM   7825  H  HD2  . HIS A 1 56 ? 1.943   -3.701  -1.627  1.00 0.00 ? 56  HIS A HD2  7  
ATOM   7826  H  HE1  . HIS A 1 56 ? 0.113   -3.205  -5.422  1.00 0.00 ? 56  HIS A HE1  7  
ATOM   7827  H  HE2  . HIS A 1 56 ? 0.845   -4.854  -3.665  1.00 0.00 ? 56  HIS A HE2  7  
ATOM   7828  N  N    . PHE A 1 57 ? 4.361   -2.305  -1.026  1.00 0.00 ? 57  PHE A N    7  
ATOM   7829  C  CA   . PHE A 1 57 ? 5.142   -3.536  -0.984  1.00 0.00 ? 57  PHE A CA   7  
ATOM   7830  C  C    . PHE A 1 57 ? 4.384   -4.636  -0.246  1.00 0.00 ? 57  PHE A C    7  
ATOM   7831  O  O    . PHE A 1 57 ? 3.567   -4.361  0.632   1.00 0.00 ? 57  PHE A O    7  
ATOM   7832  C  CB   . PHE A 1 57 ? 6.490   -3.286  -0.305  1.00 0.00 ? 57  PHE A CB   7  
ATOM   7833  C  CG   . PHE A 1 57 ? 7.575   -2.875  -1.259  1.00 0.00 ? 57  PHE A CG   7  
ATOM   7834  C  CD1  . PHE A 1 57 ? 7.766   -1.540  -1.577  1.00 0.00 ? 57  PHE A CD1  7  
ATOM   7835  C  CD2  . PHE A 1 57 ? 8.403   -3.823  -1.838  1.00 0.00 ? 57  PHE A CD2  7  
ATOM   7836  C  CE1  . PHE A 1 57 ? 8.763   -1.158  -2.455  1.00 0.00 ? 57  PHE A CE1  7  
ATOM   7837  C  CE2  . PHE A 1 57 ? 9.401   -3.447  -2.717  1.00 0.00 ? 57  PHE A CE2  7  
ATOM   7838  C  CZ   . PHE A 1 57 ? 9.582   -2.113  -3.025  1.00 0.00 ? 57  PHE A CZ   7  
ATOM   7839  H  H    . PHE A 1 57 ? 3.979   -1.952  -0.195  1.00 0.00 ? 57  PHE A H    7  
ATOM   7840  H  HA   . PHE A 1 57 ? 5.314   -3.853  -2.001  1.00 0.00 ? 57  PHE A HA   7  
ATOM   7841  H  HB2  . PHE A 1 57 ? 6.377   -2.500  0.426   1.00 0.00 ? 57  PHE A HB2  7  
ATOM   7842  H  HB3  . PHE A 1 57 ? 6.808   -4.191  0.191   1.00 0.00 ? 57  PHE A HB3  7  
ATOM   7843  H  HD1  . PHE A 1 57 ? 7.127   -0.792  -1.131  1.00 0.00 ? 57  PHE A HD1  7  
ATOM   7844  H  HD2  . PHE A 1 57 ? 8.262   -4.867  -1.598  1.00 0.00 ? 57  PHE A HD2  7  
ATOM   7845  H  HE1  . PHE A 1 57 ? 8.902   -0.115  -2.694  1.00 0.00 ? 57  PHE A HE1  7  
ATOM   7846  H  HE2  . PHE A 1 57 ? 10.040  -4.197  -3.161  1.00 0.00 ? 57  PHE A HE2  7  
ATOM   7847  H  HZ   . PHE A 1 57 ? 10.361  -1.818  -3.712  1.00 0.00 ? 57  PHE A HZ   7  
ATOM   7848  N  N    . PHE A 1 58 ? 4.662   -5.884  -0.610  1.00 0.00 ? 58  PHE A N    7  
ATOM   7849  C  CA   . PHE A 1 58 ? 4.007   -7.026  0.015   1.00 0.00 ? 58  PHE A CA   7  
ATOM   7850  C  C    . PHE A 1 58 ? 4.864   -7.597  1.141   1.00 0.00 ? 58  PHE A C    7  
ATOM   7851  O  O    . PHE A 1 58 ? 5.917   -8.186  0.897   1.00 0.00 ? 58  PHE A O    7  
ATOM   7852  C  CB   . PHE A 1 58 ? 3.724   -8.112  -1.026  1.00 0.00 ? 58  PHE A CB   7  
ATOM   7853  C  CG   . PHE A 1 58 ? 2.494   -7.849  -1.847  1.00 0.00 ? 58  PHE A CG   7  
ATOM   7854  C  CD1  . PHE A 1 58 ? 1.245   -7.794  -1.249  1.00 0.00 ? 58  PHE A CD1  7  
ATOM   7855  C  CD2  . PHE A 1 58 ? 2.586   -7.659  -3.216  1.00 0.00 ? 58  PHE A CD2  7  
ATOM   7856  C  CE1  . PHE A 1 58 ? 0.111   -7.553  -2.001  1.00 0.00 ? 58  PHE A CE1  7  
ATOM   7857  C  CE2  . PHE A 1 58 ? 1.455   -7.416  -3.973  1.00 0.00 ? 58  PHE A CE2  7  
ATOM   7858  C  CZ   . PHE A 1 58 ? 0.216   -7.364  -3.365  1.00 0.00 ? 58  PHE A CZ   7  
ATOM   7859  H  H    . PHE A 1 58 ? 5.323   -6.039  -1.317  1.00 0.00 ? 58  PHE A H    7  
ATOM   7860  H  HA   . PHE A 1 58 ? 3.071   -6.685  0.429   1.00 0.00 ? 58  PHE A HA   7  
ATOM   7861  H  HB2  . PHE A 1 58 ? 4.564   -8.181  -1.701  1.00 0.00 ? 58  PHE A HB2  7  
ATOM   7862  H  HB3  . PHE A 1 58 ? 3.593   -9.058  -0.523  1.00 0.00 ? 58  PHE A HB3  7  
ATOM   7863  H  HD1  . PHE A 1 58 ? 1.161   -7.941  -0.181  1.00 0.00 ? 58  PHE A HD1  7  
ATOM   7864  H  HD2  . PHE A 1 58 ? 3.554   -7.700  -3.693  1.00 0.00 ? 58  PHE A HD2  7  
ATOM   7865  H  HE1  . PHE A 1 58 ? -0.857  -7.513  -1.522  1.00 0.00 ? 58  PHE A HE1  7  
ATOM   7866  H  HE2  . PHE A 1 58 ? 1.540   -7.270  -5.040  1.00 0.00 ? 58  PHE A HE2  7  
ATOM   7867  H  HZ   . PHE A 1 58 ? -0.669  -7.175  -3.955  1.00 0.00 ? 58  PHE A HZ   7  
ATOM   7868  N  N    . VAL A 1 59 ? 4.406   -7.416  2.375   1.00 0.00 ? 59  VAL A N    7  
ATOM   7869  C  CA   . VAL A 1 59 ? 5.130   -7.913  3.540   1.00 0.00 ? 59  VAL A CA   7  
ATOM   7870  C  C    . VAL A 1 59 ? 4.172   -8.468  4.587   1.00 0.00 ? 59  VAL A C    7  
ATOM   7871  O  O    . VAL A 1 59 ? 3.368   -7.733  5.158   1.00 0.00 ? 59  VAL A O    7  
ATOM   7872  C  CB   . VAL A 1 59 ? 5.988   -6.806  4.181   1.00 0.00 ? 59  VAL A CB   7  
ATOM   7873  C  CG1  . VAL A 1 59 ? 6.737   -7.344  5.390   1.00 0.00 ? 59  VAL A CG1  7  
ATOM   7874  C  CG2  . VAL A 1 59 ? 6.954   -6.223  3.160   1.00 0.00 ? 59  VAL A CG2  7  
ATOM   7875  H  H    . VAL A 1 59 ? 3.561   -6.939  2.506   1.00 0.00 ? 59  VAL A H    7  
ATOM   7876  H  HA   . VAL A 1 59 ? 5.788   -8.704  3.211   1.00 0.00 ? 59  VAL A HA   7  
ATOM   7877  H  HB   . VAL A 1 59 ? 5.331   -6.017  4.514   1.00 0.00 ? 59  VAL A HB   7  
ATOM   7878  H  HG11 . VAL A 1 59 ? 6.071   -7.379  6.240   1.00 0.00 ? 59  VAL A HG11 7  
ATOM   7879  H  HG12 . VAL A 1 59 ? 7.101   -8.338  5.176   1.00 0.00 ? 59  VAL A HG12 7  
ATOM   7880  H  HG13 . VAL A 1 59 ? 7.572   -6.696  5.614   1.00 0.00 ? 59  VAL A HG13 7  
ATOM   7881  H  HG21 . VAL A 1 59 ? 6.867   -5.147  3.157   1.00 0.00 ? 59  VAL A HG21 7  
ATOM   7882  H  HG22 . VAL A 1 59 ? 7.965   -6.501  3.421   1.00 0.00 ? 59  VAL A HG22 7  
ATOM   7883  H  HG23 . VAL A 1 59 ? 6.718   -6.607  2.179   1.00 0.00 ? 59  VAL A HG23 7  
ATOM   7884  N  N    . GLU A 1 60 ? 4.264   -9.771  4.833   1.00 0.00 ? 60  GLU A N    7  
ATOM   7885  C  CA   . GLU A 1 60 ? 3.404   -10.426 5.812   1.00 0.00 ? 60  GLU A CA   7  
ATOM   7886  C  C    . GLU A 1 60 ? 1.932   -10.236 5.457   1.00 0.00 ? 60  GLU A C    7  
ATOM   7887  O  O    . GLU A 1 60 ? 1.097   -9.997  6.329   1.00 0.00 ? 60  GLU A O    7  
ATOM   7888  C  CB   . GLU A 1 60 ? 3.676   -9.874  7.213   1.00 0.00 ? 60  GLU A CB   7  
ATOM   7889  C  CG   . GLU A 1 60 ? 5.056   -10.222 7.747   1.00 0.00 ? 60  GLU A CG   7  
ATOM   7890  C  CD   . GLU A 1 60 ? 5.106   -11.598 8.381   1.00 0.00 ? 60  GLU A CD   7  
ATOM   7891  O  OE1  . GLU A 1 60 ? 4.184   -11.927 9.157   1.00 0.00 ? 60  GLU A OE1  7  
ATOM   7892  O  OE2  . GLU A 1 60 ? 6.065   -12.347 8.101   1.00 0.00 ? 60  GLU A OE2  7  
ATOM   7893  H  H    . GLU A 1 60 ? 4.925   -10.305 4.345   1.00 0.00 ? 60  GLU A H    7  
ATOM   7894  H  HA   . GLU A 1 60 ? 3.631   -11.481 5.801   1.00 0.00 ? 60  GLU A HA   7  
ATOM   7895  H  HB2  . GLU A 1 60 ? 3.583   -8.798  7.188   1.00 0.00 ? 60  GLU A HB2  7  
ATOM   7896  H  HB3  . GLU A 1 60 ? 2.939   -10.273 7.894   1.00 0.00 ? 60  GLU A HB3  7  
ATOM   7897  H  HG2  . GLU A 1 60 ? 5.762   -10.193 6.930   1.00 0.00 ? 60  GLU A HG2  7  
ATOM   7898  H  HG3  . GLU A 1 60 ? 5.336   -9.489  8.489   1.00 0.00 ? 60  GLU A HG3  7  
ATOM   7899  N  N    . ASP A 1 61 ? 1.622   -10.344 4.170   1.00 0.00 ? 61  ASP A N    7  
ATOM   7900  C  CA   . ASP A 1 61 ? 0.251   -10.185 3.697   1.00 0.00 ? 61  ASP A CA   7  
ATOM   7901  C  C    . ASP A 1 61 ? -0.262  -8.778  3.984   1.00 0.00 ? 61  ASP A C    7  
ATOM   7902  O  O    . ASP A 1 61 ? -1.453  -8.579  4.226   1.00 0.00 ? 61  ASP A O    7  
ATOM   7903  C  CB   . ASP A 1 61 ? -0.661  -11.219 4.358   1.00 0.00 ? 61  ASP A CB   7  
ATOM   7904  C  CG   . ASP A 1 61 ? -1.931  -11.461 3.566   1.00 0.00 ? 61  ASP A CG   7  
ATOM   7905  O  OD1  . ASP A 1 61 ? -1.887  -12.251 2.600   1.00 0.00 ? 61  ASP A OD1  7  
ATOM   7906  O  OD2  . ASP A 1 61 ? -2.970  -10.858 3.910   1.00 0.00 ? 61  ASP A OD2  7  
ATOM   7907  H  H    . ASP A 1 61 ? 2.332   -10.536 3.521   1.00 0.00 ? 61  ASP A H    7  
ATOM   7908  H  HA   . ASP A 1 61 ? 0.248   -10.345 2.630   1.00 0.00 ? 61  ASP A HA   7  
ATOM   7909  H  HB2  . ASP A 1 61 ? -0.130  -12.156 4.444   1.00 0.00 ? 61  ASP A HB2  7  
ATOM   7910  H  HB3  . ASP A 1 61 ? -0.934  -10.872 5.344   1.00 0.00 ? 61  ASP A HB3  7  
ATOM   7911  N  N    . GLN A 1 62 ? 0.643   -7.805  3.956   1.00 0.00 ? 62  GLN A N    7  
ATOM   7912  C  CA   . GLN A 1 62 ? 0.281   -6.417  4.214   1.00 0.00 ? 62  GLN A CA   7  
ATOM   7913  C  C    . GLN A 1 62 ? 0.896   -5.490  3.171   1.00 0.00 ? 62  GLN A C    7  
ATOM   7914  O  O    . GLN A 1 62 ? 1.686   -5.923  2.331   1.00 0.00 ? 62  GLN A O    7  
ATOM   7915  C  CB   . GLN A 1 62 ? 0.737   -6.001  5.614   1.00 0.00 ? 62  GLN A CB   7  
ATOM   7916  C  CG   . GLN A 1 62 ? -0.178  -6.495  6.723   1.00 0.00 ? 62  GLN A CG   7  
ATOM   7917  C  CD   . GLN A 1 62 ? -1.496  -5.748  6.770   1.00 0.00 ? 62  GLN A CD   7  
ATOM   7918  O  OE1  . GLN A 1 62 ? -1.562  -4.612  7.241   1.00 0.00 ? 62  GLN A OE1  7  
ATOM   7919  N  NE2  . GLN A 1 62 ? -2.554  -6.382  6.279   1.00 0.00 ? 62  GLN A NE2  7  
ATOM   7920  H  H    . GLN A 1 62 ? 1.576   -8.027  3.757   1.00 0.00 ? 62  GLN A H    7  
ATOM   7921  H  HA   . GLN A 1 62 ? -0.794  -6.339  4.158   1.00 0.00 ? 62  GLN A HA   7  
ATOM   7922  H  HB2  . GLN A 1 62 ? 1.726   -6.396  5.790   1.00 0.00 ? 62  GLN A HB2  7  
ATOM   7923  H  HB3  . GLN A 1 62 ? 0.774   -4.923  5.662   1.00 0.00 ? 62  GLN A HB3  7  
ATOM   7924  H  HG2  . GLN A 1 62 ? -0.382  -7.544  6.564   1.00 0.00 ? 62  GLN A HG2  7  
ATOM   7925  H  HG3  . GLN A 1 62 ? 0.325   -6.368  7.670   1.00 0.00 ? 62  GLN A HG3  7  
ATOM   7926  H  HE21 . GLN A 1 62 ? -2.426  -7.286  5.920   1.00 0.00 ? 62  GLN A HE21 7  
ATOM   7927  H  HE22 . GLN A 1 62 ? -3.419  -5.922  6.297   1.00 0.00 ? 62  GLN A HE22 7  
ATOM   7928  N  N    . ILE A 1 63 ? 0.527   -4.215  3.228   1.00 0.00 ? 63  ILE A N    7  
ATOM   7929  C  CA   . ILE A 1 63 ? 1.043   -3.228  2.288   1.00 0.00 ? 63  ILE A CA   7  
ATOM   7930  C  C    . ILE A 1 63 ? 1.774   -2.105  3.016   1.00 0.00 ? 63  ILE A C    7  
ATOM   7931  O  O    . ILE A 1 63 ? 1.343   -1.656  4.079   1.00 0.00 ? 63  ILE A O    7  
ATOM   7932  C  CB   . ILE A 1 63 ? -0.085  -2.621  1.433   1.00 0.00 ? 63  ILE A CB   7  
ATOM   7933  C  CG1  . ILE A 1 63 ? -1.105  -1.911  2.325   1.00 0.00 ? 63  ILE A CG1  7  
ATOM   7934  C  CG2  . ILE A 1 63 ? -0.761  -3.703  0.603   1.00 0.00 ? 63  ILE A CG2  7  
ATOM   7935  C  CD1  . ILE A 1 63 ? -1.832  -0.781  1.631   1.00 0.00 ? 63  ILE A CD1  7  
ATOM   7936  H  H    . ILE A 1 63 ? -0.106  -3.931  3.920   1.00 0.00 ? 63  ILE A H    7  
ATOM   7937  H  HA   . ILE A 1 63 ? 1.738   -3.728  1.629   1.00 0.00 ? 63  ILE A HA   7  
ATOM   7938  H  HB   . ILE A 1 63 ? 0.353   -1.903  0.757   1.00 0.00 ? 63  ILE A HB   7  
ATOM   7939  H  HG12 . ILE A 1 63 ? -1.843  -2.625  2.656   1.00 0.00 ? 63  ILE A HG12 7  
ATOM   7940  H  HG13 . ILE A 1 63 ? -0.596  -1.501  3.186   1.00 0.00 ? 63  ILE A HG13 7  
ATOM   7941  H  HG21 . ILE A 1 63 ? -1.439  -3.244  -0.101  1.00 0.00 ? 63  ILE A HG21 7  
ATOM   7942  H  HG22 . ILE A 1 63 ? -0.011  -4.264  0.066   1.00 0.00 ? 63  ILE A HG22 7  
ATOM   7943  H  HG23 . ILE A 1 63 ? -1.310  -4.366  1.254   1.00 0.00 ? 63  ILE A HG23 7  
ATOM   7944  H  HD11 . ILE A 1 63 ? -1.622  0.149   2.140   1.00 0.00 ? 63  ILE A HD11 7  
ATOM   7945  H  HD12 . ILE A 1 63 ? -1.500  -0.714  0.606   1.00 0.00 ? 63  ILE A HD12 7  
ATOM   7946  H  HD13 . ILE A 1 63 ? -2.896  -0.969  1.653   1.00 0.00 ? 63  ILE A HD13 7  
ATOM   7947  N  N    . TYR A 1 64 ? 2.881   -1.654  2.437   1.00 0.00 ? 64  TYR A N    7  
ATOM   7948  C  CA   . TYR A 1 64 ? 3.673   -0.583  3.031   1.00 0.00 ? 64  TYR A CA   7  
ATOM   7949  C  C    . TYR A 1 64 ? 4.402   0.216   1.955   1.00 0.00 ? 64  TYR A C    7  
ATOM   7950  O  O    . TYR A 1 64 ? 4.446   -0.183  0.791   1.00 0.00 ? 64  TYR A O    7  
ATOM   7951  C  CB   . TYR A 1 64 ? 4.681   -1.158  4.026   1.00 0.00 ? 64  TYR A CB   7  
ATOM   7952  C  CG   . TYR A 1 64 ? 4.056   -2.049  5.075   1.00 0.00 ? 64  TYR A CG   7  
ATOM   7953  C  CD1  . TYR A 1 64 ? 3.515   -1.513  6.237   1.00 0.00 ? 64  TYR A CD1  7  
ATOM   7954  C  CD2  . TYR A 1 64 ? 4.007   -3.427  4.906   1.00 0.00 ? 64  TYR A CD2  7  
ATOM   7955  C  CE1  . TYR A 1 64 ? 2.943   -2.323  7.199   1.00 0.00 ? 64  TYR A CE1  7  
ATOM   7956  C  CE2  . TYR A 1 64 ? 3.436   -4.245  5.861   1.00 0.00 ? 64  TYR A CE2  7  
ATOM   7957  C  CZ   . TYR A 1 64 ? 2.906   -3.688  7.006   1.00 0.00 ? 64  TYR A CZ   7  
ATOM   7958  O  OH   . TYR A 1 64 ? 2.337   -4.500  7.962   1.00 0.00 ? 64  TYR A OH   7  
ATOM   7959  H  H    . TYR A 1 64 ? 3.174   -2.051  1.590   1.00 0.00 ? 64  TYR A H    7  
ATOM   7960  H  HA   . TYR A 1 64 ? 2.997   0.076   3.557   1.00 0.00 ? 64  TYR A HA   7  
ATOM   7961  H  HB2  . TYR A 1 64 ? 5.414   -1.742  3.490   1.00 0.00 ? 64  TYR A HB2  7  
ATOM   7962  H  HB3  . TYR A 1 64 ? 5.179   -0.345  4.535   1.00 0.00 ? 64  TYR A HB3  7  
ATOM   7963  H  HD1  . TYR A 1 64 ? 3.545   -0.443  6.386   1.00 0.00 ? 64  TYR A HD1  7  
ATOM   7964  H  HD2  . TYR A 1 64 ? 4.424   -3.860  4.008   1.00 0.00 ? 64  TYR A HD2  7  
ATOM   7965  H  HE1  . TYR A 1 64 ? 2.527   -1.888  8.096   1.00 0.00 ? 64  TYR A HE1  7  
ATOM   7966  H  HE2  . TYR A 1 64 ? 3.407   -5.314  5.711   1.00 0.00 ? 64  TYR A HE2  7  
ATOM   7967  H  HH   . TYR A 1 64 ? 2.415   -5.417  7.689   1.00 0.00 ? 64  TYR A HH   7  
ATOM   7968  N  N    . CYS A 1 65 ? 4.973   1.348   2.353   1.00 0.00 ? 65  CYS A N    7  
ATOM   7969  C  CA   . CYS A 1 65 ? 5.701   2.205   1.426   1.00 0.00 ? 65  CYS A CA   7  
ATOM   7970  C  C    . CYS A 1 65 ? 7.152   1.751   1.290   1.00 0.00 ? 65  CYS A C    7  
ATOM   7971  O  O    . CYS A 1 65 ? 7.742   1.236   2.239   1.00 0.00 ? 65  CYS A O    7  
ATOM   7972  C  CB   . CYS A 1 65 ? 5.652   3.660   1.897   1.00 0.00 ? 65  CYS A CB   7  
ATOM   7973  S  SG   . CYS A 1 65 ? 6.019   3.880   3.668   1.00 0.00 ? 65  CYS A SG   7  
ATOM   7974  H  H    . CYS A 1 65 ? 4.903   1.613   3.295   1.00 0.00 ? 65  CYS A H    7  
ATOM   7975  H  HA   . CYS A 1 65 ? 5.223   2.132   0.461   1.00 0.00 ? 65  CYS A HA   7  
ATOM   7976  H  HB2  . CYS A 1 65 ? 6.376   4.236   1.339   1.00 0.00 ? 65  CYS A HB2  7  
ATOM   7977  H  HB3  . CYS A 1 65 ? 4.665   4.056   1.714   1.00 0.00 ? 65  CYS A HB3  7  
ATOM   7978  N  N    . GLU A 1 66 ? 7.719   1.948   0.104   1.00 0.00 ? 66  GLU A N    7  
ATOM   7979  C  CA   . GLU A 1 66 ? 9.101   1.558   -0.155  1.00 0.00 ? 66  GLU A CA   7  
ATOM   7980  C  C    . GLU A 1 66 ? 9.989   1.874   1.045   1.00 0.00 ? 66  GLU A C    7  
ATOM   7981  O  O    . GLU A 1 66 ? 10.833  1.067   1.436   1.00 0.00 ? 66  GLU A O    7  
ATOM   7982  C  CB   . GLU A 1 66 ? 9.631   2.275   -1.398  1.00 0.00 ? 66  GLU A CB   7  
ATOM   7983  C  CG   . GLU A 1 66 ? 11.115  2.054   -1.642  1.00 0.00 ? 66  GLU A CG   7  
ATOM   7984  C  CD   . GLU A 1 66 ? 11.590  2.670   -2.943  1.00 0.00 ? 66  GLU A CD   7  
ATOM   7985  O  OE1  . GLU A 1 66 ? 11.146  2.209   -4.016  1.00 0.00 ? 66  GLU A OE1  7  
ATOM   7986  O  OE2  . GLU A 1 66 ? 12.407  3.613   -2.889  1.00 0.00 ? 66  GLU A OE2  7  
ATOM   7987  H  H    . GLU A 1 66 ? 7.197   2.364   -0.613  1.00 0.00 ? 66  GLU A H    7  
ATOM   7988  H  HA   . GLU A 1 66 ? 9.118   0.493   -0.330  1.00 0.00 ? 66  GLU A HA   7  
ATOM   7989  H  HB2  . GLU A 1 66 ? 9.088   1.921   -2.262  1.00 0.00 ? 66  GLU A HB2  7  
ATOM   7990  H  HB3  . GLU A 1 66 ? 9.460   3.336   -1.288  1.00 0.00 ? 66  GLU A HB3  7  
ATOM   7991  H  HG2  . GLU A 1 66 ? 11.670  2.496   -0.828  1.00 0.00 ? 66  GLU A HG2  7  
ATOM   7992  H  HG3  . GLU A 1 66 ? 11.307  0.991   -1.672  1.00 0.00 ? 66  GLU A HG3  7  
ATOM   7993  N  N    . LYS A 1 67 ? 9.793   3.053   1.625   1.00 0.00 ? 67  LYS A N    7  
ATOM   7994  C  CA   . LYS A 1 67 ? 10.575  3.477   2.781   1.00 0.00 ? 67  LYS A CA   7  
ATOM   7995  C  C    . LYS A 1 67 ? 10.476  2.455   3.909   1.00 0.00 ? 67  LYS A C    7  
ATOM   7996  O  O    . LYS A 1 67 ? 11.464  1.811   4.265   1.00 0.00 ? 67  LYS A O    7  
ATOM   7997  C  CB   . LYS A 1 67 ? 10.095  4.844   3.273   1.00 0.00 ? 67  LYS A CB   7  
ATOM   7998  C  CG   . LYS A 1 67 ? 10.784  5.309   4.544   1.00 0.00 ? 67  LYS A CG   7  
ATOM   7999  C  CD   . LYS A 1 67 ? 9.904   6.257   5.341   1.00 0.00 ? 67  LYS A CD   7  
ATOM   8000  C  CE   . LYS A 1 67 ? 9.878   7.646   4.722   1.00 0.00 ? 67  LYS A CE   7  
ATOM   8001  N  NZ   . LYS A 1 67 ? 8.729   8.453   5.219   1.00 0.00 ? 67  LYS A NZ   7  
ATOM   8002  H  H    . LYS A 1 67 ? 9.105   3.653   1.267   1.00 0.00 ? 67  LYS A H    7  
ATOM   8003  H  HA   . LYS A 1 67 ? 11.606  3.557   2.472   1.00 0.00 ? 67  LYS A HA   7  
ATOM   8004  H  HB2  . LYS A 1 67 ? 10.278  5.576   2.500   1.00 0.00 ? 67  LYS A HB2  7  
ATOM   8005  H  HB3  . LYS A 1 67 ? 9.032   4.792   3.463   1.00 0.00 ? 67  LYS A HB3  7  
ATOM   8006  H  HG2  . LYS A 1 67 ? 11.012  4.448   5.155   1.00 0.00 ? 67  LYS A HG2  7  
ATOM   8007  H  HG3  . LYS A 1 67 ? 11.700  5.819   4.280   1.00 0.00 ? 67  LYS A HG3  7  
ATOM   8008  H  HD2  . LYS A 1 67 ? 8.897   5.867   5.363   1.00 0.00 ? 67  LYS A HD2  7  
ATOM   8009  H  HD3  . LYS A 1 67 ? 10.287  6.328   6.349   1.00 0.00 ? 67  LYS A HD3  7  
ATOM   8010  H  HE2  . LYS A 1 67 ? 10.797  8.154   4.971   1.00 0.00 ? 67  LYS A HE2  7  
ATOM   8011  H  HE3  . LYS A 1 67 ? 9.801   7.547   3.650   1.00 0.00 ? 67  LYS A HE3  7  
ATOM   8012  H  HZ1  . LYS A 1 67 ? 8.179   8.822   4.417   1.00 0.00 ? 67  LYS A HZ1  7  
ATOM   8013  H  HZ2  . LYS A 1 67 ? 9.074   9.255   5.785   1.00 0.00 ? 67  LYS A HZ2  7  
ATOM   8014  H  HZ3  . LYS A 1 67 ? 8.108   7.866   5.811   1.00 0.00 ? 67  LYS A HZ3  7  
ATOM   8015  N  N    . HIS A 1 68 ? 9.278   2.310   4.466   1.00 0.00 ? 68  HIS A N    7  
ATOM   8016  C  CA   . HIS A 1 68 ? 9.051   1.364   5.553   1.00 0.00 ? 68  HIS A CA   7  
ATOM   8017  C  C    . HIS A 1 68 ? 9.324   -0.066  5.095   1.00 0.00 ? 68  HIS A C    7  
ATOM   8018  O  O    . HIS A 1 68 ? 10.142  -0.771  5.685   1.00 0.00 ? 68  HIS A O    7  
ATOM   8019  C  CB   . HIS A 1 68 ? 7.616   1.481   6.067   1.00 0.00 ? 68  HIS A CB   7  
ATOM   8020  C  CG   . HIS A 1 68 ? 7.426   2.581   7.066   1.00 0.00 ? 68  HIS A CG   7  
ATOM   8021  N  ND1  . HIS A 1 68 ? 6.234   3.255   7.225   1.00 0.00 ? 68  HIS A ND1  7  
ATOM   8022  C  CD2  . HIS A 1 68 ? 8.285   3.122   7.961   1.00 0.00 ? 68  HIS A CD2  7  
ATOM   8023  C  CE1  . HIS A 1 68 ? 6.368   4.165   8.174   1.00 0.00 ? 68  HIS A CE1  7  
ATOM   8024  N  NE2  . HIS A 1 68 ? 7.604   4.105   8.637   1.00 0.00 ? 68  HIS A NE2  7  
ATOM   8025  H  H    . HIS A 1 68 ? 8.530   2.851   4.139   1.00 0.00 ? 68  HIS A H    7  
ATOM   8026  H  HA   . HIS A 1 68 ? 9.732   1.608   6.354   1.00 0.00 ? 68  HIS A HA   7  
ATOM   8027  H  HB2  . HIS A 1 68 ? 6.956   1.673   5.234   1.00 0.00 ? 68  HIS A HB2  7  
ATOM   8028  H  HB3  . HIS A 1 68 ? 7.332   0.551   6.539   1.00 0.00 ? 68  HIS A HB3  7  
ATOM   8029  H  HD2  . HIS A 1 68 ? 9.316   2.836   8.116   1.00 0.00 ? 68  HIS A HD2  7  
ATOM   8030  H  HE1  . HIS A 1 68 ? 5.599   4.842   8.514   1.00 0.00 ? 68  HIS A HE1  7  
ATOM   8031  H  HE2  . HIS A 1 68 ? 7.994   4.726   9.286   1.00 0.00 ? 68  HIS A HE2  7  
ATOM   8032  N  N    . ALA A 1 69 ? 8.633   -0.487  4.041   1.00 0.00 ? 69  ALA A N    7  
ATOM   8033  C  CA   . ALA A 1 69 ? 8.802   -1.831  3.503   1.00 0.00 ? 69  ALA A CA   7  
ATOM   8034  C  C    . ALA A 1 69 ? 10.252  -2.290  3.619   1.00 0.00 ? 69  ALA A C    7  
ATOM   8035  O  O    . ALA A 1 69 ? 10.538  -3.334  4.205   1.00 0.00 ? 69  ALA A O    7  
ATOM   8036  C  CB   . ALA A 1 69 ? 8.344   -1.881  2.053   1.00 0.00 ? 69  ALA A CB   7  
ATOM   8037  H  H    . ALA A 1 69 ? 7.995   0.122   3.613   1.00 0.00 ? 69  ALA A H    7  
ATOM   8038  H  HA   . ALA A 1 69 ? 8.177   -2.501  4.076   1.00 0.00 ? 69  ALA A HA   7  
ATOM   8039  H  HB1  . ALA A 1 69 ? 8.572   -2.853  1.638   1.00 0.00 ? 69  ALA A HB1  7  
ATOM   8040  H  HB2  . ALA A 1 69 ? 7.280   -1.710  2.006   1.00 0.00 ? 69  ALA A HB2  7  
ATOM   8041  H  HB3  . ALA A 1 69 ? 8.858   -1.119  1.487   1.00 0.00 ? 69  ALA A HB3  7  
ATOM   8042  N  N    . ARG A 1 70 ? 11.163  -1.503  3.055   1.00 0.00 ? 70  ARG A N    7  
ATOM   8043  C  CA   . ARG A 1 70 ? 12.583  -1.830  3.093   1.00 0.00 ? 70  ARG A CA   7  
ATOM   8044  C  C    . ARG A 1 70 ? 13.042  -2.097  4.524   1.00 0.00 ? 70  ARG A C    7  
ATOM   8045  O  O    . ARG A 1 70 ? 13.750  -3.068  4.788   1.00 0.00 ? 70  ARG A O    7  
ATOM   8046  C  CB   . ARG A 1 70 ? 13.407  -0.693  2.486   1.00 0.00 ? 70  ARG A CB   7  
ATOM   8047  C  CG   . ARG A 1 70 ? 13.422  -0.696  0.966   1.00 0.00 ? 70  ARG A CG   7  
ATOM   8048  C  CD   . ARG A 1 70 ? 14.162  0.512   0.414   1.00 0.00 ? 70  ARG A CD   7  
ATOM   8049  N  NE   . ARG A 1 70 ? 15.552  0.552   0.860   1.00 0.00 ? 70  ARG A NE   7  
ATOM   8050  C  CZ   . ARG A 1 70 ? 16.521  1.169   0.192   1.00 0.00 ? 70  ARG A CZ   7  
ATOM   8051  N  NH1  . ARG A 1 70 ? 16.251  1.795   -0.946  1.00 0.00 ? 70  ARG A NH1  7  
ATOM   8052  N  NH2  . ARG A 1 70 ? 17.762  1.162   0.661   1.00 0.00 ? 70  ARG A NH2  7  
ATOM   8053  H  H    . ARG A 1 70 ? 10.874  -0.684  2.602   1.00 0.00 ? 70  ARG A H    7  
ATOM   8054  H  HA   . ARG A 1 70 ? 12.734  -2.725  2.507   1.00 0.00 ? 70  ARG A HA   7  
ATOM   8055  H  HB2  . ARG A 1 70 ? 12.998  0.249   2.818   1.00 0.00 ? 70  ARG A HB2  7  
ATOM   8056  H  HB3  . ARG A 1 70 ? 14.425  -0.777  2.834   1.00 0.00 ? 70  ARG A HB3  7  
ATOM   8057  H  HG2  . ARG A 1 70 ? 13.913  -1.594  0.622   1.00 0.00 ? 70  ARG A HG2  7  
ATOM   8058  H  HG3  . ARG A 1 70 ? 12.404  -0.679  0.606   1.00 0.00 ? 70  ARG A HG3  7  
ATOM   8059  H  HD2  . ARG A 1 70 ? 14.141  0.468   -0.665  1.00 0.00 ? 70  ARG A HD2  7  
ATOM   8060  H  HD3  . ARG A 1 70 ? 13.661  1.408   0.748   1.00 0.00 ? 70  ARG A HD3  7  
ATOM   8061  H  HE   . ARG A 1 70 ? 15.774  0.096   1.698   1.00 0.00 ? 70  ARG A HE   7  
ATOM   8062  H  HH11 . ARG A 1 70 ? 15.317  1.803   -1.302  1.00 0.00 ? 70  ARG A HH11 7  
ATOM   8063  H  HH12 . ARG A 1 70 ? 16.982  2.259   -1.447  1.00 0.00 ? 70  ARG A HH12 7  
ATOM   8064  H  HH21 . ARG A 1 70 ? 17.969  0.691   1.519   1.00 0.00 ? 70  ARG A HH21 7  
ATOM   8065  H  HH22 . ARG A 1 70 ? 18.489  1.626   0.158   1.00 0.00 ? 70  ARG A HH22 7  
ATOM   8066  N  N    . GLU A 1 71 ? 12.632  -1.228  5.443   1.00 0.00 ? 71  GLU A N    7  
ATOM   8067  C  CA   . GLU A 1 71 ? 13.002  -1.369  6.846   1.00 0.00 ? 71  GLU A CA   7  
ATOM   8068  C  C    . GLU A 1 71 ? 12.491  -2.691  7.413   1.00 0.00 ? 71  GLU A C    7  
ATOM   8069  O  O    . GLU A 1 71 ? 13.147  -3.316  8.247   1.00 0.00 ? 71  GLU A O    7  
ATOM   8070  C  CB   . GLU A 1 71 ? 12.446  -0.202  7.664   1.00 0.00 ? 71  GLU A CB   7  
ATOM   8071  C  CG   . GLU A 1 71 ? 12.926  1.158   7.187   1.00 0.00 ? 71  GLU A CG   7  
ATOM   8072  C  CD   . GLU A 1 71 ? 12.135  2.302   7.793   1.00 0.00 ? 71  GLU A CD   7  
ATOM   8073  O  OE1  . GLU A 1 71 ? 11.830  2.235   9.003   1.00 0.00 ? 71  GLU A OE1  7  
ATOM   8074  O  OE2  . GLU A 1 71 ? 11.822  3.262   7.060   1.00 0.00 ? 71  GLU A OE2  7  
ATOM   8075  H  H    . GLU A 1 71 ? 12.068  -0.474  5.171   1.00 0.00 ? 71  GLU A H    7  
ATOM   8076  H  HA   . GLU A 1 71 ? 14.080  -1.358  6.908   1.00 0.00 ? 71  GLU A HA   7  
ATOM   8077  H  HB2  . GLU A 1 71 ? 11.367  -0.221  7.608   1.00 0.00 ? 71  GLU A HB2  7  
ATOM   8078  H  HB3  . GLU A 1 71 ? 12.745  -0.325  8.694   1.00 0.00 ? 71  GLU A HB3  7  
ATOM   8079  H  HG2  . GLU A 1 71 ? 13.964  1.275   7.459   1.00 0.00 ? 71  GLU A HG2  7  
ATOM   8080  H  HG3  . GLU A 1 71 ? 12.829  1.204   6.112   1.00 0.00 ? 71  GLU A HG3  7  
ATOM   8081  N  N    . ARG A 1 72 ? 11.316  -3.109  6.955   1.00 0.00 ? 72  ARG A N    7  
ATOM   8082  C  CA   . ARG A 1 72 ? 10.715  -4.355  7.417   1.00 0.00 ? 72  ARG A CA   7  
ATOM   8083  C  C    . ARG A 1 72 ? 11.583  -5.551  7.037   1.00 0.00 ? 72  ARG A C    7  
ATOM   8084  O  O    . ARG A 1 72 ? 11.955  -6.357  7.889   1.00 0.00 ? 72  ARG A O    7  
ATOM   8085  C  CB   . ARG A 1 72 ? 9.314   -4.520  6.826   1.00 0.00 ? 72  ARG A CB   7  
ATOM   8086  C  CG   . ARG A 1 72 ? 8.214   -3.929  7.692   1.00 0.00 ? 72  ARG A CG   7  
ATOM   8087  C  CD   . ARG A 1 72 ? 6.868   -4.575  7.402   1.00 0.00 ? 72  ARG A CD   7  
ATOM   8088  N  NE   . ARG A 1 72 ? 6.609   -5.716  8.276   1.00 0.00 ? 72  ARG A NE   7  
ATOM   8089  C  CZ   . ARG A 1 72 ? 6.329   -5.602  9.570   1.00 0.00 ? 72  ARG A CZ   7  
ATOM   8090  N  NH1  . ARG A 1 72 ? 6.273   -4.405  10.136  1.00 0.00 ? 72  ARG A NH1  7  
ATOM   8091  N  NH2  . ARG A 1 72 ? 6.105   -6.688  10.299  1.00 0.00 ? 72  ARG A NH2  7  
ATOM   8092  H  H    . ARG A 1 72 ? 10.841  -2.567  6.291   1.00 0.00 ? 72  ARG A H    7  
ATOM   8093  H  HA   . ARG A 1 72 ? 10.639  -4.308  8.493   1.00 0.00 ? 72  ARG A HA   7  
ATOM   8094  H  HB2  . ARG A 1 72 ? 9.283   -4.034  5.862   1.00 0.00 ? 72  ARG A HB2  7  
ATOM   8095  H  HB3  . ARG A 1 72 ? 9.113   -5.573  6.696   1.00 0.00 ? 72  ARG A HB3  7  
ATOM   8096  H  HG2  . ARG A 1 72 ? 8.461   -4.090  8.731   1.00 0.00 ? 72  ARG A HG2  7  
ATOM   8097  H  HG3  . ARG A 1 72 ? 8.145   -2.869  7.496   1.00 0.00 ? 72  ARG A HG3  7  
ATOM   8098  H  HD2  . ARG A 1 72 ? 6.092   -3.839  7.547   1.00 0.00 ? 72  ARG A HD2  7  
ATOM   8099  H  HD3  . ARG A 1 72 ? 6.859   -4.910  6.375   1.00 0.00 ? 72  ARG A HD3  7  
ATOM   8100  H  HE   . ARG A 1 72 ? 6.646   -6.610  7.878   1.00 0.00 ? 72  ARG A HE   7  
ATOM   8101  H  HH11 . ARG A 1 72 ? 6.440   -3.585  9.589   1.00 0.00 ? 72  ARG A HH11 7  
ATOM   8102  H  HH12 . ARG A 1 72 ? 6.061   -4.322  11.110  1.00 0.00 ? 72  ARG A HH12 7  
ATOM   8103  H  HH21 . ARG A 1 72 ? 6.147   -7.592  9.875   1.00 0.00 ? 72  ARG A HH21 7  
ATOM   8104  H  HH22 . ARG A 1 72 ? 5.895   -6.601  11.272  1.00 0.00 ? 72  ARG A HH22 7  
ATOM   8105  N  N    . VAL A 1 73 ? 11.903  -5.659  5.751   1.00 0.00 ? 73  VAL A N    7  
ATOM   8106  C  CA   . VAL A 1 73 ? 12.727  -6.756  5.258   1.00 0.00 ? 73  VAL A CA   7  
ATOM   8107  C  C    . VAL A 1 73 ? 14.150  -6.659  5.797   1.00 0.00 ? 73  VAL A C    7  
ATOM   8108  O  O    . VAL A 1 73 ? 14.781  -7.673  6.098   1.00 0.00 ? 73  VAL A O    7  
ATOM   8109  C  CB   . VAL A 1 73 ? 12.774  -6.775  3.718   1.00 0.00 ? 73  VAL A CB   7  
ATOM   8110  C  CG1  . VAL A 1 73 ? 13.245  -5.432  3.182   1.00 0.00 ? 73  VAL A CG1  7  
ATOM   8111  C  CG2  . VAL A 1 73 ? 13.672  -7.900  3.227   1.00 0.00 ? 73  VAL A CG2  7  
ATOM   8112  H  H    . VAL A 1 73 ? 11.576  -4.985  5.119   1.00 0.00 ? 73  VAL A H    7  
ATOM   8113  H  HA   . VAL A 1 73 ? 12.287  -7.683  5.595   1.00 0.00 ? 73  VAL A HA   7  
ATOM   8114  H  HB   . VAL A 1 73 ? 11.774  -6.954  3.350   1.00 0.00 ? 73  VAL A HB   7  
ATOM   8115  H  HG11 . VAL A 1 73 ? 13.498  -5.532  2.136   1.00 0.00 ? 73  VAL A HG11 7  
ATOM   8116  H  HG12 . VAL A 1 73 ? 12.456  -4.702  3.294   1.00 0.00 ? 73  VAL A HG12 7  
ATOM   8117  H  HG13 . VAL A 1 73 ? 14.115  -5.110  3.733   1.00 0.00 ? 73  VAL A HG13 7  
ATOM   8118  H  HG21 . VAL A 1 73 ? 14.704  -7.591  3.296   1.00 0.00 ? 73  VAL A HG21 7  
ATOM   8119  H  HG22 . VAL A 1 73 ? 13.517  -8.778  3.837   1.00 0.00 ? 73  VAL A HG22 7  
ATOM   8120  H  HG23 . VAL A 1 73 ? 13.432  -8.130  2.199   1.00 0.00 ? 73  VAL A HG23 7  
ATOM   8121  N  N    . SER A 1 74 ? 14.649  -5.434  5.918   1.00 0.00 ? 74  SER A N    7  
ATOM   8122  C  CA   . SER A 1 74 ? 16.000  -5.204  6.418   1.00 0.00 ? 74  SER A CA   7  
ATOM   8123  C  C    . SER A 1 74 ? 16.108  -5.596  7.888   1.00 0.00 ? 74  SER A C    7  
ATOM   8124  O  O    . SER A 1 74 ? 17.013  -6.332  8.281   1.00 0.00 ? 74  SER A O    7  
ATOM   8125  C  CB   . SER A 1 74 ? 16.389  -3.735  6.240   1.00 0.00 ? 74  SER A CB   7  
ATOM   8126  O  OG   . SER A 1 74 ? 17.577  -3.433  6.952   1.00 0.00 ? 74  SER A OG   7  
ATOM   8127  H  H    . SER A 1 74 ? 14.097  -4.665  5.661   1.00 0.00 ? 74  SER A H    7  
ATOM   8128  H  HA   . SER A 1 74 ? 16.675  -5.819  5.842   1.00 0.00 ? 74  SER A HA   7  
ATOM   8129  H  HB2  . SER A 1 74 ? 16.550  -3.532  5.192   1.00 0.00 ? 74  SER A HB2  7  
ATOM   8130  H  HB3  . SER A 1 74 ? 15.592  -3.107  6.610   1.00 0.00 ? 74  SER A HB3  7  
ATOM   8131  H  HG   . SER A 1 74 ? 18.015  -2.685  6.540   1.00 0.00 ? 74  SER A HG   7  
ATOM   8132  N  N    . GLY A 1 75 ? 15.178  -5.099  8.697   1.00 0.00 ? 75  GLY A N    7  
ATOM   8133  C  CA   . GLY A 1 75 ? 15.186  -5.407  10.115  1.00 0.00 ? 75  GLY A CA   7  
ATOM   8134  C  C    . GLY A 1 75 ? 15.651  -6.822  10.398  1.00 0.00 ? 75  GLY A C    7  
ATOM   8135  O  O    . GLY A 1 75 ? 15.089  -7.795  9.896   1.00 0.00 ? 75  GLY A O    7  
ATOM   8136  H  H    . GLY A 1 75 ? 14.480  -4.517  8.328   1.00 0.00 ? 75  GLY A H    7  
ATOM   8137  H  HA2  . GLY A 1 75 ? 15.844  -4.716  10.619  1.00 0.00 ? 75  GLY A HA2  7  
ATOM   8138  H  HA3  . GLY A 1 75 ? 14.186  -5.285  10.504  1.00 0.00 ? 75  GLY A HA3  7  
ATOM   8139  N  N    . PRO A 1 76 ? 16.704  -6.950  11.220  1.00 0.00 ? 76  PRO A N    7  
ATOM   8140  C  CA   . PRO A 1 76 ? 17.268  -8.252  11.586  1.00 0.00 ? 76  PRO A CA   7  
ATOM   8141  C  C    . PRO A 1 76 ? 16.339  -9.053  12.492  1.00 0.00 ? 76  PRO A C    7  
ATOM   8142  O  O    . PRO A 1 76 ? 15.832  -8.537  13.488  1.00 0.00 ? 76  PRO A O    7  
ATOM   8143  C  CB   . PRO A 1 76 ? 18.554  -7.885  12.330  1.00 0.00 ? 76  PRO A CB   7  
ATOM   8144  C  CG   . PRO A 1 76 ? 18.306  -6.516  12.863  1.00 0.00 ? 76  PRO A CG   7  
ATOM   8145  C  CD   . PRO A 1 76 ? 17.423  -5.833  11.855  1.00 0.00 ? 76  PRO A CD   7  
ATOM   8146  H  HA   . PRO A 1 76 ? 17.511  -8.839  10.712  1.00 0.00 ? 76  PRO A HA   7  
ATOM   8147  H  HB2  . PRO A 1 76 ? 18.728  -8.594  13.127  1.00 0.00 ? 76  PRO A HB2  7  
ATOM   8148  H  HB3  . PRO A 1 76 ? 19.387  -7.896  11.643  1.00 0.00 ? 76  PRO A HB3  7  
ATOM   8149  H  HG2  . PRO A 1 76 ? 17.806  -6.579  13.818  1.00 0.00 ? 76  PRO A HG2  7  
ATOM   8150  H  HG3  . PRO A 1 76 ? 19.241  -5.985  12.962  1.00 0.00 ? 76  PRO A HG3  7  
ATOM   8151  H  HD2  . PRO A 1 76 ? 16.735  -5.163  12.349  1.00 0.00 ? 76  PRO A HD2  7  
ATOM   8152  H  HD3  . PRO A 1 76 ? 18.020  -5.299  11.131  1.00 0.00 ? 76  PRO A HD3  7  
ATOM   8153  N  N    . SER A 1 77 ? 16.121  -10.316 12.140  1.00 0.00 ? 77  SER A N    7  
ATOM   8154  C  CA   . SER A 1 77 ? 15.249  -11.187 12.921  1.00 0.00 ? 77  SER A CA   7  
ATOM   8155  C  C    . SER A 1 77 ? 16.051  -12.302 13.586  1.00 0.00 ? 77  SER A C    7  
ATOM   8156  O  O    . SER A 1 77 ? 17.242  -12.465 13.325  1.00 0.00 ? 77  SER A O    7  
ATOM   8157  C  CB   . SER A 1 77 ? 14.162  -11.788 12.028  1.00 0.00 ? 77  SER A CB   7  
ATOM   8158  O  OG   . SER A 1 77 ? 14.688  -12.812 11.202  1.00 0.00 ? 77  SER A OG   7  
ATOM   8159  H  H    . SER A 1 77 ? 16.554  -10.669 11.335  1.00 0.00 ? 77  SER A H    7  
ATOM   8160  H  HA   . SER A 1 77 ? 14.783  -10.588 13.688  1.00 0.00 ? 77  SER A HA   7  
ATOM   8161  H  HB2  . SER A 1 77 ? 13.382  -12.205 12.646  1.00 0.00 ? 77  SER A HB2  7  
ATOM   8162  H  HB3  . SER A 1 77 ? 13.747  -11.013 11.400  1.00 0.00 ? 77  SER A HB3  7  
ATOM   8163  H  HG   . SER A 1 77 ? 15.080  -13.496 11.751  1.00 0.00 ? 77  SER A HG   7  
ATOM   8164  N  N    . SER A 1 78 ? 15.386  -13.067 14.446  1.00 0.00 ? 78  SER A N    7  
ATOM   8165  C  CA   . SER A 1 78 ? 16.036  -14.165 15.153  1.00 0.00 ? 78  SER A CA   7  
ATOM   8166  C  C    . SER A 1 78 ? 16.834  -15.036 14.187  1.00 0.00 ? 78  SER A C    7  
ATOM   8167  O  O    . SER A 1 78 ? 18.014  -15.304 14.406  1.00 0.00 ? 78  SER A O    7  
ATOM   8168  C  CB   . SER A 1 78 ? 14.996  -15.015 15.884  1.00 0.00 ? 78  SER A CB   7  
ATOM   8169  O  OG   . SER A 1 78 ? 14.716  -14.486 17.169  1.00 0.00 ? 78  SER A OG   7  
ATOM   8170  H  H    . SER A 1 78 ? 14.437  -12.887 14.612  1.00 0.00 ? 78  SER A H    7  
ATOM   8171  H  HA   . SER A 1 78 ? 16.713  -13.738 15.877  1.00 0.00 ? 78  SER A HA   7  
ATOM   8172  H  HB2  . SER A 1 78 ? 14.082  -15.035 15.310  1.00 0.00 ? 78  SER A HB2  7  
ATOM   8173  H  HB3  . SER A 1 78 ? 15.373  -16.022 15.996  1.00 0.00 ? 78  SER A HB3  7  
ATOM   8174  H  HG   . SER A 1 78 ? 14.225  -13.666 17.077  1.00 0.00 ? 78  SER A HG   7  
ATOM   8175  N  N    . GLY A 1 79 ? 16.179  -15.474 13.116  1.00 0.00 ? 79  GLY A N    7  
ATOM   8176  C  CA   . GLY A 1 79 ? 16.841  -16.311 12.132  1.00 0.00 ? 79  GLY A CA   7  
ATOM   8177  C  C    . GLY A 1 79 ? 17.867  -15.547 11.319  1.00 0.00 ? 79  GLY A C    7  
ATOM   8178  O  O    . GLY A 1 79 ? 18.311  -16.052 10.289  1.00 0.00 ? 79  GLY A O    7  
ATOM   8179  H  H    . GLY A 1 79 ? 15.238  -15.228 12.994  1.00 0.00 ? 79  GLY A H    7  
ATOM   8180  H  HA2  . GLY A 1 79 ? 17.335  -17.125 12.642  1.00 0.00 ? 79  GLY A HA2  7  
ATOM   8181  H  HA3  . GLY A 1 79 ? 16.097  -16.717 11.463  1.00 0.00 ? 79  GLY A HA3  7  
HETATM 8182  ZN ZN   . ZN  B 2 .  ? -11.217 0.034   3.366   1.00 0.00 ? 201 ZN  A ZN   7  
HETATM 8183  ZN ZN   . ZN  C 2 .  ? 4.957   3.780   5.738   1.00 0.00 ? 401 ZN  A ZN   7  
ATOM   8184  N  N    . GLY A 1 1  ? -40.733 -11.042 19.490  1.00 0.00 ? 1   GLY A N    8  
ATOM   8185  C  CA   . GLY A 1 1  ? -41.659 -11.524 18.483  1.00 0.00 ? 1   GLY A CA   8  
ATOM   8186  C  C    . GLY A 1 1  ? -41.914 -10.502 17.393  1.00 0.00 ? 1   GLY A C    8  
ATOM   8187  O  O    . GLY A 1 1  ? -42.395 -9.402  17.664  1.00 0.00 ? 1   GLY A O    8  
ATOM   8188  H  H1   . GLY A 1 1  ? -40.368 -10.134 19.424  1.00 0.00 ? 1   GLY A H1   8  
ATOM   8189  H  HA2  . GLY A 1 1  ? -41.254 -12.419 18.036  1.00 0.00 ? 1   GLY A HA2  8  
ATOM   8190  H  HA3  . GLY A 1 1  ? -42.598 -11.766 18.960  1.00 0.00 ? 1   GLY A HA3  8  
ATOM   8191  N  N    . SER A 1 2  ? -41.589 -10.865 16.156  1.00 0.00 ? 2   SER A N    8  
ATOM   8192  C  CA   . SER A 1 2  ? -41.781 -9.969  15.021  1.00 0.00 ? 2   SER A CA   8  
ATOM   8193  C  C    . SER A 1 2  ? -42.108 -10.757 13.757  1.00 0.00 ? 2   SER A C    8  
ATOM   8194  O  O    . SER A 1 2  ? -42.097 -11.988 13.758  1.00 0.00 ? 2   SER A O    8  
ATOM   8195  C  CB   . SER A 1 2  ? -40.528 -9.121  14.797  1.00 0.00 ? 2   SER A CB   8  
ATOM   8196  O  OG   . SER A 1 2  ? -40.327 -8.215  15.868  1.00 0.00 ? 2   SER A OG   8  
ATOM   8197  H  H    . SER A 1 2  ? -41.210 -11.756 16.004  1.00 0.00 ? 2   SER A H    8  
ATOM   8198  H  HA   . SER A 1 2  ? -42.610 -9.317  15.250  1.00 0.00 ? 2   SER A HA   8  
ATOM   8199  H  HB2  . SER A 1 2  ? -39.667 -9.767  14.723  1.00 0.00 ? 2   SER A HB2  8  
ATOM   8200  H  HB3  . SER A 1 2  ? -40.636 -8.559  13.881  1.00 0.00 ? 2   SER A HB3  8  
ATOM   8201  H  HG   . SER A 1 2  ? -40.581 -7.331  15.592  1.00 0.00 ? 2   SER A HG   8  
ATOM   8202  N  N    . SER A 1 3  ? -42.399 -10.038 12.678  1.00 0.00 ? 3   SER A N    8  
ATOM   8203  C  CA   . SER A 1 3  ? -42.734 -10.668 11.406  1.00 0.00 ? 3   SER A CA   8  
ATOM   8204  C  C    . SER A 1 3  ? -42.393 -9.748  10.237  1.00 0.00 ? 3   SER A C    8  
ATOM   8205  O  O    . SER A 1 3  ? -42.487 -8.526  10.347  1.00 0.00 ? 3   SER A O    8  
ATOM   8206  C  CB   . SER A 1 3  ? -44.219 -11.031 11.368  1.00 0.00 ? 3   SER A CB   8  
ATOM   8207  O  OG   . SER A 1 3  ? -45.030 -9.888  11.579  1.00 0.00 ? 3   SER A OG   8  
ATOM   8208  H  H    . SER A 1 3  ? -42.391 -9.059  12.739  1.00 0.00 ? 3   SER A H    8  
ATOM   8209  H  HA   . SER A 1 3  ? -42.149 -11.571 11.320  1.00 0.00 ? 3   SER A HA   8  
ATOM   8210  H  HB2  . SER A 1 3  ? -44.459 -11.455 10.404  1.00 0.00 ? 3   SER A HB2  8  
ATOM   8211  H  HB3  . SER A 1 3  ? -44.430 -11.755 12.142  1.00 0.00 ? 3   SER A HB3  8  
ATOM   8212  H  HG   . SER A 1 3  ? -45.824 -10.142 12.054  1.00 0.00 ? 3   SER A HG   8  
ATOM   8213  N  N    . GLY A 1 4  ? -41.997 -10.345 9.118   1.00 0.00 ? 4   GLY A N    8  
ATOM   8214  C  CA   . GLY A 1 4  ? -41.649 -9.566  7.944   1.00 0.00 ? 4   GLY A CA   8  
ATOM   8215  C  C    . GLY A 1 4  ? -41.413 -10.431 6.722   1.00 0.00 ? 4   GLY A C    8  
ATOM   8216  O  O    . GLY A 1 4  ? -41.538 -11.654 6.786   1.00 0.00 ? 4   GLY A O    8  
ATOM   8217  H  H    . GLY A 1 4  ? -41.941 -11.323 9.088   1.00 0.00 ? 4   GLY A H    8  
ATOM   8218  H  HA2  . GLY A 1 4  ? -42.451 -8.874  7.733   1.00 0.00 ? 4   GLY A HA2  8  
ATOM   8219  H  HA3  . GLY A 1 4  ? -40.749 -9.005  8.153   1.00 0.00 ? 4   GLY A HA3  8  
ATOM   8220  N  N    . SER A 1 5  ? -41.072 -9.796  5.606   1.00 0.00 ? 5   SER A N    8  
ATOM   8221  C  CA   . SER A 1 5  ? -40.823 -10.515 4.362   1.00 0.00 ? 5   SER A CA   8  
ATOM   8222  C  C    . SER A 1 5  ? -39.480 -10.112 3.760   1.00 0.00 ? 5   SER A C    8  
ATOM   8223  O  O    . SER A 1 5  ? -39.303 -8.980  3.311   1.00 0.00 ? 5   SER A O    8  
ATOM   8224  C  CB   . SER A 1 5  ? -41.946 -10.245 3.359   1.00 0.00 ? 5   SER A CB   8  
ATOM   8225  O  OG   . SER A 1 5  ? -43.211 -10.565 3.911   1.00 0.00 ? 5   SER A OG   8  
ATOM   8226  H  H    . SER A 1 5  ? -40.988 -8.819  5.619   1.00 0.00 ? 5   SER A H    8  
ATOM   8227  H  HA   . SER A 1 5  ? -40.801 -11.571 4.588   1.00 0.00 ? 5   SER A HA   8  
ATOM   8228  H  HB2  . SER A 1 5  ? -41.939 -9.200  3.087   1.00 0.00 ? 5   SER A HB2  8  
ATOM   8229  H  HB3  . SER A 1 5  ? -41.789 -10.847 2.476   1.00 0.00 ? 5   SER A HB3  8  
ATOM   8230  H  HG   . SER A 1 5  ? -43.163 -10.522 4.868   1.00 0.00 ? 5   SER A HG   8  
ATOM   8231  N  N    . SER A 1 6  ? -38.537 -11.048 3.756   1.00 0.00 ? 6   SER A N    8  
ATOM   8232  C  CA   . SER A 1 6  ? -37.208 -10.791 3.213   1.00 0.00 ? 6   SER A CA   8  
ATOM   8233  C  C    . SER A 1 6  ? -36.912 -11.718 2.038   1.00 0.00 ? 6   SER A C    8  
ATOM   8234  O  O    . SER A 1 6  ? -37.548 -12.759 1.879   1.00 0.00 ? 6   SER A O    8  
ATOM   8235  C  CB   . SER A 1 6  ? -36.146 -10.972 4.300   1.00 0.00 ? 6   SER A CB   8  
ATOM   8236  O  OG   . SER A 1 6  ? -34.859 -10.626 3.819   1.00 0.00 ? 6   SER A OG   8  
ATOM   8237  H  H    . SER A 1 6  ? -38.739 -11.932 4.128   1.00 0.00 ? 6   SER A H    8  
ATOM   8238  H  HA   . SER A 1 6  ? -37.184 -9.769  2.865   1.00 0.00 ? 6   SER A HA   8  
ATOM   8239  H  HB2  . SER A 1 6  ? -36.385 -10.340 5.141   1.00 0.00 ? 6   SER A HB2  8  
ATOM   8240  H  HB3  . SER A 1 6  ? -36.133 -12.005 4.618   1.00 0.00 ? 6   SER A HB3  8  
ATOM   8241  H  HG   . SER A 1 6  ? -34.919 -9.828  3.289   1.00 0.00 ? 6   SER A HG   8  
ATOM   8242  N  N    . GLY A 1 7  ? -35.941 -11.331 1.216   1.00 0.00 ? 7   GLY A N    8  
ATOM   8243  C  CA   . GLY A 1 7  ? -35.577 -12.137 0.066   1.00 0.00 ? 7   GLY A CA   8  
ATOM   8244  C  C    . GLY A 1 7  ? -35.560 -11.336 -1.221  1.00 0.00 ? 7   GLY A C    8  
ATOM   8245  O  O    . GLY A 1 7  ? -36.350 -10.408 -1.393  1.00 0.00 ? 7   GLY A O    8  
ATOM   8246  H  H    . GLY A 1 7  ? -35.468 -10.491 1.393   1.00 0.00 ? 7   GLY A H    8  
ATOM   8247  H  HA2  . GLY A 1 7  ? -34.595 -12.556 0.230   1.00 0.00 ? 7   GLY A HA2  8  
ATOM   8248  H  HA3  . GLY A 1 7  ? -36.289 -12.943 -0.034  1.00 0.00 ? 7   GLY A HA3  8  
ATOM   8249  N  N    . SER A 1 8  ? -34.657 -11.695 -2.128  1.00 0.00 ? 8   SER A N    8  
ATOM   8250  C  CA   . SER A 1 8  ? -34.537 -11.000 -3.404  1.00 0.00 ? 8   SER A CA   8  
ATOM   8251  C  C    . SER A 1 8  ? -34.032 -11.943 -4.491  1.00 0.00 ? 8   SER A C    8  
ATOM   8252  O  O    . SER A 1 8  ? -32.852 -12.295 -4.524  1.00 0.00 ? 8   SER A O    8  
ATOM   8253  C  CB   . SER A 1 8  ? -33.592 -9.804  -3.271  1.00 0.00 ? 8   SER A CB   8  
ATOM   8254  O  OG   . SER A 1 8  ? -33.649 -8.979  -4.421  1.00 0.00 ? 8   SER A OG   8  
ATOM   8255  H  H    . SER A 1 8  ? -34.056 -12.444 -1.933  1.00 0.00 ? 8   SER A H    8  
ATOM   8256  H  HA   . SER A 1 8  ? -35.518 -10.643 -3.681  1.00 0.00 ? 8   SER A HA   8  
ATOM   8257  H  HB2  . SER A 1 8  ? -33.875 -9.220  -2.409  1.00 0.00 ? 8   SER A HB2  8  
ATOM   8258  H  HB3  . SER A 1 8  ? -32.580 -10.161 -3.148  1.00 0.00 ? 8   SER A HB3  8  
ATOM   8259  H  HG   . SER A 1 8  ? -32.993 -9.272  -5.058  1.00 0.00 ? 8   SER A HG   8  
ATOM   8260  N  N    . ILE A 1 9  ? -34.933 -12.349 -5.380  1.00 0.00 ? 9   ILE A N    8  
ATOM   8261  C  CA   . ILE A 1 9  ? -34.579 -13.250 -6.469  1.00 0.00 ? 9   ILE A CA   8  
ATOM   8262  C  C    . ILE A 1 9  ? -33.644 -12.570 -7.463  1.00 0.00 ? 9   ILE A C    8  
ATOM   8263  O  O    . ILE A 1 9  ? -33.557 -11.344 -7.512  1.00 0.00 ? 9   ILE A O    8  
ATOM   8264  C  CB   . ILE A 1 9  ? -35.830 -13.748 -7.216  1.00 0.00 ? 9   ILE A CB   8  
ATOM   8265  C  CG1  . ILE A 1 9  ? -36.607 -12.566 -7.800  1.00 0.00 ? 9   ILE A CG1  8  
ATOM   8266  C  CG2  . ILE A 1 9  ? -36.715 -14.563 -6.284  1.00 0.00 ? 9   ILE A CG2  8  
ATOM   8267  C  CD1  . ILE A 1 9  ? -36.173 -12.189 -9.199  1.00 0.00 ? 9   ILE A CD1  8  
ATOM   8268  H  H    . ILE A 1 9  ? -35.857 -12.034 -5.301  1.00 0.00 ? 9   ILE A H    8  
ATOM   8269  H  HA   . ILE A 1 9  ? -34.074 -14.105 -6.043  1.00 0.00 ? 9   ILE A HA   8  
ATOM   8270  H  HB   . ILE A 1 9  ? -35.509 -14.391 -8.022  1.00 0.00 ? 9   ILE A HB   8  
ATOM   8271  H  HG12 . ILE A 1 9  ? -37.656 -12.815 -7.834  1.00 0.00 ? 9   ILE A HG12 8  
ATOM   8272  H  HG13 . ILE A 1 9  ? -36.466 -11.704 -7.164  1.00 0.00 ? 9   ILE A HG13 8  
ATOM   8273  H  HG21 . ILE A 1 9  ? -37.305 -13.895 -5.674  1.00 0.00 ? 9   ILE A HG21 8  
ATOM   8274  H  HG22 . ILE A 1 9  ? -37.371 -15.190 -6.868  1.00 0.00 ? 9   ILE A HG22 8  
ATOM   8275  H  HG23 . ILE A 1 9  ? -36.097 -15.180 -5.649  1.00 0.00 ? 9   ILE A HG23 8  
ATOM   8276  H  HD11 . ILE A 1 9  ? -35.162 -11.812 -9.173  1.00 0.00 ? 9   ILE A HD11 8  
ATOM   8277  H  HD12 . ILE A 1 9  ? -36.218 -13.059 -9.837  1.00 0.00 ? 9   ILE A HD12 8  
ATOM   8278  H  HD13 . ILE A 1 9  ? -36.832 -11.425 -9.586  1.00 0.00 ? 9   ILE A HD13 8  
ATOM   8279  N  N    . GLY A 1 10 ? -32.946 -13.377 -8.257  1.00 0.00 ? 10  GLY A N    8  
ATOM   8280  C  CA   . GLY A 1 10 ? -32.027 -12.835 -9.242  1.00 0.00 ? 10  GLY A CA   8  
ATOM   8281  C  C    . GLY A 1 10 ? -30.576 -13.071 -8.872  1.00 0.00 ? 10  GLY A C    8  
ATOM   8282  O  O    . GLY A 1 10 ? -30.278 -13.569 -7.787  1.00 0.00 ? 10  GLY A O    8  
ATOM   8283  H  H    . GLY A 1 10 ? -33.055 -14.347 -8.174  1.00 0.00 ? 10  GLY A H    8  
ATOM   8284  H  HA2  . GLY A 1 10 ? -32.225 -13.300 -10.196 1.00 0.00 ? 10  GLY A HA2  8  
ATOM   8285  H  HA3  . GLY A 1 10 ? -32.196 -11.772 -9.328  1.00 0.00 ? 10  GLY A HA3  8  
ATOM   8286  N  N    . ASN A 1 11 ? -29.671 -12.714 -9.777  1.00 0.00 ? 11  ASN A N    8  
ATOM   8287  C  CA   . ASN A 1 11 ? -28.243 -12.891 -9.541  1.00 0.00 ? 11  ASN A CA   8  
ATOM   8288  C  C    . ASN A 1 11 ? -27.786 -12.080 -8.333  1.00 0.00 ? 11  ASN A C    8  
ATOM   8289  O  O    . ASN A 1 11 ? -28.348 -11.028 -8.030  1.00 0.00 ? 11  ASN A O    8  
ATOM   8290  C  CB   . ASN A 1 11 ? -27.444 -12.477 -10.779 1.00 0.00 ? 11  ASN A CB   8  
ATOM   8291  C  CG   . ASN A 1 11 ? -25.991 -12.901 -10.698 1.00 0.00 ? 11  ASN A CG   8  
ATOM   8292  O  OD1  . ASN A 1 11 ? -25.667 -14.080 -10.845 1.00 0.00 ? 11  ASN A OD1  8  
ATOM   8293  N  ND2  . ASN A 1 11 ? -25.106 -11.939 -10.463 1.00 0.00 ? 11  ASN A ND2  8  
ATOM   8294  H  H    . ASN A 1 11 ? -29.970 -12.321 -10.624 1.00 0.00 ? 11  ASN A H    8  
ATOM   8295  H  HA   . ASN A 1 11 ? -28.067 -13.938 -9.344  1.00 0.00 ? 11  ASN A HA   8  
ATOM   8296  H  HB2  . ASN A 1 11 ? -27.884 -12.935 -11.653 1.00 0.00 ? 11  ASN A HB2  8  
ATOM   8297  H  HB3  . ASN A 1 11 ? -27.482 -11.403 -10.882 1.00 0.00 ? 11  ASN A HB3  8  
ATOM   8298  H  HD21 . ASN A 1 11 ? -25.436 -11.022 -10.356 1.00 0.00 ? 11  ASN A HD21 8  
ATOM   8299  H  HD22 . ASN A 1 11 ? -24.159 -12.185 -10.406 1.00 0.00 ? 11  ASN A HD22 8  
ATOM   8300  N  N    . ALA A 1 12 ? -26.761 -12.576 -7.647  1.00 0.00 ? 12  ALA A N    8  
ATOM   8301  C  CA   . ALA A 1 12 ? -26.227 -11.896 -6.473  1.00 0.00 ? 12  ALA A CA   8  
ATOM   8302  C  C    . ALA A 1 12 ? -24.706 -12.001 -6.423  1.00 0.00 ? 12  ALA A C    8  
ATOM   8303  O  O    . ALA A 1 12 ? -24.139 -13.055 -6.706  1.00 0.00 ? 12  ALA A O    8  
ATOM   8304  C  CB   . ALA A 1 12 ? -26.840 -12.472 -5.205  1.00 0.00 ? 12  ALA A CB   8  
ATOM   8305  H  H    . ALA A 1 12 ? -26.354 -13.418 -7.937  1.00 0.00 ? 12  ALA A H    8  
ATOM   8306  H  HA   . ALA A 1 12 ? -26.504 -10.853 -6.536  1.00 0.00 ? 12  ALA A HA   8  
ATOM   8307  H  HB1  . ALA A 1 12 ? -26.311 -12.087 -4.345  1.00 0.00 ? 12  ALA A HB1  8  
ATOM   8308  H  HB2  . ALA A 1 12 ? -27.879 -12.187 -5.146  1.00 0.00 ? 12  ALA A HB2  8  
ATOM   8309  H  HB3  . ALA A 1 12 ? -26.761 -13.548 -5.224  1.00 0.00 ? 12  ALA A HB3  8  
ATOM   8310  N  N    . GLN A 1 13 ? -24.054 -10.900 -6.063  1.00 0.00 ? 13  GLN A N    8  
ATOM   8311  C  CA   . GLN A 1 13 ? -22.598 -10.870 -5.977  1.00 0.00 ? 13  GLN A CA   8  
ATOM   8312  C  C    . GLN A 1 13 ? -22.140 -10.009 -4.805  1.00 0.00 ? 13  GLN A C    8  
ATOM   8313  O  O    . GLN A 1 13 ? -22.728 -8.966  -4.519  1.00 0.00 ? 13  GLN A O    8  
ATOM   8314  C  CB   . GLN A 1 13 ? -22.001 -10.336 -7.281  1.00 0.00 ? 13  GLN A CB   8  
ATOM   8315  C  CG   . GLN A 1 13 ? -20.482 -10.276 -7.274  1.00 0.00 ? 13  GLN A CG   8  
ATOM   8316  C  CD   . GLN A 1 13 ? -19.911 -9.814  -8.600  1.00 0.00 ? 13  GLN A CD   8  
ATOM   8317  O  OE1  . GLN A 1 13 ? -20.196 -8.708  -9.060  1.00 0.00 ? 13  GLN A OE1  8  
ATOM   8318  N  NE2  . GLN A 1 13 ? -19.099 -10.661 -9.223  1.00 0.00 ? 13  GLN A NE2  8  
ATOM   8319  H  H    . GLN A 1 13 ? -24.562 -10.091 -5.850  1.00 0.00 ? 13  GLN A H    8  
ATOM   8320  H  HA   . GLN A 1 13 ? -22.254 -11.881 -5.822  1.00 0.00 ? 13  GLN A HA   8  
ATOM   8321  H  HB2  . GLN A 1 13 ? -22.312 -10.975 -8.093  1.00 0.00 ? 13  GLN A HB2  8  
ATOM   8322  H  HB3  . GLN A 1 13 ? -22.378 -9.339  -7.453  1.00 0.00 ? 13  GLN A HB3  8  
ATOM   8323  H  HG2  . GLN A 1 13 ? -20.165 -9.589  -6.504  1.00 0.00 ? 13  GLN A HG2  8  
ATOM   8324  H  HG3  . GLN A 1 13 ? -20.097 -11.262 -7.057  1.00 0.00 ? 13  GLN A HG3  8  
ATOM   8325  H  HE21 . GLN A 1 13 ? -18.919 -11.526 -8.797  1.00 0.00 ? 13  GLN A HE21 8  
ATOM   8326  H  HE22 . GLN A 1 13 ? -18.717 -10.388 -10.082 1.00 0.00 ? 13  GLN A HE22 8  
ATOM   8327  N  N    . LYS A 1 14 ? -21.086 -10.454 -4.127  1.00 0.00 ? 14  LYS A N    8  
ATOM   8328  C  CA   . LYS A 1 14 ? -20.547 -9.725  -2.986  1.00 0.00 ? 14  LYS A CA   8  
ATOM   8329  C  C    . LYS A 1 14 ? -19.195 -9.105  -3.324  1.00 0.00 ? 14  LYS A C    8  
ATOM   8330  O  O    . LYS A 1 14 ? -18.321 -9.767  -3.886  1.00 0.00 ? 14  LYS A O    8  
ATOM   8331  C  CB   . LYS A 1 14 ? -20.405 -10.657 -1.780  1.00 0.00 ? 14  LYS A CB   8  
ATOM   8332  C  CG   . LYS A 1 14 ? -20.382 -9.929  -0.447  1.00 0.00 ? 14  LYS A CG   8  
ATOM   8333  C  CD   . LYS A 1 14 ? -21.771 -9.466  -0.041  1.00 0.00 ? 14  LYS A CD   8  
ATOM   8334  C  CE   . LYS A 1 14 ? -22.505 -10.536 0.751   1.00 0.00 ? 14  LYS A CE   8  
ATOM   8335  N  NZ   . LYS A 1 14 ? -23.300 -11.434 -0.133  1.00 0.00 ? 14  LYS A NZ   8  
ATOM   8336  H  H    . LYS A 1 14 ? -20.660 -11.293 -4.404  1.00 0.00 ? 14  LYS A H    8  
ATOM   8337  H  HA   . LYS A 1 14 ? -21.240 -8.935  -2.739  1.00 0.00 ? 14  LYS A HA   8  
ATOM   8338  H  HB2  . LYS A 1 14 ? -21.236 -11.348 -1.775  1.00 0.00 ? 14  LYS A HB2  8  
ATOM   8339  H  HB3  . LYS A 1 14 ? -19.485 -11.215 -1.878  1.00 0.00 ? 14  LYS A HB3  8  
ATOM   8340  H  HG2  . LYS A 1 14 ? -20.000 -10.596 0.311   1.00 0.00 ? 14  LYS A HG2  8  
ATOM   8341  H  HG3  . LYS A 1 14 ? -19.735 -9.067  -0.530  1.00 0.00 ? 14  LYS A HG3  8  
ATOM   8342  H  HD2  . LYS A 1 14 ? -21.681 -8.580  0.571   1.00 0.00 ? 14  LYS A HD2  8  
ATOM   8343  H  HD3  . LYS A 1 14 ? -22.339 -9.235  -0.931  1.00 0.00 ? 14  LYS A HD3  8  
ATOM   8344  H  HE2  . LYS A 1 14 ? -21.781 -11.127 1.292   1.00 0.00 ? 14  LYS A HE2  8  
ATOM   8345  H  HE3  . LYS A 1 14 ? -23.171 -10.054 1.452   1.00 0.00 ? 14  LYS A HE3  8  
ATOM   8346  H  HZ1  . LYS A 1 14 ? -23.137 -12.427 0.128   1.00 0.00 ? 14  LYS A HZ1  8  
ATOM   8347  H  HZ2  . LYS A 1 14 ? -23.019 -11.297 -1.125  1.00 0.00 ? 14  LYS A HZ2  8  
ATOM   8348  H  HZ3  . LYS A 1 14 ? -24.313 -11.223 -0.039  1.00 0.00 ? 14  LYS A HZ3  8  
ATOM   8349  N  N    . LEU A 1 15 ? -19.029 -7.834  -2.979  1.00 0.00 ? 15  LEU A N    8  
ATOM   8350  C  CA   . LEU A 1 15 ? -17.782 -7.125  -3.246  1.00 0.00 ? 15  LEU A CA   8  
ATOM   8351  C  C    . LEU A 1 15 ? -16.641 -7.699  -2.412  1.00 0.00 ? 15  LEU A C    8  
ATOM   8352  O  O    . LEU A 1 15 ? -16.852 -8.321  -1.370  1.00 0.00 ? 15  LEU A O    8  
ATOM   8353  C  CB   . LEU A 1 15 ? -17.946 -5.634  -2.948  1.00 0.00 ? 15  LEU A CB   8  
ATOM   8354  C  CG   . LEU A 1 15 ? -19.361 -5.071  -3.097  1.00 0.00 ? 15  LEU A CG   8  
ATOM   8355  C  CD1  . LEU A 1 15 ? -20.073 -5.723  -4.272  1.00 0.00 ? 15  LEU A CD1  8  
ATOM   8356  C  CD2  . LEU A 1 15 ? -20.152 -5.272  -1.813  1.00 0.00 ? 15  LEU A CD2  8  
ATOM   8357  H  H    . LEU A 1 15 ? -19.762 -7.359  -2.535  1.00 0.00 ? 15  LEU A H    8  
ATOM   8358  H  HA   . LEU A 1 15 ? -17.546 -7.251  -4.292  1.00 0.00 ? 15  LEU A HA   8  
ATOM   8359  H  HB2  . LEU A 1 15 ? -17.628 -5.462  -1.932  1.00 0.00 ? 15  LEU A HB2  8  
ATOM   8360  H  HB3  . LEU A 1 15 ? -17.300 -5.090  -3.623  1.00 0.00 ? 15  LEU A HB3  8  
ATOM   8361  H  HG   . LEU A 1 15 ? -19.300 -4.009  -3.292  1.00 0.00 ? 15  LEU A HG   8  
ATOM   8362  H  HD11 . LEU A 1 15 ? -19.355 -6.250  -4.881  1.00 0.00 ? 15  LEU A HD11 8  
ATOM   8363  H  HD12 . LEU A 1 15 ? -20.559 -4.962  -4.865  1.00 0.00 ? 15  LEU A HD12 8  
ATOM   8364  H  HD13 . LEU A 1 15 ? -20.813 -6.418  -3.903  1.00 0.00 ? 15  LEU A HD13 8  
ATOM   8365  H  HD21 . LEU A 1 15 ? -20.371 -4.311  -1.372  1.00 0.00 ? 15  LEU A HD21 8  
ATOM   8366  H  HD22 . LEU A 1 15 ? -19.570 -5.862  -1.120  1.00 0.00 ? 15  LEU A HD22 8  
ATOM   8367  H  HD23 . LEU A 1 15 ? -21.076 -5.785  -2.036  1.00 0.00 ? 15  LEU A HD23 8  
ATOM   8368  N  N    . PRO A 1 16 ? -15.401 -7.484  -2.877  1.00 0.00 ? 16  PRO A N    8  
ATOM   8369  C  CA   . PRO A 1 16 ? -14.202 -7.969  -2.188  1.00 0.00 ? 16  PRO A CA   8  
ATOM   8370  C  C    . PRO A 1 16 ? -13.945 -7.228  -0.880  1.00 0.00 ? 16  PRO A C    8  
ATOM   8371  O  O    . PRO A 1 16 ? -13.596 -6.048  -0.883  1.00 0.00 ? 16  PRO A O    8  
ATOM   8372  C  CB   . PRO A 1 16 ? -13.079 -7.689  -3.190  1.00 0.00 ? 16  PRO A CB   8  
ATOM   8373  C  CG   . PRO A 1 16 ? -13.586 -6.562  -4.021  1.00 0.00 ? 16  PRO A CG   8  
ATOM   8374  C  CD   . PRO A 1 16 ? -15.075 -6.750  -4.111  1.00 0.00 ? 16  PRO A CD   8  
ATOM   8375  H  HA   . PRO A 1 16 ? -14.258 -9.030  -1.994  1.00 0.00 ? 16  PRO A HA   8  
ATOM   8376  H  HB2  . PRO A 1 16 ? -12.179 -7.416  -2.658  1.00 0.00 ? 16  PRO A HB2  8  
ATOM   8377  H  HB3  . PRO A 1 16 ? -12.898 -8.570  -3.788  1.00 0.00 ? 16  PRO A HB3  8  
ATOM   8378  H  HG2  . PRO A 1 16 ? -13.355 -5.621  -3.545  1.00 0.00 ? 16  PRO A HG2  8  
ATOM   8379  H  HG3  . PRO A 1 16 ? -13.143 -6.604  -5.006  1.00 0.00 ? 16  PRO A HG3  8  
ATOM   8380  H  HD2  . PRO A 1 16 ? -15.576 -5.793  -4.135  1.00 0.00 ? 16  PRO A HD2  8  
ATOM   8381  H  HD3  . PRO A 1 16 ? -15.330 -7.333  -4.984  1.00 0.00 ? 16  PRO A HD3  8  
ATOM   8382  N  N    . MET A 1 17 ? -14.120 -7.928  0.236   1.00 0.00 ? 17  MET A N    8  
ATOM   8383  C  CA   . MET A 1 17 ? -13.905 -7.336  1.551   1.00 0.00 ? 17  MET A CA   8  
ATOM   8384  C  C    . MET A 1 17 ? -12.501 -6.750  1.661   1.00 0.00 ? 17  MET A C    8  
ATOM   8385  O  O    . MET A 1 17 ? -11.507 -7.461  1.507   1.00 0.00 ? 17  MET A O    8  
ATOM   8386  C  CB   . MET A 1 17 ? -14.121 -8.382  2.647   1.00 0.00 ? 17  MET A CB   8  
ATOM   8387  C  CG   . MET A 1 17 ? -15.586 -8.648  2.952   1.00 0.00 ? 17  MET A CG   8  
ATOM   8388  S  SD   . MET A 1 17 ? -15.827 -9.466  4.541   1.00 0.00 ? 17  MET A SD   8  
ATOM   8389  C  CE   . MET A 1 17 ? -17.236 -8.561  5.178   1.00 0.00 ? 17  MET A CE   8  
ATOM   8390  H  H    . MET A 1 17 ? -14.399 -8.865  0.174   1.00 0.00 ? 17  MET A H    8  
ATOM   8391  H  HA   . MET A 1 17 ? -14.625 -6.541  1.678   1.00 0.00 ? 17  MET A HA   8  
ATOM   8392  H  HB2  . MET A 1 17 ? -13.666 -9.310  2.336   1.00 0.00 ? 17  MET A HB2  8  
ATOM   8393  H  HB3  . MET A 1 17 ? -13.643 -8.041  3.553   1.00 0.00 ? 17  MET A HB3  8  
ATOM   8394  H  HG2  . MET A 1 17 ? -16.115 -7.706  2.966   1.00 0.00 ? 17  MET A HG2  8  
ATOM   8395  H  HG3  . MET A 1 17 ? -15.994 -9.276  2.174   1.00 0.00 ? 17  MET A HG3  8  
ATOM   8396  H  HE1  . MET A 1 17 ? -16.911 -7.597  5.539   1.00 0.00 ? 17  MET A HE1  8  
ATOM   8397  H  HE2  . MET A 1 17 ? -17.962 -8.425  4.390   1.00 0.00 ? 17  MET A HE2  8  
ATOM   8398  H  HE3  . MET A 1 17 ? -17.683 -9.118  5.989   1.00 0.00 ? 17  MET A HE3  8  
ATOM   8399  N  N    . CYS A 1 18 ? -12.426 -5.450  1.928   1.00 0.00 ? 18  CYS A N    8  
ATOM   8400  C  CA   . CYS A 1 18 ? -11.144 -4.769  2.057   1.00 0.00 ? 18  CYS A CA   8  
ATOM   8401  C  C    . CYS A 1 18 ? -10.253 -5.474  3.076   1.00 0.00 ? 18  CYS A C    8  
ATOM   8402  O  O    . CYS A 1 18 ? -10.696 -5.813  4.173   1.00 0.00 ? 18  CYS A O    8  
ATOM   8403  C  CB   . CYS A 1 18 ? -11.357 -3.312  2.472   1.00 0.00 ? 18  CYS A CB   8  
ATOM   8404  S  SG   . CYS A 1 18 ? -9.814  -2.395  2.786   1.00 0.00 ? 18  CYS A SG   8  
ATOM   8405  H  H    . CYS A 1 18 ? -13.254 -4.936  2.040   1.00 0.00 ? 18  CYS A H    8  
ATOM   8406  H  HA   . CYS A 1 18 ? -10.657 -4.792  1.094   1.00 0.00 ? 18  CYS A HA   8  
ATOM   8407  H  HB2  . CYS A 1 18 ? -11.891 -2.796  1.687   1.00 0.00 ? 18  CYS A HB2  8  
ATOM   8408  H  HB3  . CYS A 1 18 ? -11.945 -3.286  3.378   1.00 0.00 ? 18  CYS A HB3  8  
ATOM   8409  N  N    . ASP A 1 19 ? -8.997  -5.692  2.704   1.00 0.00 ? 19  ASP A N    8  
ATOM   8410  C  CA   . ASP A 1 19 ? -8.043  -6.356  3.585   1.00 0.00 ? 19  ASP A CA   8  
ATOM   8411  C  C    . ASP A 1 19 ? -7.733  -5.489  4.802   1.00 0.00 ? 19  ASP A C    8  
ATOM   8412  O  O    . ASP A 1 19 ? -7.573  -5.995  5.913   1.00 0.00 ? 19  ASP A O    8  
ATOM   8413  C  CB   . ASP A 1 19 ? -6.752  -6.673  2.827   1.00 0.00 ? 19  ASP A CB   8  
ATOM   8414  C  CG   . ASP A 1 19 ? -5.921  -7.736  3.519   1.00 0.00 ? 19  ASP A CG   8  
ATOM   8415  O  OD1  . ASP A 1 19 ? -5.746  -7.643  4.753   1.00 0.00 ? 19  ASP A OD1  8  
ATOM   8416  O  OD2  . ASP A 1 19 ? -5.447  -8.661  2.828   1.00 0.00 ? 19  ASP A OD2  8  
ATOM   8417  H  H    . ASP A 1 19 ? -8.703  -5.398  1.816   1.00 0.00 ? 19  ASP A H    8  
ATOM   8418  H  HA   . ASP A 1 19 ? -8.489  -7.280  3.921   1.00 0.00 ? 19  ASP A HA   8  
ATOM   8419  H  HB2  . ASP A 1 19 ? -7.001  -7.026  1.837   1.00 0.00 ? 19  ASP A HB2  8  
ATOM   8420  H  HB3  . ASP A 1 19 ? -6.160  -5.774  2.746   1.00 0.00 ? 19  ASP A HB3  8  
ATOM   8421  N  N    . LYS A 1 20 ? -7.648  -4.181  4.584   1.00 0.00 ? 20  LYS A N    8  
ATOM   8422  C  CA   . LYS A 1 20 ? -7.358  -3.243  5.662   1.00 0.00 ? 20  LYS A CA   8  
ATOM   8423  C  C    . LYS A 1 20 ? -8.406  -3.341  6.766   1.00 0.00 ? 20  LYS A C    8  
ATOM   8424  O  O    . LYS A 1 20 ? -8.092  -3.692  7.904   1.00 0.00 ? 20  LYS A O    8  
ATOM   8425  C  CB   . LYS A 1 20 ? -7.305  -1.813  5.120   1.00 0.00 ? 20  LYS A CB   8  
ATOM   8426  C  CG   . LYS A 1 20 ? -7.014  -0.770  6.185   1.00 0.00 ? 20  LYS A CG   8  
ATOM   8427  C  CD   . LYS A 1 20 ? -5.525  -0.486  6.296   1.00 0.00 ? 20  LYS A CD   8  
ATOM   8428  C  CE   . LYS A 1 20 ? -5.262  0.890   6.887   1.00 0.00 ? 20  LYS A CE   8  
ATOM   8429  N  NZ   . LYS A 1 20 ? -5.681  0.970   8.314   1.00 0.00 ? 20  LYS A NZ   8  
ATOM   8430  H  H    . LYS A 1 20 ? -7.786  -3.838  3.676   1.00 0.00 ? 20  LYS A H    8  
ATOM   8431  H  HA   . LYS A 1 20 ? -6.393  -3.499  6.074   1.00 0.00 ? 20  LYS A HA   8  
ATOM   8432  H  HB2  . LYS A 1 20 ? -6.532  -1.754  4.368   1.00 0.00 ? 20  LYS A HB2  8  
ATOM   8433  H  HB3  . LYS A 1 20 ? -8.256  -1.577  4.666   1.00 0.00 ? 20  LYS A HB3  8  
ATOM   8434  H  HG2  . LYS A 1 20 ? -7.525  0.146   5.929   1.00 0.00 ? 20  LYS A HG2  8  
ATOM   8435  H  HG3  . LYS A 1 20 ? -7.374  -1.131  7.138   1.00 0.00 ? 20  LYS A HG3  8  
ATOM   8436  H  HD2  . LYS A 1 20 ? -5.072  -1.231  6.933   1.00 0.00 ? 20  LYS A HD2  8  
ATOM   8437  H  HD3  . LYS A 1 20 ? -5.084  -0.536  5.311   1.00 0.00 ? 20  LYS A HD3  8  
ATOM   8438  H  HE2  . LYS A 1 20 ? -4.206  1.102   6.818   1.00 0.00 ? 20  LYS A HE2  8  
ATOM   8439  H  HE3  . LYS A 1 20 ? -5.814  1.623   6.317   1.00 0.00 ? 20  LYS A HE3  8  
ATOM   8440  H  HZ1  . LYS A 1 20 ? -6.241  0.132   8.569   1.00 0.00 ? 20  LYS A HZ1  8  
ATOM   8441  H  HZ2  . LYS A 1 20 ? -6.259  1.820   8.470   1.00 0.00 ? 20  LYS A HZ2  8  
ATOM   8442  H  HZ3  . LYS A 1 20 ? -4.844  1.015   8.930   1.00 0.00 ? 20  LYS A HZ3  8  
ATOM   8443  N  N    . CYS A 1 21 ? -9.651  -3.031  6.422   1.00 0.00 ? 21  CYS A N    8  
ATOM   8444  C  CA   . CYS A 1 21 ? -10.746 -3.085  7.383   1.00 0.00 ? 21  CYS A CA   8  
ATOM   8445  C  C    . CYS A 1 21 ? -11.466 -4.429  7.313   1.00 0.00 ? 21  CYS A C    8  
ATOM   8446  O  O    . CYS A 1 21 ? -11.383 -5.238  8.236   1.00 0.00 ? 21  CYS A O    8  
ATOM   8447  C  CB   . CYS A 1 21 ? -11.737 -1.949  7.123   1.00 0.00 ? 21  CYS A CB   8  
ATOM   8448  S  SG   . CYS A 1 21 ? -11.920 -1.510  5.365   1.00 0.00 ? 21  CYS A SG   8  
ATOM   8449  H  H    . CYS A 1 21 ? -9.839  -2.759  5.499   1.00 0.00 ? 21  CYS A H    8  
ATOM   8450  H  HA   . CYS A 1 21 ? -10.327 -2.967  8.371   1.00 0.00 ? 21  CYS A HA   8  
ATOM   8451  H  HB2  . CYS A 1 21 ? -12.711 -2.240  7.491   1.00 0.00 ? 21  CYS A HB2  8  
ATOM   8452  H  HB3  . CYS A 1 21 ? -11.408 -1.067  7.651   1.00 0.00 ? 21  CYS A HB3  8  
ATOM   8453  N  N    . GLY A 1 22 ? -12.171 -4.660  6.210   1.00 0.00 ? 22  GLY A N    8  
ATOM   8454  C  CA   . GLY A 1 22 ? -12.895 -5.906  6.039   1.00 0.00 ? 22  GLY A CA   8  
ATOM   8455  C  C    . GLY A 1 22 ? -14.359 -5.686  5.713   1.00 0.00 ? 22  GLY A C    8  
ATOM   8456  O  O    . GLY A 1 22 ? -15.240 -6.262  6.353   1.00 0.00 ? 22  GLY A O    8  
ATOM   8457  H  H    . GLY A 1 22 ? -12.201 -3.977  5.507   1.00 0.00 ? 22  GLY A H    8  
ATOM   8458  H  HA2  . GLY A 1 22 ? -12.439 -6.467  5.238   1.00 0.00 ? 22  GLY A HA2  8  
ATOM   8459  H  HA3  . GLY A 1 22 ? -12.824 -6.478  6.952   1.00 0.00 ? 22  GLY A HA3  8  
ATOM   8460  N  N    . THR A 1 23 ? -14.622 -4.849  4.714   1.00 0.00 ? 23  THR A N    8  
ATOM   8461  C  CA   . THR A 1 23 ? -15.989 -4.552  4.306   1.00 0.00 ? 23  THR A CA   8  
ATOM   8462  C  C    . THR A 1 23 ? -16.126 -4.568  2.787   1.00 0.00 ? 23  THR A C    8  
ATOM   8463  O  O    . THR A 1 23 ? -15.250 -4.085  2.071   1.00 0.00 ? 23  THR A O    8  
ATOM   8464  C  CB   . THR A 1 23 ? -16.449 -3.181  4.836   1.00 0.00 ? 23  THR A CB   8  
ATOM   8465  O  OG1  . THR A 1 23 ? -15.443 -2.194  4.580   1.00 0.00 ? 23  THR A OG1  8  
ATOM   8466  C  CG2  . THR A 1 23 ? -16.734 -3.246  6.329   1.00 0.00 ? 23  THR A CG2  8  
ATOM   8467  H  H    . THR A 1 23 ? -13.878 -4.421  4.242   1.00 0.00 ? 23  THR A H    8  
ATOM   8468  H  HA   . THR A 1 23 ? -16.635 -5.311  4.724   1.00 0.00 ? 23  THR A HA   8  
ATOM   8469  H  HB   . THR A 1 23 ? -17.358 -2.900  4.323   1.00 0.00 ? 23  THR A HB   8  
ATOM   8470  H  HG1  . THR A 1 23 ? -15.158 -1.805  5.410   1.00 0.00 ? 23  THR A HG1  8  
ATOM   8471  H  HG21 . THR A 1 23 ? -17.766 -3.522  6.487   1.00 0.00 ? 23  THR A HG21 8  
ATOM   8472  H  HG22 . THR A 1 23 ? -16.546 -2.280  6.774   1.00 0.00 ? 23  THR A HG22 8  
ATOM   8473  H  HG23 . THR A 1 23 ? -16.091 -3.984  6.786   1.00 0.00 ? 23  THR A HG23 8  
ATOM   8474  N  N    . GLY A 1 24 ? -17.230 -5.127  2.303   1.00 0.00 ? 24  GLY A N    8  
ATOM   8475  C  CA   . GLY A 1 24 ? -17.461 -5.195  0.872   1.00 0.00 ? 24  GLY A CA   8  
ATOM   8476  C  C    . GLY A 1 24 ? -17.119 -3.898  0.167   1.00 0.00 ? 24  GLY A C    8  
ATOM   8477  O  O    . GLY A 1 24 ? -17.775 -2.877  0.378   1.00 0.00 ? 24  GLY A O    8  
ATOM   8478  H  H    . GLY A 1 24 ? -17.894 -5.497  2.922   1.00 0.00 ? 24  GLY A H    8  
ATOM   8479  H  HA2  . GLY A 1 24 ? -16.855 -5.988  0.458   1.00 0.00 ? 24  GLY A HA2  8  
ATOM   8480  H  HA3  . GLY A 1 24 ? -18.502 -5.423  0.697   1.00 0.00 ? 24  GLY A HA3  8  
ATOM   8481  N  N    . ILE A 1 25 ? -16.088 -3.935  -0.671  1.00 0.00 ? 25  ILE A N    8  
ATOM   8482  C  CA   . ILE A 1 25 ? -15.661 -2.752  -1.408  1.00 0.00 ? 25  ILE A CA   8  
ATOM   8483  C  C    . ILE A 1 25 ? -16.619 -2.442  -2.553  1.00 0.00 ? 25  ILE A C    8  
ATOM   8484  O  O    . ILE A 1 25 ? -16.577 -3.083  -3.603  1.00 0.00 ? 25  ILE A O    8  
ATOM   8485  C  CB   . ILE A 1 25 ? -14.240 -2.926  -1.975  1.00 0.00 ? 25  ILE A CB   8  
ATOM   8486  C  CG1  . ILE A 1 25 ? -13.228 -3.077  -0.837  1.00 0.00 ? 25  ILE A CG1  8  
ATOM   8487  C  CG2  . ILE A 1 25 ? -13.875 -1.744  -2.862  1.00 0.00 ? 25  ILE A CG2  8  
ATOM   8488  C  CD1  . ILE A 1 25 ? -11.881 -3.595  -1.291  1.00 0.00 ? 25  ILE A CD1  8  
ATOM   8489  H  H    . ILE A 1 25 ? -15.605 -4.777  -0.797  1.00 0.00 ? 25  ILE A H    8  
ATOM   8490  H  HA   . ILE A 1 25 ? -15.654 -1.917  -0.723  1.00 0.00 ? 25  ILE A HA   8  
ATOM   8491  H  HB   . ILE A 1 25 ? -14.225 -3.818  -2.582  1.00 0.00 ? 25  ILE A HB   8  
ATOM   8492  H  HG12 . ILE A 1 25 ? -13.073 -2.117  -0.371  1.00 0.00 ? 25  ILE A HG12 8  
ATOM   8493  H  HG13 . ILE A 1 25 ? -13.621 -3.769  -0.106  1.00 0.00 ? 25  ILE A HG13 8  
ATOM   8494  H  HG21 . ILE A 1 25 ? -13.022 -1.230  -2.443  1.00 0.00 ? 25  ILE A HG21 8  
ATOM   8495  H  HG22 . ILE A 1 25 ? -13.630 -2.099  -3.851  1.00 0.00 ? 25  ILE A HG22 8  
ATOM   8496  H  HG23 . ILE A 1 25 ? -14.712 -1.065  -2.919  1.00 0.00 ? 25  ILE A HG23 8  
ATOM   8497  H  HD11 . ILE A 1 25 ? -11.217 -3.664  -0.443  1.00 0.00 ? 25  ILE A HD11 8  
ATOM   8498  H  HD12 . ILE A 1 25 ? -12.001 -4.571  -1.736  1.00 0.00 ? 25  ILE A HD12 8  
ATOM   8499  H  HD13 . ILE A 1 25 ? -11.462 -2.917  -2.021  1.00 0.00 ? 25  ILE A HD13 8  
ATOM   8500  N  N    . VAL A 1 26 ? -17.481 -1.452  -2.345  1.00 0.00 ? 26  VAL A N    8  
ATOM   8501  C  CA   . VAL A 1 26 ? -18.448 -1.054  -3.361  1.00 0.00 ? 26  VAL A CA   8  
ATOM   8502  C  C    . VAL A 1 26 ? -17.971 0.178   -4.120  1.00 0.00 ? 26  VAL A C    8  
ATOM   8503  O  O    . VAL A 1 26 ? -17.795 1.249   -3.540  1.00 0.00 ? 26  VAL A O    8  
ATOM   8504  C  CB   . VAL A 1 26 ? -19.826 -0.759  -2.739  1.00 0.00 ? 26  VAL A CB   8  
ATOM   8505  C  CG1  . VAL A 1 26 ? -19.694 0.235   -1.594  1.00 0.00 ? 26  VAL A CG1  8  
ATOM   8506  C  CG2  . VAL A 1 26 ? -20.788 -0.240  -3.797  1.00 0.00 ? 26  VAL A CG2  8  
ATOM   8507  H  H    . VAL A 1 26 ? -17.466 -0.978  -1.487  1.00 0.00 ? 26  VAL A H    8  
ATOM   8508  H  HA   . VAL A 1 26 ? -18.559 -1.874  -4.056  1.00 0.00 ? 26  VAL A HA   8  
ATOM   8509  H  HB   . VAL A 1 26 ? -20.225 -1.681  -2.341  1.00 0.00 ? 26  VAL A HB   8  
ATOM   8510  H  HG11 . VAL A 1 26 ? -19.280 1.160   -1.967  1.00 0.00 ? 26  VAL A HG11 8  
ATOM   8511  H  HG12 . VAL A 1 26 ? -20.667 0.421   -1.165  1.00 0.00 ? 26  VAL A HG12 8  
ATOM   8512  H  HG13 . VAL A 1 26 ? -19.038 -0.173  -0.838  1.00 0.00 ? 26  VAL A HG13 8  
ATOM   8513  H  HG21 . VAL A 1 26 ? -21.705 0.077   -3.324  1.00 0.00 ? 26  VAL A HG21 8  
ATOM   8514  H  HG22 . VAL A 1 26 ? -20.340 0.598   -4.312  1.00 0.00 ? 26  VAL A HG22 8  
ATOM   8515  H  HG23 . VAL A 1 26 ? -21.000 -1.025  -4.507  1.00 0.00 ? 26  VAL A HG23 8  
ATOM   8516  N  N    . GLY A 1 27 ? -17.763 0.019   -5.424  1.00 0.00 ? 27  GLY A N    8  
ATOM   8517  C  CA   . GLY A 1 27 ? -17.309 1.128   -6.243  1.00 0.00 ? 27  GLY A CA   8  
ATOM   8518  C  C    . GLY A 1 27 ? -15.836 1.027   -6.589  1.00 0.00 ? 27  GLY A C    8  
ATOM   8519  O  O    . GLY A 1 27 ? -15.289 -0.070  -6.693  1.00 0.00 ? 27  GLY A O    8  
ATOM   8520  H  H    . GLY A 1 27 ? -17.920 -0.857  -5.833  1.00 0.00 ? 27  GLY A H    8  
ATOM   8521  H  HA2  . GLY A 1 27 ? -17.882 1.144   -7.158  1.00 0.00 ? 27  GLY A HA2  8  
ATOM   8522  H  HA3  . GLY A 1 27 ? -17.478 2.050   -5.707  1.00 0.00 ? 27  GLY A HA3  8  
ATOM   8523  N  N    . VAL A 1 28 ? -15.192 2.176   -6.768  1.00 0.00 ? 28  VAL A N    8  
ATOM   8524  C  CA   . VAL A 1 28 ? -13.774 2.214   -7.105  1.00 0.00 ? 28  VAL A CA   8  
ATOM   8525  C  C    . VAL A 1 28 ? -12.925 1.645   -5.973  1.00 0.00 ? 28  VAL A C    8  
ATOM   8526  O  O    . VAL A 1 28 ? -13.279 1.761   -4.799  1.00 0.00 ? 28  VAL A O    8  
ATOM   8527  C  CB   . VAL A 1 28 ? -13.307 3.649   -7.410  1.00 0.00 ? 28  VAL A CB   8  
ATOM   8528  C  CG1  . VAL A 1 28 ? -13.663 4.582   -6.263  1.00 0.00 ? 28  VAL A CG1  8  
ATOM   8529  C  CG2  . VAL A 1 28 ? -11.811 3.675   -7.685  1.00 0.00 ? 28  VAL A CG2  8  
ATOM   8530  H  H    . VAL A 1 28 ? -15.682 3.019   -6.671  1.00 0.00 ? 28  VAL A H    8  
ATOM   8531  H  HA   . VAL A 1 28 ? -13.625 1.613   -7.990  1.00 0.00 ? 28  VAL A HA   8  
ATOM   8532  H  HB   . VAL A 1 28 ? -13.820 3.992   -8.297  1.00 0.00 ? 28  VAL A HB   8  
ATOM   8533  H  HG11 . VAL A 1 28 ? -14.691 4.420   -5.974  1.00 0.00 ? 28  VAL A HG11 8  
ATOM   8534  H  HG12 . VAL A 1 28 ? -13.016 4.383   -5.422  1.00 0.00 ? 28  VAL A HG12 8  
ATOM   8535  H  HG13 . VAL A 1 28 ? -13.537 5.607   -6.580  1.00 0.00 ? 28  VAL A HG13 8  
ATOM   8536  H  HG21 . VAL A 1 28 ? -11.496 2.710   -8.051  1.00 0.00 ? 28  VAL A HG21 8  
ATOM   8537  H  HG22 . VAL A 1 28 ? -11.594 4.430   -8.427  1.00 0.00 ? 28  VAL A HG22 8  
ATOM   8538  H  HG23 . VAL A 1 28 ? -11.281 3.905   -6.772  1.00 0.00 ? 28  VAL A HG23 8  
ATOM   8539  N  N    . PHE A 1 29 ? -11.804 1.030   -6.333  1.00 0.00 ? 29  PHE A N    8  
ATOM   8540  C  CA   . PHE A 1 29 ? -10.904 0.443   -5.347  1.00 0.00 ? 29  PHE A CA   8  
ATOM   8541  C  C    . PHE A 1 29 ? -9.574  0.054   -5.988  1.00 0.00 ? 29  PHE A C    8  
ATOM   8542  O  O    . PHE A 1 29 ? -9.412  0.134   -7.206  1.00 0.00 ? 29  PHE A O    8  
ATOM   8543  C  CB   . PHE A 1 29 ? -11.550 -0.785  -4.703  1.00 0.00 ? 29  PHE A CB   8  
ATOM   8544  C  CG   . PHE A 1 29 ? -11.794 -1.910  -5.668  1.00 0.00 ? 29  PHE A CG   8  
ATOM   8545  C  CD1  . PHE A 1 29 ? -10.752 -2.723  -6.082  1.00 0.00 ? 29  PHE A CD1  8  
ATOM   8546  C  CD2  . PHE A 1 29 ? -13.066 -2.153  -6.161  1.00 0.00 ? 29  PHE A CD2  8  
ATOM   8547  C  CE1  . PHE A 1 29 ? -10.973 -3.760  -6.969  1.00 0.00 ? 29  PHE A CE1  8  
ATOM   8548  C  CE2  . PHE A 1 29 ? -13.293 -3.188  -7.049  1.00 0.00 ? 29  PHE A CE2  8  
ATOM   8549  C  CZ   . PHE A 1 29 ? -12.245 -3.992  -7.454  1.00 0.00 ? 29  PHE A CZ   8  
ATOM   8550  H  H    . PHE A 1 29 ? -11.576 0.970   -7.284  1.00 0.00 ? 29  PHE A H    8  
ATOM   8551  H  HA   . PHE A 1 29 ? -10.719 1.184   -4.585  1.00 0.00 ? 29  PHE A HA   8  
ATOM   8552  H  HB2  . PHE A 1 29 ? -10.905 -1.154  -3.920  1.00 0.00 ? 29  PHE A HB2  8  
ATOM   8553  H  HB3  . PHE A 1 29 ? -12.500 -0.500  -4.276  1.00 0.00 ? 29  PHE A HB3  8  
ATOM   8554  H  HD1  . PHE A 1 29 ? -9.756  -2.542  -5.703  1.00 0.00 ? 29  PHE A HD1  8  
ATOM   8555  H  HD2  . PHE A 1 29 ? -13.886 -1.525  -5.846  1.00 0.00 ? 29  PHE A HD2  8  
ATOM   8556  H  HE1  . PHE A 1 29 ? -10.151 -4.386  -7.284  1.00 0.00 ? 29  PHE A HE1  8  
ATOM   8557  H  HE2  . PHE A 1 29 ? -14.289 -3.368  -7.427  1.00 0.00 ? 29  PHE A HE2  8  
ATOM   8558  H  HZ   . PHE A 1 29 ? -12.420 -4.801  -8.147  1.00 0.00 ? 29  PHE A HZ   8  
ATOM   8559  N  N    . VAL A 1 30 ? -8.625  -0.366  -5.158  1.00 0.00 ? 30  VAL A N    8  
ATOM   8560  C  CA   . VAL A 1 30 ? -7.309  -0.768  -5.642  1.00 0.00 ? 30  VAL A CA   8  
ATOM   8561  C  C    . VAL A 1 30 ? -7.165  -2.286  -5.646  1.00 0.00 ? 30  VAL A C    8  
ATOM   8562  O  O    . VAL A 1 30 ? -6.993  -2.907  -4.598  1.00 0.00 ? 30  VAL A O    8  
ATOM   8563  C  CB   . VAL A 1 30 ? -6.185  -0.159  -4.784  1.00 0.00 ? 30  VAL A CB   8  
ATOM   8564  C  CG1  . VAL A 1 30 ? -4.831  -0.383  -5.439  1.00 0.00 ? 30  VAL A CG1  8  
ATOM   8565  C  CG2  . VAL A 1 30 ? -6.436  1.324   -4.552  1.00 0.00 ? 30  VAL A CG2  8  
ATOM   8566  H  H    . VAL A 1 30 ? -8.814  -0.408  -4.198  1.00 0.00 ? 30  VAL A H    8  
ATOM   8567  H  HA   . VAL A 1 30 ? -7.200  -0.403  -6.653  1.00 0.00 ? 30  VAL A HA   8  
ATOM   8568  H  HB   . VAL A 1 30 ? -6.183  -0.656  -3.825  1.00 0.00 ? 30  VAL A HB   8  
ATOM   8569  H  HG11 . VAL A 1 30 ? -4.965  -0.924  -6.364  1.00 0.00 ? 30  VAL A HG11 8  
ATOM   8570  H  HG12 . VAL A 1 30 ? -4.367  0.571   -5.643  1.00 0.00 ? 30  VAL A HG12 8  
ATOM   8571  H  HG13 . VAL A 1 30 ? -4.201  -0.956  -4.776  1.00 0.00 ? 30  VAL A HG13 8  
ATOM   8572  H  HG21 . VAL A 1 30 ? -5.540  1.880   -4.784  1.00 0.00 ? 30  VAL A HG21 8  
ATOM   8573  H  HG22 . VAL A 1 30 ? -7.242  1.657   -5.190  1.00 0.00 ? 30  VAL A HG22 8  
ATOM   8574  H  HG23 . VAL A 1 30 ? -6.704  1.487   -3.519  1.00 0.00 ? 30  VAL A HG23 8  
ATOM   8575  N  N    . LYS A 1 31 ? -7.237  -2.878  -6.834  1.00 0.00 ? 31  LYS A N    8  
ATOM   8576  C  CA   . LYS A 1 31 ? -7.112  -4.324  -6.977  1.00 0.00 ? 31  LYS A CA   8  
ATOM   8577  C  C    . LYS A 1 31 ? -5.656  -4.759  -6.854  1.00 0.00 ? 31  LYS A C    8  
ATOM   8578  O  O    . LYS A 1 31 ? -4.839  -4.487  -7.734  1.00 0.00 ? 31  LYS A O    8  
ATOM   8579  C  CB   . LYS A 1 31 ? -7.678  -4.774  -8.325  1.00 0.00 ? 31  LYS A CB   8  
ATOM   8580  C  CG   . LYS A 1 31 ? -7.975  -6.262  -8.394  1.00 0.00 ? 31  LYS A CG   8  
ATOM   8581  C  CD   . LYS A 1 31 ? -6.758  -7.053  -8.841  1.00 0.00 ? 31  LYS A CD   8  
ATOM   8582  C  CE   . LYS A 1 31 ? -6.928  -8.540  -8.567  1.00 0.00 ? 31  LYS A CE   8  
ATOM   8583  N  NZ   . LYS A 1 31 ? -7.563  -9.246  -9.714  1.00 0.00 ? 31  LYS A NZ   8  
ATOM   8584  H  H    . LYS A 1 31 ? -7.375  -2.329  -7.634  1.00 0.00 ? 31  LYS A H    8  
ATOM   8585  H  HA   . LYS A 1 31 ? -7.682  -4.786  -6.185  1.00 0.00 ? 31  LYS A HA   8  
ATOM   8586  H  HB2  . LYS A 1 31 ? -8.595  -4.236  -8.515  1.00 0.00 ? 31  LYS A HB2  8  
ATOM   8587  H  HB3  . LYS A 1 31 ? -6.964  -4.535  -9.100  1.00 0.00 ? 31  LYS A HB3  8  
ATOM   8588  H  HG2  . LYS A 1 31 ? -8.275  -6.606  -7.415  1.00 0.00 ? 31  LYS A HG2  8  
ATOM   8589  H  HG3  . LYS A 1 31 ? -8.779  -6.427  -9.097  1.00 0.00 ? 31  LYS A HG3  8  
ATOM   8590  H  HD2  . LYS A 1 31 ? -6.615  -6.909  -9.902  1.00 0.00 ? 31  LYS A HD2  8  
ATOM   8591  H  HD3  . LYS A 1 31 ? -5.890  -6.695  -8.307  1.00 0.00 ? 31  LYS A HD3  8  
ATOM   8592  H  HE2  . LYS A 1 31 ? -5.956  -8.972  -8.383  1.00 0.00 ? 31  LYS A HE2  8  
ATOM   8593  H  HE3  . LYS A 1 31 ? -7.548  -8.662  -7.692  1.00 0.00 ? 31  LYS A HE3  8  
ATOM   8594  H  HZ1  . LYS A 1 31 ? -7.156  -10.198 -9.817  1.00 0.00 ? 31  LYS A HZ1  8  
ATOM   8595  H  HZ2  . LYS A 1 31 ? -7.401  -8.716  -10.594 1.00 0.00 ? 31  LYS A HZ2  8  
ATOM   8596  H  HZ3  . LYS A 1 31 ? -8.587  -9.333  -9.558  1.00 0.00 ? 31  LYS A HZ3  8  
ATOM   8597  N  N    . LEU A 1 32 ? -5.337  -5.439  -5.757  1.00 0.00 ? 32  LEU A N    8  
ATOM   8598  C  CA   . LEU A 1 32 ? -3.978  -5.914  -5.520  1.00 0.00 ? 32  LEU A CA   8  
ATOM   8599  C  C    . LEU A 1 32 ? -3.724  -7.225  -6.257  1.00 0.00 ? 32  LEU A C    8  
ATOM   8600  O  O    . LEU A 1 32 ? -4.660  -7.902  -6.681  1.00 0.00 ? 32  LEU A O    8  
ATOM   8601  C  CB   . LEU A 1 32 ? -3.737  -6.103  -4.021  1.00 0.00 ? 32  LEU A CB   8  
ATOM   8602  C  CG   . LEU A 1 32 ? -3.716  -4.827  -3.179  1.00 0.00 ? 32  LEU A CG   8  
ATOM   8603  C  CD1  . LEU A 1 32 ? -3.728  -5.166  -1.696  1.00 0.00 ? 32  LEU A CD1  8  
ATOM   8604  C  CD2  . LEU A 1 32 ? -2.500  -3.980  -3.525  1.00 0.00 ? 32  LEU A CD2  8  
ATOM   8605  H  H    . LEU A 1 32 ? -6.031  -5.626  -5.092  1.00 0.00 ? 32  LEU A H    8  
ATOM   8606  H  HA   . LEU A 1 32 ? -3.295  -5.166  -5.895  1.00 0.00 ? 32  LEU A HA   8  
ATOM   8607  H  HB2  . LEU A 1 32 ? -4.521  -6.739  -3.638  1.00 0.00 ? 32  LEU A HB2  8  
ATOM   8608  H  HB3  . LEU A 1 32 ? -2.784  -6.597  -3.900  1.00 0.00 ? 32  LEU A HB3  8  
ATOM   8609  H  HG   . LEU A 1 32 ? -4.602  -4.246  -3.395  1.00 0.00 ? 32  LEU A HG   8  
ATOM   8610  H  HD11 . LEU A 1 32 ? -4.264  -6.090  -1.543  1.00 0.00 ? 32  LEU A HD11 8  
ATOM   8611  H  HD12 . LEU A 1 32 ? -4.214  -4.372  -1.150  1.00 0.00 ? 32  LEU A HD12 8  
ATOM   8612  H  HD13 . LEU A 1 32 ? -2.712  -5.275  -1.344  1.00 0.00 ? 32  LEU A HD13 8  
ATOM   8613  H  HD21 . LEU A 1 32 ? -2.393  -3.926  -4.598  1.00 0.00 ? 32  LEU A HD21 8  
ATOM   8614  H  HD22 . LEU A 1 32 ? -1.615  -4.429  -3.098  1.00 0.00 ? 32  LEU A HD22 8  
ATOM   8615  H  HD23 . LEU A 1 32 ? -2.628  -2.986  -3.125  1.00 0.00 ? 32  LEU A HD23 8  
ATOM   8616  N  N    . ARG A 1 33 ? -2.451  -7.578  -6.403  1.00 0.00 ? 33  ARG A N    8  
ATOM   8617  C  CA   . ARG A 1 33 ? -2.073  -8.809  -7.087  1.00 0.00 ? 33  ARG A CA   8  
ATOM   8618  C  C    . ARG A 1 33 ? -3.122  -9.896  -6.870  1.00 0.00 ? 33  ARG A C    8  
ATOM   8619  O  O    . ARG A 1 33 ? -3.894  -10.217 -7.774  1.00 0.00 ? 33  ARG A O    8  
ATOM   8620  C  CB   . ARG A 1 33 ? -0.709  -9.295  -6.592  1.00 0.00 ? 33  ARG A CB   8  
ATOM   8621  C  CG   . ARG A 1 33 ? 0.463   -8.548  -7.207  1.00 0.00 ? 33  ARG A CG   8  
ATOM   8622  C  CD   . ARG A 1 33 ? 0.934   -7.415  -6.309  1.00 0.00 ? 33  ARG A CD   8  
ATOM   8623  N  NE   . ARG A 1 33 ? 1.475   -6.297  -7.077  1.00 0.00 ? 33  ARG A NE   8  
ATOM   8624  C  CZ   . ARG A 1 33 ? 0.760   -5.582  -7.938  1.00 0.00 ? 33  ARG A CZ   8  
ATOM   8625  N  NH1  . ARG A 1 33 ? -0.519  -5.867  -8.139  1.00 0.00 ? 33  ARG A NH1  8  
ATOM   8626  N  NH2  . ARG A 1 33 ? 1.324   -4.579  -8.600  1.00 0.00 ? 33  ARG A NH2  8  
ATOM   8627  H  H    . ARG A 1 33 ? -1.749  -6.997  -6.043  1.00 0.00 ? 33  ARG A H    8  
ATOM   8628  H  HA   . ARG A 1 33 ? -2.007  -8.595  -8.143  1.00 0.00 ? 33  ARG A HA   8  
ATOM   8629  H  HB2  . ARG A 1 33 ? -0.664  -9.172  -5.520  1.00 0.00 ? 33  ARG A HB2  8  
ATOM   8630  H  HB3  . ARG A 1 33 ? -0.606  -10.343 -6.831  1.00 0.00 ? 33  ARG A HB3  8  
ATOM   8631  H  HG2  . ARG A 1 33 ? 1.280   -9.239  -7.354  1.00 0.00 ? 33  ARG A HG2  8  
ATOM   8632  H  HG3  . ARG A 1 33 ? 0.158   -8.139  -8.159  1.00 0.00 ? 33  ARG A HG3  8  
ATOM   8633  H  HD2  . ARG A 1 33 ? 0.097   -7.065  -5.724  1.00 0.00 ? 33  ARG A HD2  8  
ATOM   8634  H  HD3  . ARG A 1 33 ? 1.701   -7.792  -5.649  1.00 0.00 ? 33  ARG A HD3  8  
ATOM   8635  H  HE   . ARG A 1 33 ? 2.419   -6.069  -6.944  1.00 0.00 ? 33  ARG A HE   8  
ATOM   8636  H  HH11 . ARG A 1 33 ? -0.947  -6.621  -7.642  1.00 0.00 ? 33  ARG A HH11 8  
ATOM   8637  H  HH12 . ARG A 1 33 ? -1.056  -5.326  -8.788  1.00 0.00 ? 33  ARG A HH12 8  
ATOM   8638  H  HH21 . ARG A 1 33 ? 2.288   -4.362  -8.451  1.00 0.00 ? 33  ARG A HH21 8  
ATOM   8639  H  HH22 . ARG A 1 33 ? 0.784   -4.042  -9.248  1.00 0.00 ? 33  ARG A HH22 8  
ATOM   8640  N  N    . ASP A 1 34 ? -3.143  -10.458 -5.667  1.00 0.00 ? 34  ASP A N    8  
ATOM   8641  C  CA   . ASP A 1 34 ? -4.097  -11.509 -5.331  1.00 0.00 ? 34  ASP A CA   8  
ATOM   8642  C  C    . ASP A 1 34 ? -5.015  -11.065 -4.196  1.00 0.00 ? 34  ASP A C    8  
ATOM   8643  O  O    . ASP A 1 34 ? -5.746  -11.874 -3.624  1.00 0.00 ? 34  ASP A O    8  
ATOM   8644  C  CB   . ASP A 1 34 ? -3.360  -12.789 -4.936  1.00 0.00 ? 34  ASP A CB   8  
ATOM   8645  C  CG   . ASP A 1 34 ? -2.414  -13.270 -6.019  1.00 0.00 ? 34  ASP A CG   8  
ATOM   8646  O  OD1  . ASP A 1 34 ? -2.734  -13.081 -7.212  1.00 0.00 ? 34  ASP A OD1  8  
ATOM   8647  O  OD2  . ASP A 1 34 ? -1.356  -13.836 -5.675  1.00 0.00 ? 34  ASP A OD2  8  
ATOM   8648  H  H    . ASP A 1 34 ? -2.502  -10.159 -4.988  1.00 0.00 ? 34  ASP A H    8  
ATOM   8649  H  HA   . ASP A 1 34 ? -4.697  -11.705 -6.206  1.00 0.00 ? 34  ASP A HA   8  
ATOM   8650  H  HB2  . ASP A 1 34 ? -2.786  -12.605 -4.039  1.00 0.00 ? 34  ASP A HB2  8  
ATOM   8651  H  HB3  . ASP A 1 34 ? -4.083  -13.568 -4.742  1.00 0.00 ? 34  ASP A HB3  8  
ATOM   8652  N  N    . ARG A 1 35 ? -4.972  -9.776  -3.875  1.00 0.00 ? 35  ARG A N    8  
ATOM   8653  C  CA   . ARG A 1 35 ? -5.798  -9.226  -2.807  1.00 0.00 ? 35  ARG A CA   8  
ATOM   8654  C  C    . ARG A 1 35 ? -6.567  -8.000  -3.291  1.00 0.00 ? 35  ARG A C    8  
ATOM   8655  O  O    . ARG A 1 35 ? -6.369  -7.534  -4.414  1.00 0.00 ? 35  ARG A O    8  
ATOM   8656  C  CB   . ARG A 1 35 ? -4.931  -8.855  -1.603  1.00 0.00 ? 35  ARG A CB   8  
ATOM   8657  C  CG   . ARG A 1 35 ? -4.290  -10.053 -0.921  1.00 0.00 ? 35  ARG A CG   8  
ATOM   8658  C  CD   . ARG A 1 35 ? -5.306  -10.843 -0.111  1.00 0.00 ? 35  ARG A CD   8  
ATOM   8659  N  NE   . ARG A 1 35 ? -4.888  -12.228 0.089   1.00 0.00 ? 35  ARG A NE   8  
ATOM   8660  C  CZ   . ARG A 1 35 ? -4.073  -12.616 1.063   1.00 0.00 ? 35  ARG A CZ   8  
ATOM   8661  N  NH1  . ARG A 1 35 ? -3.591  -11.728 1.922   1.00 0.00 ? 35  ARG A NH1  8  
ATOM   8662  N  NH2  . ARG A 1 35 ? -3.739  -13.895 1.181   1.00 0.00 ? 35  ARG A NH2  8  
ATOM   8663  H  H    . ARG A 1 35 ? -4.369  -9.181  -4.368  1.00 0.00 ? 35  ARG A H    8  
ATOM   8664  H  HA   . ARG A 1 35 ? -6.505  -9.986  -2.510  1.00 0.00 ? 35  ARG A HA   8  
ATOM   8665  H  HB2  . ARG A 1 35 ? -4.144  -8.192  -1.930  1.00 0.00 ? 35  ARG A HB2  8  
ATOM   8666  H  HB3  . ARG A 1 35 ? -5.545  -8.342  -0.878  1.00 0.00 ? 35  ARG A HB3  8  
ATOM   8667  H  HG2  . ARG A 1 35 ? -3.866  -10.700 -1.675  1.00 0.00 ? 35  ARG A HG2  8  
ATOM   8668  H  HG3  . ARG A 1 35 ? -3.509  -9.705  -0.262  1.00 0.00 ? 35  ARG A HG3  8  
ATOM   8669  H  HD2  . ARG A 1 35 ? -5.425  -10.370 0.852   1.00 0.00 ? 35  ARG A HD2  8  
ATOM   8670  H  HD3  . ARG A 1 35 ? -6.250  -10.834 -0.636  1.00 0.00 ? 35  ARG A HD3  8  
ATOM   8671  H  HE   . ARG A 1 35 ? -5.233  -12.901 -0.534  1.00 0.00 ? 35  ARG A HE   8  
ATOM   8672  H  HH11 . ARG A 1 35 ? -3.841  -10.764 1.836   1.00 0.00 ? 35  ARG A HH11 8  
ATOM   8673  H  HH12 . ARG A 1 35 ? -2.978  -12.023 2.655   1.00 0.00 ? 35  ARG A HH12 8  
ATOM   8674  H  HH21 . ARG A 1 35 ? -4.101  -14.567 0.536   1.00 0.00 ? 35  ARG A HH21 8  
ATOM   8675  H  HH22 . ARG A 1 35 ? -3.125  -14.186 1.914   1.00 0.00 ? 35  ARG A HH22 8  
ATOM   8676  N  N    . HIS A 1 36 ? -7.445  -7.484  -2.438  1.00 0.00 ? 36  HIS A N    8  
ATOM   8677  C  CA   . HIS A 1 36 ? -8.244  -6.312  -2.778  1.00 0.00 ? 36  HIS A CA   8  
ATOM   8678  C  C    . HIS A 1 36 ? -8.376  -5.377  -1.579  1.00 0.00 ? 36  HIS A C    8  
ATOM   8679  O  O    . HIS A 1 36 ? -8.565  -5.826  -0.449  1.00 0.00 ? 36  HIS A O    8  
ATOM   8680  C  CB   . HIS A 1 36 ? -9.630  -6.737  -3.263  1.00 0.00 ? 36  HIS A CB   8  
ATOM   8681  C  CG   . HIS A 1 36 ? -9.597  -7.615  -4.476  1.00 0.00 ? 36  HIS A CG   8  
ATOM   8682  N  ND1  . HIS A 1 36 ? -9.346  -8.969  -4.419  1.00 0.00 ? 36  HIS A ND1  8  
ATOM   8683  C  CD2  . HIS A 1 36 ? -9.787  -7.324  -5.785  1.00 0.00 ? 36  HIS A CD2  8  
ATOM   8684  C  CE1  . HIS A 1 36 ? -9.382  -9.474  -5.639  1.00 0.00 ? 36  HIS A CE1  8  
ATOM   8685  N  NE2  . HIS A 1 36 ? -9.648  -8.496  -6.487  1.00 0.00 ? 36  HIS A NE2  8  
ATOM   8686  H  H    . HIS A 1 36 ? -7.558  -7.900  -1.558  1.00 0.00 ? 36  HIS A H    8  
ATOM   8687  H  HA   . HIS A 1 36 ? -7.739  -5.786  -3.574  1.00 0.00 ? 36  HIS A HA   8  
ATOM   8688  H  HB2  . HIS A 1 36 ? -10.129 -7.281  -2.475  1.00 0.00 ? 36  HIS A HB2  8  
ATOM   8689  H  HB3  . HIS A 1 36 ? -10.206 -5.855  -3.506  1.00 0.00 ? 36  HIS A HB3  8  
ATOM   8690  H  HD1  . HIS A 1 36 ? -9.167  -9.484  -3.605  1.00 0.00 ? 36  HIS A HD1  8  
ATOM   8691  H  HD2  . HIS A 1 36 ? -10.007 -6.350  -6.201  1.00 0.00 ? 36  HIS A HD2  8  
ATOM   8692  H  HE1  . HIS A 1 36 ? -9.221  -10.509 -5.901  1.00 0.00 ? 36  HIS A HE1  8  
ATOM   8693  H  HE2  . HIS A 1 36 ? -9.646  -8.579  -7.463  1.00 0.00 ? 36  HIS A HE2  8  
ATOM   8694  N  N    . ARG A 1 37 ? -8.274  -4.077  -1.835  1.00 0.00 ? 37  ARG A N    8  
ATOM   8695  C  CA   . ARG A 1 37 ? -8.380  -3.080  -0.777  1.00 0.00 ? 37  ARG A CA   8  
ATOM   8696  C  C    . ARG A 1 37 ? -9.048  -1.809  -1.292  1.00 0.00 ? 37  ARG A C    8  
ATOM   8697  O  O    . ARG A 1 37 ? -9.089  -1.562  -2.498  1.00 0.00 ? 37  ARG A O    8  
ATOM   8698  C  CB   . ARG A 1 37 ? -6.995  -2.750  -0.217  1.00 0.00 ? 37  ARG A CB   8  
ATOM   8699  C  CG   . ARG A 1 37 ? -6.589  -3.623  0.959   1.00 0.00 ? 37  ARG A CG   8  
ATOM   8700  C  CD   . ARG A 1 37 ? -5.515  -2.955  1.804   1.00 0.00 ? 37  ARG A CD   8  
ATOM   8701  N  NE   . ARG A 1 37 ? -4.691  -3.931  2.512   1.00 0.00 ? 37  ARG A NE   8  
ATOM   8702  C  CZ   . ARG A 1 37 ? -4.025  -3.658  3.629   1.00 0.00 ? 37  ARG A CZ   8  
ATOM   8703  N  NH1  . ARG A 1 37 ? -4.087  -2.446  4.162   1.00 0.00 ? 37  ARG A NH1  8  
ATOM   8704  N  NH2  . ARG A 1 37 ? -3.296  -4.599  4.215   1.00 0.00 ? 37  ARG A NH2  8  
ATOM   8705  H  H    . ARG A 1 37 ? -8.123  -3.781  -2.757  1.00 0.00 ? 37  ARG A H    8  
ATOM   8706  H  HA   . ARG A 1 37 ? -8.987  -3.497  0.013   1.00 0.00 ? 37  ARG A HA   8  
ATOM   8707  H  HB2  . ARG A 1 37 ? -6.263  -2.877  -1.001  1.00 0.00 ? 37  ARG A HB2  8  
ATOM   8708  H  HB3  . ARG A 1 37 ? -6.987  -1.720  0.107   1.00 0.00 ? 37  ARG A HB3  8  
ATOM   8709  H  HG2  . ARG A 1 37 ? -7.456  -3.805  1.576   1.00 0.00 ? 37  ARG A HG2  8  
ATOM   8710  H  HG3  . ARG A 1 37 ? -6.208  -4.561  0.584   1.00 0.00 ? 37  ARG A HG3  8  
ATOM   8711  H  HD2  . ARG A 1 37 ? -4.883  -2.365  1.158   1.00 0.00 ? 37  ARG A HD2  8  
ATOM   8712  H  HD3  . ARG A 1 37 ? -5.994  -2.311  2.526   1.00 0.00 ? 37  ARG A HD3  8  
ATOM   8713  H  HE   . ARG A 1 37 ? -4.631  -4.833  2.135   1.00 0.00 ? 37  ARG A HE   8  
ATOM   8714  H  HH11 . ARG A 1 37 ? -4.637  -1.735  3.723   1.00 0.00 ? 37  ARG A HH11 8  
ATOM   8715  H  HH12 . ARG A 1 37 ? -3.586  -2.243  5.004   1.00 0.00 ? 37  ARG A HH12 8  
ATOM   8716  H  HH21 . ARG A 1 37 ? -3.247  -5.514  3.816   1.00 0.00 ? 37  ARG A HH21 8  
ATOM   8717  H  HH22 . ARG A 1 37 ? -2.796  -4.393  5.055   1.00 0.00 ? 37  ARG A HH22 8  
ATOM   8718  N  N    . HIS A 1 38 ? -9.571  -1.006  -0.371  1.00 0.00 ? 38  HIS A N    8  
ATOM   8719  C  CA   . HIS A 1 38 ? -10.237 0.241   -0.733  1.00 0.00 ? 38  HIS A CA   8  
ATOM   8720  C  C    . HIS A 1 38 ? -9.255  1.215   -1.377  1.00 0.00 ? 38  HIS A C    8  
ATOM   8721  O  O    . HIS A 1 38 ? -8.039  1.091   -1.237  1.00 0.00 ? 38  HIS A O    8  
ATOM   8722  C  CB   . HIS A 1 38 ? -10.873 0.880   0.502   1.00 0.00 ? 38  HIS A CB   8  
ATOM   8723  C  CG   . HIS A 1 38 ? -12.211 0.307   0.852   1.00 0.00 ? 38  HIS A CG   8  
ATOM   8724  N  ND1  . HIS A 1 38 ? -12.411 -0.539  1.922   1.00 0.00 ? 38  HIS A ND1  8  
ATOM   8725  C  CD2  . HIS A 1 38 ? -13.422 0.464   0.267   1.00 0.00 ? 38  HIS A CD2  8  
ATOM   8726  C  CE1  . HIS A 1 38 ? -13.687 -0.879  1.979   1.00 0.00 ? 38  HIS A CE1  8  
ATOM   8727  N  NE2  . HIS A 1 38 ? -14.322 -0.284  0.986   1.00 0.00 ? 38  HIS A NE2  8  
ATOM   8728  H  H    . HIS A 1 38 ? -9.506  -1.257  0.574   1.00 0.00 ? 38  HIS A H    8  
ATOM   8729  H  HA   . HIS A 1 38 ? -11.013 0.007   -1.446  1.00 0.00 ? 38  HIS A HA   8  
ATOM   8730  H  HB2  . HIS A 1 38 ? -10.219 0.737   1.350   1.00 0.00 ? 38  HIS A HB2  8  
ATOM   8731  H  HB3  . HIS A 1 38 ? -11.000 1.939   0.326   1.00 0.00 ? 38  HIS A HB3  8  
ATOM   8732  H  HD2  . HIS A 1 38 ? -13.641 1.065   -0.605  1.00 0.00 ? 38  HIS A HD2  8  
ATOM   8733  H  HE1  . HIS A 1 38 ? -14.135 -1.533  2.713   1.00 0.00 ? 38  HIS A HE1  8  
ATOM   8734  H  HE2  . HIS A 1 38 ? -15.260 -0.432  0.747   1.00 0.00 ? 38  HIS A HE2  8  
ATOM   8735  N  N    . PRO A 1 39 ? -9.795  2.207   -2.100  1.00 0.00 ? 39  PRO A N    8  
ATOM   8736  C  CA   . PRO A 1 39 ? -8.984  3.222   -2.780  1.00 0.00 ? 39  PRO A CA   8  
ATOM   8737  C  C    . PRO A 1 39 ? -8.304  4.173   -1.801  1.00 0.00 ? 39  PRO A C    8  
ATOM   8738  O  O    . PRO A 1 39 ? -7.450  4.970   -2.188  1.00 0.00 ? 39  PRO A O    8  
ATOM   8739  C  CB   . PRO A 1 39 ? -10.004 3.976   -3.636  1.00 0.00 ? 39  PRO A CB   8  
ATOM   8740  C  CG   . PRO A 1 39 ? -11.304 3.782   -2.935  1.00 0.00 ? 39  PRO A CG   8  
ATOM   8741  C  CD   . PRO A 1 39 ? -11.237 2.416   -2.309  1.00 0.00 ? 39  PRO A CD   8  
ATOM   8742  H  HA   . PRO A 1 39 ? -8.238  2.771   -3.419  1.00 0.00 ? 39  PRO A HA   8  
ATOM   8743  H  HB2  . PRO A 1 39 ? -9.733  5.021   -3.686  1.00 0.00 ? 39  PRO A HB2  8  
ATOM   8744  H  HB3  . PRO A 1 39 ? -10.025 3.556   -4.631  1.00 0.00 ? 39  PRO A HB3  8  
ATOM   8745  H  HG2  . PRO A 1 39 ? -11.428 4.538   -2.175  1.00 0.00 ? 39  PRO A HG2  8  
ATOM   8746  H  HG3  . PRO A 1 39 ? -12.115 3.828   -3.647  1.00 0.00 ? 39  PRO A HG3  8  
ATOM   8747  H  HD2  . PRO A 1 39 ? -11.769 2.406   -1.369  1.00 0.00 ? 39  PRO A HD2  8  
ATOM   8748  H  HD3  . PRO A 1 39 ? -11.640 1.673   -2.981  1.00 0.00 ? 39  PRO A HD3  8  
ATOM   8749  N  N    . GLU A 1 40 ? -8.689  4.082   -0.531  1.00 0.00 ? 40  GLU A N    8  
ATOM   8750  C  CA   . GLU A 1 40 ? -8.115  4.936   0.502   1.00 0.00 ? 40  GLU A CA   8  
ATOM   8751  C  C    . GLU A 1 40 ? -7.369  4.105   1.542   1.00 0.00 ? 40  GLU A C    8  
ATOM   8752  O  O    . GLU A 1 40 ? -6.432  4.585   2.182   1.00 0.00 ? 40  GLU A O    8  
ATOM   8753  C  CB   . GLU A 1 40 ? -9.212  5.758   1.182   1.00 0.00 ? 40  GLU A CB   8  
ATOM   8754  C  CG   . GLU A 1 40 ? -10.119 4.936   2.083   1.00 0.00 ? 40  GLU A CG   8  
ATOM   8755  C  CD   . GLU A 1 40 ? -10.820 5.779   3.130   1.00 0.00 ? 40  GLU A CD   8  
ATOM   8756  O  OE1  . GLU A 1 40 ? -11.769 6.506   2.768   1.00 0.00 ? 40  GLU A OE1  8  
ATOM   8757  O  OE2  . GLU A 1 40 ? -10.420 5.712   4.311   1.00 0.00 ? 40  GLU A OE2  8  
ATOM   8758  H  H    . GLU A 1 40 ? -9.374  3.427   -0.285  1.00 0.00 ? 40  GLU A H    8  
ATOM   8759  H  HA   . GLU A 1 40 ? -7.416  5.608   0.028   1.00 0.00 ? 40  GLU A HA   8  
ATOM   8760  H  HB2  . GLU A 1 40 ? -8.749  6.530   1.780   1.00 0.00 ? 40  GLU A HB2  8  
ATOM   8761  H  HB3  . GLU A 1 40 ? -9.821  6.222   0.421   1.00 0.00 ? 40  GLU A HB3  8  
ATOM   8762  H  HG2  . GLU A 1 40 ? -10.867 4.452   1.473   1.00 0.00 ? 40  GLU A HG2  8  
ATOM   8763  H  HG3  . GLU A 1 40 ? -9.524  4.187   2.584   1.00 0.00 ? 40  GLU A HG3  8  
ATOM   8764  N  N    . CYS A 1 41 ? -7.790  2.855   1.706   1.00 0.00 ? 41  CYS A N    8  
ATOM   8765  C  CA   . CYS A 1 41 ? -7.164  1.956   2.667   1.00 0.00 ? 41  CYS A CA   8  
ATOM   8766  C  C    . CYS A 1 41 ? -5.881  1.359   2.098   1.00 0.00 ? 41  CYS A C    8  
ATOM   8767  O  O    . CYS A 1 41 ? -5.129  0.688   2.805   1.00 0.00 ? 41  CYS A O    8  
ATOM   8768  C  CB   . CYS A 1 41 ? -8.132  0.837   3.056   1.00 0.00 ? 41  CYS A CB   8  
ATOM   8769  S  SG   . CYS A 1 41 ? -9.692  1.424   3.792   1.00 0.00 ? 41  CYS A SG   8  
ATOM   8770  H  H    . CYS A 1 41 ? -8.542  2.529   1.166   1.00 0.00 ? 41  CYS A H    8  
ATOM   8771  H  HA   . CYS A 1 41 ? -6.920  2.530   3.548   1.00 0.00 ? 41  CYS A HA   8  
ATOM   8772  H  HB2  . CYS A 1 41 ? -8.382  0.265   2.174   1.00 0.00 ? 41  CYS A HB2  8  
ATOM   8773  H  HB3  . CYS A 1 41 ? -7.652  0.189   3.774   1.00 0.00 ? 41  CYS A HB3  8  
ATOM   8774  N  N    . TYR A 1 42 ? -5.637  1.607   0.816   1.00 0.00 ? 42  TYR A N    8  
ATOM   8775  C  CA   . TYR A 1 42 ? -4.447  1.093   0.150   1.00 0.00 ? 42  TYR A CA   8  
ATOM   8776  C  C    . TYR A 1 42 ? -3.194  1.812   0.642   1.00 0.00 ? 42  TYR A C    8  
ATOM   8777  O  O    . TYR A 1 42 ? -2.086  1.539   0.180   1.00 0.00 ? 42  TYR A O    8  
ATOM   8778  C  CB   . TYR A 1 42 ? -4.576  1.249   -1.366  1.00 0.00 ? 42  TYR A CB   8  
ATOM   8779  C  CG   . TYR A 1 42 ? -3.342  0.821   -2.126  1.00 0.00 ? 42  TYR A CG   8  
ATOM   8780  C  CD1  . TYR A 1 42 ? -2.692  -0.369  -1.823  1.00 0.00 ? 42  TYR A CD1  8  
ATOM   8781  C  CD2  . TYR A 1 42 ? -2.823  1.608   -3.147  1.00 0.00 ? 42  TYR A CD2  8  
ATOM   8782  C  CE1  . TYR A 1 42 ? -1.564  -0.764  -2.515  1.00 0.00 ? 42  TYR A CE1  8  
ATOM   8783  C  CE2  . TYR A 1 42 ? -1.696  1.221   -3.845  1.00 0.00 ? 42  TYR A CE2  8  
ATOM   8784  C  CZ   . TYR A 1 42 ? -1.069  0.035   -3.525  1.00 0.00 ? 42  TYR A CZ   8  
ATOM   8785  O  OH   . TYR A 1 42 ? 0.055   -0.354  -4.217  1.00 0.00 ? 42  TYR A OH   8  
ATOM   8786  H  H    . TYR A 1 42 ? -6.274  2.148   0.304   1.00 0.00 ? 42  TYR A H    8  
ATOM   8787  H  HA   . TYR A 1 42 ? -4.361  0.042   0.388   1.00 0.00 ? 42  TYR A HA   8  
ATOM   8788  H  HB2  . TYR A 1 42 ? -5.403  0.649   -1.713  1.00 0.00 ? 42  TYR A HB2  8  
ATOM   8789  H  HB3  . TYR A 1 42 ? -4.768  2.286   -1.599  1.00 0.00 ? 42  TYR A HB3  8  
ATOM   8790  H  HD1  . TYR A 1 42 ? -3.082  -0.993  -1.031  1.00 0.00 ? 42  TYR A HD1  8  
ATOM   8791  H  HD2  . TYR A 1 42 ? -3.316  2.537   -3.395  1.00 0.00 ? 42  TYR A HD2  8  
ATOM   8792  H  HE1  . TYR A 1 42 ? -1.073  -1.693  -2.265  1.00 0.00 ? 42  TYR A HE1  8  
ATOM   8793  H  HE2  . TYR A 1 42 ? -1.308  1.846   -4.636  1.00 0.00 ? 42  TYR A HE2  8  
ATOM   8794  H  HH   . TYR A 1 42 ? -0.130  -0.342  -5.160  1.00 0.00 ? 42  TYR A HH   8  
ATOM   8795  N  N    . VAL A 1 43 ? -3.379  2.733   1.582   1.00 0.00 ? 43  VAL A N    8  
ATOM   8796  C  CA   . VAL A 1 43 ? -2.266  3.492   2.139   1.00 0.00 ? 43  VAL A CA   8  
ATOM   8797  C  C    . VAL A 1 43 ? -1.405  2.620   3.045   1.00 0.00 ? 43  VAL A C    8  
ATOM   8798  O  O    . VAL A 1 43 ? -1.789  1.505   3.400   1.00 0.00 ? 43  VAL A O    8  
ATOM   8799  C  CB   . VAL A 1 43 ? -2.761  4.712   2.938   1.00 0.00 ? 43  VAL A CB   8  
ATOM   8800  C  CG1  . VAL A 1 43 ? -3.588  5.631   2.052   1.00 0.00 ? 43  VAL A CG1  8  
ATOM   8801  C  CG2  . VAL A 1 43 ? -3.563  4.263   4.150   1.00 0.00 ? 43  VAL A CG2  8  
ATOM   8802  H  H    . VAL A 1 43 ? -4.286  2.906   1.910   1.00 0.00 ? 43  VAL A H    8  
ATOM   8803  H  HA   . VAL A 1 43 ? -1.661  3.848   1.317   1.00 0.00 ? 43  VAL A HA   8  
ATOM   8804  H  HB   . VAL A 1 43 ? -1.900  5.263   3.286   1.00 0.00 ? 43  VAL A HB   8  
ATOM   8805  H  HG11 . VAL A 1 43 ? -4.499  5.902   2.566   1.00 0.00 ? 43  VAL A HG11 8  
ATOM   8806  H  HG12 . VAL A 1 43 ? -3.020  6.522   1.829   1.00 0.00 ? 43  VAL A HG12 8  
ATOM   8807  H  HG13 . VAL A 1 43 ? -3.833  5.120   1.133   1.00 0.00 ? 43  VAL A HG13 8  
ATOM   8808  H  HG21 . VAL A 1 43 ? -3.550  3.185   4.211   1.00 0.00 ? 43  VAL A HG21 8  
ATOM   8809  H  HG22 . VAL A 1 43 ? -3.126  4.679   5.046   1.00 0.00 ? 43  VAL A HG22 8  
ATOM   8810  H  HG23 . VAL A 1 43 ? -4.583  4.606   4.055   1.00 0.00 ? 43  VAL A HG23 8  
ATOM   8811  N  N    . CYS A 1 44 ? -0.238  3.134   3.418   1.00 0.00 ? 44  CYS A N    8  
ATOM   8812  C  CA   . CYS A 1 44 ? 0.679   2.403   4.284   1.00 0.00 ? 44  CYS A CA   8  
ATOM   8813  C  C    . CYS A 1 44 ? 0.052   2.152   5.652   1.00 0.00 ? 44  CYS A C    8  
ATOM   8814  O  O    . CYS A 1 44 ? -0.842  2.882   6.081   1.00 0.00 ? 44  CYS A O    8  
ATOM   8815  C  CB   . CYS A 1 44 ? 1.989   3.178   4.445   1.00 0.00 ? 44  CYS A CB   8  
ATOM   8816  S  SG   . CYS A 1 44 ? 3.233   2.331   5.472   1.00 0.00 ? 44  CYS A SG   8  
ATOM   8817  H  H    . CYS A 1 44 ? 0.014   4.029   3.103   1.00 0.00 ? 44  CYS A H    8  
ATOM   8818  H  HA   . CYS A 1 44 ? 0.889   1.452   3.818   1.00 0.00 ? 44  CYS A HA   8  
ATOM   8819  H  HB2  . CYS A 1 44 ? 2.425   3.340   3.470   1.00 0.00 ? 44  CYS A HB2  8  
ATOM   8820  H  HB3  . CYS A 1 44 ? 1.779   4.133   4.903   1.00 0.00 ? 44  CYS A HB3  8  
ATOM   8821  N  N    . THR A 1 45 ? 0.528   1.115   6.334   1.00 0.00 ? 45  THR A N    8  
ATOM   8822  C  CA   . THR A 1 45 ? 0.015   0.767   7.653   1.00 0.00 ? 45  THR A CA   8  
ATOM   8823  C  C    . THR A 1 45 ? 0.779   1.497   8.751   1.00 0.00 ? 45  THR A C    8  
ATOM   8824  O  O    . THR A 1 45 ? 0.206   1.874   9.773   1.00 0.00 ? 45  THR A O    8  
ATOM   8825  C  CB   . THR A 1 45 ? 0.100   -0.750  7.906   1.00 0.00 ? 45  THR A CB   8  
ATOM   8826  O  OG1  . THR A 1 45 ? -0.594  -1.459  6.873   1.00 0.00 ? 45  THR A OG1  8  
ATOM   8827  C  CG2  . THR A 1 45 ? -0.494  -1.107  9.260   1.00 0.00 ? 45  THR A CG2  8  
ATOM   8828  H  H    . THR A 1 45 ? 1.241   0.571   5.939   1.00 0.00 ? 45  THR A H    8  
ATOM   8829  H  HA   . THR A 1 45 ? -1.024  1.060   7.694   1.00 0.00 ? 45  THR A HA   8  
ATOM   8830  H  HB   . THR A 1 45 ? 1.140   -1.044  7.897   1.00 0.00 ? 45  THR A HB   8  
ATOM   8831  H  HG1  . THR A 1 45 ? 0.037   -1.956  6.346   1.00 0.00 ? 45  THR A HG1  8  
ATOM   8832  H  HG21 . THR A 1 45 ? 0.197   -0.827  10.042  1.00 0.00 ? 45  THR A HG21 8  
ATOM   8833  H  HG22 . THR A 1 45 ? -0.677  -2.170  9.304   1.00 0.00 ? 45  THR A HG22 8  
ATOM   8834  H  HG23 . THR A 1 45 ? -1.424  -0.576  9.396   1.00 0.00 ? 45  THR A HG23 8  
ATOM   8835  N  N    . ASP A 1 46 ? 2.074   1.695   8.533   1.00 0.00 ? 46  ASP A N    8  
ATOM   8836  C  CA   . ASP A 1 46 ? 2.917   2.383   9.504   1.00 0.00 ? 46  ASP A CA   8  
ATOM   8837  C  C    . ASP A 1 46 ? 2.516   3.849   9.629   1.00 0.00 ? 46  ASP A C    8  
ATOM   8838  O  O    . ASP A 1 46 ? 2.046   4.288   10.680  1.00 0.00 ? 46  ASP A O    8  
ATOM   8839  C  CB   . ASP A 1 46 ? 4.389   2.276   9.100   1.00 0.00 ? 46  ASP A CB   8  
ATOM   8840  C  CG   . ASP A 1 46 ? 5.327   2.471   10.275  1.00 0.00 ? 46  ASP A CG   8  
ATOM   8841  O  OD1  . ASP A 1 46 ? 4.868   2.340   11.429  1.00 0.00 ? 46  ASP A OD1  8  
ATOM   8842  O  OD2  . ASP A 1 46 ? 6.520   2.755   10.040  1.00 0.00 ? 46  ASP A OD2  8  
ATOM   8843  H  H    . ASP A 1 46 ? 2.473   1.371   7.698   1.00 0.00 ? 46  ASP A H    8  
ATOM   8844  H  HA   . ASP A 1 46 ? 2.780   1.902   10.461  1.00 0.00 ? 46  ASP A HA   8  
ATOM   8845  H  HB2  . ASP A 1 46 ? 4.569   1.298   8.678   1.00 0.00 ? 46  ASP A HB2  8  
ATOM   8846  H  HB3  . ASP A 1 46 ? 4.607   3.030   8.359   1.00 0.00 ? 46  ASP A HB3  8  
ATOM   8847  N  N    . CYS A 1 47 ? 2.705   4.603   8.552   1.00 0.00 ? 47  CYS A N    8  
ATOM   8848  C  CA   . CYS A 1 47 ? 2.365   6.021   8.540   1.00 0.00 ? 47  CYS A CA   8  
ATOM   8849  C  C    . CYS A 1 47 ? 0.962   6.239   7.983   1.00 0.00 ? 47  CYS A C    8  
ATOM   8850  O  O    . CYS A 1 47 ? 0.076   6.733   8.679   1.00 0.00 ? 47  CYS A O    8  
ATOM   8851  C  CB   . CYS A 1 47 ? 3.383   6.804   7.709   1.00 0.00 ? 47  CYS A CB   8  
ATOM   8852  S  SG   . CYS A 1 47 ? 3.958   5.928   6.219   1.00 0.00 ? 47  CYS A SG   8  
ATOM   8853  H  H    . CYS A 1 47 ? 3.084   4.196   7.743   1.00 0.00 ? 47  CYS A H    8  
ATOM   8854  H  HA   . CYS A 1 47 ? 2.394   6.377   9.558   1.00 0.00 ? 47  CYS A HA   8  
ATOM   8855  H  HB2  . CYS A 1 47 ? 2.937   7.735   7.391   1.00 0.00 ? 47  CYS A HB2  8  
ATOM   8856  H  HB3  . CYS A 1 47 ? 4.248   7.017   8.320   1.00 0.00 ? 47  CYS A HB3  8  
ATOM   8857  N  N    . GLY A 1 48 ? 0.767   5.866   6.721   1.00 0.00 ? 48  GLY A N    8  
ATOM   8858  C  CA   . GLY A 1 48 ? -0.530  6.029   6.091   1.00 0.00 ? 48  GLY A CA   8  
ATOM   8859  C  C    . GLY A 1 48 ? -0.484  6.968   4.902   1.00 0.00 ? 48  GLY A C    8  
ATOM   8860  O  O    . GLY A 1 48 ? -1.238  7.939   4.838   1.00 0.00 ? 48  GLY A O    8  
ATOM   8861  H  H    . GLY A 1 48 ? 1.511   5.478   6.214   1.00 0.00 ? 48  GLY A H    8  
ATOM   8862  H  HA2  . GLY A 1 48 ? -0.881  5.063   5.761   1.00 0.00 ? 48  GLY A HA2  8  
ATOM   8863  H  HA3  . GLY A 1 48 ? -1.224  6.423   6.819   1.00 0.00 ? 48  GLY A HA3  8  
ATOM   8864  N  N    . THR A 1 49 ? 0.406   6.679   3.957   1.00 0.00 ? 49  THR A N    8  
ATOM   8865  C  CA   . THR A 1 49 ? 0.550   7.506   2.766   1.00 0.00 ? 49  THR A CA   8  
ATOM   8866  C  C    . THR A 1 49 ? -0.008  6.801   1.535   1.00 0.00 ? 49  THR A C    8  
ATOM   8867  O  O    . THR A 1 49 ? -0.113  5.575   1.506   1.00 0.00 ? 49  THR A O    8  
ATOM   8868  C  CB   . THR A 1 49 ? 2.025   7.870   2.510   1.00 0.00 ? 49  THR A CB   8  
ATOM   8869  O  OG1  . THR A 1 49 ? 2.116   8.830   1.450   1.00 0.00 ? 49  THR A OG1  8  
ATOM   8870  C  CG2  . THR A 1 49 ? 2.833   6.632   2.151   1.00 0.00 ? 49  THR A CG2  8  
ATOM   8871  H  H    . THR A 1 49 ? 0.979   5.892   4.065   1.00 0.00 ? 49  THR A H    8  
ATOM   8872  H  HA   . THR A 1 49 ? -0.002  8.421   2.926   1.00 0.00 ? 49  THR A HA   8  
ATOM   8873  H  HB   . THR A 1 49 ? 2.435   8.301   3.412   1.00 0.00 ? 49  THR A HB   8  
ATOM   8874  H  HG1  . THR A 1 49 ? 2.233   9.707   1.822   1.00 0.00 ? 49  THR A HG1  8  
ATOM   8875  H  HG21 . THR A 1 49 ? 2.202   5.930   1.626   1.00 0.00 ? 49  THR A HG21 8  
ATOM   8876  H  HG22 . THR A 1 49 ? 3.210   6.175   3.053   1.00 0.00 ? 49  THR A HG22 8  
ATOM   8877  H  HG23 . THR A 1 49 ? 3.661   6.915   1.517   1.00 0.00 ? 49  THR A HG23 8  
ATOM   8878  N  N    . ASN A 1 50 ? -0.364  7.582   0.521   1.00 0.00 ? 50  ASN A N    8  
ATOM   8879  C  CA   . ASN A 1 50 ? -0.912  7.031   -0.713  1.00 0.00 ? 50  ASN A CA   8  
ATOM   8880  C  C    . ASN A 1 50 ? 0.133   6.197   -1.448  1.00 0.00 ? 50  ASN A C    8  
ATOM   8881  O  O    . ASN A 1 50 ? 1.114   6.731   -1.969  1.00 0.00 ? 50  ASN A O    8  
ATOM   8882  C  CB   . ASN A 1 50 ? -1.414  8.156   -1.620  1.00 0.00 ? 50  ASN A CB   8  
ATOM   8883  C  CG   . ASN A 1 50 ? -2.452  7.676   -2.617  1.00 0.00 ? 50  ASN A CG   8  
ATOM   8884  O  OD1  . ASN A 1 50 ? -2.238  7.731   -3.828  1.00 0.00 ? 50  ASN A OD1  8  
ATOM   8885  N  ND2  . ASN A 1 50 ? -3.584  7.203   -2.109  1.00 0.00 ? 50  ASN A ND2  8  
ATOM   8886  H  H    . ASN A 1 50 ? -0.257  8.553   0.604   1.00 0.00 ? 50  ASN A H    8  
ATOM   8887  H  HA   . ASN A 1 50 ? -1.744  6.394   -0.451  1.00 0.00 ? 50  ASN A HA   8  
ATOM   8888  H  HB2  . ASN A 1 50 ? -1.858  8.930   -1.011  1.00 0.00 ? 50  ASN A HB2  8  
ATOM   8889  H  HB3  . ASN A 1 50 ? -0.580  8.569   -2.167  1.00 0.00 ? 50  ASN A HB3  8  
ATOM   8890  H  HD21 . ASN A 1 50 ? -3.685  7.189   -1.134  1.00 0.00 ? 50  ASN A HD21 8  
ATOM   8891  H  HD22 . ASN A 1 50 ? -4.272  6.885   -2.731  1.00 0.00 ? 50  ASN A HD22 8  
ATOM   8892  N  N    . LEU A 1 51 ? -0.083  4.887   -1.486  1.00 0.00 ? 51  LEU A N    8  
ATOM   8893  C  CA   . LEU A 1 51 ? 0.840   3.979   -2.158  1.00 0.00 ? 51  LEU A CA   8  
ATOM   8894  C  C    . LEU A 1 51 ? 0.435   3.770   -3.614  1.00 0.00 ? 51  LEU A C    8  
ATOM   8895  O  O    . LEU A 1 51 ? 0.951   2.881   -4.292  1.00 0.00 ? 51  LEU A O    8  
ATOM   8896  C  CB   . LEU A 1 51 ? 0.883   2.634   -1.431  1.00 0.00 ? 51  LEU A CB   8  
ATOM   8897  C  CG   . LEU A 1 51 ? 1.170   2.691   0.070   1.00 0.00 ? 51  LEU A CG   8  
ATOM   8898  C  CD1  . LEU A 1 51 ? 0.994   1.318   0.699   1.00 0.00 ? 51  LEU A CD1  8  
ATOM   8899  C  CD2  . LEU A 1 51 ? 2.573   3.222   0.324   1.00 0.00 ? 51  LEU A CD2  8  
ATOM   8900  H  H    . LEU A 1 51 ? -0.882  4.521   -1.054  1.00 0.00 ? 51  LEU A H    8  
ATOM   8901  H  HA   . LEU A 1 51 ? 1.823   4.426   -2.131  1.00 0.00 ? 51  LEU A HA   8  
ATOM   8902  H  HB2  . LEU A 1 51 ? -0.074  2.155   -1.566  1.00 0.00 ? 51  LEU A HB2  8  
ATOM   8903  H  HB3  . LEU A 1 51 ? 1.653   2.033   -1.894  1.00 0.00 ? 51  LEU A HB3  8  
ATOM   8904  H  HG   . LEU A 1 51 ? 0.466   3.365   0.539   1.00 0.00 ? 51  LEU A HG   8  
ATOM   8905  H  HD11 . LEU A 1 51 ? 0.905   1.422   1.770   1.00 0.00 ? 51  LEU A HD11 8  
ATOM   8906  H  HD12 . LEU A 1 51 ? 1.852   0.704   0.468   1.00 0.00 ? 51  LEU A HD12 8  
ATOM   8907  H  HD13 . LEU A 1 51 ? 0.102   0.853   0.306   1.00 0.00 ? 51  LEU A HD13 8  
ATOM   8908  H  HD21 . LEU A 1 51 ? 2.993   2.727   1.188   1.00 0.00 ? 51  LEU A HD21 8  
ATOM   8909  H  HD22 . LEU A 1 51 ? 2.528   4.286   0.506   1.00 0.00 ? 51  LEU A HD22 8  
ATOM   8910  H  HD23 . LEU A 1 51 ? 3.193   3.029   -0.538  1.00 0.00 ? 51  LEU A HD23 8  
ATOM   8911  N  N    . LYS A 1 52 ? -0.489  4.597   -4.090  1.00 0.00 ? 52  LYS A N    8  
ATOM   8912  C  CA   . LYS A 1 52 ? -0.962  4.507   -5.467  1.00 0.00 ? 52  LYS A CA   8  
ATOM   8913  C  C    . LYS A 1 52 ? 0.201   4.609   -6.449  1.00 0.00 ? 52  LYS A C    8  
ATOM   8914  O  O    . LYS A 1 52 ? 0.392   3.732   -7.290  1.00 0.00 ? 52  LYS A O    8  
ATOM   8915  C  CB   . LYS A 1 52 ? -1.982  5.611   -5.751  1.00 0.00 ? 52  LYS A CB   8  
ATOM   8916  C  CG   . LYS A 1 52 ? -2.634  5.500   -7.118  1.00 0.00 ? 52  LYS A CG   8  
ATOM   8917  C  CD   . LYS A 1 52 ? -3.614  4.340   -7.176  1.00 0.00 ? 52  LYS A CD   8  
ATOM   8918  C  CE   . LYS A 1 52 ? -4.493  4.414   -8.415  1.00 0.00 ? 52  LYS A CE   8  
ATOM   8919  N  NZ   . LYS A 1 52 ? -5.026  3.077   -8.797  1.00 0.00 ? 52  LYS A NZ   8  
ATOM   8920  H  H    . LYS A 1 52 ? -0.863  5.286   -3.501  1.00 0.00 ? 52  LYS A H    8  
ATOM   8921  H  HA   . LYS A 1 52 ? -1.439  3.547   -5.591  1.00 0.00 ? 52  LYS A HA   8  
ATOM   8922  H  HB2  . LYS A 1 52 ? -2.758  5.570   -5.001  1.00 0.00 ? 52  LYS A HB2  8  
ATOM   8923  H  HB3  . LYS A 1 52 ? -1.484  6.569   -5.690  1.00 0.00 ? 52  LYS A HB3  8  
ATOM   8924  H  HG2  . LYS A 1 52 ? -3.165  6.416   -7.330  1.00 0.00 ? 52  LYS A HG2  8  
ATOM   8925  H  HG3  . LYS A 1 52 ? -1.865  5.347   -7.862  1.00 0.00 ? 52  LYS A HG3  8  
ATOM   8926  H  HD2  . LYS A 1 52 ? -3.060  3.413   -7.196  1.00 0.00 ? 52  LYS A HD2  8  
ATOM   8927  H  HD3  . LYS A 1 52 ? -4.242  4.367   -6.297  1.00 0.00 ? 52  LYS A HD3  8  
ATOM   8928  H  HE2  . LYS A 1 52 ? -5.320  5.077   -8.214  1.00 0.00 ? 52  LYS A HE2  8  
ATOM   8929  H  HE3  . LYS A 1 52 ? -3.907  4.806   -9.233  1.00 0.00 ? 52  LYS A HE3  8  
ATOM   8930  H  HZ1  . LYS A 1 52 ? -4.247  2.394   -8.886  1.00 0.00 ? 52  LYS A HZ1  8  
ATOM   8931  H  HZ2  . LYS A 1 52 ? -5.524  3.138   -9.708  1.00 0.00 ? 52  LYS A HZ2  8  
ATOM   8932  H  HZ3  . LYS A 1 52 ? -5.691  2.736   -8.073  1.00 0.00 ? 52  LYS A HZ3  8  
ATOM   8933  N  N    . GLN A 1 53 ? 0.974   5.683   -6.333  1.00 0.00 ? 53  GLN A N    8  
ATOM   8934  C  CA   . GLN A 1 53 ? 2.119   5.898   -7.211  1.00 0.00 ? 53  GLN A CA   8  
ATOM   8935  C  C    . GLN A 1 53 ? 3.398   5.361   -6.579  1.00 0.00 ? 53  GLN A C    8  
ATOM   8936  O  O    . GLN A 1 53 ? 4.085   4.519   -7.159  1.00 0.00 ? 53  GLN A O    8  
ATOM   8937  C  CB   . GLN A 1 53 ? 2.276   7.387   -7.523  1.00 0.00 ? 53  GLN A CB   8  
ATOM   8938  C  CG   . GLN A 1 53 ? 1.165   7.947   -8.396  1.00 0.00 ? 53  GLN A CG   8  
ATOM   8939  C  CD   . GLN A 1 53 ? 1.270   7.491   -9.838  1.00 0.00 ? 53  GLN A CD   8  
ATOM   8940  O  OE1  . GLN A 1 53 ? 1.651   6.354   -10.116 1.00 0.00 ? 53  GLN A OE1  8  
ATOM   8941  N  NE2  . GLN A 1 53 ? 0.930   8.379   -10.766 1.00 0.00 ? 53  GLN A NE2  8  
ATOM   8942  H  H    . GLN A 1 53 ? 0.771   6.347   -5.643  1.00 0.00 ? 53  GLN A H    8  
ATOM   8943  H  HA   . GLN A 1 53 ? 1.935   5.364   -8.131  1.00 0.00 ? 53  GLN A HA   8  
ATOM   8944  H  HB2  . GLN A 1 53 ? 2.288   7.939   -6.595  1.00 0.00 ? 53  GLN A HB2  8  
ATOM   8945  H  HB3  . GLN A 1 53 ? 3.216   7.538   -8.034  1.00 0.00 ? 53  GLN A HB3  8  
ATOM   8946  H  HG2  . GLN A 1 53 ? 0.214   7.620   -8.000  1.00 0.00 ? 53  GLN A HG2  8  
ATOM   8947  H  HG3  . GLN A 1 53 ? 1.212   9.026   -8.370  1.00 0.00 ? 53  GLN A HG3  8  
ATOM   8948  H  HE21 . GLN A 1 53 ? 0.636   9.267   -10.471 1.00 0.00 ? 53  GLN A HE21 8  
ATOM   8949  H  HE22 . GLN A 1 53 ? 0.989   8.112   -11.706 1.00 0.00 ? 53  GLN A HE22 8  
ATOM   8950  N  N    . LYS A 1 54 ? 3.715   5.853   -5.386  1.00 0.00 ? 54  LYS A N    8  
ATOM   8951  C  CA   . LYS A 1 54 ? 4.911   5.423   -4.672  1.00 0.00 ? 54  LYS A CA   8  
ATOM   8952  C  C    . LYS A 1 54 ? 5.081   3.910   -4.758  1.00 0.00 ? 54  LYS A C    8  
ATOM   8953  O  O    . LYS A 1 54 ? 6.178   3.411   -5.002  1.00 0.00 ? 54  LYS A O    8  
ATOM   8954  C  CB   . LYS A 1 54 ? 4.840   5.857   -3.207  1.00 0.00 ? 54  LYS A CB   8  
ATOM   8955  C  CG   . LYS A 1 54 ? 4.956   7.359   -3.011  1.00 0.00 ? 54  LYS A CG   8  
ATOM   8956  C  CD   . LYS A 1 54 ? 5.046   7.724   -1.539  1.00 0.00 ? 54  LYS A CD   8  
ATOM   8957  C  CE   . LYS A 1 54 ? 4.813   9.211   -1.318  1.00 0.00 ? 54  LYS A CE   8  
ATOM   8958  N  NZ   . LYS A 1 54 ? 5.518   9.709   -0.105  1.00 0.00 ? 54  LYS A NZ   8  
ATOM   8959  H  H    . LYS A 1 54 ? 3.128   6.523   -4.974  1.00 0.00 ? 54  LYS A H    8  
ATOM   8960  H  HA   . LYS A 1 54 ? 5.763   5.895   -5.138  1.00 0.00 ? 54  LYS A HA   8  
ATOM   8961  H  HB2  . LYS A 1 54 ? 3.897   5.533   -2.793  1.00 0.00 ? 54  LYS A HB2  8  
ATOM   8962  H  HB3  . LYS A 1 54 ? 5.645   5.382   -2.664  1.00 0.00 ? 54  LYS A HB3  8  
ATOM   8963  H  HG2  . LYS A 1 54 ? 5.846   7.711   -3.512  1.00 0.00 ? 54  LYS A HG2  8  
ATOM   8964  H  HG3  . LYS A 1 54 ? 4.087   7.837   -3.439  1.00 0.00 ? 54  LYS A HG3  8  
ATOM   8965  H  HD2  . LYS A 1 54 ? 4.297   7.170   -0.993  1.00 0.00 ? 54  LYS A HD2  8  
ATOM   8966  H  HD3  . LYS A 1 54 ? 6.028   7.464   -1.171  1.00 0.00 ? 54  LYS A HD3  8  
ATOM   8967  H  HE2  . LYS A 1 54 ? 5.174   9.751   -2.180  1.00 0.00 ? 54  LYS A HE2  8  
ATOM   8968  H  HE3  . LYS A 1 54 ? 3.752   9.383   -1.204  1.00 0.00 ? 54  LYS A HE3  8  
ATOM   8969  H  HZ1  . LYS A 1 54 ? 6.132   8.964   0.282   1.00 0.00 ? 54  LYS A HZ1  8  
ATOM   8970  H  HZ2  . LYS A 1 54 ? 4.827   9.984   0.622   1.00 0.00 ? 54  LYS A HZ2  8  
ATOM   8971  H  HZ3  . LYS A 1 54 ? 6.101   10.536  -0.344  1.00 0.00 ? 54  LYS A HZ3  8  
ATOM   8972  N  N    . GLY A 1 55 ? 3.985   3.184   -4.555  1.00 0.00 ? 55  GLY A N    8  
ATOM   8973  C  CA   . GLY A 1 55 ? 4.035   1.734   -4.615  1.00 0.00 ? 55  GLY A CA   8  
ATOM   8974  C  C    . GLY A 1 55 ? 3.891   1.093   -3.249  1.00 0.00 ? 55  GLY A C    8  
ATOM   8975  O  O    . GLY A 1 55 ? 4.201   1.710   -2.229  1.00 0.00 ? 55  GLY A O    8  
ATOM   8976  H  H    . GLY A 1 55 ? 3.137   3.636   -4.364  1.00 0.00 ? 55  GLY A H    8  
ATOM   8977  H  HA2  . GLY A 1 55 ? 3.236   1.384   -5.252  1.00 0.00 ? 55  GLY A HA2  8  
ATOM   8978  H  HA3  . GLY A 1 55 ? 4.980   1.435   -5.042  1.00 0.00 ? 55  GLY A HA3  8  
ATOM   8979  N  N    . HIS A 1 56 ? 3.418   -0.149  -3.227  1.00 0.00 ? 56  HIS A N    8  
ATOM   8980  C  CA   . HIS A 1 56 ? 3.232   -0.875  -1.975  1.00 0.00 ? 56  HIS A CA   8  
ATOM   8981  C  C    . HIS A 1 56 ? 4.085   -2.139  -1.949  1.00 0.00 ? 56  HIS A C    8  
ATOM   8982  O  O    . HIS A 1 56 ? 4.507   -2.638  -2.993  1.00 0.00 ? 56  HIS A O    8  
ATOM   8983  C  CB   . HIS A 1 56 ? 1.759   -1.236  -1.784  1.00 0.00 ? 56  HIS A CB   8  
ATOM   8984  C  CG   . HIS A 1 56 ? 1.384   -2.559  -2.378  1.00 0.00 ? 56  HIS A CG   8  
ATOM   8985  N  ND1  . HIS A 1 56 ? 0.976   -2.708  -3.686  1.00 0.00 ? 56  HIS A ND1  8  
ATOM   8986  C  CD2  . HIS A 1 56 ? 1.360   -3.798  -1.834  1.00 0.00 ? 56  HIS A CD2  8  
ATOM   8987  C  CE1  . HIS A 1 56 ? 0.714   -3.982  -3.921  1.00 0.00 ? 56  HIS A CE1  8  
ATOM   8988  N  NE2  . HIS A 1 56 ? 0.940   -4.664  -2.813  1.00 0.00 ? 56  HIS A NE2  8  
ATOM   8989  H  H    . HIS A 1 56 ? 3.188   -0.588  -4.073  1.00 0.00 ? 56  HIS A H    8  
ATOM   8990  H  HA   . HIS A 1 56 ? 3.543   -0.229  -1.169  1.00 0.00 ? 56  HIS A HA   8  
ATOM   8991  H  HB2  . HIS A 1 56 ? 1.538   -1.272  -0.728  1.00 0.00 ? 56  HIS A HB2  8  
ATOM   8992  H  HB3  . HIS A 1 56 ? 1.145   -0.477  -2.249  1.00 0.00 ? 56  HIS A HB3  8  
ATOM   8993  H  HD1  . HIS A 1 56 ? 0.889   -1.988  -4.344  1.00 0.00 ? 56  HIS A HD1  8  
ATOM   8994  H  HD2  . HIS A 1 56 ? 1.621   -4.058  -0.818  1.00 0.00 ? 56  HIS A HD2  8  
ATOM   8995  H  HE1  . HIS A 1 56 ? 0.375   -4.395  -4.859  1.00 0.00 ? 56  HIS A HE1  8  
ATOM   8996  H  HE2  . HIS A 1 56 ? 0.744   -5.616  -2.687  1.00 0.00 ? 56  HIS A HE2  8  
ATOM   8997  N  N    . PHE A 1 57 ? 4.337   -2.652  -0.749  1.00 0.00 ? 57  PHE A N    8  
ATOM   8998  C  CA   . PHE A 1 57 ? 5.142   -3.857  -0.586  1.00 0.00 ? 57  PHE A CA   8  
ATOM   8999  C  C    . PHE A 1 57 ? 4.415   -4.884  0.277   1.00 0.00 ? 57  PHE A C    8  
ATOM   9000  O  O    . PHE A 1 57 ? 3.425   -4.568  0.938   1.00 0.00 ? 57  PHE A O    8  
ATOM   9001  C  CB   . PHE A 1 57 ? 6.494   -3.513  0.041   1.00 0.00 ? 57  PHE A CB   8  
ATOM   9002  C  CG   . PHE A 1 57 ? 7.543   -3.135  -0.965  1.00 0.00 ? 57  PHE A CG   8  
ATOM   9003  C  CD1  . PHE A 1 57 ? 8.331   -4.107  -1.562  1.00 0.00 ? 57  PHE A CD1  8  
ATOM   9004  C  CD2  . PHE A 1 57 ? 7.742   -1.809  -1.314  1.00 0.00 ? 57  PHE A CD2  8  
ATOM   9005  C  CE1  . PHE A 1 57 ? 9.297   -3.763  -2.488  1.00 0.00 ? 57  PHE A CE1  8  
ATOM   9006  C  CE2  . PHE A 1 57 ? 8.706   -1.460  -2.240  1.00 0.00 ? 57  PHE A CE2  8  
ATOM   9007  C  CZ   . PHE A 1 57 ? 9.486   -2.437  -2.827  1.00 0.00 ? 57  PHE A CZ   8  
ATOM   9008  H  H    . PHE A 1 57 ? 3.973   -2.209  0.046   1.00 0.00 ? 57  PHE A H    8  
ATOM   9009  H  HA   . PHE A 1 57 ? 5.306   -4.280  -1.566  1.00 0.00 ? 57  PHE A HA   8  
ATOM   9010  H  HB2  . PHE A 1 57 ? 6.367   -2.680  0.716   1.00 0.00 ? 57  PHE A HB2  8  
ATOM   9011  H  HB3  . PHE A 1 57 ? 6.854   -4.367  0.594   1.00 0.00 ? 57  PHE A HB3  8  
ATOM   9012  H  HD1  . PHE A 1 57 ? 8.184   -5.144  -1.297  1.00 0.00 ? 57  PHE A HD1  8  
ATOM   9013  H  HD2  . PHE A 1 57 ? 7.134   -1.043  -0.855  1.00 0.00 ? 57  PHE A HD2  8  
ATOM   9014  H  HE1  . PHE A 1 57 ? 9.904   -4.530  -2.945  1.00 0.00 ? 57  PHE A HE1  8  
ATOM   9015  H  HE2  . PHE A 1 57 ? 8.852   -0.422  -2.503  1.00 0.00 ? 57  PHE A HE2  8  
ATOM   9016  H  HZ   . PHE A 1 57 ? 10.239  -2.167  -3.551  1.00 0.00 ? 57  PHE A HZ   8  
ATOM   9017  N  N    . PHE A 1 58 ? 4.912   -6.117  0.265   1.00 0.00 ? 58  PHE A N    8  
ATOM   9018  C  CA   . PHE A 1 58 ? 4.310   -7.192  1.045   1.00 0.00 ? 58  PHE A CA   8  
ATOM   9019  C  C    . PHE A 1 58 ? 5.230   -7.618  2.185   1.00 0.00 ? 58  PHE A C    8  
ATOM   9020  O  O    . PHE A 1 58 ? 6.300   -8.183  1.956   1.00 0.00 ? 58  PHE A O    8  
ATOM   9021  C  CB   . PHE A 1 58 ? 4.003   -8.392  0.147   1.00 0.00 ? 58  PHE A CB   8  
ATOM   9022  C  CG   . PHE A 1 58 ? 2.689   -8.280  -0.574  1.00 0.00 ? 58  PHE A CG   8  
ATOM   9023  C  CD1  . PHE A 1 58 ? 1.501   -8.196  0.134   1.00 0.00 ? 58  PHE A CD1  8  
ATOM   9024  C  CD2  . PHE A 1 58 ? 2.644   -8.261  -1.958  1.00 0.00 ? 58  PHE A CD2  8  
ATOM   9025  C  CE1  . PHE A 1 58 ? 0.291   -8.093  -0.526  1.00 0.00 ? 58  PHE A CE1  8  
ATOM   9026  C  CE2  . PHE A 1 58 ? 1.437   -8.158  -2.624  1.00 0.00 ? 58  PHE A CE2  8  
ATOM   9027  C  CZ   . PHE A 1 58 ? 0.259   -8.075  -1.907  1.00 0.00 ? 58  PHE A CZ   8  
ATOM   9028  H  H    . PHE A 1 58 ? 5.703   -6.308  -0.282  1.00 0.00 ? 58  PHE A H    8  
ATOM   9029  H  HA   . PHE A 1 58 ? 3.387   -6.820  1.463   1.00 0.00 ? 58  PHE A HA   8  
ATOM   9030  H  HB2  . PHE A 1 58 ? 4.781   -8.485  -0.595  1.00 0.00 ? 58  PHE A HB2  8  
ATOM   9031  H  HB3  . PHE A 1 58 ? 3.977   -9.286  0.751   1.00 0.00 ? 58  PHE A HB3  8  
ATOM   9032  H  HD1  . PHE A 1 58 ? 1.525   -8.210  1.214   1.00 0.00 ? 58  PHE A HD1  8  
ATOM   9033  H  HD2  . PHE A 1 58 ? 3.564   -8.326  -2.520  1.00 0.00 ? 58  PHE A HD2  8  
ATOM   9034  H  HE1  . PHE A 1 58 ? -0.628  -8.028  0.037   1.00 0.00 ? 58  PHE A HE1  8  
ATOM   9035  H  HE2  . PHE A 1 58 ? 1.414   -8.144  -3.703  1.00 0.00 ? 58  PHE A HE2  8  
ATOM   9036  H  HZ   . PHE A 1 58 ? -0.685  -7.994  -2.424  1.00 0.00 ? 58  PHE A HZ   8  
ATOM   9037  N  N    . VAL A 1 59 ? 4.807   -7.342  3.415   1.00 0.00 ? 59  VAL A N    8  
ATOM   9038  C  CA   . VAL A 1 59 ? 5.591   -7.696  4.591   1.00 0.00 ? 59  VAL A CA   8  
ATOM   9039  C  C    . VAL A 1 59 ? 4.696   -8.197  5.719   1.00 0.00 ? 59  VAL A C    8  
ATOM   9040  O  O    . VAL A 1 59 ? 3.818   -7.477  6.193   1.00 0.00 ? 59  VAL A O    8  
ATOM   9041  C  CB   . VAL A 1 59 ? 6.415   -6.498  5.099   1.00 0.00 ? 59  VAL A CB   8  
ATOM   9042  C  CG1  . VAL A 1 59 ? 7.138   -6.854  6.389   1.00 0.00 ? 59  VAL A CG1  8  
ATOM   9043  C  CG2  . VAL A 1 59 ? 7.401   -6.041  4.034   1.00 0.00 ? 59  VAL A CG2  8  
ATOM   9044  H  H    . VAL A 1 59 ? 3.946   -6.889  3.533   1.00 0.00 ? 59  VAL A H    8  
ATOM   9045  H  HA   . VAL A 1 59 ? 6.276   -8.484  4.311   1.00 0.00 ? 59  VAL A HA   8  
ATOM   9046  H  HB   . VAL A 1 59 ? 5.737   -5.683  5.305   1.00 0.00 ? 59  VAL A HB   8  
ATOM   9047  H  HG11 . VAL A 1 59 ? 6.706   -6.298  7.208   1.00 0.00 ? 59  VAL A HG11 8  
ATOM   9048  H  HG12 . VAL A 1 59 ? 7.037   -7.913  6.577   1.00 0.00 ? 59  VAL A HG12 8  
ATOM   9049  H  HG13 . VAL A 1 59 ? 8.184   -6.602  6.296   1.00 0.00 ? 59  VAL A HG13 8  
ATOM   9050  H  HG21 . VAL A 1 59 ? 7.351   -4.966  3.936   1.00 0.00 ? 59  VAL A HG21 8  
ATOM   9051  H  HG22 . VAL A 1 59 ? 8.402   -6.329  4.322   1.00 0.00 ? 59  VAL A HG22 8  
ATOM   9052  H  HG23 . VAL A 1 59 ? 7.152   -6.501  3.090   1.00 0.00 ? 59  VAL A HG23 8  
ATOM   9053  N  N    . GLU A 1 60 ? 4.925   -9.436  6.143   1.00 0.00 ? 60  GLU A N    8  
ATOM   9054  C  CA   . GLU A 1 60 ? 4.137   -10.033 7.215   1.00 0.00 ? 60  GLU A CA   8  
ATOM   9055  C  C    . GLU A 1 60 ? 2.646   -9.962  6.899   1.00 0.00 ? 60  GLU A C    8  
ATOM   9056  O  O    . GLU A 1 60 ? 1.825   -9.705  7.780   1.00 0.00 ? 60  GLU A O    8  
ATOM   9057  C  CB   . GLU A 1 60 ? 4.423   -9.326  8.542   1.00 0.00 ? 60  GLU A CB   8  
ATOM   9058  C  CG   . GLU A 1 60 ? 5.887   -9.359  8.947   1.00 0.00 ? 60  GLU A CG   8  
ATOM   9059  C  CD   . GLU A 1 60 ? 6.084   -9.168  10.438  1.00 0.00 ? 60  GLU A CD   8  
ATOM   9060  O  OE1  . GLU A 1 60 ? 5.227   -8.515  11.070  1.00 0.00 ? 60  GLU A OE1  8  
ATOM   9061  O  OE2  . GLU A 1 60 ? 7.095   -9.669  10.972  1.00 0.00 ? 60  GLU A OE2  8  
ATOM   9062  H  H    . GLU A 1 60 ? 5.639   -9.960  5.725   1.00 0.00 ? 60  GLU A H    8  
ATOM   9063  H  HA   . GLU A 1 60 ? 4.426   -11.070 7.301   1.00 0.00 ? 60  GLU A HA   8  
ATOM   9064  H  HB2  . GLU A 1 60 ? 4.116   -8.294  8.459   1.00 0.00 ? 60  GLU A HB2  8  
ATOM   9065  H  HB3  . GLU A 1 60 ? 3.845   -9.802  9.321   1.00 0.00 ? 60  GLU A HB3  8  
ATOM   9066  H  HG2  . GLU A 1 60 ? 6.304   -10.314 8.664   1.00 0.00 ? 60  GLU A HG2  8  
ATOM   9067  H  HG3  . GLU A 1 60 ? 6.409   -8.571  8.425   1.00 0.00 ? 60  GLU A HG3  8  
ATOM   9068  N  N    . ASP A 1 61 ? 2.304   -10.192 5.637   1.00 0.00 ? 61  ASP A N    8  
ATOM   9069  C  CA   . ASP A 1 61 ? 0.912   -10.156 5.203   1.00 0.00 ? 61  ASP A CA   8  
ATOM   9070  C  C    . ASP A 1 61 ? 0.329   -8.755  5.363   1.00 0.00 ? 61  ASP A C    8  
ATOM   9071  O  O    . ASP A 1 61 ? -0.861  -8.594  5.630   1.00 0.00 ? 61  ASP A O    8  
ATOM   9072  C  CB   . ASP A 1 61 ? 0.080   -11.161 6.001   1.00 0.00 ? 61  ASP A CB   8  
ATOM   9073  C  CG   . ASP A 1 61 ? -1.318  -11.332 5.439   1.00 0.00 ? 61  ASP A CG   8  
ATOM   9074  O  OD1  . ASP A 1 61 ? -1.449  -11.445 4.203   1.00 0.00 ? 61  ASP A OD1  8  
ATOM   9075  O  OD2  . ASP A 1 61 ? -2.280  -11.352 6.236   1.00 0.00 ? 61  ASP A OD2  8  
ATOM   9076  H  H    . ASP A 1 61 ? 3.004   -10.392 4.980   1.00 0.00 ? 61  ASP A H    8  
ATOM   9077  H  HA   . ASP A 1 61 ? 0.882   -10.427 4.159   1.00 0.00 ? 61  ASP A HA   8  
ATOM   9078  H  HB2  . ASP A 1 61 ? 0.574   -12.122 5.984   1.00 0.00 ? 61  ASP A HB2  8  
ATOM   9079  H  HB3  . ASP A 1 61 ? -0.001  -10.820 7.023   1.00 0.00 ? 61  ASP A HB3  8  
ATOM   9080  N  N    . GLN A 1 62 ? 1.178   -7.745  5.199   1.00 0.00 ? 62  GLN A N    8  
ATOM   9081  C  CA   . GLN A 1 62 ? 0.747   -6.358  5.327   1.00 0.00 ? 62  GLN A CA   8  
ATOM   9082  C  C    . GLN A 1 62 ? 1.252   -5.521  4.156   1.00 0.00 ? 62  GLN A C    8  
ATOM   9083  O  O    . GLN A 1 62 ? 2.015   -6.004  3.319   1.00 0.00 ? 62  GLN A O    8  
ATOM   9084  C  CB   . GLN A 1 62 ? 1.247   -5.766  6.645   1.00 0.00 ? 62  GLN A CB   8  
ATOM   9085  C  CG   . GLN A 1 62 ? 0.509   -6.290  7.866   1.00 0.00 ? 62  GLN A CG   8  
ATOM   9086  C  CD   . GLN A 1 62 ? 0.557   -5.326  9.036   1.00 0.00 ? 62  GLN A CD   8  
ATOM   9087  O  OE1  . GLN A 1 62 ? 0.155   -4.168  8.918   1.00 0.00 ? 62  GLN A OE1  8  
ATOM   9088  N  NE2  . GLN A 1 62 ? 1.050   -5.800  10.174  1.00 0.00 ? 62  GLN A NE2  8  
ATOM   9089  H  H    . GLN A 1 62 ? 2.114   -7.937  4.987   1.00 0.00 ? 62  GLN A H    8  
ATOM   9090  H  HA   . GLN A 1 62 ? -0.332  -6.344  5.323   1.00 0.00 ? 62  GLN A HA   8  
ATOM   9091  H  HB2  . GLN A 1 62 ? 2.295   -6.000  6.757   1.00 0.00 ? 62  GLN A HB2  8  
ATOM   9092  H  HB3  . GLN A 1 62 ? 1.128   -4.693  6.613   1.00 0.00 ? 62  GLN A HB3  8  
ATOM   9093  H  HG2  . GLN A 1 62 ? -0.525  -6.458  7.602   1.00 0.00 ? 62  GLN A HG2  8  
ATOM   9094  H  HG3  . GLN A 1 62 ? 0.958   -7.224  8.169   1.00 0.00 ? 62  GLN A HG3  8  
ATOM   9095  H  HE21 . GLN A 1 62 ? 1.353   -6.733  10.194  1.00 0.00 ? 62  GLN A HE21 8  
ATOM   9096  H  HE22 . GLN A 1 62 ? 1.094   -5.199  10.945  1.00 0.00 ? 62  GLN A HE22 8  
ATOM   9097  N  N    . ILE A 1 63 ? 0.821   -4.265  4.104   1.00 0.00 ? 63  ILE A N    8  
ATOM   9098  C  CA   . ILE A 1 63 ? 1.230   -3.361  3.036   1.00 0.00 ? 63  ILE A CA   8  
ATOM   9099  C  C    . ILE A 1 63 ? 1.878   -2.101  3.600   1.00 0.00 ? 63  ILE A C    8  
ATOM   9100  O  O    . ILE A 1 63 ? 1.396   -1.527  4.577   1.00 0.00 ? 63  ILE A O    8  
ATOM   9101  C  CB   . ILE A 1 63 ? 0.036   -2.959  2.150   1.00 0.00 ? 63  ILE A CB   8  
ATOM   9102  C  CG1  . ILE A 1 63 ? -1.090  -2.379  3.008   1.00 0.00 ? 63  ILE A CG1  8  
ATOM   9103  C  CG2  . ILE A 1 63 ? -0.459  -4.156  1.353   1.00 0.00 ? 63  ILE A CG2  8  
ATOM   9104  C  CD1  . ILE A 1 63 ? -2.037  -1.485  2.238   1.00 0.00 ? 63  ILE A CD1  8  
ATOM   9105  H  H    . ILE A 1 63 ? 0.214   -3.938  4.800   1.00 0.00 ? 63  ILE A H    8  
ATOM   9106  H  HA   . ILE A 1 63 ? 1.952   -3.879  2.420   1.00 0.00 ? 63  ILE A HA   8  
ATOM   9107  H  HB   . ILE A 1 63 ? 0.372   -2.207  1.452   1.00 0.00 ? 63  ILE A HB   8  
ATOM   9108  H  HG12 . ILE A 1 63 ? -1.667  -3.188  3.428   1.00 0.00 ? 63  ILE A HG12 8  
ATOM   9109  H  HG13 . ILE A 1 63 ? -0.659  -1.796  3.808   1.00 0.00 ? 63  ILE A HG13 8  
ATOM   9110  H  HG21 . ILE A 1 63 ? 0.385   -4.739  1.016   1.00 0.00 ? 63  ILE A HG21 8  
ATOM   9111  H  HG22 . ILE A 1 63 ? -1.090  -4.769  1.980   1.00 0.00 ? 63  ILE A HG22 8  
ATOM   9112  H  HG23 . ILE A 1 63 ? -1.024  -3.813  0.500   1.00 0.00 ? 63  ILE A HG23 8  
ATOM   9113  H  HD11 . ILE A 1 63 ? -2.842  -2.079  1.829   1.00 0.00 ? 63  ILE A HD11 8  
ATOM   9114  H  HD12 . ILE A 1 63 ? -2.442  -0.735  2.899   1.00 0.00 ? 63  ILE A HD12 8  
ATOM   9115  H  HD13 . ILE A 1 63 ? -1.502  -1.004  1.432   1.00 0.00 ? 63  ILE A HD13 8  
ATOM   9116  N  N    . TYR A 1 64 ? 2.971   -1.675  2.977   1.00 0.00 ? 64  TYR A N    8  
ATOM   9117  C  CA   . TYR A 1 64 ? 3.685   -0.482  3.417   1.00 0.00 ? 64  TYR A CA   8  
ATOM   9118  C  C    . TYR A 1 64 ? 4.277   0.268   2.228   1.00 0.00 ? 64  TYR A C    8  
ATOM   9119  O  O    . TYR A 1 64 ? 4.243   -0.213  1.095   1.00 0.00 ? 64  TYR A O    8  
ATOM   9120  C  CB   . TYR A 1 64 ? 4.795   -0.860  4.400   1.00 0.00 ? 64  TYR A CB   8  
ATOM   9121  C  CG   . TYR A 1 64 ? 4.311   -1.685  5.571   1.00 0.00 ? 64  TYR A CG   8  
ATOM   9122  C  CD1  . TYR A 1 64 ? 3.808   -1.076  6.714   1.00 0.00 ? 64  TYR A CD1  8  
ATOM   9123  C  CD2  . TYR A 1 64 ? 4.359   -3.073  5.535   1.00 0.00 ? 64  TYR A CD2  8  
ATOM   9124  C  CE1  . TYR A 1 64 ? 3.365   -1.826  7.787   1.00 0.00 ? 64  TYR A CE1  8  
ATOM   9125  C  CE2  . TYR A 1 64 ? 3.917   -3.831  6.603   1.00 0.00 ? 64  TYR A CE2  8  
ATOM   9126  C  CZ   . TYR A 1 64 ? 3.422   -3.203  7.726   1.00 0.00 ? 64  TYR A CZ   8  
ATOM   9127  O  OH   . TYR A 1 64 ? 2.982   -3.954  8.792   1.00 0.00 ? 64  TYR A OH   8  
ATOM   9128  H  H    . TYR A 1 64 ? 3.306   -2.174  2.204   1.00 0.00 ? 64  TYR A H    8  
ATOM   9129  H  HA   . TYR A 1 64 ? 2.978   0.162   3.919   1.00 0.00 ? 64  TYR A HA   8  
ATOM   9130  H  HB2  . TYR A 1 64 ? 5.547   -1.433  3.880   1.00 0.00 ? 64  TYR A HB2  8  
ATOM   9131  H  HB3  . TYR A 1 64 ? 5.242   0.042   4.791   1.00 0.00 ? 64  TYR A HB3  8  
ATOM   9132  H  HD1  . TYR A 1 64 ? 3.765   0.002   6.758   1.00 0.00 ? 64  TYR A HD1  8  
ATOM   9133  H  HD2  . TYR A 1 64 ? 4.748   -3.562  4.654   1.00 0.00 ? 64  TYR A HD2  8  
ATOM   9134  H  HE1  . TYR A 1 64 ? 2.977   -1.335  8.667   1.00 0.00 ? 64  TYR A HE1  8  
ATOM   9135  H  HE2  . TYR A 1 64 ? 3.962   -4.909  6.556   1.00 0.00 ? 64  TYR A HE2  8  
ATOM   9136  H  HH   . TYR A 1 64 ? 3.687   -4.034  9.439   1.00 0.00 ? 64  TYR A HH   8  
ATOM   9137  N  N    . CYS A 1 65 ? 4.821   1.451   2.494   1.00 0.00 ? 65  CYS A N    8  
ATOM   9138  C  CA   . CYS A 1 65 ? 5.422   2.270   1.449   1.00 0.00 ? 65  CYS A CA   8  
ATOM   9139  C  C    . CYS A 1 65 ? 6.873   1.864   1.206   1.00 0.00 ? 65  CYS A C    8  
ATOM   9140  O  O    . CYS A 1 65 ? 7.587   1.492   2.137   1.00 0.00 ? 65  CYS A O    8  
ATOM   9141  C  CB   . CYS A 1 65 ? 5.352   3.750   1.828   1.00 0.00 ? 65  CYS A CB   8  
ATOM   9142  S  SG   . CYS A 1 65 ? 6.144   4.149   3.419   1.00 0.00 ? 65  CYS A SG   8  
ATOM   9143  H  H    . CYS A 1 65 ? 4.819   1.782   3.418   1.00 0.00 ? 65  CYS A H    8  
ATOM   9144  H  HA   . CYS A 1 65 ? 4.861   2.113   0.540   1.00 0.00 ? 65  CYS A HA   8  
ATOM   9145  H  HB2  . CYS A 1 65 ? 5.842   4.334   1.062   1.00 0.00 ? 65  CYS A HB2  8  
ATOM   9146  H  HB3  . CYS A 1 65 ? 4.316   4.049   1.892   1.00 0.00 ? 65  CYS A HB3  8  
ATOM   9147  N  N    . GLU A 1 66 ? 7.301   1.940   -0.050  1.00 0.00 ? 66  GLU A N    8  
ATOM   9148  C  CA   . GLU A 1 66 ? 8.666   1.580   -0.414  1.00 0.00 ? 66  GLU A CA   8  
ATOM   9149  C  C    . GLU A 1 66 ? 9.651   2.015   0.667   1.00 0.00 ? 66  GLU A C    8  
ATOM   9150  O  O    . GLU A 1 66 ? 10.563  1.272   1.029   1.00 0.00 ? 66  GLU A O    8  
ATOM   9151  C  CB   . GLU A 1 66 ? 9.046   2.218   -1.752  1.00 0.00 ? 66  GLU A CB   8  
ATOM   9152  C  CG   . GLU A 1 66 ? 10.480  1.943   -2.172  1.00 0.00 ? 66  GLU A CG   8  
ATOM   9153  C  CD   . GLU A 1 66 ? 10.851  2.635   -3.470  1.00 0.00 ? 66  GLU A CD   8  
ATOM   9154  O  OE1  . GLU A 1 66 ? 10.603  3.854   -3.584  1.00 0.00 ? 66  GLU A OE1  8  
ATOM   9155  O  OE2  . GLU A 1 66 ? 11.388  1.958   -4.371  1.00 0.00 ? 66  GLU A OE2  8  
ATOM   9156  H  H    . GLU A 1 66 ? 6.684   2.244   -0.748  1.00 0.00 ? 66  GLU A H    8  
ATOM   9157  H  HA   . GLU A 1 66 ? 8.711   0.506   -0.513  1.00 0.00 ? 66  GLU A HA   8  
ATOM   9158  H  HB2  . GLU A 1 66 ? 8.388   1.837   -2.519  1.00 0.00 ? 66  GLU A HB2  8  
ATOM   9159  H  HB3  . GLU A 1 66 ? 8.914   3.287   -1.677  1.00 0.00 ? 66  GLU A HB3  8  
ATOM   9160  H  HG2  . GLU A 1 66 ? 11.143  2.293   -1.395  1.00 0.00 ? 66  GLU A HG2  8  
ATOM   9161  H  HG3  . GLU A 1 66 ? 10.607  0.878   -2.300  1.00 0.00 ? 66  GLU A HG3  8  
ATOM   9162  N  N    . LYS A 1 67 ? 9.459   3.226   1.180   1.00 0.00 ? 67  LYS A N    8  
ATOM   9163  C  CA   . LYS A 1 67 ? 10.328  3.763   2.221   1.00 0.00 ? 67  LYS A CA   8  
ATOM   9164  C  C    . LYS A 1 67 ? 10.362  2.837   3.433   1.00 0.00 ? 67  LYS A C    8  
ATOM   9165  O  O    . LYS A 1 67 ? 11.393  2.237   3.740   1.00 0.00 ? 67  LYS A O    8  
ATOM   9166  C  CB   . LYS A 1 67 ? 9.853   5.155   2.643   1.00 0.00 ? 67  LYS A CB   8  
ATOM   9167  C  CG   . LYS A 1 67 ? 10.789  5.847   3.618   1.00 0.00 ? 67  LYS A CG   8  
ATOM   9168  C  CD   . LYS A 1 67 ? 10.389  5.581   5.060   1.00 0.00 ? 67  LYS A CD   8  
ATOM   9169  C  CE   . LYS A 1 67 ? 11.218  6.407   6.031   1.00 0.00 ? 67  LYS A CE   8  
ATOM   9170  N  NZ   . LYS A 1 67 ? 10.601  7.736   6.296   1.00 0.00 ? 67  LYS A NZ   8  
ATOM   9171  H  H    . LYS A 1 67 ? 8.714   3.772   0.851   1.00 0.00 ? 67  LYS A H    8  
ATOM   9172  H  HA   . LYS A 1 67 ? 11.325  3.840   1.814   1.00 0.00 ? 67  LYS A HA   8  
ATOM   9173  H  HB2  . LYS A 1 67 ? 9.763   5.774   1.762   1.00 0.00 ? 67  LYS A HB2  8  
ATOM   9174  H  HB3  . LYS A 1 67 ? 8.883   5.065   3.110   1.00 0.00 ? 67  LYS A HB3  8  
ATOM   9175  H  HG2  . LYS A 1 67 ? 11.793  5.482   3.462   1.00 0.00 ? 67  LYS A HG2  8  
ATOM   9176  H  HG3  . LYS A 1 67 ? 10.759  6.913   3.437   1.00 0.00 ? 67  LYS A HG3  8  
ATOM   9177  H  HD2  . LYS A 1 67 ? 9.347   5.834   5.188   1.00 0.00 ? 67  LYS A HD2  8  
ATOM   9178  H  HD3  . LYS A 1 67 ? 10.535  4.532   5.277   1.00 0.00 ? 67  LYS A HD3  8  
ATOM   9179  H  HE2  . LYS A 1 67 ? 11.303  5.867   6.961   1.00 0.00 ? 67  LYS A HE2  8  
ATOM   9180  H  HE3  . LYS A 1 67 ? 12.201  6.554   5.609   1.00 0.00 ? 67  LYS A HE3  8  
ATOM   9181  H  HZ1  . LYS A 1 67 ? 9.576   7.695   6.121   1.00 0.00 ? 67  LYS A HZ1  8  
ATOM   9182  H  HZ2  . LYS A 1 67 ? 11.019  8.455   5.673   1.00 0.00 ? 67  LYS A HZ2  8  
ATOM   9183  H  HZ3  . LYS A 1 67 ? 10.762  8.014   7.285   1.00 0.00 ? 67  LYS A HZ3  8  
ATOM   9184  N  N    . HIS A 1 68 ? 9.228   2.724   4.117   1.00 0.00 ? 68  HIS A N    8  
ATOM   9185  C  CA   . HIS A 1 68 ? 9.128   1.869   5.295   1.00 0.00 ? 68  HIS A CA   8  
ATOM   9186  C  C    . HIS A 1 68 ? 9.447   0.419   4.942   1.00 0.00 ? 68  HIS A C    8  
ATOM   9187  O  O    . HIS A 1 68 ? 10.320  -0.200  5.549   1.00 0.00 ? 68  HIS A O    8  
ATOM   9188  C  CB   . HIS A 1 68 ? 7.728   1.963   5.901   1.00 0.00 ? 68  HIS A CB   8  
ATOM   9189  C  CG   . HIS A 1 68 ? 7.544   3.142   6.806   1.00 0.00 ? 68  HIS A CG   8  
ATOM   9190  N  ND1  . HIS A 1 68 ? 6.333   3.779   6.975   1.00 0.00 ? 68  HIS A ND1  8  
ATOM   9191  C  CD2  . HIS A 1 68 ? 8.427   3.799   7.594   1.00 0.00 ? 68  HIS A CD2  8  
ATOM   9192  C  CE1  . HIS A 1 68 ? 6.479   4.778   7.828   1.00 0.00 ? 68  HIS A CE1  8  
ATOM   9193  N  NE2  . HIS A 1 68 ? 7.741   4.811   8.219   1.00 0.00 ? 68  HIS A NE2  8  
ATOM   9194  H  H    . HIS A 1 68 ? 8.441   3.227   3.824   1.00 0.00 ? 68  HIS A H    8  
ATOM   9195  H  HA   . HIS A 1 68 ? 9.849   2.217   6.019   1.00 0.00 ? 68  HIS A HA   8  
ATOM   9196  H  HB2  . HIS A 1 68 ? 7.002   2.040   5.105   1.00 0.00 ? 68  HIS A HB2  8  
ATOM   9197  H  HB3  . HIS A 1 68 ? 7.531   1.069   6.476   1.00 0.00 ? 68  HIS A HB3  8  
ATOM   9198  H  HD2  . HIS A 1 68 ? 9.477   3.570   7.711   1.00 0.00 ? 68  HIS A HD2  8  
ATOM   9199  H  HE1  . HIS A 1 68 ? 5.701   5.453   8.151   1.00 0.00 ? 68  HIS A HE1  8  
ATOM   9200  H  HE2  . HIS A 1 68 ? 8.138   5.506   8.783   1.00 0.00 ? 68  HIS A HE2  8  
ATOM   9201  N  N    . ALA A 1 69 ? 8.732   -0.116  3.958   1.00 0.00 ? 69  ALA A N    8  
ATOM   9202  C  CA   . ALA A 1 69 ? 8.940   -1.492  3.524   1.00 0.00 ? 69  ALA A CA   8  
ATOM   9203  C  C    . ALA A 1 69 ? 10.408  -1.888  3.637   1.00 0.00 ? 69  ALA A C    8  
ATOM   9204  O  O    . ALA A 1 69 ? 10.753  -2.835  4.344   1.00 0.00 ? 69  ALA A O    8  
ATOM   9205  C  CB   . ALA A 1 69 ? 8.451   -1.674  2.094   1.00 0.00 ? 69  ALA A CB   8  
ATOM   9206  H  H    . ALA A 1 69 ? 8.050   0.428   3.512   1.00 0.00 ? 69  ALA A H    8  
ATOM   9207  H  HA   . ALA A 1 69 ? 8.353   -2.136  4.164   1.00 0.00 ? 69  ALA A HA   8  
ATOM   9208  H  HB1  . ALA A 1 69 ? 9.095   -1.126  1.422   1.00 0.00 ? 69  ALA A HB1  8  
ATOM   9209  H  HB2  . ALA A 1 69 ? 8.471   -2.723  1.838   1.00 0.00 ? 69  ALA A HB2  8  
ATOM   9210  H  HB3  . ALA A 1 69 ? 7.441   -1.301  2.010   1.00 0.00 ? 69  ALA A HB3  8  
ATOM   9211  N  N    . ARG A 1 70 ? 11.269  -1.157  2.936   1.00 0.00 ? 70  ARG A N    8  
ATOM   9212  C  CA   . ARG A 1 70 ? 12.700  -1.433  2.957   1.00 0.00 ? 70  ARG A CA   8  
ATOM   9213  C  C    . ARG A 1 70 ? 13.208  -1.561  4.391   1.00 0.00 ? 70  ARG A C    8  
ATOM   9214  O  O    . ARG A 1 70 ? 13.897  -2.523  4.731   1.00 0.00 ? 70  ARG A O    8  
ATOM   9215  C  CB   . ARG A 1 70 ? 13.466  -0.326  2.231   1.00 0.00 ? 70  ARG A CB   8  
ATOM   9216  C  CG   . ARG A 1 70 ? 13.416  -0.445  0.716   1.00 0.00 ? 70  ARG A CG   8  
ATOM   9217  C  CD   . ARG A 1 70 ? 14.379  0.526   0.050   1.00 0.00 ? 70  ARG A CD   8  
ATOM   9218  N  NE   . ARG A 1 70 ? 15.742  0.004   0.010   1.00 0.00 ? 70  ARG A NE   8  
ATOM   9219  C  CZ   . ARG A 1 70 ? 16.191  -0.806  -0.942  1.00 0.00 ? 70  ARG A CZ   8  
ATOM   9220  N  NH1  . ARG A 1 70 ? 15.390  -1.185  -1.928  1.00 0.00 ? 70  ARG A NH1  8  
ATOM   9221  N  NH2  . ARG A 1 70 ? 17.446  -1.239  -0.910  1.00 0.00 ? 70  ARG A NH2  8  
ATOM   9222  H  H    . ARG A 1 70 ? 10.934  -0.414  2.392   1.00 0.00 ? 70  ARG A H    8  
ATOM   9223  H  HA   . ARG A 1 70 ? 12.865  -2.369  2.445   1.00 0.00 ? 70  ARG A HA   8  
ATOM   9224  H  HB2  . ARG A 1 70 ? 13.045  0.629   2.508   1.00 0.00 ? 70  ARG A HB2  8  
ATOM   9225  H  HB3  . ARG A 1 70 ? 14.500  -0.358  2.539   1.00 0.00 ? 70  ARG A HB3  8  
ATOM   9226  H  HG2  . ARG A 1 70 ? 13.686  -1.452  0.434   1.00 0.00 ? 70  ARG A HG2  8  
ATOM   9227  H  HG3  . ARG A 1 70 ? 12.413  -0.231  0.380   1.00 0.00 ? 70  ARG A HG3  8  
ATOM   9228  H  HD2  . ARG A 1 70 ? 14.044  0.708   -0.961  1.00 0.00 ? 70  ARG A HD2  8  
ATOM   9229  H  HD3  . ARG A 1 70 ? 14.374  1.453   0.603   1.00 0.00 ? 70  ARG A HD3  8  
ATOM   9230  H  HE   . ARG A 1 70 ? 16.352  0.272   0.728   1.00 0.00 ? 70  ARG A HE   8  
ATOM   9231  H  HH11 . ARG A 1 70 ? 14.445  -0.860  -1.955  1.00 0.00 ? 70  ARG A HH11 8  
ATOM   9232  H  HH12 . ARG A 1 70 ? 15.731  -1.795  -2.644  1.00 0.00 ? 70  ARG A HH12 8  
ATOM   9233  H  HH21 . ARG A 1 70 ? 18.053  -0.955  -0.169  1.00 0.00 ? 70  ARG A HH21 8  
ATOM   9234  H  HH22 . ARG A 1 70 ? 17.782  -1.849  -1.626  1.00 0.00 ? 70  ARG A HH22 8  
ATOM   9235  N  N    . GLU A 1 71 ? 12.864  -0.585  5.225   1.00 0.00 ? 71  GLU A N    8  
ATOM   9236  C  CA   . GLU A 1 71 ? 13.287  -0.589  6.620   1.00 0.00 ? 71  GLU A CA   8  
ATOM   9237  C  C    . GLU A 1 71 ? 12.874  -1.886  7.310   1.00 0.00 ? 71  GLU A C    8  
ATOM   9238  O  O    . GLU A 1 71 ? 13.637  -2.457  8.089   1.00 0.00 ? 71  GLU A O    8  
ATOM   9239  C  CB   . GLU A 1 71 ? 12.688  0.609   7.361   1.00 0.00 ? 71  GLU A CB   8  
ATOM   9240  C  CG   . GLU A 1 71 ? 13.032  1.948   6.731   1.00 0.00 ? 71  GLU A CG   8  
ATOM   9241  C  CD   . GLU A 1 71 ? 14.340  2.516   7.245   1.00 0.00 ? 71  GLU A CD   8  
ATOM   9242  O  OE1  . GLU A 1 71 ? 14.681  2.254   8.417   1.00 0.00 ? 71  GLU A OE1  8  
ATOM   9243  O  OE2  . GLU A 1 71 ? 15.023  3.223   6.475   1.00 0.00 ? 71  GLU A OE2  8  
ATOM   9244  H  H    . GLU A 1 71 ? 12.313  0.155   4.894   1.00 0.00 ? 71  GLU A H    8  
ATOM   9245  H  HA   . GLU A 1 71 ? 14.363  -0.511  6.641   1.00 0.00 ? 71  GLU A HA   8  
ATOM   9246  H  HB2  . GLU A 1 71 ? 11.613  0.506   7.376   1.00 0.00 ? 71  GLU A HB2  8  
ATOM   9247  H  HB3  . GLU A 1 71 ? 13.055  0.608   8.377   1.00 0.00 ? 71  GLU A HB3  8  
ATOM   9248  H  HG2  . GLU A 1 71 ? 13.109  1.819   5.661   1.00 0.00 ? 71  GLU A HG2  8  
ATOM   9249  H  HG3  . GLU A 1 71 ? 12.240  2.649   6.951   1.00 0.00 ? 71  GLU A HG3  8  
ATOM   9250  N  N    . ARG A 1 72 ? 11.661  -2.344  7.019   1.00 0.00 ? 72  ARG A N    8  
ATOM   9251  C  CA   . ARG A 1 72 ? 11.145  -3.572  7.612   1.00 0.00 ? 72  ARG A CA   8  
ATOM   9252  C  C    . ARG A 1 72 ? 11.910  -4.788  7.096   1.00 0.00 ? 72  ARG A C    8  
ATOM   9253  O  O    . ARG A 1 72 ? 12.400  -5.603  7.878   1.00 0.00 ? 72  ARG A O    8  
ATOM   9254  C  CB   . ARG A 1 72 ? 9.655   -3.726  7.304   1.00 0.00 ? 72  ARG A CB   8  
ATOM   9255  C  CG   . ARG A 1 72 ? 8.759   -2.876  8.190   1.00 0.00 ? 72  ARG A CG   8  
ATOM   9256  C  CD   . ARG A 1 72 ? 7.289   -3.186  7.956   1.00 0.00 ? 72  ARG A CD   8  
ATOM   9257  N  NE   . ARG A 1 72 ? 6.457   -2.776  9.084   1.00 0.00 ? 72  ARG A NE   8  
ATOM   9258  C  CZ   . ARG A 1 72 ? 6.111   -1.515  9.322   1.00 0.00 ? 72  ARG A CZ   8  
ATOM   9259  N  NH1  . ARG A 1 72 ? 6.523   -0.548  8.515   1.00 0.00 ? 72  ARG A NH1  8  
ATOM   9260  N  NH2  . ARG A 1 72 ? 5.351   -1.221  10.369  1.00 0.00 ? 72  ARG A NH2  8  
ATOM   9261  H  H    . ARG A 1 72 ? 11.099  -1.844  6.390   1.00 0.00 ? 72  ARG A H    8  
ATOM   9262  H  HA   . ARG A 1 72 ? 11.278  -3.505  8.681   1.00 0.00 ? 72  ARG A HA   8  
ATOM   9263  H  HB2  . ARG A 1 72 ? 9.480   -3.442  6.276   1.00 0.00 ? 72  ARG A HB2  8  
ATOM   9264  H  HB3  . ARG A 1 72 ? 9.377   -4.761  7.435   1.00 0.00 ? 72  ARG A HB3  8  
ATOM   9265  H  HG2  . ARG A 1 72 ? 8.997   -3.076  9.224   1.00 0.00 ? 72  ARG A HG2  8  
ATOM   9266  H  HG3  . ARG A 1 72 ? 8.937   -1.834  7.972   1.00 0.00 ? 72  ARG A HG3  8  
ATOM   9267  H  HD2  . ARG A 1 72 ? 6.960   -2.663  7.070   1.00 0.00 ? 72  ARG A HD2  8  
ATOM   9268  H  HD3  . ARG A 1 72 ? 7.178   -4.250  7.808   1.00 0.00 ? 72  ARG A HD3  8  
ATOM   9269  H  HE   . ARG A 1 72 ? 6.141   -3.475  9.694   1.00 0.00 ? 72  ARG A HE   8  
ATOM   9270  H  HH11 . ARG A 1 72 ? 7.095   -0.767  7.725   1.00 0.00 ? 72  ARG A HH11 8  
ATOM   9271  H  HH12 . ARG A 1 72 ? 6.261   0.400   8.696   1.00 0.00 ? 72  ARG A HH12 8  
ATOM   9272  H  HH21 . ARG A 1 72 ? 5.039   -1.948  10.980  1.00 0.00 ? 72  ARG A HH21 8  
ATOM   9273  H  HH22 . ARG A 1 72 ? 5.092   -0.272  10.548  1.00 0.00 ? 72  ARG A HH22 8  
ATOM   9274  N  N    . VAL A 1 73 ? 12.009  -4.902  5.776   1.00 0.00 ? 73  VAL A N    8  
ATOM   9275  C  CA   . VAL A 1 73 ? 12.714  -6.018  5.156   1.00 0.00 ? 73  VAL A CA   8  
ATOM   9276  C  C    . VAL A 1 73 ? 13.910  -6.448  5.998   1.00 0.00 ? 73  VAL A C    8  
ATOM   9277  O  O    . VAL A 1 73 ? 13.981  -7.588  6.456   1.00 0.00 ? 73  VAL A O    8  
ATOM   9278  C  CB   . VAL A 1 73 ? 13.200  -5.656  3.740   1.00 0.00 ? 73  VAL A CB   8  
ATOM   9279  C  CG1  . VAL A 1 73 ? 14.010  -6.799  3.145   1.00 0.00 ? 73  VAL A CG1  8  
ATOM   9280  C  CG2  . VAL A 1 73 ? 12.021  -5.306  2.845   1.00 0.00 ? 73  VAL A CG2  8  
ATOM   9281  H  H    . VAL A 1 73 ? 11.597  -4.220  5.205   1.00 0.00 ? 73  VAL A H    8  
ATOM   9282  H  HA   . VAL A 1 73 ? 12.025  -6.846  5.076   1.00 0.00 ? 73  VAL A HA   8  
ATOM   9283  H  HB   . VAL A 1 73 ? 13.841  -4.790  3.811   1.00 0.00 ? 73  VAL A HB   8  
ATOM   9284  H  HG11 . VAL A 1 73 ? 13.419  -7.308  2.398   1.00 0.00 ? 73  VAL A HG11 8  
ATOM   9285  H  HG12 . VAL A 1 73 ? 14.907  -6.406  2.690   1.00 0.00 ? 73  VAL A HG12 8  
ATOM   9286  H  HG13 . VAL A 1 73 ? 14.277  -7.495  3.927   1.00 0.00 ? 73  VAL A HG13 8  
ATOM   9287  H  HG21 . VAL A 1 73 ? 12.063  -4.258  2.589   1.00 0.00 ? 73  VAL A HG21 8  
ATOM   9288  H  HG22 . VAL A 1 73 ? 12.065  -5.899  1.942   1.00 0.00 ? 73  VAL A HG22 8  
ATOM   9289  H  HG23 . VAL A 1 73 ? 11.099  -5.513  3.367   1.00 0.00 ? 73  VAL A HG23 8  
ATOM   9290  N  N    . SER A 1 74 ? 14.848  -5.527  6.198   1.00 0.00 ? 74  SER A N    8  
ATOM   9291  C  CA   . SER A 1 74 ? 16.043  -5.812  6.982   1.00 0.00 ? 74  SER A CA   8  
ATOM   9292  C  C    . SER A 1 74 ? 15.932  -5.210  8.380   1.00 0.00 ? 74  SER A C    8  
ATOM   9293  O  O    . SER A 1 74 ? 15.777  -3.999  8.536   1.00 0.00 ? 74  SER A O    8  
ATOM   9294  C  CB   . SER A 1 74 ? 17.285  -5.265  6.276   1.00 0.00 ? 74  SER A CB   8  
ATOM   9295  O  OG   . SER A 1 74 ? 17.784  -6.194  5.329   1.00 0.00 ? 74  SER A OG   8  
ATOM   9296  H  H    . SER A 1 74 ? 14.733  -4.636  5.806   1.00 0.00 ? 74  SER A H    8  
ATOM   9297  H  HA   . SER A 1 74 ? 16.134  -6.884  7.071   1.00 0.00 ? 74  SER A HA   8  
ATOM   9298  H  HB2  . SER A 1 74 ? 17.030  -4.349  5.764   1.00 0.00 ? 74  SER A HB2  8  
ATOM   9299  H  HB3  . SER A 1 74 ? 18.054  -5.066  7.008   1.00 0.00 ? 74  SER A HB3  8  
ATOM   9300  H  HG   . SER A 1 74 ? 18.626  -6.540  5.634   1.00 0.00 ? 74  SER A HG   8  
ATOM   9301  N  N    . GLY A 1 75 ? 16.014  -6.065  9.394   1.00 0.00 ? 75  GLY A N    8  
ATOM   9302  C  CA   . GLY A 1 75 ? 15.920  -5.600  10.766  1.00 0.00 ? 75  GLY A CA   8  
ATOM   9303  C  C    . GLY A 1 75 ? 16.593  -4.257  10.970  1.00 0.00 ? 75  GLY A C    8  
ATOM   9304  O  O    . GLY A 1 75 ? 17.682  -4.000  10.456  1.00 0.00 ? 75  GLY A O    8  
ATOM   9305  H  H    . GLY A 1 75 ? 16.138  -7.020  9.210   1.00 0.00 ? 75  GLY A H    8  
ATOM   9306  H  HA2  . GLY A 1 75 ? 14.878  -5.513  11.035  1.00 0.00 ? 75  GLY A HA2  8  
ATOM   9307  H  HA3  . GLY A 1 75 ? 16.390  -6.327  11.413  1.00 0.00 ? 75  GLY A HA3  8  
ATOM   9308  N  N    . PRO A 1 76 ? 15.937  -3.372  11.735  1.00 0.00 ? 76  PRO A N    8  
ATOM   9309  C  CA   . PRO A 1 76 ? 16.460  -2.033  12.022  1.00 0.00 ? 76  PRO A CA   8  
ATOM   9310  C  C    . PRO A 1 76 ? 17.678  -2.071  12.939  1.00 0.00 ? 76  PRO A C    8  
ATOM   9311  O  O    . PRO A 1 76 ? 17.675  -2.752  13.964  1.00 0.00 ? 76  PRO A O    8  
ATOM   9312  C  CB   . PRO A 1 76 ? 15.288  -1.337  12.719  1.00 0.00 ? 76  PRO A CB   8  
ATOM   9313  C  CG   . PRO A 1 76 ? 14.491  -2.444  13.317  1.00 0.00 ? 76  PRO A CG   8  
ATOM   9314  C  CD   . PRO A 1 76 ? 14.635  -3.611  12.380  1.00 0.00 ? 76  PRO A CD   8  
ATOM   9315  H  HA   . PRO A 1 76 ? 16.710  -1.502  11.116  1.00 0.00 ? 76  PRO A HA   8  
ATOM   9316  H  HB2  . PRO A 1 76 ? 15.665  -0.665  13.478  1.00 0.00 ? 76  PRO A HB2  8  
ATOM   9317  H  HB3  . PRO A 1 76 ? 14.712  -0.782  11.994  1.00 0.00 ? 76  PRO A HB3  8  
ATOM   9318  H  HG2  . PRO A 1 76 ? 14.883  -2.695  14.291  1.00 0.00 ? 76  PRO A HG2  8  
ATOM   9319  H  HG3  . PRO A 1 76 ? 13.454  -2.150  13.392  1.00 0.00 ? 76  PRO A HG3  8  
ATOM   9320  H  HD2  . PRO A 1 76 ? 14.642  -4.540  12.931  1.00 0.00 ? 76  PRO A HD2  8  
ATOM   9321  H  HD3  . PRO A 1 76 ? 13.839  -3.610  11.650  1.00 0.00 ? 76  PRO A HD3  8  
ATOM   9322  N  N    . SER A 1 77 ? 18.719  -1.334  12.563  1.00 0.00 ? 77  SER A N    8  
ATOM   9323  C  CA   . SER A 1 77 ? 19.946  -1.286  13.350  1.00 0.00 ? 77  SER A CA   8  
ATOM   9324  C  C    . SER A 1 77 ? 20.506  0.132   13.396  1.00 0.00 ? 77  SER A C    8  
ATOM   9325  O  O    . SER A 1 77 ? 20.817  0.722   12.361  1.00 0.00 ? 77  SER A O    8  
ATOM   9326  C  CB   . SER A 1 77 ? 20.989  -2.241  12.766  1.00 0.00 ? 77  SER A CB   8  
ATOM   9327  O  OG   . SER A 1 77 ? 21.354  -1.856  11.452  1.00 0.00 ? 77  SER A OG   8  
ATOM   9328  H  H    . SER A 1 77 ? 18.661  -0.812  11.735  1.00 0.00 ? 77  SER A H    8  
ATOM   9329  H  HA   . SER A 1 77 ? 19.707  -1.598  14.356  1.00 0.00 ? 77  SER A HA   8  
ATOM   9330  H  HB2  . SER A 1 77 ? 21.870  -2.231  13.389  1.00 0.00 ? 77  SER A HB2  8  
ATOM   9331  H  HB3  . SER A 1 77 ? 20.580  -3.240  12.736  1.00 0.00 ? 77  SER A HB3  8  
ATOM   9332  H  HG   . SER A 1 77 ? 21.016  -0.976  11.271  1.00 0.00 ? 77  SER A HG   8  
ATOM   9333  N  N    . SER A 1 78 ? 20.633  0.673   14.603  1.00 0.00 ? 78  SER A N    8  
ATOM   9334  C  CA   . SER A 1 78 ? 21.153  2.023   14.785  1.00 0.00 ? 78  SER A CA   8  
ATOM   9335  C  C    . SER A 1 78 ? 22.105  2.083   15.977  1.00 0.00 ? 78  SER A C    8  
ATOM   9336  O  O    . SER A 1 78 ? 21.785  1.607   17.065  1.00 0.00 ? 78  SER A O    8  
ATOM   9337  C  CB   . SER A 1 78 ? 20.003  3.012   14.986  1.00 0.00 ? 78  SER A CB   8  
ATOM   9338  O  OG   . SER A 1 78 ? 20.432  4.345   14.764  1.00 0.00 ? 78  SER A OG   8  
ATOM   9339  H  H    . SER A 1 78 ? 20.369  0.152   15.390  1.00 0.00 ? 78  SER A H    8  
ATOM   9340  H  HA   . SER A 1 78 ? 21.696  2.293   13.892  1.00 0.00 ? 78  SER A HA   8  
ATOM   9341  H  HB2  . SER A 1 78 ? 19.209  2.782   14.293  1.00 0.00 ? 78  SER A HB2  8  
ATOM   9342  H  HB3  . SER A 1 78 ? 19.634  2.929   15.998  1.00 0.00 ? 78  SER A HB3  8  
ATOM   9343  H  HG   . SER A 1 78 ? 21.351  4.434   15.029  1.00 0.00 ? 78  SER A HG   8  
ATOM   9344  N  N    . GLY A 1 79 ? 23.276  2.673   15.761  1.00 0.00 ? 79  GLY A N    8  
ATOM   9345  C  CA   . GLY A 1 79 ? 24.257  2.785   16.825  1.00 0.00 ? 79  GLY A CA   8  
ATOM   9346  C  C    . GLY A 1 79 ? 24.372  4.198   17.361  1.00 0.00 ? 79  GLY A C    8  
ATOM   9347  O  O    . GLY A 1 79 ? 25.453  4.781   17.288  1.00 0.00 ? 79  GLY A O    8  
ATOM   9348  H  H    . GLY A 1 79 ? 23.477  3.035   14.873  1.00 0.00 ? 79  GLY A H    8  
ATOM   9349  H  HA2  . GLY A 1 79 ? 23.974  2.127   17.632  1.00 0.00 ? 79  GLY A HA2  8  
ATOM   9350  H  HA3  . GLY A 1 79 ? 25.221  2.478   16.445  1.00 0.00 ? 79  GLY A HA3  8  
HETATM 9351  ZN ZN   . ZN  B 2 .  ? -11.022 -0.516  3.462   1.00 0.00 ? 201 ZN  A ZN   8  
HETATM 9352  ZN ZN   . ZN  C 2 .  ? 4.942   3.915   5.448   1.00 0.00 ? 401 ZN  A ZN   8  
ATOM   9353  N  N    . GLY A 1 1  ? -15.554 -15.135 11.521  1.00 0.00 ? 1   GLY A N    9  
ATOM   9354  C  CA   . GLY A 1 1  ? -16.913 -15.312 11.998  1.00 0.00 ? 1   GLY A CA   9  
ATOM   9355  C  C    . GLY A 1 1  ? -17.288 -14.305 13.067  1.00 0.00 ? 1   GLY A C    9  
ATOM   9356  O  O    . GLY A 1 1  ? -17.266 -14.616 14.258  1.00 0.00 ? 1   GLY A O    9  
ATOM   9357  H  H1   . GLY A 1 1  ? -14.860 -15.779 11.774  1.00 0.00 ? 1   GLY A H1   9  
ATOM   9358  H  HA2  . GLY A 1 1  ? -17.592 -15.207 11.165  1.00 0.00 ? 1   GLY A HA2  9  
ATOM   9359  H  HA3  . GLY A 1 1  ? -17.012 -16.307 12.407  1.00 0.00 ? 1   GLY A HA3  9  
ATOM   9360  N  N    . SER A 1 2  ? -17.632 -13.093 12.642  1.00 0.00 ? 2   SER A N    9  
ATOM   9361  C  CA   . SER A 1 2  ? -18.008 -12.035 13.572  1.00 0.00 ? 2   SER A CA   9  
ATOM   9362  C  C    . SER A 1 2  ? -18.923 -12.574 14.667  1.00 0.00 ? 2   SER A C    9  
ATOM   9363  O  O    . SER A 1 2  ? -18.618 -12.467 15.855  1.00 0.00 ? 2   SER A O    9  
ATOM   9364  C  CB   . SER A 1 2  ? -18.703 -10.895 12.826  1.00 0.00 ? 2   SER A CB   9  
ATOM   9365  O  OG   . SER A 1 2  ? -19.770 -11.382 12.031  1.00 0.00 ? 2   SER A OG   9  
ATOM   9366  H  H    . SER A 1 2  ? -17.630 -12.906 11.680  1.00 0.00 ? 2   SER A H    9  
ATOM   9367  H  HA   . SER A 1 2  ? -17.104 -11.658 14.028  1.00 0.00 ? 2   SER A HA   9  
ATOM   9368  H  HB2  . SER A 1 2  ? -19.097 -10.188 13.541  1.00 0.00 ? 2   SER A HB2  9  
ATOM   9369  H  HB3  . SER A 1 2  ? -17.989 -10.399 12.185  1.00 0.00 ? 2   SER A HB3  9  
ATOM   9370  H  HG   . SER A 1 2  ? -19.431 -11.670 11.181  1.00 0.00 ? 2   SER A HG   9  
ATOM   9371  N  N    . SER A 1 3  ? -20.046 -13.155 14.258  1.00 0.00 ? 3   SER A N    9  
ATOM   9372  C  CA   . SER A 1 3  ? -21.009 -13.708 15.204  1.00 0.00 ? 3   SER A CA   9  
ATOM   9373  C  C    . SER A 1 3  ? -20.604 -15.116 15.630  1.00 0.00 ? 3   SER A C    9  
ATOM   9374  O  O    . SER A 1 3  ? -20.500 -15.411 16.820  1.00 0.00 ? 3   SER A O    9  
ATOM   9375  C  CB   . SER A 1 3  ? -22.408 -13.733 14.584  1.00 0.00 ? 3   SER A CB   9  
ATOM   9376  O  OG   . SER A 1 3  ? -23.395 -14.001 15.565  1.00 0.00 ? 3   SER A OG   9  
ATOM   9377  H  H    . SER A 1 3  ? -20.233 -13.210 13.298  1.00 0.00 ? 3   SER A H    9  
ATOM   9378  H  HA   . SER A 1 3  ? -21.022 -13.071 16.075  1.00 0.00 ? 3   SER A HA   9  
ATOM   9379  H  HB2  . SER A 1 3  ? -22.616 -12.774 14.135  1.00 0.00 ? 3   SER A HB2  9  
ATOM   9380  H  HB3  . SER A 1 3  ? -22.450 -14.502 13.828  1.00 0.00 ? 3   SER A HB3  9  
ATOM   9381  H  HG   . SER A 1 3  ? -22.995 -14.465 16.304  1.00 0.00 ? 3   SER A HG   9  
ATOM   9382  N  N    . GLY A 1 4  ? -20.378 -15.983 14.647  1.00 0.00 ? 4   GLY A N    9  
ATOM   9383  C  CA   . GLY A 1 4  ? -19.987 -17.350 14.939  1.00 0.00 ? 4   GLY A CA   9  
ATOM   9384  C  C    . GLY A 1 4  ? -21.067 -18.351 14.578  1.00 0.00 ? 4   GLY A C    9  
ATOM   9385  O  O    . GLY A 1 4  ? -21.382 -19.245 15.363  1.00 0.00 ? 4   GLY A O    9  
ATOM   9386  H  H    . GLY A 1 4  ? -20.477 -15.692 13.717  1.00 0.00 ? 4   GLY A H    9  
ATOM   9387  H  HA2  . GLY A 1 4  ? -19.092 -17.584 14.383  1.00 0.00 ? 4   GLY A HA2  9  
ATOM   9388  H  HA3  . GLY A 1 4  ? -19.775 -17.434 15.995  1.00 0.00 ? 4   GLY A HA3  9  
ATOM   9389  N  N    . SER A 1 5  ? -21.636 -18.200 13.386  1.00 0.00 ? 5   SER A N    9  
ATOM   9390  C  CA   . SER A 1 5  ? -22.690 -19.095 12.924  1.00 0.00 ? 5   SER A CA   9  
ATOM   9391  C  C    . SER A 1 5  ? -22.273 -19.811 11.643  1.00 0.00 ? 5   SER A C    9  
ATOM   9392  O  O    . SER A 1 5  ? -21.888 -19.175 10.661  1.00 0.00 ? 5   SER A O    9  
ATOM   9393  C  CB   . SER A 1 5  ? -23.984 -18.314 12.687  1.00 0.00 ? 5   SER A CB   9  
ATOM   9394  O  OG   . SER A 1 5  ? -24.472 -17.756 13.895  1.00 0.00 ? 5   SER A OG   9  
ATOM   9395  H  H    . SER A 1 5  ? -21.341 -17.468 12.805  1.00 0.00 ? 5   SER A H    9  
ATOM   9396  H  HA   . SER A 1 5  ? -22.861 -19.832 13.694  1.00 0.00 ? 5   SER A HA   9  
ATOM   9397  H  HB2  . SER A 1 5  ? -23.796 -17.515 11.986  1.00 0.00 ? 5   SER A HB2  9  
ATOM   9398  H  HB3  . SER A 1 5  ? -24.734 -18.979 12.282  1.00 0.00 ? 5   SER A HB3  9  
ATOM   9399  H  HG   . SER A 1 5  ? -23.761 -17.714 14.538  1.00 0.00 ? 5   SER A HG   9  
ATOM   9400  N  N    . SER A 1 6  ? -22.352 -21.137 11.661  1.00 0.00 ? 6   SER A N    9  
ATOM   9401  C  CA   . SER A 1 6  ? -21.979 -21.941 10.502  1.00 0.00 ? 6   SER A CA   9  
ATOM   9402  C  C    . SER A 1 6  ? -22.809 -23.219 10.438  1.00 0.00 ? 6   SER A C    9  
ATOM   9403  O  O    . SER A 1 6  ? -22.802 -24.025 11.368  1.00 0.00 ? 6   SER A O    9  
ATOM   9404  C  CB   . SER A 1 6  ? -20.490 -22.288 10.554  1.00 0.00 ? 6   SER A CB   9  
ATOM   9405  O  OG   . SER A 1 6  ? -19.697 -21.199 10.116  1.00 0.00 ? 6   SER A OG   9  
ATOM   9406  H  H    . SER A 1 6  ? -22.666 -21.586 12.473  1.00 0.00 ? 6   SER A H    9  
ATOM   9407  H  HA   . SER A 1 6  ? -22.173 -21.355 9.616   1.00 0.00 ? 6   SER A HA   9  
ATOM   9408  H  HB2  . SER A 1 6  ? -20.215 -22.532 11.569  1.00 0.00 ? 6   SER A HB2  9  
ATOM   9409  H  HB3  . SER A 1 6  ? -20.299 -23.138 9.914   1.00 0.00 ? 6   SER A HB3  9  
ATOM   9410  H  HG   . SER A 1 6  ? -19.473 -21.317 9.190   1.00 0.00 ? 6   SER A HG   9  
ATOM   9411  N  N    . GLY A 1 7  ? -23.524 -23.399 9.332   1.00 0.00 ? 7   GLY A N    9  
ATOM   9412  C  CA   . GLY A 1 7  ? -24.350 -24.580 9.165   1.00 0.00 ? 7   GLY A CA   9  
ATOM   9413  C  C    . GLY A 1 7  ? -25.212 -24.515 7.920   1.00 0.00 ? 7   GLY A C    9  
ATOM   9414  O  O    . GLY A 1 7  ? -26.436 -24.419 8.008   1.00 0.00 ? 7   GLY A O    9  
ATOM   9415  H  H    . GLY A 1 7  ? -23.491 -22.723 8.623   1.00 0.00 ? 7   GLY A H    9  
ATOM   9416  H  HA2  . GLY A 1 7  ? -23.710 -25.447 9.102   1.00 0.00 ? 7   GLY A HA2  9  
ATOM   9417  H  HA3  . GLY A 1 7  ? -24.992 -24.681 10.028  1.00 0.00 ? 7   GLY A HA3  9  
ATOM   9418  N  N    . SER A 1 8  ? -24.572 -24.564 6.756   1.00 0.00 ? 8   SER A N    9  
ATOM   9419  C  CA   . SER A 1 8  ? -25.288 -24.504 5.487   1.00 0.00 ? 8   SER A CA   9  
ATOM   9420  C  C    . SER A 1 8  ? -26.201 -23.283 5.436   1.00 0.00 ? 8   SER A C    9  
ATOM   9421  O  O    . SER A 1 8  ? -27.339 -23.365 4.973   1.00 0.00 ? 8   SER A O    9  
ATOM   9422  C  CB   . SER A 1 8  ? -26.109 -25.778 5.280   1.00 0.00 ? 8   SER A CB   9  
ATOM   9423  O  OG   . SER A 1 8  ? -25.298 -26.934 5.406   1.00 0.00 ? 8   SER A OG   9  
ATOM   9424  H  H    . SER A 1 8  ? -23.595 -24.641 6.751   1.00 0.00 ? 8   SER A H    9  
ATOM   9425  H  HA   . SER A 1 8  ? -24.556 -24.426 4.697   1.00 0.00 ? 8   SER A HA   9  
ATOM   9426  H  HB2  . SER A 1 8  ? -26.894 -25.822 6.020   1.00 0.00 ? 8   SER A HB2  9  
ATOM   9427  H  HB3  . SER A 1 8  ? -26.546 -25.765 4.292   1.00 0.00 ? 8   SER A HB3  9  
ATOM   9428  H  HG   . SER A 1 8  ? -24.957 -27.181 4.543   1.00 0.00 ? 8   SER A HG   9  
ATOM   9429  N  N    . ILE A 1 9  ? -25.693 -22.152 5.913   1.00 0.00 ? 9   ILE A N    9  
ATOM   9430  C  CA   . ILE A 1 9  ? -26.461 -20.914 5.921   1.00 0.00 ? 9   ILE A CA   9  
ATOM   9431  C  C    . ILE A 1 9  ? -25.601 -19.730 5.489   1.00 0.00 ? 9   ILE A C    9  
ATOM   9432  O  O    . ILE A 1 9  ? -24.375 -19.777 5.575   1.00 0.00 ? 9   ILE A O    9  
ATOM   9433  C  CB   . ILE A 1 9  ? -27.049 -20.624 7.315   1.00 0.00 ? 9   ILE A CB   9  
ATOM   9434  C  CG1  . ILE A 1 9  ? -25.927 -20.452 8.340   1.00 0.00 ? 9   ILE A CG1  9  
ATOM   9435  C  CG2  . ILE A 1 9  ? -27.990 -21.744 7.735   1.00 0.00 ? 9   ILE A CG2  9  
ATOM   9436  C  CD1  . ILE A 1 9  ? -26.383 -19.816 9.635   1.00 0.00 ? 9   ILE A CD1  9  
ATOM   9437  H  H    . ILE A 1 9  ? -24.780 -22.150 6.268   1.00 0.00 ? 9   ILE A H    9  
ATOM   9438  H  HA   . ILE A 1 9  ? -27.279 -21.024 5.224   1.00 0.00 ? 9   ILE A HA   9  
ATOM   9439  H  HB   . ILE A 1 9  ? -27.619 -19.710 7.258   1.00 0.00 ? 9   ILE A HB   9  
ATOM   9440  H  HG12 . ILE A 1 9  ? -25.510 -21.418 8.575   1.00 0.00 ? 9   ILE A HG12 9  
ATOM   9441  H  HG13 . ILE A 1 9  ? -25.155 -19.825 7.916   1.00 0.00 ? 9   ILE A HG13 9  
ATOM   9442  H  HG21 . ILE A 1 9  ? -27.441 -22.483 8.300   1.00 0.00 ? 9   ILE A HG21 9  
ATOM   9443  H  HG22 . ILE A 1 9  ? -28.780 -21.337 8.349   1.00 0.00 ? 9   ILE A HG22 9  
ATOM   9444  H  HG23 . ILE A 1 9  ? -28.416 -22.205 6.857   1.00 0.00 ? 9   ILE A HG23 9  
ATOM   9445  H  HD11 . ILE A 1 9  ? -25.937 -20.337 10.469  1.00 0.00 ? 9   ILE A HD11 9  
ATOM   9446  H  HD12 . ILE A 1 9  ? -26.082 -18.780 9.653   1.00 0.00 ? 9   ILE A HD12 9  
ATOM   9447  H  HD13 . ILE A 1 9  ? -27.460 -19.879 9.706   1.00 0.00 ? 9   ILE A HD13 9  
ATOM   9448  N  N    . GLY A 1 10 ? -26.254 -18.669 5.025   1.00 0.00 ? 10  GLY A N    9  
ATOM   9449  C  CA   . GLY A 1 10 ? -25.534 -17.488 4.588   1.00 0.00 ? 10  GLY A CA   9  
ATOM   9450  C  C    . GLY A 1 10 ? -25.208 -17.522 3.108   1.00 0.00 ? 10  GLY A C    9  
ATOM   9451  O  O    . GLY A 1 10 ? -25.316 -18.566 2.466   1.00 0.00 ? 10  GLY A O    9  
ATOM   9452  H  H    . GLY A 1 10 ? -27.233 -18.689 4.979   1.00 0.00 ? 10  GLY A H    9  
ATOM   9453  H  HA2  . GLY A 1 10 ? -26.137 -16.616 4.793   1.00 0.00 ? 10  GLY A HA2  9  
ATOM   9454  H  HA3  . GLY A 1 10 ? -24.612 -17.415 5.147   1.00 0.00 ? 10  GLY A HA3  9  
ATOM   9455  N  N    . ASN A 1 11 ? -24.808 -16.377 2.565   1.00 0.00 ? 11  ASN A N    9  
ATOM   9456  C  CA   . ASN A 1 11 ? -24.467 -16.279 1.151   1.00 0.00 ? 11  ASN A CA   9  
ATOM   9457  C  C    . ASN A 1 11 ? -23.086 -15.658 0.966   1.00 0.00 ? 11  ASN A C    9  
ATOM   9458  O  O    . ASN A 1 11 ? -22.789 -14.602 1.525   1.00 0.00 ? 11  ASN A O    9  
ATOM   9459  C  CB   . ASN A 1 11 ? -25.516 -15.449 0.408   1.00 0.00 ? 11  ASN A CB   9  
ATOM   9460  C  CG   . ASN A 1 11 ? -25.555 -14.009 0.882   1.00 0.00 ? 11  ASN A CG   9  
ATOM   9461  O  OD1  . ASN A 1 11 ? -25.055 -13.685 1.959   1.00 0.00 ? 11  ASN A OD1  9  
ATOM   9462  N  ND2  . ASN A 1 11 ? -26.153 -13.138 0.077   1.00 0.00 ? 11  ASN A ND2  9  
ATOM   9463  H  H    . ASN A 1 11 ? -24.741 -15.578 3.129   1.00 0.00 ? 11  ASN A H    9  
ATOM   9464  H  HA   . ASN A 1 11 ? -24.456 -17.279 0.743   1.00 0.00 ? 11  ASN A HA   9  
ATOM   9465  H  HB2  . ASN A 1 11 ? -25.288 -15.454 -0.648  1.00 0.00 ? 11  ASN A HB2  9  
ATOM   9466  H  HB3  . ASN A 1 11 ? -26.490 -15.888 0.563   1.00 0.00 ? 11  ASN A HB3  9  
ATOM   9467  H  HD21 . ASN A 1 11 ? -26.529 -13.468 -0.766  1.00 0.00 ? 11  ASN A HD21 9  
ATOM   9468  H  HD22 . ASN A 1 11 ? -26.192 -12.200 0.358   1.00 0.00 ? 11  ASN A HD22 9  
ATOM   9469  N  N    . ALA A 1 12 ? -22.246 -16.319 0.176   1.00 0.00 ? 12  ALA A N    9  
ATOM   9470  C  CA   . ALA A 1 12 ? -20.898 -15.831 -0.085  1.00 0.00 ? 12  ALA A CA   9  
ATOM   9471  C  C    . ALA A 1 12 ? -20.927 -14.420 -0.661  1.00 0.00 ? 12  ALA A C    9  
ATOM   9472  O  O    . ALA A 1 12 ? -21.708 -14.126 -1.566  1.00 0.00 ? 12  ALA A O    9  
ATOM   9473  C  CB   . ALA A 1 12 ? -20.169 -16.774 -1.030  1.00 0.00 ? 12  ALA A CB   9  
ATOM   9474  H  H    . ALA A 1 12 ? -22.541 -17.155 -0.241  1.00 0.00 ? 12  ALA A H    9  
ATOM   9475  H  HA   . ALA A 1 12 ? -20.361 -15.815 0.853   1.00 0.00 ? 12  ALA A HA   9  
ATOM   9476  H  HB1  . ALA A 1 12 ? -19.599 -16.197 -1.744  1.00 0.00 ? 12  ALA A HB1  9  
ATOM   9477  H  HB2  . ALA A 1 12 ? -19.502 -17.407 -0.464  1.00 0.00 ? 12  ALA A HB2  9  
ATOM   9478  H  HB3  . ALA A 1 12 ? -20.888 -17.386 -1.554  1.00 0.00 ? 12  ALA A HB3  9  
ATOM   9479  N  N    . GLN A 1 13 ? -20.072 -13.551 -0.131  1.00 0.00 ? 13  GLN A N    9  
ATOM   9480  C  CA   . GLN A 1 13 ? -20.003 -12.170 -0.594  1.00 0.00 ? 13  GLN A CA   9  
ATOM   9481  C  C    . GLN A 1 13 ? -19.529 -12.103 -2.042  1.00 0.00 ? 13  GLN A C    9  
ATOM   9482  O  O    . GLN A 1 13 ? -18.602 -12.811 -2.436  1.00 0.00 ? 13  GLN A O    9  
ATOM   9483  C  CB   . GLN A 1 13 ? -19.064 -11.357 0.300   1.00 0.00 ? 13  GLN A CB   9  
ATOM   9484  C  CG   . GLN A 1 13 ? -19.757 -10.728 1.498   1.00 0.00 ? 13  GLN A CG   9  
ATOM   9485  C  CD   . GLN A 1 13 ? -18.783 -10.300 2.578   1.00 0.00 ? 13  GLN A CD   9  
ATOM   9486  O  OE1  . GLN A 1 13 ? -18.178 -9.231  2.496   1.00 0.00 ? 13  GLN A OE1  9  
ATOM   9487  N  NE2  . GLN A 1 13 ? -18.626 -11.135 3.598   1.00 0.00 ? 13  GLN A NE2  9  
ATOM   9488  H  H    . GLN A 1 13 ? -19.475 -13.845 0.587   1.00 0.00 ? 13  GLN A H    9  
ATOM   9489  H  HA   . GLN A 1 13 ? -20.995 -11.749 -0.533  1.00 0.00 ? 13  GLN A HA   9  
ATOM   9490  H  HB2  . GLN A 1 13 ? -18.281 -12.006 0.664   1.00 0.00 ? 13  GLN A HB2  9  
ATOM   9491  H  HB3  . GLN A 1 13 ? -18.621 -10.567 -0.288  1.00 0.00 ? 13  GLN A HB3  9  
ATOM   9492  H  HG2  . GLN A 1 13 ? -20.305 -9.859  1.165   1.00 0.00 ? 13  GLN A HG2  9  
ATOM   9493  H  HG3  . GLN A 1 13 ? -20.445 -11.447 1.918   1.00 0.00 ? 13  GLN A HG3  9  
ATOM   9494  H  HE21 . GLN A 1 13 ? -19.140 -11.970 3.596   1.00 0.00 ? 13  GLN A HE21 9  
ATOM   9495  H  HE22 . GLN A 1 13 ? -18.002 -10.884 4.310   1.00 0.00 ? 13  GLN A HE22 9  
ATOM   9496  N  N    . LYS A 1 14 ? -20.172 -11.249 -2.831  1.00 0.00 ? 14  LYS A N    9  
ATOM   9497  C  CA   . LYS A 1 14 ? -19.816 -11.088 -4.236  1.00 0.00 ? 14  LYS A CA   9  
ATOM   9498  C  C    . LYS A 1 14 ? -18.938 -9.858  -4.438  1.00 0.00 ? 14  LYS A C    9  
ATOM   9499  O  O    . LYS A 1 14 ? -18.800 -9.358  -5.555  1.00 0.00 ? 14  LYS A O    9  
ATOM   9500  C  CB   . LYS A 1 14 ? -21.079 -10.973 -5.092  1.00 0.00 ? 14  LYS A CB   9  
ATOM   9501  C  CG   . LYS A 1 14 ? -21.635 -12.313 -5.540  1.00 0.00 ? 14  LYS A CG   9  
ATOM   9502  C  CD   . LYS A 1 14 ? -22.506 -12.943 -4.466  1.00 0.00 ? 14  LYS A CD   9  
ATOM   9503  C  CE   . LYS A 1 14 ? -23.417 -14.014 -5.045  1.00 0.00 ? 14  LYS A CE   9  
ATOM   9504  N  NZ   . LYS A 1 14 ? -24.611 -14.251 -4.186  1.00 0.00 ? 14  LYS A NZ   9  
ATOM   9505  H  H    . LYS A 1 14 ? -20.903 -10.711 -2.458  1.00 0.00 ? 14  LYS A H    9  
ATOM   9506  H  HA   . LYS A 1 14 ? -19.264 -11.964 -4.540  1.00 0.00 ? 14  LYS A HA   9  
ATOM   9507  H  HB2  . LYS A 1 14 ? -21.842 -10.463 -4.521  1.00 0.00 ? 14  LYS A HB2  9  
ATOM   9508  H  HB3  . LYS A 1 14 ? -20.851 -10.389 -5.972  1.00 0.00 ? 14  LYS A HB3  9  
ATOM   9509  H  HG2  . LYS A 1 14 ? -22.229 -12.167 -6.430  1.00 0.00 ? 14  LYS A HG2  9  
ATOM   9510  H  HG3  . LYS A 1 14 ? -20.812 -12.978 -5.760  1.00 0.00 ? 14  LYS A HG3  9  
ATOM   9511  H  HD2  . LYS A 1 14 ? -21.870 -13.394 -3.718  1.00 0.00 ? 14  LYS A HD2  9  
ATOM   9512  H  HD3  . LYS A 1 14 ? -23.113 -12.174 -4.010  1.00 0.00 ? 14  LYS A HD3  9  
ATOM   9513  H  HE2  . LYS A 1 14 ? -23.746 -13.699 -6.024  1.00 0.00 ? 14  LYS A HE2  9  
ATOM   9514  H  HE3  . LYS A 1 14 ? -22.859 -14.935 -5.133  1.00 0.00 ? 14  LYS A HE3  9  
ATOM   9515  H  HZ1  . LYS A 1 14 ? -24.501 -13.754 -3.279  1.00 0.00 ? 14  LYS A HZ1  9  
ATOM   9516  H  HZ2  . LYS A 1 14 ? -24.722 -15.268 -4.001  1.00 0.00 ? 14  LYS A HZ2  9  
ATOM   9517  H  HZ3  . LYS A 1 14 ? -25.467 -13.900 -4.660  1.00 0.00 ? 14  LYS A HZ3  9  
ATOM   9518  N  N    . LEU A 1 15 ? -18.346 -9.374  -3.351  1.00 0.00 ? 15  LEU A N    9  
ATOM   9519  C  CA   . LEU A 1 15 ? -17.479 -8.203  -3.410  1.00 0.00 ? 15  LEU A CA   9  
ATOM   9520  C  C    . LEU A 1 15 ? -16.216 -8.418  -2.582  1.00 0.00 ? 15  LEU A C    9  
ATOM   9521  O  O    . LEU A 1 15 ? -16.255 -8.945  -1.470  1.00 0.00 ? 15  LEU A O    9  
ATOM   9522  C  CB   . LEU A 1 15 ? -18.226 -6.965  -2.909  1.00 0.00 ? 15  LEU A CB   9  
ATOM   9523  C  CG   . LEU A 1 15 ? -19.591 -6.702  -3.546  1.00 0.00 ? 15  LEU A CG   9  
ATOM   9524  C  CD1  . LEU A 1 15 ? -20.309 -5.573  -2.823  1.00 0.00 ? 15  LEU A CD1  9  
ATOM   9525  C  CD2  . LEU A 1 15 ? -19.435 -6.376  -5.025  1.00 0.00 ? 15  LEU A CD2  9  
ATOM   9526  H  H    . LEU A 1 15 ? -18.494 -9.815  -2.489  1.00 0.00 ? 15  LEU A H    9  
ATOM   9527  H  HA   . LEU A 1 15 ? -17.197 -8.050  -4.441  1.00 0.00 ? 15  LEU A HA   9  
ATOM   9528  H  HB2  . LEU A 1 15 ? -18.374 -7.076  -1.846  1.00 0.00 ? 15  LEU A HB2  9  
ATOM   9529  H  HB3  . LEU A 1 15 ? -17.600 -6.104  -3.096  1.00 0.00 ? 15  LEU A HB3  9  
ATOM   9530  H  HG   . LEU A 1 15 ? -20.199 -7.592  -3.462  1.00 0.00 ? 15  LEU A HG   9  
ATOM   9531  H  HD11 . LEU A 1 15 ? -19.873 -5.438  -1.845  1.00 0.00 ? 15  LEU A HD11 9  
ATOM   9532  H  HD12 . LEU A 1 15 ? -21.355 -5.820  -2.720  1.00 0.00 ? 15  LEU A HD12 9  
ATOM   9533  H  HD13 . LEU A 1 15 ? -20.209 -4.660  -3.392  1.00 0.00 ? 15  LEU A HD13 9  
ATOM   9534  H  HD21 . LEU A 1 15 ? -20.017 -7.072  -5.610  1.00 0.00 ? 15  LEU A HD21 9  
ATOM   9535  H  HD22 . LEU A 1 15 ? -18.393 -6.455  -5.303  1.00 0.00 ? 15  LEU A HD22 9  
ATOM   9536  H  HD23 . LEU A 1 15 ? -19.782 -5.371  -5.210  1.00 0.00 ? 15  LEU A HD23 9  
ATOM   9537  N  N    . PRO A 1 16 ? -15.067 -7.999  -3.134  1.00 0.00 ? 16  PRO A N    9  
ATOM   9538  C  CA   . PRO A 1 16 ? -13.771 -8.133  -2.462  1.00 0.00 ? 16  PRO A CA   9  
ATOM   9539  C  C    . PRO A 1 16 ? -13.644 -7.206  -1.257  1.00 0.00 ? 16  PRO A C    9  
ATOM   9540  O  O    . PRO A 1 16 ? -13.233 -6.054  -1.390  1.00 0.00 ? 16  PRO A O    9  
ATOM   9541  C  CB   . PRO A 1 16 ? -12.767 -7.739  -3.548  1.00 0.00 ? 16  PRO A CB   9  
ATOM   9542  C  CG   . PRO A 1 16 ? -13.532 -6.851  -4.467  1.00 0.00 ? 16  PRO A CG   9  
ATOM   9543  C  CD   . PRO A 1 16 ? -14.946 -7.362  -4.456  1.00 0.00 ? 16  PRO A CD   9  
ATOM   9544  H  HA   . PRO A 1 16 ? -13.588 -9.151  -2.152  1.00 0.00 ? 16  PRO A HA   9  
ATOM   9545  H  HB2  . PRO A 1 16 ? -11.933 -7.219  -3.098  1.00 0.00 ? 16  PRO A HB2  9  
ATOM   9546  H  HB3  . PRO A 1 16 ? -12.415 -8.624  -4.056  1.00 0.00 ? 16  PRO A HB3  9  
ATOM   9547  H  HG2  . PRO A 1 16 ? -13.498 -5.833  -4.108  1.00 0.00 ? 16  PRO A HG2  9  
ATOM   9548  H  HG3  . PRO A 1 16 ? -13.120 -6.912  -5.464  1.00 0.00 ? 16  PRO A HG3  9  
ATOM   9549  H  HD2  . PRO A 1 16 ? -15.644 -6.544  -4.555  1.00 0.00 ? 16  PRO A HD2  9  
ATOM   9550  H  HD3  . PRO A 1 16 ? -15.093 -8.084  -5.246  1.00 0.00 ? 16  PRO A HD3  9  
ATOM   9551  N  N    . MET A 1 17 ? -13.999 -7.718  -0.083  1.00 0.00 ? 17  MET A N    9  
ATOM   9552  C  CA   . MET A 1 17 ? -13.923 -6.936  1.145   1.00 0.00 ? 17  MET A CA   9  
ATOM   9553  C  C    . MET A 1 17 ? -12.512 -6.396  1.359   1.00 0.00 ? 17  MET A C    9  
ATOM   9554  O  O    . MET A 1 17 ? -11.527 -7.108  1.159   1.00 0.00 ? 17  MET A O    9  
ATOM   9555  C  CB   . MET A 1 17 ? -14.343 -7.788  2.344   1.00 0.00 ? 17  MET A CB   9  
ATOM   9556  C  CG   . MET A 1 17 ? -13.318 -8.842  2.730   1.00 0.00 ? 17  MET A CG   9  
ATOM   9557  S  SD   . MET A 1 17 ? -13.610 -9.528  4.372   1.00 0.00 ? 17  MET A SD   9  
ATOM   9558  C  CE   . MET A 1 17 ? -15.344 -9.961  4.254   1.00 0.00 ? 17  MET A CE   9  
ATOM   9559  H  H    . MET A 1 17 ? -14.319 -8.643  -0.041  1.00 0.00 ? 17  MET A H    9  
ATOM   9560  H  HA   . MET A 1 17 ? -14.604 -6.103  1.050   1.00 0.00 ? 17  MET A HA   9  
ATOM   9561  H  HB2  . MET A 1 17 ? -14.498 -7.140  3.194   1.00 0.00 ? 17  MET A HB2  9  
ATOM   9562  H  HB3  . MET A 1 17 ? -15.270 -8.288  2.109   1.00 0.00 ? 17  MET A HB3  9  
ATOM   9563  H  HG2  . MET A 1 17 ? -13.358 -9.645  2.008   1.00 0.00 ? 17  MET A HG2  9  
ATOM   9564  H  HG3  . MET A 1 17 ? -12.336 -8.393  2.711   1.00 0.00 ? 17  MET A HG3  9  
ATOM   9565  H  HE1  . MET A 1 17 ? -15.740 -10.136 5.243   1.00 0.00 ? 17  MET A HE1  9  
ATOM   9566  H  HE2  . MET A 1 17 ? -15.886 -9.152  3.787   1.00 0.00 ? 17  MET A HE2  9  
ATOM   9567  H  HE3  . MET A 1 17 ? -15.451 -10.857 3.660   1.00 0.00 ? 17  MET A HE3  9  
ATOM   9568  N  N    . CYS A 1 18 ? -12.422 -5.135  1.767   1.00 0.00 ? 18  CYS A N    9  
ATOM   9569  C  CA   . CYS A 1 18 ? -11.132 -4.499  2.007   1.00 0.00 ? 18  CYS A CA   9  
ATOM   9570  C  C    . CYS A 1 18 ? -10.358 -5.234  3.097   1.00 0.00 ? 18  CYS A C    9  
ATOM   9571  O  O    . CYS A 1 18 ? -10.944 -5.747  4.051   1.00 0.00 ? 18  CYS A O    9  
ATOM   9572  C  CB   . CYS A 1 18 ? -11.328 -3.035  2.405   1.00 0.00 ? 18  CYS A CB   9  
ATOM   9573  S  SG   . CYS A 1 18 ? -9.829  -2.237  3.065   1.00 0.00 ? 18  CYS A SG   9  
ATOM   9574  H  H    . CYS A 1 18 ? -13.243 -4.617  1.909   1.00 0.00 ? 18  CYS A H    9  
ATOM   9575  H  HA   . CYS A 1 18 ? -10.565 -4.541  1.090   1.00 0.00 ? 18  CYS A HA   9  
ATOM   9576  H  HB2  . CYS A 1 18 ? -11.643 -2.473  1.538   1.00 0.00 ? 18  CYS A HB2  9  
ATOM   9577  H  HB3  . CYS A 1 18 ? -12.094 -2.975  3.164   1.00 0.00 ? 18  CYS A HB3  9  
ATOM   9578  N  N    . ASP A 1 19 ? -9.039  -5.282  2.948   1.00 0.00 ? 19  ASP A N    9  
ATOM   9579  C  CA   . ASP A 1 19 ? -8.183  -5.953  3.920   1.00 0.00 ? 19  ASP A CA   9  
ATOM   9580  C  C    . ASP A 1 19 ? -7.890  -5.041  5.108   1.00 0.00 ? 19  ASP A C    9  
ATOM   9581  O  O    . ASP A 1 19 ? -7.872  -5.485  6.256   1.00 0.00 ? 19  ASP A O    9  
ATOM   9582  C  CB   . ASP A 1 19 ? -6.874  -6.391  3.262   1.00 0.00 ? 19  ASP A CB   9  
ATOM   9583  C  CG   . ASP A 1 19 ? -6.103  -7.383  4.111   1.00 0.00 ? 19  ASP A CG   9  
ATOM   9584  O  OD1  . ASP A 1 19 ? -6.328  -8.601  3.952   1.00 0.00 ? 19  ASP A OD1  9  
ATOM   9585  O  OD2  . ASP A 1 19 ? -5.275  -6.942  4.935   1.00 0.00 ? 19  ASP A OD2  9  
ATOM   9586  H  H    . ASP A 1 19 ? -8.630  -4.854  2.167   1.00 0.00 ? 19  ASP A H    9  
ATOM   9587  H  HA   . ASP A 1 19 ? -8.707  -6.828  4.275   1.00 0.00 ? 19  ASP A HA   9  
ATOM   9588  H  HB2  . ASP A 1 19 ? -7.093  -6.854  2.311   1.00 0.00 ? 19  ASP A HB2  9  
ATOM   9589  H  HB3  . ASP A 1 19 ? -6.252  -5.523  3.100   1.00 0.00 ? 19  ASP A HB3  9  
ATOM   9590  N  N    . LYS A 1 20 ? -7.660  -3.764  4.823   1.00 0.00 ? 20  LYS A N    9  
ATOM   9591  C  CA   . LYS A 1 20 ? -7.367  -2.788  5.867   1.00 0.00 ? 20  LYS A CA   9  
ATOM   9592  C  C    . LYS A 1 20 ? -8.426  -2.831  6.964   1.00 0.00 ? 20  LYS A C    9  
ATOM   9593  O  O    . LYS A 1 20 ? -8.131  -3.162  8.113   1.00 0.00 ? 20  LYS A O    9  
ATOM   9594  C  CB   . LYS A 1 20 ? -7.293  -1.381  5.271   1.00 0.00 ? 20  LYS A CB   9  
ATOM   9595  C  CG   . LYS A 1 20 ? -7.073  -0.292  6.307   1.00 0.00 ? 20  LYS A CG   9  
ATOM   9596  C  CD   . LYS A 1 20 ? -5.598  0.035   6.469   1.00 0.00 ? 20  LYS A CD   9  
ATOM   9597  C  CE   . LYS A 1 20 ? -5.388  1.497   6.834   1.00 0.00 ? 20  LYS A CE   9  
ATOM   9598  N  NZ   . LYS A 1 20 ? -5.813  2.409   5.736   1.00 0.00 ? 20  LYS A NZ   9  
ATOM   9599  H  H    . LYS A 1 20 ? -7.688  -3.470  3.888   1.00 0.00 ? 20  LYS A H    9  
ATOM   9600  H  HA   . LYS A 1 20 ? -6.410  -3.039  6.297   1.00 0.00 ? 20  LYS A HA   9  
ATOM   9601  H  HB2  . LYS A 1 20 ? -6.477  -1.345  4.563   1.00 0.00 ? 20  LYS A HB2  9  
ATOM   9602  H  HB3  . LYS A 1 20 ? -8.217  -1.173  4.751   1.00 0.00 ? 20  LYS A HB3  9  
ATOM   9603  H  HG2  . LYS A 1 20 ? -7.597  0.600   5.996   1.00 0.00 ? 20  LYS A HG2  9  
ATOM   9604  H  HG3  . LYS A 1 20 ? -7.465  -0.628  7.257   1.00 0.00 ? 20  LYS A HG3  9  
ATOM   9605  H  HD2  . LYS A 1 20 ? -5.185  -0.583  7.252   1.00 0.00 ? 20  LYS A HD2  9  
ATOM   9606  H  HD3  . LYS A 1 20 ? -5.089  -0.172  5.538   1.00 0.00 ? 20  LYS A HD3  9  
ATOM   9607  H  HE2  . LYS A 1 20 ? -5.964  1.719   7.719   1.00 0.00 ? 20  LYS A HE2  9  
ATOM   9608  H  HE3  . LYS A 1 20 ? -4.340  1.656   7.038   1.00 0.00 ? 20  LYS A HE3  9  
ATOM   9609  H  HZ1  . LYS A 1 20 ? -5.146  3.203   5.654   1.00 0.00 ? 20  LYS A HZ1  9  
ATOM   9610  H  HZ2  . LYS A 1 20 ? -6.762  2.787   5.933   1.00 0.00 ? 20  LYS A HZ2  9  
ATOM   9611  H  HZ3  . LYS A 1 20 ? -5.837  1.895   4.833   1.00 0.00 ? 20  LYS A HZ3  9  
ATOM   9612  N  N    . CYS A 1 21 ? -9.660  -2.497  6.603   1.00 0.00 ? 21  CYS A N    9  
ATOM   9613  C  CA   . CYS A 1 21 ? -10.763 -2.498  7.556   1.00 0.00 ? 21  CYS A CA   9  
ATOM   9614  C  C    . CYS A 1 21 ? -11.434 -3.868  7.609   1.00 0.00 ? 21  CYS A C    9  
ATOM   9615  O  O    . CYS A 1 21 ? -11.394 -4.551  8.631   1.00 0.00 ? 21  CYS A O    9  
ATOM   9616  C  CB   . CYS A 1 21 ? -11.791 -1.429  7.180   1.00 0.00 ? 21  CYS A CB   9  
ATOM   9617  S  SG   . CYS A 1 21 ? -12.019 -1.215  5.385   1.00 0.00 ? 21  CYS A SG   9  
ATOM   9618  H  H    . CYS A 1 21 ? -9.834  -2.242  5.672   1.00 0.00 ? 21  CYS A H    9  
ATOM   9619  H  HA   . CYS A 1 21 ? -10.360 -2.270  8.531   1.00 0.00 ? 21  CYS A HA   9  
ATOM   9620  H  HB2  . CYS A 1 21 ? -12.749 -1.697  7.602   1.00 0.00 ? 21  CYS A HB2  9  
ATOM   9621  H  HB3  . CYS A 1 21 ? -11.477 -0.479  7.587   1.00 0.00 ? 21  CYS A HB3  9  
ATOM   9622  N  N    . GLY A 1 22 ? -12.051 -4.262  6.499   1.00 0.00 ? 22  GLY A N    9  
ATOM   9623  C  CA   . GLY A 1 22 ? -12.722 -5.548  6.440   1.00 0.00 ? 22  GLY A CA   9  
ATOM   9624  C  C    . GLY A 1 22 ? -14.188 -5.421  6.077   1.00 0.00 ? 22  GLY A C    9  
ATOM   9625  O  O    . GLY A 1 22 ? -15.058 -5.923  6.788   1.00 0.00 ? 22  GLY A O    9  
ATOM   9626  H  H    . GLY A 1 22 ? -12.051 -3.675  5.714   1.00 0.00 ? 22  GLY A H    9  
ATOM   9627  H  HA2  . GLY A 1 22 ? -12.231 -6.164  5.702   1.00 0.00 ? 22  GLY A HA2  9  
ATOM   9628  H  HA3  . GLY A 1 22 ? -12.643 -6.027  7.405   1.00 0.00 ? 22  GLY A HA3  9  
ATOM   9629  N  N    . THR A 1 23 ? -14.464 -4.745  4.966   1.00 0.00 ? 23  THR A N    9  
ATOM   9630  C  CA   . THR A 1 23 ? -15.835 -4.550  4.511   1.00 0.00 ? 23  THR A CA   9  
ATOM   9631  C  C    . THR A 1 23 ? -15.939 -4.705  2.998   1.00 0.00 ? 23  THR A C    9  
ATOM   9632  O  O    . THR A 1 23 ? -15.039 -4.307  2.260   1.00 0.00 ? 23  THR A O    9  
ATOM   9633  C  CB   . THR A 1 23 ? -16.368 -3.162  4.911   1.00 0.00 ? 23  THR A CB   9  
ATOM   9634  O  OG1  . THR A 1 23 ? -15.571 -2.138  4.306   1.00 0.00 ? 23  THR A OG1  9  
ATOM   9635  C  CG2  . THR A 1 23 ? -16.358 -2.993  6.423   1.00 0.00 ? 23  THR A CG2  9  
ATOM   9636  H  H    . THR A 1 23 ? -13.728 -4.368  4.441   1.00 0.00 ? 23  THR A H    9  
ATOM   9637  H  HA   . THR A 1 23 ? -16.453 -5.300  4.983   1.00 0.00 ? 23  THR A HA   9  
ATOM   9638  H  HB   . THR A 1 23 ? -17.386 -3.069  4.560   1.00 0.00 ? 23  THR A HB   9  
ATOM   9639  H  HG1  . THR A 1 23 ? -16.122 -1.598  3.734   1.00 0.00 ? 23  THR A HG1  9  
ATOM   9640  H  HG21 . THR A 1 23 ? -17.362 -2.804  6.771   1.00 0.00 ? 23  THR A HG21 9  
ATOM   9641  H  HG22 . THR A 1 23 ? -15.722 -2.161  6.687   1.00 0.00 ? 23  THR A HG22 9  
ATOM   9642  H  HG23 . THR A 1 23 ? -15.981 -3.894  6.882   1.00 0.00 ? 23  THR A HG23 9  
ATOM   9643  N  N    . GLY A 1 24 ? -17.045 -5.287  2.541   1.00 0.00 ? 24  GLY A N    9  
ATOM   9644  C  CA   . GLY A 1 24 ? -17.246 -5.483  1.118   1.00 0.00 ? 24  GLY A CA   9  
ATOM   9645  C  C    . GLY A 1 24 ? -17.017 -4.215  0.319   1.00 0.00 ? 24  GLY A C    9  
ATOM   9646  O  O    . GLY A 1 24 ? -17.649 -3.190  0.574   1.00 0.00 ? 24  GLY A O    9  
ATOM   9647  H  H    . GLY A 1 24 ? -17.729 -5.584  3.177   1.00 0.00 ? 24  GLY A H    9  
ATOM   9648  H  HA2  . GLY A 1 24 ? -16.563 -6.244  0.770   1.00 0.00 ? 24  GLY A HA2  9  
ATOM   9649  H  HA3  . GLY A 1 24 ? -18.259 -5.821  0.952   1.00 0.00 ? 24  GLY A HA3  9  
ATOM   9650  N  N    . ILE A 1 25 ? -16.109 -4.284  -0.649  1.00 0.00 ? 25  ILE A N    9  
ATOM   9651  C  CA   . ILE A 1 25 ? -15.798 -3.132  -1.486  1.00 0.00 ? 25  ILE A CA   9  
ATOM   9652  C  C    . ILE A 1 25 ? -16.844 -2.949  -2.580  1.00 0.00 ? 25  ILE A C    9  
ATOM   9653  O  O    . ILE A 1 25 ? -17.362 -3.922  -3.128  1.00 0.00 ? 25  ILE A O    9  
ATOM   9654  C  CB   . ILE A 1 25 ? -14.409 -3.269  -2.138  1.00 0.00 ? 25  ILE A CB   9  
ATOM   9655  C  CG1  . ILE A 1 25 ? -13.322 -3.340  -1.063  1.00 0.00 ? 25  ILE A CG1  9  
ATOM   9656  C  CG2  . ILE A 1 25 ? -14.151 -2.105  -3.083  1.00 0.00 ? 25  ILE A CG2  9  
ATOM   9657  C  CD1  . ILE A 1 25 ? -11.939 -3.600  -1.618  1.00 0.00 ? 25  ILE A CD1  9  
ATOM   9658  H  H    . ILE A 1 25 ? -15.638 -5.129  -0.804  1.00 0.00 ? 25  ILE A H    9  
ATOM   9659  H  HA   . ILE A 1 25 ? -15.793 -2.254  -0.856  1.00 0.00 ? 25  ILE A HA   9  
ATOM   9660  H  HB   . ILE A 1 25 ? -14.395 -4.180  -2.715  1.00 0.00 ? 25  ILE A HB   9  
ATOM   9661  H  HG12 . ILE A 1 25 ? -13.293 -2.404  -0.527  1.00 0.00 ? 25  ILE A HG12 9  
ATOM   9662  H  HG13 . ILE A 1 25 ? -13.559 -4.137  -0.374  1.00 0.00 ? 25  ILE A HG13 9  
ATOM   9663  H  HG21 . ILE A 1 25 ? -13.197 -1.656  -2.849  1.00 0.00 ? 25  ILE A HG21 9  
ATOM   9664  H  HG22 . ILE A 1 25 ? -14.137 -2.465  -4.101  1.00 0.00 ? 25  ILE A HG22 9  
ATOM   9665  H  HG23 . ILE A 1 25 ? -14.933 -1.369  -2.972  1.00 0.00 ? 25  ILE A HG23 9  
ATOM   9666  H  HD11 . ILE A 1 25 ? -11.638 -2.769  -2.239  1.00 0.00 ? 25  ILE A HD11 9  
ATOM   9667  H  HD12 . ILE A 1 25 ? -11.240 -3.715  -0.804  1.00 0.00 ? 25  ILE A HD12 9  
ATOM   9668  H  HD13 . ILE A 1 25 ? -11.954 -4.504  -2.211  1.00 0.00 ? 25  ILE A HD13 9  
ATOM   9669  N  N    . VAL A 1 26 ? -17.150 -1.694  -2.895  1.00 0.00 ? 26  VAL A N    9  
ATOM   9670  C  CA   . VAL A 1 26 ? -18.132 -1.382  -3.926  1.00 0.00 ? 26  VAL A CA   9  
ATOM   9671  C  C    . VAL A 1 26 ? -17.668 -0.218  -4.793  1.00 0.00 ? 26  VAL A C    9  
ATOM   9672  O  O    . VAL A 1 26 ? -17.486 0.898   -4.308  1.00 0.00 ? 26  VAL A O    9  
ATOM   9673  C  CB   . VAL A 1 26 ? -19.501 -1.036  -3.310  1.00 0.00 ? 26  VAL A CB   9  
ATOM   9674  C  CG1  . VAL A 1 26 ? -20.507 -0.697  -4.400  1.00 0.00 ? 26  VAL A CG1  9  
ATOM   9675  C  CG2  . VAL A 1 26 ? -20.003 -2.185  -2.449  1.00 0.00 ? 26  VAL A CG2  9  
ATOM   9676  H  H    . VAL A 1 26 ? -16.703 -0.961  -2.423  1.00 0.00 ? 26  VAL A H    9  
ATOM   9677  H  HA   . VAL A 1 26 ? -18.252 -2.257  -4.549  1.00 0.00 ? 26  VAL A HA   9  
ATOM   9678  H  HB   . VAL A 1 26 ? -19.380 -0.167  -2.680  1.00 0.00 ? 26  VAL A HB   9  
ATOM   9679  H  HG11 . VAL A 1 26 ? -19.985 -0.311  -5.263  1.00 0.00 ? 26  VAL A HG11 9  
ATOM   9680  H  HG12 . VAL A 1 26 ? -21.053 -1.587  -4.677  1.00 0.00 ? 26  VAL A HG12 9  
ATOM   9681  H  HG13 . VAL A 1 26 ? -21.196 0.049   -4.034  1.00 0.00 ? 26  VAL A HG13 9  
ATOM   9682  H  HG21 . VAL A 1 26 ? -20.809 -2.691  -2.960  1.00 0.00 ? 26  VAL A HG21 9  
ATOM   9683  H  HG22 . VAL A 1 26 ? -19.197 -2.881  -2.271  1.00 0.00 ? 26  VAL A HG22 9  
ATOM   9684  H  HG23 . VAL A 1 26 ? -20.360 -1.799  -1.506  1.00 0.00 ? 26  VAL A HG23 9  
ATOM   9685  N  N    . GLY A 1 27 ? -17.478 -0.485  -6.082  1.00 0.00 ? 27  GLY A N    9  
ATOM   9686  C  CA   . GLY A 1 27 ? -17.037 0.550   -6.998  1.00 0.00 ? 27  GLY A CA   9  
ATOM   9687  C  C    . GLY A 1 27 ? -15.533 0.559   -7.181  1.00 0.00 ? 27  GLY A C    9  
ATOM   9688  O  O    . GLY A 1 27 ? -14.909 -0.494  -7.310  1.00 0.00 ? 27  GLY A O    9  
ATOM   9689  H  H    . GLY A 1 27 ? -17.639 -1.394  -6.413  1.00 0.00 ? 27  GLY A H    9  
ATOM   9690  H  HA2  . GLY A 1 27 ? -17.506 0.391   -7.957  1.00 0.00 ? 27  GLY A HA2  9  
ATOM   9691  H  HA3  . GLY A 1 27 ? -17.347 1.511   -6.612  1.00 0.00 ? 27  GLY A HA3  9  
ATOM   9692  N  N    . VAL A 1 28 ? -14.947 1.753   -7.196  1.00 0.00 ? 28  VAL A N    9  
ATOM   9693  C  CA   . VAL A 1 28 ? -13.506 1.895   -7.366  1.00 0.00 ? 28  VAL A CA   9  
ATOM   9694  C  C    . VAL A 1 28 ? -12.751 1.297   -6.184  1.00 0.00 ? 28  VAL A C    9  
ATOM   9695  O  O    . VAL A 1 28 ? -13.202 1.379   -5.041  1.00 0.00 ? 28  VAL A O    9  
ATOM   9696  C  CB   . VAL A 1 28 ? -13.103 3.373   -7.525  1.00 0.00 ? 28  VAL A CB   9  
ATOM   9697  C  CG1  . VAL A 1 28 ? -13.584 4.188   -6.334  1.00 0.00 ? 28  VAL A CG1  9  
ATOM   9698  C  CG2  . VAL A 1 28 ? -11.596 3.498   -7.693  1.00 0.00 ? 28  VAL A CG2  9  
ATOM   9699  H  H    . VAL A 1 28 ? -15.497 2.556   -7.089  1.00 0.00 ? 28  VAL A H    9  
ATOM   9700  H  HA   . VAL A 1 28 ? -13.222 1.368   -8.266  1.00 0.00 ? 28  VAL A HA   9  
ATOM   9701  H  HB   . VAL A 1 28 ? -13.577 3.761   -8.414  1.00 0.00 ? 28  VAL A HB   9  
ATOM   9702  H  HG11 . VAL A 1 28 ? -12.790 4.841   -6.001  1.00 0.00 ? 28  VAL A HG11 9  
ATOM   9703  H  HG12 . VAL A 1 28 ? -14.440 4.780   -6.625  1.00 0.00 ? 28  VAL A HG12 9  
ATOM   9704  H  HG13 . VAL A 1 28 ? -13.863 3.522   -5.531  1.00 0.00 ? 28  VAL A HG13 9  
ATOM   9705  H  HG21 . VAL A 1 28 ? -11.148 3.745   -6.742  1.00 0.00 ? 28  VAL A HG21 9  
ATOM   9706  H  HG22 . VAL A 1 28 ? -11.193 2.561   -8.048  1.00 0.00 ? 28  VAL A HG22 9  
ATOM   9707  H  HG23 . VAL A 1 28 ? -11.377 4.277   -8.408  1.00 0.00 ? 28  VAL A HG23 9  
ATOM   9708  N  N    . PHE A 1 29 ? -11.600 0.697   -6.466  1.00 0.00 ? 29  PHE A N    9  
ATOM   9709  C  CA   . PHE A 1 29 ? -10.782 0.085   -5.426  1.00 0.00 ? 29  PHE A CA   9  
ATOM   9710  C  C    . PHE A 1 29 ? -9.385  -0.236  -5.951  1.00 0.00 ? 29  PHE A C    9  
ATOM   9711  O  O    . PHE A 1 29 ? -9.121  -0.134  -7.149  1.00 0.00 ? 29  PHE A O    9  
ATOM   9712  C  CB   . PHE A 1 29 ? -11.449 -1.191  -4.908  1.00 0.00 ? 29  PHE A CB   9  
ATOM   9713  C  CG   . PHE A 1 29 ? -11.609 -2.253  -5.958  1.00 0.00 ? 29  PHE A CG   9  
ATOM   9714  C  CD1  . PHE A 1 29 ? -10.516 -2.987  -6.392  1.00 0.00 ? 29  PHE A CD1  9  
ATOM   9715  C  CD2  . PHE A 1 29 ? -12.851 -2.518  -6.510  1.00 0.00 ? 29  PHE A CD2  9  
ATOM   9716  C  CE1  . PHE A 1 29 ? -10.660 -3.965  -7.358  1.00 0.00 ? 29  PHE A CE1  9  
ATOM   9717  C  CE2  . PHE A 1 29 ? -13.001 -3.495  -7.476  1.00 0.00 ? 29  PHE A CE2  9  
ATOM   9718  C  CZ   . PHE A 1 29 ? -11.904 -4.219  -7.901  1.00 0.00 ? 29  PHE A CZ   9  
ATOM   9719  H  H    . PHE A 1 29 ? -11.294 0.664   -7.397  1.00 0.00 ? 29  PHE A H    9  
ATOM   9720  H  HA   . PHE A 1 29 ? -10.695 0.791   -4.615  1.00 0.00 ? 29  PHE A HA   9  
ATOM   9721  H  HB2  . PHE A 1 29 ? -10.851 -1.603  -4.109  1.00 0.00 ? 29  PHE A HB2  9  
ATOM   9722  H  HB3  . PHE A 1 29 ? -12.430 -0.947  -4.529  1.00 0.00 ? 29  PHE A HB3  9  
ATOM   9723  H  HD1  . PHE A 1 29 ? -9.542  -2.788  -5.968  1.00 0.00 ? 29  PHE A HD1  9  
ATOM   9724  H  HD2  . PHE A 1 29 ? -13.710 -1.952  -6.180  1.00 0.00 ? 29  PHE A HD2  9  
ATOM   9725  H  HE1  . PHE A 1 29 ? -9.800  -4.529  -7.688  1.00 0.00 ? 29  PHE A HE1  9  
ATOM   9726  H  HE2  . PHE A 1 29 ? -13.975 -3.692  -7.899  1.00 0.00 ? 29  PHE A HE2  9  
ATOM   9727  H  HZ   . PHE A 1 29 ? -12.019 -4.983  -8.655  1.00 0.00 ? 29  PHE A HZ   9  
ATOM   9728  N  N    . VAL A 1 30 ? -8.493  -0.623  -5.044  1.00 0.00 ? 30  VAL A N    9  
ATOM   9729  C  CA   . VAL A 1 30 ? -7.123  -0.958  -5.414  1.00 0.00 ? 30  VAL A CA   9  
ATOM   9730  C  C    . VAL A 1 30 ? -6.911  -2.468  -5.424  1.00 0.00 ? 30  VAL A C    9  
ATOM   9731  O  O    . VAL A 1 30 ? -6.787  -3.096  -4.372  1.00 0.00 ? 30  VAL A O    9  
ATOM   9732  C  CB   . VAL A 1 30 ? -6.108  -0.314  -4.452  1.00 0.00 ? 30  VAL A CB   9  
ATOM   9733  C  CG1  . VAL A 1 30 ? -4.691  -0.739  -4.807  1.00 0.00 ? 30  VAL A CG1  9  
ATOM   9734  C  CG2  . VAL A 1 30 ? -6.240  1.201   -4.475  1.00 0.00 ? 30  VAL A CG2  9  
ATOM   9735  H  H    . VAL A 1 30 ? -8.763  -0.684  -4.104  1.00 0.00 ? 30  VAL A H    9  
ATOM   9736  H  HA   . VAL A 1 30 ? -6.942  -0.573  -6.407  1.00 0.00 ? 30  VAL A HA   9  
ATOM   9737  H  HB   . VAL A 1 30 ? -6.323  -0.658  -3.451  1.00 0.00 ? 30  VAL A HB   9  
ATOM   9738  H  HG11 . VAL A 1 30 ? -4.126  0.125   -5.124  1.00 0.00 ? 30  VAL A HG11 9  
ATOM   9739  H  HG12 . VAL A 1 30 ? -4.220  -1.182  -3.942  1.00 0.00 ? 30  VAL A HG12 9  
ATOM   9740  H  HG13 . VAL A 1 30 ? -4.723  -1.462  -5.609  1.00 0.00 ? 30  VAL A HG13 9  
ATOM   9741  H  HG21 . VAL A 1 30 ? -7.279  1.473   -4.356  1.00 0.00 ? 30  VAL A HG21 9  
ATOM   9742  H  HG22 . VAL A 1 30 ? -5.663  1.626   -3.667  1.00 0.00 ? 30  VAL A HG22 9  
ATOM   9743  H  HG23 . VAL A 1 30 ? -5.874  1.581   -5.417  1.00 0.00 ? 30  VAL A HG23 9  
ATOM   9744  N  N    . LYS A 1 31 ? -6.869  -3.047  -6.619  1.00 0.00 ? 31  LYS A N    9  
ATOM   9745  C  CA   . LYS A 1 31 ? -6.670  -4.483  -6.767  1.00 0.00 ? 31  LYS A CA   9  
ATOM   9746  C  C    . LYS A 1 31 ? -5.218  -4.862  -6.496  1.00 0.00 ? 31  LYS A C    9  
ATOM   9747  O  O    . LYS A 1 31 ? -4.298  -4.319  -7.111  1.00 0.00 ? 31  LYS A O    9  
ATOM   9748  C  CB   . LYS A 1 31 ? -7.071  -4.932  -8.175  1.00 0.00 ? 31  LYS A CB   9  
ATOM   9749  C  CG   . LYS A 1 31 ? -7.318  -6.426  -8.289  1.00 0.00 ? 31  LYS A CG   9  
ATOM   9750  C  CD   . LYS A 1 31 ? -6.019  -7.194  -8.469  1.00 0.00 ? 31  LYS A CD   9  
ATOM   9751  C  CE   . LYS A 1 31 ? -6.262  -8.695  -8.523  1.00 0.00 ? 31  LYS A CE   9  
ATOM   9752  N  NZ   . LYS A 1 31 ? -6.554  -9.160  -9.907  1.00 0.00 ? 31  LYS A NZ   9  
ATOM   9753  H  H    . LYS A 1 31 ? -6.974  -2.493  -7.422  1.00 0.00 ? 31  LYS A H    9  
ATOM   9754  H  HA   . LYS A 1 31 ? -7.300  -4.982  -6.047  1.00 0.00 ? 31  LYS A HA   9  
ATOM   9755  H  HB2  . LYS A 1 31 ? -7.975  -4.415  -8.460  1.00 0.00 ? 31  LYS A HB2  9  
ATOM   9756  H  HB3  . LYS A 1 31 ? -6.282  -4.665  -8.863  1.00 0.00 ? 31  LYS A HB3  9  
ATOM   9757  H  HG2  . LYS A 1 31 ? -7.806  -6.772  -7.390  1.00 0.00 ? 31  LYS A HG2  9  
ATOM   9758  H  HG3  . LYS A 1 31 ? -7.957  -6.612  -9.142  1.00 0.00 ? 31  LYS A HG3  9  
ATOM   9759  H  HD2  . LYS A 1 31 ? -5.552  -6.884  -9.392  1.00 0.00 ? 31  LYS A HD2  9  
ATOM   9760  H  HD3  . LYS A 1 31 ? -5.363  -6.974  -7.639  1.00 0.00 ? 31  LYS A HD3  9  
ATOM   9761  H  HE2  . LYS A 1 31 ? -5.381  -9.202  -8.160  1.00 0.00 ? 31  LYS A HE2  9  
ATOM   9762  H  HE3  . LYS A 1 31 ? -7.102  -8.933  -7.887  1.00 0.00 ? 31  LYS A HE3  9  
ATOM   9763  H  HZ1  . LYS A 1 31 ? -7.572  -9.351  -10.011 1.00 0.00 ? 31  LYS A HZ1  9  
ATOM   9764  H  HZ2  . LYS A 1 31 ? -6.027  -10.034 -10.109 1.00 0.00 ? 31  LYS A HZ2  9  
ATOM   9765  H  HZ3  . LYS A 1 31 ? -6.276  -8.433  -10.595 1.00 0.00 ? 31  LYS A HZ3  9  
ATOM   9766  N  N    . LEU A 1 32 ? -5.017  -5.797  -5.574  1.00 0.00 ? 32  LEU A N    9  
ATOM   9767  C  CA   . LEU A 1 32 ? -3.676  -6.250  -5.222  1.00 0.00 ? 32  LEU A CA   9  
ATOM   9768  C  C    . LEU A 1 32 ? -3.393  -7.626  -5.815  1.00 0.00 ? 32  LEU A C    9  
ATOM   9769  O  O    . LEU A 1 32 ? -4.306  -8.319  -6.265  1.00 0.00 ? 32  LEU A O    9  
ATOM   9770  C  CB   . LEU A 1 32 ? -3.513  -6.294  -3.702  1.00 0.00 ? 32  LEU A CB   9  
ATOM   9771  C  CG   . LEU A 1 32 ? -3.053  -4.996  -3.038  1.00 0.00 ? 32  LEU A CG   9  
ATOM   9772  C  CD1  . LEU A 1 32 ? -4.107  -3.912  -3.197  1.00 0.00 ? 32  LEU A CD1  9  
ATOM   9773  C  CD2  . LEU A 1 32 ? -2.744  -5.230  -1.566  1.00 0.00 ? 32  LEU A CD2  9  
ATOM   9774  H  H    . LEU A 1 32 ? -5.789  -6.193  -5.118  1.00 0.00 ? 32  LEU A H    9  
ATOM   9775  H  HA   . LEU A 1 32 ? -2.970  -5.543  -5.631  1.00 0.00 ? 32  LEU A HA   9  
ATOM   9776  H  HB2  . LEU A 1 32 ? -4.467  -6.563  -3.275  1.00 0.00 ? 32  LEU A HB2  9  
ATOM   9777  H  HB3  . LEU A 1 32 ? -2.788  -7.061  -3.470  1.00 0.00 ? 32  LEU A HB3  9  
ATOM   9778  H  HG   . LEU A 1 32 ? -2.148  -4.653  -3.521  1.00 0.00 ? 32  LEU A HG   9  
ATOM   9779  H  HD11 . LEU A 1 32 ? -3.627  -2.945  -3.234  1.00 0.00 ? 32  LEU A HD11 9  
ATOM   9780  H  HD12 . LEU A 1 32 ? -4.786  -3.944  -2.358  1.00 0.00 ? 32  LEU A HD12 9  
ATOM   9781  H  HD13 . LEU A 1 32 ? -4.658  -4.077  -4.112  1.00 0.00 ? 32  LEU A HD13 9  
ATOM   9782  H  HD21 . LEU A 1 32 ? -2.987  -6.249  -1.306  1.00 0.00 ? 32  LEU A HD21 9  
ATOM   9783  H  HD22 . LEU A 1 32 ? -3.332  -4.553  -0.963  1.00 0.00 ? 32  LEU A HD22 9  
ATOM   9784  H  HD23 . LEU A 1 32 ? -1.694  -5.052  -1.387  1.00 0.00 ? 32  LEU A HD23 9  
ATOM   9785  N  N    . ARG A 1 33 ? -2.122  -8.017  -5.811  1.00 0.00 ? 33  ARG A N    9  
ATOM   9786  C  CA   . ARG A 1 33 ? -1.719  -9.311  -6.348  1.00 0.00 ? 33  ARG A CA   9  
ATOM   9787  C  C    . ARG A 1 33 ? -2.818  -10.350 -6.146  1.00 0.00 ? 33  ARG A C    9  
ATOM   9788  O  O    . ARG A 1 33 ? -3.502  -10.737 -7.094  1.00 0.00 ? 33  ARG A O    9  
ATOM   9789  C  CB   . ARG A 1 33 ? -0.427  -9.784  -5.680  1.00 0.00 ? 33  ARG A CB   9  
ATOM   9790  C  CG   . ARG A 1 33 ? 0.108   -11.090 -6.245  1.00 0.00 ? 33  ARG A CG   9  
ATOM   9791  C  CD   . ARG A 1 33 ? 0.846   -11.894 -5.186  1.00 0.00 ? 33  ARG A CD   9  
ATOM   9792  N  NE   . ARG A 1 33 ? 1.059   -13.278 -5.600  1.00 0.00 ? 33  ARG A NE   9  
ATOM   9793  C  CZ   . ARG A 1 33 ? 2.191   -13.719 -6.135  1.00 0.00 ? 33  ARG A CZ   9  
ATOM   9794  N  NH1  . ARG A 1 33 ? 3.208   -12.889 -6.321  1.00 0.00 ? 33  ARG A NH1  9  
ATOM   9795  N  NH2  . ARG A 1 33 ? 2.309   -14.994 -6.486  1.00 0.00 ? 33  ARG A NH2  9  
ATOM   9796  H  H    . ARG A 1 33 ? -1.440  -7.420  -5.439  1.00 0.00 ? 33  ARG A H    9  
ATOM   9797  H  HA   . ARG A 1 33 ? -1.544  -9.191  -7.407  1.00 0.00 ? 33  ARG A HA   9  
ATOM   9798  H  HB2  . ARG A 1 33 ? 0.331   -9.024  -5.810  1.00 0.00 ? 33  ARG A HB2  9  
ATOM   9799  H  HB3  . ARG A 1 33 ? -0.611  -9.921  -4.626  1.00 0.00 ? 33  ARG A HB3  9  
ATOM   9800  H  HG2  . ARG A 1 33 ? -0.719  -11.677 -6.616  1.00 0.00 ? 33  ARG A HG2  9  
ATOM   9801  H  HG3  . ARG A 1 33 ? 0.787   -10.869 -7.056  1.00 0.00 ? 33  ARG A HG3  9  
ATOM   9802  H  HD2  . ARG A 1 33 ? 1.805   -11.431 -5.005  1.00 0.00 ? 33  ARG A HD2  9  
ATOM   9803  H  HD3  . ARG A 1 33 ? 0.264   -11.884 -4.277  1.00 0.00 ? 33  ARG A HD3  9  
ATOM   9804  H  HE   . ARG A 1 33 ? 0.320   -13.909 -5.472  1.00 0.00 ? 33  ARG A HE   9  
ATOM   9805  H  HH11 . ARG A 1 33 ? 3.123   -11.929 -6.056  1.00 0.00 ? 33  ARG A HH11 9  
ATOM   9806  H  HH12 . ARG A 1 33 ? 4.061   -13.224 -6.723  1.00 0.00 ? 33  ARG A HH12 9  
ATOM   9807  H  HH21 . ARG A 1 33 ? 1.544   -15.622 -6.348  1.00 0.00 ? 33  ARG A HH21 9  
ATOM   9808  H  HH22 . ARG A 1 33 ? 3.161   -15.325 -6.889  1.00 0.00 ? 33  ARG A HH22 9  
ATOM   9809  N  N    . ASP A 1 34 ? -2.982  -10.797 -4.906  1.00 0.00 ? 34  ASP A N    9  
ATOM   9810  C  CA   . ASP A 1 34 ? -3.998  -11.790 -4.579  1.00 0.00 ? 34  ASP A CA   9  
ATOM   9811  C  C    . ASP A 1 34 ? -5.015  -11.223 -3.593  1.00 0.00 ? 34  ASP A C    9  
ATOM   9812  O  O    . ASP A 1 34 ? -5.979  -11.895 -3.225  1.00 0.00 ? 34  ASP A O    9  
ATOM   9813  C  CB   . ASP A 1 34 ? -3.346  -13.044 -3.994  1.00 0.00 ? 34  ASP A CB   9  
ATOM   9814  C  CG   . ASP A 1 34 ? -2.864  -12.836 -2.572  1.00 0.00 ? 34  ASP A CG   9  
ATOM   9815  O  OD1  . ASP A 1 34 ? -3.659  -13.066 -1.636  1.00 0.00 ? 34  ASP A OD1  9  
ATOM   9816  O  OD2  . ASP A 1 34 ? -1.692  -12.445 -2.395  1.00 0.00 ? 34  ASP A OD2  9  
ATOM   9817  H  H    . ASP A 1 34 ? -2.405  -10.449 -4.193  1.00 0.00 ? 34  ASP A H    9  
ATOM   9818  H  HA   . ASP A 1 34 ? -4.510  -12.054 -5.492  1.00 0.00 ? 34  ASP A HA   9  
ATOM   9819  H  HB2  . ASP A 1 34 ? -4.065  -13.850 -3.996  1.00 0.00 ? 34  ASP A HB2  9  
ATOM   9820  H  HB3  . ASP A 1 34 ? -2.500  -13.320 -4.606  1.00 0.00 ? 34  ASP A HB3  9  
ATOM   9821  N  N    . ARG A 1 35 ? -4.792  -9.984  -3.168  1.00 0.00 ? 35  ARG A N    9  
ATOM   9822  C  CA   . ARG A 1 35 ? -5.687  -9.327  -2.223  1.00 0.00 ? 35  ARG A CA   9  
ATOM   9823  C  C    . ARG A 1 35 ? -6.298  -8.071  -2.836  1.00 0.00 ? 35  ARG A C    9  
ATOM   9824  O  O    . ARG A 1 35 ? -6.005  -7.719  -3.979  1.00 0.00 ? 35  ARG A O    9  
ATOM   9825  C  CB   . ARG A 1 35 ? -4.935  -8.968  -0.941  1.00 0.00 ? 35  ARG A CB   9  
ATOM   9826  C  CG   . ARG A 1 35 ? -4.259  -10.157 -0.277  1.00 0.00 ? 35  ARG A CG   9  
ATOM   9827  C  CD   . ARG A 1 35 ? -5.270  -11.057 0.416   1.00 0.00 ? 35  ARG A CD   9  
ATOM   9828  N  NE   . ARG A 1 35 ? -4.684  -12.333 0.816   1.00 0.00 ? 35  ARG A NE   9  
ATOM   9829  C  CZ   . ARG A 1 35 ? -5.401  -13.391 1.178   1.00 0.00 ? 35  ARG A CZ   9  
ATOM   9830  N  NH1  . ARG A 1 35 ? -6.726  -13.325 1.189   1.00 0.00 ? 35  ARG A NH1  9  
ATOM   9831  N  NH2  . ARG A 1 35 ? -4.794  -14.517 1.529   1.00 0.00 ? 35  ARG A NH2  9  
ATOM   9832  H  H    . ARG A 1 35 ? -4.006  -9.499  -3.498  1.00 0.00 ? 35  ARG A H    9  
ATOM   9833  H  HA   . ARG A 1 35 ? -6.481  -10.019 -1.983  1.00 0.00 ? 35  ARG A HA   9  
ATOM   9834  H  HB2  . ARG A 1 35 ? -4.176  -8.236  -1.175  1.00 0.00 ? 35  ARG A HB2  9  
ATOM   9835  H  HB3  . ARG A 1 35 ? -5.632  -8.539  -0.237  1.00 0.00 ? 35  ARG A HB3  9  
ATOM   9836  H  HG2  . ARG A 1 35 ? -3.741  -10.731 -1.031  1.00 0.00 ? 35  ARG A HG2  9  
ATOM   9837  H  HG3  . ARG A 1 35 ? -3.551  -9.796  0.453   1.00 0.00 ? 35  ARG A HG3  9  
ATOM   9838  H  HD2  . ARG A 1 35 ? -5.640  -10.551 1.295   1.00 0.00 ? 35  ARG A HD2  9  
ATOM   9839  H  HD3  . ARG A 1 35 ? -6.089  -11.245 -0.262  1.00 0.00 ? 35  ARG A HD3  9  
ATOM   9840  H  HE   . ARG A 1 35 ? -3.707  -12.404 0.815   1.00 0.00 ? 35  ARG A HE   9  
ATOM   9841  H  HH11 . ARG A 1 35 ? -7.186  -12.478 0.924   1.00 0.00 ? 35  ARG A HH11 9  
ATOM   9842  H  HH12 . ARG A 1 35 ? -7.264  -14.123 1.461   1.00 0.00 ? 35  ARG A HH12 9  
ATOM   9843  H  HH21 . ARG A 1 35 ? -3.796  -14.571 1.521   1.00 0.00 ? 35  ARG A HH21 9  
ATOM   9844  H  HH22 . ARG A 1 35 ? -5.335  -15.313 1.801   1.00 0.00 ? 35  ARG A HH22 9  
ATOM   9845  N  N    . HIS A 1 36 ? -7.151  -7.399  -2.069  1.00 0.00 ? 36  HIS A N    9  
ATOM   9846  C  CA   . HIS A 1 36 ? -7.803  -6.181  -2.536  1.00 0.00 ? 36  HIS A CA   9  
ATOM   9847  C  C    . HIS A 1 36 ? -8.061  -5.223  -1.376  1.00 0.00 ? 36  HIS A C    9  
ATOM   9848  O  O    . HIS A 1 36 ? -8.472  -5.641  -0.294  1.00 0.00 ? 36  HIS A O    9  
ATOM   9849  C  CB   . HIS A 1 36 ? -9.120  -6.519  -3.236  1.00 0.00 ? 36  HIS A CB   9  
ATOM   9850  C  CG   . HIS A 1 36 ? -8.994  -7.610  -4.254  1.00 0.00 ? 36  HIS A CG   9  
ATOM   9851  N  ND1  . HIS A 1 36 ? -8.670  -8.910  -3.929  1.00 0.00 ? 36  HIS A ND1  9  
ATOM   9852  C  CD2  . HIS A 1 36 ? -9.152  -7.589  -5.598  1.00 0.00 ? 36  HIS A CD2  9  
ATOM   9853  C  CE1  . HIS A 1 36 ? -8.633  -9.641  -5.028  1.00 0.00 ? 36  HIS A CE1  9  
ATOM   9854  N  NE2  . HIS A 1 36 ? -8.922  -8.863  -6.056  1.00 0.00 ? 36  HIS A NE2  9  
ATOM   9855  H  H    . HIS A 1 36 ? -7.344  -7.729  -1.167  1.00 0.00 ? 36  HIS A H    9  
ATOM   9856  H  HA   . HIS A 1 36 ? -7.143  -5.701  -3.243  1.00 0.00 ? 36  HIS A HA   9  
ATOM   9857  H  HB2  . HIS A 1 36 ? -9.841  -6.837  -2.497  1.00 0.00 ? 36  HIS A HB2  9  
ATOM   9858  H  HB3  . HIS A 1 36 ? -9.491  -5.637  -3.737  1.00 0.00 ? 36  HIS A HB3  9  
ATOM   9859  H  HD1  . HIS A 1 36 ? -8.492  -9.246  -3.026  1.00 0.00 ? 36  HIS A HD1  9  
ATOM   9860  H  HD2  . HIS A 1 36 ? -9.411  -6.729  -6.201  1.00 0.00 ? 36  HIS A HD2  9  
ATOM   9861  H  HE1  . HIS A 1 36 ? -8.405  -10.695 -5.080  1.00 0.00 ? 36  HIS A HE1  9  
ATOM   9862  H  HE2  . HIS A 1 36 ? -8.880  -9.132  -6.997  1.00 0.00 ? 36  HIS A HE2  9  
ATOM   9863  N  N    . ARG A 1 37 ? -7.817  -3.938  -1.611  1.00 0.00 ? 37  ARG A N    9  
ATOM   9864  C  CA   . ARG A 1 37 ? -8.021  -2.922  -0.586  1.00 0.00 ? 37  ARG A CA   9  
ATOM   9865  C  C    . ARG A 1 37 ? -8.720  -1.696  -1.166  1.00 0.00 ? 37  ARG A C    9  
ATOM   9866  O  O    . ARG A 1 37 ? -8.667  -1.452  -2.372  1.00 0.00 ? 37  ARG A O    9  
ATOM   9867  C  CB   . ARG A 1 37 ? -6.682  -2.514  0.032   1.00 0.00 ? 37  ARG A CB   9  
ATOM   9868  C  CG   . ARG A 1 37 ? -6.221  -3.435  1.150   1.00 0.00 ? 37  ARG A CG   9  
ATOM   9869  C  CD   . ARG A 1 37 ? -5.349  -2.699  2.154   1.00 0.00 ? 37  ARG A CD   9  
ATOM   9870  N  NE   . ARG A 1 37 ? -4.602  -3.618  3.009   1.00 0.00 ? 37  ARG A NE   9  
ATOM   9871  C  CZ   . ARG A 1 37 ? -3.948  -3.239  4.101   1.00 0.00 ? 37  ARG A CZ   9  
ATOM   9872  N  NH1  . ARG A 1 37 ? -3.949  -1.965  4.470   1.00 0.00 ? 37  ARG A NH1  9  
ATOM   9873  N  NH2  . ARG A 1 37 ? -3.292  -4.135  4.828   1.00 0.00 ? 37  ARG A NH2  9  
ATOM   9874  H  H    . ARG A 1 37 ? -7.491  -3.667  -2.494  1.00 0.00 ? 37  ARG A H    9  
ATOM   9875  H  HA   . ARG A 1 37 ? -8.647  -3.348  0.184   1.00 0.00 ? 37  ARG A HA   9  
ATOM   9876  H  HB2  . ARG A 1 37 ? -5.927  -2.516  -0.741  1.00 0.00 ? 37  ARG A HB2  9  
ATOM   9877  H  HB3  . ARG A 1 37 ? -6.773  -1.516  0.432   1.00 0.00 ? 37  ARG A HB3  9  
ATOM   9878  H  HG2  . ARG A 1 37 ? -7.087  -3.827  1.661   1.00 0.00 ? 37  ARG A HG2  9  
ATOM   9879  H  HG3  . ARG A 1 37 ? -5.654  -4.249  0.722   1.00 0.00 ? 37  ARG A HG3  9  
ATOM   9880  H  HD2  . ARG A 1 37 ? -4.650  -2.075  1.616   1.00 0.00 ? 37  ARG A HD2  9  
ATOM   9881  H  HD3  . ARG A 1 37 ? -5.981  -2.079  2.773   1.00 0.00 ? 37  ARG A HD3  9  
ATOM   9882  H  HE   . ARG A 1 37 ? -4.588  -4.564  2.755   1.00 0.00 ? 37  ARG A HE   9  
ATOM   9883  H  HH11 . ARG A 1 37 ? -4.444  -1.288  3.925   1.00 0.00 ? 37  ARG A HH11 9  
ATOM   9884  H  HH12 . ARG A 1 37 ? -3.457  -1.683  5.294   1.00 0.00 ? 37  ARG A HH12 9  
ATOM   9885  H  HH21 . ARG A 1 37 ? -3.289  -5.096  4.553   1.00 0.00 ? 37  ARG A HH21 9  
ATOM   9886  H  HH22 . ARG A 1 37 ? -2.800  -3.849  5.649   1.00 0.00 ? 37  ARG A HH22 9  
ATOM   9887  N  N    . HIS A 1 38 ? -9.374  -0.929  -0.300  1.00 0.00 ? 38  HIS A N    9  
ATOM   9888  C  CA   . HIS A 1 38 ? -10.084 0.272   -0.727  1.00 0.00 ? 38  HIS A CA   9  
ATOM   9889  C  C    . HIS A 1 38 ? -9.116  1.296   -1.311  1.00 0.00 ? 38  HIS A C    9  
ATOM   9890  O  O    . HIS A 1 38 ? -7.903  1.223   -1.113  1.00 0.00 ? 38  HIS A O    9  
ATOM   9891  C  CB   . HIS A 1 38 ? -10.845 0.885   0.449   1.00 0.00 ? 38  HIS A CB   9  
ATOM   9892  C  CG   . HIS A 1 38 ? -12.146 0.203   0.741   1.00 0.00 ? 38  HIS A CG   9  
ATOM   9893  N  ND1  . HIS A 1 38 ? -12.441 -0.366  1.962   1.00 0.00 ? 38  HIS A ND1  9  
ATOM   9894  C  CD2  . HIS A 1 38 ? -13.234 0.002   -0.039  1.00 0.00 ? 38  HIS A CD2  9  
ATOM   9895  C  CE1  . HIS A 1 38 ? -13.653 -0.889  1.920   1.00 0.00 ? 38  HIS A CE1  9  
ATOM   9896  N  NE2  . HIS A 1 38 ? -14.157 -0.679  0.717   1.00 0.00 ? 38  HIS A NE2  9  
ATOM   9897  H  H    . HIS A 1 38 ? -9.379  -1.176  0.648   1.00 0.00 ? 38  HIS A H    9  
ATOM   9898  H  HA   . HIS A 1 38 ? -10.790 -0.014  -1.492  1.00 0.00 ? 38  HIS A HA   9  
ATOM   9899  H  HB2  . HIS A 1 38 ? -10.233 0.824   1.337   1.00 0.00 ? 38  HIS A HB2  9  
ATOM   9900  H  HB3  . HIS A 1 38 ? -11.054 1.922   0.232   1.00 0.00 ? 38  HIS A HB3  9  
ATOM   9901  H  HD2  . HIS A 1 38 ? -13.356 0.317   -1.066  1.00 0.00 ? 38  HIS A HD2  9  
ATOM   9902  H  HE1  . HIS A 1 38 ? -14.149 -1.400  2.732   1.00 0.00 ? 38  HIS A HE1  9  
ATOM   9903  H  HE2  . HIS A 1 38 ? -15.008 -1.038  0.392   1.00 0.00 ? 38  HIS A HE2  9  
ATOM   9904  N  N    . PRO A 1 39 ? -9.662  2.274   -2.049  1.00 0.00 ? 39  PRO A N    9  
ATOM   9905  C  CA   . PRO A 1 39 ? -8.864  3.332   -2.677  1.00 0.00 ? 39  PRO A CA   9  
ATOM   9906  C  C    . PRO A 1 39 ? -8.276  4.298   -1.654  1.00 0.00 ? 39  PRO A C    9  
ATOM   9907  O  O    . PRO A 1 39 ? -7.307  5.002   -1.939  1.00 0.00 ? 39  PRO A O    9  
ATOM   9908  C  CB   . PRO A 1 39 ? -9.874  4.052   -3.574  1.00 0.00 ? 39  PRO A CB   9  
ATOM   9909  C  CG   . PRO A 1 39 ? -11.197 3.792   -2.939  1.00 0.00 ? 39  PRO A CG   9  
ATOM   9910  C  CD   . PRO A 1 39 ? -11.100 2.423   -2.326  1.00 0.00 ? 39  PRO A CD   9  
ATOM   9911  H  HA   . PRO A 1 39 ? -8.070  2.922   -3.283  1.00 0.00 ? 39  PRO A HA   9  
ATOM   9912  H  HB2  . PRO A 1 39 ? -9.648  5.109   -3.598  1.00 0.00 ? 39  PRO A HB2  9  
ATOM   9913  H  HB3  . PRO A 1 39 ? -9.829  3.645   -4.572  1.00 0.00 ? 39  PRO A HB3  9  
ATOM   9914  H  HG2  . PRO A 1 39 ? -11.391 4.532   -2.178  1.00 0.00 ? 39  PRO A HG2  9  
ATOM   9915  H  HG3  . PRO A 1 39 ? -11.974 3.813   -3.690  1.00 0.00 ? 39  PRO A HG3  9  
ATOM   9916  H  HD2  . PRO A 1 39 ? -11.676 2.377   -1.413  1.00 0.00 ? 39  PRO A HD2  9  
ATOM   9917  H  HD3  . PRO A 1 39 ? -11.437 1.672   -3.025  1.00 0.00 ? 39  PRO A HD3  9  
ATOM   9918  N  N    . GLU A 1 40 ? -8.866  4.326   -0.464  1.00 0.00 ? 40  GLU A N    9  
ATOM   9919  C  CA   . GLU A 1 40 ? -8.399  5.207   0.600   1.00 0.00 ? 40  GLU A CA   9  
ATOM   9920  C  C    . GLU A 1 40 ? -7.571  4.434   1.622   1.00 0.00 ? 40  GLU A C    9  
ATOM   9921  O  O    . GLU A 1 40 ? -6.664  4.984   2.247   1.00 0.00 ? 40  GLU A O    9  
ATOM   9922  C  CB   . GLU A 1 40 ? -9.585  5.880   1.293   1.00 0.00 ? 40  GLU A CB   9  
ATOM   9923  C  CG   . GLU A 1 40 ? -10.412 4.931   2.144   1.00 0.00 ? 40  GLU A CG   9  
ATOM   9924  C  CD   . GLU A 1 40 ? -11.278 5.658   3.155   1.00 0.00 ? 40  GLU A CD   9  
ATOM   9925  O  OE1  . GLU A 1 40 ? -11.964 6.624   2.761   1.00 0.00 ? 40  GLU A OE1  9  
ATOM   9926  O  OE2  . GLU A 1 40 ? -11.270 5.261   4.339   1.00 0.00 ? 40  GLU A OE2  9  
ATOM   9927  H  H    . GLU A 1 40 ? -9.635  3.741   -0.297  1.00 0.00 ? 40  GLU A H    9  
ATOM   9928  H  HA   . GLU A 1 40 ? -7.777  5.967   0.151   1.00 0.00 ? 40  GLU A HA   9  
ATOM   9929  H  HB2  . GLU A 1 40 ? -9.215  6.671   1.928   1.00 0.00 ? 40  GLU A HB2  9  
ATOM   9930  H  HB3  . GLU A 1 40 ? -10.230 6.309   0.540   1.00 0.00 ? 40  GLU A HB3  9  
ATOM   9931  H  HG2  . GLU A 1 40 ? -11.051 4.351   1.497   1.00 0.00 ? 40  GLU A HG2  9  
ATOM   9932  H  HG3  . GLU A 1 40 ? -9.743  4.270   2.675   1.00 0.00 ? 40  GLU A HG3  9  
ATOM   9933  N  N    . CYS A 1 41 ? -7.889  3.154   1.787   1.00 0.00 ? 41  CYS A N    9  
ATOM   9934  C  CA   . CYS A 1 41 ? -7.177  2.304   2.733   1.00 0.00 ? 41  CYS A CA   9  
ATOM   9935  C  C    . CYS A 1 41 ? -5.889  1.765   2.117   1.00 0.00 ? 41  CYS A C    9  
ATOM   9936  O  O    . CYS A 1 41 ? -5.149  1.018   2.756   1.00 0.00 ? 41  CYS A O    9  
ATOM   9937  C  CB   . CYS A 1 41 ? -8.068  1.143   3.178   1.00 0.00 ? 41  CYS A CB   9  
ATOM   9938  S  SG   . CYS A 1 41 ? -9.685  1.657   3.841   1.00 0.00 ? 41  CYS A SG   9  
ATOM   9939  H  H    . CYS A 1 41 ? -8.623  2.772   1.259   1.00 0.00 ? 41  CYS A H    9  
ATOM   9940  H  HA   . CYS A 1 41 ? -6.926  2.904   3.594   1.00 0.00 ? 41  CYS A HA   9  
ATOM   9941  H  HB2  . CYS A 1 41 ? -8.251  0.496   2.333   1.00 0.00 ? 41  CYS A HB2  9  
ATOM   9942  H  HB3  . CYS A 1 41 ? -7.559  0.583   3.949   1.00 0.00 ? 41  CYS A HB3  9  
ATOM   9943  N  N    . TYR A 1 42 ? -5.629  2.150   0.873   1.00 0.00 ? 42  TYR A N    9  
ATOM   9944  C  CA   . TYR A 1 42 ? -4.433  1.704   0.169   1.00 0.00 ? 42  TYR A CA   9  
ATOM   9945  C  C    . TYR A 1 42 ? -3.198  2.450   0.666   1.00 0.00 ? 42  TYR A C    9  
ATOM   9946  O  O    . TYR A 1 42 ? -2.137  2.402   0.044   1.00 0.00 ? 42  TYR A O    9  
ATOM   9947  C  CB   . TYR A 1 42 ? -4.595  1.910   -1.338  1.00 0.00 ? 42  TYR A CB   9  
ATOM   9948  C  CG   . TYR A 1 42 ? -3.387  1.483   -2.141  1.00 0.00 ? 42  TYR A CG   9  
ATOM   9949  C  CD1  . TYR A 1 42 ? -2.837  0.217   -1.986  1.00 0.00 ? 42  TYR A CD1  9  
ATOM   9950  C  CD2  . TYR A 1 42 ? -2.795  2.347   -3.054  1.00 0.00 ? 42  TYR A CD2  9  
ATOM   9951  C  CE1  . TYR A 1 42 ? -1.733  -0.177  -2.717  1.00 0.00 ? 42  TYR A CE1  9  
ATOM   9952  C  CE2  . TYR A 1 42 ? -1.692  1.961   -3.791  1.00 0.00 ? 42  TYR A CE2  9  
ATOM   9953  C  CZ   . TYR A 1 42 ? -1.164  0.698   -3.618  1.00 0.00 ? 42  TYR A CZ   9  
ATOM   9954  O  OH   . TYR A 1 42 ? -0.064  0.311   -4.349  1.00 0.00 ? 42  TYR A OH   9  
ATOM   9955  H  H    . TYR A 1 42 ? -6.258  2.746   0.415   1.00 0.00 ? 42  TYR A H    9  
ATOM   9956  H  HA   . TYR A 1 42 ? -4.306  0.649   0.366   1.00 0.00 ? 42  TYR A HA   9  
ATOM   9957  H  HB2  . TYR A 1 42 ? -5.441  1.337   -1.684  1.00 0.00 ? 42  TYR A HB2  9  
ATOM   9958  H  HB3  . TYR A 1 42 ? -4.771  2.957   -1.534  1.00 0.00 ? 42  TYR A HB3  9  
ATOM   9959  H  HD1  . TYR A 1 42 ? -3.285  -0.467  -1.279  1.00 0.00 ? 42  TYR A HD1  9  
ATOM   9960  H  HD2  . TYR A 1 42 ? -3.210  3.336   -3.186  1.00 0.00 ? 42  TYR A HD2  9  
ATOM   9961  H  HE1  . TYR A 1 42 ? -1.320  -1.166  -2.582  1.00 0.00 ? 42  TYR A HE1  9  
ATOM   9962  H  HE2  . TYR A 1 42 ? -1.246  2.647   -4.496  1.00 0.00 ? 42  TYR A HE2  9  
ATOM   9963  H  HH   . TYR A 1 42 ? 0.735   0.569   -3.884  1.00 0.00 ? 42  TYR A HH   9  
ATOM   9964  N  N    . VAL A 1 43 ? -3.346  3.140   1.792   1.00 0.00 ? 43  VAL A N    9  
ATOM   9965  C  CA   . VAL A 1 43 ? -2.244  3.896   2.376   1.00 0.00 ? 43  VAL A CA   9  
ATOM   9966  C  C    . VAL A 1 43 ? -1.382  3.011   3.268   1.00 0.00 ? 43  VAL A C    9  
ATOM   9967  O  O    . VAL A 1 43 ? -1.836  1.980   3.764   1.00 0.00 ? 43  VAL A O    9  
ATOM   9968  C  CB   . VAL A 1 43 ? -2.758  5.091   3.200   1.00 0.00 ? 43  VAL A CB   9  
ATOM   9969  C  CG1  . VAL A 1 43 ? -3.506  6.072   2.310   1.00 0.00 ? 43  VAL A CG1  9  
ATOM   9970  C  CG2  . VAL A 1 43 ? -3.643  4.610   4.340   1.00 0.00 ? 43  VAL A CG2  9  
ATOM   9971  H  H    . VAL A 1 43 ? -4.217  3.140   2.242   1.00 0.00 ? 43  VAL A H    9  
ATOM   9972  H  HA   . VAL A 1 43 ? -1.636  4.278   1.568   1.00 0.00 ? 43  VAL A HA   9  
ATOM   9973  H  HB   . VAL A 1 43 ? -1.907  5.603   3.625   1.00 0.00 ? 43  VAL A HB   9  
ATOM   9974  H  HG11 . VAL A 1 43 ? -3.331  5.823   1.274   1.00 0.00 ? 43  VAL A HG11 9  
ATOM   9975  H  HG12 . VAL A 1 43 ? -4.564  6.015   2.522   1.00 0.00 ? 43  VAL A HG12 9  
ATOM   9976  H  HG13 . VAL A 1 43 ? -3.154  7.074   2.503   1.00 0.00 ? 43  VAL A HG13 9  
ATOM   9977  H  HG21 . VAL A 1 43 ? -3.046  4.059   5.050   1.00 0.00 ? 43  VAL A HG21 9  
ATOM   9978  H  HG22 . VAL A 1 43 ? -4.092  5.461   4.832   1.00 0.00 ? 43  VAL A HG22 9  
ATOM   9979  H  HG23 . VAL A 1 43 ? -4.420  3.971   3.948   1.00 0.00 ? 43  VAL A HG23 9  
ATOM   9980  N  N    . CYS A 1 44 ? -0.133  3.420   3.468   1.00 0.00 ? 44  CYS A N    9  
ATOM   9981  C  CA   . CYS A 1 44 ? 0.795   2.664   4.301   1.00 0.00 ? 44  CYS A CA   9  
ATOM   9982  C  C    . CYS A 1 44 ? 0.185   2.373   5.669   1.00 0.00 ? 44  CYS A C    9  
ATOM   9983  O  O    . CYS A 1 44 ? -0.679  3.109   6.146   1.00 0.00 ? 44  CYS A O    9  
ATOM   9984  C  CB   . CYS A 1 44 ? 2.106   3.435   4.468   1.00 0.00 ? 44  CYS A CB   9  
ATOM   9985  S  SG   . CYS A 1 44 ? 3.317   2.616   5.555   1.00 0.00 ? 44  CYS A SG   9  
ATOM   9986  H  H    . CYS A 1 44 ? 0.172   4.251   3.045   1.00 0.00 ? 44  CYS A H    9  
ATOM   9987  H  HA   . CYS A 1 44 ? 0.999   1.728   3.805   1.00 0.00 ? 44  CYS A HA   9  
ATOM   9988  H  HB2  . CYS A 1 44 ? 2.567   3.561   3.499   1.00 0.00 ? 44  CYS A HB2  9  
ATOM   9989  H  HB3  . CYS A 1 44 ? 1.892   4.407   4.888   1.00 0.00 ? 44  CYS A HB3  9  
ATOM   9990  N  N    . THR A 1 45 ? 0.642   1.294   6.297   1.00 0.00 ? 45  THR A N    9  
ATOM   9991  C  CA   . THR A 1 45 ? 0.141   0.904   7.609   1.00 0.00 ? 45  THR A CA   9  
ATOM   9992  C  C    . THR A 1 45 ? 0.944   1.567   8.723   1.00 0.00 ? 45  THR A C    9  
ATOM   9993  O  O    . THR A 1 45 ? 0.401   1.907   9.774   1.00 0.00 ? 45  THR A O    9  
ATOM   9994  C  CB   . THR A 1 45 ? 0.189   -0.624  7.797   1.00 0.00 ? 45  THR A CB   9  
ATOM   9995  O  OG1  . THR A 1 45 ? -0.605  -1.266  6.794   1.00 0.00 ? 45  THR A OG1  9  
ATOM   9996  C  CG2  . THR A 1 45 ? -0.316  -1.015  9.178   1.00 0.00 ? 45  THR A CG2  9  
ATOM   9997  H  H    . THR A 1 45 ? 1.331   0.747   5.865   1.00 0.00 ? 45  THR A H    9  
ATOM   9998  H  HA   . THR A 1 45 ? -0.888  1.223   7.682   1.00 0.00 ? 45  THR A HA   9  
ATOM   9999  H  HB   . THR A 1 45 ? 1.214   -0.952  7.699   1.00 0.00 ? 45  THR A HB   9  
ATOM   10000 H  HG1  . THR A 1 45 ? -1.518  -1.313  7.089   1.00 0.00 ? 45  THR A HG1  9  
ATOM   10001 H  HG21 . THR A 1 45 ? -1.372  -0.798  9.250   1.00 0.00 ? 45  THR A HG21 9  
ATOM   10002 H  HG22 . THR A 1 45 ? 0.220   -0.455  9.929   1.00 0.00 ? 45  THR A HG22 9  
ATOM   10003 H  HG23 . THR A 1 45 ? -0.155  -2.071  9.334   1.00 0.00 ? 45  THR A HG23 9  
ATOM   10004 N  N    . ASP A 1 46 ? 2.238   1.748   8.485   1.00 0.00 ? 46  ASP A N    9  
ATOM   10005 C  CA   . ASP A 1 46 ? 3.116   2.373   9.468   1.00 0.00 ? 46  ASP A CA   9  
ATOM   10006 C  C    . ASP A 1 46 ? 2.777   3.851   9.638   1.00 0.00 ? 46  ASP A C    9  
ATOM   10007 O  O    . ASP A 1 46 ? 2.370   4.285   10.716  1.00 0.00 ? 46  ASP A O    9  
ATOM   10008 C  CB   . ASP A 1 46 ? 4.579   2.218   9.049   1.00 0.00 ? 46  ASP A CB   9  
ATOM   10009 C  CG   . ASP A 1 46 ? 5.541   2.552   10.172  1.00 0.00 ? 46  ASP A CG   9  
ATOM   10010 O  OD1  . ASP A 1 46 ? 5.231   3.463   10.968  1.00 0.00 ? 46  ASP A OD1  9  
ATOM   10011 O  OD2  . ASP A 1 46 ? 6.604   1.902   10.255  1.00 0.00 ? 46  ASP A OD2  9  
ATOM   10012 H  H    . ASP A 1 46 ? 2.613   1.456   7.627   1.00 0.00 ? 46  ASP A H    9  
ATOM   10013 H  HA   . ASP A 1 46 ? 2.967   1.872   10.412  1.00 0.00 ? 46  ASP A HA   9  
ATOM   10014 H  HB2  . ASP A 1 46 ? 4.752   1.196   8.744   1.00 0.00 ? 46  ASP A HB2  9  
ATOM   10015 H  HB3  . ASP A 1 46 ? 4.780   2.877   8.218   1.00 0.00 ? 46  ASP A HB3  9  
ATOM   10016 N  N    . CYS A 1 47 ? 2.948   4.619   8.567   1.00 0.00 ? 47  CYS A N    9  
ATOM   10017 C  CA   . CYS A 1 47 ? 2.662   6.048   8.597   1.00 0.00 ? 47  CYS A CA   9  
ATOM   10018 C  C    . CYS A 1 47 ? 1.232   6.326   8.143   1.00 0.00 ? 47  CYS A C    9  
ATOM   10019 O  O    . CYS A 1 47 ? 0.408   6.814   8.916   1.00 0.00 ? 47  CYS A O    9  
ATOM   10020 C  CB   . CYS A 1 47 ? 3.648   6.805   7.706   1.00 0.00 ? 47  CYS A CB   9  
ATOM   10021 S  SG   . CYS A 1 47 ? 4.099   5.922   6.178   1.00 0.00 ? 47  CYS A SG   9  
ATOM   10022 H  H    . CYS A 1 47 ? 3.275   4.214   7.736   1.00 0.00 ? 47  CYS A H    9  
ATOM   10023 H  HA   . CYS A 1 47 ? 2.776   6.388   9.615   1.00 0.00 ? 47  CYS A HA   9  
ATOM   10024 H  HB2  . CYS A 1 47 ? 3.211   7.751   7.420   1.00 0.00 ? 47  CYS A HB2  9  
ATOM   10025 H  HB3  . CYS A 1 47 ? 4.557   6.988   8.261   1.00 0.00 ? 47  CYS A HB3  9  
ATOM   10026 N  N    . GLY A 1 48 ? 0.945   6.012   6.883   1.00 0.00 ? 48  GLY A N    9  
ATOM   10027 C  CA   . GLY A 1 48 ? -0.385  6.235   6.348   1.00 0.00 ? 48  GLY A CA   9  
ATOM   10028 C  C    . GLY A 1 48 ? -0.377  7.144   5.135   1.00 0.00 ? 48  GLY A C    9  
ATOM   10029 O  O    . GLY A 1 48 ? -1.216  8.037   5.013   1.00 0.00 ? 48  GLY A O    9  
ATOM   10030 H  H    . GLY A 1 48 ? 1.642   5.626   6.313   1.00 0.00 ? 48  GLY A H    9  
ATOM   10031 H  HA2  . GLY A 1 48 ? -0.813  5.284   6.069   1.00 0.00 ? 48  GLY A HA2  9  
ATOM   10032 H  HA3  . GLY A 1 48 ? -0.999  6.683   7.115   1.00 0.00 ? 48  GLY A HA3  9  
ATOM   10033 N  N    . THR A 1 49 ? 0.574   6.919   4.235   1.00 0.00 ? 49  THR A N    9  
ATOM   10034 C  CA   . THR A 1 49 ? 0.690   7.726   3.027   1.00 0.00 ? 49  THR A CA   9  
ATOM   10035 C  C    . THR A 1 49 ? 0.042   7.029   1.836   1.00 0.00 ? 49  THR A C    9  
ATOM   10036 O  O    . THR A 1 49 ? 0.019   5.802   1.759   1.00 0.00 ? 49  THR A O    9  
ATOM   10037 C  CB   . THR A 1 49 ? 2.163   8.026   2.691   1.00 0.00 ? 49  THR A CB   9  
ATOM   10038 O  OG1  . THR A 1 49 ? 2.238   8.946   1.596   1.00 0.00 ? 49  THR A OG1  9  
ATOM   10039 C  CG2  . THR A 1 49 ? 2.910   6.749   2.339   1.00 0.00 ? 49  THR A CG2  9  
ATOM   10040 H  H    . THR A 1 49 ? 1.214   6.192   4.388   1.00 0.00 ? 49  THR A H    9  
ATOM   10041 H  HA   . THR A 1 49 ? 0.184   8.664   3.202   1.00 0.00 ? 49  THR A HA   9  
ATOM   10042 H  HB   . THR A 1 49 ? 2.630   8.472   3.558   1.00 0.00 ? 49  THR A HB   9  
ATOM   10043 H  HG1  . THR A 1 49 ? 1.417   9.439   1.535   1.00 0.00 ? 49  THR A HG1  9  
ATOM   10044 H  HG21 . THR A 1 49 ? 2.462   5.915   2.860   1.00 0.00 ? 49  THR A HG21 9  
ATOM   10045 H  HG22 . THR A 1 49 ? 3.945   6.844   2.633   1.00 0.00 ? 49  THR A HG22 9  
ATOM   10046 H  HG23 . THR A 1 49 ? 2.852   6.580   1.274   1.00 0.00 ? 49  THR A HG23 9  
ATOM   10047 N  N    . ASN A 1 50 ? -0.485  7.822   0.908   1.00 0.00 ? 50  ASN A N    9  
ATOM   10048 C  CA   . ASN A 1 50 ? -1.134  7.280   -0.281  1.00 0.00 ? 50  ASN A CA   9  
ATOM   10049 C  C    . ASN A 1 50 ? -0.123  6.577   -1.180  1.00 0.00 ? 50  ASN A C    9  
ATOM   10050 O  O    . ASN A 1 50 ? 0.703   7.222   -1.828  1.00 0.00 ? 50  ASN A O    9  
ATOM   10051 C  CB   . ASN A 1 50 ? -1.835  8.397   -1.057  1.00 0.00 ? 50  ASN A CB   9  
ATOM   10052 C  CG   . ASN A 1 50 ? -2.965  9.029   -0.268  1.00 0.00 ? 50  ASN A CG   9  
ATOM   10053 O  OD1  . ASN A 1 50 ? -2.731  9.770   0.687   1.00 0.00 ? 50  ASN A OD1  9  
ATOM   10054 N  ND2  . ASN A 1 50 ? -4.199  8.739   -0.664  1.00 0.00 ? 50  ASN A ND2  9  
ATOM   10055 H  H    . ASN A 1 50 ? -0.436  8.794   1.025   1.00 0.00 ? 50  ASN A H    9  
ATOM   10056 H  HA   . ASN A 1 50 ? -1.872  6.562   0.043   1.00 0.00 ? 50  ASN A HA   9  
ATOM   10057 H  HB2  . ASN A 1 50 ? -1.116  9.166   -1.298  1.00 0.00 ? 50  ASN A HB2  9  
ATOM   10058 H  HB3  . ASN A 1 50 ? -2.242  7.991   -1.971  1.00 0.00 ? 50  ASN A HB3  9  
ATOM   10059 H  HD21 . ASN A 1 50 ? -4.310  8.142   -1.433  1.00 0.00 ? 50  ASN A HD21 9  
ATOM   10060 H  HD22 . ASN A 1 50 ? -4.948  9.135   -0.172  1.00 0.00 ? 50  ASN A HD22 9  
ATOM   10061 N  N    . LEU A 1 51 ? -0.194  5.251   -1.217  1.00 0.00 ? 51  LEU A N    9  
ATOM   10062 C  CA   . LEU A 1 51 ? 0.715   4.458   -2.038  1.00 0.00 ? 51  LEU A CA   9  
ATOM   10063 C  C    . LEU A 1 51 ? 0.213   4.369   -3.475  1.00 0.00 ? 51  LEU A C    9  
ATOM   10064 O  O    . LEU A 1 51 ? 0.718   3.579   -4.273  1.00 0.00 ? 51  LEU A O    9  
ATOM   10065 C  CB   . LEU A 1 51 ? 0.870   3.054   -1.451  1.00 0.00 ? 51  LEU A CB   9  
ATOM   10066 C  CG   . LEU A 1 51 ? 1.195   2.982   0.041   1.00 0.00 ? 51  LEU A CG   9  
ATOM   10067 C  CD1  . LEU A 1 51 ? 1.113   1.546   0.536   1.00 0.00 ? 51  LEU A CD1  9  
ATOM   10068 C  CD2  . LEU A 1 51 ? 2.573   3.565   0.316   1.00 0.00 ? 51  LEU A CD2  9  
ATOM   10069 H  H    . LEU A 1 51 ? -0.872  4.793   -0.679  1.00 0.00 ? 51  LEU A H    9  
ATOM   10070 H  HA   . LEU A 1 51 ? 1.677   4.949   -2.035  1.00 0.00 ? 51  LEU A HA   9  
ATOM   10071 H  HB2  . LEU A 1 51 ? -0.055  2.524   -1.614  1.00 0.00 ? 51  LEU A HB2  9  
ATOM   10072 H  HB3  . LEU A 1 51 ? 1.667   2.558   -1.989  1.00 0.00 ? 51  LEU A HB3  9  
ATOM   10073 H  HG   . LEU A 1 51 ? 0.468   3.565   0.590   1.00 0.00 ? 51  LEU A HG   9  
ATOM   10074 H  HD11 . LEU A 1 51 ? 1.702   0.910   -0.107  1.00 0.00 ? 51  LEU A HD11 9  
ATOM   10075 H  HD12 . LEU A 1 51 ? 0.084   1.219   0.523   1.00 0.00 ? 51  LEU A HD12 9  
ATOM   10076 H  HD13 . LEU A 1 51 ? 1.495   1.491   1.545   1.00 0.00 ? 51  LEU A HD13 9  
ATOM   10077 H  HD21 . LEU A 1 51 ? 2.921   3.227   1.281   1.00 0.00 ? 51  LEU A HD21 9  
ATOM   10078 H  HD22 . LEU A 1 51 ? 2.515   4.644   0.313   1.00 0.00 ? 51  LEU A HD22 9  
ATOM   10079 H  HD23 . LEU A 1 51 ? 3.261   3.239   -0.450  1.00 0.00 ? 51  LEU A HD23 9  
ATOM   10080 N  N    . LYS A 1 52 ? -0.784  5.186   -3.800  1.00 0.00 ? 52  LYS A N    9  
ATOM   10081 C  CA   . LYS A 1 52 ? -1.353  5.203   -5.142  1.00 0.00 ? 52  LYS A CA   9  
ATOM   10082 C  C    . LYS A 1 52 ? -0.256  5.139   -6.199  1.00 0.00 ? 52  LYS A C    9  
ATOM   10083 O  O    . LYS A 1 52 ? -0.255  4.251   -7.051  1.00 0.00 ? 52  LYS A O    9  
ATOM   10084 C  CB   . LYS A 1 52 ? -2.198  6.463   -5.344  1.00 0.00 ? 52  LYS A CB   9  
ATOM   10085 C  CG   . LYS A 1 52 ? -3.006  6.454   -6.630  1.00 0.00 ? 52  LYS A CG   9  
ATOM   10086 C  CD   . LYS A 1 52 ? -4.254  7.311   -6.511  1.00 0.00 ? 52  LYS A CD   9  
ATOM   10087 C  CE   . LYS A 1 52 ? -3.925  8.793   -6.612  1.00 0.00 ? 52  LYS A CE   9  
ATOM   10088 N  NZ   . LYS A 1 52 ? -4.964  9.638   -5.960  1.00 0.00 ? 52  LYS A NZ   9  
ATOM   10089 H  H    . LYS A 1 52 ? -1.145  5.793   -3.120  1.00 0.00 ? 52  LYS A H    9  
ATOM   10090 H  HA   . LYS A 1 52 ? -1.987  4.335   -5.244  1.00 0.00 ? 52  LYS A HA   9  
ATOM   10091 H  HB2  . LYS A 1 52 ? -2.883  6.559   -4.514  1.00 0.00 ? 52  LYS A HB2  9  
ATOM   10092 H  HB3  . LYS A 1 52 ? -1.543  7.322   -5.360  1.00 0.00 ? 52  LYS A HB3  9  
ATOM   10093 H  HG2  . LYS A 1 52 ? -2.393  6.839   -7.432  1.00 0.00 ? 52  LYS A HG2  9  
ATOM   10094 H  HG3  . LYS A 1 52 ? -3.298  5.438   -6.854  1.00 0.00 ? 52  LYS A HG3  9  
ATOM   10095 H  HD2  . LYS A 1 52 ? -4.937  7.051   -7.306  1.00 0.00 ? 52  LYS A HD2  9  
ATOM   10096 H  HD3  . LYS A 1 52 ? -4.722  7.120   -5.555  1.00 0.00 ? 52  LYS A HD3  9  
ATOM   10097 H  HE2  . LYS A 1 52 ? -2.975  8.971   -6.131  1.00 0.00 ? 52  LYS A HE2  9  
ATOM   10098 H  HE3  . LYS A 1 52 ? -3.857  9.062   -7.656  1.00 0.00 ? 52  LYS A HE3  9  
ATOM   10099 H  HZ1  . LYS A 1 52 ? -4.521  10.462  -5.506  1.00 0.00 ? 52  LYS A HZ1  9  
ATOM   10100 H  HZ2  . LYS A 1 52 ? -5.469  9.088   -5.237  1.00 0.00 ? 52  LYS A HZ2  9  
ATOM   10101 H  HZ3  . LYS A 1 52 ? -5.649  9.972   -6.668  1.00 0.00 ? 52  LYS A HZ3  9  
ATOM   10102 N  N    . GLN A 1 53 ? 0.675   6.085   -6.137  1.00 0.00 ? 53  GLN A N    9  
ATOM   10103 C  CA   . GLN A 1 53 ? 1.778   6.134   -7.090  1.00 0.00 ? 53  GLN A CA   9  
ATOM   10104 C  C    . GLN A 1 53 ? 3.009   5.425   -6.535  1.00 0.00 ? 53  GLN A C    9  
ATOM   10105 O  O    . GLN A 1 53 ? 3.482   4.441   -7.104  1.00 0.00 ? 53  GLN A O    9  
ATOM   10106 C  CB   . GLN A 1 53 ? 2.121   7.585   -7.430  1.00 0.00 ? 53  GLN A CB   9  
ATOM   10107 C  CG   . GLN A 1 53 ? 1.084   8.265   -8.310  1.00 0.00 ? 53  GLN A CG   9  
ATOM   10108 C  CD   . GLN A 1 53 ? 1.674   9.379   -9.153  1.00 0.00 ? 53  GLN A CD   9  
ATOM   10109 O  OE1  . GLN A 1 53 ? 2.216   10.351  -8.627  1.00 0.00 ? 53  GLN A OE1  9  
ATOM   10110 N  NE2  . GLN A 1 53 ? 1.571   9.243   -10.470 1.00 0.00 ? 53  GLN A NE2  9  
ATOM   10111 H  H    . GLN A 1 53 ? 0.619   6.765   -5.435  1.00 0.00 ? 53  GLN A H    9  
ATOM   10112 H  HA   . GLN A 1 53 ? 1.462   5.628   -7.989  1.00 0.00 ? 53  GLN A HA   9  
ATOM   10113 H  HB2  . GLN A 1 53 ? 2.207   8.147   -6.513  1.00 0.00 ? 53  GLN A HB2  9  
ATOM   10114 H  HB3  . GLN A 1 53 ? 3.069   7.607   -7.947  1.00 0.00 ? 53  GLN A HB3  9  
ATOM   10115 H  HG2  . GLN A 1 53 ? 0.650   7.527   -8.969  1.00 0.00 ? 53  GLN A HG2  9  
ATOM   10116 H  HG3  . GLN A 1 53 ? 0.313   8.680   -7.679  1.00 0.00 ? 53  GLN A HG3  9  
ATOM   10117 H  HE21 . GLN A 1 53 ? 1.125   8.442   -10.819 1.00 0.00 ? 53  GLN A HE21 9  
ATOM   10118 H  HE22 . GLN A 1 53 ? 1.942   9.948   -11.038 1.00 0.00 ? 53  GLN A HE22 9  
ATOM   10119 N  N    . LYS A 1 54 ? 3.525   5.931   -5.420  1.00 0.00 ? 54  LYS A N    9  
ATOM   10120 C  CA   . LYS A 1 54 ? 4.701   5.347   -4.786  1.00 0.00 ? 54  LYS A CA   9  
ATOM   10121 C  C    . LYS A 1 54 ? 4.692   3.828   -4.919  1.00 0.00 ? 54  LYS A C    9  
ATOM   10122 O  O    . LYS A 1 54 ? 5.697   3.221   -5.286  1.00 0.00 ? 54  LYS A O    9  
ATOM   10123 C  CB   . LYS A 1 54 ? 4.757   5.740   -3.308  1.00 0.00 ? 54  LYS A CB   9  
ATOM   10124 C  CG   . LYS A 1 54 ? 4.942   7.230   -3.081  1.00 0.00 ? 54  LYS A CG   9  
ATOM   10125 C  CD   . LYS A 1 54 ? 5.282   7.536   -1.632  1.00 0.00 ? 54  LYS A CD   9  
ATOM   10126 C  CE   . LYS A 1 54 ? 4.989   8.988   -1.286  1.00 0.00 ? 54  LYS A CE   9  
ATOM   10127 N  NZ   . LYS A 1 54 ? 6.145   9.876   -1.594  1.00 0.00 ? 54  LYS A NZ   9  
ATOM   10128 H  H    . LYS A 1 54 ? 3.103   6.718   -5.012  1.00 0.00 ? 54  LYS A H    9  
ATOM   10129 H  HA   . LYS A 1 54 ? 5.575   5.735   -5.286  1.00 0.00 ? 54  LYS A HA   9  
ATOM   10130 H  HB2  . LYS A 1 54 ? 3.836   5.436   -2.831  1.00 0.00 ? 54  LYS A HB2  9  
ATOM   10131 H  HB3  . LYS A 1 54 ? 5.582   5.221   -2.841  1.00 0.00 ? 54  LYS A HB3  9  
ATOM   10132 H  HG2  . LYS A 1 54 ? 5.745   7.584   -3.710  1.00 0.00 ? 54  LYS A HG2  9  
ATOM   10133 H  HG3  . LYS A 1 54 ? 4.026   7.741   -3.342  1.00 0.00 ? 54  LYS A HG3  9  
ATOM   10134 H  HD2  . LYS A 1 54 ? 4.691   6.899   -0.990  1.00 0.00 ? 54  LYS A HD2  9  
ATOM   10135 H  HD3  . LYS A 1 54 ? 6.332   7.341   -1.469  1.00 0.00 ? 54  LYS A HD3  9  
ATOM   10136 H  HE2  . LYS A 1 54 ? 4.133   9.315   -1.855  1.00 0.00 ? 54  LYS A HE2  9  
ATOM   10137 H  HE3  . LYS A 1 54 ? 4.767   9.055   -0.231  1.00 0.00 ? 54  LYS A HE3  9  
ATOM   10138 H  HZ1  . LYS A 1 54 ? 5.870   10.585  -2.303  1.00 0.00 ? 54  LYS A HZ1  9  
ATOM   10139 H  HZ2  . LYS A 1 54 ? 6.936   9.315   -1.970  1.00 0.00 ? 54  LYS A HZ2  9  
ATOM   10140 H  HZ3  . LYS A 1 54 ? 6.459   10.366  -0.733  1.00 0.00 ? 54  LYS A HZ3  9  
ATOM   10141 N  N    . GLY A 1 55 ? 3.549   3.218   -4.618  1.00 0.00 ? 55  GLY A N    9  
ATOM   10142 C  CA   . GLY A 1 55 ? 3.431   1.775   -4.712  1.00 0.00 ? 55  GLY A CA   9  
ATOM   10143 C  C    . GLY A 1 55 ? 3.306   1.114   -3.354  1.00 0.00 ? 55  GLY A C    9  
ATOM   10144 O  O    . GLY A 1 55 ? 3.667   1.702   -2.334  1.00 0.00 ? 55  GLY A O    9  
ATOM   10145 H  H    . GLY A 1 55 ? 2.779   3.753   -4.331  1.00 0.00 ? 55  GLY A H    9  
ATOM   10146 H  HA2  . GLY A 1 55 ? 2.558   1.533   -5.300  1.00 0.00 ? 55  GLY A HA2  9  
ATOM   10147 H  HA3  . GLY A 1 55 ? 4.307   1.385   -5.210  1.00 0.00 ? 55  GLY A HA3  9  
ATOM   10148 N  N    . HIS A 1 56 ? 2.793   -0.112  -3.339  1.00 0.00 ? 56  HIS A N    9  
ATOM   10149 C  CA   . HIS A 1 56 ? 2.621   -0.854  -2.094  1.00 0.00 ? 56  HIS A CA   9  
ATOM   10150 C  C    . HIS A 1 56 ? 3.493   -2.106  -2.083  1.00 0.00 ? 56  HIS A C    9  
ATOM   10151 O  O    . HIS A 1 56 ? 3.659   -2.768  -3.107  1.00 0.00 ? 56  HIS A O    9  
ATOM   10152 C  CB   . HIS A 1 56 ? 1.153   -1.238  -1.904  1.00 0.00 ? 56  HIS A CB   9  
ATOM   10153 C  CG   . HIS A 1 56 ? 0.719   -2.386  -2.762  1.00 0.00 ? 56  HIS A CG   9  
ATOM   10154 N  ND1  . HIS A 1 56 ? 0.374   -2.245  -4.090  1.00 0.00 ? 56  HIS A ND1  9  
ATOM   10155 C  CD2  . HIS A 1 56 ? 0.576   -3.701  -2.476  1.00 0.00 ? 56  HIS A CD2  9  
ATOM   10156 C  CE1  . HIS A 1 56 ? 0.036   -3.424  -4.582  1.00 0.00 ? 56  HIS A CE1  9  
ATOM   10157 N  NE2  . HIS A 1 56 ? 0.151   -4.325  -3.623  1.00 0.00 ? 56  HIS A NE2  9  
ATOM   10158 H  H    . HIS A 1 56 ? 2.524   -0.528  -4.184  1.00 0.00 ? 56  HIS A H    9  
ATOM   10159 H  HA   . HIS A 1 56 ? 2.924   -0.212  -1.281  1.00 0.00 ? 56  HIS A HA   9  
ATOM   10160 H  HB2  . HIS A 1 56 ? 0.991   -1.516  -0.873  1.00 0.00 ? 56  HIS A HB2  9  
ATOM   10161 H  HB3  . HIS A 1 56 ? 0.531   -0.389  -2.145  1.00 0.00 ? 56  HIS A HB3  9  
ATOM   10162 H  HD1  . HIS A 1 56 ? 0.375   -1.406  -4.595  1.00 0.00 ? 56  HIS A HD1  9  
ATOM   10163 H  HD2  . HIS A 1 56 ? 0.762   -4.174  -1.521  1.00 0.00 ? 56  HIS A HD2  9  
ATOM   10164 H  HE1  . HIS A 1 56 ? -0.280  -3.619  -5.596  1.00 0.00 ? 56  HIS A HE1  9  
ATOM   10165 H  HE2  . HIS A 1 56 ? -0.120  -5.263  -3.695  1.00 0.00 ? 56  HIS A HE2  9  
ATOM   10166 N  N    . PHE A 1 57 ? 4.048   -2.424  -0.918  1.00 0.00 ? 57  PHE A N    9  
ATOM   10167 C  CA   . PHE A 1 57 ? 4.904   -3.595  -0.773  1.00 0.00 ? 57  PHE A CA   9  
ATOM   10168 C  C    . PHE A 1 57 ? 4.229   -4.660  0.086   1.00 0.00 ? 57  PHE A C    9  
ATOM   10169 O  O    . PHE A 1 57 ? 3.562   -4.346  1.072   1.00 0.00 ? 57  PHE A O    9  
ATOM   10170 C  CB   . PHE A 1 57 ? 6.246   -3.199  -0.154  1.00 0.00 ? 57  PHE A CB   9  
ATOM   10171 C  CG   . PHE A 1 57 ? 7.190   -2.555  -1.129  1.00 0.00 ? 57  PHE A CG   9  
ATOM   10172 C  CD1  . PHE A 1 57 ? 6.915   -1.304  -1.657  1.00 0.00 ? 57  PHE A CD1  9  
ATOM   10173 C  CD2  . PHE A 1 57 ? 8.352   -3.202  -1.518  1.00 0.00 ? 57  PHE A CD2  9  
ATOM   10174 C  CE1  . PHE A 1 57 ? 7.782   -0.710  -2.555  1.00 0.00 ? 57  PHE A CE1  9  
ATOM   10175 C  CE2  . PHE A 1 57 ? 9.222   -2.613  -2.416  1.00 0.00 ? 57  PHE A CE2  9  
ATOM   10176 C  CZ   . PHE A 1 57 ? 8.937   -1.365  -2.934  1.00 0.00 ? 57  PHE A CZ   9  
ATOM   10177 H  H    . PHE A 1 57 ? 3.877   -1.856  -0.137  1.00 0.00 ? 57  PHE A H    9  
ATOM   10178 H  HA   . PHE A 1 57 ? 5.078   -4.001  -1.758  1.00 0.00 ? 57  PHE A HA   9  
ATOM   10179 H  HB2  . PHE A 1 57 ? 6.071   -2.498  0.649   1.00 0.00 ? 57  PHE A HB2  9  
ATOM   10180 H  HB3  . PHE A 1 57 ? 6.726   -4.081  0.242   1.00 0.00 ? 57  PHE A HB3  9  
ATOM   10181 H  HD1  . PHE A 1 57 ? 6.013   -0.790  -1.360  1.00 0.00 ? 57  PHE A HD1  9  
ATOM   10182 H  HD2  . PHE A 1 57 ? 8.576   -4.179  -1.113  1.00 0.00 ? 57  PHE A HD2  9  
ATOM   10183 H  HE1  . PHE A 1 57 ? 7.557   0.266   -2.958  1.00 0.00 ? 57  PHE A HE1  9  
ATOM   10184 H  HE2  . PHE A 1 57 ? 10.125  -3.128  -2.710  1.00 0.00 ? 57  PHE A HE2  9  
ATOM   10185 H  HZ   . PHE A 1 57 ? 9.616   -0.903  -3.636  1.00 0.00 ? 57  PHE A HZ   9  
ATOM   10186 N  N    . PHE A 1 58 ? 4.407   -5.920  -0.296  1.00 0.00 ? 58  PHE A N    9  
ATOM   10187 C  CA   . PHE A 1 58 ? 3.814   -7.032  0.438   1.00 0.00 ? 58  PHE A CA   9  
ATOM   10188 C  C    . PHE A 1 58 ? 4.761   -7.533  1.524   1.00 0.00 ? 58  PHE A C    9  
ATOM   10189 O  O    . PHE A 1 58 ? 5.814   -8.099  1.233   1.00 0.00 ? 58  PHE A O    9  
ATOM   10190 C  CB   . PHE A 1 58 ? 3.467   -8.175  -0.519  1.00 0.00 ? 58  PHE A CB   9  
ATOM   10191 C  CG   . PHE A 1 58 ? 2.265   -7.895  -1.376  1.00 0.00 ? 58  PHE A CG   9  
ATOM   10192 C  CD1  . PHE A 1 58 ? 1.050   -7.560  -0.801  1.00 0.00 ? 58  PHE A CD1  9  
ATOM   10193 C  CD2  . PHE A 1 58 ? 2.351   -7.968  -2.757  1.00 0.00 ? 58  PHE A CD2  9  
ATOM   10194 C  CE1  . PHE A 1 58 ? -0.057  -7.302  -1.586  1.00 0.00 ? 58  PHE A CE1  9  
ATOM   10195 C  CE2  . PHE A 1 58 ? 1.248   -7.710  -3.548  1.00 0.00 ? 58  PHE A CE2  9  
ATOM   10196 C  CZ   . PHE A 1 58 ? 0.042   -7.378  -2.962  1.00 0.00 ? 58  PHE A CZ   9  
ATOM   10197 H  H    . PHE A 1 58 ? 4.949   -6.107  -1.091  1.00 0.00 ? 58  PHE A H    9  
ATOM   10198 H  HA   . PHE A 1 58 ? 2.908   -6.676  0.903   1.00 0.00 ? 58  PHE A HA   9  
ATOM   10199 H  HB2  . PHE A 1 58 ? 4.306   -8.354  -1.173  1.00 0.00 ? 58  PHE A HB2  9  
ATOM   10200 H  HB3  . PHE A 1 58 ? 3.266   -9.067  0.056   1.00 0.00 ? 58  PHE A HB3  9  
ATOM   10201 H  HD1  . PHE A 1 58 ? 0.972   -7.501  0.276   1.00 0.00 ? 58  PHE A HD1  9  
ATOM   10202 H  HD2  . PHE A 1 58 ? 3.293   -8.228  -3.217  1.00 0.00 ? 58  PHE A HD2  9  
ATOM   10203 H  HE1  . PHE A 1 58 ? -0.998  -7.042  -1.125  1.00 0.00 ? 58  PHE A HE1  9  
ATOM   10204 H  HE2  . PHE A 1 58 ? 1.327   -7.771  -4.623  1.00 0.00 ? 58  PHE A HE2  9  
ATOM   10205 H  HZ   . PHE A 1 58 ? -0.822  -7.176  -3.578  1.00 0.00 ? 58  PHE A HZ   9  
ATOM   10206 N  N    . VAL A 1 59 ? 4.378   -7.320  2.779   1.00 0.00 ? 59  VAL A N    9  
ATOM   10207 C  CA   . VAL A 1 59 ? 5.191   -7.750  3.910   1.00 0.00 ? 59  VAL A CA   9  
ATOM   10208 C  C    . VAL A 1 59 ? 4.320   -8.272  5.047   1.00 0.00 ? 59  VAL A C    9  
ATOM   10209 O  O    . VAL A 1 59 ? 3.623   -7.505  5.711   1.00 0.00 ? 59  VAL A O    9  
ATOM   10210 C  CB   . VAL A 1 59 ? 6.070   -6.601  4.438   1.00 0.00 ? 59  VAL A CB   9  
ATOM   10211 C  CG1  . VAL A 1 59 ? 6.853   -7.047  5.664   1.00 0.00 ? 59  VAL A CG1  9  
ATOM   10212 C  CG2  . VAL A 1 59 ? 7.008   -6.104  3.349   1.00 0.00 ? 59  VAL A CG2  9  
ATOM   10213 H  H    . VAL A 1 59 ? 3.527   -6.864  2.948   1.00 0.00 ? 59  VAL A H    9  
ATOM   10214 H  HA   . VAL A 1 59 ? 5.840   -8.545  3.572   1.00 0.00 ? 59  VAL A HA   9  
ATOM   10215 H  HB   . VAL A 1 59 ? 5.425   -5.785  4.728   1.00 0.00 ? 59  VAL A HB   9  
ATOM   10216 H  HG11 . VAL A 1 59 ? 7.209   -8.055  5.516   1.00 0.00 ? 59  VAL A HG11 9  
ATOM   10217 H  HG12 . VAL A 1 59 ? 7.693   -6.385  5.816   1.00 0.00 ? 59  VAL A HG12 9  
ATOM   10218 H  HG13 . VAL A 1 59 ? 6.210   -7.017  6.532   1.00 0.00 ? 59  VAL A HG13 9  
ATOM   10219 H  HG21 . VAL A 1 59 ? 7.976   -6.566  3.470   1.00 0.00 ? 59  VAL A HG21 9  
ATOM   10220 H  HG22 . VAL A 1 59 ? 6.605   -6.363  2.380   1.00 0.00 ? 59  VAL A HG22 9  
ATOM   10221 H  HG23 . VAL A 1 59 ? 7.108   -5.031  3.421   1.00 0.00 ? 59  VAL A HG23 9  
ATOM   10222 N  N    . GLU A 1 60 ? 4.364   -9.583  5.266   1.00 0.00 ? 60  GLU A N    9  
ATOM   10223 C  CA   . GLU A 1 60 ? 3.578   -10.207 6.323   1.00 0.00 ? 60  GLU A CA   9  
ATOM   10224 C  C    . GLU A 1 60 ? 2.084   -10.019 6.073   1.00 0.00 ? 60  GLU A C    9  
ATOM   10225 O  O    . GLU A 1 60 ? 1.318   -9.749  6.998   1.00 0.00 ? 60  GLU A O    9  
ATOM   10226 C  CB   . GLU A 1 60 ? 3.956   -9.621  7.685   1.00 0.00 ? 60  GLU A CB   9  
ATOM   10227 C  CG   . GLU A 1 60 ? 5.421   -9.810  8.043   1.00 0.00 ? 60  GLU A CG   9  
ATOM   10228 C  CD   . GLU A 1 60 ? 5.798   -11.270 8.205   1.00 0.00 ? 60  GLU A CD   9  
ATOM   10229 O  OE1  . GLU A 1 60 ? 4.912   -12.075 8.557   1.00 0.00 ? 60  GLU A OE1  9  
ATOM   10230 O  OE2  . GLU A 1 60 ? 6.979   -11.606 7.979   1.00 0.00 ? 60  GLU A OE2  9  
ATOM   10231 H  H    . GLU A 1 60 ? 4.939   -10.142 4.703   1.00 0.00 ? 60  GLU A H    9  
ATOM   10232 H  HA   . GLU A 1 60 ? 3.800   -11.264 6.322   1.00 0.00 ? 60  GLU A HA   9  
ATOM   10233 H  HB2  . GLU A 1 60 ? 3.741   -8.563  7.680   1.00 0.00 ? 60  GLU A HB2  9  
ATOM   10234 H  HB3  . GLU A 1 60 ? 3.357   -10.098 8.447   1.00 0.00 ? 60  GLU A HB3  9  
ATOM   10235 H  HG2  . GLU A 1 60 ? 6.028   -9.382  7.259   1.00 0.00 ? 60  GLU A HG2  9  
ATOM   10236 H  HG3  . GLU A 1 60 ? 5.620   -9.296  8.972   1.00 0.00 ? 60  GLU A HG3  9  
ATOM   10237 N  N    . ASP A 1 61 ? 1.678   -10.164 4.817   1.00 0.00 ? 61  ASP A N    9  
ATOM   10238 C  CA   . ASP A 1 61 ? 0.276   -10.011 4.444   1.00 0.00 ? 61  ASP A CA   9  
ATOM   10239 C  C    . ASP A 1 61 ? -0.204  -8.587  4.708   1.00 0.00 ? 61  ASP A C    9  
ATOM   10240 O  O    . ASP A 1 61 ? -1.371  -8.366  5.032   1.00 0.00 ? 61  ASP A O    9  
ATOM   10241 C  CB   . ASP A 1 61 ? -0.591  -11.006 5.216   1.00 0.00 ? 61  ASP A CB   9  
ATOM   10242 C  CG   . ASP A 1 61 ? -1.951  -11.208 4.577   1.00 0.00 ? 61  ASP A CG   9  
ATOM   10243 O  OD1  . ASP A 1 61 ? -2.420  -10.286 3.877   1.00 0.00 ? 61  ASP A OD1  9  
ATOM   10244 O  OD2  . ASP A 1 61 ? -2.545  -12.287 4.776   1.00 0.00 ? 61  ASP A OD2  9  
ATOM   10245 H  H    . ASP A 1 61 ? 2.336   -10.380 4.123   1.00 0.00 ? 61  ASP A H    9  
ATOM   10246 H  HA   . ASP A 1 61 ? 0.189   -10.216 3.388   1.00 0.00 ? 61  ASP A HA   9  
ATOM   10247 H  HB2  . ASP A 1 61 ? -0.086  -11.961 5.253   1.00 0.00 ? 61  ASP A HB2  9  
ATOM   10248 H  HB3  . ASP A 1 61 ? -0.736  -10.642 6.223   1.00 0.00 ? 61  ASP A HB3  9  
ATOM   10249 N  N    . GLN A 1 62 ? 0.704   -7.626  4.569   1.00 0.00 ? 62  GLN A N    9  
ATOM   10250 C  CA   . GLN A 1 62 ? 0.372   -6.225  4.795   1.00 0.00 ? 62  GLN A CA   9  
ATOM   10251 C  C    . GLN A 1 62 ? 0.925   -5.348  3.676   1.00 0.00 ? 62  GLN A C    9  
ATOM   10252 O  O    . GLN A 1 62 ? 1.607   -5.833  2.773   1.00 0.00 ? 62  GLN A O    9  
ATOM   10253 C  CB   . GLN A 1 62 ? 0.924   -5.759  6.143   1.00 0.00 ? 62  GLN A CB   9  
ATOM   10254 C  CG   . GLN A 1 62 ? -0.024  -6.004  7.306   1.00 0.00 ? 62  GLN A CG   9  
ATOM   10255 C  CD   . GLN A 1 62 ? 0.705   -6.240  8.614   1.00 0.00 ? 62  GLN A CD   9  
ATOM   10256 O  OE1  . GLN A 1 62 ? 1.585   -7.097  8.701   1.00 0.00 ? 62  GLN A OE1  9  
ATOM   10257 N  NE2  . GLN A 1 62 ? 0.341   -5.480  9.640   1.00 0.00 ? 62  GLN A NE2  9  
ATOM   10258 H  H    . GLN A 1 62 ? 1.617   -7.866  4.309   1.00 0.00 ? 62  GLN A H    9  
ATOM   10259 H  HA   . GLN A 1 62 ? -0.703  -6.136  4.807   1.00 0.00 ? 62  GLN A HA   9  
ATOM   10260 H  HB2  . GLN A 1 62 ? 1.847   -6.284  6.342   1.00 0.00 ? 62  GLN A HB2  9  
ATOM   10261 H  HB3  . GLN A 1 62 ? 1.127   -4.699  6.090   1.00 0.00 ? 62  GLN A HB3  9  
ATOM   10262 H  HG2  . GLN A 1 62 ? -0.664  -5.141  7.420   1.00 0.00 ? 62  GLN A HG2  9  
ATOM   10263 H  HG3  . GLN A 1 62 ? -0.628  -6.872  7.085   1.00 0.00 ? 62  GLN A HG3  9  
ATOM   10264 H  HE21 . GLN A 1 62 ? -0.369  -4.819  9.498   1.00 0.00 ? 62  GLN A HE21 9  
ATOM   10265 H  HE22 . GLN A 1 62 ? 0.795   -5.613  10.498  1.00 0.00 ? 62  GLN A HE22 9  
ATOM   10266 N  N    . ILE A 1 63 ? 0.626   -4.055  3.742   1.00 0.00 ? 63  ILE A N    9  
ATOM   10267 C  CA   . ILE A 1 63 ? 1.094   -3.111  2.735   1.00 0.00 ? 63  ILE A CA   9  
ATOM   10268 C  C    . ILE A 1 63 ? 1.802   -1.924  3.380   1.00 0.00 ? 63  ILE A C    9  
ATOM   10269 O  O    . ILE A 1 63 ? 1.321   -1.360  4.363   1.00 0.00 ? 63  ILE A O    9  
ATOM   10270 C  CB   . ILE A 1 63 ? -0.069  -2.591  1.868   1.00 0.00 ? 63  ILE A CB   9  
ATOM   10271 C  CG1  . ILE A 1 63 ? -1.165  -1.992  2.752   1.00 0.00 ? 63  ILE A CG1  9  
ATOM   10272 C  CG2  . ILE A 1 63 ? -0.629  -3.712  1.006   1.00 0.00 ? 63  ILE A CG2  9  
ATOM   10273 C  CD1  . ILE A 1 63 ? -1.917  -0.856  2.095   1.00 0.00 ? 63  ILE A CD1  9  
ATOM   10274 H  H    . ILE A 1 63 ? 0.079   -3.728  4.486   1.00 0.00 ? 63  ILE A H    9  
ATOM   10275 H  HA   . ILE A 1 63 ? 1.792   -3.628  2.093   1.00 0.00 ? 63  ILE A HA   9  
ATOM   10276 H  HB   . ILE A 1 63 ? 0.315   -1.823  1.213   1.00 0.00 ? 63  ILE A HB   9  
ATOM   10277 H  HG12 . ILE A 1 63 ? -1.878  -2.761  3.001   1.00 0.00 ? 63  ILE A HG12 9  
ATOM   10278 H  HG13 . ILE A 1 63 ? -0.718  -1.614  3.660   1.00 0.00 ? 63  ILE A HG13 9  
ATOM   10279 H  HG21 . ILE A 1 63 ? 0.168   -4.153  0.427   1.00 0.00 ? 63  ILE A HG21 9  
ATOM   10280 H  HG22 . ILE A 1 63 ? -1.072  -4.465  1.640   1.00 0.00 ? 63  ILE A HG22 9  
ATOM   10281 H  HG23 . ILE A 1 63 ? -1.380  -3.314  0.340   1.00 0.00 ? 63  ILE A HG23 9  
ATOM   10282 H  HD11 . ILE A 1 63 ? -2.964  -1.113  2.020   1.00 0.00 ? 63  ILE A HD11 9  
ATOM   10283 H  HD12 . ILE A 1 63 ? -1.807  0.040   2.687   1.00 0.00 ? 63  ILE A HD12 9  
ATOM   10284 H  HD13 . ILE A 1 63 ? -1.518  -0.685  1.105   1.00 0.00 ? 63  ILE A HD13 9  
ATOM   10285 N  N    . TYR A 1 64 ? 2.947   -1.550  2.819   1.00 0.00 ? 64  TYR A N    9  
ATOM   10286 C  CA   . TYR A 1 64 ? 3.722   -0.431  3.340   1.00 0.00 ? 64  TYR A CA   9  
ATOM   10287 C  C    . TYR A 1 64 ? 4.390   0.343   2.208   1.00 0.00 ? 64  TYR A C    9  
ATOM   10288 O  O    . TYR A 1 64 ? 4.325   -0.055  1.044   1.00 0.00 ? 64  TYR A O    9  
ATOM   10289 C  CB   . TYR A 1 64 ? 4.781   -0.931  4.325   1.00 0.00 ? 64  TYR A CB   9  
ATOM   10290 C  CG   . TYR A 1 64 ? 4.229   -1.845  5.395   1.00 0.00 ? 64  TYR A CG   9  
ATOM   10291 C  CD1  . TYR A 1 64 ? 4.144   -3.216  5.190   1.00 0.00 ? 64  TYR A CD1  9  
ATOM   10292 C  CD2  . TYR A 1 64 ? 3.792   -1.337  6.613   1.00 0.00 ? 64  TYR A CD2  9  
ATOM   10293 C  CE1  . TYR A 1 64 ? 3.639   -4.055  6.165   1.00 0.00 ? 64  TYR A CE1  9  
ATOM   10294 C  CE2  . TYR A 1 64 ? 3.287   -2.168  7.594   1.00 0.00 ? 64  TYR A CE2  9  
ATOM   10295 C  CZ   . TYR A 1 64 ? 3.213   -3.526  7.365   1.00 0.00 ? 64  TYR A CZ   9  
ATOM   10296 O  OH   . TYR A 1 64 ? 2.711   -4.358  8.339   1.00 0.00 ? 64  TYR A OH   9  
ATOM   10297 H  H    . TYR A 1 64 ? 3.279   -2.039  2.038   1.00 0.00 ? 64  TYR A H    9  
ATOM   10298 H  HA   . TYR A 1 64 ? 3.044   0.229   3.861   1.00 0.00 ? 64  TYR A HA   9  
ATOM   10299 H  HB2  . TYR A 1 64 ? 5.538   -1.476  3.783   1.00 0.00 ? 64  TYR A HB2  9  
ATOM   10300 H  HB3  . TYR A 1 64 ? 5.236   -0.083  4.815   1.00 0.00 ? 64  TYR A HB3  9  
ATOM   10301 H  HD1  . TYR A 1 64 ? 4.480   -3.627  4.249   1.00 0.00 ? 64  TYR A HD1  9  
ATOM   10302 H  HD2  . TYR A 1 64 ? 3.852   -0.272  6.789   1.00 0.00 ? 64  TYR A HD2  9  
ATOM   10303 H  HE1  . TYR A 1 64 ? 3.581   -5.118  5.986   1.00 0.00 ? 64  TYR A HE1  9  
ATOM   10304 H  HE2  . TYR A 1 64 ? 2.953   -1.754  8.534   1.00 0.00 ? 64  TYR A HE2  9  
ATOM   10305 H  HH   . TYR A 1 64 ? 3.393   -4.975  8.616   1.00 0.00 ? 64  TYR A HH   9  
ATOM   10306 N  N    . CYS A 1 65 ? 5.034   1.452   2.557   1.00 0.00 ? 65  CYS A N    9  
ATOM   10307 C  CA   . CYS A 1 65 ? 5.715   2.283   1.572   1.00 0.00 ? 65  CYS A CA   9  
ATOM   10308 C  C    . CYS A 1 65 ? 7.179   1.875   1.434   1.00 0.00 ? 65  CYS A C    9  
ATOM   10309 O  O    . CYS A 1 65 ? 7.858   1.618   2.428   1.00 0.00 ? 65  CYS A O    9  
ATOM   10310 C  CB   . CYS A 1 65 ? 5.621   3.759   1.967   1.00 0.00 ? 65  CYS A CB   9  
ATOM   10311 S  SG   . CYS A 1 65 ? 6.361   4.143   3.586   1.00 0.00 ? 65  CYS A SG   9  
ATOM   10312 H  H    . CYS A 1 65 ? 5.051   1.718   3.501   1.00 0.00 ? 65  CYS A H    9  
ATOM   10313 H  HA   . CYS A 1 65 ? 5.224   2.142   0.621   1.00 0.00 ? 65  CYS A HA   9  
ATOM   10314 H  HB2  . CYS A 1 65 ? 6.131   4.355   1.224   1.00 0.00 ? 65  CYS A HB2  9  
ATOM   10315 H  HB3  . CYS A 1 65 ? 4.581   4.048   2.002   1.00 0.00 ? 65  CYS A HB3  9  
ATOM   10316 N  N    . GLU A 1 66 ? 7.658   1.818   0.195   1.00 0.00 ? 66  GLU A N    9  
ATOM   10317 C  CA   . GLU A 1 66 ? 9.040   1.440   -0.072  1.00 0.00 ? 66  GLU A CA   9  
ATOM   10318 C  C    . GLU A 1 66 ? 9.961   1.917   1.047   1.00 0.00 ? 66  GLU A C    9  
ATOM   10319 O  O    . GLU A 1 66 ? 10.874  1.203   1.463   1.00 0.00 ? 66  GLU A O    9  
ATOM   10320 C  CB   . GLU A 1 66 ? 9.502   2.022   -1.410  1.00 0.00 ? 66  GLU A CB   9  
ATOM   10321 C  CG   . GLU A 1 66 ? 10.980  1.807   -1.690  1.00 0.00 ? 66  GLU A CG   9  
ATOM   10322 C  CD   . GLU A 1 66 ? 11.482  2.645   -2.850  1.00 0.00 ? 66  GLU A CD   9  
ATOM   10323 O  OE1  . GLU A 1 66 ? 10.926  2.514   -3.961  1.00 0.00 ? 66  GLU A OE1  9  
ATOM   10324 O  OE2  . GLU A 1 66 ? 12.430  3.431   -2.647  1.00 0.00 ? 66  GLU A OE2  9  
ATOM   10325 H  H    . GLU A 1 66 ? 7.067   2.034   -0.556  1.00 0.00 ? 66  GLU A H    9  
ATOM   10326 H  HA   . GLU A 1 66 ? 9.086   0.363   -0.124  1.00 0.00 ? 66  GLU A HA   9  
ATOM   10327 H  HB2  . GLU A 1 66 ? 8.935   1.560   -2.205  1.00 0.00 ? 66  GLU A HB2  9  
ATOM   10328 H  HB3  . GLU A 1 66 ? 9.307   3.084   -1.412  1.00 0.00 ? 66  GLU A HB3  9  
ATOM   10329 H  HG2  . GLU A 1 66 ? 11.542  2.071   -0.806  1.00 0.00 ? 66  GLU A HG2  9  
ATOM   10330 H  HG3  . GLU A 1 66 ? 11.142  0.765   -1.921  1.00 0.00 ? 66  GLU A HG3  9  
ATOM   10331 N  N    . LYS A 1 67 ? 9.714   3.130   1.531   1.00 0.00 ? 67  LYS A N    9  
ATOM   10332 C  CA   . LYS A 1 67 ? 10.519  3.704   2.603   1.00 0.00 ? 67  LYS A CA   9  
ATOM   10333 C  C    . LYS A 1 67 ? 10.499  2.809   3.838   1.00 0.00 ? 67  LYS A C    9  
ATOM   10334 O  O    . LYS A 1 67 ? 11.547  2.486   4.399   1.00 0.00 ? 67  LYS A O    9  
ATOM   10335 C  CB   . LYS A 1 67 ? 10.004  5.100   2.963   1.00 0.00 ? 67  LYS A CB   9  
ATOM   10336 C  CG   . LYS A 1 67 ? 10.789  5.769   4.078   1.00 0.00 ? 67  LYS A CG   9  
ATOM   10337 C  CD   . LYS A 1 67 ? 9.965   6.836   4.778   1.00 0.00 ? 67  LYS A CD   9  
ATOM   10338 C  CE   . LYS A 1 67 ? 10.021  8.161   4.034   1.00 0.00 ? 67  LYS A CE   9  
ATOM   10339 N  NZ   . LYS A 1 67 ? 11.335  8.840   4.208   1.00 0.00 ? 67  LYS A NZ   9  
ATOM   10340 H  H    . LYS A 1 67 ? 8.972   3.651   1.159   1.00 0.00 ? 67  LYS A H    9  
ATOM   10341 H  HA   . LYS A 1 67 ? 11.535  3.785   2.248   1.00 0.00 ? 67  LYS A HA   9  
ATOM   10342 H  HB2  . LYS A 1 67 ? 10.058  5.728   2.086   1.00 0.00 ? 67  LYS A HB2  9  
ATOM   10343 H  HB3  . LYS A 1 67 ? 8.973   5.020   3.275   1.00 0.00 ? 67  LYS A HB3  9  
ATOM   10344 H  HG2  . LYS A 1 67 ? 11.079  5.021   4.801   1.00 0.00 ? 67  LYS A HG2  9  
ATOM   10345 H  HG3  . LYS A 1 67 ? 11.673  6.228   3.658   1.00 0.00 ? 67  LYS A HG3  9  
ATOM   10346 H  HD2  . LYS A 1 67 ? 8.937   6.509   4.829   1.00 0.00 ? 67  LYS A HD2  9  
ATOM   10347 H  HD3  . LYS A 1 67 ? 10.350  6.978   5.778   1.00 0.00 ? 67  LYS A HD3  9  
ATOM   10348 H  HE2  . LYS A 1 67 ? 9.858   7.976   2.983   1.00 0.00 ? 67  LYS A HE2  9  
ATOM   10349 H  HE3  . LYS A 1 67 ? 9.240   8.805   4.411   1.00 0.00 ? 67  LYS A HE3  9  
ATOM   10350 H  HZ1  . LYS A 1 67 ? 12.093  8.133   4.297   1.00 0.00 ? 67  LYS A HZ1  9  
ATOM   10351 H  HZ2  . LYS A 1 67 ? 11.323  9.427   5.066   1.00 0.00 ? 67  LYS A HZ2  9  
ATOM   10352 H  HZ3  . LYS A 1 67 ? 11.535  9.447   3.388   1.00 0.00 ? 67  LYS A HZ3  9  
ATOM   10353 N  N    . HIS A 1 68 ? 9.302   2.411   4.255   1.00 0.00 ? 68  HIS A N    9  
ATOM   10354 C  CA   . HIS A 1 68 ? 9.147   1.551   5.423   1.00 0.00 ? 68  HIS A CA   9  
ATOM   10355 C  C    . HIS A 1 68 ? 9.329   0.084   5.046   1.00 0.00 ? 68  HIS A C    9  
ATOM   10356 O  O    . HIS A 1 68 ? 10.128  -0.629  5.652   1.00 0.00 ? 68  HIS A O    9  
ATOM   10357 C  CB   . HIS A 1 68 ? 7.771   1.759   6.057   1.00 0.00 ? 68  HIS A CB   9  
ATOM   10358 C  CG   . HIS A 1 68 ? 7.727   2.896   7.031   1.00 0.00 ? 68  HIS A CG   9  
ATOM   10359 N  ND1  . HIS A 1 68 ? 6.636   3.730   7.166   1.00 0.00 ? 68  HIS A ND1  9  
ATOM   10360 C  CD2  . HIS A 1 68 ? 8.646   3.335   7.922   1.00 0.00 ? 68  HIS A CD2  9  
ATOM   10361 C  CE1  . HIS A 1 68 ? 6.888   4.633   8.097   1.00 0.00 ? 68  HIS A CE1  9  
ATOM   10362 N  NE2  . HIS A 1 68 ? 8.101   4.415   8.572   1.00 0.00 ? 68  HIS A NE2  9  
ATOM   10363 H  H    . HIS A 1 68 ? 8.504   2.702   3.766   1.00 0.00 ? 68  HIS A H    9  
ATOM   10364 H  HA   . HIS A 1 68 ? 9.908   1.822   6.139   1.00 0.00 ? 68  HIS A HA   9  
ATOM   10365 H  HB2  . HIS A 1 68 ? 7.050   1.962   5.279   1.00 0.00 ? 68  HIS A HB2  9  
ATOM   10366 H  HB3  . HIS A 1 68 ? 7.484   0.860   6.583   1.00 0.00 ? 68  HIS A HB3  9  
ATOM   10367 H  HD2  . HIS A 1 68 ? 9.628   2.915   8.091   1.00 0.00 ? 68  HIS A HD2  9  
ATOM   10368 H  HE1  . HIS A 1 68 ? 6.216   5.416   8.416   1.00 0.00 ? 68  HIS A HE1  9  
ATOM   10369 H  HE2  . HIS A 1 68 ? 8.568   4.992   9.211   1.00 0.00 ? 68  HIS A HE2  9  
ATOM   10370 N  N    . ALA A 1 69 ? 8.581   -0.361  4.041   1.00 0.00 ? 69  ALA A N    9  
ATOM   10371 C  CA   . ALA A 1 69 ? 8.662   -1.742  3.582   1.00 0.00 ? 69  ALA A CA   9  
ATOM   10372 C  C    . ALA A 1 69 ? 10.109  -2.216  3.519   1.00 0.00 ? 69  ALA A C    9  
ATOM   10373 O  O    . ALA A 1 69 ? 10.458  -3.254  4.083   1.00 0.00 ? 69  ALA A O    9  
ATOM   10374 C  CB   . ALA A 1 69 ? 7.997   -1.885  2.220   1.00 0.00 ? 69  ALA A CB   9  
ATOM   10375 H  H    . ALA A 1 69 ? 7.963   0.255   3.596   1.00 0.00 ? 69  ALA A H    9  
ATOM   10376 H  HA   . ALA A 1 69 ? 8.121   -2.359  4.285   1.00 0.00 ? 69  ALA A HA   9  
ATOM   10377 H  HB1  . ALA A 1 69 ? 7.587   -0.932  1.919   1.00 0.00 ? 69  ALA A HB1  9  
ATOM   10378 H  HB2  . ALA A 1 69 ? 8.729   -2.208  1.495   1.00 0.00 ? 69  ALA A HB2  9  
ATOM   10379 H  HB3  . ALA A 1 69 ? 7.204   -2.615  2.282   1.00 0.00 ? 69  ALA A HB3  9  
ATOM   10380 N  N    . ARG A 1 70 ? 10.949  -1.451  2.829   1.00 0.00 ? 70  ARG A N    9  
ATOM   10381 C  CA   . ARG A 1 70 ? 12.359  -1.795  2.691   1.00 0.00 ? 70  ARG A CA   9  
ATOM   10382 C  C    . ARG A 1 70 ? 12.994  -2.042  4.056   1.00 0.00 ? 70  ARG A C    9  
ATOM   10383 O  O    . ARG A 1 70 ? 13.796  -2.961  4.220   1.00 0.00 ? 70  ARG A O    9  
ATOM   10384 C  CB   . ARG A 1 70 ? 13.109  -0.679  1.961   1.00 0.00 ? 70  ARG A CB   9  
ATOM   10385 C  CG   . ARG A 1 70 ? 13.378  0.541   2.828   1.00 0.00 ? 70  ARG A CG   9  
ATOM   10386 C  CD   . ARG A 1 70 ? 14.349  1.498   2.155   1.00 0.00 ? 70  ARG A CD   9  
ATOM   10387 N  NE   . ARG A 1 70 ? 15.739  1.183   2.474   1.00 0.00 ? 70  ARG A NE   9  
ATOM   10388 C  CZ   . ARG A 1 70 ? 16.767  1.536   1.711   1.00 0.00 ? 70  ARG A CZ   9  
ATOM   10389 N  NH1  . ARG A 1 70 ? 16.563  2.215   0.590   1.00 0.00 ? 70  ARG A NH1  9  
ATOM   10390 N  NH2  . ARG A 1 70 ? 18.003  1.212   2.069   1.00 0.00 ? 70  ARG A NH2  9  
ATOM   10391 H  H    . ARG A 1 70 ? 10.611  -0.636  2.401   1.00 0.00 ? 70  ARG A H    9  
ATOM   10392 H  HA   . ARG A 1 70 ? 12.424  -2.701  2.107   1.00 0.00 ? 70  ARG A HA   9  
ATOM   10393 H  HB2  . ARG A 1 70 ? 14.057  -1.064  1.616   1.00 0.00 ? 70  ARG A HB2  9  
ATOM   10394 H  HB3  . ARG A 1 70 ? 12.524  -0.366  1.109   1.00 0.00 ? 70  ARG A HB3  9  
ATOM   10395 H  HG2  . ARG A 1 70 ? 12.447  1.057   3.006   1.00 0.00 ? 70  ARG A HG2  9  
ATOM   10396 H  HG3  . ARG A 1 70 ? 13.799  0.217   3.768   1.00 0.00 ? 70  ARG A HG3  9  
ATOM   10397 H  HD2  . ARG A 1 70 ? 14.213  1.436   1.085   1.00 0.00 ? 70  ARG A HD2  9  
ATOM   10398 H  HD3  . ARG A 1 70 ? 14.132  2.502   2.487   1.00 0.00 ? 70  ARG A HD3  9  
ATOM   10399 H  HE   . ARG A 1 70 ? 15.913  0.682   3.298   1.00 0.00 ? 70  ARG A HE   9  
ATOM   10400 H  HH11 . ARG A 1 70 ? 15.632  2.461   0.319   1.00 0.00 ? 70  ARG A HH11 9  
ATOM   10401 H  HH12 . ARG A 1 70 ? 17.339  2.481   0.018   1.00 0.00 ? 70  ARG A HH12 9  
ATOM   10402 H  HH21 . ARG A 1 70 ? 18.161  0.702   2.913   1.00 0.00 ? 70  ARG A HH21 9  
ATOM   10403 H  HH22 . ARG A 1 70 ? 18.776  1.479   1.494   1.00 0.00 ? 70  ARG A HH22 9  
ATOM   10404 N  N    . GLU A 1 71 ? 12.631  -1.214  5.031   1.00 0.00 ? 71  GLU A N    9  
ATOM   10405 C  CA   . GLU A 1 71 ? 13.167  -1.343  6.381   1.00 0.00 ? 71  GLU A CA   9  
ATOM   10406 C  C    . GLU A 1 71 ? 12.741  -2.666  7.011   1.00 0.00 ? 71  GLU A C    9  
ATOM   10407 O  O    . GLU A 1 71 ? 13.522  -3.312  7.710   1.00 0.00 ? 71  GLU A O    9  
ATOM   10408 C  CB   . GLU A 1 71 ? 12.699  -0.176  7.252   1.00 0.00 ? 71  GLU A CB   9  
ATOM   10409 C  CG   . GLU A 1 71 ? 13.331  1.155   6.879   1.00 0.00 ? 71  GLU A CG   9  
ATOM   10410 C  CD   . GLU A 1 71 ? 13.296  2.157   8.017   1.00 0.00 ? 71  GLU A CD   9  
ATOM   10411 O  OE1  . GLU A 1 71 ? 12.421  2.025   8.898   1.00 0.00 ? 71  GLU A OE1  9  
ATOM   10412 O  OE2  . GLU A 1 71 ? 14.145  3.072   8.026   1.00 0.00 ? 71  GLU A OE2  9  
ATOM   10413 H  H    . GLU A 1 71 ? 11.987  -0.501  4.837   1.00 0.00 ? 71  GLU A H    9  
ATOM   10414 H  HA   . GLU A 1 71 ? 14.244  -1.320  6.313   1.00 0.00 ? 71  GLU A HA   9  
ATOM   10415 H  HB2  . GLU A 1 71 ? 11.627  -0.080  7.160   1.00 0.00 ? 71  GLU A HB2  9  
ATOM   10416 H  HB3  . GLU A 1 71 ? 12.944  -0.391  8.282   1.00 0.00 ? 71  GLU A HB3  9  
ATOM   10417 H  HG2  . GLU A 1 71 ? 14.361  0.984   6.602   1.00 0.00 ? 71  GLU A HG2  9  
ATOM   10418 H  HG3  . GLU A 1 71 ? 12.797  1.569   6.037   1.00 0.00 ? 71  GLU A HG3  9  
ATOM   10419 N  N    . ARG A 1 72 ? 11.498  -3.061  6.760   1.00 0.00 ? 72  ARG A N    9  
ATOM   10420 C  CA   . ARG A 1 72 ? 10.967  -4.306  7.304   1.00 0.00 ? 72  ARG A CA   9  
ATOM   10421 C  C    . ARG A 1 72 ? 11.698  -5.510  6.718   1.00 0.00 ? 72  ARG A C    9  
ATOM   10422 O  O    . ARG A 1 72 ? 12.245  -6.335  7.450   1.00 0.00 ? 72  ARG A O    9  
ATOM   10423 C  CB   . ARG A 1 72 ? 9.469   -4.415  7.017   1.00 0.00 ? 72  ARG A CB   9  
ATOM   10424 C  CG   . ARG A 1 72 ? 8.607   -3.581  7.951   1.00 0.00 ? 72  ARG A CG   9  
ATOM   10425 C  CD   . ARG A 1 72 ? 7.149   -3.590  7.521   1.00 0.00 ? 72  ARG A CD   9  
ATOM   10426 N  NE   . ARG A 1 72 ? 6.258   -3.167  8.597   1.00 0.00 ? 72  ARG A NE   9  
ATOM   10427 C  CZ   . ARG A 1 72 ? 6.180   -1.916  9.038   1.00 0.00 ? 72  ARG A CZ   9  
ATOM   10428 N  NH1  . ARG A 1 72 ? 6.936   -0.971  8.497   1.00 0.00 ? 72  ARG A NH1  9  
ATOM   10429 N  NH2  . ARG A 1 72 ? 5.345   -1.608  10.022  1.00 0.00 ? 72  ARG A NH2  9  
ATOM   10430 H  H    . ARG A 1 72 ? 10.923  -2.503  6.195   1.00 0.00 ? 72  ARG A H    9  
ATOM   10431 H  HA   . ARG A 1 72 ? 11.120  -4.292  8.373   1.00 0.00 ? 72  ARG A HA   9  
ATOM   10432 H  HB2  . ARG A 1 72 ? 9.283   -4.087  6.004   1.00 0.00 ? 72  ARG A HB2  9  
ATOM   10433 H  HB3  . ARG A 1 72 ? 9.171   -5.448  7.113   1.00 0.00 ? 72  ARG A HB3  9  
ATOM   10434 H  HG2  . ARG A 1 72 ? 8.679   -3.987  8.950   1.00 0.00 ? 72  ARG A HG2  9  
ATOM   10435 H  HG3  . ARG A 1 72 ? 8.969   -2.564  7.947   1.00 0.00 ? 72  ARG A HG3  9  
ATOM   10436 H  HD2  . ARG A 1 72 ? 7.031   -2.918  6.684   1.00 0.00 ? 72  ARG A HD2  9  
ATOM   10437 H  HD3  . ARG A 1 72 ? 6.883   -4.592  7.218   1.00 0.00 ? 72  ARG A HD3  9  
ATOM   10438 H  HE   . ARG A 1 72 ? 5.690   -3.849  9.011   1.00 0.00 ? 72  ARG A HE   9  
ATOM   10439 H  HH11 . ARG A 1 72 ? 7.566   -1.199  7.755   1.00 0.00 ? 72  ARG A HH11 9  
ATOM   10440 H  HH12 . ARG A 1 72 ? 6.875   -0.029  8.830   1.00 0.00 ? 72  ARG A HH12 9  
ATOM   10441 H  HH21 . ARG A 1 72 ? 4.773   -2.318  10.432  1.00 0.00 ? 72  ARG A HH21 9  
ATOM   10442 H  HH22 . ARG A 1 72 ? 5.287   -0.667  10.353  1.00 0.00 ? 72  ARG A HH22 9  
ATOM   10443 N  N    . VAL A 1 73 ? 11.701  -5.606  5.392   1.00 0.00 ? 73  VAL A N    9  
ATOM   10444 C  CA   . VAL A 1 73 ? 12.364  -6.709  4.707   1.00 0.00 ? 73  VAL A CA   9  
ATOM   10445 C  C    . VAL A 1 73 ? 13.682  -7.065  5.385   1.00 0.00 ? 73  VAL A C    9  
ATOM   10446 O  O    . VAL A 1 73 ? 13.912  -8.217  5.753   1.00 0.00 ? 73  VAL A O    9  
ATOM   10447 C  CB   . VAL A 1 73 ? 12.635  -6.370  3.229   1.00 0.00 ? 73  VAL A CB   9  
ATOM   10448 C  CG1  . VAL A 1 73 ? 13.367  -7.515  2.544   1.00 0.00 ? 73  VAL A CG1  9  
ATOM   10449 C  CG2  . VAL A 1 73 ? 11.334  -6.052  2.508   1.00 0.00 ? 73  VAL A CG2  9  
ATOM   10450 H  H    . VAL A 1 73 ? 11.248  -4.918  4.862   1.00 0.00 ? 73  VAL A H    9  
ATOM   10451 H  HA   . VAL A 1 73 ? 11.708  -7.567  4.743   1.00 0.00 ? 73  VAL A HA   9  
ATOM   10452 H  HB   . VAL A 1 73 ? 13.267  -5.495  3.191   1.00 0.00 ? 73  VAL A HB   9  
ATOM   10453 H  HG11 . VAL A 1 73 ? 12.647  -8.194  2.111   1.00 0.00 ? 73  VAL A HG11 9  
ATOM   10454 H  HG12 . VAL A 1 73 ? 14.004  -7.121  1.766   1.00 0.00 ? 73  VAL A HG12 9  
ATOM   10455 H  HG13 . VAL A 1 73 ? 13.968  -8.043  3.270   1.00 0.00 ? 73  VAL A HG13 9  
ATOM   10456 H  HG21 . VAL A 1 73 ? 10.952  -6.948  2.043   1.00 0.00 ? 73  VAL A HG21 9  
ATOM   10457 H  HG22 . VAL A 1 73 ? 10.610  -5.679  3.219   1.00 0.00 ? 73  VAL A HG22 9  
ATOM   10458 H  HG23 . VAL A 1 73 ? 11.514  -5.302  1.753   1.00 0.00 ? 73  VAL A HG23 9  
ATOM   10459 N  N    . SER A 1 74 ? 14.545  -6.067  5.548   1.00 0.00 ? 74  SER A N    9  
ATOM   10460 C  CA   . SER A 1 74 ? 15.843  -6.275  6.180   1.00 0.00 ? 74  SER A CA   9  
ATOM   10461 C  C    . SER A 1 74 ? 15.677  -6.672  7.644   1.00 0.00 ? 74  SER A C    9  
ATOM   10462 O  O    . SER A 1 74 ? 16.152  -7.724  8.071   1.00 0.00 ? 74  SER A O    9  
ATOM   10463 C  CB   . SER A 1 74 ? 16.693  -5.007  6.077   1.00 0.00 ? 74  SER A CB   9  
ATOM   10464 O  OG   . SER A 1 74 ? 16.020  -3.895  6.641   1.00 0.00 ? 74  SER A OG   9  
ATOM   10465 H  H    . SER A 1 74 ? 14.304  -5.171  5.234   1.00 0.00 ? 74  SER A H    9  
ATOM   10466 H  HA   . SER A 1 74 ? 16.342  -7.077  5.656   1.00 0.00 ? 74  SER A HA   9  
ATOM   10467 H  HB2  . SER A 1 74 ? 17.622  -5.156  6.606   1.00 0.00 ? 74  SER A HB2  9  
ATOM   10468 H  HB3  . SER A 1 74 ? 16.899  -4.800  5.037   1.00 0.00 ? 74  SER A HB3  9  
ATOM   10469 H  HG   . SER A 1 74 ? 16.648  -3.186  6.797   1.00 0.00 ? 74  SER A HG   9  
ATOM   10470 N  N    . GLY A 1 75 ? 14.999  -5.822  8.408   1.00 0.00 ? 75  GLY A N    9  
ATOM   10471 C  CA   . GLY A 1 75 ? 14.782  -6.100  9.816   1.00 0.00 ? 75  GLY A CA   9  
ATOM   10472 C  C    . GLY A 1 75 ? 14.506  -7.567  10.081  1.00 0.00 ? 75  GLY A C    9  
ATOM   10473 O  O    . GLY A 1 75 ? 13.874  -8.256  9.281   1.00 0.00 ? 75  GLY A O    9  
ATOM   10474 H  H    . GLY A 1 75 ? 14.643  -4.998  8.013   1.00 0.00 ? 75  GLY A H    9  
ATOM   10475 H  HA2  . GLY A 1 75 ? 15.659  -5.803  10.370  1.00 0.00 ? 75  GLY A HA2  9  
ATOM   10476 H  HA3  . GLY A 1 75 ? 13.938  -5.520  10.160  1.00 0.00 ? 75  GLY A HA3  9  
ATOM   10477 N  N    . PRO A 1 76 ? 14.990  -8.066  11.228  1.00 0.00 ? 76  PRO A N    9  
ATOM   10478 C  CA   . PRO A 1 76 ? 14.806  -9.466  11.623  1.00 0.00 ? 76  PRO A CA   9  
ATOM   10479 C  C    . PRO A 1 76 ? 13.359  -9.781  11.982  1.00 0.00 ? 76  PRO A C    9  
ATOM   10480 O  O    . PRO A 1 76 ? 12.602  -8.897  12.385  1.00 0.00 ? 76  PRO A O    9  
ATOM   10481 C  CB   . PRO A 1 76 ? 15.706  -9.609  12.853  1.00 0.00 ? 76  PRO A CB   9  
ATOM   10482 C  CG   . PRO A 1 76 ? 15.808  -8.231  13.410  1.00 0.00 ? 76  PRO A CG   9  
ATOM   10483 C  CD   . PRO A 1 76 ? 15.754  -7.302  12.229  1.00 0.00 ? 76  PRO A CD   9  
ATOM   10484 H  HA   . PRO A 1 76 ? 15.140  -10.143 10.850  1.00 0.00 ? 76  PRO A HA   9  
ATOM   10485 H  HB2  . PRO A 1 76 ? 15.250  -10.289 13.559  1.00 0.00 ? 76  PRO A HB2  9  
ATOM   10486 H  HB3  . PRO A 1 76 ? 16.673  -9.986  12.554  1.00 0.00 ? 76  PRO A HB3  9  
ATOM   10487 H  HG2  . PRO A 1 76 ? 14.979  -8.041  14.075  1.00 0.00 ? 76  PRO A HG2  9  
ATOM   10488 H  HG3  . PRO A 1 76 ? 16.746  -8.116  13.934  1.00 0.00 ? 76  PRO A HG3  9  
ATOM   10489 H  HD2  . PRO A 1 76 ? 15.241  -6.388  12.491  1.00 0.00 ? 76  PRO A HD2  9  
ATOM   10490 H  HD3  . PRO A 1 76 ? 16.750  -7.088  11.871  1.00 0.00 ? 76  PRO A HD3  9  
ATOM   10491 N  N    . SER A 1 77 ? 12.979  -11.046 11.835  1.00 0.00 ? 77  SER A N    9  
ATOM   10492 C  CA   . SER A 1 77 ? 11.620  -11.478 12.141  1.00 0.00 ? 77  SER A CA   9  
ATOM   10493 C  C    . SER A 1 77 ? 11.393  -11.527 13.649  1.00 0.00 ? 77  SER A C    9  
ATOM   10494 O  O    . SER A 1 77 ? 12.103  -12.225 14.372  1.00 0.00 ? 77  SER A O    9  
ATOM   10495 C  CB   . SER A 1 77 ? 11.349  -12.853 11.528  1.00 0.00 ? 77  SER A CB   9  
ATOM   10496 O  OG   . SER A 1 77 ? 11.113  -12.752 10.134  1.00 0.00 ? 77  SER A OG   9  
ATOM   10497 H  H    . SER A 1 77 ? 13.628  -11.705 11.510  1.00 0.00 ? 77  SER A H    9  
ATOM   10498 H  HA   . SER A 1 77 ? 10.939  -10.760 11.709  1.00 0.00 ? 77  SER A HA   9  
ATOM   10499 H  HB2  . SER A 1 77 ? 12.203  -13.492 11.691  1.00 0.00 ? 77  SER A HB2  9  
ATOM   10500 H  HB3  . SER A 1 77 ? 10.478  -13.288 11.997  1.00 0.00 ? 77  SER A HB3  9  
ATOM   10501 H  HG   . SER A 1 77 ? 10.642  -11.937 9.947   1.00 0.00 ? 77  SER A HG   9  
ATOM   10502 N  N    . SER A 1 78 ? 10.397  -10.780 14.115  1.00 0.00 ? 78  SER A N    9  
ATOM   10503 C  CA   . SER A 1 78 ? 10.077  -10.734 15.537  1.00 0.00 ? 78  SER A CA   9  
ATOM   10504 C  C    . SER A 1 78 ? 9.334   -11.995 15.968  1.00 0.00 ? 78  SER A C    9  
ATOM   10505 O  O    . SER A 1 78 ? 9.777   -12.716 16.861  1.00 0.00 ? 78  SER A O    9  
ATOM   10506 C  CB   . SER A 1 78 ? 9.233   -9.498  15.852  1.00 0.00 ? 78  SER A CB   9  
ATOM   10507 O  OG   . SER A 1 78 ? 9.357   -9.130  17.215  1.00 0.00 ? 78  SER A OG   9  
ATOM   10508 H  H    . SER A 1 78 ? 9.867   -10.245 13.488  1.00 0.00 ? 78  SER A H    9  
ATOM   10509 H  HA   . SER A 1 78 ? 11.006  -10.674 16.084  1.00 0.00 ? 78  SER A HA   9  
ATOM   10510 H  HB2  . SER A 1 78 ? 9.562   -8.674  15.238  1.00 0.00 ? 78  SER A HB2  9  
ATOM   10511 H  HB3  . SER A 1 78 ? 8.195   -9.712  15.642  1.00 0.00 ? 78  SER A HB3  9  
ATOM   10512 H  HG   . SER A 1 78 ? 9.130   -9.879  17.771  1.00 0.00 ? 78  SER A HG   9  
ATOM   10513 N  N    . GLY A 1 79 ? 8.199   -12.255 15.324  1.00 0.00 ? 79  GLY A N    9  
ATOM   10514 C  CA   . GLY A 1 79 ? 7.412   -13.428 15.653  1.00 0.00 ? 79  GLY A CA   9  
ATOM   10515 C  C    . GLY A 1 79 ? 6.189   -13.091 16.483  1.00 0.00 ? 79  GLY A C    9  
ATOM   10516 O  O    . GLY A 1 79 ? 6.209   -12.093 17.202  1.00 0.00 ? 79  GLY A O    9  
ATOM   10517 H  H    . GLY A 1 79 ? 7.895   -11.644 14.620  1.00 0.00 ? 79  GLY A H    9  
ATOM   10518 H  HA2  . GLY A 1 79 ? 7.093   -13.903 14.737  1.00 0.00 ? 79  GLY A HA2  9  
ATOM   10519 H  HA3  . GLY A 1 79 ? 8.030   -14.119 16.208  1.00 0.00 ? 79  GLY A HA3  9  
HETATM 10520 ZN ZN   . ZN  B 2 .  ? -11.034 -0.280  3.500   1.00 0.00 ? 201 ZN  A ZN   9  
HETATM 10521 ZN ZN   . ZN  C 2 .  ? 5.241   3.925   5.658   1.00 0.00 ? 401 ZN  A ZN   9  
ATOM   10522 N  N    . GLY A 1 1  ? -19.086 -4.371  34.957  1.00 0.00 ? 1   GLY A N    10 
ATOM   10523 C  CA   . GLY A 1 1  ? -19.215 -4.522  33.519  1.00 0.00 ? 1   GLY A CA   10 
ATOM   10524 C  C    . GLY A 1 1  ? -19.153 -5.971  33.080  1.00 0.00 ? 1   GLY A C    10 
ATOM   10525 O  O    . GLY A 1 1  ? -18.085 -6.583  33.087  1.00 0.00 ? 1   GLY A O    10 
ATOM   10526 H  H1   . GLY A 1 1  ? -19.752 -4.776  35.552  1.00 0.00 ? 1   GLY A H1   10 
ATOM   10527 H  HA2  . GLY A 1 1  ? -20.160 -4.102  33.208  1.00 0.00 ? 1   GLY A HA2  10 
ATOM   10528 H  HA3  . GLY A 1 1  ? -18.416 -3.977  33.038  1.00 0.00 ? 1   GLY A HA3  10 
ATOM   10529 N  N    . SER A 1 2  ? -20.300 -6.522  32.698  1.00 0.00 ? 2   SER A N    10 
ATOM   10530 C  CA   . SER A 1 2  ? -20.373 -7.911  32.259  1.00 0.00 ? 2   SER A CA   10 
ATOM   10531 C  C    . SER A 1 2  ? -21.292 -8.051  31.050  1.00 0.00 ? 2   SER A C    10 
ATOM   10532 O  O    . SER A 1 2  ? -22.457 -7.656  31.093  1.00 0.00 ? 2   SER A O    10 
ATOM   10533 C  CB   . SER A 1 2  ? -20.870 -8.803  33.398  1.00 0.00 ? 2   SER A CB   10 
ATOM   10534 O  OG   . SER A 1 2  ? -22.262 -8.636  33.606  1.00 0.00 ? 2   SER A OG   10 
ATOM   10535 H  H    . SER A 1 2  ? -21.118 -5.982  32.715  1.00 0.00 ? 2   SER A H    10 
ATOM   10536 H  HA   . SER A 1 2  ? -19.378 -8.222  31.978  1.00 0.00 ? 2   SER A HA   10 
ATOM   10537 H  HB2  . SER A 1 2  ? -20.676 -9.836  33.154  1.00 0.00 ? 2   SER A HB2  10 
ATOM   10538 H  HB3  . SER A 1 2  ? -20.349 -8.544  34.308  1.00 0.00 ? 2   SER A HB3  10 
ATOM   10539 H  HG   . SER A 1 2  ? -22.685 -9.497  33.650  1.00 0.00 ? 2   SER A HG   10 
ATOM   10540 N  N    . SER A 1 3  ? -20.759 -8.616  29.971  1.00 0.00 ? 3   SER A N    10 
ATOM   10541 C  CA   . SER A 1 3  ? -21.529 -8.806  28.748  1.00 0.00 ? 3   SER A CA   10 
ATOM   10542 C  C    . SER A 1 3  ? -22.268 -10.140 28.772  1.00 0.00 ? 3   SER A C    10 
ATOM   10543 O  O    . SER A 1 3  ? -22.118 -10.929 29.704  1.00 0.00 ? 3   SER A O    10 
ATOM   10544 C  CB   . SER A 1 3  ? -20.610 -8.742  27.526  1.00 0.00 ? 3   SER A CB   10 
ATOM   10545 O  OG   . SER A 1 3  ? -21.322 -8.329  26.373  1.00 0.00 ? 3   SER A OG   10 
ATOM   10546 H  H    . SER A 1 3  ? -19.824 -8.910  29.999  1.00 0.00 ? 3   SER A H    10 
ATOM   10547 H  HA   . SER A 1 3  ? -22.253 -8.007  28.685  1.00 0.00 ? 3   SER A HA   10 
ATOM   10548 H  HB2  . SER A 1 3  ? -19.814 -8.037  27.714  1.00 0.00 ? 3   SER A HB2  10 
ATOM   10549 H  HB3  . SER A 1 3  ? -20.189 -9.720  27.344  1.00 0.00 ? 3   SER A HB3  10 
ATOM   10550 H  HG   . SER A 1 3  ? -20.743 -7.814  25.806  1.00 0.00 ? 3   SER A HG   10 
ATOM   10551 N  N    . GLY A 1 4  ? -23.069 -10.385 27.739  1.00 0.00 ? 4   GLY A N    10 
ATOM   10552 C  CA   . GLY A 1 4  ? -23.821 -11.624 27.661  1.00 0.00 ? 4   GLY A CA   10 
ATOM   10553 C  C    . GLY A 1 4  ? -24.388 -11.872 26.278  1.00 0.00 ? 4   GLY A C    10 
ATOM   10554 O  O    . GLY A 1 4  ? -25.525 -12.322 26.137  1.00 0.00 ? 4   GLY A O    10 
ATOM   10555 H  H    . GLY A 1 4  ? -23.150 -9.719  27.025  1.00 0.00 ? 4   GLY A H    10 
ATOM   10556 H  HA2  . GLY A 1 4  ? -23.170 -12.444 27.924  1.00 0.00 ? 4   GLY A HA2  10 
ATOM   10557 H  HA3  . GLY A 1 4  ? -24.636 -11.583 28.369  1.00 0.00 ? 4   GLY A HA3  10 
ATOM   10558 N  N    . SER A 1 5  ? -23.595 -11.576 25.253  1.00 0.00 ? 5   SER A N    10 
ATOM   10559 C  CA   . SER A 1 5  ? -24.027 -11.764 23.873  1.00 0.00 ? 5   SER A CA   10 
ATOM   10560 C  C    . SER A 1 5  ? -23.470 -13.064 23.302  1.00 0.00 ? 5   SER A C    10 
ATOM   10561 O  O    . SER A 1 5  ? -22.301 -13.394 23.504  1.00 0.00 ? 5   SER A O    10 
ATOM   10562 C  CB   . SER A 1 5  ? -23.579 -10.582 23.011  1.00 0.00 ? 5   SER A CB   10 
ATOM   10563 O  OG   . SER A 1 5  ? -22.165 -10.492 22.963  1.00 0.00 ? 5   SER A OG   10 
ATOM   10564 H  H    . SER A 1 5  ? -22.699 -11.220 25.430  1.00 0.00 ? 5   SER A H    10 
ATOM   10565 H  HA   . SER A 1 5  ? -25.105 -11.814 23.867  1.00 0.00 ? 5   SER A HA   10 
ATOM   10566 H  HB2  . SER A 1 5  ? -23.953 -10.710 22.006  1.00 0.00 ? 5   SER A HB2  10 
ATOM   10567 H  HB3  . SER A 1 5  ? -23.973 -9.666  23.428  1.00 0.00 ? 5   SER A HB3  10 
ATOM   10568 H  HG   . SER A 1 5  ? -21.812 -11.251 22.494  1.00 0.00 ? 5   SER A HG   10 
ATOM   10569 N  N    . SER A 1 6  ? -24.315 -13.799 22.587  1.00 0.00 ? 6   SER A N    10 
ATOM   10570 C  CA   . SER A 1 6  ? -23.910 -15.066 21.989  1.00 0.00 ? 6   SER A CA   10 
ATOM   10571 C  C    . SER A 1 6  ? -24.699 -15.341 20.712  1.00 0.00 ? 6   SER A C    10 
ATOM   10572 O  O    . SER A 1 6  ? -25.766 -14.769 20.493  1.00 0.00 ? 6   SER A O    10 
ATOM   10573 C  CB   . SER A 1 6  ? -24.112 -16.211 22.983  1.00 0.00 ? 6   SER A CB   10 
ATOM   10574 O  OG   . SER A 1 6  ? -23.224 -17.282 22.714  1.00 0.00 ? 6   SER A OG   10 
ATOM   10575 H  H    . SER A 1 6  ? -25.235 -13.483 22.461  1.00 0.00 ? 6   SER A H    10 
ATOM   10576 H  HA   . SER A 1 6  ? -22.861 -14.996 21.742  1.00 0.00 ? 6   SER A HA   10 
ATOM   10577 H  HB2  . SER A 1 6  ? -23.930 -15.851 23.984  1.00 0.00 ? 6   SER A HB2  10 
ATOM   10578 H  HB3  . SER A 1 6  ? -25.127 -16.574 22.910  1.00 0.00 ? 6   SER A HB3  10 
ATOM   10579 H  HG   . SER A 1 6  ? -23.726 -18.059 22.458  1.00 0.00 ? 6   SER A HG   10 
ATOM   10580 N  N    . GLY A 1 7  ? -24.165 -16.222 19.872  1.00 0.00 ? 7   GLY A N    10 
ATOM   10581 C  CA   . GLY A 1 7  ? -24.831 -16.559 18.627  1.00 0.00 ? 7   GLY A CA   10 
ATOM   10582 C  C    . GLY A 1 7  ? -24.392 -15.674 17.477  1.00 0.00 ? 7   GLY A C    10 
ATOM   10583 O  O    . GLY A 1 7  ? -24.252 -14.462 17.636  1.00 0.00 ? 7   GLY A O    10 
ATOM   10584 H  H    . GLY A 1 7  ? -23.311 -16.647 20.099  1.00 0.00 ? 7   GLY A H    10 
ATOM   10585 H  HA2  . GLY A 1 7  ? -24.612 -17.587 18.381  1.00 0.00 ? 7   GLY A HA2  10 
ATOM   10586 H  HA3  . GLY A 1 7  ? -25.897 -16.450 18.762  1.00 0.00 ? 7   GLY A HA3  10 
ATOM   10587 N  N    . SER A 1 8  ? -24.172 -16.282 16.316  1.00 0.00 ? 8   SER A N    10 
ATOM   10588 C  CA   . SER A 1 8  ? -23.741 -15.542 15.135  1.00 0.00 ? 8   SER A CA   10 
ATOM   10589 C  C    . SER A 1 8  ? -24.250 -16.208 13.861  1.00 0.00 ? 8   SER A C    10 
ATOM   10590 O  O    . SER A 1 8  ? -24.171 -17.428 13.711  1.00 0.00 ? 8   SER A O    10 
ATOM   10591 C  CB   . SER A 1 8  ? -22.214 -15.445 15.099  1.00 0.00 ? 8   SER A CB   10 
ATOM   10592 O  OG   . SER A 1 8  ? -21.755 -14.342 15.861  1.00 0.00 ? 8   SER A OG   10 
ATOM   10593 H  H    . SER A 1 8  ? -24.301 -17.252 16.252  1.00 0.00 ? 8   SER A H    10 
ATOM   10594 H  HA   . SER A 1 8  ? -24.155 -14.547 15.198  1.00 0.00 ? 8   SER A HA   10 
ATOM   10595 H  HB2  . SER A 1 8  ? -21.788 -16.349 15.504  1.00 0.00 ? 8   SER A HB2  10 
ATOM   10596 H  HB3  . SER A 1 8  ? -21.889 -15.320 14.076  1.00 0.00 ? 8   SER A HB3  10 
ATOM   10597 H  HG   . SER A 1 8  ? -22.395 -13.628 15.809  1.00 0.00 ? 8   SER A HG   10 
ATOM   10598 N  N    . ILE A 1 9  ? -24.772 -15.399 12.946  1.00 0.00 ? 9   ILE A N    10 
ATOM   10599 C  CA   . ILE A 1 9  ? -25.293 -15.908 11.684  1.00 0.00 ? 9   ILE A CA   10 
ATOM   10600 C  C    . ILE A 1 9  ? -24.367 -15.557 10.524  1.00 0.00 ? 9   ILE A C    10 
ATOM   10601 O  O    . ILE A 1 9  ? -23.746 -14.495 10.512  1.00 0.00 ? 9   ILE A O    10 
ATOM   10602 C  CB   . ILE A 1 9  ? -26.699 -15.352 11.389  1.00 0.00 ? 9   ILE A CB   10 
ATOM   10603 C  CG1  . ILE A 1 9  ? -27.269 -15.992 10.122  1.00 0.00 ? 9   ILE A CG1  10 
ATOM   10604 C  CG2  . ILE A 1 9  ? -26.651 -13.838 11.250  1.00 0.00 ? 9   ILE A CG2  10 
ATOM   10605 C  CD1  . ILE A 1 9  ? -28.753 -15.761 9.944   1.00 0.00 ? 9   ILE A CD1  10 
ATOM   10606 H  H    . ILE A 1 9  ? -24.807 -14.436 13.124  1.00 0.00 ? 9   ILE A H    10 
ATOM   10607 H  HA   . ILE A 1 9  ? -25.362 -16.984 11.762  1.00 0.00 ? 9   ILE A HA   10 
ATOM   10608 H  HB   . ILE A 1 9  ? -27.339 -15.593 12.225  1.00 0.00 ? 9   ILE A HB   10 
ATOM   10609 H  HG12 . ILE A 1 9  ? -26.765 -15.582 9.261   1.00 0.00 ? 9   ILE A HG12 10 
ATOM   10610 H  HG13 . ILE A 1 9  ? -27.101 -17.059 10.159  1.00 0.00 ? 9   ILE A HG13 10 
ATOM   10611 H  HG21 . ILE A 1 9  ? -26.098 -13.418 12.077  1.00 0.00 ? 9   ILE A HG21 10 
ATOM   10612 H  HG22 . ILE A 1 9  ? -26.164 -13.578 10.322  1.00 0.00 ? 9   ILE A HG22 10 
ATOM   10613 H  HG23 . ILE A 1 9  ? -27.656 -13.444 11.252  1.00 0.00 ? 9   ILE A HG23 10 
ATOM   10614 H  HD11 . ILE A 1 9  ? -28.911 -14.883 9.334   1.00 0.00 ? 9   ILE A HD11 10 
ATOM   10615 H  HD12 . ILE A 1 9  ? -29.197 -16.619 9.462   1.00 0.00 ? 9   ILE A HD12 10 
ATOM   10616 H  HD13 . ILE A 1 9  ? -29.213 -15.614 10.911  1.00 0.00 ? 9   ILE A HD13 10 
ATOM   10617 N  N    . GLY A 1 10 ? -24.280 -16.457 9.549   1.00 0.00 ? 10  GLY A N    10 
ATOM   10618 C  CA   . GLY A 1 10 ? -23.429 -16.223 8.398   1.00 0.00 ? 10  GLY A CA   10 
ATOM   10619 C  C    . GLY A 1 10 ? -24.171 -15.564 7.252   1.00 0.00 ? 10  GLY A C    10 
ATOM   10620 O  O    . GLY A 1 10 ? -25.257 -16.001 6.874   1.00 0.00 ? 10  GLY A O    10 
ATOM   10621 H  H    . GLY A 1 10 ? -24.798 -17.286 9.613   1.00 0.00 ? 10  GLY A H    10 
ATOM   10622 H  HA2  . GLY A 1 10 ? -22.607 -15.588 8.694   1.00 0.00 ? 10  GLY A HA2  10 
ATOM   10623 H  HA3  . GLY A 1 10 ? -23.034 -17.169 8.058   1.00 0.00 ? 10  GLY A HA3  10 
ATOM   10624 N  N    . ASN A 1 11 ? -23.585 -14.507 6.699   1.00 0.00 ? 11  ASN A N    10 
ATOM   10625 C  CA   . ASN A 1 11 ? -24.199 -13.785 5.591   1.00 0.00 ? 11  ASN A CA   10 
ATOM   10626 C  C    . ASN A 1 11 ? -23.371 -13.934 4.318   1.00 0.00 ? 11  ASN A C    10 
ATOM   10627 O  O    . ASN A 1 11 ? -22.162 -13.707 4.322   1.00 0.00 ? 11  ASN A O    10 
ATOM   10628 C  CB   . ASN A 1 11 ? -24.351 -12.303 5.943   1.00 0.00 ? 11  ASN A CB   10 
ATOM   10629 C  CG   . ASN A 1 11 ? -24.932 -12.094 7.328   1.00 0.00 ? 11  ASN A CG   10 
ATOM   10630 O  OD1  . ASN A 1 11 ? -26.148 -11.994 7.494   1.00 0.00 ? 11  ASN A OD1  10 
ATOM   10631 N  ND2  . ASN A 1 11 ? -24.063 -12.027 8.330   1.00 0.00 ? 11  ASN A ND2  10 
ATOM   10632 H  H    . ASN A 1 11 ? -22.718 -14.206 7.044   1.00 0.00 ? 11  ASN A H    10 
ATOM   10633 H  HA   . ASN A 1 11 ? -25.178 -14.207 5.422   1.00 0.00 ? 11  ASN A HA   10 
ATOM   10634 H  HB2  . ASN A 1 11 ? -23.381 -11.830 5.906   1.00 0.00 ? 11  ASN A HB2  10 
ATOM   10635 H  HB3  . ASN A 1 11 ? -25.004 -11.833 5.223   1.00 0.00 ? 11  ASN A HB3  10 
ATOM   10636 H  HD21 . ASN A 1 11 ? -23.109 -12.115 8.123   1.00 0.00 ? 11  ASN A HD21 10 
ATOM   10637 H  HD22 . ASN A 1 11 ? -24.412 -11.893 9.236   1.00 0.00 ? 11  ASN A HD22 10 
ATOM   10638 N  N    . ALA A 1 12 ? -24.032 -14.318 3.231   1.00 0.00 ? 12  ALA A N    10 
ATOM   10639 C  CA   . ALA A 1 12 ? -23.359 -14.496 1.951   1.00 0.00 ? 12  ALA A CA   10 
ATOM   10640 C  C    . ALA A 1 12 ? -22.838 -13.166 1.415   1.00 0.00 ? 12  ALA A C    10 
ATOM   10641 O  O    . ALA A 1 12 ? -23.618 -12.286 1.051   1.00 0.00 ? 12  ALA A O    10 
ATOM   10642 C  CB   . ALA A 1 12 ? -24.300 -15.140 0.944   1.00 0.00 ? 12  ALA A CB   10 
ATOM   10643 H  H    . ALA A 1 12 ? -24.996 -14.484 3.291   1.00 0.00 ? 12  ALA A H    10 
ATOM   10644 H  HA   . ALA A 1 12 ? -22.523 -15.163 2.103   1.00 0.00 ? 12  ALA A HA   10 
ATOM   10645 H  HB1  . ALA A 1 12 ? -25.263 -15.303 1.406   1.00 0.00 ? 12  ALA A HB1  10 
ATOM   10646 H  HB2  . ALA A 1 12 ? -24.415 -14.489 0.091   1.00 0.00 ? 12  ALA A HB2  10 
ATOM   10647 H  HB3  . ALA A 1 12 ? -23.891 -16.086 0.623   1.00 0.00 ? 12  ALA A HB3  10 
ATOM   10648 N  N    . GLN A 1 13 ? -21.517 -13.028 1.371   1.00 0.00 ? 13  GLN A N    10 
ATOM   10649 C  CA   . GLN A 1 13 ? -20.894 -11.804 0.881   1.00 0.00 ? 13  GLN A CA   10 
ATOM   10650 C  C    . GLN A 1 13 ? -20.611 -11.898 -0.615  1.00 0.00 ? 13  GLN A C    10 
ATOM   10651 O  O    . GLN A 1 13 ? -19.972 -12.844 -1.078  1.00 0.00 ? 13  GLN A O    10 
ATOM   10652 C  CB   . GLN A 1 13 ? -19.595 -11.528 1.641   1.00 0.00 ? 13  GLN A CB   10 
ATOM   10653 C  CG   . GLN A 1 13 ? -18.440 -12.420 1.215   1.00 0.00 ? 13  GLN A CG   10 
ATOM   10654 C  CD   . GLN A 1 13 ? -18.720 -13.891 1.453   1.00 0.00 ? 13  GLN A CD   10 
ATOM   10655 O  OE1  . GLN A 1 13 ? -18.724 -14.357 2.593   1.00 0.00 ? 13  GLN A OE1  10 
ATOM   10656 N  NE2  . GLN A 1 13 ? -18.955 -14.631 0.376   1.00 0.00 ? 13  GLN A NE2  10 
ATOM   10657 H  H    . GLN A 1 13 ? -20.949 -13.765 1.675   1.00 0.00 ? 13  GLN A H    10 
ATOM   10658 H  HA   . GLN A 1 13 ? -21.581 -10.990 1.054   1.00 0.00 ? 13  GLN A HA   10 
ATOM   10659 H  HB2  . GLN A 1 13 ? -19.308 -10.500 1.478   1.00 0.00 ? 13  GLN A HB2  10 
ATOM   10660 H  HB3  . GLN A 1 13 ? -19.770 -11.682 2.696   1.00 0.00 ? 13  GLN A HB3  10 
ATOM   10661 H  HG2  . GLN A 1 13 ? -18.256 -12.270 0.162   1.00 0.00 ? 13  GLN A HG2  10 
ATOM   10662 H  HG3  . GLN A 1 13 ? -17.561 -12.140 1.777   1.00 0.00 ? 13  GLN A HG3  10 
ATOM   10663 H  HE21 . GLN A 1 13 ? -18.933 -14.191 -0.500  1.00 0.00 ? 13  GLN A HE21 10 
ATOM   10664 H  HE22 . GLN A 1 13 ? -19.138 -15.584 0.500   1.00 0.00 ? 13  GLN A HE22 10 
ATOM   10665 N  N    . LYS A 1 14 ? -21.091 -10.913 -1.366  1.00 0.00 ? 14  LYS A N    10 
ATOM   10666 C  CA   . LYS A 1 14 ? -20.889 -10.883 -2.810  1.00 0.00 ? 14  LYS A CA   10 
ATOM   10667 C  C    . LYS A 1 14 ? -19.945 -9.752  -3.204  1.00 0.00 ? 14  LYS A C    10 
ATOM   10668 O  O    . LYS A 1 14 ? -19.898 -9.346  -4.366  1.00 0.00 ? 14  LYS A O    10 
ATOM   10669 C  CB   . LYS A 1 14 ? -22.230 -10.717 -3.529  1.00 0.00 ? 14  LYS A CB   10 
ATOM   10670 C  CG   . LYS A 1 14 ? -23.216 -9.837  -2.781  1.00 0.00 ? 14  LYS A CG   10 
ATOM   10671 C  CD   . LYS A 1 14 ? -24.539 -9.728  -3.522  1.00 0.00 ? 14  LYS A CD   10 
ATOM   10672 C  CE   . LYS A 1 14 ? -25.359 -8.547  -3.026  1.00 0.00 ? 14  LYS A CE   10 
ATOM   10673 N  NZ   . LYS A 1 14 ? -26.820 -8.772  -3.208  1.00 0.00 ? 14  LYS A NZ   10 
ATOM   10674 H  H    . LYS A 1 14 ? -21.592 -10.187 -0.938  1.00 0.00 ? 14  LYS A H    10 
ATOM   10675 H  HA   . LYS A 1 14 ? -20.447 -11.824 -3.103  1.00 0.00 ? 14  LYS A HA   10 
ATOM   10676 H  HB2  . LYS A 1 14 ? -22.052 -10.279 -4.500  1.00 0.00 ? 14  LYS A HB2  10 
ATOM   10677 H  HB3  . LYS A 1 14 ? -22.677 -11.692 -3.660  1.00 0.00 ? 14  LYS A HB3  10 
ATOM   10678 H  HG2  . LYS A 1 14 ? -23.397 -10.262 -1.805  1.00 0.00 ? 14  LYS A HG2  10 
ATOM   10679 H  HG3  . LYS A 1 14 ? -22.793 -8.849  -2.673  1.00 0.00 ? 14  LYS A HG3  10 
ATOM   10680 H  HD2  . LYS A 1 14 ? -24.342 -9.598  -4.576  1.00 0.00 ? 14  LYS A HD2  10 
ATOM   10681 H  HD3  . LYS A 1 14 ? -25.103 -10.637 -3.368  1.00 0.00 ? 14  LYS A HD3  10 
ATOM   10682 H  HE2  . LYS A 1 14 ? -25.155 -8.398  -1.977  1.00 0.00 ? 14  LYS A HE2  10 
ATOM   10683 H  HE3  . LYS A 1 14 ? -25.068 -7.666  -3.579  1.00 0.00 ? 14  LYS A HE3  10 
ATOM   10684 H  HZ1  . LYS A 1 14 ? -27.318 -8.630  -2.306  1.00 0.00 ? 14  LYS A HZ1  10 
ATOM   10685 H  HZ2  . LYS A 1 14 ? -26.994 -9.743  -3.538  1.00 0.00 ? 14  LYS A HZ2  10 
ATOM   10686 H  HZ3  . LYS A 1 14 ? -27.200 -8.105  -3.910  1.00 0.00 ? 14  LYS A HZ3  10 
ATOM   10687 N  N    . LEU A 1 15 ? -19.194 -9.248  -2.231  1.00 0.00 ? 15  LEU A N    10 
ATOM   10688 C  CA   . LEU A 1 15 ? -18.249 -8.164  -2.477  1.00 0.00 ? 15  LEU A CA   10 
ATOM   10689 C  C    . LEU A 1 15 ? -16.928 -8.420  -1.759  1.00 0.00 ? 15  LEU A C    10 
ATOM   10690 O  O    . LEU A 1 15 ? -16.888 -8.968  -0.657  1.00 0.00 ? 15  LEU A O    10 
ATOM   10691 C  CB   . LEU A 1 15 ? -18.842 -6.831  -2.020  1.00 0.00 ? 15  LEU A CB   10 
ATOM   10692 C  CG   . LEU A 1 15 ? -20.232 -6.492  -2.561  1.00 0.00 ? 15  LEU A CG   10 
ATOM   10693 C  CD1  . LEU A 1 15 ? -20.807 -5.284  -1.839  1.00 0.00 ? 15  LEU A CD1  10 
ATOM   10694 C  CD2  . LEU A 1 15 ? -20.173 -6.242  -4.061  1.00 0.00 ? 15  LEU A CD2  10 
ATOM   10695 H  H    . LEU A 1 15 ? -19.276 -9.613  -1.326  1.00 0.00 ? 15  LEU A H    10 
ATOM   10696 H  HA   . LEU A 1 15 ? -18.065 -8.121  -3.540  1.00 0.00 ? 15  LEU A HA   10 
ATOM   10697 H  HB2  . LEU A 1 15 ? -18.903 -6.848  -0.942  1.00 0.00 ? 15  LEU A HB2  10 
ATOM   10698 H  HB3  . LEU A 1 15 ? -18.166 -6.046  -2.327  1.00 0.00 ? 15  LEU A HB3  10 
ATOM   10699 H  HG   . LEU A 1 15 ? -20.893 -7.330  -2.387  1.00 0.00 ? 15  LEU A HG   10 
ATOM   10700 H  HD11 . LEU A 1 15 ? -20.003 -4.704  -1.411  1.00 0.00 ? 15  LEU A HD11 10 
ATOM   10701 H  HD12 . LEU A 1 15 ? -21.469 -5.615  -1.053  1.00 0.00 ? 15  LEU A HD12 10 
ATOM   10702 H  HD13 . LEU A 1 15 ? -21.357 -4.674  -2.540  1.00 0.00 ? 15  LEU A HD13 10 
ATOM   10703 H  HD21 . LEU A 1 15 ? -19.838 -7.138  -4.562  1.00 0.00 ? 15  LEU A HD21 10 
ATOM   10704 H  HD22 . LEU A 1 15 ? -19.482 -5.436  -4.264  1.00 0.00 ? 15  LEU A HD22 10 
ATOM   10705 H  HD23 . LEU A 1 15 ? -21.155 -5.973  -4.420  1.00 0.00 ? 15  LEU A HD23 10 
ATOM   10706 N  N    . PRO A 1 16 ? -15.820 -8.011  -2.395  1.00 0.00 ? 16  PRO A N    10 
ATOM   10707 C  CA   . PRO A 1 16 ? -14.477 -8.183  -1.833  1.00 0.00 ? 16  PRO A CA   10 
ATOM   10708 C  C    . PRO A 1 16 ? -14.234 -7.284  -0.626  1.00 0.00 ? 16  PRO A C    10 
ATOM   10709 O  O    . PRO A 1 16 ? -13.964 -6.092  -0.773  1.00 0.00 ? 16  PRO A O    10 
ATOM   10710 C  CB   . PRO A 1 16 ? -13.556 -7.786  -2.990  1.00 0.00 ? 16  PRO A CB   10 
ATOM   10711 C  CG   . PRO A 1 16 ? -14.375 -6.865  -3.827  1.00 0.00 ? 16  PRO A CG   10 
ATOM   10712 C  CD   . PRO A 1 16 ? -15.793 -7.350  -3.710  1.00 0.00 ? 16  PRO A CD   10 
ATOM   10713 H  HA   . PRO A 1 16 ? -14.290 -9.211  -1.559  1.00 0.00 ? 16  PRO A HA   10 
ATOM   10714 H  HB2  . PRO A 1 16 ? -12.677 -7.291  -2.600  1.00 0.00 ? 16  PRO A HB2  10 
ATOM   10715 H  HB3  . PRO A 1 16 ? -13.265 -8.667  -3.542  1.00 0.00 ? 16  PRO A HB3  10 
ATOM   10716 H  HG2  . PRO A 1 16 ? -14.291 -5.857  -3.453  1.00 0.00 ? 16  PRO A HG2  10 
ATOM   10717 H  HG3  . PRO A 1 16 ? -14.046 -6.915  -4.855  1.00 0.00 ? 16  PRO A HG3  10 
ATOM   10718 H  HD2  . PRO A 1 16 ? -16.480 -6.517  -3.737  1.00 0.00 ? 16  PRO A HD2  10 
ATOM   10719 H  HD3  . PRO A 1 16 ? -16.018 -8.053  -4.499  1.00 0.00 ? 16  PRO A HD3  10 
ATOM   10720 N  N    . MET A 1 17 ? -14.331 -7.863  0.566   1.00 0.00 ? 17  MET A N    10 
ATOM   10721 C  CA   . MET A 1 17 ? -14.120 -7.113  1.799   1.00 0.00 ? 17  MET A CA   10 
ATOM   10722 C  C    . MET A 1 17 ? -12.721 -6.506  1.833   1.00 0.00 ? 17  MET A C    10 
ATOM   10723 O  O    . MET A 1 17 ? -11.726 -7.201  1.623   1.00 0.00 ? 17  MET A O    10 
ATOM   10724 C  CB   . MET A 1 17 ? -14.325 -8.019  3.014   1.00 0.00 ? 17  MET A CB   10 
ATOM   10725 C  CG   . MET A 1 17 ? -15.755 -8.031  3.529   1.00 0.00 ? 17  MET A CG   10 
ATOM   10726 S  SD   . MET A 1 17 ? -15.868 -8.552  5.252   1.00 0.00 ? 17  MET A SD   10 
ATOM   10727 C  CE   . MET A 1 17 ? -16.848 -7.222  5.943   1.00 0.00 ? 17  MET A CE   10 
ATOM   10728 H  H    . MET A 1 17 ? -14.549 -8.817  0.619   1.00 0.00 ? 17  MET A H    10 
ATOM   10729 H  HA   . MET A 1 17 ? -14.847 -6.315  1.830   1.00 0.00 ? 17  MET A HA   10 
ATOM   10730 H  HB2  . MET A 1 17 ? -14.053 -9.029  2.745   1.00 0.00 ? 17  MET A HB2  10 
ATOM   10731 H  HB3  . MET A 1 17 ? -13.681 -7.682  3.813   1.00 0.00 ? 17  MET A HB3  10 
ATOM   10732 H  HG2  . MET A 1 17 ? -16.163 -7.036  3.442   1.00 0.00 ? 17  MET A HG2  10 
ATOM   10733 H  HG3  . MET A 1 17 ? -16.335 -8.711  2.922   1.00 0.00 ? 17  MET A HG3  10 
ATOM   10734 H  HE1  . MET A 1 17 ? -16.455 -6.273  5.609   1.00 0.00 ? 17  MET A HE1  10 
ATOM   10735 H  HE2  . MET A 1 17 ? -17.872 -7.322  5.617   1.00 0.00 ? 17  MET A HE2  10 
ATOM   10736 H  HE3  . MET A 1 17 ? -16.807 -7.268  7.022   1.00 0.00 ? 17  MET A HE3  10 
ATOM   10737 N  N    . CYS A 1 18 ? -12.651 -5.205  2.097   1.00 0.00 ? 18  CYS A N    10 
ATOM   10738 C  CA   . CYS A 1 18 ? -11.375 -4.504  2.158   1.00 0.00 ? 18  CYS A CA   10 
ATOM   10739 C  C    . CYS A 1 18 ? -10.424 -5.188  3.137   1.00 0.00 ? 18  CYS A C    10 
ATOM   10740 O  O    . CYS A 1 18 ? -10.852 -5.953  4.002   1.00 0.00 ? 18  CYS A O    10 
ATOM   10741 C  CB   . CYS A 1 18 ? -11.589 -3.046  2.572   1.00 0.00 ? 18  CYS A CB   10 
ATOM   10742 S  SG   . CYS A 1 18 ? -10.101 -2.006  2.424   1.00 0.00 ? 18  CYS A SG   10 
ATOM   10743 H  H    . CYS A 1 18 ? -13.480 -4.704  2.256   1.00 0.00 ? 18  CYS A H    10 
ATOM   10744 H  HA   . CYS A 1 18 ? -10.935 -4.528  1.172   1.00 0.00 ? 18  CYS A HA   10 
ATOM   10745 H  HB2  . CYS A 1 18 ? -12.356 -2.612  1.947   1.00 0.00 ? 18  CYS A HB2  10 
ATOM   10746 H  HB3  . CYS A 1 18 ? -11.911 -3.016  3.602   1.00 0.00 ? 18  CYS A HB3  10 
ATOM   10747 N  N    . ASP A 1 19 ? -9.134  -4.906  2.994   1.00 0.00 ? 19  ASP A N    10 
ATOM   10748 C  CA   . ASP A 1 19 ? -8.123  -5.492  3.866   1.00 0.00 ? 19  ASP A CA   10 
ATOM   10749 C  C    . ASP A 1 19 ? -7.757  -4.534  4.995   1.00 0.00 ? 19  ASP A C    10 
ATOM   10750 O  O    . ASP A 1 19 ? -7.831  -4.888  6.172   1.00 0.00 ? 19  ASP A O    10 
ATOM   10751 C  CB   . ASP A 1 19 ? -6.872  -5.853  3.062   1.00 0.00 ? 19  ASP A CB   10 
ATOM   10752 C  CG   . ASP A 1 19 ? -5.752  -6.379  3.938   1.00 0.00 ? 19  ASP A CG   10 
ATOM   10753 O  OD1  . ASP A 1 19 ? -6.047  -7.139  4.883   1.00 0.00 ? 19  ASP A OD1  10 
ATOM   10754 O  OD2  . ASP A 1 19 ? -4.582  -6.029  3.678   1.00 0.00 ? 19  ASP A OD2  10 
ATOM   10755 H  H    . ASP A 1 19 ? -8.855  -4.289  2.286   1.00 0.00 ? 19  ASP A H    10 
ATOM   10756 H  HA   . ASP A 1 19 ? -8.536  -6.393  4.294   1.00 0.00 ? 19  ASP A HA   10 
ATOM   10757 H  HB2  . ASP A 1 19 ? -7.125  -6.613  2.337   1.00 0.00 ? 19  ASP A HB2  10 
ATOM   10758 H  HB3  . ASP A 1 19 ? -6.518  -4.973  2.545   1.00 0.00 ? 19  ASP A HB3  10 
ATOM   10759 N  N    . LYS A 1 20 ? -7.362  -3.319  4.629   1.00 0.00 ? 20  LYS A N    10 
ATOM   10760 C  CA   . LYS A 1 20 ? -6.985  -2.309  5.611   1.00 0.00 ? 20  LYS A CA   10 
ATOM   10761 C  C    . LYS A 1 20 ? -8.058  -2.168  6.686   1.00 0.00 ? 20  LYS A C    10 
ATOM   10762 O  O    . LYS A 1 20 ? -7.806  -2.420  7.865   1.00 0.00 ? 20  LYS A O    10 
ATOM   10763 C  CB   . LYS A 1 20 ? -6.757  -0.961  4.923   1.00 0.00 ? 20  LYS A CB   10 
ATOM   10764 C  CG   . LYS A 1 20 ? -6.342  0.146   5.877   1.00 0.00 ? 20  LYS A CG   10 
ATOM   10765 C  CD   . LYS A 1 20 ? -7.538  0.962   6.339   1.00 0.00 ? 20  LYS A CD   10 
ATOM   10766 C  CE   . LYS A 1 20 ? -7.104  2.188   7.127   1.00 0.00 ? 20  LYS A CE   10 
ATOM   10767 N  NZ   . LYS A 1 20 ? -8.206  3.182   7.256   1.00 0.00 ? 20  LYS A NZ   10 
ATOM   10768 H  H    . LYS A 1 20 ? -7.324  -3.097  3.675   1.00 0.00 ? 20  LYS A H    10 
ATOM   10769 H  HA   . LYS A 1 20 ? -6.065  -2.626  6.076   1.00 0.00 ? 20  LYS A HA   10 
ATOM   10770 H  HB2  . LYS A 1 20 ? -5.983  -1.076  4.179   1.00 0.00 ? 20  LYS A HB2  10 
ATOM   10771 H  HB3  . LYS A 1 20 ? -7.673  -0.661  4.434   1.00 0.00 ? 20  LYS A HB3  10 
ATOM   10772 H  HG2  . LYS A 1 20 ? -5.865  -0.295  6.740   1.00 0.00 ? 20  LYS A HG2  10 
ATOM   10773 H  HG3  . LYS A 1 20 ? -5.644  0.800   5.373   1.00 0.00 ? 20  LYS A HG3  10 
ATOM   10774 H  HD2  . LYS A 1 20 ? -8.099  1.283   5.475   1.00 0.00 ? 20  LYS A HD2  10 
ATOM   10775 H  HD3  . LYS A 1 20 ? -8.163  0.343   6.968   1.00 0.00 ? 20  LYS A HD3  10 
ATOM   10776 H  HE2  . LYS A 1 20 ? -6.795  1.876   8.113   1.00 0.00 ? 20  LYS A HE2  10 
ATOM   10777 H  HE3  . LYS A 1 20 ? -6.271  2.651   6.618   1.00 0.00 ? 20  LYS A HE3  10 
ATOM   10778 H  HZ1  . LYS A 1 20 ? -8.781  2.970   8.097   1.00 0.00 ? 20  LYS A HZ1  10 
ATOM   10779 H  HZ2  . LYS A 1 20 ? -8.816  3.150   6.415   1.00 0.00 ? 20  LYS A HZ2  10 
ATOM   10780 H  HZ3  . LYS A 1 20 ? -7.813  4.140   7.350   1.00 0.00 ? 20  LYS A HZ3  10 
ATOM   10781 N  N    . CYS A 1 21 ? -9.255  -1.765  6.273   1.00 0.00 ? 21  CYS A N    10 
ATOM   10782 C  CA   . CYS A 1 21 ? -10.366 -1.592  7.200   1.00 0.00 ? 21  CYS A CA   10 
ATOM   10783 C  C    . CYS A 1 21 ? -11.131 -2.900  7.383   1.00 0.00 ? 21  CYS A C    10 
ATOM   10784 O  O    . CYS A 1 21 ? -11.151 -3.471  8.472   1.00 0.00 ? 21  CYS A O    10 
ATOM   10785 C  CB   . CYS A 1 21 ? -11.313 -0.501  6.695   1.00 0.00 ? 21  CYS A CB   10 
ATOM   10786 S  SG   . CYS A 1 21 ? -11.554 -0.503  4.889   1.00 0.00 ? 21  CYS A SG   10 
ATOM   10787 H  H    . CYS A 1 21 ? -9.394  -1.579  5.319   1.00 0.00 ? 21  CYS A H    10 
ATOM   10788 H  HA   . CYS A 1 21 ? -9.959  -1.290  8.153   1.00 0.00 ? 21  CYS A HA   10 
ATOM   10789 H  HB2  . CYS A 1 21 ? -12.282 -0.635  7.155   1.00 0.00 ? 21  CYS A HB2  10 
ATOM   10790 H  HB3  . CYS A 1 21 ? -10.919 0.465   6.974   1.00 0.00 ? 21  CYS A HB3  10 
ATOM   10791 N  N    . GLY A 1 22 ? -11.758 -3.368  6.309   1.00 0.00 ? 22  GLY A N    10 
ATOM   10792 C  CA   . GLY A 1 22 ? -12.515 -4.604  6.372   1.00 0.00 ? 22  GLY A CA   10 
ATOM   10793 C  C    . GLY A 1 22 ? -13.992 -4.395  6.099   1.00 0.00 ? 22  GLY A C    10 
ATOM   10794 O  O    . GLY A 1 22 ? -14.843 -4.842  6.868   1.00 0.00 ? 22  GLY A O    10 
ATOM   10795 H  H    . GLY A 1 22 ? -11.707 -2.869  5.466   1.00 0.00 ? 22  GLY A H    10 
ATOM   10796 H  HA2  . GLY A 1 22 ? -12.119 -5.294  5.641   1.00 0.00 ? 22  GLY A HA2  10 
ATOM   10797 H  HA3  . GLY A 1 22 ? -12.400 -5.033  7.356   1.00 0.00 ? 22  GLY A HA3  10 
ATOM   10798 N  N    . THR A 1 23 ? -14.298 -3.712  5.000   1.00 0.00 ? 23  THR A N    10 
ATOM   10799 C  CA   . THR A 1 23 ? -15.681 -3.441  4.629   1.00 0.00 ? 23  THR A CA   10 
ATOM   10800 C  C    . THR A 1 23 ? -15.945 -3.820  3.177   1.00 0.00 ? 23  THR A C    10 
ATOM   10801 O  O    . THR A 1 23 ? -15.186 -3.452  2.281   1.00 0.00 ? 23  THR A O    10 
ATOM   10802 C  CB   . THR A 1 23 ? -16.038 -1.957  4.833   1.00 0.00 ? 23  THR A CB   10 
ATOM   10803 O  OG1  . THR A 1 23 ? -15.196 -1.134  4.017   1.00 0.00 ? 23  THR A OG1  10 
ATOM   10804 C  CG2  . THR A 1 23 ? -15.882 -1.558  6.293   1.00 0.00 ? 23  THR A CG2  10 
ATOM   10805 H  H    . THR A 1 23 ? -13.575 -3.382  4.427   1.00 0.00 ? 23  THR A H    10 
ATOM   10806 H  HA   . THR A 1 23 ? -16.320 -4.034  5.268   1.00 0.00 ? 23  THR A HA   10 
ATOM   10807 H  HB   . THR A 1 23 ? -17.067 -1.806  4.542   1.00 0.00 ? 23  THR A HB   10 
ATOM   10808 H  HG1  . THR A 1 23 ? -14.442 -1.647  3.717   1.00 0.00 ? 23  THR A HG1  10 
ATOM   10809 H  HG21 . THR A 1 23 ? -16.726 -1.924  6.858   1.00 0.00 ? 23  THR A HG21 10 
ATOM   10810 H  HG22 . THR A 1 23 ? -15.836 -0.482  6.370   1.00 0.00 ? 23  THR A HG22 10 
ATOM   10811 H  HG23 . THR A 1 23 ? -14.973 -1.987  6.688   1.00 0.00 ? 23  THR A HG23 10 
ATOM   10812 N  N    . GLY A 1 24 ? -17.027 -4.559  2.950   1.00 0.00 ? 24  GLY A N    10 
ATOM   10813 C  CA   . GLY A 1 24 ? -17.372 -4.975  1.603   1.00 0.00 ? 24  GLY A CA   10 
ATOM   10814 C  C    . GLY A 1 24 ? -17.210 -3.858  0.592   1.00 0.00 ? 24  GLY A C    10 
ATOM   10815 O  O    . GLY A 1 24 ? -18.003 -2.916  0.566   1.00 0.00 ? 24  GLY A O    10 
ATOM   10816 H  H    . GLY A 1 24 ? -17.596 -4.824  3.703   1.00 0.00 ? 24  GLY A H    10 
ATOM   10817 H  HA2  . GLY A 1 24 ? -16.735 -5.799  1.318   1.00 0.00 ? 24  GLY A HA2  10 
ATOM   10818 H  HA3  . GLY A 1 24 ? -18.399 -5.308  1.593   1.00 0.00 ? 24  GLY A HA3  10 
ATOM   10819 N  N    . ILE A 1 25 ? -16.181 -3.961  -0.242  1.00 0.00 ? 25  ILE A N    10 
ATOM   10820 C  CA   . ILE A 1 25 ? -15.919 -2.950  -1.260  1.00 0.00 ? 25  ILE A CA   10 
ATOM   10821 C  C    . ILE A 1 25 ? -17.036 -2.911  -2.297  1.00 0.00 ? 25  ILE A C    10 
ATOM   10822 O  O    . ILE A 1 25 ? -17.640 -3.936  -2.613  1.00 0.00 ? 25  ILE A O    10 
ATOM   10823 C  CB   . ILE A 1 25 ? -14.578 -3.205  -1.974  1.00 0.00 ? 25  ILE A CB   10 
ATOM   10824 C  CG1  . ILE A 1 25 ? -13.442 -3.304  -0.954  1.00 0.00 ? 25  ILE A CG1  10 
ATOM   10825 C  CG2  . ILE A 1 25 ? -14.298 -2.102  -2.984  1.00 0.00 ? 25  ILE A CG2  10 
ATOM   10826 C  CD1  . ILE A 1 25 ? -12.196 -3.964  -1.500  1.00 0.00 ? 25  ILE A CD1  10 
ATOM   10827 H  H    . ILE A 1 25 ? -15.585 -4.735  -0.173  1.00 0.00 ? 25  ILE A H    10 
ATOM   10828 H  HA   . ILE A 1 25 ? -15.865 -1.989  -0.768  1.00 0.00 ? 25  ILE A HA   10 
ATOM   10829 H  HB   . ILE A 1 25 ? -14.654 -4.140  -2.510  1.00 0.00 ? 25  ILE A HB   10 
ATOM   10830 H  HG12 . ILE A 1 25 ? -13.175 -2.312  -0.626  1.00 0.00 ? 25  ILE A HG12 10 
ATOM   10831 H  HG13 . ILE A 1 25 ? -13.780 -3.880  -0.105  1.00 0.00 ? 25  ILE A HG13 10 
ATOM   10832 H  HG21 . ILE A 1 25 ? -13.265 -1.798  -2.906  1.00 0.00 ? 25  ILE A HG21 10 
ATOM   10833 H  HG22 . ILE A 1 25 ? -14.490 -2.470  -3.980  1.00 0.00 ? 25  ILE A HG22 10 
ATOM   10834 H  HG23 . ILE A 1 25 ? -14.938 -1.257  -2.781  1.00 0.00 ? 25  ILE A HG23 10 
ATOM   10835 H  HD11 . ILE A 1 25 ? -11.797 -3.370  -2.308  1.00 0.00 ? 25  ILE A HD11 10 
ATOM   10836 H  HD12 . ILE A 1 25 ? -11.459 -4.048  -0.715  1.00 0.00 ? 25  ILE A HD12 10 
ATOM   10837 H  HD13 . ILE A 1 25 ? -12.443 -4.950  -1.867  1.00 0.00 ? 25  ILE A HD13 10 
ATOM   10838 N  N    . VAL A 1 26 ? -17.304 -1.721  -2.826  1.00 0.00 ? 26  VAL A N    10 
ATOM   10839 C  CA   . VAL A 1 26 ? -18.346 -1.548  -3.830  1.00 0.00 ? 26  VAL A CA   10 
ATOM   10840 C  C    . VAL A 1 26 ? -17.921 -0.546  -4.897  1.00 0.00 ? 26  VAL A C    10 
ATOM   10841 O  O    . VAL A 1 26 ? -17.520 0.575   -4.586  1.00 0.00 ? 26  VAL A O    10 
ATOM   10842 C  CB   . VAL A 1 26 ? -19.666 -1.075  -3.193  1.00 0.00 ? 26  VAL A CB   10 
ATOM   10843 C  CG1  . VAL A 1 26 ? -19.486 0.287   -2.541  1.00 0.00 ? 26  VAL A CG1  10 
ATOM   10844 C  CG2  . VAL A 1 26 ? -20.775 -1.034  -4.234  1.00 0.00 ? 26  VAL A CG2  10 
ATOM   10845 H  H    . VAL A 1 26 ? -16.787 -0.941  -2.533  1.00 0.00 ? 26  VAL A H    10 
ATOM   10846 H  HA   . VAL A 1 26 ? -18.520 -2.506  -4.299  1.00 0.00 ? 26  VAL A HA   10 
ATOM   10847 H  HB   . VAL A 1 26 ? -19.947 -1.782  -2.427  1.00 0.00 ? 26  VAL A HB   10 
ATOM   10848 H  HG11 . VAL A 1 26 ? -18.557 0.302   -1.990  1.00 0.00 ? 26  VAL A HG11 10 
ATOM   10849 H  HG12 . VAL A 1 26 ? -19.466 1.052   -3.303  1.00 0.00 ? 26  VAL A HG12 10 
ATOM   10850 H  HG13 . VAL A 1 26 ? -20.307 0.473   -1.864  1.00 0.00 ? 26  VAL A HG13 10 
ATOM   10851 H  HG21 . VAL A 1 26 ? -21.255 -0.067  -4.209  1.00 0.00 ? 26  VAL A HG21 10 
ATOM   10852 H  HG22 . VAL A 1 26 ? -20.354 -1.201  -5.216  1.00 0.00 ? 26  VAL A HG22 10 
ATOM   10853 H  HG23 . VAL A 1 26 ? -21.501 -1.803  -4.019  1.00 0.00 ? 26  VAL A HG23 10 
ATOM   10854 N  N    . GLY A 1 27 ? -18.011 -0.957  -6.158  1.00 0.00 ? 27  GLY A N    10 
ATOM   10855 C  CA   . GLY A 1 27 ? -17.632 -0.083  -7.252  1.00 0.00 ? 27  GLY A CA   10 
ATOM   10856 C  C    . GLY A 1 27 ? -16.133 -0.056  -7.481  1.00 0.00 ? 27  GLY A C    10 
ATOM   10857 O  O    . GLY A 1 27 ? -15.482 -1.100  -7.499  1.00 0.00 ? 27  GLY A O    10 
ATOM   10858 H  H    . GLY A 1 27 ? -18.337 -1.862  -6.347  1.00 0.00 ? 27  GLY A H    10 
ATOM   10859 H  HA2  . GLY A 1 27 ? -18.117 -0.423  -8.155  1.00 0.00 ? 27  GLY A HA2  10 
ATOM   10860 H  HA3  . GLY A 1 27 ? -17.968 0.919   -7.031  1.00 0.00 ? 27  GLY A HA3  10 
ATOM   10861 N  N    . VAL A 1 28 ? -15.585 1.142   -7.657  1.00 0.00 ? 28  VAL A N    10 
ATOM   10862 C  CA   . VAL A 1 28 ? -14.154 1.302   -7.886  1.00 0.00 ? 28  VAL A CA   10 
ATOM   10863 C  C    . VAL A 1 28 ? -13.349 0.832   -6.680  1.00 0.00 ? 28  VAL A C    10 
ATOM   10864 O  O    . VAL A 1 28 ? -13.726 1.078   -5.534  1.00 0.00 ? 28  VAL A O    10 
ATOM   10865 C  CB   . VAL A 1 28 ? -13.794 2.768   -8.190  1.00 0.00 ? 28  VAL A CB   10 
ATOM   10866 C  CG1  . VAL A 1 28 ? -14.227 3.672   -7.047  1.00 0.00 ? 28  VAL A CG1  10 
ATOM   10867 C  CG2  . VAL A 1 28 ? -12.302 2.906   -8.454  1.00 0.00 ? 28  VAL A CG2  10 
ATOM   10868 H  H    . VAL A 1 28 ? -16.156 1.938   -7.632  1.00 0.00 ? 28  VAL A H    10 
ATOM   10869 H  HA   . VAL A 1 28 ? -13.884 0.702   -8.743  1.00 0.00 ? 28  VAL A HA   10 
ATOM   10870 H  HB   . VAL A 1 28 ? -14.325 3.071   -9.081  1.00 0.00 ? 28  VAL A HB   10 
ATOM   10871 H  HG11 . VAL A 1 28 ? -15.290 3.565   -6.886  1.00 0.00 ? 28  VAL A HG11 10 
ATOM   10872 H  HG12 . VAL A 1 28 ? -13.696 3.396   -6.148  1.00 0.00 ? 28  VAL A HG12 10 
ATOM   10873 H  HG13 . VAL A 1 28 ? -14.004 4.700   -7.296  1.00 0.00 ? 28  VAL A HG13 10 
ATOM   10874 H  HG21 . VAL A 1 28 ? -12.146 3.563   -9.298  1.00 0.00 ? 28  VAL A HG21 10 
ATOM   10875 H  HG22 . VAL A 1 28 ? -11.819 3.321   -7.582  1.00 0.00 ? 28  VAL A HG22 10 
ATOM   10876 H  HG23 . VAL A 1 28 ? -11.883 1.935   -8.671  1.00 0.00 ? 28  VAL A HG23 10 
ATOM   10877 N  N    . PHE A 1 29 ? -12.237 0.154   -6.946  1.00 0.00 ? 29  PHE A N    10 
ATOM   10878 C  CA   . PHE A 1 29 ? -11.377 -0.352  -5.882  1.00 0.00 ? 29  PHE A CA   10 
ATOM   10879 C  C    . PHE A 1 29 ? -10.030 -0.802  -6.439  1.00 0.00 ? 29  PHE A C    10 
ATOM   10880 O  O    . PHE A 1 29 ? -9.899  -1.078  -7.632  1.00 0.00 ? 29  PHE A O    10 
ATOM   10881 C  CB   . PHE A 1 29 ? -12.057 -1.515  -5.158  1.00 0.00 ? 29  PHE A CB   10 
ATOM   10882 C  CG   . PHE A 1 29 ? -12.278 -2.717  -6.031  1.00 0.00 ? 29  PHE A CG   10 
ATOM   10883 C  CD1  . PHE A 1 29 ? -11.212 -3.507  -6.429  1.00 0.00 ? 29  PHE A CD1  10 
ATOM   10884 C  CD2  . PHE A 1 29 ? -13.553 -3.057  -6.454  1.00 0.00 ? 29  PHE A CD2  10 
ATOM   10885 C  CE1  . PHE A 1 29 ? -11.412 -4.614  -7.232  1.00 0.00 ? 29  PHE A CE1  10 
ATOM   10886 C  CE2  . PHE A 1 29 ? -13.760 -4.163  -7.256  1.00 0.00 ? 29  PHE A CE2  10 
ATOM   10887 C  CZ   . PHE A 1 29 ? -12.688 -4.942  -7.647  1.00 0.00 ? 29  PHE A CZ   10 
ATOM   10888 H  H    . PHE A 1 29 ? -11.989 -0.011  -7.880  1.00 0.00 ? 29  PHE A H    10 
ATOM   10889 H  HA   . PHE A 1 29 ? -11.213 0.451   -5.180  1.00 0.00 ? 29  PHE A HA   10 
ATOM   10890 H  HB2  . PHE A 1 29 ? -11.442 -1.820  -4.324  1.00 0.00 ? 29  PHE A HB2  10 
ATOM   10891 H  HB3  . PHE A 1 29 ? -13.018 -1.189  -4.790  1.00 0.00 ? 29  PHE A HB3  10 
ATOM   10892 H  HD1  . PHE A 1 29 ? -10.213 -3.251  -6.105  1.00 0.00 ? 29  PHE A HD1  10 
ATOM   10893 H  HD2  . PHE A 1 29 ? -14.393 -2.449  -6.150  1.00 0.00 ? 29  PHE A HD2  10 
ATOM   10894 H  HE1  . PHE A 1 29 ? -10.572 -5.220  -7.536  1.00 0.00 ? 29  PHE A HE1  10 
ATOM   10895 H  HE2  . PHE A 1 29 ? -14.758 -4.417  -7.580  1.00 0.00 ? 29  PHE A HE2  10 
ATOM   10896 H  HZ   . PHE A 1 29 ? -12.847 -5.806  -8.274  1.00 0.00 ? 29  PHE A HZ   10 
ATOM   10897 N  N    . VAL A 1 30 ? -9.029  -0.873  -5.566  1.00 0.00 ? 30  VAL A N    10 
ATOM   10898 C  CA   . VAL A 1 30 ? -7.692  -1.290  -5.970  1.00 0.00 ? 30  VAL A CA   10 
ATOM   10899 C  C    . VAL A 1 30 ? -7.525  -2.800  -5.842  1.00 0.00 ? 30  VAL A C    10 
ATOM   10900 O  O    . VAL A 1 30 ? -7.345  -3.325  -4.744  1.00 0.00 ? 30  VAL A O    10 
ATOM   10901 C  CB   . VAL A 1 30 ? -6.608  -0.592  -5.126  1.00 0.00 ? 30  VAL A CB   10 
ATOM   10902 C  CG1  . VAL A 1 30 ? -5.225  -1.093  -5.513  1.00 0.00 ? 30  VAL A CG1  10 
ATOM   10903 C  CG2  . VAL A 1 30 ? -6.700  0.918   -5.285  1.00 0.00 ? 30  VAL A CG2  10 
ATOM   10904 H  H    . VAL A 1 30 ? -9.195  -0.640  -4.629  1.00 0.00 ? 30  VAL A H    10 
ATOM   10905 H  HA   . VAL A 1 30 ? -7.551  -1.007  -7.003  1.00 0.00 ? 30  VAL A HA   10 
ATOM   10906 H  HB   . VAL A 1 30 ? -6.777  -0.834  -4.087  1.00 0.00 ? 30  VAL A HB   10 
ATOM   10907 H  HG11 . VAL A 1 30 ? -5.229  -1.395  -6.550  1.00 0.00 ? 30  VAL A HG11 10 
ATOM   10908 H  HG12 . VAL A 1 30 ? -4.502  -0.303  -5.369  1.00 0.00 ? 30  VAL A HG12 10 
ATOM   10909 H  HG13 . VAL A 1 30 ? -4.963  -1.938  -4.893  1.00 0.00 ? 30  VAL A HG13 10 
ATOM   10910 H  HG21 . VAL A 1 30 ? -6.710  1.169   -6.336  1.00 0.00 ? 30  VAL A HG21 10 
ATOM   10911 H  HG22 . VAL A 1 30 ? -7.609  1.275   -4.822  1.00 0.00 ? 30  VAL A HG22 10 
ATOM   10912 H  HG23 . VAL A 1 30 ? -5.849  1.384   -4.812  1.00 0.00 ? 30  VAL A HG23 10 
ATOM   10913 N  N    . LYS A 1 31 ? -7.585  -3.493  -6.974  1.00 0.00 ? 31  LYS A N    10 
ATOM   10914 C  CA   . LYS A 1 31 ? -7.439  -4.944  -6.991  1.00 0.00 ? 31  LYS A CA   10 
ATOM   10915 C  C    . LYS A 1 31 ? -5.978  -5.346  -6.817  1.00 0.00 ? 31  LYS A C    10 
ATOM   10916 O  O    . LYS A 1 31 ? -5.166  -5.182  -7.728  1.00 0.00 ? 31  LYS A O    10 
ATOM   10917 C  CB   . LYS A 1 31 ? -7.984  -5.517  -8.302  1.00 0.00 ? 31  LYS A CB   10 
ATOM   10918 C  CG   . LYS A 1 31 ? -8.316  -6.997  -8.227  1.00 0.00 ? 31  LYS A CG   10 
ATOM   10919 C  CD   . LYS A 1 31 ? -7.082  -7.857  -8.441  1.00 0.00 ? 31  LYS A CD   10 
ATOM   10920 C  CE   . LYS A 1 31 ? -7.359  -9.318  -8.122  1.00 0.00 ? 31  LYS A CE   10 
ATOM   10921 N  NZ   . LYS A 1 31 ? -8.094  -9.997  -9.225  1.00 0.00 ? 31  LYS A NZ   10 
ATOM   10922 H  H    . LYS A 1 31 ? -7.731  -3.018  -7.819  1.00 0.00 ? 31  LYS A H    10 
ATOM   10923 H  HA   . LYS A 1 31 ? -8.011  -5.345  -6.168  1.00 0.00 ? 31  LYS A HA   10 
ATOM   10924 H  HB2  . LYS A 1 31 ? -8.882  -4.980  -8.569  1.00 0.00 ? 31  LYS A HB2  10 
ATOM   10925 H  HB3  . LYS A 1 31 ? -7.245  -5.374  -9.077  1.00 0.00 ? 31  LYS A HB3  10 
ATOM   10926 H  HG2  . LYS A 1 31 ? -8.730  -7.215  -7.254  1.00 0.00 ? 31  LYS A HG2  10 
ATOM   10927 H  HG3  . LYS A 1 31 ? -9.044  -7.232  -8.991  1.00 0.00 ? 31  LYS A HG3  10 
ATOM   10928 H  HD2  . LYS A 1 31 ? -6.772  -7.778  -9.472  1.00 0.00 ? 31  LYS A HD2  10 
ATOM   10929 H  HD3  . LYS A 1 31 ? -6.290  -7.501  -7.797  1.00 0.00 ? 31  LYS A HD3  10 
ATOM   10930 H  HE2  . LYS A 1 31 ? -6.418  -9.823  -7.963  1.00 0.00 ? 31  LYS A HE2  10 
ATOM   10931 H  HE3  . LYS A 1 31 ? -7.952  -9.370  -7.221  1.00 0.00 ? 31  LYS A HE3  10 
ATOM   10932 H  HZ1  . LYS A 1 31 ? -9.044  -10.271 -8.905  1.00 0.00 ? 31  LYS A HZ1  10 
ATOM   10933 H  HZ2  . LYS A 1 31 ? -7.581  -10.851 -9.524  1.00 0.00 ? 31  LYS A HZ2  10 
ATOM   10934 H  HZ3  . LYS A 1 31 ? -8.184  -9.357  -10.041 1.00 0.00 ? 31  LYS A HZ3  10 
ATOM   10935 N  N    . LEU A 1 32 ? -5.651  -5.874  -5.643  1.00 0.00 ? 32  LEU A N    10 
ATOM   10936 C  CA   . LEU A 1 32 ? -4.287  -6.301  -5.350  1.00 0.00 ? 32  LEU A CA   10 
ATOM   10937 C  C    . LEU A 1 32 ? -4.017  -7.690  -5.920  1.00 0.00 ? 32  LEU A C    10 
ATOM   10938 O  O    . LEU A 1 32 ? -4.943  -8.407  -6.298  1.00 0.00 ? 32  LEU A O    10 
ATOM   10939 C  CB   . LEU A 1 32 ? -4.045  -6.302  -3.839  1.00 0.00 ? 32  LEU A CB   10 
ATOM   10940 C  CG   . LEU A 1 32 ? -3.755  -4.941  -3.205  1.00 0.00 ? 32  LEU A CG   10 
ATOM   10941 C  CD1  . LEU A 1 32 ? -3.635  -5.071  -1.695  1.00 0.00 ? 32  LEU A CD1  10 
ATOM   10942 C  CD2  . LEU A 1 32 ? -2.487  -4.339  -3.793  1.00 0.00 ? 32  LEU A CD2  10 
ATOM   10943 H  H    . LEU A 1 32 ? -6.341  -5.980  -4.956  1.00 0.00 ? 32  LEU A H    10 
ATOM   10944 H  HA   . LEU A 1 32 ? -3.612  -5.597  -5.813  1.00 0.00 ? 32  LEU A HA   10 
ATOM   10945 H  HB2  . LEU A 1 32 ? -4.925  -6.707  -3.364  1.00 0.00 ? 32  LEU A HB2  10 
ATOM   10946 H  HB3  . LEU A 1 32 ? -3.202  -6.948  -3.640  1.00 0.00 ? 32  LEU A HB3  10 
ATOM   10947 H  HG   . LEU A 1 32 ? -4.575  -4.270  -3.418  1.00 0.00 ? 32  LEU A HG   10 
ATOM   10948 H  HD11 . LEU A 1 32 ? -2.875  -4.394  -1.334  1.00 0.00 ? 32  LEU A HD11 10 
ATOM   10949 H  HD12 . LEU A 1 32 ? -3.362  -6.085  -1.441  1.00 0.00 ? 32  LEU A HD12 10 
ATOM   10950 H  HD13 . LEU A 1 32 ? -4.582  -4.828  -1.236  1.00 0.00 ? 32  LEU A HD13 10 
ATOM   10951 H  HD21 . LEU A 1 32 ? -2.074  -3.623  -3.098  1.00 0.00 ? 32  LEU A HD21 10 
ATOM   10952 H  HD22 . LEU A 1 32 ? -2.723  -3.842  -4.723  1.00 0.00 ? 32  LEU A HD22 10 
ATOM   10953 H  HD23 . LEU A 1 32 ? -1.767  -5.122  -3.975  1.00 0.00 ? 32  LEU A HD23 10 
ATOM   10954 N  N    . ARG A 1 33 ? -2.742  -8.063  -5.978  1.00 0.00 ? 33  ARG A N    10 
ATOM   10955 C  CA   . ARG A 1 33 ? -2.350  -9.366  -6.501  1.00 0.00 ? 33  ARG A CA   10 
ATOM   10956 C  C    . ARG A 1 33 ? -3.420  -10.414 -6.207  1.00 0.00 ? 33  ARG A C    10 
ATOM   10957 O  O    . ARG A 1 33 ? -4.170  -10.815 -7.097  1.00 0.00 ? 33  ARG A O    10 
ATOM   10958 C  CB   . ARG A 1 33 ? -1.015  -9.801  -5.896  1.00 0.00 ? 33  ARG A CB   10 
ATOM   10959 C  CG   . ARG A 1 33 ? -0.318  -10.898 -6.684  1.00 0.00 ? 33  ARG A CG   10 
ATOM   10960 C  CD   . ARG A 1 33 ? 0.880   -11.452 -5.928  1.00 0.00 ? 33  ARG A CD   10 
ATOM   10961 N  NE   . ARG A 1 33 ? 1.491   -12.582 -6.623  1.00 0.00 ? 33  ARG A NE   10 
ATOM   10962 C  CZ   . ARG A 1 33 ? 1.869   -13.701 -6.017  1.00 0.00 ? 33  ARG A CZ   10 
ATOM   10963 N  NH1  . ARG A 1 33 ? 1.699   -13.841 -4.709  1.00 0.00 ? 33  ARG A NH1  10 
ATOM   10964 N  NH2  . ARG A 1 33 ? 2.418   -14.685 -6.718  1.00 0.00 ? 33  ARG A NH2  10 
ATOM   10965 H  H    . ARG A 1 33 ? -2.049  -7.446  -5.661  1.00 0.00 ? 33  ARG A H    10 
ATOM   10966 H  HA   . ARG A 1 33 ? -2.238  -9.273  -7.571  1.00 0.00 ? 33  ARG A HA   10 
ATOM   10967 H  HB2  . ARG A 1 33 ? -0.356  -8.946  -5.852  1.00 0.00 ? 33  ARG A HB2  10 
ATOM   10968 H  HB3  . ARG A 1 33 ? -1.189  -10.163 -4.893  1.00 0.00 ? 33  ARG A HB3  10 
ATOM   10969 H  HG2  . ARG A 1 33 ? -1.018  -11.700 -6.864  1.00 0.00 ? 33  ARG A HG2  10 
ATOM   10970 H  HG3  . ARG A 1 33 ? 0.019   -10.493 -7.626  1.00 0.00 ? 33  ARG A HG3  10 
ATOM   10971 H  HD2  . ARG A 1 33 ? 1.614   -10.669 -5.819  1.00 0.00 ? 33  ARG A HD2  10 
ATOM   10972 H  HD3  . ARG A 1 33 ? 0.553   -11.777 -4.951  1.00 0.00 ? 33  ARG A HD3  10 
ATOM   10973 H  HE   . ARG A 1 33 ? 1.626   -12.500 -7.590  1.00 0.00 ? 33  ARG A HE   10 
ATOM   10974 H  HH11 . ARG A 1 33 ? 1.284   -13.102 -4.178  1.00 0.00 ? 33  ARG A HH11 10 
ATOM   10975 H  HH12 . ARG A 1 33 ? 1.983   -14.685 -4.255  1.00 0.00 ? 33  ARG A HH12 10 
ATOM   10976 H  HH21 . ARG A 1 33 ? 2.548   -14.583 -7.704  1.00 0.00 ? 33  ARG A HH21 10 
ATOM   10977 H  HH22 . ARG A 1 33 ? 2.703   -15.527 -6.260  1.00 0.00 ? 33  ARG A HH22 10 
ATOM   10978 N  N    . ASP A 1 34 ? -3.483  -10.852 -4.955  1.00 0.00 ? 34  ASP A N    10 
ATOM   10979 C  CA   . ASP A 1 34 ? -4.461  -11.853 -4.544  1.00 0.00 ? 34  ASP A CA   10 
ATOM   10980 C  C    . ASP A 1 34 ? -5.405  -11.288 -3.487  1.00 0.00 ? 34  ASP A C    10 
ATOM   10981 O  O    . ASP A 1 34 ? -6.172  -12.025 -2.868  1.00 0.00 ? 34  ASP A O    10 
ATOM   10982 C  CB   . ASP A 1 34 ? -3.753  -13.096 -4.002  1.00 0.00 ? 34  ASP A CB   10 
ATOM   10983 C  CG   . ASP A 1 34 ? -3.219  -12.891 -2.598  1.00 0.00 ? 34  ASP A CG   10 
ATOM   10984 O  OD1  . ASP A 1 34 ? -2.735  -11.778 -2.303  1.00 0.00 ? 34  ASP A OD1  10 
ATOM   10985 O  OD2  . ASP A 1 34 ? -3.284  -13.845 -1.793  1.00 0.00 ? 34  ASP A OD2  10 
ATOM   10986 H  H    . ASP A 1 34 ? -2.858  -10.494 -4.291  1.00 0.00 ? 34  ASP A H    10 
ATOM   10987 H  HA   . ASP A 1 34 ? -5.038  -12.129 -5.413  1.00 0.00 ? 34  ASP A HA   10 
ATOM   10988 H  HB2  . ASP A 1 34 ? -4.451  -13.921 -3.985  1.00 0.00 ? 34  ASP A HB2  10 
ATOM   10989 H  HB3  . ASP A 1 34 ? -2.926  -13.342 -4.650  1.00 0.00 ? 34  ASP A HB3  10 
ATOM   10990 N  N    . ARG A 1 35 ? -5.342  -9.976  -3.285  1.00 0.00 ? 35  ARG A N    10 
ATOM   10991 C  CA   . ARG A 1 35 ? -6.189  -9.313  -2.301  1.00 0.00 ? 35  ARG A CA   10 
ATOM   10992 C  C    . ARG A 1 35 ? -6.908  -8.118  -2.920  1.00 0.00 ? 35  ARG A C    10 
ATOM   10993 O  O    . ARG A 1 35 ? -6.660  -7.759  -4.072  1.00 0.00 ? 35  ARG A O    10 
ATOM   10994 C  CB   . ARG A 1 35 ? -5.355  -8.855  -1.104  1.00 0.00 ? 35  ARG A CB   10 
ATOM   10995 C  CG   . ARG A 1 35 ? -4.845  -10.000 -0.243  1.00 0.00 ? 35  ARG A CG   10 
ATOM   10996 C  CD   . ARG A 1 35 ? -5.862  -10.396 0.816   1.00 0.00 ? 35  ARG A CD   10 
ATOM   10997 N  NE   . ARG A 1 35 ? -5.369  -11.470 1.674   1.00 0.00 ? 35  ARG A NE   10 
ATOM   10998 C  CZ   . ARG A 1 35 ? -5.812  -11.688 2.907   1.00 0.00 ? 35  ARG A CZ   10 
ATOM   10999 N  NH1  . ARG A 1 35 ? -6.753  -10.910 3.424   1.00 0.00 ? 35  ARG A NH1  10 
ATOM   11000 N  NH2  . ARG A 1 35 ? -5.313  -12.686 3.625   1.00 0.00 ? 35  ARG A NH2  10 
ATOM   11001 H  H    . ARG A 1 35 ? -4.710  -9.441  -3.809  1.00 0.00 ? 35  ARG A H    10 
ATOM   11002 H  HA   . ARG A 1 35 ? -6.926  -10.026 -1.963  1.00 0.00 ? 35  ARG A HA   10 
ATOM   11003 H  HB2  . ARG A 1 35 ? -4.502  -8.299  -1.465  1.00 0.00 ? 35  ARG A HB2  10 
ATOM   11004 H  HB3  . ARG A 1 35 ? -5.959  -8.210  -0.484  1.00 0.00 ? 35  ARG A HB3  10 
ATOM   11005 H  HG2  . ARG A 1 35 ? -4.649  -10.853 -0.875  1.00 0.00 ? 35  ARG A HG2  10 
ATOM   11006 H  HG3  . ARG A 1 35 ? -3.932  -9.693  0.244   1.00 0.00 ? 35  ARG A HG3  10 
ATOM   11007 H  HD2  . ARG A 1 35 ? -6.081  -9.533  1.427   1.00 0.00 ? 35  ARG A HD2  10 
ATOM   11008 H  HD3  . ARG A 1 35 ? -6.764  -10.726 0.323   1.00 0.00 ? 35  ARG A HD3  10 
ATOM   11009 H  HE   . ARG A 1 35 ? -4.673  -12.057 1.311   1.00 0.00 ? 35  ARG A HE   10 
ATOM   11010 H  HH11 . ARG A 1 35 ? -7.131  -10.158 2.884   1.00 0.00 ? 35  ARG A HH11 10 
ATOM   11011 H  HH12 . ARG A 1 35 ? -7.085  -11.077 4.352   1.00 0.00 ? 35  ARG A HH12 10 
ATOM   11012 H  HH21 . ARG A 1 35 ? -4.604  -13.275 3.239   1.00 0.00 ? 35  ARG A HH21 10 
ATOM   11013 H  HH22 . ARG A 1 35 ? -5.647  -12.849 4.553   1.00 0.00 ? 35  ARG A HH22 10 
ATOM   11014 N  N    . HIS A 1 36 ? -7.799  -7.504  -2.148  1.00 0.00 ? 36  HIS A N    10 
ATOM   11015 C  CA   . HIS A 1 36 ? -8.554  -6.349  -2.620  1.00 0.00 ? 36  HIS A CA   10 
ATOM   11016 C  C    . HIS A 1 36 ? -8.572  -5.244  -1.569  1.00 0.00 ? 36  HIS A C    10 
ATOM   11017 O  O    . HIS A 1 36 ? -8.490  -5.514  -0.370  1.00 0.00 ? 36  HIS A O    10 
ATOM   11018 C  CB   . HIS A 1 36 ? -9.985  -6.758  -2.971  1.00 0.00 ? 36  HIS A CB   10 
ATOM   11019 C  CG   . HIS A 1 36 ? -10.077 -7.643  -4.176  1.00 0.00 ? 36  HIS A CG   10 
ATOM   11020 N  ND1  . HIS A 1 36 ? -9.986  -9.018  -4.108  1.00 0.00 ? 36  HIS A ND1  10 
ATOM   11021 C  CD2  . HIS A 1 36 ? -10.255 -7.343  -5.484  1.00 0.00 ? 36  HIS A CD2  10 
ATOM   11022 C  CE1  . HIS A 1 36 ? -10.102 -9.524  -5.323  1.00 0.00 ? 36  HIS A CE1  10 
ATOM   11023 N  NE2  . HIS A 1 36 ? -10.266 -8.529  -6.176  1.00 0.00 ? 36  HIS A NE2  10 
ATOM   11024 H  H    . HIS A 1 36 ? -7.953  -7.837  -1.239  1.00 0.00 ? 36  HIS A H    10 
ATOM   11025 H  HA   . HIS A 1 36 ? -8.068  -5.976  -3.509  1.00 0.00 ? 36  HIS A HA   10 
ATOM   11026 H  HB2  . HIS A 1 36 ? -10.416 -7.289  -2.136  1.00 0.00 ? 36  HIS A HB2  10 
ATOM   11027 H  HB3  . HIS A 1 36 ? -10.569 -5.870  -3.166  1.00 0.00 ? 36  HIS A HB3  10 
ATOM   11028 H  HD1  . HIS A 1 36 ? -9.854  -9.543  -3.292  1.00 0.00 ? 36  HIS A HD1  10 
ATOM   11029 H  HD2  . HIS A 1 36 ? -10.366 -6.354  -5.906  1.00 0.00 ? 36  HIS A HD2  10 
ATOM   11030 H  HE1  . HIS A 1 36 ? -10.068 -10.573 -5.576  1.00 0.00 ? 36  HIS A HE1  10 
ATOM   11031 H  HE2  . HIS A 1 36 ? -10.292 -8.621  -7.151  1.00 0.00 ? 36  HIS A HE2  10 
ATOM   11032 N  N    . ARG A 1 37 ? -8.677  -4.001  -2.025  1.00 0.00 ? 37  ARG A N    10 
ATOM   11033 C  CA   . ARG A 1 37 ? -8.703  -2.855  -1.124  1.00 0.00 ? 37  ARG A CA   10 
ATOM   11034 C  C    . ARG A 1 37 ? -9.416  -1.671  -1.770  1.00 0.00 ? 37  ARG A C    10 
ATOM   11035 O  O    . ARG A 1 37 ? -9.736  -1.699  -2.959  1.00 0.00 ? 37  ARG A O    10 
ATOM   11036 C  CB   . ARG A 1 37 ? -7.279  -2.455  -0.733  1.00 0.00 ? 37  ARG A CB   10 
ATOM   11037 C  CG   . ARG A 1 37 ? -6.807  -3.079  0.571   1.00 0.00 ? 37  ARG A CG   10 
ATOM   11038 C  CD   . ARG A 1 37 ? -5.887  -2.141  1.336   1.00 0.00 ? 37  ARG A CD   10 
ATOM   11039 N  NE   . ARG A 1 37 ? -4.480  -2.486  1.155   1.00 0.00 ? 37  ARG A NE   10 
ATOM   11040 C  CZ   . ARG A 1 37 ? -3.797  -2.228  0.045   1.00 0.00 ? 37  ARG A CZ   10 
ATOM   11041 N  NH1  . ARG A 1 37 ? -4.390  -1.626  -0.977  1.00 0.00 ? 37  ARG A NH1  10 
ATOM   11042 N  NH2  . ARG A 1 37 ? -2.519  -2.573  -0.044  1.00 0.00 ? 37  ARG A NH2  10 
ATOM   11043 H  H    . ARG A 1 37 ? -8.738  -3.850  -2.992  1.00 0.00 ? 37  ARG A H    10 
ATOM   11044 H  HA   . ARG A 1 37 ? -9.243  -3.145  -0.235  1.00 0.00 ? 37  ARG A HA   10 
ATOM   11045 H  HB2  . ARG A 1 37 ? -6.603  -2.761  -1.518  1.00 0.00 ? 37  ARG A HB2  10 
ATOM   11046 H  HB3  . ARG A 1 37 ? -7.236  -1.381  -0.629  1.00 0.00 ? 37  ARG A HB3  10 
ATOM   11047 H  HG2  . ARG A 1 37 ? -7.668  -3.301  1.185   1.00 0.00 ? 37  ARG A HG2  10 
ATOM   11048 H  HG3  . ARG A 1 37 ? -6.274  -3.991  0.350   1.00 0.00 ? 37  ARG A HG3  10 
ATOM   11049 H  HD2  . ARG A 1 37 ? -6.049  -1.133  0.984   1.00 0.00 ? 37  ARG A HD2  10 
ATOM   11050 H  HD3  . ARG A 1 37 ? -6.130  -2.198  2.387   1.00 0.00 ? 37  ARG A HD3  10 
ATOM   11051 H  HE   . ARG A 1 37 ? -4.023  -2.932  1.897   1.00 0.00 ? 37  ARG A HE   10 
ATOM   11052 H  HH11 . ARG A 1 37 ? -5.353  -1.364  -0.912  1.00 0.00 ? 37  ARG A HH11 10 
ATOM   11053 H  HH12 . ARG A 1 37 ? -3.873  -1.432  -1.811  1.00 0.00 ? 37  ARG A HH12 10 
ATOM   11054 H  HH21 . ARG A 1 37 ? -2.069  -3.027  0.724   1.00 0.00 ? 37  ARG A HH21 10 
ATOM   11055 H  HH22 . ARG A 1 37 ? -2.006  -2.378  -0.880  1.00 0.00 ? 37  ARG A HH22 10 
ATOM   11056 N  N    . HIS A 1 38 ? -9.663  -0.632  -0.978  1.00 0.00 ? 38  HIS A N    10 
ATOM   11057 C  CA   . HIS A 1 38 ? -10.339 0.562   -1.473  1.00 0.00 ? 38  HIS A CA   10 
ATOM   11058 C  C    . HIS A 1 38 ? -9.340  1.532   -2.096  1.00 0.00 ? 38  HIS A C    10 
ATOM   11059 O  O    . HIS A 1 38 ? -8.133  1.448   -1.872  1.00 0.00 ? 38  HIS A O    10 
ATOM   11060 C  CB   . HIS A 1 38 ? -11.097 1.252   -0.338  1.00 0.00 ? 38  HIS A CB   10 
ATOM   11061 C  CG   . HIS A 1 38 ? -12.422 0.624   -0.034  1.00 0.00 ? 38  HIS A CG   10 
ATOM   11062 N  ND1  . HIS A 1 38 ? -12.624 -0.234  1.026   1.00 0.00 ? 38  HIS A ND1  10 
ATOM   11063 C  CD2  . HIS A 1 38 ? -13.618 0.735   -0.659  1.00 0.00 ? 38  HIS A CD2  10 
ATOM   11064 C  CE1  . HIS A 1 38 ? -13.885 -0.625  1.040   1.00 0.00 ? 38  HIS A CE1  10 
ATOM   11065 N  NE2  . HIS A 1 38 ? -14.511 -0.051  0.028   1.00 0.00 ? 38  HIS A NE2  10 
ATOM   11066 H  H    . HIS A 1 38 ? -9.384  -0.670  -0.040  1.00 0.00 ? 38  HIS A H    10 
ATOM   11067 H  HA   . HIS A 1 38 ? -11.044 0.255   -2.230  1.00 0.00 ? 38  HIS A HA   10 
ATOM   11068 H  HB2  . HIS A 1 38 ? -10.499 1.213   0.561   1.00 0.00 ? 38  HIS A HB2  10 
ATOM   11069 H  HB3  . HIS A 1 38 ? -11.271 2.284   -0.605  1.00 0.00 ? 38  HIS A HB3  10 
ATOM   11070 H  HD2  . HIS A 1 38 ? -13.832 1.330   -1.535  1.00 0.00 ? 38  HIS A HD2  10 
ATOM   11071 H  HE1  . HIS A 1 38 ? -14.331 -1.299  1.757   1.00 0.00 ? 38  HIS A HE1  10 
ATOM   11072 H  HE2  . HIS A 1 38 ? -15.434 -0.236  -0.243  1.00 0.00 ? 38  HIS A HE2  10 
ATOM   11073 N  N    . PRO A 1 39 ? -9.854  2.476   -2.899  1.00 0.00 ? 39  PRO A N    10 
ATOM   11074 C  CA   . PRO A 1 39 ? -9.024  3.480   -3.572  1.00 0.00 ? 39  PRO A CA   10 
ATOM   11075 C  C    . PRO A 1 39 ? -8.434  4.492   -2.596  1.00 0.00 ? 39  PRO A C    10 
ATOM   11076 O  O    . PRO A 1 39 ? -7.570  5.289   -2.962  1.00 0.00 ? 39  PRO A O    10 
ATOM   11077 C  CB   . PRO A 1 39 ? -10.004 4.167   -4.527  1.00 0.00 ? 39  PRO A CB   10 
ATOM   11078 C  CG   . PRO A 1 39 ? -11.342 3.970   -3.904  1.00 0.00 ? 39  PRO A CG   10 
ATOM   11079 C  CD   . PRO A 1 39 ? -11.284 2.637   -3.211  1.00 0.00 ? 39  PRO A CD   10 
ATOM   11080 H  HA   . PRO A 1 39 ? -8.228  3.021   -4.139  1.00 0.00 ? 39  PRO A HA   10 
ATOM   11081 H  HB2  . PRO A 1 39 ? -9.755  5.216   -4.608  1.00 0.00 ? 39  PRO A HB2  10 
ATOM   11082 H  HB3  . PRO A 1 39 ? -9.949  3.702   -5.500  1.00 0.00 ? 39  PRO A HB3  10 
ATOM   11083 H  HG2  . PRO A 1 39 ? -11.534 4.756   -3.189  1.00 0.00 ? 39  PRO A HG2  10 
ATOM   11084 H  HG3  . PRO A 1 39 ? -12.105 3.962   -4.668  1.00 0.00 ? 39  PRO A HG3  10 
ATOM   11085 H  HD2  . PRO A 1 39 ? -11.876 2.654   -2.308  1.00 0.00 ? 39  PRO A HD2  10 
ATOM   11086 H  HD3  . PRO A 1 39 ? -11.624 1.853   -3.872  1.00 0.00 ? 39  PRO A HD3  10 
ATOM   11087 N  N    . GLU A 1 40 ? -8.905  4.454   -1.354  1.00 0.00 ? 40  GLU A N    10 
ATOM   11088 C  CA   . GLU A 1 40 ? -8.422  5.369   -0.326  1.00 0.00 ? 40  GLU A CA   10 
ATOM   11089 C  C    . GLU A 1 40 ? -7.720  4.608   0.795   1.00 0.00 ? 40  GLU A C    10 
ATOM   11090 O  O    . GLU A 1 40 ? -6.877  5.159   1.503   1.00 0.00 ? 40  GLU A O    10 
ATOM   11091 C  CB   . GLU A 1 40 ? -9.582  6.187   0.246   1.00 0.00 ? 40  GLU A CB   10 
ATOM   11092 C  CG   . GLU A 1 40 ? -10.514 5.381   1.135   1.00 0.00 ? 40  GLU A CG   10 
ATOM   11093 C  CD   . GLU A 1 40 ? -11.928 5.928   1.147   1.00 0.00 ? 40  GLU A CD   10 
ATOM   11094 O  OE1  . GLU A 1 40 ? -12.429 6.299   0.064   1.00 0.00 ? 40  GLU A OE1  10 
ATOM   11095 O  OE2  . GLU A 1 40 ? -12.533 5.987   2.237   1.00 0.00 ? 40  GLU A OE2  10 
ATOM   11096 H  H    . GLU A 1 40 ? -9.593  3.796   -1.123  1.00 0.00 ? 40  GLU A H    10 
ATOM   11097 H  HA   . GLU A 1 40 ? -7.713  6.041   -0.787  1.00 0.00 ? 40  GLU A HA   10 
ATOM   11098 H  HB2  . GLU A 1 40 ? -9.179  7.003   0.828   1.00 0.00 ? 40  GLU A HB2  10 
ATOM   11099 H  HB3  . GLU A 1 40 ? -10.160 6.591   -0.572  1.00 0.00 ? 40  GLU A HB3  10 
ATOM   11100 H  HG2  . GLU A 1 40 ? -10.542 4.363   0.777   1.00 0.00 ? 40  GLU A HG2  10 
ATOM   11101 H  HG3  . GLU A 1 40 ? -10.130 5.395   2.145   1.00 0.00 ? 40  GLU A HG3  10 
ATOM   11102 N  N    . CYS A 1 41 ? -8.075  3.337   0.951   1.00 0.00 ? 41  CYS A N    10 
ATOM   11103 C  CA   . CYS A 1 41 ? -7.482  2.498   1.985   1.00 0.00 ? 41  CYS A CA   10 
ATOM   11104 C  C    . CYS A 1 41 ? -6.159  1.903   1.511   1.00 0.00 ? 41  CYS A C    10 
ATOM   11105 O  O    . CYS A 1 41 ? -5.515  1.141   2.232   1.00 0.00 ? 41  CYS A O    10 
ATOM   11106 C  CB   . CYS A 1 41 ? -8.447  1.377   2.378   1.00 0.00 ? 41  CYS A CB   10 
ATOM   11107 S  SG   . CYS A 1 41 ? -10.054 1.965   3.001   1.00 0.00 ? 41  CYS A SG   10 
ATOM   11108 H  H    . CYS A 1 41 ? -8.754  2.953   0.355   1.00 0.00 ? 41  CYS A H    10 
ATOM   11109 H  HA   . CYS A 1 41 ? -7.294  3.118   2.848   1.00 0.00 ? 41  CYS A HA   10 
ATOM   11110 H  HB2  . CYS A 1 41 ? -8.637  0.757   1.514   1.00 0.00 ? 41  CYS A HB2  10 
ATOM   11111 H  HB3  . CYS A 1 41 ? -7.992  0.777   3.152   1.00 0.00 ? 41  CYS A HB3  10 
ATOM   11112 N  N    . TYR A 1 42 ? -5.761  2.256   0.293   1.00 0.00 ? 42  TYR A N    10 
ATOM   11113 C  CA   . TYR A 1 42 ? -4.517  1.755   -0.279  1.00 0.00 ? 42  TYR A CA   10 
ATOM   11114 C  C    . TYR A 1 42 ? -3.311  2.433   0.363   1.00 0.00 ? 42  TYR A C    10 
ATOM   11115 O  O    . TYR A 1 42 ? -2.207  2.408   -0.182  1.00 0.00 ? 42  TYR A O    10 
ATOM   11116 C  CB   . TYR A 1 42 ? -4.499  1.982   -1.791  1.00 0.00 ? 42  TYR A CB   10 
ATOM   11117 C  CG   . TYR A 1 42 ? -3.170  1.660   -2.437  1.00 0.00 ? 42  TYR A CG   10 
ATOM   11118 C  CD1  . TYR A 1 42 ? -2.413  0.577   -2.009  1.00 0.00 ? 42  TYR A CD1  10 
ATOM   11119 C  CD2  . TYR A 1 42 ? -2.672  2.440   -3.473  1.00 0.00 ? 42  TYR A CD2  10 
ATOM   11120 C  CE1  . TYR A 1 42 ? -1.197  0.279   -2.594  1.00 0.00 ? 42  TYR A CE1  10 
ATOM   11121 C  CE2  . TYR A 1 42 ? -1.459  2.148   -4.066  1.00 0.00 ? 42  TYR A CE2  10 
ATOM   11122 C  CZ   . TYR A 1 42 ? -0.725  1.068   -3.623  1.00 0.00 ? 42  TYR A CZ   10 
ATOM   11123 O  OH   . TYR A 1 42 ? 0.485   0.775   -4.210  1.00 0.00 ? 42  TYR A OH   10 
ATOM   11124 H  H    . TYR A 1 42 ? -6.318  2.866   -0.234  1.00 0.00 ? 42  TYR A H    10 
ATOM   11125 H  HA   . TYR A 1 42 ? -4.465  0.694   -0.084  1.00 0.00 ? 42  TYR A HA   10 
ATOM   11126 H  HB2  . TYR A 1 42 ? -5.250  1.358   -2.251  1.00 0.00 ? 42  TYR A HB2  10 
ATOM   11127 H  HB3  . TYR A 1 42 ? -4.725  3.019   -1.996  1.00 0.00 ? 42  TYR A HB3  10 
ATOM   11128 H  HD1  . TYR A 1 42 ? -2.785  -0.039  -1.203  1.00 0.00 ? 42  TYR A HD1  10 
ATOM   11129 H  HD2  . TYR A 1 42 ? -3.249  3.286   -3.817  1.00 0.00 ? 42  TYR A HD2  10 
ATOM   11130 H  HE1  . TYR A 1 42 ? -0.623  -0.567  -2.248  1.00 0.00 ? 42  TYR A HE1  10 
ATOM   11131 H  HE2  . TYR A 1 42 ? -1.088  2.766   -4.871  1.00 0.00 ? 42  TYR A HE2  10 
ATOM   11132 H  HH   . TYR A 1 42 ? 0.930   0.092   -3.702  1.00 0.00 ? 42  TYR A HH   10 
ATOM   11133 N  N    . VAL A 1 43 ? -3.530  3.040   1.525   1.00 0.00 ? 43  VAL A N    10 
ATOM   11134 C  CA   . VAL A 1 43 ? -2.461  3.724   2.244   1.00 0.00 ? 43  VAL A CA   10 
ATOM   11135 C  C    . VAL A 1 43 ? -1.638  2.742   3.070   1.00 0.00 ? 43  VAL A C    10 
ATOM   11136 O  O    . VAL A 1 43 ? -2.104  1.652   3.404   1.00 0.00 ? 43  VAL A O    10 
ATOM   11137 C  CB   . VAL A 1 43 ? -3.021  4.817   3.173   1.00 0.00 ? 43  VAL A CB   10 
ATOM   11138 C  CG1  . VAL A 1 43 ? -3.739  5.888   2.366   1.00 0.00 ? 43  VAL A CG1  10 
ATOM   11139 C  CG2  . VAL A 1 43 ? -3.950  4.208   4.212   1.00 0.00 ? 43  VAL A CG2  10 
ATOM   11140 H  H    . VAL A 1 43 ? -4.431  3.026   1.909   1.00 0.00 ? 43  VAL A H    10 
ATOM   11141 H  HA   . VAL A 1 43 ? -1.817  4.195   1.516   1.00 0.00 ? 43  VAL A HA   10 
ATOM   11142 H  HB   . VAL A 1 43 ? -2.193  5.281   3.689   1.00 0.00 ? 43  VAL A HB   10 
ATOM   11143 H  HG11 . VAL A 1 43 ? -4.758  5.580   2.185   1.00 0.00 ? 43  VAL A HG11 10 
ATOM   11144 H  HG12 . VAL A 1 43 ? -3.735  6.818   2.917   1.00 0.00 ? 43  VAL A HG12 10 
ATOM   11145 H  HG13 . VAL A 1 43 ? -3.233  6.027   1.422   1.00 0.00 ? 43  VAL A HG13 10 
ATOM   11146 H  HG21 . VAL A 1 43 ? -3.787  3.142   4.259   1.00 0.00 ? 43  VAL A HG21 10 
ATOM   11147 H  HG22 . VAL A 1 43 ? -3.747  4.647   5.179   1.00 0.00 ? 43  VAL A HG22 10 
ATOM   11148 H  HG23 . VAL A 1 43 ? -4.976  4.404   3.937   1.00 0.00 ? 43  VAL A HG23 10 
ATOM   11149 N  N    . CYS A 1 44 ? -0.412  3.136   3.398   1.00 0.00 ? 44  CYS A N    10 
ATOM   11150 C  CA   . CYS A 1 44 ? 0.477   2.291   4.186   1.00 0.00 ? 44  CYS A CA   10 
ATOM   11151 C  C    . CYS A 1 44 ? -0.209  1.825   5.467   1.00 0.00 ? 44  CYS A C    10 
ATOM   11152 O  O    . CYS A 1 44 ? -1.214  2.396   5.891   1.00 0.00 ? 44  CYS A O    10 
ATOM   11153 C  CB   . CYS A 1 44 ? 1.762   3.048   4.529   1.00 0.00 ? 44  CYS A CB   10 
ATOM   11154 S  SG   . CYS A 1 44 ? 2.938   2.096   5.543   1.00 0.00 ? 44  CYS A SG   10 
ATOM   11155 H  H    . CYS A 1 44 ? -0.098  4.017   3.103   1.00 0.00 ? 44  CYS A H    10 
ATOM   11156 H  HA   . CYS A 1 44 ? 0.728   1.427   3.591   1.00 0.00 ? 44  CYS A HA   10 
ATOM   11157 H  HB2  . CYS A 1 44 ? 2.265   3.321   3.613   1.00 0.00 ? 44  CYS A HB2  10 
ATOM   11158 H  HB3  . CYS A 1 44 ? 1.507   3.945   5.075   1.00 0.00 ? 44  CYS A HB3  10 
ATOM   11159 N  N    . THR A 1 45 ? 0.342   0.781   6.080   1.00 0.00 ? 45  THR A N    10 
ATOM   11160 C  CA   . THR A 1 45 ? -0.216  0.237   7.311   1.00 0.00 ? 45  THR A CA   10 
ATOM   11161 C  C    . THR A 1 45 ? 0.475   0.826   8.536   1.00 0.00 ? 45  THR A C    10 
ATOM   11162 O  O    . THR A 1 45 ? -0.160  1.068   9.562   1.00 0.00 ? 45  THR A O    10 
ATOM   11163 C  CB   . THR A 1 45 ? -0.091  -1.298  7.354   1.00 0.00 ? 45  THR A CB   10 
ATOM   11164 O  OG1  . THR A 1 45 ? -0.768  -1.876  6.232   1.00 0.00 ? 45  THR A OG1  10 
ATOM   11165 C  CG2  . THR A 1 45 ? -0.674  -1.853  8.645   1.00 0.00 ? 45  THR A CG2  10 
ATOM   11166 H  H    . THR A 1 45 ? 1.142   0.369   5.693   1.00 0.00 ? 45  THR A H    10 
ATOM   11167 H  HA   . THR A 1 45 ? -1.265  0.493   7.344   1.00 0.00 ? 45  THR A HA   10 
ATOM   11168 H  HB   . THR A 1 45 ? 0.956   -1.560  7.307   1.00 0.00 ? 45  THR A HB   10 
ATOM   11169 H  HG1  . THR A 1 45 ? -0.399  -2.744  6.048   1.00 0.00 ? 45  THR A HG1  10 
ATOM   11170 H  HG21 . THR A 1 45 ? -1.749  -1.901  8.563   1.00 0.00 ? 45  THR A HG21 10 
ATOM   11171 H  HG22 . THR A 1 45 ? -0.404  -1.208  9.468   1.00 0.00 ? 45  THR A HG22 10 
ATOM   11172 H  HG23 . THR A 1 45 ? -0.281  -2.843  8.820   1.00 0.00 ? 45  THR A HG23 10 
ATOM   11173 N  N    . ASP A 1 46 ? 1.778   1.055   8.421   1.00 0.00 ? 46  ASP A N    10 
ATOM   11174 C  CA   . ASP A 1 46 ? 2.555   1.618   9.519   1.00 0.00 ? 46  ASP A CA   10 
ATOM   11175 C  C    . ASP A 1 46 ? 2.137   3.058   9.799   1.00 0.00 ? 46  ASP A C    10 
ATOM   11176 O  O    . ASP A 1 46 ? 1.565   3.357   10.848  1.00 0.00 ? 46  ASP A O    10 
ATOM   11177 C  CB   . ASP A 1 46 ? 4.049   1.561   9.196   1.00 0.00 ? 46  ASP A CB   10 
ATOM   11178 C  CG   . ASP A 1 46 ? 4.914   1.659   10.437  1.00 0.00 ? 46  ASP A CG   10 
ATOM   11179 O  OD1  . ASP A 1 46 ? 4.450   1.240   11.518  1.00 0.00 ? 46  ASP A OD1  10 
ATOM   11180 O  OD2  . ASP A 1 46 ? 6.055   2.155   10.328  1.00 0.00 ? 46  ASP A OD2  10 
ATOM   11181 H  H    . ASP A 1 46 ? 2.228   0.841   7.577   1.00 0.00 ? 46  ASP A H    10 
ATOM   11182 H  HA   . ASP A 1 46 ? 2.364   1.023   10.399  1.00 0.00 ? 46  ASP A HA   10 
ATOM   11183 H  HB2  . ASP A 1 46 ? 4.269   0.627   8.700   1.00 0.00 ? 46  ASP A HB2  10 
ATOM   11184 H  HB3  . ASP A 1 46 ? 4.300   2.381   8.539   1.00 0.00 ? 46  ASP A HB3  10 
ATOM   11185 N  N    . CYS A 1 47 ? 2.426   3.947   8.854   1.00 0.00 ? 47  CYS A N    10 
ATOM   11186 C  CA   . CYS A 1 47 ? 2.081   5.356   8.999   1.00 0.00 ? 47  CYS A CA   10 
ATOM   11187 C  C    . CYS A 1 47 ? 0.677   5.630   8.468   1.00 0.00 ? 47  CYS A C    10 
ATOM   11188 O  O    . CYS A 1 47 ? -0.180  6.142   9.186   1.00 0.00 ? 47  CYS A O    10 
ATOM   11189 C  CB   . CYS A 1 47 ? 3.097   6.229   8.259   1.00 0.00 ? 47  CYS A CB   10 
ATOM   11190 S  SG   . CYS A 1 47 ? 3.585   5.583   6.628   1.00 0.00 ? 47  CYS A SG   10 
ATOM   11191 H  H    . CYS A 1 47 ? 2.883   3.648   8.040   1.00 0.00 ? 47  CYS A H    10 
ATOM   11192 H  HA   . CYS A 1 47 ? 2.109   5.598   10.050  1.00 0.00 ? 47  CYS A HA   10 
ATOM   11193 H  HB2  . CYS A 1 47 ? 2.674   7.212   8.110   1.00 0.00 ? 47  CYS A HB2  10 
ATOM   11194 H  HB3  . CYS A 1 47 ? 3.991   6.316   8.860   1.00 0.00 ? 47  CYS A HB3  10 
ATOM   11195 N  N    . GLY A 1 48 ? 0.450   5.283   7.204   1.00 0.00 ? 48  GLY A N    10 
ATOM   11196 C  CA   . GLY A 1 48 ? -0.851  5.499   6.598   1.00 0.00 ? 48  GLY A CA   10 
ATOM   11197 C  C    . GLY A 1 48 ? -0.817  6.559   5.515   1.00 0.00 ? 48  GLY A C    10 
ATOM   11198 O  O    . GLY A 1 48 ? -1.643  7.473   5.504   1.00 0.00 ? 48  GLY A O    10 
ATOM   11199 H  H    . GLY A 1 48 ? 1.172   4.878   6.679   1.00 0.00 ? 48  GLY A H    10 
ATOM   11200 H  HA2  . GLY A 1 48 ? -1.194  4.570   6.168   1.00 0.00 ? 48  GLY A HA2  10 
ATOM   11201 H  HA3  . GLY A 1 48 ? -1.546  5.807   7.366   1.00 0.00 ? 48  GLY A HA3  10 
ATOM   11202 N  N    . THR A 1 49 ? 0.141   6.440   4.602   1.00 0.00 ? 49  THR A N    10 
ATOM   11203 C  CA   . THR A 1 49 ? 0.281   7.397   3.512   1.00 0.00 ? 49  THR A CA   10 
ATOM   11204 C  C    . THR A 1 49 ? -0.123  6.776   2.180   1.00 0.00 ? 49  THR A C    10 
ATOM   11205 O  O    . THR A 1 49 ? -0.017  5.565   1.991   1.00 0.00 ? 49  THR A O    10 
ATOM   11206 C  CB   . THR A 1 49 ? 1.726   7.919   3.404   1.00 0.00 ? 49  THR A CB   10 
ATOM   11207 O  OG1  . THR A 1 49 ? 1.775   9.052   2.530   1.00 0.00 ? 49  THR A OG1  10 
ATOM   11208 C  CG2  . THR A 1 49 ? 2.657   6.832   2.886   1.00 0.00 ? 49  THR A CG2  10 
ATOM   11209 H  H    . THR A 1 49 ? 0.769   5.691   4.665   1.00 0.00 ? 49  THR A H    10 
ATOM   11210 H  HA   . THR A 1 49 ? -0.368  8.236   3.719   1.00 0.00 ? 49  THR A HA   10 
ATOM   11211 H  HB   . THR A 1 49 ? 2.059   8.218   4.388   1.00 0.00 ? 49  THR A HB   10 
ATOM   11212 H  HG1  . THR A 1 49 ? 2.600   9.044   2.040   1.00 0.00 ? 49  THR A HG1  10 
ATOM   11213 H  HG21 . THR A 1 49 ? 3.379   6.583   3.649   1.00 0.00 ? 49  THR A HG21 10 
ATOM   11214 H  HG22 . THR A 1 49 ? 3.171   7.188   2.006   1.00 0.00 ? 49  THR A HG22 10 
ATOM   11215 H  HG23 . THR A 1 49 ? 2.080   5.955   2.636   1.00 0.00 ? 49  THR A HG23 10 
ATOM   11216 N  N    . ASN A 1 50 ? -0.587  7.614   1.258   1.00 0.00 ? 50  ASN A N    10 
ATOM   11217 C  CA   . ASN A 1 50 ? -1.007  7.146   -0.058  1.00 0.00 ? 50  ASN A CA   10 
ATOM   11218 C  C    . ASN A 1 50 ? 0.159   6.507   -0.806  1.00 0.00 ? 50  ASN A C    10 
ATOM   11219 O  O    . ASN A 1 50 ? 1.183   7.148   -1.047  1.00 0.00 ? 50  ASN A O    10 
ATOM   11220 C  CB   . ASN A 1 50 ? -1.578  8.305   -0.876  1.00 0.00 ? 50  ASN A CB   10 
ATOM   11221 C  CG   . ASN A 1 50 ? -2.329  7.831   -2.105  1.00 0.00 ? 50  ASN A CG   10 
ATOM   11222 O  OD1  . ASN A 1 50 ? -1.927  8.105   -3.236  1.00 0.00 ? 50  ASN A OD1  10 
ATOM   11223 N  ND2  . ASN A 1 50 ? -3.427  7.116   -1.889  1.00 0.00 ? 50  ASN A ND2  10 
ATOM   11224 H  H    . ASN A 1 50 ? -0.648  8.569   1.467   1.00 0.00 ? 50  ASN A H    10 
ATOM   11225 H  HA   . ASN A 1 50 ? -1.778  6.404   0.085   1.00 0.00 ? 50  ASN A HA   10 
ATOM   11226 H  HB2  . ASN A 1 50 ? -2.260  8.872   -0.259  1.00 0.00 ? 50  ASN A HB2  10 
ATOM   11227 H  HB3  . ASN A 1 50 ? -0.770  8.946   -1.195  1.00 0.00 ? 50  ASN A HB3  10 
ATOM   11228 H  HD21 . ASN A 1 50 ? -3.688  6.937   -0.961  1.00 0.00 ? 50  ASN A HD21 10 
ATOM   11229 H  HD22 . ASN A 1 50 ? -3.932  6.796   -2.665  1.00 0.00 ? 50  ASN A HD22 10 
ATOM   11230 N  N    . LEU A 1 51 ? -0.004  5.240   -1.172  1.00 0.00 ? 51  LEU A N    10 
ATOM   11231 C  CA   . LEU A 1 51 ? 1.035   4.513   -1.894  1.00 0.00 ? 51  LEU A CA   10 
ATOM   11232 C  C    . LEU A 1 51 ? 0.747   4.496   -3.392  1.00 0.00 ? 51  LEU A C    10 
ATOM   11233 O  O    . LEU A 1 51 ? 1.311   3.693   -4.135  1.00 0.00 ? 51  LEU A O    10 
ATOM   11234 C  CB   . LEU A 1 51 ? 1.142   3.081   -1.368  1.00 0.00 ? 51  LEU A CB   10 
ATOM   11235 C  CG   . LEU A 1 51 ? 1.214   2.928   0.152   1.00 0.00 ? 51  LEU A CG   10 
ATOM   11236 C  CD1  . LEU A 1 51 ? 1.086   1.465   0.547   1.00 0.00 ? 51  LEU A CD1  10 
ATOM   11237 C  CD2  . LEU A 1 51 ? 2.512   3.515   0.686   1.00 0.00 ? 51  LEU A CD2  10 
ATOM   11238 H  H    . LEU A 1 51 ? -0.841  4.782   -0.953  1.00 0.00 ? 51  LEU A H    10 
ATOM   11239 H  HA   . LEU A 1 51 ? 1.973   5.021   -1.726  1.00 0.00 ? 51  LEU A HA   10 
ATOM   11240 H  HB2  . LEU A 1 51 ? 0.278   2.536   -1.715  1.00 0.00 ? 51  LEU A HB2  10 
ATOM   11241 H  HB3  . LEU A 1 51 ? 2.035   2.641   -1.789  1.00 0.00 ? 51  LEU A HB3  10 
ATOM   11242 H  HG   . LEU A 1 51 ? 0.392   3.467   0.601   1.00 0.00 ? 51  LEU A HG   10 
ATOM   11243 H  HD11 . LEU A 1 51 ? 0.465   1.383   1.426   1.00 0.00 ? 51  LEU A HD11 10 
ATOM   11244 H  HD12 . LEU A 1 51 ? 2.066   1.062   0.759   1.00 0.00 ? 51  LEU A HD12 10 
ATOM   11245 H  HD13 . LEU A 1 51 ? 0.638   0.910   -0.264  1.00 0.00 ? 51  LEU A HD13 10 
ATOM   11246 H  HD21 . LEU A 1 51 ? 3.077   2.743   1.186   1.00 0.00 ? 51  LEU A HD21 10 
ATOM   11247 H  HD22 . LEU A 1 51 ? 2.287   4.307   1.386   1.00 0.00 ? 51  LEU A HD22 10 
ATOM   11248 H  HD23 . LEU A 1 51 ? 3.092   3.912   -0.134  1.00 0.00 ? 51  LEU A HD23 10 
ATOM   11249 N  N    . LYS A 1 52 ? -0.133  5.390   -3.830  1.00 0.00 ? 52  LYS A N    10 
ATOM   11250 C  CA   . LYS A 1 52 ? -0.494  5.482   -5.240  1.00 0.00 ? 52  LYS A CA   10 
ATOM   11251 C  C    . LYS A 1 52 ? 0.747   5.650   -6.110  1.00 0.00 ? 52  LYS A C    10 
ATOM   11252 O  O    . LYS A 1 52 ? 1.010   4.836   -6.994  1.00 0.00 ? 52  LYS A O    10 
ATOM   11253 C  CB   . LYS A 1 52 ? -1.452  6.654   -5.467  1.00 0.00 ? 52  LYS A CB   10 
ATOM   11254 C  CG   . LYS A 1 52 ? -1.905  6.798   -6.909  1.00 0.00 ? 52  LYS A CG   10 
ATOM   11255 C  CD   . LYS A 1 52 ? -2.908  5.722   -7.288  1.00 0.00 ? 52  LYS A CD   10 
ATOM   11256 C  CE   . LYS A 1 52 ? -3.033  5.582   -8.797  1.00 0.00 ? 52  LYS A CE   10 
ATOM   11257 N  NZ   . LYS A 1 52 ? -1.882  4.839   -9.382  1.00 0.00 ? 52  LYS A NZ   10 
ATOM   11258 H  H    . LYS A 1 52 ? -0.549  6.005   -3.189  1.00 0.00 ? 52  LYS A H    10 
ATOM   11259 H  HA   . LYS A 1 52 ? -0.991  4.564   -5.515  1.00 0.00 ? 52  LYS A HA   10 
ATOM   11260 H  HB2  . LYS A 1 52 ? -2.326  6.515   -4.848  1.00 0.00 ? 52  LYS A HB2  10 
ATOM   11261 H  HB3  . LYS A 1 52 ? -0.957  7.569   -5.174  1.00 0.00 ? 52  LYS A HB3  10 
ATOM   11262 H  HG2  . LYS A 1 52 ? -2.367  7.766   -7.037  1.00 0.00 ? 52  LYS A HG2  10 
ATOM   11263 H  HG3  . LYS A 1 52 ? -1.044  6.720   -7.557  1.00 0.00 ? 52  LYS A HG3  10 
ATOM   11264 H  HD2  . LYS A 1 52 ? -2.583  4.778   -6.876  1.00 0.00 ? 52  LYS A HD2  10 
ATOM