data_1X7N
# 
_entry.id   1X7N 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.295 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1X7N         
RCSB  RCSB030041   
WWPDB D_1000030041 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1PLZ 
_pdbx_database_related.details        'Crystal Structure Of Phosphoglucose Isomerase From Pyrococcus Furiosus' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1X7N 
_pdbx_database_status.recvd_initial_deposition_date   2004-08-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Berrisford, J.M.'  1  
'Akerboom, J.'      2  
'Brouns, S.'        3  
'Sedelnikova, S.E.' 4  
'Turnbull, A.P.'    5  
'van der Oost, J.'  6  
'Salmon, L.'        7  
'Hardre, R.'        8  
'Murray, I.A.'      9  
'Blackburn, G.M.'   10 
'Rice, D.W.'        11 
'Baker, P.J.'       12 
# 
_citation.id                        primary 
_citation.title                     
;The structures of inhibitor complexes of Pyrococcus furiosus phosphoglucose isomerase provide insights into substrate binding and catalysis.
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            343 
_citation.page_first                649 
_citation.page_last                 657 
_citation.year                      2004 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15465052 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2004.08.061 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Berrisford, J.M.'  1  
primary 'Akerboom, J.'      2  
primary 'Brouns, S.'        3  
primary 'Sedelnikova, S.E.' 4  
primary 'Turnbull, A.P.'    5  
primary 'van der Oost, J.'  6  
primary 'Salmon, L.'        7  
primary 'Hardre, R.'        8  
primary 'Murray, I.A.'      9  
primary 'Blackburn, G.M.'   10 
primary 'Rice, D.W.'        11 
primary 'Baker, P.J.'       12 
# 
_cell.entry_id           1X7N 
_cell.length_a           84.674 
_cell.length_b           42.382 
_cell.length_c           57.255 
_cell.angle_alpha        90.00 
_cell.angle_beta         120.57 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1X7N 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glucose-6-phosphate isomerase' 21636.633 1   5.3.1.9 ? ? ? 
2 non-polymer syn 'MANGANESE (II) ION'            54.938    1   ?       ? ? ? 
3 non-polymer syn '5-PHOSPHOARABINONIC ACID'      246.109   1   ?       ? ? ? 
4 water       nat water                           18.015    205 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GPI, Phosphoglucose isomerase, PGI, Phosphohexose isomerase, PHI' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MMYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVG
KEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHD
YGTIAEKGFSKIVIEENGEVKVVDNPRWKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MMYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVG
KEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHD
YGTIAEKGFSKIVIEENGEVKVVDNPRWKK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   MET n 
1 3   TYR n 
1 4   LYS n 
1 5   GLU n 
1 6   PRO n 
1 7   PHE n 
1 8   GLY n 
1 9   VAL n 
1 10  LYS n 
1 11  VAL n 
1 12  ASP n 
1 13  PHE n 
1 14  GLU n 
1 15  THR n 
1 16  GLY n 
1 17  ILE n 
1 18  ILE n 
1 19  GLU n 
1 20  GLY n 
1 21  ALA n 
1 22  LYS n 
1 23  LYS n 
1 24  SER n 
1 25  VAL n 
1 26  ARG n 
1 27  ARG n 
1 28  LEU n 
1 29  SER n 
1 30  ASP n 
1 31  MET n 
1 32  GLU n 
1 33  GLY n 
1 34  TYR n 
1 35  PHE n 
1 36  VAL n 
1 37  ASP n 
1 38  GLU n 
1 39  ARG n 
1 40  ALA n 
1 41  TRP n 
1 42  LYS n 
1 43  GLU n 
1 44  LEU n 
1 45  VAL n 
1 46  GLU n 
1 47  LYS n 
1 48  GLU n 
1 49  ASP n 
1 50  PRO n 
1 51  VAL n 
1 52  VAL n 
1 53  TYR n 
1 54  GLU n 
1 55  VAL n 
1 56  TYR n 
1 57  ALA n 
1 58  VAL n 
1 59  GLU n 
1 60  GLN n 
1 61  GLU n 
1 62  GLU n 
1 63  LYS n 
1 64  GLU n 
1 65  GLY n 
1 66  ASP n 
1 67  LEU n 
1 68  ASN n 
1 69  PHE n 
1 70  ALA n 
1 71  THR n 
1 72  THR n 
1 73  VAL n 
1 74  LEU n 
1 75  TYR n 
1 76  PRO n 
1 77  GLY n 
1 78  LYS n 
1 79  VAL n 
1 80  GLY n 
1 81  LYS n 
1 82  GLU n 
1 83  PHE n 
1 84  PHE n 
1 85  PHE n 
1 86  THR n 
1 87  LYS n 
1 88  GLY n 
1 89  HIS n 
1 90  PHE n 
1 91  HIS n 
1 92  ALA n 
1 93  LYS n 
1 94  LEU n 
1 95  ASP n 
1 96  ARG n 
1 97  ALA n 
1 98  GLU n 
1 99  VAL n 
1 100 TYR n 
1 101 VAL n 
1 102 ALA n 
1 103 LEU n 
1 104 LYS n 
1 105 GLY n 
1 106 LYS n 
1 107 GLY n 
1 108 GLY n 
1 109 MET n 
1 110 LEU n 
1 111 LEU n 
1 112 GLN n 
1 113 THR n 
1 114 PRO n 
1 115 GLU n 
1 116 GLY n 
1 117 ASP n 
1 118 ALA n 
1 119 LYS n 
1 120 TRP n 
1 121 ILE n 
1 122 SER n 
1 123 MET n 
1 124 GLU n 
1 125 PRO n 
1 126 GLY n 
1 127 THR n 
1 128 VAL n 
1 129 VAL n 
1 130 TYR n 
1 131 VAL n 
1 132 PRO n 
1 133 PRO n 
1 134 TYR n 
1 135 TRP n 
1 136 ALA n 
1 137 HIS n 
1 138 ARG n 
1 139 THR n 
1 140 VAL n 
1 141 ASN n 
1 142 ILE n 
1 143 GLY n 
1 144 ASP n 
1 145 GLU n 
1 146 PRO n 
1 147 PHE n 
1 148 ILE n 
1 149 PHE n 
1 150 LEU n 
1 151 ALA n 
1 152 ILE n 
1 153 TYR n 
1 154 PRO n 
1 155 ALA n 
1 156 ASP n 
1 157 ALA n 
1 158 GLY n 
1 159 HIS n 
1 160 ASP n 
1 161 TYR n 
1 162 GLY n 
1 163 THR n 
1 164 ILE n 
1 165 ALA n 
1 166 GLU n 
1 167 LYS n 
1 168 GLY n 
1 169 PHE n 
1 170 SER n 
1 171 LYS n 
1 172 ILE n 
1 173 VAL n 
1 174 ILE n 
1 175 GLU n 
1 176 GLU n 
1 177 ASN n 
1 178 GLY n 
1 179 GLU n 
1 180 VAL n 
1 181 LYS n 
1 182 VAL n 
1 183 VAL n 
1 184 ASP n 
1 185 ASN n 
1 186 PRO n 
1 187 ARG n 
1 188 TRP n 
1 189 LYS n 
1 190 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Pyrococcus 
_entity_src_gen.pdbx_gene_src_gene                 pgiA 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pyrococcus furiosus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2261 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET-24D 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    G6PI_PYRFU 
_struct_ref.pdbx_db_accession          P83194 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGK
EFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHDY
GTIAEKGFSKIVIEENGEVKVVDNPRWKK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1X7N 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 190 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P83194 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  189 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       189 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1X7N 
_struct_ref_seq_dif.mon_id                       MET 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P83194 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'INITIATING METHIONINE' 
_struct_ref_seq_dif.pdbx_auth_seq_num            0 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                      ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'  149.211 
MN  non-polymer         . 'MANGANESE (II) ION'       ? 'Mn 2'           54.938  
PA5 saccharide          . '5-PHOSPHOARABINONIC ACID' ? 'C5 H11 O9 P'    246.109 
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1X7N 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.9 
_exptl_crystal.density_percent_sol   35.9 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'1.6M tri-sodium citrate, 50mM 5-phospho-D-arabinonate, 100mM MnCl2, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2003-08-22 
_diffrn_detector.details                'yale mirrors' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54 
# 
_reflns.entry_id                     1X7N 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            1.89 
_reflns.d_resolution_low             49.39 
_reflns.number_all                   13726 
_reflns.number_obs                   13726 
_reflns.percent_possible_obs         97.9 
_reflns.pdbx_Rmerge_I_obs            0.052 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        4.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.89 
_reflns_shell.d_res_low              1.94 
_reflns_shell.percent_possible_all   81.3 
_reflns_shell.Rmerge_I_obs           0.349 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.79 
_reflns_shell.pdbx_redundancy        2.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      741 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1X7N 
_refine.ls_number_reflns_obs                     13075 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             49.39 
_refine.ls_d_res_high                            1.89 
_refine.ls_percent_reflns_obs                    96.97 
_refine.ls_R_factor_obs                          0.1439 
_refine.ls_R_factor_all                          0.1439 
_refine.ls_R_factor_R_work                       0.14051 
_refine.ls_R_factor_R_free                       0.21226 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.7 
_refine.ls_number_reflns_R_free                  651 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.976 
_refine.correlation_coeff_Fo_to_Fc_free          0.949 
_refine.B_iso_mean                               30.619 
_refine.aniso_B[1][1]                            -0.13 
_refine.aniso_B[2][2]                            0.26 
_refine.aniso_B[3][3]                            -0.33 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.19 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1PLZ 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.146 
_refine.pdbx_overall_ESU_R_Free                  0.150 
_refine.overall_SU_ML                            0.105 
_refine.overall_SU_B                             3.738 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1519 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         16 
_refine_hist.number_atoms_solvent             205 
_refine_hist.number_atoms_total               1740 
_refine_hist.d_res_high                       1.89 
_refine_hist.d_res_low                        49.39 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.011  0.022 ? 1575 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.002  0.020 ? 1394 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.354  1.960 ? 2131 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        0.739  3.000 ? 3260 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   7.053  5.000 ? 188  'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.082  0.200 ? 221  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.005  0.020 ? 1737 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.003  0.020 ? 325  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.201  0.200 ? 244  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.239  0.200 ? 1561 'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.082  0.200 ? 978  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.135  0.200 ? 133  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.133  0.200 ? 12   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.269  0.200 ? 89   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.145  0.200 ? 26   'X-RAY DIFFRACTION' ? 
r_mcbond_it              12.569 2.000 ? 936  'X-RAY DIFFRACTION' ? 
r_mcangle_it             14.296 3.000 ? 1510 'X-RAY DIFFRACTION' ? 
r_scbond_it              31.869 2.000 ? 639  'X-RAY DIFFRACTION' ? 
r_scangle_it             28.127 3.000 ? 621  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.891 
_refine_ls_shell.d_res_low                        1.940 
_refine_ls_shell.number_reflns_R_work             700 
_refine_ls_shell.R_factor_R_work                  0.26 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.329 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             39 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1X7N 
_struct.title                     
'The crystal structure of Pyrococcus furiosus phosphoglucose isomerase with bound 5-phospho-D-arabinonate and Manganese' 
_struct.pdbx_descriptor           'Glucose-6-phosphate isomerase (E.C.5.3.1.9)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1X7N 
_struct_keywords.pdbx_keywords   ISOMERASE 
_struct_keywords.text            
;CUPIN SUPERFAMILY, PYROCOCCUS FURIOSUS, HYPERTHERMOPHILE, PHOSPHOGLUCOSE ISOMERASE, EXTREMEOPHILE, 5-phospho-D-arabinonate, ISOMERASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The biological dimer is generated by 180 degree rotation around the y axis' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 29  ? MET A 31  ? SER A 28  MET A 30  5 ? 3  
HELX_P HELX_P2 2 ASP A 37  ? GLU A 48  ? ASP A 36  GLU A 47  1 ? 12 
HELX_P HELX_P3 3 TYR A 161 ? GLY A 168 ? TYR A 160 GLY A 167 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B MN . MN ? ? ? 1_555 D HOH .   O   ? ? A MN 400 A HOH 407 1_555 ? ? ? ? ? ? ? 2.279 ? 
metalc2 metalc ? ? B MN . MN ? ? ? 1_555 A HIS 91  NE2 ? ? A MN 400 A HIS 90  1_555 ? ? ? ? ? ? ? 2.653 ? 
metalc3 metalc ? ? B MN . MN ? ? ? 1_555 A HIS 89  NE2 ? ? A MN 400 A HIS 88  1_555 ? ? ? ? ? ? ? 2.440 ? 
metalc4 metalc ? ? B MN . MN ? ? ? 1_555 A GLU 98  OE1 ? ? A MN 400 A GLU 97  1_555 ? ? ? ? ? ? ? 2.309 ? 
metalc5 metalc ? ? B MN . MN ? ? ? 1_555 A HIS 137 NE2 ? ? A MN 400 A HIS 136 1_555 ? ? ? ? ? ? ? 2.333 ? 
metalc6 metalc ? ? B MN . MN ? ? ? 1_555 C PA5 .   O1  ? ? A MN 400 A PA5 301 1_555 ? ? ? ? ? ? ? 2.440 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 3 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 24  ? ARG A 27  ? SER A 23  ARG A 26  
A 2 VAL A 51  ? VAL A 58  ? VAL A 50  VAL A 57  
A 3 LEU A 67  ? LEU A 74  ? LEU A 66  LEU A 73  
A 4 PHE A 147 ? PRO A 154 ? PHE A 146 PRO A 153 
A 5 GLU A 98  ? LYS A 104 ? GLU A 97  LYS A 103 
A 6 VAL A 128 ? VAL A 131 ? VAL A 127 VAL A 130 
B 1 LYS A 78  ? VAL A 79  ? LYS A 77  VAL A 78  
B 2 GLU A 82  ? PHE A 83  ? GLU A 81  PHE A 82  
C 1 ALA A 118 ? MET A 123 ? ALA A 117 MET A 122 
C 2 GLY A 107 ? GLN A 112 ? GLY A 106 GLN A 111 
C 3 ALA A 136 ? ASN A 141 ? ALA A 135 ASN A 140 
D 1 LYS A 171 ? GLU A 176 ? LYS A 170 GLU A 175 
D 2 GLU A 179 ? ASP A 184 ? GLU A 178 ASP A 183 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 26  ? N ARG A 25  O TYR A 53  ? O TYR A 52  
A 2 3 N VAL A 58  ? N VAL A 57  O PHE A 69  ? O PHE A 68  
A 3 4 N ASN A 68  ? N ASN A 67  O TYR A 153 ? O TYR A 152 
A 4 5 O ILE A 152 ? O ILE A 151 N VAL A 99  ? N VAL A 98  
A 5 6 N GLU A 98  ? N GLU A 97  O VAL A 131 ? O VAL A 130 
B 1 2 N VAL A 79  ? N VAL A 78  O GLU A 82  ? O GLU A 81  
C 1 2 O ILE A 121 ? O ILE A 120 N MET A 109 ? N MET A 108 
C 2 3 N GLN A 112 ? N GLN A 111 O ALA A 136 ? O ALA A 135 
D 1 2 N ILE A 174 ? N ILE A 173 O LYS A 181 ? O LYS A 180 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN A 400'  
AC2 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE PA5 A 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  HIS A 89  ? HIS A 88  . ? 1_555 ? 
2  AC1 6  HIS A 91  ? HIS A 90  . ? 1_555 ? 
3  AC1 6  GLU A 98  ? GLU A 97  . ? 1_555 ? 
4  AC1 6  HIS A 137 ? HIS A 136 . ? 1_555 ? 
5  AC1 6  PA5 C .   ? PA5 A 301 . ? 1_555 ? 
6  AC1 6  HOH D .   ? HOH A 407 . ? 1_555 ? 
7  AC2 19 TYR A 53  ? TYR A 52  . ? 1_555 ? 
8  AC2 19 ALA A 70  ? ALA A 69  . ? 1_555 ? 
9  AC2 19 THR A 72  ? THR A 71  . ? 1_555 ? 
10 AC2 19 THR A 86  ? THR A 85  . ? 1_555 ? 
11 AC2 19 GLY A 88  ? GLY A 87  . ? 1_555 ? 
12 AC2 19 HIS A 89  ? HIS A 88  . ? 1_555 ? 
13 AC2 19 GLU A 98  ? GLU A 97  . ? 1_555 ? 
14 AC2 19 TYR A 100 ? TYR A 99  . ? 1_555 ? 
15 AC2 19 HIS A 137 ? HIS A 136 . ? 1_555 ? 
16 AC2 19 PHE A 149 ? PHE A 148 . ? 1_555 ? 
17 AC2 19 TYR A 153 ? TYR A 152 . ? 1_555 ? 
18 AC2 19 TYR A 161 ? TYR A 160 . ? 1_555 ? 
19 AC2 19 MN  B .   ? MN  A 400 . ? 1_555 ? 
20 AC2 19 HOH D .   ? HOH A 401 . ? 1_555 ? 
21 AC2 19 HOH D .   ? HOH A 402 . ? 1_555 ? 
22 AC2 19 HOH D .   ? HOH A 403 . ? 1_555 ? 
23 AC2 19 HOH D .   ? HOH A 404 . ? 1_555 ? 
24 AC2 19 HOH D .   ? HOH A 406 . ? 1_555 ? 
25 AC2 19 HOH D .   ? HOH A 407 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1X7N 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1X7N 
_atom_sites.fract_transf_matrix[1][1]   0.011810 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.006976 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.023595 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.020285 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 1   ? -20.696 -19.150 0.452  1.00 31.87  ? 0   MET A N   1 
ATOM   2    C  CA  . MET A 1 1   ? -19.692 -18.540 1.375  1.00 46.26  ? 0   MET A CA  1 
ATOM   3    C  C   . MET A 1 1   ? -20.045 -17.093 1.694  1.00 26.40  ? 0   MET A C   1 
ATOM   4    O  O   . MET A 1 1   ? -20.880 -16.477 1.012  1.00 28.51  ? 0   MET A O   1 
ATOM   5    C  CB  . MET A 1 1   ? -18.294 -18.587 0.753  1.00 48.98  ? 0   MET A CB  1 
ATOM   6    C  CG  . MET A 1 1   ? -18.177 -17.894 -0.620 1.00 60.53  ? 0   MET A CG  1 
ATOM   7    S  SD  . MET A 1 1   ? -16.449 -17.734 -1.190 1.00 56.16  ? 0   MET A SD  1 
ATOM   8    C  CE  . MET A 1 1   ? -15.674 -16.927 0.264  1.00 55.04  ? 0   MET A CE  1 
ATOM   9    N  N   . MET A 1 2   ? -19.398 -16.555 2.732  1.00 34.60  ? 1   MET A N   1 
ATOM   10   C  CA  . MET A 1 2   ? -19.466 -15.134 3.011  1.00 43.38  ? 1   MET A CA  1 
ATOM   11   C  C   . MET A 1 2   ? -18.370 -14.410 2.257  1.00 46.26  ? 1   MET A C   1 
ATOM   12   O  O   . MET A 1 2   ? -17.184 -14.708 2.380  1.00 46.92  ? 1   MET A O   1 
ATOM   13   C  CB  . MET A 1 2   ? -19.337 -14.801 4.498  1.00 46.36  ? 1   MET A CB  1 
ATOM   14   C  CG  . MET A 1 2   ? -19.796 -13.341 4.806  1.00 35.56  ? 1   MET A CG  1 
ATOM   15   S  SD  . MET A 1 2   ? -20.158 -13.077 6.550  1.00 57.76  ? 1   MET A SD  1 
ATOM   16   C  CE  . MET A 1 2   ? -18.529 -13.089 7.173  1.00 142.54 ? 1   MET A CE  1 
ATOM   17   N  N   . TYR A 1 3   ? -18.813 -13.459 1.459  1.00 28.47  ? 2   TYR A N   1 
ATOM   18   C  CA  . TYR A 1 3   ? -17.952 -12.491 0.831  1.00 24.00  ? 2   TYR A CA  1 
ATOM   19   C  C   . TYR A 1 3   ? -17.845 -11.361 1.837  1.00 28.67  ? 2   TYR A C   1 
ATOM   20   O  O   . TYR A 1 3   ? -18.849 -10.786 2.256  1.00 34.86  ? 2   TYR A O   1 
ATOM   21   C  CB  . TYR A 1 3   ? -18.551 -12.048 -0.507 1.00 31.27  ? 2   TYR A CB  1 
ATOM   22   C  CG  . TYR A 1 3   ? -18.671 -13.187 -1.505 1.00 28.78  ? 2   TYR A CG  1 
ATOM   23   C  CD1 . TYR A 1 3   ? -19.912 -13.644 -1.931 1.00 29.71  ? 2   TYR A CD1 1 
ATOM   24   C  CD2 . TYR A 1 3   ? -17.534 -13.828 -2.003 1.00 27.38  ? 2   TYR A CD2 1 
ATOM   25   C  CE1 . TYR A 1 3   ? -20.015 -14.673 -2.835 1.00 26.04  ? 2   TYR A CE1 1 
ATOM   26   C  CE2 . TYR A 1 3   ? -17.631 -14.847 -2.920 1.00 35.01  ? 2   TYR A CE2 1 
ATOM   27   C  CZ  . TYR A 1 3   ? -18.873 -15.277 -3.324 1.00 31.88  ? 2   TYR A CZ  1 
ATOM   28   O  OH  . TYR A 1 3   ? -18.968 -16.294 -4.231 1.00 38.05  ? 2   TYR A OH  1 
ATOM   29   N  N   . LYS A 1 4   ? -16.625 -11.118 2.302  1.00 27.74  ? 3   LYS A N   1 
ATOM   30   C  CA  . LYS A 1 4   ? -16.353 -10.042 3.238  1.00 31.82  ? 3   LYS A CA  1 
ATOM   31   C  C   . LYS A 1 4   ? -16.702 -8.731  2.579  1.00 27.70  ? 3   LYS A C   1 
ATOM   32   O  O   . LYS A 1 4   ? -16.678 -8.608  1.353  1.00 22.91  ? 3   LYS A O   1 
ATOM   33   C  CB  . LYS A 1 4   ? -14.875 -10.035 3.646  1.00 28.32  ? 3   LYS A CB  1 
ATOM   34   C  CG  . LYS A 1 4   ? -14.437 -11.297 4.395  1.00 33.52  ? 3   LYS A CG  1 
ATOM   35   C  CD  . LYS A 1 4   ? -12.918 -11.466 4.392  1.00 35.80  ? 3   LYS A CD  1 
ATOM   36   C  CE  . LYS A 1 4   ? -12.221 -10.452 5.244  1.00 38.87  ? 3   LYS A CE  1 
ATOM   37   N  NZ  . LYS A 1 4   ? -10.738 -10.667 5.253  1.00 23.99  ? 3   LYS A NZ  1 
ATOM   38   N  N   . GLU A 1 5   ? -17.021 -7.761  3.413  1.00 25.54  ? 4   GLU A N   1 
ATOM   39   C  CA  . GLU A 1 5   ? -17.522 -6.471  2.993  1.00 31.73  ? 4   GLU A CA  1 
ATOM   40   C  C   . GLU A 1 5   ? -16.346 -5.583  2.609  1.00 27.49  ? 4   GLU A C   1 
ATOM   41   O  O   . GLU A 1 5   ? -15.442 -5.370  3.433  1.00 22.57  ? 4   GLU A O   1 
ATOM   42   C  CB  . GLU A 1 5   ? -18.313 -5.833  4.158  1.00 38.88  ? 4   GLU A CB  1 
ATOM   43   C  CG  . GLU A 1 5   ? -19.133 -4.608  3.787  1.00 74.56  ? 4   GLU A CG  1 
ATOM   44   C  CD  . GLU A 1 5   ? -20.516 -4.959  3.283  1.00 98.34  ? 4   GLU A CD  1 
ATOM   45   O  OE1 . GLU A 1 5   ? -20.628 -5.868  2.433  1.00 61.75  ? 4   GLU A OE1 1 
ATOM   46   O  OE2 . GLU A 1 5   ? -21.489 -4.323  3.737  1.00 101.14 ? 4   GLU A OE2 1 
ATOM   47   N  N   . PRO A 1 6   ? -16.318 -5.078  1.368  1.00 23.43  ? 5   PRO A N   1 
ATOM   48   C  CA  . PRO A 1 6   ? -15.276 -4.110  1.004  1.00 24.93  ? 5   PRO A CA  1 
ATOM   49   C  C   . PRO A 1 6   ? -15.547 -2.837  1.773  1.00 27.88  ? 5   PRO A C   1 
ATOM   50   O  O   . PRO A 1 6   ? -16.688 -2.565  2.134  1.00 22.80  ? 5   PRO A O   1 
ATOM   51   C  CB  . PRO A 1 6   ? -15.454 -3.908  -0.504 1.00 24.17  ? 5   PRO A CB  1 
ATOM   52   C  CG  . PRO A 1 6   ? -16.335 -5.043  -0.956 1.00 29.29  ? 5   PRO A CG  1 
ATOM   53   C  CD  . PRO A 1 6   ? -17.213 -5.368  0.234  1.00 22.64  ? 5   PRO A CD  1 
ATOM   54   N  N   . PHE A 1 7   ? -14.508 -2.071  2.041  1.00 27.13  ? 6   PHE A N   1 
ATOM   55   C  CA  . PHE A 1 7   ? -14.697 -0.794  2.695  1.00 35.69  ? 6   PHE A CA  1 
ATOM   56   C  C   . PHE A 1 7   ? -13.595 0.186   2.346  1.00 29.44  ? 6   PHE A C   1 
ATOM   57   O  O   . PHE A 1 7   ? -12.510 -0.193  1.902  1.00 22.42  ? 6   PHE A O   1 
ATOM   58   C  CB  . PHE A 1 7   ? -14.781 -0.985  4.209  1.00 25.05  ? 6   PHE A CB  1 
ATOM   59   C  CG  . PHE A 1 7   ? -13.518 -1.544  4.841  1.00 20.35  ? 6   PHE A CG  1 
ATOM   60   C  CD1 . PHE A 1 7   ? -13.369 -2.907  5.040  1.00 25.73  ? 6   PHE A CD1 1 
ATOM   61   C  CD2 . PHE A 1 7   ? -12.505 -0.710  5.259  1.00 27.85  ? 6   PHE A CD2 1 
ATOM   62   C  CE1 . PHE A 1 7   ? -12.243 -3.410  5.623  1.00 28.34  ? 6   PHE A CE1 1 
ATOM   63   C  CE2 . PHE A 1 7   ? -11.367 -1.226  5.836  1.00 29.50  ? 6   PHE A CE2 1 
ATOM   64   C  CZ  . PHE A 1 7   ? -11.242 -2.575  6.021  1.00 30.25  ? 6   PHE A CZ  1 
ATOM   65   N  N   . GLY A 1 8   ? -13.905 1.457   2.540  1.00 22.55  ? 7   GLY A N   1 
ATOM   66   C  CA  . GLY A 1 8   ? -12.922 2.522   2.489  1.00 26.76  ? 7   GLY A CA  1 
ATOM   67   C  C   . GLY A 1 8   ? -12.739 3.051   3.882  1.00 36.43  ? 7   GLY A C   1 
ATOM   68   O  O   . GLY A 1 8   ? -13.679 3.062   4.678  1.00 29.18  ? 7   GLY A O   1 
ATOM   69   N  N   . VAL A 1 9   ? -11.522 3.446   4.207  1.00 26.16  ? 8   VAL A N   1 
ATOM   70   C  CA  . VAL A 1 9   ? -11.278 4.108   5.473  1.00 24.53  ? 8   VAL A CA  1 
ATOM   71   C  C   . VAL A 1 9   ? -10.430 5.338   5.189  1.00 25.70  ? 8   VAL A C   1 
ATOM   72   O  O   . VAL A 1 9   ? -9.587  5.322   4.307  1.00 23.84  ? 8   VAL A O   1 
ATOM   73   C  CB  . VAL A 1 9   ? -10.624 3.155   6.487  1.00 25.65  ? 8   VAL A CB  1 
ATOM   74   C  CG1 . VAL A 1 9   ? -9.175  2.830   6.087  1.00 30.39  ? 8   VAL A CG1 1 
ATOM   75   C  CG2 . VAL A 1 9   ? -10.684 3.741   7.879  1.00 41.70  ? 8   VAL A CG2 1 
ATOM   76   N  N   . LYS A 1 10  ? -10.673 6.412   5.926  1.00 28.86  ? 9   LYS A N   1 
ATOM   77   C  CA  . LYS A 1 10  ? -9.963  7.656   5.694  1.00 31.64  ? 9   LYS A CA  1 
ATOM   78   C  C   . LYS A 1 10  ? -8.683  7.653   6.500  1.00 34.95  ? 9   LYS A C   1 
ATOM   79   O  O   . LYS A 1 10  ? -8.665  7.355   7.695  1.00 28.97  ? 9   LYS A O   1 
ATOM   80   C  CB  . LYS A 1 10  ? -10.808 8.879   6.034  1.00 33.12  ? 9   LYS A CB  1 
ATOM   81   C  CG  . LYS A 1 10  ? -11.491 9.514   4.801  1.00 73.99  ? 9   LYS A CG  1 
ATOM   82   C  CD  . LYS A 1 10  ? -13.014 9.409   4.829  1.00 85.94  ? 9   LYS A CD  1 
ATOM   83   C  CE  . LYS A 1 10  ? -13.660 10.725  5.222  1.00 66.92  ? 9   LYS A CE  1 
ATOM   84   N  NZ  . LYS A 1 10  ? -13.145 11.208  6.531  1.00 84.18  ? 9   LYS A NZ  1 
ATOM   85   N  N   . VAL A 1 11  ? -7.602  7.965   5.816  1.00 22.71  ? 10  VAL A N   1 
ATOM   86   C  CA  . VAL A 1 11  ? -6.301  8.064   6.468  1.00 25.48  ? 10  VAL A CA  1 
ATOM   87   C  C   . VAL A 1 11  ? -5.848  9.477   6.263  1.00 29.77  ? 10  VAL A C   1 
ATOM   88   O  O   . VAL A 1 11  ? -5.838  9.977   5.141  1.00 28.90  ? 10  VAL A O   1 
ATOM   89   C  CB  . VAL A 1 11  ? -5.286  7.096   5.876  1.00 35.79  ? 10  VAL A CB  1 
ATOM   90   C  CG1 . VAL A 1 11  ? -3.903  7.326   6.511  1.00 39.00  ? 10  VAL A CG1 1 
ATOM   91   C  CG2 . VAL A 1 11  ? -5.772  5.652   6.058  1.00 25.65  ? 10  VAL A CG2 1 
ATOM   92   N  N   . ASP A 1 12  ? -5.499  10.118  7.370  1.00 26.66  ? 11  ASP A N   1 
ATOM   93   C  CA  . ASP A 1 12  ? -5.037  11.483  7.376  1.00 34.52  ? 11  ASP A CA  1 
ATOM   94   C  C   . ASP A 1 12  ? -3.533  11.437  7.156  1.00 26.21  ? 11  ASP A C   1 
ATOM   95   O  O   . ASP A 1 12  ? -2.804  10.957  8.026  1.00 27.91  ? 11  ASP A O   1 
ATOM   96   C  CB  . ASP A 1 12  ? -5.392  12.100  8.730  1.00 42.23  ? 11  ASP A CB  1 
ATOM   97   C  CG  . ASP A 1 12  ? -5.252  13.592  8.743  1.00 36.77  ? 11  ASP A CG  1 
ATOM   98   O  OD1 . ASP A 1 12  ? -4.525  14.126  7.880  1.00 38.79  ? 11  ASP A OD1 1 
ATOM   99   O  OD2 . ASP A 1 12  ? -5.833  14.310  9.593  1.00 35.28  ? 11  ASP A OD2 1 
ATOM   100  N  N   . PHE A 1 13  ? -3.076  11.907  5.987  1.00 23.48  ? 12  PHE A N   1 
ATOM   101  C  CA  . PHE A 1 13  ? -1.652  11.840  5.607  1.00 28.26  ? 12  PHE A CA  1 
ATOM   102  C  C   . PHE A 1 13  ? -0.805  12.808  6.436  1.00 36.63  ? 12  PHE A C   1 
ATOM   103  O  O   . PHE A 1 13  ? 0.415   12.746  6.400  1.00 26.91  ? 12  PHE A O   1 
ATOM   104  C  CB  . PHE A 1 13  ? -1.450  12.155  4.114  1.00 30.15  ? 12  PHE A CB  1 
ATOM   105  C  CG  . PHE A 1 13  ? -1.806  11.018  3.172  1.00 31.18  ? 12  PHE A CG  1 
ATOM   106  C  CD1 . PHE A 1 13  ? -2.412  9.855   3.626  1.00 24.85  ? 12  PHE A CD1 1 
ATOM   107  C  CD2 . PHE A 1 13  ? -1.510  11.122  1.820  1.00 41.00  ? 12  PHE A CD2 1 
ATOM   108  C  CE1 . PHE A 1 13  ? -2.740  8.829   2.747  1.00 24.58  ? 12  PHE A CE1 1 
ATOM   109  C  CE2 . PHE A 1 13  ? -1.825  10.093  0.938  1.00 31.89  ? 12  PHE A CE2 1 
ATOM   110  C  CZ  . PHE A 1 13  ? -2.437  8.949   1.401  1.00 30.44  ? 12  PHE A CZ  1 
ATOM   111  N  N   . GLU A 1 14  ? -1.462  13.703  7.172  1.00 31.12  ? 13  GLU A N   1 
ATOM   112  C  CA  . GLU A 1 14  ? -0.783  14.648  8.057  1.00 28.05  ? 13  GLU A CA  1 
ATOM   113  C  C   . GLU A 1 14  ? -0.553  14.110  9.471  1.00 30.50  ? 13  GLU A C   1 
ATOM   114  O  O   . GLU A 1 14  ? 0.406   14.498  10.132 1.00 35.90  ? 13  GLU A O   1 
ATOM   115  C  CB  . GLU A 1 14  ? -1.598  15.947  8.148  1.00 37.56  ? 13  GLU A CB  1 
ATOM   116  C  CG  . GLU A 1 14  ? -1.563  16.775  6.872  1.00 34.96  ? 13  GLU A CG  1 
ATOM   117  C  CD  . GLU A 1 14  ? -0.223  17.470  6.665  1.00 39.43  ? 13  GLU A CD  1 
ATOM   118  O  OE1 . GLU A 1 14  ? 0.126   18.355  7.480  1.00 73.54  ? 13  GLU A OE1 1 
ATOM   119  O  OE2 . GLU A 1 14  ? 0.480   17.127  5.688  1.00 65.84  ? 13  GLU A OE2 1 
ATOM   120  N  N   . THR A 1 15  ? -1.454  13.263  9.952  1.00 27.46  ? 14  THR A N   1 
ATOM   121  C  CA  . THR A 1 15  ? -1.371  12.745  11.324 1.00 28.70  ? 14  THR A CA  1 
ATOM   122  C  C   . THR A 1 15  ? -1.133  11.234  11.394 1.00 35.73  ? 14  THR A C   1 
ATOM   123  O  O   . THR A 1 15  ? -0.862  10.701  12.478 1.00 27.33  ? 14  THR A O   1 
ATOM   124  C  CB  . THR A 1 15  ? -2.680  13.033  12.063 1.00 38.27  ? 14  THR A CB  1 
ATOM   125  O  OG1 . THR A 1 15  ? -3.732  12.255  11.480 1.00 27.39  ? 14  THR A OG1 1 
ATOM   126  C  CG2 . THR A 1 15  ? -3.131  14.515  11.895 1.00 37.69  ? 14  THR A CG2 1 
ATOM   127  N  N   . GLY A 1 16  ? -1.291  10.547  10.260 1.00 33.97  ? 15  GLY A N   1 
ATOM   128  C  CA  . GLY A 1 16  ? -1.258  9.089   10.204 1.00 28.16  ? 15  GLY A CA  1 
ATOM   129  C  C   . GLY A 1 16  ? -2.408  8.364   10.885 1.00 28.91  ? 15  GLY A C   1 
ATOM   130  O  O   . GLY A 1 16  ? -2.435  7.128   10.923 1.00 25.88  ? 15  GLY A O   1 
ATOM   131  N  N   . ILE A 1 17  ? -3.383  9.107   11.410 1.00 33.35  ? 16  ILE A N   1 
ATOM   132  C  CA  . ILE A 1 17  ? -4.518  8.477   12.067 1.00 25.73  ? 16  ILE A CA  1 
ATOM   133  C  C   . ILE A 1 17  ? -5.449  7.816   11.026 1.00 27.92  ? 16  ILE A C   1 
ATOM   134  O  O   . ILE A 1 17  ? -5.870  8.439   10.044 1.00 30.21  ? 16  ILE A O   1 
ATOM   135  C  CB  . ILE A 1 17  ? -5.299  9.489   12.952 1.00 26.27  ? 16  ILE A CB  1 
ATOM   136  C  CG1 . ILE A 1 17  ? -4.413  9.985   14.109 1.00 26.72  ? 16  ILE A CG1 1 
ATOM   137  C  CG2 . ILE A 1 17  ? -6.571  8.829   13.499 1.00 32.40  ? 16  ILE A CG2 1 
ATOM   138  C  CD1 . ILE A 1 17  ? -4.911  11.227  14.857 1.00 31.44  ? 16  ILE A CD1 1 
ATOM   139  N  N   . ILE A 1 18  ? -5.760  6.545   11.258 1.00 28.81  ? 17  ILE A N   1 
ATOM   140  C  CA  . ILE A 1 18  ? -6.783  5.847   10.495 1.00 46.20  ? 17  ILE A CA  1 
ATOM   141  C  C   . ILE A 1 18  ? -8.059  5.890   11.317 1.00 33.01  ? 17  ILE A C   1 
ATOM   142  O  O   . ILE A 1 18  ? -8.110  5.339   12.433 1.00 28.28  ? 17  ILE A O   1 
ATOM   143  C  CB  . ILE A 1 18  ? -6.398  4.379   10.241 1.00 32.69  ? 17  ILE A CB  1 
ATOM   144  C  CG1 . ILE A 1 18  ? -5.055  4.276   9.504  1.00 26.67  ? 17  ILE A CG1 1 
ATOM   145  C  CG2 . ILE A 1 18  ? -7.508  3.671   9.449  1.00 32.18  ? 17  ILE A CG2 1 
ATOM   146  C  CD1 . ILE A 1 18  ? -4.604  2.874   9.289  1.00 24.82  ? 17  ILE A CD1 1 
ATOM   147  N  N   . GLU A 1 19  ? -9.085  6.521   10.755 1.00 38.11  ? 18  GLU A N   1 
ATOM   148  C  CA  . GLU A 1 19  ? -10.382 6.666   11.417 1.00 50.21  ? 18  GLU A CA  1 
ATOM   149  C  C   . GLU A 1 19  ? -10.922 5.323   11.855 1.00 46.95  ? 18  GLU A C   1 
ATOM   150  O  O   . GLU A 1 19  ? -10.930 4.364   11.072 1.00 40.92  ? 18  GLU A O   1 
ATOM   151  C  CB  . GLU A 1 19  ? -11.391 7.324   10.479 1.00 48.77  ? 18  GLU A CB  1 
ATOM   152  C  CG  . GLU A 1 19  ? -11.207 8.826   10.349 1.00 82.55  ? 18  GLU A CG  1 
ATOM   153  C  CD  . GLU A 1 19  ? -12.311 9.485   9.547  1.00 128.33 ? 18  GLU A CD  1 
ATOM   154  O  OE1 . GLU A 1 19  ? -13.344 8.831   9.269  1.00 42.20  ? 18  GLU A OE1 1 
ATOM   155  O  OE2 . GLU A 1 19  ? -12.141 10.667  9.195  1.00 55.11  ? 18  GLU A OE2 1 
ATOM   156  N  N   . GLY A 1 20  ? -11.350 5.257   13.115 1.00 38.31  ? 19  GLY A N   1 
ATOM   157  C  CA  . GLY A 1 20  ? -11.927 4.053   13.685 1.00 43.45  ? 19  GLY A CA  1 
ATOM   158  C  C   . GLY A 1 20  ? -10.986 2.890   13.964 1.00 50.05  ? 19  GLY A C   1 
ATOM   159  O  O   . GLY A 1 20  ? -11.468 1.802   14.274 1.00 51.85  ? 19  GLY A O   1 
ATOM   160  N  N   . ALA A 1 21  ? -9.666  3.100   13.889 1.00 32.72  ? 20  ALA A N   1 
ATOM   161  C  CA  . ALA A 1 21  ? -8.693  1.982   13.911 1.00 64.64  ? 20  ALA A CA  1 
ATOM   162  C  C   . ALA A 1 21  ? -8.199  1.546   15.294 1.00 128.89 ? 20  ALA A C   1 
ATOM   163  O  O   . ALA A 1 21  ? -7.994  0.348   15.520 1.00 68.42  ? 20  ALA A O   1 
ATOM   164  C  CB  . ALA A 1 21  ? -7.492  2.296   13.027 1.00 43.47  ? 20  ALA A CB  1 
ATOM   165  N  N   . LYS A 1 22  ? -7.968  2.510   16.187 1.00 47.62  ? 21  LYS A N   1 
ATOM   166  C  CA  . LYS A 1 22  ? -7.538  2.234   17.579 1.00 160.65 ? 21  LYS A CA  1 
ATOM   167  C  C   . LYS A 1 22  ? -6.008  2.145   17.795 1.00 41.67  ? 21  LYS A C   1 
ATOM   168  O  O   . LYS A 1 22  ? -5.356  1.154   17.437 1.00 37.79  ? 21  LYS A O   1 
ATOM   169  C  CB  . LYS A 1 22  ? -8.216  0.975   18.151 1.00 101.91 ? 21  LYS A CB  1 
ATOM   170  C  CG  . LYS A 1 22  ? -8.183  0.881   19.676 1.00 70.87  ? 21  LYS A CG  1 
ATOM   171  C  CD  . LYS A 1 22  ? -7.364  -0.319  20.146 1.00 146.50 ? 21  LYS A CD  1 
ATOM   172  C  CE  . LYS A 1 22  ? -7.216  -0.343  21.656 1.00 108.26 ? 21  LYS A CE  1 
ATOM   173  N  NZ  . LYS A 1 22  ? -6.519  0.874   22.154 1.00 64.82  ? 21  LYS A NZ  1 
ATOM   174  N  N   . LYS A 1 23  ? -5.472  3.200   18.409 1.00 34.92  ? 22  LYS A N   1 
ATOM   175  C  CA  . LYS A 1 23  ? -4.062  3.335   18.768 1.00 42.70  ? 22  LYS A CA  1 
ATOM   176  C  C   . LYS A 1 23  ? -3.493  2.149   19.534 1.00 50.61  ? 22  LYS A C   1 
ATOM   177  O  O   . LYS A 1 23  ? -4.020  1.776   20.584 1.00 42.56  ? 22  LYS A O   1 
ATOM   178  C  CB  . LYS A 1 23  ? -3.886  4.557   19.688 1.00 56.98  ? 22  LYS A CB  1 
ATOM   179  C  CG  . LYS A 1 23  ? -3.343  5.792   19.047 1.00 45.05  ? 22  LYS A CG  1 
ATOM   180  C  CD  . LYS A 1 23  ? -2.714  6.729   20.083 1.00 40.35  ? 22  LYS A CD  1 
ATOM   181  C  CE  . LYS A 1 23  ? -3.700  7.109   21.193 1.00 83.49  ? 22  LYS A CE  1 
ATOM   182  N  NZ  . LYS A 1 23  ? -3.374  8.425   21.813 1.00 61.43  ? 22  LYS A NZ  1 
ATOM   183  N  N   . SER A 1 24  ? -2.418  1.573   19.005 1.00 34.90  ? 23  SER A N   1 
ATOM   184  C  CA  . SER A 1 24  ? -1.413  0.888   19.822 1.00 26.53  ? 23  SER A CA  1 
ATOM   185  C  C   . SER A 1 24  ? -0.215  1.841   20.090 1.00 31.76  ? 23  SER A C   1 
ATOM   186  O  O   . SER A 1 24  ? 0.277   2.486   19.183 1.00 28.69  ? 23  SER A O   1 
ATOM   187  C  CB  . SER A 1 24  ? -0.955  -0.391  19.140 1.00 37.96  ? 23  SER A CB  1 
ATOM   188  O  OG  . SER A 1 24  ? -0.021  -1.063  19.955 1.00 48.25  ? 23  SER A OG  1 
ATOM   189  N  N   . VAL A 1 25  ? 0.248   1.911   21.339 1.00 32.88  ? 24  VAL A N   1 
ATOM   190  C  CA  . VAL A 1 25  ? 1.293   2.856   21.764 1.00 32.65  ? 24  VAL A CA  1 
ATOM   191  C  C   . VAL A 1 25  ? 2.506   2.092   22.289 1.00 32.35  ? 24  VAL A C   1 
ATOM   192  O  O   . VAL A 1 25  ? 2.369   1.246   23.163 1.00 25.68  ? 24  VAL A O   1 
ATOM   193  C  CB  . VAL A 1 25  ? 0.779   3.809   22.882 1.00 33.74  ? 24  VAL A CB  1 
ATOM   194  C  CG1 . VAL A 1 25  ? 1.879   4.763   23.350 1.00 32.02  ? 24  VAL A CG1 1 
ATOM   195  C  CG2 . VAL A 1 25  ? -0.466  4.563   22.422 1.00 50.26  ? 24  VAL A CG2 1 
ATOM   196  N  N   . ARG A 1 26  ? 3.685   2.377   21.735 1.00 23.41  ? 25  ARG A N   1 
ATOM   197  C  CA  . ARG A 1 26  ? 4.952   1.854   22.247 1.00 24.79  ? 25  ARG A CA  1 
ATOM   198  C  C   . ARG A 1 26  ? 5.710   3.018   22.883 1.00 20.37  ? 25  ARG A C   1 
ATOM   199  O  O   . ARG A 1 26  ? 6.084   3.986   22.202 1.00 23.95  ? 25  ARG A O   1 
ATOM   200  C  CB  . ARG A 1 26  ? 5.806   1.177   21.151 1.00 37.02  ? 25  ARG A CB  1 
ATOM   201  C  CG  . ARG A 1 26  ? 5.466   -0.325  20.857 1.00 32.13  ? 25  ARG A CG  1 
ATOM   202  C  CD  . ARG A 1 26  ? 5.471   -1.286  22.053 1.00 160.54 ? 25  ARG A CD  1 
ATOM   203  N  NE  . ARG A 1 26  ? 4.598   -2.442  21.828 1.00 155.90 ? 25  ARG A NE  1 
ATOM   204  C  CZ  . ARG A 1 26  ? 4.271   -3.351  22.752 1.00 185.16 ? 25  ARG A CZ  1 
ATOM   205  N  NH1 . ARG A 1 26  ? 4.740   -3.268  23.995 1.00 84.54  ? 25  ARG A NH1 1 
ATOM   206  N  NH2 . ARG A 1 26  ? 3.465   -4.360  22.430 1.00 93.62  ? 25  ARG A NH2 1 
ATOM   207  N  N   . ARG A 1 27  ? 5.863   2.934   24.205 1.00 21.72  ? 26  ARG A N   1 
ATOM   208  C  CA  . ARG A 1 27  ? 6.666   3.860   24.982 1.00 31.02  ? 26  ARG A CA  1 
ATOM   209  C  C   . ARG A 1 27  ? 8.093   3.346   25.034 1.00 25.80  ? 26  ARG A C   1 
ATOM   210  O  O   . ARG A 1 27  ? 8.350   2.167   24.789 1.00 25.88  ? 26  ARG A O   1 
ATOM   211  C  CB  . ARG A 1 27  ? 6.115   3.976   26.407 1.00 28.99  ? 26  ARG A CB  1 
ATOM   212  C  CG  . ARG A 1 27  ? 4.666   4.451   26.478 1.00 30.70  ? 26  ARG A CG  1 
ATOM   213  C  CD  . ARG A 1 27  ? 4.238   4.952   27.856 1.00 32.42  ? 26  ARG A CD  1 
ATOM   214  N  NE  . ARG A 1 27  ? 4.614   6.344   27.986 1.00 34.53  ? 26  ARG A NE  1 
ATOM   215  C  CZ  . ARG A 1 27  ? 3.879   7.379   27.594 1.00 32.12  ? 26  ARG A CZ  1 
ATOM   216  N  NH1 . ARG A 1 27  ? 2.658   7.222   27.107 1.00 27.03  ? 26  ARG A NH1 1 
ATOM   217  N  NH2 . ARG A 1 27  ? 4.377   8.598   27.703 1.00 26.60  ? 26  ARG A NH2 1 
ATOM   218  N  N   . LEU A 1 28  ? 9.027   4.228   25.374 1.00 25.93  ? 27  LEU A N   1 
ATOM   219  C  CA  . LEU A 1 28  ? 10.422  3.838   25.500 1.00 32.14  ? 27  LEU A CA  1 
ATOM   220  C  C   . LEU A 1 28  ? 10.595  2.677   26.494 1.00 31.68  ? 27  LEU A C   1 
ATOM   221  O  O   . LEU A 1 28  ? 11.373  1.770   26.236 1.00 25.89  ? 27  LEU A O   1 
ATOM   222  C  CB  . LEU A 1 28  ? 11.280  5.040   25.890 1.00 28.28  ? 27  LEU A CB  1 
ATOM   223  C  CG  . LEU A 1 28  ? 12.789  4.856   25.776 1.00 26.80  ? 27  LEU A CG  1 
ATOM   224  C  CD1 . LEU A 1 28  ? 13.187  4.432   24.372 1.00 24.14  ? 27  LEU A CD1 1 
ATOM   225  C  CD2 . LEU A 1 28  ? 13.511  6.127   26.178 1.00 29.07  ? 27  LEU A CD2 1 
ATOM   226  N  N   . SER A 1 29  ? 9.815   2.675   27.578 1.00 25.15  ? 28  SER A N   1 
ATOM   227  C  CA  . SER A 1 29  ? 9.886   1.623   28.603 1.00 31.33  ? 28  SER A CA  1 
ATOM   228  C  C   . SER A 1 29  ? 9.493   0.249   28.063 1.00 27.84  ? 28  SER A C   1 
ATOM   229  O  O   . SER A 1 29  ? 9.795   -0.771  28.670 1.00 31.07  ? 28  SER A O   1 
ATOM   230  C  CB  . SER A 1 29  ? 8.981   1.971   29.800 1.00 30.74  ? 28  SER A CB  1 
ATOM   231  O  OG  . SER A 1 29  ? 7.621   2.184   29.413 1.00 25.57  ? 28  SER A OG  1 
ATOM   232  N  N   . ASP A 1 30  ? 8.784   0.225   26.935 1.00 27.30  ? 29  ASP A N   1 
ATOM   233  C  CA  . ASP A 1 30  ? 8.468   -1.028  26.225 1.00 27.92  ? 29  ASP A CA  1 
ATOM   234  C  C   . ASP A 1 30  ? 9.620   -1.540  25.348 1.00 28.33  ? 29  ASP A C   1 
ATOM   235  O  O   . ASP A 1 30  ? 9.471   -2.554  24.677 1.00 35.10  ? 29  ASP A O   1 
ATOM   236  C  CB  . ASP A 1 30  ? 7.215   -0.862  25.347 1.00 34.86  ? 29  ASP A CB  1 
ATOM   237  C  CG  . ASP A 1 30  ? 5.981   -0.457  26.135 1.00 41.71  ? 29  ASP A CG  1 
ATOM   238  O  OD1 . ASP A 1 30  ? 5.726   -1.064  27.192 1.00 40.85  ? 29  ASP A OD1 1 
ATOM   239  O  OD2 . ASP A 1 30  ? 5.188   0.444   25.763 1.00 34.86  ? 29  ASP A OD2 1 
ATOM   240  N  N   . MET A 1 31  ? 10.770  -0.868  25.361 1.00 26.00  ? 30  MET A N   1 
ATOM   241  C  CA  . MET A 1 31  ? 11.878  -1.229  24.463 1.00 32.81  ? 30  MET A CA  1 
ATOM   242  C  C   . MET A 1 31  ? 13.210  -1.418  25.211 1.00 25.82  ? 30  MET A C   1 
ATOM   243  O  O   . MET A 1 31  ? 14.281  -0.994  24.754 1.00 29.83  ? 30  MET A O   1 
ATOM   244  C  CB  . MET A 1 31  ? 12.021  -0.182  23.374 1.00 27.08  ? 30  MET A CB  1 
ATOM   245  C  CG  . MET A 1 31  ? 10.700  0.097   22.605 1.00 35.65  ? 30  MET A CG  1 
ATOM   246  S  SD  . MET A 1 31  ? 10.906  1.407   21.386 1.00 27.96  ? 30  MET A SD  1 
ATOM   247  C  CE  . MET A 1 31  ? 12.092  0.643   20.207 1.00 28.00  ? 30  MET A CE  1 
ATOM   248  N  N   . GLU A 1 32  ? 13.125  -2.048  26.372 1.00 28.07  ? 31  GLU A N   1 
ATOM   249  C  CA  . GLU A 1 32  ? 14.319  -2.442  27.091 1.00 31.64  ? 31  GLU A CA  1 
ATOM   250  C  C   . GLU A 1 32  ? 15.102  -3.415  26.228 1.00 25.46  ? 31  GLU A C   1 
ATOM   251  O  O   . GLU A 1 32  ? 14.521  -4.324  25.614 1.00 31.03  ? 31  GLU A O   1 
ATOM   252  C  CB  . GLU A 1 32  ? 13.997  -3.105  28.431 1.00 30.80  ? 31  GLU A CB  1 
ATOM   253  C  CG  . GLU A 1 32  ? 15.214  -3.156  29.346 1.00 43.45  ? 31  GLU A CG  1 
ATOM   254  C  CD  . GLU A 1 32  ? 14.904  -3.613  30.762 1.00 48.93  ? 31  GLU A CD  1 
ATOM   255  O  OE1 . GLU A 1 32  ? 13.726  -3.904  31.074 1.00 52.05  ? 31  GLU A OE1 1 
ATOM   256  O  OE2 . GLU A 1 32  ? 15.856  -3.669  31.567 1.00 49.12  ? 31  GLU A OE2 1 
ATOM   257  N  N   . GLY A 1 33  ? 16.406  -3.190  26.184 1.00 28.14  ? 32  GLY A N   1 
ATOM   258  C  CA  . GLY A 1 33  ? 17.346  -4.041  25.471 1.00 44.64  ? 32  GLY A CA  1 
ATOM   259  C  C   . GLY A 1 33  ? 17.478  -3.749  23.988 1.00 39.19  ? 32  GLY A C   1 
ATOM   260  O  O   . GLY A 1 33  ? 18.066  -4.546  23.280 1.00 35.00  ? 32  GLY A O   1 
ATOM   261  N  N   . TYR A 1 34  ? 16.928  -2.626  23.516 1.00 31.68  ? 33  TYR A N   1 
ATOM   262  C  CA  . TYR A 1 34  ? 16.892  -2.308  22.076 1.00 29.06  ? 33  TYR A CA  1 
ATOM   263  C  C   . TYR A 1 34  ? 17.981  -1.353  21.638 1.00 19.96  ? 33  TYR A C   1 
ATOM   264  O  O   . TYR A 1 34  ? 18.511  -1.481  20.537 1.00 29.14  ? 33  TYR A O   1 
ATOM   265  C  CB  . TYR A 1 34  ? 15.503  -1.760  21.674 1.00 25.02  ? 33  TYR A CB  1 
ATOM   266  C  CG  . TYR A 1 34  ? 14.512  -2.879  21.387 1.00 22.53  ? 33  TYR A CG  1 
ATOM   267  C  CD1 . TYR A 1 34  ? 13.777  -3.479  22.411 1.00 28.95  ? 33  TYR A CD1 1 
ATOM   268  C  CD2 . TYR A 1 34  ? 14.361  -3.380  20.102 1.00 22.65  ? 33  TYR A CD2 1 
ATOM   269  C  CE1 . TYR A 1 34  ? 12.885  -4.522  22.147 1.00 27.60  ? 33  TYR A CE1 1 
ATOM   270  C  CE2 . TYR A 1 34  ? 13.480  -4.438  19.822 1.00 22.39  ? 33  TYR A CE2 1 
ATOM   271  C  CZ  . TYR A 1 34  ? 12.746  -5.005  20.849 1.00 20.80  ? 33  TYR A CZ  1 
ATOM   272  O  OH  . TYR A 1 34  ? 11.871  -6.036  20.556 1.00 25.86  ? 33  TYR A OH  1 
ATOM   273  N  N   . PHE A 1 35  ? 18.283  -0.371  22.495 1.00 34.01  ? 34  PHE A N   1 
ATOM   274  C  CA  . PHE A 1 35  ? 19.197  0.722   22.173 1.00 27.75  ? 34  PHE A CA  1 
ATOM   275  C  C   . PHE A 1 35  ? 20.613  0.407   22.670 1.00 21.21  ? 34  PHE A C   1 
ATOM   276  O  O   . PHE A 1 35  ? 20.792  -0.317  23.647 1.00 33.91  ? 34  PHE A O   1 
ATOM   277  C  CB  . PHE A 1 35  ? 18.651  2.032   22.762 1.00 30.00  ? 34  PHE A CB  1 
ATOM   278  C  CG  . PHE A 1 35  ? 17.381  2.493   22.097 1.00 34.88  ? 34  PHE A CG  1 
ATOM   279  C  CD1 . PHE A 1 35  ? 16.145  2.143   22.615 1.00 29.63  ? 34  PHE A CD1 1 
ATOM   280  C  CD2 . PHE A 1 35  ? 17.433  3.219   20.913 1.00 38.98  ? 34  PHE A CD2 1 
ATOM   281  C  CE1 . PHE A 1 35  ? 14.976  2.539   21.986 1.00 27.10  ? 34  PHE A CE1 1 
ATOM   282  C  CE2 . PHE A 1 35  ? 16.285  3.609   20.273 1.00 22.04  ? 34  PHE A CE2 1 
ATOM   283  C  CZ  . PHE A 1 35  ? 15.049  3.277   20.806 1.00 26.23  ? 34  PHE A CZ  1 
ATOM   284  N  N   . VAL A 1 36  ? 21.608  0.916   21.957 1.00 23.47  ? 35  VAL A N   1 
ATOM   285  C  CA  . VAL A 1 36  ? 23.013  0.615   22.235 1.00 29.54  ? 35  VAL A CA  1 
ATOM   286  C  C   . VAL A 1 36  ? 23.471  1.195   23.580 1.00 34.13  ? 35  VAL A C   1 
ATOM   287  O  O   . VAL A 1 36  ? 24.213  0.557   24.314 1.00 34.75  ? 35  VAL A O   1 
ATOM   288  C  CB  . VAL A 1 36  ? 23.927  1.111   21.082 1.00 52.63  ? 35  VAL A CB  1 
ATOM   289  C  CG1 . VAL A 1 36  ? 25.404  0.967   21.439 1.00 37.91  ? 35  VAL A CG1 1 
ATOM   290  C  CG2 . VAL A 1 36  ? 23.623  0.335   19.807 1.00 68.41  ? 35  VAL A CG2 1 
ATOM   291  N  N   . ASP A 1 37  ? 22.993  2.385   23.910 1.00 31.30  ? 36  ASP A N   1 
ATOM   292  C  CA  . ASP A 1 37  ? 23.346  3.047   25.162 1.00 27.55  ? 36  ASP A CA  1 
ATOM   293  C  C   . ASP A 1 37  ? 22.268  2.767   26.214 1.00 29.75  ? 36  ASP A C   1 
ATOM   294  O  O   . ASP A 1 37  ? 21.318  3.525   26.350 1.00 32.05  ? 36  ASP A O   1 
ATOM   295  C  CB  . ASP A 1 37  ? 23.507  4.558   24.909 1.00 31.37  ? 36  ASP A CB  1 
ATOM   296  C  CG  . ASP A 1 37  ? 24.155  5.289   26.081 1.00 30.77  ? 36  ASP A CG  1 
ATOM   297  O  OD1 . ASP A 1 37  ? 24.060  4.791   27.217 1.00 32.24  ? 36  ASP A OD1 1 
ATOM   298  O  OD2 . ASP A 1 37  ? 24.753  6.376   25.953 1.00 34.85  ? 36  ASP A OD2 1 
ATOM   299  N  N   . GLU A 1 38  ? 22.433  1.686   26.979 1.00 25.97  ? 37  GLU A N   1 
ATOM   300  C  CA  . GLU A 1 38  ? 21.424  1.256   27.953 1.00 24.77  ? 37  GLU A CA  1 
ATOM   301  C  C   . GLU A 1 38  ? 21.229  2.235   29.120 1.00 25.39  ? 37  GLU A C   1 
ATOM   302  O  O   . GLU A 1 38  ? 20.147  2.316   29.698 1.00 29.61  ? 37  GLU A O   1 
ATOM   303  C  CB  . GLU A 1 38  ? 21.757  -0.155  28.492 1.00 38.01  ? 37  GLU A CB  1 
ATOM   304  C  CG  . GLU A 1 38  ? 20.843  -0.648  29.616 1.00 50.14  ? 37  GLU A CG  1 
ATOM   305  C  CD  . GLU A 1 38  ? 21.370  -0.328  31.017 1.00 209.26 ? 37  GLU A CD  1 
ATOM   306  O  OE1 . GLU A 1 38  ? 20.628  0.285   31.829 1.00 69.53  ? 37  GLU A OE1 1 
ATOM   307  O  OE2 . GLU A 1 38  ? 22.530  -0.691  31.315 1.00 135.94 ? 37  GLU A OE2 1 
ATOM   308  N  N   . ARG A 1 39  ? 22.283  2.962   29.485 1.00 28.32  ? 38  ARG A N   1 
ATOM   309  C  CA  . ARG A 1 39  ? 22.166  3.930   30.567 1.00 30.63  ? 38  ARG A CA  1 
ATOM   310  C  C   . ARG A 1 39  ? 21.358  5.137   30.096 1.00 28.74  ? 38  ARG A C   1 
ATOM   311  O  O   . ARG A 1 39  ? 20.537  5.655   30.849 1.00 30.66  ? 38  ARG A O   1 
ATOM   312  C  CB  . ARG A 1 39  ? 23.542  4.355   31.081 1.00 30.08  ? 38  ARG A CB  1 
ATOM   313  C  CG  . ARG A 1 39  ? 24.275  3.246   31.844 1.00 38.02  ? 38  ARG A CG  1 
ATOM   314  C  CD  . ARG A 1 39  ? 25.647  3.676   32.353 1.00 37.28  ? 38  ARG A CD  1 
ATOM   315  N  NE  . ARG A 1 39  ? 25.532  4.992   32.966 1.00 28.99  ? 38  ARG A NE  1 
ATOM   316  C  CZ  . ARG A 1 39  ? 24.969  5.219   34.149 1.00 26.52  ? 38  ARG A CZ  1 
ATOM   317  N  NH1 . ARG A 1 39  ? 24.542  4.218   34.903 1.00 29.95  ? 38  ARG A NH1 1 
ATOM   318  N  NH2 . ARG A 1 39  ? 24.867  6.456   34.590 1.00 30.20  ? 38  ARG A NH2 1 
ATOM   319  N  N   . ALA A 1 40  ? 21.581  5.568   28.854 1.00 32.17  ? 39  ALA A N   1 
ATOM   320  C  CA  . ALA A 1 40  ? 20.773  6.633   28.247 1.00 26.25  ? 39  ALA A CA  1 
ATOM   321  C  C   . ALA A 1 40  ? 19.311  6.220   28.152 1.00 21.04  ? 39  ALA A C   1 
ATOM   322  O  O   . ALA A 1 40  ? 18.403  7.034   28.427 1.00 26.63  ? 39  ALA A O   1 
ATOM   323  C  CB  . ALA A 1 40  ? 21.305  7.012   26.867 1.00 25.96  ? 39  ALA A CB  1 
ATOM   324  N  N   . TRP A 1 41  ? 19.064  4.970   27.750 1.00 24.33  ? 40  TRP A N   1 
ATOM   325  C  CA  . TRP A 1 41  ? 17.710  4.410   27.761 1.00 30.22  ? 40  TRP A CA  1 
ATOM   326  C  C   . TRP A 1 41  ? 17.055  4.522   29.148 1.00 39.66  ? 40  TRP A C   1 
ATOM   327  O  O   . TRP A 1 41  ? 15.923  4.996   29.281 1.00 21.39  ? 40  TRP A O   1 
ATOM   328  C  CB  . TRP A 1 41  ? 17.713  2.939   27.295 1.00 27.09  ? 40  TRP A CB  1 
ATOM   329  C  CG  . TRP A 1 41  ? 16.355  2.303   27.397 1.00 27.26  ? 40  TRP A CG  1 
ATOM   330  C  CD1 . TRP A 1 41  ? 15.352  2.357   26.461 1.00 23.48  ? 40  TRP A CD1 1 
ATOM   331  C  CD2 . TRP A 1 41  ? 15.823  1.552   28.503 1.00 23.45  ? 40  TRP A CD2 1 
ATOM   332  N  NE1 . TRP A 1 41  ? 14.244  1.682   26.914 1.00 27.54  ? 40  TRP A NE1 1 
ATOM   333  C  CE2 . TRP A 1 41  ? 14.503  1.169   28.157 1.00 24.53  ? 40  TRP A CE2 1 
ATOM   334  C  CE3 . TRP A 1 41  ? 16.335  1.135   29.740 1.00 28.76  ? 40  TRP A CE3 1 
ATOM   335  C  CZ2 . TRP A 1 41  ? 13.688  0.399   29.005 1.00 27.59  ? 40  TRP A CZ2 1 
ATOM   336  C  CZ3 . TRP A 1 41  ? 15.514  0.384   30.592 1.00 26.28  ? 40  TRP A CZ3 1 
ATOM   337  C  CH2 . TRP A 1 41  ? 14.207  0.026   30.216 1.00 42.58  ? 40  TRP A CH2 1 
ATOM   338  N  N   . LYS A 1 42  ? 17.761  4.087   30.186 1.00 28.92  ? 41  LYS A N   1 
ATOM   339  C  CA  . LYS A 1 42  ? 17.161  4.023   31.521 1.00 25.72  ? 41  LYS A CA  1 
ATOM   340  C  C   . LYS A 1 42  ? 16.878  5.432   32.020 1.00 25.25  ? 41  LYS A C   1 
ATOM   341  O  O   . LYS A 1 42  ? 15.856  5.683   32.648 1.00 25.36  ? 41  LYS A O   1 
ATOM   342  C  CB  . LYS A 1 42  ? 18.077  3.283   32.521 1.00 36.46  ? 41  LYS A CB  1 
ATOM   343  C  CG  . LYS A 1 42  ? 17.530  3.222   33.961 1.00 60.33  ? 41  LYS A CG  1 
ATOM   344  C  CD  . LYS A 1 42  ? 16.066  2.760   34.018 1.00 85.75  ? 41  LYS A CD  1 
ATOM   345  C  CE  . LYS A 1 42  ? 15.646  2.344   35.425 1.00 69.50  ? 41  LYS A CE  1 
ATOM   346  N  NZ  . LYS A 1 42  ? 15.842  0.887   35.660 1.00 94.01  ? 41  LYS A NZ  1 
ATOM   347  N  N   . GLU A 1 43  ? 17.794  6.351   31.723 1.00 23.66  ? 42  GLU A N   1 
ATOM   348  C  CA  . GLU A 1 43  ? 17.676  7.717   32.188 1.00 26.08  ? 42  GLU A CA  1 
ATOM   349  C  C   . GLU A 1 43  ? 16.481  8.394   31.517 1.00 25.78  ? 42  GLU A C   1 
ATOM   350  O  O   . GLU A 1 43  ? 15.730  9.104   32.164 1.00 28.30  ? 42  GLU A O   1 
ATOM   351  C  CB  . GLU A 1 43  ? 18.995  8.474   31.936 1.00 24.38  ? 42  GLU A CB  1 
ATOM   352  C  CG  . GLU A 1 43  ? 18.991  9.967   32.223 1.00 31.17  ? 42  GLU A CG  1 
ATOM   353  C  CD  . GLU A 1 43  ? 20.194  10.681  31.603 1.00 52.76  ? 42  GLU A CD  1 
ATOM   354  O  OE1 . GLU A 1 43  ? 20.515  10.425  30.419 1.00 85.05  ? 42  GLU A OE1 1 
ATOM   355  O  OE2 . GLU A 1 43  ? 20.826  11.499  32.298 1.00 63.92  ? 42  GLU A OE2 1 
ATOM   356  N  N   . LEU A 1 44  ? 16.283  8.147   30.224 1.00 25.83  ? 43  LEU A N   1 
ATOM   357  C  CA  . LEU A 1 44  ? 15.184  8.784   29.502 1.00 19.03  ? 43  LEU A CA  1 
ATOM   358  C  C   . LEU A 1 44  ? 13.821  8.182   29.913 1.00 22.83  ? 43  LEU A C   1 
ATOM   359  O  O   . LEU A 1 44  ? 12.816  8.884   29.927 1.00 26.18  ? 43  LEU A O   1 
ATOM   360  C  CB  . LEU A 1 44  ? 15.428  8.731   27.980 1.00 23.20  ? 43  LEU A CB  1 
ATOM   361  C  CG  . LEU A 1 44  ? 14.420  9.422   27.043 1.00 25.25  ? 43  LEU A CG  1 
ATOM   362  C  CD1 . LEU A 1 44  ? 14.137  10.895  27.438 1.00 35.01  ? 43  LEU A CD1 1 
ATOM   363  C  CD2 . LEU A 1 44  ? 14.979  9.360   25.630 1.00 20.07  ? 43  LEU A CD2 1 
ATOM   364  N  N   . VAL A 1 45  ? 13.786  6.904   30.267 1.00 26.21  ? 44  VAL A N   1 
ATOM   365  C  CA  . VAL A 1 45  ? 12.575  6.312   30.832 1.00 23.17  ? 44  VAL A CA  1 
ATOM   366  C  C   . VAL A 1 45  ? 12.212  6.963   32.167 1.00 22.59  ? 44  VAL A C   1 
ATOM   367  O  O   . VAL A 1 45  ? 11.046  7.290   32.417 1.00 27.89  ? 44  VAL A O   1 
ATOM   368  C  CB  . VAL A 1 45  ? 12.719  4.795   31.022 1.00 20.22  ? 44  VAL A CB  1 
ATOM   369  C  CG1 . VAL A 1 45  ? 11.592  4.216   31.872 1.00 32.57  ? 44  VAL A CG1 1 
ATOM   370  C  CG2 . VAL A 1 45  ? 12.749  4.097   29.653 1.00 35.58  ? 44  VAL A CG2 1 
ATOM   371  N  N   . GLU A 1 46  ? 13.228  7.139   33.015 1.00 32.96  ? 45  GLU A N   1 
ATOM   372  C  CA  . GLU A 1 46  ? 13.049  7.720   34.346 1.00 36.76  ? 45  GLU A CA  1 
ATOM   373  C  C   . GLU A 1 46  ? 12.492  9.129   34.226 1.00 25.96  ? 45  GLU A C   1 
ATOM   374  O  O   . GLU A 1 46  ? 11.586  9.525   34.965 1.00 29.63  ? 45  GLU A O   1 
ATOM   375  C  CB  . GLU A 1 46  ? 14.395  7.766   35.110 1.00 27.95  ? 45  GLU A CB  1 
ATOM   376  C  CG  . GLU A 1 46  ? 14.863  6.435   35.673 1.00 43.91  ? 45  GLU A CG  1 
ATOM   377  C  CD  . GLU A 1 46  ? 13.746  5.694   36.364 1.00 143.48 ? 45  GLU A CD  1 
ATOM   378  O  OE1 . GLU A 1 46  ? 13.288  6.158   37.431 1.00 32.04  ? 45  GLU A OE1 1 
ATOM   379  O  OE2 . GLU A 1 46  ? 13.306  4.669   35.812 1.00 50.31  ? 45  GLU A OE2 1 
ATOM   380  N  N   . LYS A 1 47  ? 13.055  9.876   33.282 1.00 25.73  ? 46  LYS A N   1 
ATOM   381  C  CA  . LYS A 1 47  ? 12.833  11.304  33.176 1.00 35.45  ? 46  LYS A CA  1 
ATOM   382  C  C   . LYS A 1 47  ? 11.501  11.632  32.490 1.00 31.48  ? 46  LYS A C   1 
ATOM   383  O  O   . LYS A 1 47  ? 10.858  12.616  32.831 1.00 28.95  ? 46  LYS A O   1 
ATOM   384  C  CB  . LYS A 1 47  ? 14.013  11.930  32.416 1.00 27.96  ? 46  LYS A CB  1 
ATOM   385  C  CG  . LYS A 1 47  ? 14.013  13.457  32.382 1.00 116.82 ? 46  LYS A CG  1 
ATOM   386  C  CD  . LYS A 1 47  ? 14.873  14.012  31.244 1.00 136.62 ? 46  LYS A CD  1 
ATOM   387  C  CE  . LYS A 1 47  ? 16.332  14.174  31.658 1.00 158.13 ? 46  LYS A CE  1 
ATOM   388  N  NZ  . LYS A 1 47  ? 17.037  12.865  31.787 1.00 76.17  ? 46  LYS A NZ  1 
ATOM   389  N  N   . GLU A 1 48  ? 11.073  10.789  31.548 1.00 35.08  ? 47  GLU A N   1 
ATOM   390  C  CA  . GLU A 1 48  ? 9.936   11.121  30.673 1.00 28.01  ? 47  GLU A CA  1 
ATOM   391  C  C   . GLU A 1 48  ? 9.122   9.904   30.196 1.00 24.87  ? 47  GLU A C   1 
ATOM   392  O  O   . GLU A 1 48  ? 7.875   9.959   30.100 1.00 33.05  ? 47  GLU A O   1 
ATOM   393  C  CB  . GLU A 1 48  ? 10.461  11.896  29.461 1.00 29.77  ? 47  GLU A CB  1 
ATOM   394  C  CG  . GLU A 1 48  ? 9.378   12.544  28.617 1.00 67.98  ? 47  GLU A CG  1 
ATOM   395  C  CD  . GLU A 1 48  ? 9.932   13.187  27.366 1.00 66.40  ? 47  GLU A CD  1 
ATOM   396  O  OE1 . GLU A 1 48  ? 9.148   13.417  26.423 1.00 122.55 ? 47  GLU A OE1 1 
ATOM   397  O  OE2 . GLU A 1 48  ? 11.152  13.454  27.326 1.00 51.92  ? 47  GLU A OE2 1 
ATOM   398  N  N   . ASP A 1 49  ? 9.837   8.816   29.915 1.00 27.82  ? 48  ASP A N   1 
ATOM   399  C  CA  . ASP A 1 49  ? 9.299   7.643   29.248 1.00 27.94  ? 48  ASP A CA  1 
ATOM   400  C  C   . ASP A 1 49  ? 8.398   8.027   28.084 1.00 28.68  ? 48  ASP A C   1 
ATOM   401  O  O   . ASP A 1 49  ? 7.193   7.725   28.097 1.00 24.54  ? 48  ASP A O   1 
ATOM   402  C  CB  . ASP A 1 49  ? 8.546   6.748   30.226 1.00 29.92  ? 48  ASP A CB  1 
ATOM   403  C  CG  . ASP A 1 49  ? 8.198   5.430   29.627 1.00 30.26  ? 48  ASP A CG  1 
ATOM   404  O  OD1 . ASP A 1 49  ? 8.776   5.124   28.552 1.00 26.58  ? 48  ASP A OD1 1 
ATOM   405  O  OD2 . ASP A 1 49  ? 7.345   4.649   30.127 1.00 36.95  ? 48  ASP A OD2 1 
ATOM   406  N  N   . PRO A 1 50  ? 8.988   8.639   27.059 1.00 25.06  ? 49  PRO A N   1 
ATOM   407  C  CA  . PRO A 1 50  ? 8.204   9.181   25.955 1.00 30.08  ? 49  PRO A CA  1 
ATOM   408  C  C   . PRO A 1 50  ? 7.623   8.071   25.100 1.00 23.59  ? 49  PRO A C   1 
ATOM   409  O  O   . PRO A 1 50  ? 8.065   6.933   25.162 1.00 25.35  ? 49  PRO A O   1 
ATOM   410  C  CB  . PRO A 1 50  ? 9.235   9.989   25.158 1.00 28.59  ? 49  PRO A CB  1 
ATOM   411  C  CG  . PRO A 1 50  ? 10.514  9.266   25.396 1.00 27.58  ? 49  PRO A CG  1 
ATOM   412  C  CD  . PRO A 1 50  ? 10.436  8.817   26.830 1.00 23.66  ? 49  PRO A CD  1 
ATOM   413  N  N   . VAL A 1 51  ? 6.612   8.426   24.322 1.00 23.07  ? 50  VAL A N   1 
ATOM   414  C  CA  . VAL A 1 51  ? 6.084   7.570   23.273 1.00 25.39  ? 50  VAL A CA  1 
ATOM   415  C  C   . VAL A 1 51  ? 7.129   7.580   22.159 1.00 19.53  ? 50  VAL A C   1 
ATOM   416  O  O   . VAL A 1 51  ? 7.628   8.636   21.764 1.00 23.99  ? 50  VAL A O   1 
ATOM   417  C  CB  . VAL A 1 51  ? 4.704   8.095   22.757 1.00 28.95  ? 50  VAL A CB  1 
ATOM   418  C  CG1 . VAL A 1 51  ? 4.178   7.243   21.608 1.00 23.38  ? 50  VAL A CG1 1 
ATOM   419  C  CG2 . VAL A 1 51  ? 3.688   8.142   23.899 1.00 34.22  ? 50  VAL A CG2 1 
ATOM   420  N  N   . VAL A 1 52  ? 7.513   6.390   21.706 1.00 25.93  ? 51  VAL A N   1 
ATOM   421  C  CA  . VAL A 1 52  ? 8.435   6.258   20.588 1.00 25.65  ? 51  VAL A CA  1 
ATOM   422  C  C   . VAL A 1 52  ? 7.591   6.162   19.313 1.00 16.66  ? 51  VAL A C   1 
ATOM   423  O  O   . VAL A 1 52  ? 7.902   6.798   18.325 1.00 22.00  ? 51  VAL A O   1 
ATOM   424  C  CB  . VAL A 1 52  ? 9.354   5.024   20.764 1.00 25.32  ? 51  VAL A CB  1 
ATOM   425  C  CG1 . VAL A 1 52  ? 10.357  4.912   19.617 1.00 28.10  ? 51  VAL A CG1 1 
ATOM   426  C  CG2 . VAL A 1 52  ? 10.065  5.082   22.119 1.00 26.35  ? 51  VAL A CG2 1 
ATOM   427  N  N   . TYR A 1 53  ? 6.527   5.382   19.355 1.00 18.50  ? 52  TYR A N   1 
ATOM   428  C  CA  . TYR A 1 53  ? 5.623   5.307   18.208 1.00 19.98  ? 52  TYR A CA  1 
ATOM   429  C  C   . TYR A 1 53  ? 4.241   4.794   18.509 1.00 23.91  ? 52  TYR A C   1 
ATOM   430  O  O   . TYR A 1 53  ? 4.014   4.121   19.492 1.00 25.43  ? 52  TYR A O   1 
ATOM   431  C  CB  . TYR A 1 53  ? 6.248   4.502   17.063 1.00 23.37  ? 52  TYR A CB  1 
ATOM   432  C  CG  . TYR A 1 53  ? 6.617   3.075   17.353 1.00 18.50  ? 52  TYR A CG  1 
ATOM   433  C  CD1 . TYR A 1 53  ? 5.819   2.022   16.892 1.00 20.78  ? 52  TYR A CD1 1 
ATOM   434  C  CD2 . TYR A 1 53  ? 7.799   2.753   18.020 1.00 26.58  ? 52  TYR A CD2 1 
ATOM   435  C  CE1 . TYR A 1 53  ? 6.162   0.685   17.133 1.00 23.13  ? 52  TYR A CE1 1 
ATOM   436  C  CE2 . TYR A 1 53  ? 8.154   1.426   18.238 1.00 24.54  ? 52  TYR A CE2 1 
ATOM   437  C  CZ  . TYR A 1 53  ? 7.341   0.403   17.789 1.00 32.13  ? 52  TYR A CZ  1 
ATOM   438  O  OH  . TYR A 1 53  ? 7.698   -0.903  18.009 1.00 23.86  ? 52  TYR A OH  1 
ATOM   439  N  N   . GLU A 1 54  ? 3.313   5.152   17.627 1.00 23.28  ? 53  GLU A N   1 
ATOM   440  C  CA  . GLU A 1 54  ? 1.948   4.701   17.694 1.00 25.49  ? 53  GLU A CA  1 
ATOM   441  C  C   . GLU A 1 54  ? 1.644   3.996   16.390 1.00 22.86  ? 53  GLU A C   1 
ATOM   442  O  O   . GLU A 1 54  ? 2.146   4.398   15.346 1.00 20.79  ? 53  GLU A O   1 
ATOM   443  C  CB  . GLU A 1 54  ? 1.021   5.895   17.881 1.00 25.59  ? 53  GLU A CB  1 
ATOM   444  C  CG  . GLU A 1 54  ? 1.193   6.557   19.241 1.00 30.59  ? 53  GLU A CG  1 
ATOM   445  C  CD  . GLU A 1 54  ? 0.731   8.002   19.309 1.00 42.35  ? 53  GLU A CD  1 
ATOM   446  O  OE1 . GLU A 1 54  ? 0.606   8.673   18.268 1.00 33.42  ? 53  GLU A OE1 1 
ATOM   447  O  OE2 . GLU A 1 54  ? 0.535   8.481   20.437 1.00 45.91  ? 53  GLU A OE2 1 
ATOM   448  N  N   . VAL A 1 55  ? 0.835   2.947   16.462 1.00 23.40  ? 54  VAL A N   1 
ATOM   449  C  CA  . VAL A 1 55  ? 0.407   2.215   15.277 1.00 28.36  ? 54  VAL A CA  1 
ATOM   450  C  C   . VAL A 1 55  ? -1.126  2.127   15.208 1.00 23.99  ? 54  VAL A C   1 
ATOM   451  O  O   . VAL A 1 55  ? -1.780  1.838   16.212 1.00 28.86  ? 54  VAL A O   1 
ATOM   452  C  CB  . VAL A 1 55  ? 0.995   0.779   15.276 1.00 27.99  ? 54  VAL A CB  1 
ATOM   453  C  CG1 . VAL A 1 55  ? 0.513   -0.021  14.055 1.00 31.84  ? 54  VAL A CG1 1 
ATOM   454  C  CG2 . VAL A 1 55  ? 2.499   0.806   15.339 1.00 30.15  ? 54  VAL A CG2 1 
ATOM   455  N  N   . TYR A 1 56  ? -1.667  2.371   14.016 1.00 23.71  ? 55  TYR A N   1 
ATOM   456  C  CA  . TYR A 1 56  ? -3.081  2.158   13.695 1.00 25.79  ? 55  TYR A CA  1 
ATOM   457  C  C   . TYR A 1 56  ? -3.178  1.052   12.653 1.00 24.11  ? 55  TYR A C   1 
ATOM   458  O  O   . TYR A 1 56  ? -2.714  1.229   11.523 1.00 21.29  ? 55  TYR A O   1 
ATOM   459  C  CB  . TYR A 1 56  ? -3.678  3.434   13.124 1.00 26.73  ? 55  TYR A CB  1 
ATOM   460  C  CG  . TYR A 1 56  ? -3.599  4.608   14.054 1.00 20.30  ? 55  TYR A CG  1 
ATOM   461  C  CD1 . TYR A 1 56  ? -2.488  5.458   14.044 1.00 27.92  ? 55  TYR A CD1 1 
ATOM   462  C  CD2 . TYR A 1 56  ? -4.646  4.889   14.941 1.00 32.26  ? 55  TYR A CD2 1 
ATOM   463  C  CE1 . TYR A 1 56  ? -2.411  6.551   14.908 1.00 25.98  ? 55  TYR A CE1 1 
ATOM   464  C  CE2 . TYR A 1 56  ? -4.583  5.982   15.806 1.00 34.87  ? 55  TYR A CE2 1 
ATOM   465  C  CZ  . TYR A 1 56  ? -3.467  6.799   15.785 1.00 31.33  ? 55  TYR A CZ  1 
ATOM   466  O  OH  . TYR A 1 56  ? -3.385  7.861   16.636 1.00 32.84  ? 55  TYR A OH  1 
ATOM   467  N  N   . ALA A 1 57  ? -3.754  -0.087  13.040 1.00 28.54  ? 56  ALA A N   1 
ATOM   468  C  CA  . ALA A 1 57  ? -3.730  -1.296  12.200 1.00 31.52  ? 56  ALA A CA  1 
ATOM   469  C  C   . ALA A 1 57  ? -5.145  -1.732  11.852 1.00 34.83  ? 56  ALA A C   1 
ATOM   470  O  O   . ALA A 1 57  ? -6.044  -1.667  12.676 1.00 24.42  ? 56  ALA A O   1 
ATOM   471  C  CB  . ALA A 1 57  ? -2.981  -2.415  12.883 1.00 30.42  ? 56  ALA A CB  1 
ATOM   472  N  N   . VAL A 1 58  ? -5.327  -2.129  10.599 1.00 24.42  ? 57  VAL A N   1 
ATOM   473  C  CA  . VAL A 1 58  ? -6.573  -2.670  10.106 1.00 23.98  ? 57  VAL A CA  1 
ATOM   474  C  C   . VAL A 1 58  ? -6.219  -4.060  9.595  1.00 27.12  ? 57  VAL A C   1 
ATOM   475  O  O   . VAL A 1 58  ? -5.546  -4.220  8.576  1.00 24.51  ? 57  VAL A O   1 
ATOM   476  C  CB  . VAL A 1 58  ? -7.166  -1.788  8.994  1.00 27.21  ? 57  VAL A CB  1 
ATOM   477  C  CG1 . VAL A 1 58  ? -8.450  -2.384  8.454  1.00 26.56  ? 57  VAL A CG1 1 
ATOM   478  C  CG2 . VAL A 1 58  ? -7.388  -0.371  9.517  1.00 30.38  ? 57  VAL A CG2 1 
ATOM   479  N  N   . GLU A 1 59  ? -6.655  -5.065  10.334 1.00 25.90  ? 58  GLU A N   1 
ATOM   480  C  CA  . GLU A 1 59  ? -6.163  -6.423  10.142 1.00 27.81  ? 58  GLU A CA  1 
ATOM   481  C  C   . GLU A 1 59  ? -7.293  -7.395  9.853  1.00 29.59  ? 58  GLU A C   1 
ATOM   482  O  O   . GLU A 1 59  ? -8.408  -7.269  10.339 1.00 28.62  ? 58  GLU A O   1 
ATOM   483  C  CB  . GLU A 1 59  ? -5.320  -6.859  11.342 1.00 25.25  ? 58  GLU A CB  1 
ATOM   484  C  CG  . GLU A 1 59  ? -4.169  -5.880  11.606 1.00 30.19  ? 58  GLU A CG  1 
ATOM   485  C  CD  . GLU A 1 59  ? -3.127  -6.416  12.573 1.00 42.66  ? 58  GLU A CD  1 
ATOM   486  O  OE1 . GLU A 1 59  ? -3.514  -6.829  13.683 1.00 70.88  ? 58  GLU A OE1 1 
ATOM   487  O  OE2 . GLU A 1 59  ? -1.925  -6.410  12.227 1.00 52.55  ? 58  GLU A OE2 1 
ATOM   488  N  N   . GLN A 1 60  ? -6.981  -8.365  9.013  1.00 25.28  ? 59  GLN A N   1 
ATOM   489  C  CA  . GLN A 1 60  ? -7.935  -9.352  8.605  1.00 23.29  ? 59  GLN A CA  1 
ATOM   490  C  C   . GLN A 1 60  ? -7.672  -10.636 9.383  1.00 25.01  ? 59  GLN A C   1 
ATOM   491  O  O   . GLN A 1 60  ? -6.649  -10.790 10.026 1.00 23.33  ? 59  GLN A O   1 
ATOM   492  C  CB  . GLN A 1 60  ? -7.834  -9.562  7.091  1.00 24.60  ? 59  GLN A CB  1 
ATOM   493  C  CG  . GLN A 1 60  ? -8.019  -8.275  6.288  1.00 28.81  ? 59  GLN A CG  1 
ATOM   494  C  CD  . GLN A 1 60  ? -9.349  -7.563  6.586  1.00 21.94  ? 59  GLN A CD  1 
ATOM   495  O  OE1 . GLN A 1 60  ? -10.372 -8.220  6.739  1.00 29.17  ? 59  GLN A OE1 1 
ATOM   496  N  NE2 . GLN A 1 60  ? -9.332  -6.236  6.616  1.00 25.29  ? 59  GLN A NE2 1 
ATOM   497  N  N   . GLU A 1 61  ? -8.628  -11.546 9.336  1.00 32.83  ? 60  GLU A N   1 
ATOM   498  C  CA  . GLU A 1 61  ? -8.387  -12.909 9.762  1.00 35.04  ? 60  GLU A CA  1 
ATOM   499  C  C   . GLU A 1 61  ? -7.159  -13.422 9.006  1.00 33.39  ? 60  GLU A C   1 
ATOM   500  O  O   . GLU A 1 61  ? -7.047  -13.224 7.791  1.00 31.55  ? 60  GLU A O   1 
ATOM   501  C  CB  . GLU A 1 61  ? -9.619  -13.765 9.435  1.00 32.55  ? 60  GLU A CB  1 
ATOM   502  C  CG  . GLU A 1 61  ? -9.598  -15.166 9.995  1.00 37.95  ? 60  GLU A CG  1 
ATOM   503  C  CD  . GLU A 1 61  ? -9.899  -15.218 11.476 1.00 33.83  ? 60  GLU A CD  1 
ATOM   504  O  OE1 . GLU A 1 61  ? -10.299 -14.186 12.070 1.00 32.77  ? 60  GLU A OE1 1 
ATOM   505  O  OE2 . GLU A 1 61  ? -9.720  -16.315 12.043 1.00 37.25  ? 60  GLU A OE2 1 
ATOM   506  N  N   . GLU A 1 62  ? -6.259  -14.091 9.722  1.00 32.94  ? 61  GLU A N   1 
ATOM   507  C  CA  . GLU A 1 62  ? -5.034  -14.633 9.137  1.00 32.40  ? 61  GLU A CA  1 
ATOM   508  C  C   . GLU A 1 62  ? -5.426  -15.680 8.106  1.00 39.39  ? 61  GLU A C   1 
ATOM   509  O  O   . GLU A 1 62  ? -6.097  -16.668 8.414  1.00 55.69  ? 61  GLU A O   1 
ATOM   510  C  CB  . GLU A 1 62  ? -4.045  -15.129 10.235 1.00 28.71  ? 61  GLU A CB  1 
ATOM   511  C  CG  . GLU A 1 62  ? -3.905  -16.636 10.454 1.00 81.00  ? 61  GLU A CG  1 
ATOM   512  C  CD  . GLU A 1 62  ? -2.706  -17.231 9.731  1.00 115.57 ? 61  GLU A CD  1 
ATOM   513  O  OE1 . GLU A 1 62  ? -2.849  -17.614 8.550  1.00 122.95 ? 61  GLU A OE1 1 
ATOM   514  O  OE2 . GLU A 1 62  ? -1.617  -17.318 10.346 1.00 75.62  ? 61  GLU A OE2 1 
ATOM   515  N  N   . LYS A 1 63  ? -5.068  -15.398 6.861  1.00 28.63  ? 62  LYS A N   1 
ATOM   516  C  CA  . LYS A 1 63  ? -5.478  -16.201 5.714  1.00 24.12  ? 62  LYS A CA  1 
ATOM   517  C  C   . LYS A 1 63  ? -4.541  -15.887 4.564  1.00 48.09  ? 62  LYS A C   1 
ATOM   518  O  O   . LYS A 1 63  ? -4.231  -14.725 4.310  1.00 23.96  ? 62  LYS A O   1 
ATOM   519  C  CB  . LYS A 1 63  ? -6.922  -15.876 5.315  1.00 39.11  ? 62  LYS A CB  1 
ATOM   520  C  CG  . LYS A 1 63  ? -7.659  -17.006 4.604  1.00 55.55  ? 62  LYS A CG  1 
ATOM   521  C  CD  . LYS A 1 63  ? -8.135  -18.102 5.569  1.00 126.27 ? 62  LYS A CD  1 
ATOM   522  C  CE  . LYS A 1 63  ? -9.635  -18.362 5.464  1.00 118.53 ? 62  LYS A CE  1 
ATOM   523  N  NZ  . LYS A 1 63  ? -10.433 -17.388 6.268  1.00 64.53  ? 62  LYS A NZ  1 
ATOM   524  N  N   . GLU A 1 64  ? -4.098  -16.931 3.876  1.00 25.63  ? 63  GLU A N   1 
ATOM   525  C  CA  . GLU A 1 64  ? -3.255  -16.789 2.711  1.00 30.51  ? 63  GLU A CA  1 
ATOM   526  C  C   . GLU A 1 64  ? -3.943  -15.925 1.646  1.00 24.08  ? 63  GLU A C   1 
ATOM   527  O  O   . GLU A 1 64  ? -5.126  -16.102 1.371  1.00 33.54  ? 63  GLU A O   1 
ATOM   528  C  CB  . GLU A 1 64  ? -2.869  -18.192 2.172  1.00 29.29  ? 63  GLU A CB  1 
ATOM   529  C  CG  . GLU A 1 64  ? -3.130  -18.455 0.691  1.00 169.16 ? 63  GLU A CG  1 
ATOM   530  C  CD  . GLU A 1 64  ? -2.620  -19.811 0.216  1.00 151.12 ? 63  GLU A CD  1 
ATOM   531  O  OE1 . GLU A 1 64  ? -2.098  -20.593 1.044  1.00 57.46  ? 63  GLU A OE1 1 
ATOM   532  O  OE2 . GLU A 1 64  ? -2.719  -20.086 -1.002 1.00 44.91  ? 63  GLU A OE2 1 
ATOM   533  N  N   . GLY A 1 65  ? -3.202  -14.973 1.077  1.00 26.06  ? 64  GLY A N   1 
ATOM   534  C  CA  . GLY A 1 65  ? -3.701  -14.146 -0.023 1.00 24.17  ? 64  GLY A CA  1 
ATOM   535  C  C   . GLY A 1 65  ? -4.348  -12.828 0.396  1.00 25.25  ? 64  GLY A C   1 
ATOM   536  O  O   . GLY A 1 65  ? -4.566  -11.939 -0.411 1.00 20.36  ? 64  GLY A O   1 
ATOM   537  N  N   . ASP A 1 66  ? -4.643  -12.702 1.672  1.00 20.74  ? 65  ASP A N   1 
ATOM   538  C  CA  . ASP A 1 66  ? -5.288  -11.524 2.221  1.00 19.90  ? 65  ASP A CA  1 
ATOM   539  C  C   . ASP A 1 66  ? -4.252  -10.527 2.719  1.00 22.74  ? 65  ASP A C   1 
ATOM   540  O  O   . ASP A 1 66  ? -3.076  -10.860 2.866  1.00 21.74  ? 65  ASP A O   1 
ATOM   541  C  CB  . ASP A 1 66  ? -6.233  -11.922 3.354  1.00 26.59  ? 65  ASP A CB  1 
ATOM   542  C  CG  . ASP A 1 66  ? -7.476  -11.046 3.422  1.00 28.34  ? 65  ASP A CG  1 
ATOM   543  O  OD1 . ASP A 1 66  ? -7.459  -9.894  2.907  1.00 21.54  ? 65  ASP A OD1 1 
ATOM   544  O  OD2 . ASP A 1 66  ? -8.522  -11.441 3.975  1.00 22.08  ? 65  ASP A OD2 1 
ATOM   545  N  N   . LEU A 1 67  ? -4.706  -9.301  2.972  1.00 20.36  ? 66  LEU A N   1 
ATOM   546  C  CA  . LEU A 1 67  ? -3.833  -8.186  3.290  1.00 20.32  ? 66  LEU A CA  1 
ATOM   547  C  C   . LEU A 1 67  ? -4.279  -7.369  4.508  1.00 21.54  ? 66  LEU A C   1 
ATOM   548  O  O   . LEU A 1 67  ? -5.470  -7.044  4.691  1.00 23.05  ? 66  LEU A O   1 
ATOM   549  C  CB  . LEU A 1 67  ? -3.735  -7.257  2.074  1.00 18.24  ? 66  LEU A CB  1 
ATOM   550  C  CG  . LEU A 1 67  ? -3.153  -7.858  0.795  1.00 25.50  ? 66  LEU A CG  1 
ATOM   551  C  CD1 . LEU A 1 67  ? -3.318  -6.841  -0.320 1.00 22.18  ? 66  LEU A CD1 1 
ATOM   552  C  CD2 . LEU A 1 67  ? -1.706  -8.241  0.976  1.00 23.43  ? 66  LEU A CD2 1 
ATOM   553  N  N   . ASN A 1 68  ? -3.292  -7.056  5.334  1.00 22.20  ? 67  ASN A N   1 
ATOM   554  C  CA  . ASN A 1 68  ? -3.426  -6.092  6.410  1.00 20.57  ? 67  ASN A CA  1 
ATOM   555  C  C   . ASN A 1 68  ? -2.812  -4.781  5.993  1.00 27.52  ? 67  ASN A C   1 
ATOM   556  O  O   . ASN A 1 68  ? -1.967  -4.735  5.102  1.00 21.07  ? 67  ASN A O   1 
ATOM   557  C  CB  . ASN A 1 68  ? -2.687  -6.583  7.642  1.00 30.25  ? 67  ASN A CB  1 
ATOM   558  C  CG  . ASN A 1 68  ? -3.293  -7.811  8.216  1.00 23.69  ? 67  ASN A CG  1 
ATOM   559  O  OD1 . ASN A 1 68  ? -4.409  -8.193  7.852  1.00 22.94  ? 67  ASN A OD1 1 
ATOM   560  N  ND2 . ASN A 1 68  ? -2.550  -8.479  9.090  1.00 25.21  ? 67  ASN A ND2 1 
ATOM   561  N  N   . PHE A 1 69  ? -3.226  -3.709  6.641  1.00 21.94  ? 68  PHE A N   1 
ATOM   562  C  CA  . PHE A 1 69  ? -2.497  -2.455  6.527  1.00 22.15  ? 68  PHE A CA  1 
ATOM   563  C  C   . PHE A 1 69  ? -2.466  -1.683  7.843  1.00 25.85  ? 68  PHE A C   1 
ATOM   564  O  O   . PHE A 1 69  ? -3.315  -1.855  8.706  1.00 19.95  ? 68  PHE A O   1 
ATOM   565  C  CB  . PHE A 1 69  ? -3.013  -1.611  5.365  1.00 22.54  ? 68  PHE A CB  1 
ATOM   566  C  CG  . PHE A 1 69  ? -4.448  -1.181  5.492  1.00 20.85  ? 68  PHE A CG  1 
ATOM   567  C  CD1 . PHE A 1 69  ? -4.770  0.057   6.045  1.00 23.61  ? 68  PHE A CD1 1 
ATOM   568  C  CD2 . PHE A 1 69  ? -5.482  -2.004  5.041  1.00 23.20  ? 68  PHE A CD2 1 
ATOM   569  C  CE1 . PHE A 1 69  ? -6.112  0.470   6.152  1.00 25.01  ? 68  PHE A CE1 1 
ATOM   570  C  CE2 . PHE A 1 69  ? -6.817  -1.593  5.139  1.00 25.07  ? 68  PHE A CE2 1 
ATOM   571  C  CZ  . PHE A 1 69  ? -7.128  -0.354  5.687  1.00 27.05  ? 68  PHE A CZ  1 
ATOM   572  N  N   . ALA A 1 70  ? -1.454  -0.847  7.988  1.00 24.87  ? 69  ALA A N   1 
ATOM   573  C  CA  . ALA A 1 70  ? -1.222  -0.120  9.228  1.00 16.13  ? 69  ALA A CA  1 
ATOM   574  C  C   . ALA A 1 70  ? -0.452  1.141   8.954  1.00 30.10  ? 69  ALA A C   1 
ATOM   575  O  O   . ALA A 1 70  ? 0.455   1.134   8.137  1.00 18.72  ? 69  ALA A O   1 
ATOM   576  C  CB  . ALA A 1 70  ? -0.460  -0.971  10.206 1.00 22.43  ? 69  ALA A CB  1 
ATOM   577  N  N   . THR A 1 71  ? -0.808  2.222   9.638  1.00 16.52  ? 70  THR A N   1 
ATOM   578  C  CA  . THR A 1 71  ? 0.080   3.362   9.717  1.00 15.79  ? 70  THR A CA  1 
ATOM   579  C  C   . THR A 1 71  ? 0.864   3.332   11.024 1.00 23.09  ? 70  THR A C   1 
ATOM   580  O  O   . THR A 1 71  ? 0.450   2.773   12.054 1.00 21.07  ? 70  THR A O   1 
ATOM   581  C  CB  . THR A 1 71  ? -0.662  4.689   9.625  1.00 29.17  ? 70  THR A CB  1 
ATOM   582  O  OG1 . THR A 1 71  ? -1.651  4.744   10.648 1.00 20.17  ? 70  THR A OG1 1 
ATOM   583  C  CG2 . THR A 1 71  ? -1.420  4.821   8.307  1.00 23.60  ? 70  THR A CG2 1 
ATOM   584  N  N   . THR A 1 72  ? 2.003   3.973   10.961 1.00 18.45  ? 71  THR A N   1 
ATOM   585  C  CA  . THR A 1 72  ? 2.835   4.231   12.119 1.00 27.67  ? 71  THR A CA  1 
ATOM   586  C  C   . THR A 1 72  ? 3.205   5.699   12.155 1.00 26.35  ? 71  THR A C   1 
ATOM   587  O  O   . THR A 1 72  ? 3.574   6.284   11.129 1.00 24.13  ? 71  THR A O   1 
ATOM   588  C  CB  . THR A 1 72  ? 4.115   3.417   12.027 1.00 19.54  ? 71  THR A CB  1 
ATOM   589  O  OG1 . THR A 1 72  ? 3.805   2.028   11.883 1.00 20.94  ? 71  THR A OG1 1 
ATOM   590  C  CG2 . THR A 1 72  ? 4.952   3.537   13.324 1.00 28.19  ? 71  THR A CG2 1 
ATOM   591  N  N   . VAL A 1 73  ? 3.110   6.263   13.360 1.00 22.43  ? 72  VAL A N   1 
ATOM   592  C  CA  . VAL A 1 73  ? 3.622   7.576   13.702 1.00 16.83  ? 72  VAL A CA  1 
ATOM   593  C  C   . VAL A 1 73  ? 4.837   7.327   14.616 1.00 16.92  ? 72  VAL A C   1 
ATOM   594  O  O   . VAL A 1 73  ? 4.665   6.992   15.786 1.00 20.22  ? 72  VAL A O   1 
ATOM   595  C  CB  . VAL A 1 73  ? 2.577   8.397   14.491 1.00 20.93  ? 72  VAL A CB  1 
ATOM   596  C  CG1 . VAL A 1 73  ? 3.110   9.807   14.765 1.00 27.83  ? 72  VAL A CG1 1 
ATOM   597  C  CG2 . VAL A 1 73  ? 1.245   8.434   13.741 1.00 29.24  ? 72  VAL A CG2 1 
ATOM   598  N  N   . LEU A 1 74  ? 6.034   7.484   14.052 1.00 19.50  ? 73  LEU A N   1 
ATOM   599  C  CA  . LEU A 1 74  ? 7.305   7.313   14.752 1.00 20.87  ? 73  LEU A CA  1 
ATOM   600  C  C   . LEU A 1 74  ? 7.791   8.686   15.174 1.00 24.70  ? 73  LEU A C   1 
ATOM   601  O  O   . LEU A 1 74  ? 8.138   9.515   14.339 1.00 22.66  ? 73  LEU A O   1 
ATOM   602  C  CB  . LEU A 1 74  ? 8.349   6.668   13.827 1.00 22.73  ? 73  LEU A CB  1 
ATOM   603  C  CG  . LEU A 1 74  ? 9.291   5.585   14.355 1.00 39.93  ? 73  LEU A CG  1 
ATOM   604  C  CD1 . LEU A 1 74  ? 10.445  5.379   13.351 1.00 25.18  ? 73  LEU A CD1 1 
ATOM   605  C  CD2 . LEU A 1 74  ? 9.826   5.849   15.749 1.00 29.80  ? 73  LEU A CD2 1 
ATOM   606  N  N   . TYR A 1 75  ? 7.783   8.930   16.473 1.00 22.60  ? 74  TYR A N   1 
ATOM   607  C  CA  . TYR A 1 75  ? 8.099   10.250  17.000 1.00 21.46  ? 74  TYR A CA  1 
ATOM   608  C  C   . TYR A 1 75  ? 9.585   10.546  16.924 1.00 31.99  ? 74  TYR A C   1 
ATOM   609  O  O   . TYR A 1 75  ? 10.419  9.634   16.938 1.00 26.44  ? 74  TYR A O   1 
ATOM   610  C  CB  . TYR A 1 75  ? 7.591   10.366  18.439 1.00 23.65  ? 74  TYR A CB  1 
ATOM   611  C  CG  . TYR A 1 75  ? 6.081   10.497  18.446 1.00 23.63  ? 74  TYR A CG  1 
ATOM   612  C  CD1 . TYR A 1 75  ? 5.474   11.724  18.164 1.00 37.51  ? 74  TYR A CD1 1 
ATOM   613  C  CD2 . TYR A 1 75  ? 5.272   9.397   18.633 1.00 23.08  ? 74  TYR A CD2 1 
ATOM   614  C  CE1 . TYR A 1 75  ? 4.097   11.849  18.107 1.00 38.47  ? 74  TYR A CE1 1 
ATOM   615  C  CE2 . TYR A 1 75  ? 3.882   9.515   18.575 1.00 28.28  ? 74  TYR A CE2 1 
ATOM   616  C  CZ  . TYR A 1 75  ? 3.307   10.744  18.322 1.00 39.01  ? 74  TYR A CZ  1 
ATOM   617  O  OH  . TYR A 1 75  ? 1.935   10.863  18.282 1.00 30.56  ? 74  TYR A OH  1 
ATOM   618  N  N   . PRO A 1 76  ? 9.924   11.827  16.853 1.00 28.27  ? 75  PRO A N   1 
ATOM   619  C  CA  . PRO A 1 76  ? 11.332  12.213  16.793 1.00 18.28  ? 75  PRO A CA  1 
ATOM   620  C  C   . PRO A 1 76  ? 11.987  12.120  18.179 1.00 28.33  ? 75  PRO A C   1 
ATOM   621  O  O   . PRO A 1 76  ? 11.336  12.298  19.211 1.00 25.52  ? 75  PRO A O   1 
ATOM   622  C  CB  . PRO A 1 76  ? 11.276  13.637  16.259 1.00 23.57  ? 75  PRO A CB  1 
ATOM   623  C  CG  . PRO A 1 76  ? 9.971   14.174  16.758 1.00 29.73  ? 75  PRO A CG  1 
ATOM   624  C  CD  . PRO A 1 76  ? 9.026   13.000  16.845 1.00 27.14  ? 75  PRO A CD  1 
ATOM   625  N  N   . GLY A 1 77  ? 13.261  11.770  18.198 1.00 27.02  ? 76  GLY A N   1 
ATOM   626  C  CA  . GLY A 1 77  ? 13.992  11.649  19.445 1.00 27.36  ? 76  GLY A CA  1 
ATOM   627  C  C   . GLY A 1 77  ? 15.229  10.788  19.306 1.00 28.98  ? 76  GLY A C   1 
ATOM   628  O  O   . GLY A 1 77  ? 15.433  10.142  18.281 1.00 27.39  ? 76  GLY A O   1 
ATOM   629  N  N   . LYS A 1 78  ? 16.057  10.800  20.342 1.00 26.58  ? 77  LYS A N   1 
ATOM   630  C  CA  . LYS A 1 78  ? 17.241  9.956   20.406 1.00 30.80  ? 77  LYS A CA  1 
ATOM   631  C  C   . LYS A 1 78  ? 17.391  9.362   21.787 1.00 33.37  ? 77  LYS A C   1 
ATOM   632  O  O   . LYS A 1 78  ? 16.953  9.950   22.791 1.00 22.93  ? 77  LYS A O   1 
ATOM   633  C  CB  . LYS A 1 78  ? 18.511  10.742  20.087 1.00 29.74  ? 77  LYS A CB  1 
ATOM   634  C  CG  . LYS A 1 78  ? 18.550  11.351  18.693 1.00 28.20  ? 77  LYS A CG  1 
ATOM   635  C  CD  . LYS A 1 78  ? 19.919  11.986  18.388 1.00 42.66  ? 77  LYS A CD  1 
ATOM   636  C  CE  . LYS A 1 78  ? 19.889  13.493  18.471 1.00 59.07  ? 77  LYS A CE  1 
ATOM   637  N  NZ  . LYS A 1 78  ? 19.504  13.941  19.825 1.00 53.18  ? 77  LYS A NZ  1 
ATOM   638  N  N   . VAL A 1 79  ? 17.994  8.180   21.813 1.00 26.69  ? 78  VAL A N   1 
ATOM   639  C  CA  . VAL A 1 79  ? 18.476  7.529   23.031 1.00 23.39  ? 78  VAL A CA  1 
ATOM   640  C  C   . VAL A 1 79  ? 19.991  7.585   22.965 1.00 28.58  ? 78  VAL A C   1 
ATOM   641  O  O   . VAL A 1 79  ? 20.616  6.807   22.237 1.00 27.32  ? 78  VAL A O   1 
ATOM   642  C  CB  . VAL A 1 79  ? 17.979  6.061   23.097 1.00 31.28  ? 78  VAL A CB  1 
ATOM   643  C  CG1 . VAL A 1 79  ? 18.559  5.325   24.309 1.00 37.46  ? 78  VAL A CG1 1 
ATOM   644  C  CG2 . VAL A 1 79  ? 16.468  6.037   23.127 1.00 34.82  ? 78  VAL A CG2 1 
ATOM   645  N  N   . GLY A 1 80  ? 20.591  8.494   23.729 1.00 34.28  ? 79  GLY A N   1 
ATOM   646  C  CA  . GLY A 1 80  ? 21.975  8.868   23.502 1.00 34.91  ? 79  GLY A CA  1 
ATOM   647  C  C   . GLY A 1 80  ? 22.132  9.522   22.138 1.00 24.63  ? 79  GLY A C   1 
ATOM   648  O  O   . GLY A 1 80  ? 21.556  10.579  21.892 1.00 31.02  ? 79  GLY A O   1 
ATOM   649  N  N   . LYS A 1 81  ? 22.890  8.880   21.251 1.00 32.77  ? 80  LYS A N   1 
ATOM   650  C  CA  . LYS A 1 81  ? 23.105  9.342   19.872 1.00 36.81  ? 80  LYS A CA  1 
ATOM   651  C  C   . LYS A 1 81  ? 22.227  8.606   18.827 1.00 23.24  ? 80  LYS A C   1 
ATOM   652  O  O   . LYS A 1 81  ? 22.233  8.959   17.651 1.00 29.66  ? 80  LYS A O   1 
ATOM   653  C  CB  . LYS A 1 81  ? 24.570  9.136   19.485 1.00 37.57  ? 80  LYS A CB  1 
ATOM   654  C  CG  . LYS A 1 81  ? 25.574  10.033  20.213 1.00 40.46  ? 80  LYS A CG  1 
ATOM   655  C  CD  . LYS A 1 81  ? 27.005  9.588   19.899 1.00 44.21  ? 80  LYS A CD  1 
ATOM   656  C  CE  . LYS A 1 81  ? 28.020  10.682  20.202 1.00 73.12  ? 80  LYS A CE  1 
ATOM   657  N  NZ  . LYS A 1 81  ? 29.388  10.125  20.371 1.00 68.84  ? 80  LYS A NZ  1 
ATOM   658  N  N   . GLU A 1 82  ? 21.527  7.574   19.271 1.00 31.99  ? 81  GLU A N   1 
ATOM   659  C  CA  . GLU A 1 82  ? 20.750  6.689   18.414 1.00 26.29  ? 81  GLU A CA  1 
ATOM   660  C  C   . GLU A 1 82  ? 19.311  7.193   18.232 1.00 23.95  ? 81  GLU A C   1 
ATOM   661  O  O   . GLU A 1 82  ? 18.588  7.372   19.200 1.00 27.10  ? 81  GLU A O   1 
ATOM   662  C  CB  . GLU A 1 82  ? 20.714  5.313   19.063 1.00 31.71  ? 81  GLU A CB  1 
ATOM   663  C  CG  . GLU A 1 82  ? 20.407  4.170   18.131 1.00 32.22  ? 81  GLU A CG  1 
ATOM   664  C  CD  . GLU A 1 82  ? 20.698  2.818   18.740 1.00 38.49  ? 81  GLU A CD  1 
ATOM   665  O  OE1 . GLU A 1 82  ? 20.885  2.733   19.972 1.00 31.93  ? 81  GLU A OE1 1 
ATOM   666  O  OE2 . GLU A 1 82  ? 20.718  1.830   17.979 1.00 25.90  ? 81  GLU A OE2 1 
ATOM   667  N  N   . PHE A 1 83  ? 18.899  7.375   16.988 1.00 25.59  ? 82  PHE A N   1 
ATOM   668  C  CA  . PHE A 1 83  ? 17.540  7.821   16.672 1.00 26.62  ? 82  PHE A CA  1 
ATOM   669  C  C   . PHE A 1 83  ? 16.464  6.835   17.102 1.00 25.72  ? 82  PHE A C   1 
ATOM   670  O  O   . PHE A 1 83  ? 16.660  5.633   17.059 1.00 27.27  ? 82  PHE A O   1 
ATOM   671  C  CB  . PHE A 1 83  ? 17.411  8.114   15.178 1.00 22.52  ? 82  PHE A CB  1 
ATOM   672  C  CG  . PHE A 1 83  ? 18.144  9.359   14.741 1.00 20.18  ? 82  PHE A CG  1 
ATOM   673  C  CD1 . PHE A 1 83  ? 19.245  9.282   13.898 1.00 25.33  ? 82  PHE A CD1 1 
ATOM   674  C  CD2 . PHE A 1 83  ? 17.714  10.611  15.149 1.00 22.19  ? 82  PHE A CD2 1 
ATOM   675  C  CE1 . PHE A 1 83  ? 19.911  10.428  13.493 1.00 29.92  ? 82  PHE A CE1 1 
ATOM   676  C  CE2 . PHE A 1 83  ? 18.378  11.764  14.744 1.00 29.28  ? 82  PHE A CE2 1 
ATOM   677  C  CZ  . PHE A 1 83  ? 19.471  11.676  13.915 1.00 27.78  ? 82  PHE A CZ  1 
ATOM   678  N  N   . PHE A 1 84  ? 15.329  7.379   17.530 1.00 20.82  ? 83  PHE A N   1 
ATOM   679  C  CA  . PHE A 1 84  ? 14.123  6.610   17.775 1.00 22.67  ? 83  PHE A CA  1 
ATOM   680  C  C   . PHE A 1 84  ? 13.826  5.718   16.548 1.00 22.82  ? 83  PHE A C   1 
ATOM   681  O  O   . PHE A 1 84  ? 14.000  6.134   15.380 1.00 21.60  ? 83  PHE A O   1 
ATOM   682  C  CB  . PHE A 1 84  ? 12.942  7.553   18.018 1.00 23.14  ? 83  PHE A CB  1 
ATOM   683  C  CG  . PHE A 1 84  ? 12.802  8.046   19.455 1.00 25.07  ? 83  PHE A CG  1 
ATOM   684  C  CD1 . PHE A 1 84  ? 13.847  7.934   20.387 1.00 31.92  ? 83  PHE A CD1 1 
ATOM   685  C  CD2 . PHE A 1 84  ? 11.598  8.601   19.875 1.00 28.53  ? 83  PHE A CD2 1 
ATOM   686  C  CE1 . PHE A 1 84  ? 13.685  8.397   21.692 1.00 26.86  ? 83  PHE A CE1 1 
ATOM   687  C  CE2 . PHE A 1 84  ? 11.433  9.049   21.182 1.00 29.54  ? 83  PHE A CE2 1 
ATOM   688  C  CZ  . PHE A 1 84  ? 12.474  8.943   22.087 1.00 25.48  ? 83  PHE A CZ  1 
ATOM   689  N  N   . PHE A 1 85  ? 13.419  4.496   16.844 1.00 23.18  ? 84  PHE A N   1 
ATOM   690  C  CA  . PHE A 1 85  ? 13.080  3.493   15.840 1.00 23.37  ? 84  PHE A CA  1 
ATOM   691  C  C   . PHE A 1 85  ? 11.999  2.573   16.354 1.00 22.93  ? 84  PHE A C   1 
ATOM   692  O  O   . PHE A 1 85  ? 11.641  2.632   17.531 1.00 22.32  ? 84  PHE A O   1 
ATOM   693  C  CB  . PHE A 1 85  ? 14.317  2.703   15.382 1.00 23.86  ? 84  PHE A CB  1 
ATOM   694  C  CG  . PHE A 1 85  ? 15.112  2.012   16.500 1.00 21.90  ? 84  PHE A CG  1 
ATOM   695  C  CD1 . PHE A 1 85  ? 14.528  1.072   17.349 1.00 24.45  ? 84  PHE A CD1 1 
ATOM   696  C  CD2 . PHE A 1 85  ? 16.479  2.255   16.621 1.00 28.24  ? 84  PHE A CD2 1 
ATOM   697  C  CE1 . PHE A 1 85  ? 15.281  0.423   18.321 1.00 24.22  ? 84  PHE A CE1 1 
ATOM   698  C  CE2 . PHE A 1 85  ? 17.228  1.618   17.576 1.00 27.96  ? 84  PHE A CE2 1 
ATOM   699  C  CZ  . PHE A 1 85  ? 16.635  0.694   18.431 1.00 23.70  ? 84  PHE A CZ  1 
ATOM   700  N  N   . THR A 1 86  ? 11.448  1.763   15.441 1.00 20.36  ? 85  THR A N   1 
ATOM   701  C  CA  . THR A 1 86  ? 10.536  0.694   15.805 1.00 16.05  ? 85  THR A CA  1 
ATOM   702  C  C   . THR A 1 86  ? 11.302  -0.535  16.246 1.00 19.74  ? 85  THR A C   1 
ATOM   703  O  O   . THR A 1 86  ? 12.455  -0.716  15.881 1.00 23.37  ? 85  THR A O   1 
ATOM   704  C  CB  . THR A 1 86  ? 9.592   0.330   14.639 1.00 27.77  ? 85  THR A CB  1 
ATOM   705  O  OG1 . THR A 1 86  ? 10.346  -0.136  13.509 1.00 20.12  ? 85  THR A OG1 1 
ATOM   706  C  CG2 . THR A 1 86  ? 8.819   1.537   14.164 1.00 24.92  ? 85  THR A CG2 1 
ATOM   707  N  N   . LYS A 1 87  ? 10.656  -1.371  17.050 1.00 18.80  ? 86  LYS A N   1 
ATOM   708  C  CA  . LYS A 1 87  ? 11.283  -2.566  17.571 1.00 20.22  ? 86  LYS A CA  1 
ATOM   709  C  C   . LYS A 1 87  ? 11.955  -3.314  16.430 1.00 26.88  ? 86  LYS A C   1 
ATOM   710  O  O   . LYS A 1 87  ? 13.121  -3.648  16.514 1.00 22.49  ? 86  LYS A O   1 
ATOM   711  C  CB  . LYS A 1 87  ? 10.266  -3.488  18.258 1.00 21.06  ? 86  LYS A CB  1 
ATOM   712  C  CG  . LYS A 1 87  ? 9.852   -3.042  19.672 1.00 29.22  ? 86  LYS A CG  1 
ATOM   713  C  CD  . LYS A 1 87  ? 8.741   -3.948  20.253 1.00 35.73  ? 86  LYS A CD  1 
ATOM   714  C  CE  . LYS A 1 87  ? 8.798   -3.994  21.782 1.00 102.92 ? 86  LYS A CE  1 
ATOM   715  N  NZ  . LYS A 1 87  ? 7.479   -4.263  22.435 1.00 53.68  ? 86  LYS A NZ  1 
ATOM   716  N  N   . GLY A 1 88  ? 11.208  -3.553  15.360 1.00 23.97  ? 87  GLY A N   1 
ATOM   717  C  CA  . GLY A 1 88  ? 11.735  -4.262  14.214 1.00 28.84  ? 87  GLY A CA  1 
ATOM   718  C  C   . GLY A 1 88  ? 11.408  -5.729  14.349 1.00 24.06  ? 87  GLY A C   1 
ATOM   719  O  O   . GLY A 1 88  ? 11.310  -6.271  15.461 1.00 27.57  ? 87  GLY A O   1 
ATOM   720  N  N   . HIS A 1 89  ? 11.229  -6.389  13.219 1.00 24.24  ? 88  HIS A N   1 
ATOM   721  C  CA  . HIS A 1 89  ? 10.841  -7.786  13.253 1.00 18.79  ? 88  HIS A CA  1 
ATOM   722  C  C   . HIS A 1 89  ? 11.042  -8.469  11.903 1.00 21.12  ? 88  HIS A C   1 
ATOM   723  O  O   . HIS A 1 89  ? 11.065  -7.821  10.845 1.00 22.72  ? 88  HIS A O   1 
ATOM   724  C  CB  . HIS A 1 89  ? 9.379   -7.933  13.700 1.00 25.00  ? 88  HIS A CB  1 
ATOM   725  C  CG  . HIS A 1 89  ? 8.404   -7.281  12.775 1.00 23.40  ? 88  HIS A CG  1 
ATOM   726  N  ND1 . HIS A 1 89  ? 8.138   -5.925  12.810 1.00 28.62  ? 88  HIS A ND1 1 
ATOM   727  C  CD2 . HIS A 1 89  ? 7.656   -7.792  11.767 1.00 26.67  ? 88  HIS A CD2 1 
ATOM   728  C  CE1 . HIS A 1 89  ? 7.265   -5.632  11.861 1.00 31.03  ? 88  HIS A CE1 1 
ATOM   729  N  NE2 . HIS A 1 89  ? 6.970   -6.744  11.201 1.00 22.41  ? 88  HIS A NE2 1 
ATOM   730  N  N   . PHE A 1 90  ? 11.214  -9.781  11.966 1.00 23.24  ? 89  PHE A N   1 
ATOM   731  C  CA  . PHE A 1 90  ? 11.048  -10.639 10.794 1.00 22.21  ? 89  PHE A CA  1 
ATOM   732  C  C   . PHE A 1 90  ? 9.585   -11.009 10.755 1.00 29.25  ? 89  PHE A C   1 
ATOM   733  O  O   . PHE A 1 90  ? 8.872   -10.867 11.745 1.00 25.79  ? 89  PHE A O   1 
ATOM   734  C  CB  . PHE A 1 90  ? 11.854  -11.937 10.943 1.00 18.81  ? 89  PHE A CB  1 
ATOM   735  C  CG  . PHE A 1 90  ? 13.313  -11.782 10.715 1.00 25.18  ? 89  PHE A CG  1 
ATOM   736  C  CD1 . PHE A 1 90  ? 13.835  -11.825 9.430  1.00 24.41  ? 89  PHE A CD1 1 
ATOM   737  C  CD2 . PHE A 1 90  ? 14.185  -11.617 11.785 1.00 29.51  ? 89  PHE A CD2 1 
ATOM   738  C  CE1 . PHE A 1 90  ? 15.202  -11.662 9.215  1.00 26.10  ? 89  PHE A CE1 1 
ATOM   739  C  CE2 . PHE A 1 90  ? 15.557  -11.471 11.574 1.00 27.41  ? 89  PHE A CE2 1 
ATOM   740  C  CZ  . PHE A 1 90  ? 16.062  -11.497 10.283 1.00 25.04  ? 89  PHE A CZ  1 
ATOM   741  N  N   . HIS A 1 91  ? 9.122   -11.495 9.622  1.00 27.15  ? 90  HIS A N   1 
ATOM   742  C  CA  . HIS A 1 91  ? 7.819   -12.141 9.594  1.00 22.15  ? 90  HIS A CA  1 
ATOM   743  C  C   . HIS A 1 91  ? 7.911   -13.575 10.145 1.00 31.62  ? 90  HIS A C   1 
ATOM   744  O  O   . HIS A 1 91  ? 8.967   -14.219 10.084 1.00 22.16  ? 90  HIS A O   1 
ATOM   745  C  CB  . HIS A 1 91  ? 7.226   -12.079 8.191  1.00 20.40  ? 90  HIS A CB  1 
ATOM   746  C  CG  . HIS A 1 91  ? 6.876   -10.684 7.779  1.00 28.54  ? 90  HIS A CG  1 
ATOM   747  N  ND1 . HIS A 1 91  ? 7.178   -10.173 6.536  1.00 30.15  ? 90  HIS A ND1 1 
ATOM   748  C  CD2 . HIS A 1 91  ? 6.274   -9.680  8.462  1.00 26.65  ? 90  HIS A CD2 1 
ATOM   749  C  CE1 . HIS A 1 91  ? 6.748   -8.929  6.457  1.00 25.58  ? 90  HIS A CE1 1 
ATOM   750  N  NE2 . HIS A 1 91  ? 6.219   -8.594  7.620  1.00 23.89  ? 90  HIS A NE2 1 
ATOM   751  N  N   . ALA A 1 92  ? 6.816   -14.040 10.736 1.00 27.44  ? 91  ALA A N   1 
ATOM   752  C  CA  . ALA A 1 92  ? 6.726   -15.409 11.224 1.00 28.75  ? 91  ALA A CA  1 
ATOM   753  C  C   . ALA A 1 92  ? 6.735   -16.379 10.037 1.00 38.85  ? 91  ALA A C   1 
ATOM   754  O  O   . ALA A 1 92  ? 7.403   -17.399 10.074 1.00 24.27  ? 91  ALA A O   1 
ATOM   755  C  CB  . ALA A 1 92  ? 5.473   -15.604 12.110 1.00 34.77  ? 91  ALA A CB  1 
ATOM   756  N  N   . LYS A 1 93  ? 5.992   -16.051 8.987  1.00 27.08  ? 92  LYS A N   1 
ATOM   757  C  CA  . LYS A 1 93  ? 6.195   -16.663 7.681  1.00 24.48  ? 92  LYS A CA  1 
ATOM   758  C  C   . LYS A 1 93  ? 7.232   -15.807 6.966  1.00 27.08  ? 92  LYS A C   1 
ATOM   759  O  O   . LYS A 1 93  ? 6.914   -14.763 6.385  1.00 22.11  ? 92  LYS A O   1 
ATOM   760  C  CB  . LYS A 1 93  ? 4.890   -16.702 6.896  1.00 24.42  ? 92  LYS A CB  1 
ATOM   761  C  CG  . LYS A 1 93  ? 3.886   -17.724 7.420  1.00 36.60  ? 92  LYS A CG  1 
ATOM   762  C  CD  . LYS A 1 93  ? 2.851   -18.096 6.342  1.00 42.98  ? 92  LYS A CD  1 
ATOM   763  C  CE  . LYS A 1 93  ? 1.508   -18.518 6.939  1.00 64.58  ? 92  LYS A CE  1 
ATOM   764  N  NZ  . LYS A 1 93  ? 1.574   -19.826 7.657  1.00 52.69  ? 92  LYS A NZ  1 
ATOM   765  N  N   . LEU A 1 94  ? 8.476   -16.266 7.014  1.00 22.76  ? 93  LEU A N   1 
ATOM   766  C  CA  . LEU A 1 94  ? 9.637   -15.468 6.632  1.00 25.66  ? 93  LEU A CA  1 
ATOM   767  C  C   . LEU A 1 94  ? 9.560   -14.844 5.255  1.00 29.24  ? 93  LEU A C   1 
ATOM   768  O  O   . LEU A 1 94  ? 9.991   -13.702 5.084  1.00 31.07  ? 93  LEU A O   1 
ATOM   769  C  CB  . LEU A 1 94  ? 10.922  -16.311 6.710  1.00 29.64  ? 93  LEU A CB  1 
ATOM   770  C  CG  . LEU A 1 94  ? 11.623  -16.326 8.058  1.00 41.71  ? 93  LEU A CG  1 
ATOM   771  C  CD1 . LEU A 1 94  ? 12.788  -17.323 8.022  1.00 45.06  ? 93  LEU A CD1 1 
ATOM   772  C  CD2 . LEU A 1 94  ? 12.107  -14.923 8.441  1.00 30.06  ? 93  LEU A CD2 1 
ATOM   773  N  N   . ASP A 1 95  ? 9.023   -15.580 4.279  1.00 26.43  ? 94  ASP A N   1 
ATOM   774  C  CA  . ASP A 1 95  ? 9.010   -15.122 2.883  1.00 30.67  ? 94  ASP A CA  1 
ATOM   775  C  C   . ASP A 1 95  ? 7.892   -14.124 2.535  1.00 23.72  ? 94  ASP A C   1 
ATOM   776  O  O   . ASP A 1 95  ? 7.716   -13.748 1.369  1.00 22.92  ? 94  ASP A O   1 
ATOM   777  C  CB  . ASP A 1 95  ? 8.968   -16.302 1.915  1.00 31.34  ? 94  ASP A CB  1 
ATOM   778  C  CG  . ASP A 1 95  ? 7.726   -17.157 2.093  1.00 28.88  ? 94  ASP A CG  1 
ATOM   779  O  OD1 . ASP A 1 95  ? 7.557   -18.119 1.345  1.00 28.26  ? 94  ASP A OD1 1 
ATOM   780  O  OD2 . ASP A 1 95  ? 6.877   -16.945 2.962  1.00 31.91  ? 94  ASP A OD2 1 
ATOM   781  N  N   . ARG A 1 96  ? 7.155   -13.664 3.528  1.00 27.52  ? 95  ARG A N   1 
ATOM   782  C  CA  . ARG A 1 96  ? 6.177   -12.612 3.271  1.00 21.73  ? 95  ARG A CA  1 
ATOM   783  C  C   . ARG A 1 96  ? 6.888   -11.266 3.124  1.00 25.20  ? 95  ARG A C   1 
ATOM   784  O  O   . ARG A 1 96  ? 7.708   -10.866 3.968  1.00 24.83  ? 95  ARG A O   1 
ATOM   785  C  CB  . ARG A 1 96  ? 5.111   -12.586 4.361  1.00 22.56  ? 95  ARG A CB  1 
ATOM   786  C  CG  . ARG A 1 96  ? 3.926   -13.479 4.027  1.00 24.09  ? 95  ARG A CG  1 
ATOM   787  C  CD  . ARG A 1 96  ? 4.270   -14.920 3.756  1.00 25.57  ? 95  ARG A CD  1 
ATOM   788  N  NE  . ARG A 1 96  ? 3.045   -15.704 3.568  1.00 27.54  ? 95  ARG A NE  1 
ATOM   789  C  CZ  . ARG A 1 96  ? 2.939   -16.818 2.846  1.00 37.56  ? 95  ARG A CZ  1 
ATOM   790  N  NH1 . ARG A 1 96  ? 3.988   -17.354 2.248  1.00 23.48  ? 95  ARG A NH1 1 
ATOM   791  N  NH2 . ARG A 1 96  ? 1.763   -17.422 2.736  1.00 30.78  ? 95  ARG A NH2 1 
ATOM   792  N  N   . ALA A 1 97  ? 6.567   -10.583 2.034  1.00 24.00  ? 96  ALA A N   1 
ATOM   793  C  CA  . ALA A 1 97  ? 7.058   -9.252  1.769  1.00 19.30  ? 96  ALA A CA  1 
ATOM   794  C  C   . ALA A 1 97  ? 6.186   -8.189  2.442  1.00 19.83  ? 96  ALA A C   1 
ATOM   795  O  O   . ALA A 1 97  ? 5.206   -8.487  3.130  1.00 25.51  ? 96  ALA A O   1 
ATOM   796  C  CB  . ALA A 1 97  ? 7.091   -9.001  0.259  1.00 21.28  ? 96  ALA A CB  1 
ATOM   797  N  N   . GLU A 1 98  ? 6.552   -6.937  2.199  1.00 19.36  ? 97  GLU A N   1 
ATOM   798  C  CA  . GLU A 1 98  ? 5.797   -5.783  2.676  1.00 15.47  ? 97  GLU A CA  1 
ATOM   799  C  C   . GLU A 1 98  ? 6.055   -4.602  1.753  1.00 21.87  ? 97  GLU A C   1 
ATOM   800  O  O   . GLU A 1 98  ? 7.083   -4.554  1.094  1.00 22.41  ? 97  GLU A O   1 
ATOM   801  C  CB  . GLU A 1 98  ? 6.215   -5.451  4.119  1.00 23.06  ? 97  GLU A CB  1 
ATOM   802  C  CG  . GLU A 1 98  ? 5.303   -4.450  4.781  1.00 30.80  ? 97  GLU A CG  1 
ATOM   803  C  CD  . GLU A 1 98  ? 5.055   -4.712  6.256  1.00 19.36  ? 97  GLU A CD  1 
ATOM   804  O  OE1 . GLU A 1 98  ? 5.516   -5.742  6.795  1.00 23.79  ? 97  GLU A OE1 1 
ATOM   805  O  OE2 . GLU A 1 98  ? 4.366   -3.859  6.856  1.00 35.15  ? 97  GLU A OE2 1 
ATOM   806  N  N   . VAL A 1 99  ? 5.086   -3.697  1.659  1.00 17.37  ? 98  VAL A N   1 
ATOM   807  C  CA  . VAL A 1 99  ? 5.257   -2.446  0.924  1.00 17.12  ? 98  VAL A CA  1 
ATOM   808  C  C   . VAL A 1 99  ? 4.939   -1.314  1.904  1.00 15.71  ? 98  VAL A C   1 
ATOM   809  O  O   . VAL A 1 99  ? 3.888   -1.322  2.570  1.00 18.66  ? 98  VAL A O   1 
ATOM   810  C  CB  . VAL A 1 99  ? 4.365   -2.412  -0.368 1.00 17.91  ? 98  VAL A CB  1 
ATOM   811  C  CG1 . VAL A 1 99  ? 4.477   -1.065  -1.089 1.00 17.54  ? 98  VAL A CG1 1 
ATOM   812  C  CG2 . VAL A 1 99  ? 4.760   -3.545  -1.322 1.00 25.78  ? 98  VAL A CG2 1 
ATOM   813  N  N   . TYR A 1 100 ? 5.872   -0.374  2.015  1.00 16.93  ? 99  TYR A N   1 
ATOM   814  C  CA  . TYR A 1 100 ? 5.708   0.839   2.808  1.00 15.13  ? 99  TYR A CA  1 
ATOM   815  C  C   . TYR A 1 100 ? 5.592   2.042   1.889  1.00 23.01  ? 99  TYR A C   1 
ATOM   816  O  O   . TYR A 1 100 ? 6.234   2.108   0.816  1.00 18.94  ? 99  TYR A O   1 
ATOM   817  C  CB  . TYR A 1 100 ? 6.926   1.090   3.699  1.00 16.66  ? 99  TYR A CB  1 
ATOM   818  C  CG  . TYR A 1 100 ? 7.044   0.291   4.973  1.00 21.32  ? 99  TYR A CG  1 
ATOM   819  C  CD1 . TYR A 1 100 ? 7.052   -1.103  4.969  1.00 26.27  ? 99  TYR A CD1 1 
ATOM   820  C  CD2 . TYR A 1 100 ? 7.207   0.940   6.197  1.00 23.10  ? 99  TYR A CD2 1 
ATOM   821  C  CE1 . TYR A 1 100 ? 7.197   -1.828  6.166  1.00 29.38  ? 99  TYR A CE1 1 
ATOM   822  C  CE2 . TYR A 1 100 ? 7.363   0.219   7.383  1.00 22.02  ? 99  TYR A CE2 1 
ATOM   823  C  CZ  . TYR A 1 100 ? 7.356   -1.143  7.366  1.00 29.17  ? 99  TYR A CZ  1 
ATOM   824  O  OH  . TYR A 1 100 ? 7.499   -1.810  8.566  1.00 30.36  ? 99  TYR A OH  1 
ATOM   825  N  N   . VAL A 1 101 ? 4.772   2.988   2.319  1.00 20.80  ? 100 VAL A N   1 
ATOM   826  C  CA  . VAL A 1 101 ? 4.564   4.227   1.607  1.00 16.29  ? 100 VAL A CA  1 
ATOM   827  C  C   . VAL A 1 101 ? 4.806   5.354   2.610  1.00 18.70  ? 100 VAL A C   1 
ATOM   828  O  O   . VAL A 1 101 ? 4.024   5.500   3.562  1.00 23.81  ? 100 VAL A O   1 
ATOM   829  C  CB  . VAL A 1 101 ? 3.122   4.322   1.063  1.00 21.24  ? 100 VAL A CB  1 
ATOM   830  C  CG1 . VAL A 1 101 ? 2.965   5.617   0.257  1.00 27.85  ? 100 VAL A CG1 1 
ATOM   831  C  CG2 . VAL A 1 101 ? 2.765   3.087   0.248  1.00 27.66  ? 100 VAL A CG2 1 
ATOM   832  N  N   . ALA A 1 102 ? 5.892   6.114   2.417  1.00 24.71  ? 101 ALA A N   1 
ATOM   833  C  CA  . ALA A 1 102 ? 6.208   7.228   3.311  1.00 23.93  ? 101 ALA A CA  1 
ATOM   834  C  C   . ALA A 1 102 ? 5.286   8.398   3.034  1.00 24.52  ? 101 ALA A C   1 
ATOM   835  O  O   . ALA A 1 102 ? 5.064   8.753   1.883  1.00 20.75  ? 101 ALA A O   1 
ATOM   836  C  CB  . ALA A 1 102 ? 7.707   7.667   3.192  1.00 24.19  ? 101 ALA A CB  1 
ATOM   837  N  N   . LEU A 1 103 ? 4.735   8.976   4.099  1.00 28.47  ? 102 LEU A N   1 
ATOM   838  C  CA  . LEU A 1 103 ? 3.726   10.029  3.989  1.00 22.85  ? 102 LEU A CA  1 
ATOM   839  C  C   . LEU A 1 103 ? 4.231   11.384  4.476  1.00 30.12  ? 102 LEU A C   1 
ATOM   840  O  O   . LEU A 1 103 ? 3.935   12.412  3.872  1.00 28.77  ? 102 LEU A O   1 
ATOM   841  C  CB  . LEU A 1 103 ? 2.463   9.643   4.736  1.00 21.13  ? 102 LEU A CB  1 
ATOM   842  C  CG  . LEU A 1 103 ? 1.769   8.356   4.278  1.00 23.57  ? 102 LEU A CG  1 
ATOM   843  C  CD1 . LEU A 1 103 ? 0.612   8.040   5.183  1.00 24.45  ? 102 LEU A CD1 1 
ATOM   844  C  CD2 . LEU A 1 103 ? 1.361   8.442   2.817  1.00 22.76  ? 102 LEU A CD2 1 
ATOM   845  N  N   . LYS A 1 104 ? 5.018   11.383  5.543  1.00 27.91  ? 103 LYS A N   1 
ATOM   846  C  CA  . LYS A 1 104 ? 5.441   12.624  6.165  1.00 28.54  ? 103 LYS A CA  1 
ATOM   847  C  C   . LYS A 1 104 ? 6.683   12.385  6.980  1.00 31.51  ? 103 LYS A C   1 
ATOM   848  O  O   . LYS A 1 104 ? 6.878   11.287  7.525  1.00 24.15  ? 103 LYS A O   1 
ATOM   849  C  CB  . LYS A 1 104 ? 4.320   13.175  7.063  1.00 28.10  ? 103 LYS A CB  1 
ATOM   850  C  CG  . LYS A 1 104 ? 4.445   14.649  7.377  1.00 56.56  ? 103 LYS A CG  1 
ATOM   851  C  CD  . LYS A 1 104 ? 3.278   15.110  8.218  1.00 32.62  ? 103 LYS A CD  1 
ATOM   852  C  CE  . LYS A 1 104 ? 3.148   16.627  8.260  1.00 47.94  ? 103 LYS A CE  1 
ATOM   853  N  NZ  . LYS A 1 104 ? 2.174   17.035  9.311  1.00 59.65  ? 103 LYS A NZ  1 
ATOM   854  N  N   . GLY A 1 105 ? 7.516   13.421  7.036  1.00 22.56  ? 104 GLY A N   1 
ATOM   855  C  CA  . GLY A 1 105 ? 8.704   13.457  7.862  1.00 24.16  ? 104 GLY A CA  1 
ATOM   856  C  C   . GLY A 1 105 ? 9.900   12.932  7.114  1.00 24.91  ? 104 GLY A C   1 
ATOM   857  O  O   . GLY A 1 105 ? 9.862   12.812  5.891  1.00 27.12  ? 104 GLY A O   1 
ATOM   858  N  N   . LYS A 1 106 ? 10.965  12.661  7.864  1.00 29.25  ? 105 LYS A N   1 
ATOM   859  C  CA  . LYS A 1 106 ? 12.227  12.215  7.309  1.00 28.61  ? 105 LYS A CA  1 
ATOM   860  C  C   . LYS A 1 106 ? 12.732  11.017  8.113  1.00 27.73  ? 105 LYS A C   1 
ATOM   861  O  O   . LYS A 1 106 ? 12.911  11.082  9.316  1.00 24.02  ? 105 LYS A O   1 
ATOM   862  C  CB  . LYS A 1 106 ? 13.259  13.347  7.321  1.00 46.17  ? 105 LYS A CB  1 
ATOM   863  C  CG  . LYS A 1 106 ? 14.428  13.120  6.348  1.00 40.27  ? 105 LYS A CG  1 
ATOM   864  C  CD  . LYS A 1 106 ? 14.849  14.414  5.642  1.00 127.20 ? 105 LYS A CD  1 
ATOM   865  C  CE  . LYS A 1 106 ? 16.101  14.216  4.788  1.00 79.68  ? 105 LYS A CE  1 
ATOM   866  N  NZ  . LYS A 1 106 ? 17.356  14.508  5.541  1.00 55.40  ? 105 LYS A NZ  1 
ATOM   867  N  N   . GLY A 1 107 ? 12.981  9.924   7.417  1.00 23.70  ? 106 GLY A N   1 
ATOM   868  C  CA  . GLY A 1 107 ? 13.288  8.685   8.083  1.00 23.45  ? 106 GLY A CA  1 
ATOM   869  C  C   . GLY A 1 107 ? 13.918  7.741   7.100  1.00 27.00  ? 106 GLY A C   1 
ATOM   870  O  O   . GLY A 1 107 ? 14.467  8.136   6.078  1.00 28.35  ? 106 GLY A O   1 
ATOM   871  N  N   . GLY A 1 108 ? 13.817  6.472   7.412  1.00 19.80  ? 107 GLY A N   1 
ATOM   872  C  CA  . GLY A 1 108 ? 14.424  5.466   6.584  1.00 22.19  ? 107 GLY A CA  1 
ATOM   873  C  C   . GLY A 1 108 ? 14.145  4.122   7.170  1.00 22.11  ? 107 GLY A C   1 
ATOM   874  O  O   . GLY A 1 108 ? 13.612  3.996   8.270  1.00 20.91  ? 107 GLY A O   1 
ATOM   875  N  N   . MET A 1 109 ? 14.492  3.104   6.408  1.00 20.75  ? 108 MET A N   1 
ATOM   876  C  CA  . MET A 1 109 ? 14.344  1.748   6.858  1.00 27.80  ? 108 MET A CA  1 
ATOM   877  C  C   . MET A 1 109 ? 15.688  1.047   6.926  1.00 20.90  ? 108 MET A C   1 
ATOM   878  O  O   . MET A 1 109 ? 16.527  1.172   6.021  1.00 25.20  ? 108 MET A O   1 
ATOM   879  C  CB  . MET A 1 109 ? 13.428  0.997   5.904  1.00 19.03  ? 108 MET A CB  1 
ATOM   880  C  CG  . MET A 1 109 ? 12.993  -0.356  6.441  1.00 23.23  ? 108 MET A CG  1 
ATOM   881  S  SD  . MET A 1 109 ? 11.989  -1.257  5.312  1.00 24.78  ? 108 MET A SD  1 
ATOM   882  C  CE  . MET A 1 109 ? 10.513  -0.250  5.369  1.00 26.81  ? 108 MET A CE  1 
ATOM   883  N  N   . LEU A 1 110 ? 15.874  0.310   8.007  1.00 22.56  ? 109 LEU A N   1 
ATOM   884  C  CA  . LEU A 1 110 ? 16.945  -0.655  8.139  1.00 23.27  ? 109 LEU A CA  1 
ATOM   885  C  C   . LEU A 1 110 ? 16.340  -1.993  7.913  1.00 24.27  ? 109 LEU A C   1 
ATOM   886  O  O   . LEU A 1 110 ? 15.301  -2.301  8.510  1.00 22.17  ? 109 LEU A O   1 
ATOM   887  C  CB  . LEU A 1 110 ? 17.520  -0.665  9.550  1.00 23.76  ? 109 LEU A CB  1 
ATOM   888  C  CG  . LEU A 1 110 ? 18.580  0.342   9.935  1.00 51.67  ? 109 LEU A CG  1 
ATOM   889  C  CD1 . LEU A 1 110 ? 18.921  0.138   11.403 1.00 62.86  ? 109 LEU A CD1 1 
ATOM   890  C  CD2 . LEU A 1 110 ? 19.794  0.164   9.055  1.00 37.85  ? 109 LEU A CD2 1 
ATOM   891  N  N   . LEU A 1 111 ? 17.003  -2.787  7.071  1.00 25.00  ? 110 LEU A N   1 
ATOM   892  C  CA  . LEU A 1 111 ? 16.590  -4.151  6.752  1.00 31.49  ? 110 LEU A CA  1 
ATOM   893  C  C   . LEU A 1 111 ? 17.768  -5.095  6.969  1.00 26.31  ? 110 LEU A C   1 
ATOM   894  O  O   . LEU A 1 111 ? 18.931  -4.691  6.841  1.00 25.74  ? 110 LEU A O   1 
ATOM   895  C  CB  . LEU A 1 111 ? 16.105  -4.258  5.306  1.00 28.89  ? 110 LEU A CB  1 
ATOM   896  C  CG  . LEU A 1 111 ? 14.957  -3.305  4.940  1.00 20.68  ? 110 LEU A CG  1 
ATOM   897  C  CD1 . LEU A 1 111 ? 15.480  -2.067  4.264  1.00 24.38  ? 110 LEU A CD1 1 
ATOM   898  C  CD2 . LEU A 1 111 ? 13.907  -3.983  4.056  1.00 25.42  ? 110 LEU A CD2 1 
ATOM   899  N  N   . GLN A 1 112 ? 17.457  -6.350  7.290  1.00 25.96  ? 111 GLN A N   1 
ATOM   900  C  CA  . GLN A 1 112 ? 18.464  -7.355  7.596  1.00 34.44  ? 111 GLN A CA  1 
ATOM   901  C  C   . GLN A 1 112 ? 17.995  -8.766  7.214  1.00 25.07  ? 111 GLN A C   1 
ATOM   902  O  O   . GLN A 1 112 ? 16.842  -9.121  7.455  1.00 21.19  ? 111 GLN A O   1 
ATOM   903  C  CB  . GLN A 1 112 ? 18.744  -7.298  9.086  1.00 33.51  ? 111 GLN A CB  1 
ATOM   904  C  CG  . GLN A 1 112 ? 19.839  -8.184  9.555  1.00 43.26  ? 111 GLN A CG  1 
ATOM   905  C  CD  . GLN A 1 112 ? 20.395  -7.698  10.860 1.00 39.81  ? 111 GLN A CD  1 
ATOM   906  O  OE1 . GLN A 1 112 ? 20.868  -6.568  10.937 1.00 34.24  ? 111 GLN A OE1 1 
ATOM   907  N  NE2 . GLN A 1 112 ? 20.326  -8.529  11.894 1.00 34.52  ? 111 GLN A NE2 1 
ATOM   908  N  N   . THR A 1 113 ? 18.884  -9.558  6.605  1.00 25.85  ? 112 THR A N   1 
ATOM   909  C  CA  . THR A 1 113 ? 18.584  -10.950 6.288  1.00 29.12  ? 112 THR A CA  1 
ATOM   910  C  C   . THR A 1 113 ? 18.866  -11.785 7.532  1.00 27.13  ? 112 THR A C   1 
ATOM   911  O  O   . THR A 1 113 ? 19.520  -11.305 8.454  1.00 32.92  ? 112 THR A O   1 
ATOM   912  C  CB  . THR A 1 113 ? 19.468  -11.474 5.121  1.00 25.48  ? 112 THR A CB  1 
ATOM   913  O  OG1 . THR A 1 113 ? 20.836  -11.499 5.535  1.00 28.02  ? 112 THR A OG1 1 
ATOM   914  C  CG2 . THR A 1 113 ? 19.450  -10.520 3.932  1.00 31.70  ? 112 THR A CG2 1 
ATOM   915  N  N   . PRO A 1 114 ? 18.434  -13.047 7.547  1.00 26.68  ? 113 PRO A N   1 
ATOM   916  C  CA  . PRO A 1 114 ? 18.800  -13.959 8.636  1.00 45.55  ? 113 PRO A CA  1 
ATOM   917  C  C   . PRO A 1 114 ? 20.311  -14.207 8.739  1.00 30.82  ? 113 PRO A C   1 
ATOM   918  O  O   . PRO A 1 114 ? 20.776  -14.645 9.779  1.00 42.79  ? 113 PRO A O   1 
ATOM   919  C  CB  . PRO A 1 114 ? 18.032  -15.245 8.288  1.00 37.96  ? 113 PRO A CB  1 
ATOM   920  C  CG  . PRO A 1 114 ? 16.894  -14.770 7.382  1.00 32.06  ? 113 PRO A CG  1 
ATOM   921  C  CD  . PRO A 1 114 ? 17.539  -13.697 6.565  1.00 30.96  ? 113 PRO A CD  1 
ATOM   922  N  N   . GLU A 1 115 ? 21.062  -13.928 7.677  1.00 29.51  ? 114 GLU A N   1 
ATOM   923  C  CA  . GLU A 1 115 ? 22.521  -14.047 7.721  1.00 40.89  ? 114 GLU A CA  1 
ATOM   924  C  C   . GLU A 1 115 ? 23.202  -12.813 8.315  1.00 57.17  ? 114 GLU A C   1 
ATOM   925  O  O   . GLU A 1 115 ? 24.390  -12.851 8.635  1.00 47.25  ? 114 GLU A O   1 
ATOM   926  C  CB  . GLU A 1 115 ? 23.059  -14.365 6.336  1.00 67.73  ? 114 GLU A CB  1 
ATOM   927  C  CG  . GLU A 1 115 ? 22.617  -15.741 5.867  1.00 44.04  ? 114 GLU A CG  1 
ATOM   928  C  CD  . GLU A 1 115 ? 22.990  -16.025 4.432  1.00 214.28 ? 114 GLU A CD  1 
ATOM   929  O  OE1 . GLU A 1 115 ? 23.611  -15.155 3.769  1.00 62.80  ? 114 GLU A OE1 1 
ATOM   930  O  OE2 . GLU A 1 115 ? 22.645  -17.130 3.973  1.00 48.63  ? 114 GLU A OE2 1 
ATOM   931  N  N   . GLY A 1 116 ? 22.445  -11.729 8.468  1.00 44.36  ? 115 GLY A N   1 
ATOM   932  C  CA  . GLY A 1 116 ? 22.905  -10.555 9.197  1.00 58.57  ? 115 GLY A CA  1 
ATOM   933  C  C   . GLY A 1 116 ? 23.323  -9.382  8.328  1.00 41.15  ? 115 GLY A C   1 
ATOM   934  O  O   . GLY A 1 116 ? 23.746  -8.352  8.850  1.00 43.65  ? 115 GLY A O   1 
ATOM   935  N  N   . ASP A 1 117 ? 23.226  -9.535  7.010  1.00 36.38  ? 116 ASP A N   1 
ATOM   936  C  CA  . ASP A 1 117 ? 23.548  -8.454  6.083  1.00 41.60  ? 116 ASP A CA  1 
ATOM   937  C  C   . ASP A 1 117 ? 22.461  -7.380  6.144  1.00 44.48  ? 116 ASP A C   1 
ATOM   938  O  O   . ASP A 1 117 ? 21.281  -7.688  6.031  1.00 30.52  ? 116 ASP A O   1 
ATOM   939  C  CB  . ASP A 1 117 ? 23.667  -8.981  4.653  1.00 46.40  ? 116 ASP A CB  1 
ATOM   940  C  CG  . ASP A 1 117 ? 24.950  -9.751  4.427  1.00 184.56 ? 116 ASP A CG  1 
ATOM   941  O  OD1 . ASP A 1 117 ? 25.053  -10.890 4.929  1.00 87.71  ? 116 ASP A OD1 1 
ATOM   942  O  OD2 . ASP A 1 117 ? 25.913  -9.293  3.775  1.00 104.45 ? 116 ASP A OD2 1 
ATOM   943  N  N   . ALA A 1 118 ? 22.871  -6.131  6.332  1.00 32.69  ? 117 ALA A N   1 
ATOM   944  C  CA  . ALA A 1 118 ? 21.941  -5.032  6.546  1.00 31.01  ? 117 ALA A CA  1 
ATOM   945  C  C   . ALA A 1 118 ? 21.966  -4.046  5.378  1.00 45.57  ? 117 ALA A C   1 
ATOM   946  O  O   . ALA A 1 118 ? 22.951  -3.945  4.645  1.00 45.39  ? 117 ALA A O   1 
ATOM   947  C  CB  . ALA A 1 118 ? 22.241  -4.338  7.863  1.00 41.48  ? 117 ALA A CB  1 
ATOM   948  N  N   . LYS A 1 119 ? 20.851  -3.352  5.194  1.00 29.26  ? 118 LYS A N   1 
ATOM   949  C  CA  . LYS A 1 119 ? 20.699  -2.370  4.124  1.00 27.95  ? 118 LYS A CA  1 
ATOM   950  C  C   . LYS A 1 119 ? 19.850  -1.225  4.657  1.00 28.83  ? 118 LYS A C   1 
ATOM   951  O  O   . LYS A 1 119 ? 18.919  -1.443  5.433  1.00 25.48  ? 118 LYS A O   1 
ATOM   952  C  CB  . LYS A 1 119 ? 20.041  -3.012  2.895  1.00 38.75  ? 118 LYS A CB  1 
ATOM   953  C  CG  . LYS A 1 119 ? 19.840  -2.074  1.695  1.00 53.22  ? 118 LYS A CG  1 
ATOM   954  C  CD  . LYS A 1 119 ? 20.323  -2.705  0.400  1.00 126.77 ? 118 LYS A CD  1 
ATOM   955  C  CE  . LYS A 1 119 ? 19.892  -1.894  -0.809 1.00 53.94  ? 118 LYS A CE  1 
ATOM   956  N  NZ  . LYS A 1 119 ? 21.056  -1.449  -1.617 1.00 76.23  ? 118 LYS A NZ  1 
ATOM   957  N  N   . TRP A 1 120 ? 20.205  -0.006  4.268  1.00 30.41  ? 119 TRP A N   1 
ATOM   958  C  CA  . TRP A 1 120 ? 19.459  1.181   4.653  1.00 27.66  ? 119 TRP A CA  1 
ATOM   959  C  C   . TRP A 1 120 ? 18.881  1.798   3.387  1.00 33.39  ? 119 TRP A C   1 
ATOM   960  O  O   . TRP A 1 120 ? 19.580  1.933   2.376  1.00 25.92  ? 119 TRP A O   1 
ATOM   961  C  CB  . TRP A 1 120 ? 20.356  2.186   5.362  1.00 28.71  ? 119 TRP A CB  1 
ATOM   962  C  CG  . TRP A 1 120 ? 19.772  3.558   5.457  1.00 26.39  ? 119 TRP A CG  1 
ATOM   963  C  CD1 . TRP A 1 120 ? 19.909  4.567   4.551  1.00 29.14  ? 119 TRP A CD1 1 
ATOM   964  C  CD2 . TRP A 1 120 ? 18.964  4.077   6.514  1.00 19.09  ? 119 TRP A CD2 1 
ATOM   965  N  NE1 . TRP A 1 120 ? 19.214  5.679   4.960  1.00 25.81  ? 119 TRP A NE1 1 
ATOM   966  C  CE2 . TRP A 1 120 ? 18.639  5.417   6.176  1.00 22.48  ? 119 TRP A CE2 1 
ATOM   967  C  CE3 . TRP A 1 120 ? 18.440  3.542   7.692  1.00 25.05  ? 119 TRP A CE3 1 
ATOM   968  C  CZ2 . TRP A 1 120 ? 17.854  6.218   6.985  1.00 31.27  ? 119 TRP A CZ2 1 
ATOM   969  C  CZ3 . TRP A 1 120 ? 17.652  4.358   8.505  1.00 24.47  ? 119 TRP A CZ3 1 
ATOM   970  C  CH2 . TRP A 1 120 ? 17.373  5.668   8.146  1.00 23.65  ? 119 TRP A CH2 1 
ATOM   971  N  N   . ILE A 1 121 ? 17.600  2.143   3.470  1.00 29.35  ? 120 ILE A N   1 
ATOM   972  C  CA  . ILE A 1 121 ? 16.856  2.825   2.423  1.00 22.42  ? 120 ILE A CA  1 
ATOM   973  C  C   . ILE A 1 121 ? 16.268  4.091   3.015  1.00 24.92  ? 120 ILE A C   1 
ATOM   974  O  O   . ILE A 1 121 ? 15.509  4.019   3.990  1.00 23.90  ? 120 ILE A O   1 
ATOM   975  C  CB  . ILE A 1 121 ? 15.698  1.949   1.917  1.00 22.51  ? 120 ILE A CB  1 
ATOM   976  C  CG1 . ILE A 1 121 ? 16.184  0.568   1.459  1.00 35.21  ? 120 ILE A CG1 1 
ATOM   977  C  CG2 . ILE A 1 121 ? 14.922  2.703   0.778  1.00 24.89  ? 120 ILE A CG2 1 
ATOM   978  C  CD1 . ILE A 1 121 ? 17.052  0.575   0.245  1.00 37.92  ? 120 ILE A CD1 1 
ATOM   979  N  N   . SER A 1 122 ? 16.623  5.238   2.435  1.00 25.78  ? 121 SER A N   1 
ATOM   980  C  CA  . SER A 1 122 ? 16.078  6.522   2.833  1.00 22.88  ? 121 SER A CA  1 
ATOM   981  C  C   . SER A 1 122 ? 14.613  6.624   2.435  1.00 23.11  ? 121 SER A C   1 
ATOM   982  O  O   . SER A 1 122 ? 14.193  6.119   1.397  1.00 20.60  ? 121 SER A O   1 
ATOM   983  C  CB  . SER A 1 122 ? 16.878  7.684   2.194  1.00 26.73  ? 121 SER A CB  1 
ATOM   984  O  OG  . SER A 1 122 ? 18.190  7.745   2.734  1.00 33.43  ? 121 SER A OG  1 
ATOM   985  N  N   . MET A 1 123 ? 13.840  7.266   3.296  1.00 17.99  ? 122 MET A N   1 
ATOM   986  C  CA  . MET A 1 123 ? 12.416  7.464   3.091  1.00 23.76  ? 122 MET A CA  1 
ATOM   987  C  C   . MET A 1 123 ? 12.024  8.914   3.332  1.00 27.92  ? 122 MET A C   1 
ATOM   988  O  O   . MET A 1 123 ? 12.236  9.475   4.409  1.00 29.03  ? 122 MET A O   1 
ATOM   989  C  CB  . MET A 1 123 ? 11.621  6.585   4.051  1.00 25.60  ? 122 MET A CB  1 
ATOM   990  C  CG  . MET A 1 123 ? 11.634  5.157   3.662  1.00 21.09  ? 122 MET A CG  1 
ATOM   991  S  SD  . MET A 1 123 ? 11.025  4.067   4.962  1.00 22.80  ? 122 MET A SD  1 
ATOM   992  C  CE  . MET A 1 123 ? 9.237   4.197   4.716  1.00 26.84  ? 122 MET A CE  1 
ATOM   993  N  N   . GLU A 1 124 ? 11.442  9.504   2.311  1.00 26.26  ? 123 GLU A N   1 
ATOM   994  C  CA  . GLU A 1 124 ? 10.847  10.819  2.397  1.00 31.22  ? 123 GLU A CA  1 
ATOM   995  C  C   . GLU A 1 124 ? 9.478   10.705  1.748  1.00 26.81  ? 123 GLU A C   1 
ATOM   996  O  O   . GLU A 1 124 ? 9.224   9.724   1.035  1.00 25.31  ? 123 GLU A O   1 
ATOM   997  C  CB  . GLU A 1 124 ? 11.748  11.810  1.660  1.00 39.60  ? 123 GLU A CB  1 
ATOM   998  C  CG  . GLU A 1 124 ? 11.688  11.738  0.141  1.00 89.01  ? 123 GLU A CG  1 
ATOM   999  C  CD  . GLU A 1 124 ? 12.823  12.491  -0.530 1.00 210.02 ? 123 GLU A CD  1 
ATOM   1000 O  OE1 . GLU A 1 124 ? 12.824  12.557  -1.779 1.00 60.74  ? 123 GLU A OE1 1 
ATOM   1001 O  OE2 . GLU A 1 124 ? 13.706  13.017  0.186  1.00 67.47  ? 123 GLU A OE2 1 
ATOM   1002 N  N   . PRO A 1 125 ? 8.594   11.677  1.972  1.00 24.40  ? 124 PRO A N   1 
ATOM   1003 C  CA  . PRO A 1 125 ? 7.234   11.583  1.432  1.00 27.34  ? 124 PRO A CA  1 
ATOM   1004 C  C   . PRO A 1 125 ? 7.249   11.152  -0.031 1.00 28.39  ? 124 PRO A C   1 
ATOM   1005 O  O   . PRO A 1 125 ? 8.010   11.716  -0.811 1.00 29.56  ? 124 PRO A O   1 
ATOM   1006 C  CB  . PRO A 1 125 ? 6.683   12.994  1.622  1.00 25.67  ? 124 PRO A CB  1 
ATOM   1007 C  CG  . PRO A 1 125 ? 7.409   13.488  2.885  1.00 26.84  ? 124 PRO A CG  1 
ATOM   1008 C  CD  . PRO A 1 125 ? 8.800   12.913  2.755  1.00 29.03  ? 124 PRO A CD  1 
ATOM   1009 N  N   . GLY A 1 126 ? 6.463   10.129  -0.368 1.00 30.81  ? 125 GLY A N   1 
ATOM   1010 C  CA  . GLY A 1 126 ? 6.378   9.624   -1.724 1.00 28.33  ? 125 GLY A CA  1 
ATOM   1011 C  C   . GLY A 1 126 ? 7.229   8.400   -2.000 1.00 20.24  ? 125 GLY A C   1 
ATOM   1012 O  O   . GLY A 1 126 ? 7.010   7.713   -2.976 1.00 27.98  ? 125 GLY A O   1 
ATOM   1013 N  N   . THR A 1 127 ? 8.210   8.140   -1.136 1.00 25.91  ? 126 THR A N   1 
ATOM   1014 C  CA  . THR A 1 127 ? 9.058   6.965   -1.256 1.00 25.29  ? 126 THR A CA  1 
ATOM   1015 C  C   . THR A 1 127 ? 8.223   5.756   -0.932 1.00 27.62  ? 126 THR A C   1 
ATOM   1016 O  O   . THR A 1 127 ? 7.598   5.694   0.117  1.00 22.59  ? 126 THR A O   1 
ATOM   1017 C  CB  . THR A 1 127 ? 10.256  7.045   -0.291 1.00 26.42  ? 126 THR A CB  1 
ATOM   1018 O  OG1 . THR A 1 127 ? 11.094  8.137   -0.685 1.00 31.02  ? 126 THR A OG1 1 
ATOM   1019 C  CG2 . THR A 1 127 ? 11.152  5.805   -0.408 1.00 23.05  ? 126 THR A CG2 1 
ATOM   1020 N  N   . VAL A 1 128 ? 8.207   4.815   -1.862 1.00 23.34  ? 127 VAL A N   1 
ATOM   1021 C  CA  . VAL A 1 128 ? 7.654   3.508   -1.640 1.00 18.50  ? 127 VAL A CA  1 
ATOM   1022 C  C   . VAL A 1 128 ? 8.802   2.539   -1.485 1.00 26.36  ? 127 VAL A C   1 
ATOM   1023 O  O   . VAL A 1 128 ? 9.717   2.496   -2.321 1.00 18.30  ? 127 VAL A O   1 
ATOM   1024 C  CB  . VAL A 1 128 ? 6.729   3.088   -2.798 1.00 19.31  ? 127 VAL A CB  1 
ATOM   1025 C  CG1 . VAL A 1 128 ? 6.263   1.620   -2.631 1.00 26.31  ? 127 VAL A CG1 1 
ATOM   1026 C  CG2 . VAL A 1 128 ? 5.550   4.036   -2.880 1.00 23.18  ? 127 VAL A CG2 1 
ATOM   1027 N  N   . VAL A 1 129 ? 8.753   1.754   -0.424 1.00 22.74  ? 128 VAL A N   1 
ATOM   1028 C  CA  . VAL A 1 129 ? 9.811   0.803   -0.117 1.00 23.75  ? 128 VAL A CA  1 
ATOM   1029 C  C   . VAL A 1 129 ? 9.317   -0.624  -0.295 1.00 23.02  ? 128 VAL A C   1 
ATOM   1030 O  O   . VAL A 1 129 ? 8.314   -1.025  0.268  1.00 20.32  ? 128 VAL A O   1 
ATOM   1031 C  CB  . VAL A 1 129 ? 10.349  0.984   1.310  1.00 24.25  ? 128 VAL A CB  1 
ATOM   1032 C  CG1 . VAL A 1 129 ? 11.448  -0.071  1.636  1.00 21.19  ? 128 VAL A CG1 1 
ATOM   1033 C  CG2 . VAL A 1 129 ? 10.878  2.415   1.489  1.00 20.81  ? 128 VAL A CG2 1 
ATOM   1034 N  N   . TYR A 1 130 ? 10.038  -1.373  -1.117 1.00 23.80  ? 129 TYR A N   1 
ATOM   1035 C  CA  . TYR A 1 130 ? 9.820   -2.794  -1.271 1.00 15.72  ? 129 TYR A CA  1 
ATOM   1036 C  C   . TYR A 1 130 ? 10.672  -3.549  -0.238 1.00 24.61  ? 129 TYR A C   1 
ATOM   1037 O  O   . TYR A 1 130 ? 11.893  -3.557  -0.325 1.00 20.52  ? 129 TYR A O   1 
ATOM   1038 C  CB  . TYR A 1 130 ? 10.172  -3.235  -2.700 1.00 21.35  ? 129 TYR A CB  1 
ATOM   1039 C  CG  . TYR A 1 130 ? 10.061  -4.723  -2.894 1.00 24.89  ? 129 TYR A CG  1 
ATOM   1040 C  CD1 . TYR A 1 130 ? 11.203  -5.502  -3.057 1.00 25.97  ? 129 TYR A CD1 1 
ATOM   1041 C  CD2 . TYR A 1 130 ? 8.817   -5.370  -2.848 1.00 20.26  ? 129 TYR A CD2 1 
ATOM   1042 C  CE1 . TYR A 1 130 ? 11.112  -6.871  -3.212 1.00 24.61  ? 129 TYR A CE1 1 
ATOM   1043 C  CE2 . TYR A 1 130 ? 8.717   -6.745  -2.987 1.00 30.56  ? 129 TYR A CE2 1 
ATOM   1044 C  CZ  . TYR A 1 130 ? 9.879   -7.492  -3.170 1.00 22.85  ? 129 TYR A CZ  1 
ATOM   1045 O  OH  . TYR A 1 130 ? 9.813   -8.863  -3.319 1.00 22.66  ? 129 TYR A OH  1 
ATOM   1046 N  N   . VAL A 1 131 ? 10.003  -4.149  0.743  1.00 23.16  ? 130 VAL A N   1 
ATOM   1047 C  CA  . VAL A 1 131 ? 10.616  -5.028  1.747  1.00 22.68  ? 130 VAL A CA  1 
ATOM   1048 C  C   . VAL A 1 131 ? 10.504  -6.468  1.250  1.00 23.09  ? 130 VAL A C   1 
ATOM   1049 O  O   . VAL A 1 131 ? 9.425   -7.062  1.321  1.00 24.20  ? 130 VAL A O   1 
ATOM   1050 C  CB  . VAL A 1 131 ? 9.877   -4.935  3.121  1.00 18.78  ? 130 VAL A CB  1 
ATOM   1051 C  CG1 . VAL A 1 131 ? 10.511  -5.868  4.156  1.00 21.38  ? 130 VAL A CG1 1 
ATOM   1052 C  CG2 . VAL A 1 131 ? 9.809   -3.470  3.613  1.00 28.61  ? 130 VAL A CG2 1 
ATOM   1053 N  N   . PRO A 1 132 ? 11.590  -7.051  0.752  1.00 21.39  ? 131 PRO A N   1 
ATOM   1054 C  CA  . PRO A 1 132 ? 11.482  -8.372  0.128  1.00 26.32  ? 131 PRO A CA  1 
ATOM   1055 C  C   . PRO A 1 132 ? 11.287  -9.492  1.115  1.00 25.74  ? 131 PRO A C   1 
ATOM   1056 O  O   . PRO A 1 132 ? 11.487  -9.334  2.323  1.00 22.43  ? 131 PRO A O   1 
ATOM   1057 C  CB  . PRO A 1 132 ? 12.822  -8.528  -0.620 1.00 23.27  ? 131 PRO A CB  1 
ATOM   1058 C  CG  . PRO A 1 132 ? 13.446  -7.206  -0.564 1.00 23.34  ? 131 PRO A CG  1 
ATOM   1059 C  CD  . PRO A 1 132 ? 12.968  -6.546  0.691  1.00 23.27  ? 131 PRO A CD  1 
ATOM   1060 N  N   . PRO A 1 133 ? 10.900  -10.648 0.594  1.00 24.62  ? 132 PRO A N   1 
ATOM   1061 C  CA  . PRO A 1 133 ? 10.886  -11.875 1.388  1.00 24.94  ? 132 PRO A CA  1 
ATOM   1062 C  C   . PRO A 1 133 ? 12.197  -12.032 2.167  1.00 19.05  ? 132 PRO A C   1 
ATOM   1063 O  O   . PRO A 1 133 ? 13.270  -11.724 1.606  1.00 23.42  ? 132 PRO A O   1 
ATOM   1064 C  CB  . PRO A 1 133 ? 10.765  -12.960 0.325  1.00 23.21  ? 132 PRO A CB  1 
ATOM   1065 C  CG  . PRO A 1 133 ? 10.005  -12.339 -0.718 1.00 23.63  ? 132 PRO A CG  1 
ATOM   1066 C  CD  . PRO A 1 133 ? 10.484  -10.899 -0.796 1.00 26.57  ? 132 PRO A CD  1 
ATOM   1067 N  N   . TYR A 1 134 ? 12.079  -12.462 3.429  1.00 20.42  ? 133 TYR A N   1 
ATOM   1068 C  CA  . TYR A 1 134 ? 13.197  -12.842 4.331  1.00 24.82  ? 133 TYR A CA  1 
ATOM   1069 C  C   . TYR A 1 134 ? 13.936  -11.698 5.048  1.00 23.85  ? 133 TYR A C   1 
ATOM   1070 O  O   . TYR A 1 134 ? 14.851  -11.945 5.824  1.00 27.83  ? 133 TYR A O   1 
ATOM   1071 C  CB  . TYR A 1 134 ? 14.220  -13.741 3.614  1.00 32.25  ? 133 TYR A CB  1 
ATOM   1072 C  CG  . TYR A 1 134 ? 13.635  -15.048 3.166  1.00 33.38  ? 133 TYR A CG  1 
ATOM   1073 C  CD1 . TYR A 1 134 ? 13.591  -16.154 4.023  1.00 31.50  ? 133 TYR A CD1 1 
ATOM   1074 C  CD2 . TYR A 1 134 ? 13.105  -15.186 1.891  1.00 38.08  ? 133 TYR A CD2 1 
ATOM   1075 C  CE1 . TYR A 1 134 ? 13.038  -17.359 3.596  1.00 42.92  ? 133 TYR A CE1 1 
ATOM   1076 C  CE2 . TYR A 1 134 ? 12.554  -16.368 1.469  1.00 39.95  ? 133 TYR A CE2 1 
ATOM   1077 C  CZ  . TYR A 1 134 ? 12.527  -17.452 2.316  1.00 35.06  ? 133 TYR A CZ  1 
ATOM   1078 O  OH  . TYR A 1 134 ? 11.960  -18.610 1.846  1.00 32.88  ? 133 TYR A OH  1 
ATOM   1079 N  N   . TRP A 1 135 ? 13.532  -10.456 4.820  1.00 23.93  ? 134 TRP A N   1 
ATOM   1080 C  CA  . TRP A 1 135 ? 14.238  -9.316  5.399  1.00 21.16  ? 134 TRP A CA  1 
ATOM   1081 C  C   . TRP A 1 135 ? 13.452  -8.782  6.570  1.00 32.61  ? 134 TRP A C   1 
ATOM   1082 O  O   . TRP A 1 135 ? 12.284  -8.423  6.423  1.00 30.78  ? 134 TRP A O   1 
ATOM   1083 C  CB  . TRP A 1 135 ? 14.402  -8.192  4.398  1.00 22.48  ? 134 TRP A CB  1 
ATOM   1084 C  CG  . TRP A 1 135 ? 15.384  -8.446  3.261  1.00 20.49  ? 134 TRP A CG  1 
ATOM   1085 C  CD1 . TRP A 1 135 ? 15.115  -9.094  2.099  1.00 23.72  ? 134 TRP A CD1 1 
ATOM   1086 C  CD2 . TRP A 1 135 ? 16.733  -7.989  3.165  1.00 23.08  ? 134 TRP A CD2 1 
ATOM   1087 N  NE1 . TRP A 1 135 ? 16.213  -9.079  1.278  1.00 22.72  ? 134 TRP A NE1 1 
ATOM   1088 C  CE2 . TRP A 1 135 ? 17.231  -8.416  1.913  1.00 19.11  ? 134 TRP A CE2 1 
ATOM   1089 C  CE3 . TRP A 1 135 ? 17.587  -7.265  4.017  1.00 21.28  ? 134 TRP A CE3 1 
ATOM   1090 C  CZ2 . TRP A 1 135 ? 18.547  -8.160  1.495  1.00 27.11  ? 134 TRP A CZ2 1 
ATOM   1091 C  CZ3 . TRP A 1 135 ? 18.893  -7.014  3.606  1.00 30.12  ? 134 TRP A CZ3 1 
ATOM   1092 C  CH2 . TRP A 1 135 ? 19.360  -7.463  2.354  1.00 23.08  ? 134 TRP A CH2 1 
ATOM   1093 N  N   . ALA A 1 136 ? 14.099  -8.756  7.728  1.00 23.49  ? 135 ALA A N   1 
ATOM   1094 C  CA  . ALA A 1 136 ? 13.602  -8.044  8.892  1.00 21.26  ? 135 ALA A CA  1 
ATOM   1095 C  C   . ALA A 1 136 ? 13.628  -6.575  8.553  1.00 23.58  ? 135 ALA A C   1 
ATOM   1096 O  O   . ALA A 1 136 ? 14.408  -6.141  7.693  1.00 19.64  ? 135 ALA A O   1 
ATOM   1097 C  CB  . ALA A 1 136 ? 14.494  -8.299  10.098 1.00 20.92  ? 135 ALA A CB  1 
ATOM   1098 N  N   . HIS A 1 137 ? 12.785  -5.806  9.221  1.00 22.87  ? 136 HIS A N   1 
ATOM   1099 C  CA  . HIS A 1 137 ? 12.672  -4.390  8.908  1.00 22.05  ? 136 HIS A CA  1 
ATOM   1100 C  C   . HIS A 1 137 ? 12.326  -3.578  10.143 1.00 24.02  ? 136 HIS A C   1 
ATOM   1101 O  O   . HIS A 1 137 ? 11.454  -3.954  10.925 1.00 17.46  ? 136 HIS A O   1 
ATOM   1102 C  CB  . HIS A 1 137 ? 11.646  -4.147  7.790  1.00 32.11  ? 136 HIS A CB  1 
ATOM   1103 C  CG  . HIS A 1 137 ? 10.401  -4.946  7.941  1.00 25.02  ? 136 HIS A CG  1 
ATOM   1104 N  ND1 . HIS A 1 137 ? 10.341  -6.295  7.648  1.00 31.13  ? 136 HIS A ND1 1 
ATOM   1105 C  CD2 . HIS A 1 137 ? 9.166   -4.593  8.363  1.00 27.31  ? 136 HIS A CD2 1 
ATOM   1106 C  CE1 . HIS A 1 137 ? 9.116   -6.733  7.880  1.00 39.44  ? 136 HIS A CE1 1 
ATOM   1107 N  NE2 . HIS A 1 137 ? 8.386   -5.720  8.316  1.00 26.73  ? 136 HIS A NE2 1 
ATOM   1108 N  N   . ARG A 1 138 ? 13.023  -2.446  10.253 1.00 20.91  ? 137 ARG A N   1 
ATOM   1109 C  CA  . ARG A 1 138 ? 12.892  -1.476  11.320 1.00 17.55  ? 137 ARG A CA  1 
ATOM   1110 C  C   . ARG A 1 138 ? 12.877  -0.097  10.651 1.00 17.63  ? 137 ARG A C   1 
ATOM   1111 O  O   . ARG A 1 138 ? 13.634  0.154   9.730  1.00 20.67  ? 137 ARG A O   1 
ATOM   1112 C  CB  . ARG A 1 138 ? 14.098  -1.599  12.274 1.00 27.66  ? 137 ARG A CB  1 
ATOM   1113 C  CG  . ARG A 1 138 ? 14.415  -0.354  13.093 1.00 21.25  ? 137 ARG A CG  1 
ATOM   1114 C  CD  . ARG A 1 138 ? 15.590  -0.524  14.082 1.00 23.00  ? 137 ARG A CD  1 
ATOM   1115 N  NE  . ARG A 1 138 ? 15.268  -1.438  15.186 1.00 23.04  ? 137 ARG A NE  1 
ATOM   1116 C  CZ  . ARG A 1 138 ? 16.177  -2.001  15.981 1.00 25.98  ? 137 ARG A CZ  1 
ATOM   1117 N  NH1 . ARG A 1 138 ? 17.465  -1.756  15.808 1.00 23.25  ? 137 ARG A NH1 1 
ATOM   1118 N  NH2 . ARG A 1 138 ? 15.794  -2.826  16.947 1.00 23.57  ? 137 ARG A NH2 1 
ATOM   1119 N  N   . THR A 1 139 ? 12.006  0.790   11.107 1.00 22.77  ? 138 THR A N   1 
ATOM   1120 C  CA  . THR A 1 139 ? 12.034  2.160   10.617 1.00 22.96  ? 138 THR A CA  1 
ATOM   1121 C  C   . THR A 1 139 ? 12.642  3.073   11.670 1.00 24.69  ? 138 THR A C   1 
ATOM   1122 O  O   . THR A 1 139 ? 12.581  2.791   12.862 1.00 21.38  ? 138 THR A O   1 
ATOM   1123 C  CB  . THR A 1 139 ? 10.637  2.662   10.189 1.00 20.28  ? 138 THR A CB  1 
ATOM   1124 O  OG1 . THR A 1 139 ? 9.640   2.246   11.131 1.00 20.63  ? 138 THR A OG1 1 
ATOM   1125 C  CG2 . THR A 1 139 ? 10.237  2.038   8.879  1.00 25.14  ? 138 THR A CG2 1 
ATOM   1126 N  N   . VAL A 1 140 ? 13.233  4.158   11.186 1.00 21.44  ? 139 VAL A N   1 
ATOM   1127 C  CA  . VAL A 1 140 ? 14.006  5.102   11.987 1.00 26.37  ? 139 VAL A CA  1 
ATOM   1128 C  C   . VAL A 1 140 ? 13.631  6.516   11.594 1.00 21.87  ? 139 VAL A C   1 
ATOM   1129 O  O   . VAL A 1 140 ? 13.547  6.816   10.415 1.00 24.24  ? 139 VAL A O   1 
ATOM   1130 C  CB  . VAL A 1 140 ? 15.514  4.951   11.723 1.00 22.40  ? 139 VAL A CB  1 
ATOM   1131 C  CG1 . VAL A 1 140 ? 16.330  5.882   12.644 1.00 26.28  ? 139 VAL A CG1 1 
ATOM   1132 C  CG2 . VAL A 1 140 ? 15.961  3.480   11.868 1.00 25.96  ? 139 VAL A CG2 1 
ATOM   1133 N  N   . ASN A 1 141 ? 13.382  7.357   12.588 1.00 18.18  ? 140 ASN A N   1 
ATOM   1134 C  CA  . ASN A 1 141 ? 13.103  8.775   12.400 1.00 18.15  ? 140 ASN A CA  1 
ATOM   1135 C  C   . ASN A 1 141 ? 14.395  9.536   12.625 1.00 20.13  ? 140 ASN A C   1 
ATOM   1136 O  O   . ASN A 1 141 ? 14.876  9.611   13.756 1.00 24.93  ? 140 ASN A O   1 
ATOM   1137 C  CB  . ASN A 1 141 ? 12.049  9.246   13.408 1.00 22.07  ? 140 ASN A CB  1 
ATOM   1138 C  CG  . ASN A 1 141 ? 11.612  10.691  13.173 1.00 22.04  ? 140 ASN A CG  1 
ATOM   1139 O  OD1 . ASN A 1 141 ? 12.297  11.482  12.481 1.00 23.22  ? 140 ASN A OD1 1 
ATOM   1140 N  ND2 . ASN A 1 141 ? 10.478  11.050  13.756 1.00 20.05  ? 140 ASN A ND2 1 
ATOM   1141 N  N   . ILE A 1 142 ? 14.943  10.081  11.541 1.00 23.75  ? 141 ILE A N   1 
ATOM   1142 C  CA  . ILE A 1 142 ? 16.189  10.859  11.571 1.00 21.81  ? 141 ILE A CA  1 
ATOM   1143 C  C   . ILE A 1 142 ? 15.969  12.399  11.598 1.00 25.71  ? 141 ILE A C   1 
ATOM   1144 O  O   . ILE A 1 142 ? 16.917  13.168  11.499 1.00 25.68  ? 141 ILE A O   1 
ATOM   1145 C  CB  . ILE A 1 142 ? 17.090  10.451  10.387 1.00 25.74  ? 141 ILE A CB  1 
ATOM   1146 C  CG1 . ILE A 1 142 ? 16.487  10.881  9.041  1.00 28.55  ? 141 ILE A CG1 1 
ATOM   1147 C  CG2 . ILE A 1 142 ? 17.307  8.937   10.420 1.00 22.70  ? 141 ILE A CG2 1 
ATOM   1148 C  CD1 . ILE A 1 142 ? 17.465  10.813  7.900  1.00 33.84  ? 141 ILE A CD1 1 
ATOM   1149 N  N   . GLY A 1 143 ? 14.719  12.821  11.753 1.00 26.06  ? 142 GLY A N   1 
ATOM   1150 C  CA  . GLY A 1 143 ? 14.349  14.225  11.749 1.00 29.30  ? 142 GLY A CA  1 
ATOM   1151 C  C   . GLY A 1 143 ? 13.786  14.714  13.067 1.00 25.68  ? 142 GLY A C   1 
ATOM   1152 O  O   . GLY A 1 143 ? 13.812  14.010  14.086 1.00 28.38  ? 142 GLY A O   1 
ATOM   1153 N  N   . ASP A 1 144 ? 13.240  15.931  13.003 1.00 34.50  ? 143 ASP A N   1 
ATOM   1154 C  CA  . ASP A 1 144 ? 12.754  16.686  14.151 1.00 33.49  ? 143 ASP A CA  1 
ATOM   1155 C  C   . ASP A 1 144 ? 11.241  16.616  14.316 1.00 35.88  ? 143 ASP A C   1 
ATOM   1156 O  O   . ASP A 1 144 ? 10.719  17.126  15.297 1.00 32.38  ? 143 ASP A O   1 
ATOM   1157 C  CB  . ASP A 1 144 ? 13.120  18.179  13.984 1.00 46.37  ? 143 ASP A CB  1 
ATOM   1158 C  CG  . ASP A 1 144 ? 14.606  18.430  14.041 1.00 124.59 ? 143 ASP A CG  1 
ATOM   1159 O  OD1 . ASP A 1 144 ? 15.260  17.933  14.980 1.00 58.71  ? 143 ASP A OD1 1 
ATOM   1160 O  OD2 . ASP A 1 144 ? 15.205  19.126  13.197 1.00 90.90  ? 143 ASP A OD2 1 
ATOM   1161 N  N   . GLU A 1 145 ? 10.551  16.021  13.344 1.00 26.34  ? 144 GLU A N   1 
ATOM   1162 C  CA  . GLU A 1 145 ? 9.088   15.949  13.296 1.00 28.11  ? 144 GLU A CA  1 
ATOM   1163 C  C   . GLU A 1 145 ? 8.662   14.456  13.219 1.00 27.48  ? 144 GLU A C   1 
ATOM   1164 O  O   . GLU A 1 145 ? 9.498   13.606  12.911 1.00 26.99  ? 144 GLU A O   1 
ATOM   1165 C  CB  . GLU A 1 145 ? 8.607   16.704  12.048 1.00 32.37  ? 144 GLU A CB  1 
ATOM   1166 C  CG  . GLU A 1 145 ? 8.795   15.943  10.736 1.00 95.93  ? 144 GLU A CG  1 
ATOM   1167 C  CD  . GLU A 1 145 ? 8.583   16.783  9.483  1.00 184.12 ? 144 GLU A CD  1 
ATOM   1168 O  OE1 . GLU A 1 145 ? 7.415   17.127  9.153  1.00 29.27  ? 144 GLU A OE1 1 
ATOM   1169 O  OE2 . GLU A 1 145 ? 9.593   17.060  8.797  1.00 57.26  ? 144 GLU A OE2 1 
ATOM   1170 N  N   . PRO A 1 146 ? 7.401   14.126  13.497 1.00 27.97  ? 145 PRO A N   1 
ATOM   1171 C  CA  . PRO A 1 146 ? 6.948   12.753  13.287 1.00 24.72  ? 145 PRO A CA  1 
ATOM   1172 C  C   . PRO A 1 146 ? 7.231   12.242  11.870 1.00 27.92  ? 145 PRO A C   1 
ATOM   1173 O  O   . PRO A 1 146 ? 7.165   12.975  10.881 1.00 27.53  ? 145 PRO A O   1 
ATOM   1174 C  CB  . PRO A 1 146 ? 5.445   12.825  13.601 1.00 36.37  ? 145 PRO A CB  1 
ATOM   1175 C  CG  . PRO A 1 146 ? 5.366   13.900  14.639 1.00 34.14  ? 145 PRO A CG  1 
ATOM   1176 C  CD  . PRO A 1 146 ? 6.331   14.950  14.105 1.00 25.13  ? 145 PRO A CD  1 
ATOM   1177 N  N   . PHE A 1 147 ? 7.606   10.976  11.812 1.00 26.78  ? 146 PHE A N   1 
ATOM   1178 C  CA  . PHE A 1 147 ? 7.864   10.275  10.555 1.00 16.95  ? 146 PHE A CA  1 
ATOM   1179 C  C   . PHE A 1 147 ? 6.700   9.296   10.454 1.00 24.79  ? 146 PHE A C   1 
ATOM   1180 O  O   . PHE A 1 147 ? 6.522   8.454   11.335 1.00 17.42  ? 146 PHE A O   1 
ATOM   1181 C  CB  . PHE A 1 147 ? 9.255   9.620   10.621 1.00 19.37  ? 146 PHE A CB  1 
ATOM   1182 C  CG  . PHE A 1 147 ? 9.552   8.690   9.486  1.00 23.89  ? 146 PHE A CG  1 
ATOM   1183 C  CD1 . PHE A 1 147 ? 9.394   9.112   8.169  1.00 25.53  ? 146 PHE A CD1 1 
ATOM   1184 C  CD2 . PHE A 1 147 ? 10.000  7.394   9.734  1.00 27.67  ? 146 PHE A CD2 1 
ATOM   1185 C  CE1 . PHE A 1 147 ? 9.666   8.247   7.115  1.00 23.33  ? 146 PHE A CE1 1 
ATOM   1186 C  CE2 . PHE A 1 147 ? 10.264  6.530   8.684  1.00 26.38  ? 146 PHE A CE2 1 
ATOM   1187 C  CZ  . PHE A 1 147 ? 10.095  6.963   7.383  1.00 22.22  ? 146 PHE A CZ  1 
ATOM   1188 N  N   . ILE A 1 148 ? 5.866   9.490   9.427  1.00 26.28  ? 147 ILE A N   1 
ATOM   1189 C  CA  . ILE A 1 148 ? 4.605   8.795   9.279  1.00 22.29  ? 147 ILE A CA  1 
ATOM   1190 C  C   . ILE A 1 148 ? 4.606   8.026   7.970  1.00 24.30  ? 147 ILE A C   1 
ATOM   1191 O  O   . ILE A 1 148 ? 5.006   8.536   6.940  1.00 20.42  ? 147 ILE A O   1 
ATOM   1192 C  CB  . ILE A 1 148 ? 3.439   9.797   9.321  1.00 28.65  ? 147 ILE A CB  1 
ATOM   1193 C  CG1 . ILE A 1 148 ? 3.496   10.594  10.635 1.00 29.66  ? 147 ILE A CG1 1 
ATOM   1194 C  CG2 . ILE A 1 148 ? 2.100   9.072   9.166  1.00 26.05  ? 147 ILE A CG2 1 
ATOM   1195 C  CD1 . ILE A 1 148 ? 2.550   11.810  10.695 1.00 40.78  ? 147 ILE A CD1 1 
ATOM   1196 N  N   . PHE A 1 149 ? 4.183   6.779   8.030  1.00 23.00  ? 148 PHE A N   1 
ATOM   1197 C  CA  . PHE A 1 149 ? 4.098   5.951   6.841  1.00 20.35  ? 148 PHE A CA  1 
ATOM   1198 C  C   . PHE A 1 149 ? 2.954   4.961   6.971  1.00 20.59  ? 148 PHE A C   1 
ATOM   1199 O  O   . PHE A 1 149 ? 2.389   4.768   8.051  1.00 20.38  ? 148 PHE A O   1 
ATOM   1200 C  CB  . PHE A 1 149 ? 5.401   5.202   6.608  1.00 20.56  ? 148 PHE A CB  1 
ATOM   1201 C  CG  . PHE A 1 149 ? 5.904   4.468   7.814  1.00 19.21  ? 148 PHE A CG  1 
ATOM   1202 C  CD1 . PHE A 1 149 ? 6.898   5.016   8.610  1.00 23.37  ? 148 PHE A CD1 1 
ATOM   1203 C  CD2 . PHE A 1 149 ? 5.382   3.229   8.152  1.00 20.61  ? 148 PHE A CD2 1 
ATOM   1204 C  CE1 . PHE A 1 149 ? 7.356   4.345   9.736  1.00 21.58  ? 148 PHE A CE1 1 
ATOM   1205 C  CE2 . PHE A 1 149 ? 5.841   2.561   9.260  1.00 16.89  ? 148 PHE A CE2 1 
ATOM   1206 C  CZ  . PHE A 1 149 ? 6.826   3.128   10.059 1.00 19.42  ? 148 PHE A CZ  1 
ATOM   1207 N  N   . LEU A 1 150 ? 2.627   4.366   5.833  1.00 23.24  ? 149 LEU A N   1 
ATOM   1208 C  CA  . LEU A 1 150 ? 1.598   3.358   5.698  1.00 19.75  ? 149 LEU A CA  1 
ATOM   1209 C  C   . LEU A 1 150 ? 2.289   2.095   5.216  1.00 22.51  ? 149 LEU A C   1 
ATOM   1210 O  O   . LEU A 1 150 ? 3.124   2.140   4.317  1.00 22.27  ? 149 LEU A O   1 
ATOM   1211 C  CB  . LEU A 1 150 ? 0.565   3.809   4.680  1.00 21.27  ? 149 LEU A CB  1 
ATOM   1212 C  CG  . LEU A 1 150 ? -0.532  2.819   4.271  1.00 20.16  ? 149 LEU A CG  1 
ATOM   1213 C  CD1 . LEU A 1 150 ? -1.473  2.497   5.399  1.00 22.07  ? 149 LEU A CD1 1 
ATOM   1214 C  CD2 . LEU A 1 150 ? -1.302  3.377   3.064  1.00 30.62  ? 149 LEU A CD2 1 
ATOM   1215 N  N   . ALA A 1 151 ? 1.950   0.968   5.816  1.00 20.46  ? 150 ALA A N   1 
ATOM   1216 C  CA  . ALA A 1 151 ? 2.504   -0.307  5.413  1.00 22.73  ? 150 ALA A CA  1 
ATOM   1217 C  C   . ALA A 1 151 ? 1.411   -1.305  5.103  1.00 30.15  ? 150 ALA A C   1 
ATOM   1218 O  O   . ALA A 1 151 ? 0.423   -1.401  5.832  1.00 19.52  ? 150 ALA A O   1 
ATOM   1219 C  CB  . ALA A 1 151 ? 3.405   -0.826  6.501  1.00 19.72  ? 150 ALA A CB  1 
ATOM   1220 N  N   . ILE A 1 152 ? 1.603   -2.039  4.011  1.00 22.43  ? 151 ILE A N   1 
ATOM   1221 C  CA  . ILE A 1 152 ? 0.690   -3.095  3.581  1.00 26.11  ? 151 ILE A CA  1 
ATOM   1222 C  C   . ILE A 1 152 ? 1.449   -4.418  3.589  1.00 21.64  ? 151 ILE A C   1 
ATOM   1223 O  O   . ILE A 1 152 ? 2.555   -4.542  3.063  1.00 17.92  ? 151 ILE A O   1 
ATOM   1224 C  CB  . ILE A 1 152 ? 0.054   -2.790  2.165  1.00 19.66  ? 151 ILE A CB  1 
ATOM   1225 C  CG1 . ILE A 1 152 ? -0.787  -1.498  2.203  1.00 28.98  ? 151 ILE A CG1 1 
ATOM   1226 C  CG2 . ILE A 1 152 ? -0.803  -3.971  1.702  1.00 22.07  ? 151 ILE A CG2 1 
ATOM   1227 C  CD1 . ILE A 1 152 ? -0.033  -0.255  1.778  1.00 59.37  ? 151 ILE A CD1 1 
ATOM   1228 N  N   . TYR A 1 153 ? 0.858   -5.416  4.215  1.00 21.29  ? 152 TYR A N   1 
ATOM   1229 C  CA  . TYR A 1 153 ? 1.545   -6.680  4.439  1.00 21.72  ? 152 TYR A CA  1 
ATOM   1230 C  C   . TYR A 1 153 ? 0.565   -7.834  4.437  1.00 20.98  ? 152 TYR A C   1 
ATOM   1231 O  O   . TYR A 1 153 ? -0.615  -7.642  4.751  1.00 23.76  ? 152 TYR A O   1 
ATOM   1232 C  CB  . TYR A 1 153 ? 2.328   -6.652  5.757  1.00 25.50  ? 152 TYR A CB  1 
ATOM   1233 C  CG  . TYR A 1 153 ? 1.561   -6.166  6.969  1.00 27.06  ? 152 TYR A CG  1 
ATOM   1234 C  CD1 . TYR A 1 153 ? 1.298   -4.801  7.148  1.00 27.04  ? 152 TYR A CD1 1 
ATOM   1235 C  CD2 . TYR A 1 153 ? 1.164   -7.056  7.977  1.00 28.72  ? 152 TYR A CD2 1 
ATOM   1236 C  CE1 . TYR A 1 153 ? 0.603   -4.325  8.264  1.00 27.63  ? 152 TYR A CE1 1 
ATOM   1237 C  CE2 . TYR A 1 153 ? 0.491   -6.582  9.126  1.00 26.61  ? 152 TYR A CE2 1 
ATOM   1238 C  CZ  . TYR A 1 153 ? 0.207   -5.218  9.242  1.00 27.72  ? 152 TYR A CZ  1 
ATOM   1239 O  OH  . TYR A 1 153 ? -0.461  -4.731  10.336 1.00 27.75  ? 152 TYR A OH  1 
ATOM   1240 N  N   . PRO A 1 154 ? 1.031   -9.016  4.047  1.00 21.05  ? 153 PRO A N   1 
ATOM   1241 C  CA  . PRO A 1 154 ? 0.183   -10.215 4.069  1.00 25.51  ? 153 PRO A CA  1 
ATOM   1242 C  C   . PRO A 1 154 ? -0.404  -10.526 5.444  1.00 20.08  ? 153 PRO A C   1 
ATOM   1243 O  O   . PRO A 1 154 ? 0.303   -10.492 6.460  1.00 20.89  ? 153 PRO A O   1 
ATOM   1244 C  CB  . PRO A 1 154 ? 1.134   -11.316 3.610  1.00 22.44  ? 153 PRO A CB  1 
ATOM   1245 C  CG  . PRO A 1 154 ? 2.135   -10.568 2.744  1.00 20.63  ? 153 PRO A CG  1 
ATOM   1246 C  CD  . PRO A 1 154 ? 2.356   -9.310  3.487  1.00 23.61  ? 153 PRO A CD  1 
ATOM   1247 N  N   . ALA A 1 155 ? -1.688  -10.874 5.437  1.00 26.45  ? 154 ALA A N   1 
ATOM   1248 C  CA  . ALA A 1 155 ? -2.464  -11.106 6.659  1.00 31.99  ? 154 ALA A CA  1 
ATOM   1249 C  C   . ALA A 1 155 ? -1.983  -12.330 7.427  1.00 29.48  ? 154 ALA A C   1 
ATOM   1250 O  O   . ALA A 1 155 ? -2.317  -12.482 8.608  1.00 30.05  ? 154 ALA A O   1 
ATOM   1251 C  CB  . ALA A 1 155 ? -3.920  -11.254 6.329  1.00 19.09  ? 154 ALA A CB  1 
ATOM   1252 N  N   . ASP A 1 156 ? -1.223  -13.193 6.750  1.00 23.31  ? 155 ASP A N   1 
ATOM   1253 C  CA  . ASP A 1 156 ? -0.613  -14.383 7.368  1.00 26.85  ? 155 ASP A CA  1 
ATOM   1254 C  C   . ASP A 1 156 ? 0.898   -14.278 7.617  1.00 24.10  ? 155 ASP A C   1 
ATOM   1255 O  O   . ASP A 1 156 ? 1.546   -15.286 7.909  1.00 26.76  ? 155 ASP A O   1 
ATOM   1256 C  CB  . ASP A 1 156 ? -0.931  -15.646 6.538  1.00 24.91  ? 155 ASP A CB  1 
ATOM   1257 C  CG  . ASP A 1 156 ? -0.199  -15.689 5.189  1.00 34.74  ? 155 ASP A CG  1 
ATOM   1258 O  OD1 . ASP A 1 156 ? 0.400   -14.673 4.716  1.00 24.33  ? 155 ASP A OD1 1 
ATOM   1259 O  OD2 . ASP A 1 156 ? -0.189  -16.735 4.517  1.00 31.30  ? 155 ASP A OD2 1 
ATOM   1260 N  N   . ALA A 1 157 ? 1.461   -13.069 7.540  1.00 21.76  ? 156 ALA A N   1 
ATOM   1261 C  CA  . ALA A 1 157 ? 2.907   -12.891 7.697  1.00 19.54  ? 156 ALA A CA  1 
ATOM   1262 C  C   . ALA A 1 157 ? 3.352   -13.120 9.136  1.00 26.06  ? 156 ALA A C   1 
ATOM   1263 O  O   . ALA A 1 157 ? 4.426   -13.684 9.376  1.00 25.93  ? 156 ALA A O   1 
ATOM   1264 C  CB  . ALA A 1 157 ? 3.350   -11.505 7.221  1.00 29.15  ? 156 ALA A CB  1 
ATOM   1265 N  N   . GLY A 1 158 ? 2.548   -12.631 10.082 1.00 26.53  ? 157 GLY A N   1 
ATOM   1266 C  CA  . GLY A 1 158 ? 2.841   -12.751 11.494 1.00 24.66  ? 157 GLY A CA  1 
ATOM   1267 C  C   . GLY A 1 158 ? 4.031   -11.917 11.871 1.00 29.73  ? 157 GLY A C   1 
ATOM   1268 O  O   . GLY A 1 158 ? 4.515   -11.125 11.066 1.00 25.44  ? 157 GLY A O   1 
ATOM   1269 N  N   . HIS A 1 159 ? 4.515   -12.110 13.096 1.00 30.66  ? 158 HIS A N   1 
ATOM   1270 C  CA  . HIS A 1 159 ? 5.658   -11.362 13.598 1.00 18.68  ? 158 HIS A CA  1 
ATOM   1271 C  C   . HIS A 1 159 ? 6.640   -12.229 14.402 1.00 25.33  ? 158 HIS A C   1 
ATOM   1272 O  O   . HIS A 1 159 ? 6.247   -13.054 15.228 1.00 39.93  ? 158 HIS A O   1 
ATOM   1273 C  CB  . HIS A 1 159 ? 5.191   -10.197 14.492 1.00 25.47  ? 158 HIS A CB  1 
ATOM   1274 C  CG  . HIS A 1 159 ? 4.296   -9.206  13.811 1.00 25.03  ? 158 HIS A CG  1 
ATOM   1275 N  ND1 . HIS A 1 159 ? 2.934   -9.387  13.705 1.00 28.62  ? 158 HIS A ND1 1 
ATOM   1276 C  CD2 . HIS A 1 159 ? 4.564   -8.020  13.216 1.00 33.54  ? 158 HIS A CD2 1 
ATOM   1277 C  CE1 . HIS A 1 159 ? 2.398   -8.352  13.081 1.00 38.04  ? 158 HIS A CE1 1 
ATOM   1278 N  NE2 . HIS A 1 159 ? 3.366   -7.507  12.773 1.00 30.44  ? 158 HIS A NE2 1 
ATOM   1279 N  N   . ASP A 1 160 ? 7.918   -12.029 14.129 1.00 23.84  ? 159 ASP A N   1 
ATOM   1280 C  CA  . ASP A 1 160 ? 8.989   -12.528 14.955 1.00 21.66  ? 159 ASP A CA  1 
ATOM   1281 C  C   . ASP A 1 160 ? 9.773   -11.316 15.462 1.00 22.37  ? 159 ASP A C   1 
ATOM   1282 O  O   . ASP A 1 160 ? 10.621  -10.757 14.754 1.00 23.73  ? 159 ASP A O   1 
ATOM   1283 C  CB  . ASP A 1 160 ? 9.890   -13.479 14.165 1.00 29.01  ? 159 ASP A CB  1 
ATOM   1284 C  CG  . ASP A 1 160 ? 11.192  -13.769 14.883 1.00 34.49  ? 159 ASP A CG  1 
ATOM   1285 O  OD1 . ASP A 1 160 ? 11.241  -13.596 16.127 1.00 30.92  ? 159 ASP A OD1 1 
ATOM   1286 O  OD2 . ASP A 1 160 ? 12.214  -14.189 14.296 1.00 34.75  ? 159 ASP A OD2 1 
ATOM   1287 N  N   . TYR A 1 161 ? 9.444   -10.888 16.683 1.00 29.28  ? 160 TYR A N   1 
ATOM   1288 C  CA  . TYR A 1 161 ? 10.149  -9.799  17.378 1.00 24.82  ? 160 TYR A CA  1 
ATOM   1289 C  C   . TYR A 1 161 ? 11.361  -10.296 18.145 1.00 21.00  ? 160 TYR A C   1 
ATOM   1290 O  O   . TYR A 1 161 ? 12.327  -9.555  18.361 1.00 25.07  ? 160 TYR A O   1 
ATOM   1291 C  CB  . TYR A 1 161 ? 9.195   -9.110  18.376 1.00 25.76  ? 160 TYR A CB  1 
ATOM   1292 C  CG  . TYR A 1 161 ? 8.190   -8.232  17.683 1.00 24.11  ? 160 TYR A CG  1 
ATOM   1293 C  CD1 . TYR A 1 161 ? 6.882   -8.666  17.443 1.00 26.51  ? 160 TYR A CD1 1 
ATOM   1294 C  CD2 . TYR A 1 161 ? 8.557   -6.976  17.221 1.00 32.17  ? 160 TYR A CD2 1 
ATOM   1295 C  CE1 . TYR A 1 161 ? 5.972   -7.865  16.795 1.00 31.49  ? 160 TYR A CE1 1 
ATOM   1296 C  CE2 . TYR A 1 161 ? 7.659   -6.180  16.565 1.00 21.24  ? 160 TYR A CE2 1 
ATOM   1297 C  CZ  . TYR A 1 161 ? 6.376   -6.627  16.349 1.00 24.62  ? 160 TYR A CZ  1 
ATOM   1298 O  OH  . TYR A 1 161 ? 5.500   -5.826  15.704 1.00 27.67  ? 160 TYR A OH  1 
ATOM   1299 N  N   . GLY A 1 162 ? 11.298  -11.560 18.553 1.00 24.40  ? 161 GLY A N   1 
ATOM   1300 C  CA  . GLY A 1 162 ? 12.241  -12.123 19.487 1.00 27.27  ? 161 GLY A CA  1 
ATOM   1301 C  C   . GLY A 1 162 ? 13.659  -12.137 19.006 1.00 30.14  ? 161 GLY A C   1 
ATOM   1302 O  O   . GLY A 1 162 ? 14.569  -11.818 19.770 1.00 28.54  ? 161 GLY A O   1 
ATOM   1303 N  N   . THR A 1 163 ? 13.850  -12.489 17.737 1.00 35.97  ? 162 THR A N   1 
ATOM   1304 C  CA  . THR A 1 163 ? 15.175  -12.531 17.131 1.00 32.80  ? 162 THR A CA  1 
ATOM   1305 C  C   . THR A 1 163 ? 15.871  -11.187 17.221 1.00 38.38  ? 162 THR A C   1 
ATOM   1306 O  O   . THR A 1 163 ? 17.044  -11.102 17.604 1.00 35.90  ? 162 THR A O   1 
ATOM   1307 C  CB  . THR A 1 163 ? 15.070  -12.971 15.660 1.00 41.97  ? 162 THR A CB  1 
ATOM   1308 O  OG1 . THR A 1 163 ? 14.462  -14.263 15.595 1.00 36.88  ? 162 THR A OG1 1 
ATOM   1309 C  CG2 . THR A 1 163 ? 16.446  -13.177 15.036 1.00 41.53  ? 162 THR A CG2 1 
ATOM   1310 N  N   . ILE A 1 164 ? 15.142  -10.135 16.878 1.00 28.53  ? 163 ILE A N   1 
ATOM   1311 C  CA  . ILE A 1 164 ? 15.698  -8.780  16.908 1.00 31.62  ? 163 ILE A CA  1 
ATOM   1312 C  C   . ILE A 1 164 ? 15.900  -8.293  18.349 1.00 27.03  ? 163 ILE A C   1 
ATOM   1313 O  O   . ILE A 1 164 ? 16.840  -7.559  18.644 1.00 29.52  ? 163 ILE A O   1 
ATOM   1314 C  CB  . ILE A 1 164 ? 14.735  -7.807  16.150 1.00 28.75  ? 163 ILE A CB  1 
ATOM   1315 C  CG1 . ILE A 1 164 ? 14.605  -8.222  14.672 1.00 30.95  ? 163 ILE A CG1 1 
ATOM   1316 C  CG2 . ILE A 1 164 ? 15.197  -6.359  16.286 1.00 31.08  ? 163 ILE A CG2 1 
ATOM   1317 C  CD1 . ILE A 1 164 ? 15.898  -8.285  13.909 1.00 29.14  ? 163 ILE A CD1 1 
ATOM   1318 N  N   . ALA A 1 165 ? 14.987  -8.686  19.235 1.00 23.28  ? 164 ALA A N   1 
ATOM   1319 C  CA  . ALA A 1 165 ? 15.030  -8.284  20.639 1.00 27.05  ? 164 ALA A CA  1 
ATOM   1320 C  C   . ALA A 1 165 ? 16.313  -8.763  21.316 1.00 51.83  ? 164 ALA A C   1 
ATOM   1321 O  O   . ALA A 1 165 ? 16.806  -8.094  22.221 1.00 35.08  ? 164 ALA A O   1 
ATOM   1322 C  CB  . ALA A 1 165 ? 13.824  -8.820  21.379 1.00 26.02  ? 164 ALA A CB  1 
ATOM   1323 N  N   . GLU A 1 166 ? 16.850  -9.901  20.864 1.00 41.74  ? 165 GLU A N   1 
ATOM   1324 C  CA  . GLU A 1 166 ? 18.091  -10.476 21.422 1.00 33.27  ? 165 GLU A CA  1 
ATOM   1325 C  C   . GLU A 1 166 ? 19.394  -10.029 20.724 1.00 58.52  ? 165 GLU A C   1 
ATOM   1326 O  O   . GLU A 1 166 ? 20.379  -9.693  21.396 1.00 51.58  ? 165 GLU A O   1 
ATOM   1327 C  CB  . GLU A 1 166 ? 17.989  -12.016 21.463 1.00 49.01  ? 165 GLU A CB  1 
ATOM   1328 C  CG  . GLU A 1 166 ? 17.892  -12.711 20.108 1.00 148.12 ? 165 GLU A CG  1 
ATOM   1329 C  CD  . GLU A 1 166 ? 18.095  -14.211 20.194 1.00 163.54 ? 165 GLU A CD  1 
ATOM   1330 O  OE1 . GLU A 1 166 ? 17.181  -14.965 19.792 1.00 94.30  ? 165 GLU A OE1 1 
ATOM   1331 O  OE2 . GLU A 1 166 ? 19.174  -14.638 20.653 1.00 128.09 ? 165 GLU A OE2 1 
ATOM   1332 N  N   . LYS A 1 167 ? 19.393  -10.006 19.391 1.00 44.45  ? 166 LYS A N   1 
ATOM   1333 C  CA  . LYS A 1 167 ? 20.612  -9.769  18.604 1.00 66.36  ? 166 LYS A CA  1 
ATOM   1334 C  C   . LYS A 1 167 ? 20.727  -8.331  18.099 1.00 45.76  ? 166 LYS A C   1 
ATOM   1335 O  O   . LYS A 1 167 ? 21.836  -7.822  17.865 1.00 45.35  ? 166 LYS A O   1 
ATOM   1336 C  CB  . LYS A 1 167 ? 20.664  -10.733 17.411 1.00 66.62  ? 166 LYS A CB  1 
ATOM   1337 C  CG  . LYS A 1 167 ? 20.786  -12.208 17.798 1.00 87.81  ? 166 LYS A CG  1 
ATOM   1338 C  CD  . LYS A 1 167 ? 21.917  -12.921 17.048 1.00 138.78 ? 166 LYS A CD  1 
ATOM   1339 C  CE  . LYS A 1 167 ? 21.636  -13.045 15.551 1.00 129.90 ? 166 LYS A CE  1 
ATOM   1340 N  NZ  . LYS A 1 167 ? 20.332  -13.712 15.262 1.00 65.46  ? 166 LYS A NZ  1 
ATOM   1341 N  N   . GLY A 1 168 ? 19.580  -7.688  17.908 1.00 37.76  ? 167 GLY A N   1 
ATOM   1342 C  CA  . GLY A 1 168 ? 19.533  -6.355  17.338 1.00 34.60  ? 167 GLY A CA  1 
ATOM   1343 C  C   . GLY A 1 168 ? 19.717  -6.407  15.829 1.00 23.83  ? 167 GLY A C   1 
ATOM   1344 O  O   . GLY A 1 168 ? 19.608  -7.457  15.198 1.00 35.36  ? 167 GLY A O   1 
ATOM   1345 N  N   . PHE A 1 169 ? 19.960  -5.236  15.259 1.00 32.81  ? 168 PHE A N   1 
ATOM   1346 C  CA  . PHE A 1 169 ? 20.358  -5.108  13.879 1.00 30.54  ? 168 PHE A CA  1 
ATOM   1347 C  C   . PHE A 1 169 ? 21.861  -4.929  13.864 1.00 35.29  ? 168 PHE A C   1 
ATOM   1348 O  O   . PHE A 1 169 ? 22.443  -4.445  14.825 1.00 27.90  ? 168 PHE A O   1 
ATOM   1349 C  CB  . PHE A 1 169 ? 19.677  -3.897  13.234 1.00 26.25  ? 168 PHE A CB  1 
ATOM   1350 C  CG  . PHE A 1 169 ? 18.306  -4.185  12.708 1.00 32.08  ? 168 PHE A CG  1 
ATOM   1351 C  CD1 . PHE A 1 169 ? 17.216  -4.332  13.574 1.00 25.73  ? 168 PHE A CD1 1 
ATOM   1352 C  CD2 . PHE A 1 169 ? 18.093  -4.315  11.349 1.00 25.97  ? 168 PHE A CD2 1 
ATOM   1353 C  CE1 . PHE A 1 169 ? 15.947  -4.597  13.078 1.00 32.57  ? 168 PHE A CE1 1 
ATOM   1354 C  CE2 . PHE A 1 169 ? 16.833  -4.595  10.856 1.00 25.13  ? 168 PHE A CE2 1 
ATOM   1355 C  CZ  . PHE A 1 169 ? 15.759  -4.728  11.715 1.00 29.04  ? 168 PHE A CZ  1 
ATOM   1356 N  N   . SER A 1 170 ? 22.480  -5.299  12.752 1.00 23.73  ? 169 SER A N   1 
ATOM   1357 C  CA  . SER A 1 170 ? 23.917  -5.236  12.601 1.00 27.11  ? 169 SER A CA  1 
ATOM   1358 C  C   . SER A 1 170 ? 24.395  -3.828  12.359 1.00 41.63  ? 169 SER A C   1 
ATOM   1359 O  O   . SER A 1 170 ? 25.579  -3.584  12.427 1.00 27.50  ? 169 SER A O   1 
ATOM   1360 C  CB  . SER A 1 170 ? 24.375  -6.152  11.461 1.00 30.42  ? 169 SER A CB  1 
ATOM   1361 O  OG  . SER A 1 170 ? 23.992  -5.646  10.190 1.00 28.60  ? 169 SER A OG  1 
ATOM   1362 N  N   . LYS A 1 171 ? 23.472  -2.910  12.064 1.00 31.62  ? 170 LYS A N   1 
ATOM   1363 C  CA  . LYS A 1 171 ? 23.790  -1.501  11.881 1.00 28.21  ? 170 LYS A CA  1 
ATOM   1364 C  C   . LYS A 1 171 ? 22.905  -0.629  12.785 1.00 32.63  ? 170 LYS A C   1 
ATOM   1365 O  O   . LYS A 1 171 ? 21.780  -1.009  13.150 1.00 28.18  ? 170 LYS A O   1 
ATOM   1366 C  CB  . LYS A 1 171 ? 23.627  -1.099  10.404 1.00 29.03  ? 170 LYS A CB  1 
ATOM   1367 C  CG  . LYS A 1 171 ? 24.756  -1.569  9.463  1.00 34.48  ? 170 LYS A CG  1 
ATOM   1368 C  CD  . LYS A 1 171 ? 25.370  -0.415  8.671  1.00 109.20 ? 170 LYS A CD  1 
ATOM   1369 C  CE  . LYS A 1 171 ? 26.676  -0.801  7.979  1.00 105.60 ? 170 LYS A CE  1 
ATOM   1370 N  NZ  . LYS A 1 171 ? 27.657  0.334   7.956  1.00 64.42  ? 170 LYS A NZ  1 
ATOM   1371 N  N   . ILE A 1 172 ? 23.442  0.529   13.159 1.00 28.02  ? 171 ILE A N   1 
ATOM   1372 C  CA  . ILE A 1 172 ? 22.696  1.525   13.917 1.00 22.66  ? 171 ILE A CA  1 
ATOM   1373 C  C   . ILE A 1 172 ? 22.732  2.845   13.201 1.00 24.64  ? 171 ILE A C   1 
ATOM   1374 O  O   . ILE A 1 172 ? 23.584  3.092   12.343 1.00 32.02  ? 171 ILE A O   1 
ATOM   1375 C  CB  . ILE A 1 172 ? 23.228  1.671   15.365 1.00 29.80  ? 171 ILE A CB  1 
ATOM   1376 C  CG1 . ILE A 1 172 ? 24.714  2.037   15.375 1.00 29.05  ? 171 ILE A CG1 1 
ATOM   1377 C  CG2 . ILE A 1 172 ? 22.949  0.396   16.164 1.00 25.34  ? 171 ILE A CG2 1 
ATOM   1378 C  CD1 . ILE A 1 172 ? 25.207  2.567   16.726 1.00 33.13  ? 171 ILE A CD1 1 
ATOM   1379 N  N   . VAL A 1 173 ? 21.762  3.688   13.536 1.00 26.67  ? 172 VAL A N   1 
ATOM   1380 C  CA  . VAL A 1 173 ? 21.612  4.979   12.898 1.00 30.36  ? 172 VAL A CA  1 
ATOM   1381 C  C   . VAL A 1 173 ? 21.682  6.009   14.007 1.00 22.68  ? 172 VAL A C   1 
ATOM   1382 O  O   . VAL A 1 173 ? 20.845  6.011   14.914 1.00 24.43  ? 172 VAL A O   1 
ATOM   1383 C  CB  . VAL A 1 173 ? 20.270  5.079   12.119 1.00 25.24  ? 172 VAL A CB  1 
ATOM   1384 C  CG1 . VAL A 1 173 ? 20.259  6.307   11.258 1.00 22.33  ? 172 VAL A CG1 1 
ATOM   1385 C  CG2 . VAL A 1 173 ? 20.082  3.830   11.270 1.00 28.71  ? 172 VAL A CG2 1 
ATOM   1386 N  N   . ILE A 1 174 ? 22.697  6.862   13.913 1.00 25.27  ? 173 ILE A N   1 
ATOM   1387 C  CA  . ILE A 1 174 ? 23.056  7.803   14.958 1.00 26.29  ? 173 ILE A CA  1 
ATOM   1388 C  C   . ILE A 1 174 ? 23.317  9.189   14.380 1.00 20.31  ? 173 ILE A C   1 
ATOM   1389 O  O   . ILE A 1 174 ? 23.479  9.354   13.165 1.00 24.96  ? 173 ILE A O   1 
ATOM   1390 C  CB  . ILE A 1 174 ? 24.348  7.317   15.714 1.00 30.48  ? 173 ILE A CB  1 
ATOM   1391 C  CG1 . ILE A 1 174 ? 25.555  7.256   14.764 1.00 33.73  ? 173 ILE A CG1 1 
ATOM   1392 C  CG2 . ILE A 1 174 ? 24.109  5.968   16.328 1.00 27.41  ? 173 ILE A CG2 1 
ATOM   1393 C  CD1 . ILE A 1 174 ? 26.903  6.984   15.468 1.00 31.49  ? 173 ILE A CD1 1 
ATOM   1394 N  N   . GLU A 1 175 ? 23.348  10.168  15.277 1.00 26.12  ? 174 GLU A N   1 
ATOM   1395 C  CA  . GLU A 1 175 ? 23.810  11.509  14.975 1.00 33.84  ? 174 GLU A CA  1 
ATOM   1396 C  C   . GLU A 1 175 ? 25.137  11.718  15.719 1.00 26.24  ? 174 GLU A C   1 
ATOM   1397 O  O   . GLU A 1 175 ? 25.213  11.458  16.926 1.00 29.91  ? 174 GLU A O   1 
ATOM   1398 C  CB  . GLU A 1 175 ? 22.783  12.544  15.441 1.00 31.73  ? 174 GLU A CB  1 
ATOM   1399 C  CG  . GLU A 1 175 ? 23.046  13.961  14.918 1.00 36.14  ? 174 GLU A CG  1 
ATOM   1400 C  CD  . GLU A 1 175 ? 21.807  14.842  14.957 1.00 87.11  ? 174 GLU A CD  1 
ATOM   1401 O  OE1 . GLU A 1 175 ? 21.183  14.944  16.031 1.00 52.12  ? 174 GLU A OE1 1 
ATOM   1402 O  OE2 . GLU A 1 175 ? 21.448  15.429  13.916 1.00 63.32  ? 174 GLU A OE2 1 
ATOM   1403 N  N   . GLU A 1 176 ? 26.167  12.124  14.976 1.00 35.27  ? 175 GLU A N   1 
ATOM   1404 C  CA  . GLU A 1 176 ? 27.432  12.622  15.520 1.00 43.97  ? 175 GLU A CA  1 
ATOM   1405 C  C   . GLU A 1 176 ? 27.817  13.903  14.775 1.00 39.48  ? 175 GLU A C   1 
ATOM   1406 O  O   . GLU A 1 176 ? 27.776  13.934  13.549 1.00 41.59  ? 175 GLU A O   1 
ATOM   1407 C  CB  . GLU A 1 176 ? 28.548  11.595  15.321 1.00 45.97  ? 175 GLU A CB  1 
ATOM   1408 C  CG  . GLU A 1 176 ? 28.428  10.359  16.188 1.00 59.28  ? 175 GLU A CG  1 
ATOM   1409 C  CD  . GLU A 1 176 ? 29.711  9.544   16.225 1.00 33.63  ? 175 GLU A CD  1 
ATOM   1410 O  OE1 . GLU A 1 176 ? 30.439  9.512   15.208 1.00 41.26  ? 175 GLU A OE1 1 
ATOM   1411 O  OE2 . GLU A 1 176 ? 29.971  8.903   17.263 1.00 54.96  ? 175 GLU A OE2 1 
ATOM   1412 N  N   . ASN A 1 177 ? 28.207  14.944  15.508 1.00 60.53  ? 176 ASN A N   1 
ATOM   1413 C  CA  . ASN A 1 177 ? 28.630  16.217  14.904 1.00 62.13  ? 176 ASN A CA  1 
ATOM   1414 C  C   . ASN A 1 177 ? 27.554  16.850  13.998 1.00 55.57  ? 176 ASN A C   1 
ATOM   1415 O  O   . ASN A 1 177 ? 27.862  17.443  12.960 1.00 44.08  ? 176 ASN A O   1 
ATOM   1416 C  CB  . ASN A 1 177 ? 29.940  16.031  14.122 1.00 52.81  ? 176 ASN A CB  1 
ATOM   1417 C  CG  . ASN A 1 177 ? 30.965  15.181  14.875 1.00 174.50 ? 176 ASN A CG  1 
ATOM   1418 O  OD1 . ASN A 1 177 ? 31.325  14.077  14.449 1.00 53.52  ? 176 ASN A OD1 1 
ATOM   1419 N  ND2 . ASN A 1 177 ? 31.439  15.699  16.001 1.00 60.81  ? 176 ASN A ND2 1 
ATOM   1420 N  N   . GLY A 1 178 ? 26.290  16.708  14.394 1.00 52.57  ? 177 GLY A N   1 
ATOM   1421 C  CA  . GLY A 1 178 ? 25.173  17.209  13.612 1.00 58.48  ? 177 GLY A CA  1 
ATOM   1422 C  C   . GLY A 1 178 ? 24.914  16.465  12.309 1.00 127.13 ? 177 GLY A C   1 
ATOM   1423 O  O   . GLY A 1 178 ? 24.071  16.900  11.530 1.00 43.22  ? 177 GLY A O   1 
ATOM   1424 N  N   . GLU A 1 179 ? 25.617  15.354  12.073 1.00 33.93  ? 178 GLU A N   1 
ATOM   1425 C  CA  . GLU A 1 179 ? 25.457  14.572  10.843 1.00 38.59  ? 178 GLU A CA  1 
ATOM   1426 C  C   . GLU A 1 179 ? 24.881  13.183  11.158 1.00 38.85  ? 178 GLU A C   1 
ATOM   1427 O  O   . GLU A 1 179 ? 25.259  12.526  12.133 1.00 31.77  ? 178 GLU A O   1 
ATOM   1428 C  CB  . GLU A 1 179 ? 26.789  14.452  10.074 1.00 52.60  ? 178 GLU A CB  1 
ATOM   1429 C  CG  . GLU A 1 179 ? 27.472  15.782  9.734  1.00 114.87 ? 178 GLU A CG  1 
ATOM   1430 C  CD  . GLU A 1 179 ? 26.718  16.669  8.734  1.00 57.13  ? 178 GLU A CD  1 
ATOM   1431 O  OE1 . GLU A 1 179 ? 25.864  16.178  7.959  1.00 45.06  ? 178 GLU A OE1 1 
ATOM   1432 O  OE2 . GLU A 1 179 ? 27.000  17.890  8.708  1.00 59.03  ? 178 GLU A OE2 1 
ATOM   1433 N  N   . VAL A 1 180 ? 23.939  12.751  10.328 1.00 37.54  ? 179 VAL A N   1 
ATOM   1434 C  CA  . VAL A 1 180 ? 23.349  11.424  10.433 1.00 30.92  ? 179 VAL A CA  1 
ATOM   1435 C  C   . VAL A 1 180 ? 24.332  10.395  9.868  1.00 27.61  ? 179 VAL A C   1 
ATOM   1436 O  O   . VAL A 1 180 ? 24.825  10.553  8.744  1.00 35.07  ? 179 VAL A O   1 
ATOM   1437 C  CB  . VAL A 1 180 ? 21.981  11.346  9.675  1.00 45.59  ? 179 VAL A CB  1 
ATOM   1438 C  CG1 . VAL A 1 180 ? 21.368  9.946   9.772  1.00 37.61  ? 179 VAL A CG1 1 
ATOM   1439 C  CG2 . VAL A 1 180 ? 20.993  12.400  10.207 1.00 35.53  ? 179 VAL A CG2 1 
ATOM   1440 N  N   . LYS A 1 181 ? 24.579  9.335   10.637 1.00 29.40  ? 180 LYS A N   1 
ATOM   1441 C  CA  . LYS A 1 181 ? 25.466  8.241   10.238 1.00 29.00  ? 180 LYS A CA  1 
ATOM   1442 C  C   . LYS A 1 181 ? 24.807  6.873   10.392 1.00 24.35  ? 180 LYS A C   1 
ATOM   1443 O  O   . LYS A 1 181 ? 24.136  6.603   11.375 1.00 30.72  ? 180 LYS A O   1 
ATOM   1444 C  CB  . LYS A 1 181 ? 26.717  8.190   11.115 1.00 36.93  ? 180 LYS A CB  1 
ATOM   1445 C  CG  . LYS A 1 181 ? 27.662  9.355   11.010 1.00 43.32  ? 180 LYS A CG  1 
ATOM   1446 C  CD  . LYS A 1 181 ? 28.790  9.163   12.003 1.00 38.53  ? 180 LYS A CD  1 
ATOM   1447 C  CE  . LYS A 1 181 ? 30.032  9.948   11.647 1.00 40.46  ? 180 LYS A CE  1 
ATOM   1448 N  NZ  . LYS A 1 181 ? 31.127  9.619   12.612 1.00 42.47  ? 180 LYS A NZ  1 
ATOM   1449 N  N   . VAL A 1 182 ? 25.059  6.006   9.417  1.00 27.55  ? 181 VAL A N   1 
ATOM   1450 C  CA  . VAL A 1 182 ? 24.743  4.590   9.512  1.00 20.74  ? 181 VAL A CA  1 
ATOM   1451 C  C   . VAL A 1 182 ? 26.089  3.859   9.608  1.00 35.08  ? 181 VAL A C   1 
ATOM   1452 O  O   . VAL A 1 182 ? 26.914  3.912   8.679  1.00 30.95  ? 181 VAL A O   1 
ATOM   1453 C  CB  . VAL A 1 182 ? 23.961  4.102   8.289  1.00 29.25  ? 181 VAL A CB  1 
ATOM   1454 C  CG1 . VAL A 1 182 ? 23.696  2.617   8.399  1.00 27.37  ? 181 VAL A CG1 1 
ATOM   1455 C  CG2 . VAL A 1 182 ? 22.639  4.909   8.136  1.00 27.36  ? 181 VAL A CG2 1 
ATOM   1456 N  N   . VAL A 1 183 ? 26.303  3.220   10.754 1.00 33.12  ? 182 VAL A N   1 
ATOM   1457 C  CA  . VAL A 1 183 ? 27.574  2.598   11.095 1.00 57.40  ? 182 VAL A CA  1 
ATOM   1458 C  C   . VAL A 1 183 ? 27.350  1.238   11.735 1.00 40.86  ? 182 VAL A C   1 
ATOM   1459 O  O   . VAL A 1 183 ? 26.250  0.926   12.187 1.00 28.34  ? 182 VAL A O   1 
ATOM   1460 C  CB  . VAL A 1 183 ? 28.390  3.487   12.069 1.00 34.24  ? 182 VAL A CB  1 
ATOM   1461 C  CG1 . VAL A 1 183 ? 28.620  4.872   11.458 1.00 42.13  ? 182 VAL A CG1 1 
ATOM   1462 C  CG2 . VAL A 1 183 ? 27.704  3.598   13.451 1.00 31.63  ? 182 VAL A CG2 1 
ATOM   1463 N  N   . ASP A 1 184 ? 28.409  0.437   11.806 1.00 34.74  ? 183 ASP A N   1 
ATOM   1464 C  CA  . ASP A 1 184 ? 28.298  -0.881  12.392 1.00 25.85  ? 183 ASP A CA  1 
ATOM   1465 C  C   . ASP A 1 184 ? 27.838  -0.760  13.823 1.00 39.28  ? 183 ASP A C   1 
ATOM   1466 O  O   . ASP A 1 184 ? 28.228  0.160   14.535 1.00 37.62  ? 183 ASP A O   1 
ATOM   1467 C  CB  . ASP A 1 184 ? 29.639  -1.652  12.337 1.00 39.15  ? 183 ASP A CB  1 
ATOM   1468 C  CG  . ASP A 1 184 ? 29.887  -2.312  10.989 1.00 46.98  ? 183 ASP A CG  1 
ATOM   1469 O  OD1 . ASP A 1 184 ? 29.023  -2.197  10.090 1.00 45.39  ? 183 ASP A OD1 1 
ATOM   1470 O  OD2 . ASP A 1 184 ? 30.919  -2.969  10.737 1.00 89.06  ? 183 ASP A OD2 1 
ATOM   1471 N  N   . ASN A 1 185 ? 26.994  -1.696  14.232 1.00 29.07  ? 184 ASN A N   1 
ATOM   1472 C  CA  . ASN A 1 185 ? 26.484  -1.746  15.587 1.00 27.74  ? 184 ASN A CA  1 
ATOM   1473 C  C   . ASN A 1 185 ? 27.556  -2.406  16.415 1.00 54.68  ? 184 ASN A C   1 
ATOM   1474 O  O   . ASN A 1 185 ? 27.844  -3.571  16.172 1.00 34.53  ? 184 ASN A O   1 
ATOM   1475 C  CB  . ASN A 1 185 ? 25.204  -2.579  15.646 1.00 27.05  ? 184 ASN A CB  1 
ATOM   1476 C  CG  . ASN A 1 185 ? 24.615  -2.671  17.045 1.00 37.74  ? 184 ASN A CG  1 
ATOM   1477 O  OD1 . ASN A 1 185 ? 25.257  -2.344  18.032 1.00 39.38  ? 184 ASN A OD1 1 
ATOM   1478 N  ND2 . ASN A 1 185 ? 23.374  -3.110  17.126 1.00 27.31  ? 184 ASN A ND2 1 
ATOM   1479 N  N   . PRO A 1 186 ? 28.150  -1.687  17.374 1.00 43.92  ? 185 PRO A N   1 
ATOM   1480 C  CA  . PRO A 1 186 ? 29.239  -2.251  18.189 1.00 93.36  ? 185 PRO A CA  1 
ATOM   1481 C  C   . PRO A 1 186 ? 28.817  -3.466  19.032 1.00 35.20  ? 185 PRO A C   1 
ATOM   1482 O  O   . PRO A 1 186 ? 29.661  -4.301  19.338 1.00 51.68  ? 185 PRO A O   1 
ATOM   1483 C  CB  . PRO A 1 186 ? 29.671  -1.076  19.083 1.00 59.24  ? 185 PRO A CB  1 
ATOM   1484 C  CG  . PRO A 1 186 ? 28.525  -0.106  19.070 1.00 48.04  ? 185 PRO A CG  1 
ATOM   1485 C  CD  . PRO A 1 186 ? 27.826  -0.299  17.769 1.00 37.80  ? 185 PRO A CD  1 
ATOM   1486 N  N   . ARG A 1 187 ? 27.530  -3.556  19.370 1.00 42.15  ? 186 ARG A N   1 
ATOM   1487 C  CA  . ARG A 1 187 ? 26.953  -4.671  20.143 1.00 43.86  ? 186 ARG A CA  1 
ATOM   1488 C  C   . ARG A 1 187 ? 26.454  -5.894  19.329 1.00 37.45  ? 186 ARG A C   1 
ATOM   1489 O  O   . ARG A 1 187 ? 25.912  -6.842  19.910 1.00 45.74  ? 186 ARG A O   1 
ATOM   1490 C  CB  . ARG A 1 187 ? 25.766  -4.149  20.977 1.00 37.74  ? 186 ARG A CB  1 
ATOM   1491 C  CG  . ARG A 1 187 ? 26.145  -3.504  22.320 1.00 126.15 ? 186 ARG A CG  1 
ATOM   1492 C  CD  . ARG A 1 187 ? 25.035  -2.640  22.949 1.00 117.78 ? 186 ARG A CD  1 
ATOM   1493 N  NE  . ARG A 1 187 ? 24.341  -3.308  24.061 1.00 182.47 ? 186 ARG A NE  1 
ATOM   1494 C  CZ  . ARG A 1 187 ? 24.304  -2.889  25.335 1.00 198.08 ? 186 ARG A CZ  1 
ATOM   1495 N  NH1 . ARG A 1 187 ? 24.927  -1.784  25.729 1.00 141.29 ? 186 ARG A NH1 1 
ATOM   1496 N  NH2 . ARG A 1 187 ? 23.632  -3.592  26.239 1.00 78.50  ? 186 ARG A NH2 1 
ATOM   1497 N  N   . TRP A 1 188 ? 26.601  -5.881  18.005 1.00 50.60  ? 187 TRP A N   1 
ATOM   1498 C  CA  . TRP A 1 188 ? 26.071  -6.976  17.167 1.00 56.30  ? 187 TRP A CA  1 
ATOM   1499 C  C   . TRP A 1 188 ? 27.031  -8.158  17.110 1.00 152.99 ? 187 TRP A C   1 
ATOM   1500 O  O   . TRP A 1 188 ? 28.235  -7.959  17.006 1.00 47.62  ? 187 TRP A O   1 
ATOM   1501 C  CB  . TRP A 1 188 ? 25.787  -6.488  15.739 1.00 46.54  ? 187 TRP A CB  1 
ATOM   1502 C  CG  . TRP A 1 188 ? 25.720  -7.597  14.698 1.00 47.35  ? 187 TRP A CG  1 
ATOM   1503 C  CD1 . TRP A 1 188 ? 26.729  -8.017  13.862 1.00 43.91  ? 187 TRP A CD1 1 
ATOM   1504 C  CD2 . TRP A 1 188 ? 24.585  -8.405  14.383 1.00 36.92  ? 187 TRP A CD2 1 
ATOM   1505 N  NE1 . TRP A 1 188 ? 26.282  -9.034  13.052 1.00 55.72  ? 187 TRP A NE1 1 
ATOM   1506 C  CE2 . TRP A 1 188 ? 24.966  -9.288  13.345 1.00 52.78  ? 187 TRP A CE2 1 
ATOM   1507 C  CE3 . TRP A 1 188 ? 23.264  -8.450  14.846 1.00 48.17  ? 187 TRP A CE3 1 
ATOM   1508 C  CZ2 . TRP A 1 188 ? 24.084  -10.217 12.787 1.00 64.10  ? 187 TRP A CZ2 1 
ATOM   1509 C  CZ3 . TRP A 1 188 ? 22.393  -9.375  14.295 1.00 51.56  ? 187 TRP A CZ3 1 
ATOM   1510 C  CH2 . TRP A 1 188 ? 22.806  -10.248 13.276 1.00 65.48  ? 187 TRP A CH2 1 
ATOM   1511 N  N   . LYS A 1 189 ? 26.484  -9.375  17.167 1.00 48.11  ? 188 LYS A N   1 
ATOM   1512 C  CA  . LYS A 1 189 ? 27.251  -10.617 16.967 1.00 93.03  ? 188 LYS A CA  1 
ATOM   1513 C  C   . LYS A 1 189 ? 26.478  -11.665 16.139 1.00 64.72  ? 188 LYS A C   1 
ATOM   1514 O  O   . LYS A 1 189 ? 25.275  -11.895 16.343 1.00 51.45  ? 188 LYS A O   1 
ATOM   1515 C  CB  . LYS A 1 189 ? 27.663  -11.208 18.321 1.00 69.81  ? 188 LYS A CB  1 
ATOM   1516 C  CG  . LYS A 1 189 ? 28.558  -10.274 19.141 1.00 108.08 ? 188 LYS A CG  1 
ATOM   1517 C  CD  . LYS A 1 189 ? 29.181  -10.952 20.361 1.00 98.37  ? 188 LYS A CD  1 
ATOM   1518 C  CE  . LYS A 1 189 ? 30.502  -10.287 20.760 1.00 92.40  ? 188 LYS A CE  1 
ATOM   1519 N  NZ  . LYS A 1 189 ? 30.666  -10.198 22.235 1.00 77.41  ? 188 LYS A NZ  1 
HETATM 1520 MN MN  . MN  B 2 .   ? 6.208   -6.287  8.929  1.00 36.18  ? 400 MN  A MN  1 
HETATM 1521 O  O1A . PA5 C 3 .   ? 3.674   -3.839  8.991  1.00 24.69  ? 301 PA5 A O1A 1 
HETATM 1522 C  C1  . PA5 C 3 .   ? 4.633   -3.432  9.660  1.00 26.25  ? 301 PA5 A C1  1 
HETATM 1523 O  O1  . PA5 C 3 .   ? 5.692   -4.055  9.768  1.00 19.76  ? 301 PA5 A O1  1 
HETATM 1524 C  C2  . PA5 C 3 .   ? 4.493   -2.130  10.376 1.00 17.37  ? 301 PA5 A C2  1 
HETATM 1525 O  O2  . PA5 C 3 .   ? 3.103   -1.770  10.413 1.00 27.23  ? 301 PA5 A O2  1 
HETATM 1526 C  C3  . PA5 C 3 .   ? 5.125   -2.241  11.774 1.00 20.89  ? 301 PA5 A C3  1 
HETATM 1527 O  O3  . PA5 C 3 .   ? 4.476   -3.277  12.505 1.00 26.74  ? 301 PA5 A O3  1 
HETATM 1528 C  C4  . PA5 C 3 .   ? 5.028   -0.906  12.544 1.00 21.85  ? 301 PA5 A C4  1 
HETATM 1529 O  O4  . PA5 C 3 .   ? 5.767   0.109   11.849 1.00 23.09  ? 301 PA5 A O4  1 
HETATM 1530 C  C5  . PA5 C 3 .   ? 5.542   -1.032  13.981 1.00 27.46  ? 301 PA5 A C5  1 
HETATM 1531 O  O5  . PA5 C 3 .   ? 6.861   -1.596  14.020 1.00 25.10  ? 301 PA5 A O5  1 
HETATM 1532 P  P   . PA5 C 3 .   ? 7.192   -2.933  14.866 1.00 26.61  ? 301 PA5 A P   1 
HETATM 1533 O  O1P . PA5 C 3 .   ? 6.080   -3.863  14.392 1.00 25.41  ? 301 PA5 A O1P 1 
HETATM 1534 O  O2P . PA5 C 3 .   ? 8.560   -3.339  14.405 1.00 27.23  ? 301 PA5 A O2P 1 
HETATM 1535 O  O3P . PA5 C 3 .   ? 7.128   -2.565  16.334 1.00 27.95  ? 301 PA5 A O3P 1 
HETATM 1536 O  O   . HOH D 4 .   ? 9.466   -2.333  12.148 1.00 22.30  ? 401 HOH A O   1 
HETATM 1537 O  O   . HOH D 4 .   ? 4.882   -3.026  17.906 1.00 42.51  ? 402 HOH A O   1 
HETATM 1538 O  O   . HOH D 4 .   ? 8.190   -0.374  10.760 1.00 22.93  ? 403 HOH A O   1 
HETATM 1539 O  O   . HOH D 4 .   ? 2.993   -5.361  11.886 1.00 36.43  ? 404 HOH A O   1 
HETATM 1540 O  O   . HOH D 4 .   ? 1.231   -3.831  11.965 1.00 51.08  ? 405 HOH A O   1 
HETATM 1541 O  O   . HOH D 4 .   ? 2.813   0.980   9.779  1.00 20.18  ? 406 HOH A O   1 
HETATM 1542 O  O   . HOH D 4 .   ? 4.140   -6.805  9.735  1.00 24.93  ? 407 HOH A O   1 
HETATM 1543 O  O   . HOH D 4 .   ? 6.266   11.304  28.172 1.00 34.05  ? 408 HOH A O   1 
HETATM 1544 O  O   . HOH D 4 .   ? 28.129  -1.655  4.677  1.00 48.31  ? 409 HOH A O   1 
HETATM 1545 O  O   . HOH D 4 .   ? 11.980  -6.741  17.957 1.00 26.16  ? 410 HOH A O   1 
HETATM 1546 O  O   . HOH D 4 .   ? -6.625  12.803  11.945 1.00 40.46  ? 411 HOH A O   1 
HETATM 1547 O  O   . HOH D 4 .   ? -0.985  -11.922 0.926  1.00 23.93  ? 412 HOH A O   1 
HETATM 1548 O  O   . HOH D 4 .   ? 10.710  -3.455  27.687 1.00 30.91  ? 413 HOH A O   1 
HETATM 1549 O  O   . HOH D 4 .   ? 21.710  4.391   21.944 1.00 32.81  ? 414 HOH A O   1 
HETATM 1550 O  O   . HOH D 4 .   ? -6.830  -5.009  6.012  1.00 20.59  ? 415 HOH A O   1 
HETATM 1551 O  O   . HOH D 4 .   ? 18.740  5.189   0.371  1.00 32.31  ? 416 HOH A O   1 
HETATM 1552 O  O   . HOH D 4 .   ? 14.443  -12.273 -0.827 1.00 20.53  ? 417 HOH A O   1 
HETATM 1553 O  O   . HOH D 4 .   ? 19.951  2.387   15.509 1.00 22.29  ? 418 HOH A O   1 
HETATM 1554 O  O   . HOH D 4 .   ? 14.460  11.753  15.399 1.00 22.09  ? 419 HOH A O   1 
HETATM 1555 O  O   . HOH D 4 .   ? -8.917  -13.198 5.931  1.00 31.53  ? 420 HOH A O   1 
HETATM 1556 O  O   . HOH D 4 .   ? 9.475   6.772   34.525 1.00 23.26  ? 421 HOH A O   1 
HETATM 1557 O  O   . HOH D 4 .   ? 20.402  -0.597  18.797 1.00 25.76  ? 422 HOH A O   1 
HETATM 1558 O  O   . HOH D 4 .   ? -11.322 -11.240 8.145  1.00 29.46  ? 423 HOH A O   1 
HETATM 1559 O  O   . HOH D 4 .   ? -0.220  -14.418 1.969  1.00 28.49  ? 424 HOH A O   1 
HETATM 1560 O  O   . HOH D 4 .   ? 19.079  9.661   28.116 1.00 24.54  ? 425 HOH A O   1 
HETATM 1561 O  O   . HOH D 4 .   ? -1.210  9.443   16.491 1.00 36.85  ? 426 HOH A O   1 
HETATM 1562 O  O   . HOH D 4 .   ? 7.597   11.347  21.910 1.00 29.02  ? 427 HOH A O   1 
HETATM 1563 O  O   . HOH D 4 .   ? 22.084  -2.681  20.048 1.00 37.04  ? 428 HOH A O   1 
HETATM 1564 O  O   . HOH D 4 .   ? 10.394  -16.134 11.283 1.00 29.78  ? 429 HOH A O   1 
HETATM 1565 O  O   . HOH D 4 .   ? 19.476  -0.100  14.352 1.00 25.19  ? 430 HOH A O   1 
HETATM 1566 O  O   . HOH D 4 .   ? -12.600 -6.967  7.132  1.00 28.90  ? 431 HOH A O   1 
HETATM 1567 O  O   . HOH D 4 .   ? -4.912  -19.713 4.819  1.00 39.25  ? 432 HOH A O   1 
HETATM 1568 O  O   . HOH D 4 .   ? -3.839  -10.951 10.165 1.00 29.16  ? 433 HOH A O   1 
HETATM 1569 O  O   . HOH D 4 .   ? 0.827   4.568   26.964 1.00 40.46  ? 434 HOH A O   1 
HETATM 1570 O  O   . HOH D 4 .   ? 15.542  10.316  4.812  1.00 29.68  ? 435 HOH A O   1 
HETATM 1571 O  O   . HOH D 4 .   ? 23.993  6.131   21.517 1.00 30.98  ? 436 HOH A O   1 
HETATM 1572 O  O   . HOH D 4 .   ? 2.293   12.628  1.522  1.00 40.01  ? 437 HOH A O   1 
HETATM 1573 O  O   . HOH D 4 .   ? 10.471  -11.911 7.030  1.00 24.19  ? 438 HOH A O   1 
HETATM 1574 O  O   . HOH D 4 .   ? 22.586  -11.916 3.554  1.00 36.83  ? 439 HOH A O   1 
HETATM 1575 O  O   . HOH D 4 .   ? -16.863 1.899   3.304  1.00 34.41  ? 440 HOH A O   1 
HETATM 1576 O  O   . HOH D 4 .   ? 10.231  -7.204  22.319 1.00 27.98  ? 441 HOH A O   1 
HETATM 1577 O  O   . HOH D 4 .   ? 19.194  10.438  25.476 1.00 34.15  ? 442 HOH A O   1 
HETATM 1578 O  O   . HOH D 4 .   ? -5.660  8.560   18.130 1.00 45.05  ? 443 HOH A O   1 
HETATM 1579 O  O   . HOH D 4 .   ? 24.866  6.913   28.857 1.00 42.93  ? 444 HOH A O   1 
HETATM 1580 O  O   . HOH D 4 .   ? 16.001  13.531  17.015 1.00 29.10  ? 445 HOH A O   1 
HETATM 1581 O  O   . HOH D 4 .   ? 17.687  -3.404  18.911 1.00 23.91  ? 446 HOH A O   1 
HETATM 1582 O  O   . HOH D 4 .   ? 10.962  12.986  10.748 1.00 27.40  ? 447 HOH A O   1 
HETATM 1583 O  O   . HOH D 4 .   ? 20.151  -2.315  16.660 1.00 32.01  ? 448 HOH A O   1 
HETATM 1584 O  O   . HOH D 4 .   ? -0.876  11.706  14.919 1.00 33.10  ? 449 HOH A O   1 
HETATM 1585 O  O   . HOH D 4 .   ? -12.618 -14.392 2.223  1.00 35.38  ? 450 HOH A O   1 
HETATM 1586 O  O   . HOH D 4 .   ? -14.291 2.174   6.941  1.00 48.18  ? 451 HOH A O   1 
HETATM 1587 O  O   . HOH D 4 .   ? 10.734  15.034  33.352 1.00 27.79  ? 452 HOH A O   1 
HETATM 1588 O  O   . HOH D 4 .   ? 5.496   11.168  24.901 1.00 28.00  ? 453 HOH A O   1 
HETATM 1589 O  O   . HOH D 4 .   ? 21.337  5.704   33.383 1.00 38.76  ? 454 HOH A O   1 
HETATM 1590 O  O   . HOH D 4 .   ? 9.960   -9.322  5.197  1.00 28.79  ? 455 HOH A O   1 
HETATM 1591 O  O   . HOH D 4 .   ? 9.161   -19.042 7.794  1.00 33.79  ? 456 HOH A O   1 
HETATM 1592 O  O   . HOH D 4 .   ? 17.735  -5.693  20.489 1.00 29.15  ? 457 HOH A O   1 
HETATM 1593 O  O   . HOH D 4 .   ? -2.393  13.811  15.690 1.00 38.83  ? 458 HOH A O   1 
HETATM 1594 O  O   . HOH D 4 .   ? 22.918  -0.158  2.890  1.00 33.73  ? 459 HOH A O   1 
HETATM 1595 O  O   . HOH D 4 .   ? -10.054 -15.695 2.211  1.00 44.25  ? 460 HOH A O   1 
HETATM 1596 O  O   . HOH D 4 .   ? 13.927  13.209  2.829  1.00 54.36  ? 461 HOH A O   1 
HETATM 1597 O  O   . HOH D 4 .   ? -10.052 -9.063  11.931 1.00 44.63  ? 462 HOH A O   1 
HETATM 1598 O  O   . HOH D 4 .   ? -5.598  -21.211 1.762  1.00 55.89  ? 463 HOH A O   1 
HETATM 1599 O  O   . HOH D 4 .   ? 5.204   5.940   31.448 1.00 33.32  ? 464 HOH A O   1 
HETATM 1600 O  O   . HOH D 4 .   ? 0.482   -9.779  9.537  1.00 42.13  ? 465 HOH A O   1 
HETATM 1601 O  O   . HOH D 4 .   ? 13.577  8.754   38.500 1.00 46.70  ? 466 HOH A O   1 
HETATM 1602 O  O   . HOH D 4 .   ? -1.321  0.604   23.424 1.00 38.80  ? 467 HOH A O   1 
HETATM 1603 O  O   . HOH D 4 .   ? 23.786  14.204  7.879  1.00 38.83  ? 468 HOH A O   1 
HETATM 1604 O  O   . HOH D 4 .   ? 29.758  18.786  9.241  1.00 41.66  ? 469 HOH A O   1 
HETATM 1605 O  O   . HOH D 4 .   ? 14.975  12.532  22.864 1.00 48.27  ? 470 HOH A O   1 
HETATM 1606 O  O   . HOH D 4 .   ? 6.940   16.004  5.581  1.00 28.27  ? 471 HOH A O   1 
HETATM 1607 O  O   . HOH D 4 .   ? 10.337  -18.809 10.561 1.00 39.80  ? 472 HOH A O   1 
HETATM 1608 O  O   . HOH D 4 .   ? 4.320   15.165  3.748  1.00 41.41  ? 473 HOH A O   1 
HETATM 1609 O  O   . HOH D 4 .   ? 5.694   15.077  10.510 1.00 30.56  ? 474 HOH A O   1 
HETATM 1610 O  O   . HOH D 4 .   ? -11.285 -14.058 5.468  1.00 44.22  ? 475 HOH A O   1 
HETATM 1611 O  O   . HOH D 4 .   ? -11.254 1.714   10.896 1.00 37.03  ? 476 HOH A O   1 
HETATM 1612 O  O   . HOH D 4 .   ? 16.830  -0.236  25.275 1.00 33.91  ? 477 HOH A O   1 
HETATM 1613 O  O   . HOH D 4 .   ? 23.033  -0.487  0.198  1.00 51.59  ? 478 HOH A O   1 
HETATM 1614 O  O   . HOH D 4 .   ? 5.839   0.317   29.355 1.00 43.07  ? 479 HOH A O   1 
HETATM 1615 O  O   . HOH D 4 .   ? -8.489  10.769  4.614  1.00 45.36  ? 480 HOH A O   1 
HETATM 1616 O  O   . HOH D 4 .   ? 20.469  8.322   1.322  1.00 35.63  ? 481 HOH A O   1 
HETATM 1617 O  O   . HOH D 4 .   ? -12.948 -13.406 8.045  1.00 35.62  ? 482 HOH A O   1 
HETATM 1618 O  O   . HOH D 4 .   ? 18.352  14.473  9.439  1.00 41.52  ? 483 HOH A O   1 
HETATM 1619 O  O   . HOH D 4 .   ? 10.416  -1.110  31.170 1.00 38.75  ? 484 HOH A O   1 
HETATM 1620 O  O   . HOH D 4 .   ? 19.814  -11.475 11.179 1.00 36.45  ? 485 HOH A O   1 
HETATM 1621 O  O   . HOH D 4 .   ? 21.292  8.979   35.390 1.00 48.40  ? 486 HOH A O   1 
HETATM 1622 O  O   . HOH D 4 .   ? 2.900   -1.291  19.074 1.00 48.26  ? 487 HOH A O   1 
HETATM 1623 O  O   . HOH D 4 .   ? 11.703  5.016   38.925 1.00 38.41  ? 488 HOH A O   1 
HETATM 1624 O  O   . HOH D 4 .   ? -12.108 0.224   8.673  1.00 39.92  ? 489 HOH A O   1 
HETATM 1625 O  O   . HOH D 4 .   ? -14.917 -6.422  5.819  1.00 31.12  ? 490 HOH A O   1 
HETATM 1626 O  O   . HOH D 4 .   ? 25.390  7.297   23.551 1.00 42.71  ? 491 HOH A O   1 
HETATM 1627 O  O   . HOH D 4 .   ? 13.616  -19.783 10.322 1.00 50.44  ? 492 HOH A O   1 
HETATM 1628 O  O   . HOH D 4 .   ? 21.192  15.690  11.446 1.00 57.29  ? 493 HOH A O   1 
HETATM 1629 O  O   . HOH D 4 .   ? 4.311   15.707  17.706 1.00 47.56  ? 494 HOH A O   1 
HETATM 1630 O  O   . HOH D 4 .   ? 8.956   -17.046 13.722 1.00 41.10  ? 495 HOH A O   1 
HETATM 1631 O  O   . HOH D 4 .   ? 17.498  11.499  29.446 1.00 43.96  ? 496 HOH A O   1 
HETATM 1632 O  O   . HOH D 4 .   ? 12.830  -15.414 12.154 1.00 38.10  ? 497 HOH A O   1 
HETATM 1633 O  O   . HOH D 4 .   ? -16.477 -8.295  6.406  1.00 41.35  ? 498 HOH A O   1 
HETATM 1634 O  O   . HOH D 4 .   ? -13.185 6.583   7.611  1.00 37.45  ? 499 HOH A O   1 
HETATM 1635 O  O   . HOH D 4 .   ? 9.118   13.016  20.368 1.00 37.39  ? 500 HOH A O   1 
HETATM 1636 O  O   . HOH D 4 .   ? 15.100  -14.897 10.841 1.00 34.27  ? 501 HOH A O   1 
HETATM 1637 O  O   . HOH D 4 .   ? 16.251  -6.360  28.512 1.00 45.27  ? 502 HOH A O   1 
HETATM 1638 O  O   . HOH D 4 .   ? 6.975   15.262  17.680 1.00 43.70  ? 503 HOH A O   1 
HETATM 1639 O  O   . HOH D 4 .   ? 2.694   10.946  27.214 1.00 47.64  ? 504 HOH A O   1 
HETATM 1640 O  O   . HOH D 4 .   ? 27.575  1.538   25.378 0.50 50.38  ? 505 HOH A O   1 
HETATM 1641 O  O   . HOH D 4 .   ? 18.172  15.005  12.979 1.00 36.52  ? 506 HOH A O   1 
HETATM 1642 O  O   . HOH D 4 .   ? 9.838   -18.444 -0.515 1.00 52.99  ? 507 HOH A O   1 
HETATM 1643 O  O   . HOH D 4 .   ? -5.264  12.179  3.786  1.00 33.63  ? 508 HOH A O   1 
HETATM 1644 O  O   . HOH D 4 .   ? 22.489  8.660   33.028 1.00 39.26  ? 509 HOH A O   1 
HETATM 1645 O  O   . HOH D 4 .   ? -6.939  -9.967  12.977 1.00 49.78  ? 510 HOH A O   1 
HETATM 1646 O  O   . HOH D 4 .   ? 7.557   3.734   32.563 1.00 39.75  ? 511 HOH A O   1 
HETATM 1647 O  O   . HOH D 4 .   ? 18.576  -7.375  24.190 1.00 38.91  ? 512 HOH A O   1 
HETATM 1648 O  O   . HOH D 4 .   ? 6.839   -3.379  28.406 1.00 50.22  ? 513 HOH A O   1 
HETATM 1649 O  O   . HOH D 4 .   ? 9.321   2.500   33.905 1.00 49.14  ? 514 HOH A O   1 
HETATM 1650 O  O   . HOH D 4 .   ? -0.346  -16.026 0.052  0.50 38.80  ? 515 HOH A O   1 
HETATM 1651 O  O   . HOH D 4 .   ? 17.440  11.925  24.302 1.00 39.77  ? 516 HOH A O   1 
HETATM 1652 O  O   . HOH D 4 .   ? -7.776  -4.687  12.871 1.00 46.28  ? 517 HOH A O   1 
HETATM 1653 O  O   . HOH D 4 .   ? 25.423  2.682   28.516 1.00 30.15  ? 518 HOH A O   1 
HETATM 1654 O  O   . HOH D 4 .   ? 32.905  -1.264  11.535 1.00 51.09  ? 519 HOH A O   1 
HETATM 1655 O  O   . HOH D 4 .   ? 0.178   14.808  2.361  1.00 46.15  ? 520 HOH A O   1 
HETATM 1656 O  O   . HOH D 4 .   ? 15.148  -6.647  24.095 1.00 45.56  ? 521 HOH A O   1 
HETATM 1657 O  O   . HOH D 4 .   ? 26.055  -16.765 2.577  1.00 44.78  ? 522 HOH A O   1 
HETATM 1658 O  O   . HOH D 4 .   ? 26.907  4.823   19.470 1.00 43.93  ? 523 HOH A O   1 
HETATM 1659 O  O   . HOH D 4 .   ? -2.170  14.921  1.445  1.00 45.44  ? 524 HOH A O   1 
HETATM 1660 O  O   . HOH D 4 .   ? 29.303  12.171  8.978  1.00 45.68  ? 525 HOH A O   1 
HETATM 1661 O  O   . HOH D 4 .   ? 26.483  19.660  11.097 1.00 48.02  ? 526 HOH A O   1 
HETATM 1662 O  O   . HOH D 4 .   ? 13.584  17.371  10.248 1.00 43.25  ? 527 HOH A O   1 
HETATM 1663 O  O   . HOH D 4 .   ? -11.415 -5.000  8.584  1.00 35.51  ? 528 HOH A O   1 
HETATM 1664 O  O   . HOH D 4 .   ? 23.921  -17.541 1.644  1.00 43.71  ? 529 HOH A O   1 
HETATM 1665 O  O   . HOH D 4 .   ? 10.654  4.472   35.557 1.00 35.03  ? 530 HOH A O   1 
HETATM 1666 O  O   . HOH D 4 .   ? 32.457  8.443   19.196 1.00 41.76  ? 531 HOH A O   1 
HETATM 1667 O  O   . HOH D 4 .   ? 7.659   -14.720 -1.062 1.00 26.19  ? 532 HOH A O   1 
HETATM 1668 O  O   . HOH D 4 .   ? 30.725  1.358   10.024 1.00 43.25  ? 533 HOH A O   1 
HETATM 1669 O  O   . HOH D 4 .   ? 7.226   -15.872 15.280 1.00 36.92  ? 534 HOH A O   1 
HETATM 1670 O  O   . HOH D 4 .   ? 7.713   -12.515 18.362 1.00 25.28  ? 535 HOH A O   1 
HETATM 1671 O  O   . HOH D 4 .   ? 10.294  -14.731 18.294 1.00 43.80  ? 536 HOH A O   1 
HETATM 1672 O  O   . HOH D 4 .   ? 17.975  -1.099  27.956 1.00 40.13  ? 537 HOH A O   1 
HETATM 1673 O  O   . HOH D 4 .   ? 10.227  2.886   38.151 1.00 43.44  ? 538 HOH A O   1 
HETATM 1674 O  O   . HOH D 4 .   ? -15.552 -13.891 6.993  1.00 37.46  ? 539 HOH A O   1 
HETATM 1675 O  O   . HOH D 4 .   ? -7.874  -17.135 14.122 1.00 42.69  ? 540 HOH A O   1 
HETATM 1676 O  O   . HOH D 4 .   ? 30.842  1.371   14.734 1.00 31.35  ? 541 HOH A O   1 
HETATM 1677 O  O   . HOH D 4 .   ? 25.626  0.580   27.142 1.00 42.72  ? 542 HOH A O   1 
HETATM 1678 O  O   . HOH D 4 .   ? -3.953  -0.493  15.947 1.00 35.82  ? 543 HOH A O   1 
HETATM 1679 O  O   . HOH D 4 .   ? 29.020  6.806   18.375 1.00 45.67  ? 544 HOH A O   1 
HETATM 1680 O  O   . HOH D 4 .   ? -2.009  -2.253  16.405 1.00 43.29  ? 545 HOH A O   1 
HETATM 1681 O  O   . HOH D 4 .   ? 14.891  5.763   -1.096 1.00 31.44  ? 546 HOH A O   1 
HETATM 1682 O  O   . HOH D 4 .   ? 6.666   -18.213 -1.277 1.00 36.37  ? 547 HOH A O   1 
HETATM 1683 O  O   . HOH D 4 .   ? 16.977  15.390  15.197 1.00 39.35  ? 548 HOH A O   1 
HETATM 1684 O  O   . HOH D 4 .   ? 27.289  10.798  7.769  1.00 47.71  ? 549 HOH A O   1 
HETATM 1685 O  O   . HOH D 4 .   ? -17.688 -18.278 4.592  1.00 48.48  ? 550 HOH A O   1 
HETATM 1686 O  O   . HOH D 4 .   ? 8.942   14.368  -0.932 1.00 41.20  ? 551 HOH A O   1 
HETATM 1687 O  O   . HOH D 4 .   ? -0.271  8.181   22.874 1.00 42.31  ? 552 HOH A O   1 
HETATM 1688 O  O   . HOH D 4 .   ? 12.440  12.109  24.277 1.00 50.53  ? 553 HOH A O   1 
HETATM 1689 O  O   . HOH D 4 .   ? 5.947   17.810  7.082  1.00 39.26  ? 554 HOH A O   1 
HETATM 1690 O  O   . HOH D 4 .   ? 4.531   15.755  0.969  1.00 43.86  ? 555 HOH A O   1 
HETATM 1691 O  O   . HOH D 4 .   ? -14.809 6.638   5.276  1.00 48.34  ? 556 HOH A O   1 
HETATM 1692 O  O   . HOH D 4 .   ? 2.216   1.874   26.156 1.00 54.22  ? 557 HOH A O   1 
HETATM 1693 O  O   . HOH D 4 .   ? 3.262   -1.903  28.222 1.00 45.70  ? 558 HOH A O   1 
HETATM 1694 O  O   . HOH D 4 .   ? 2.231   15.099  12.260 1.00 42.81  ? 559 HOH A O   1 
HETATM 1695 O  O   . HOH D 4 .   ? 1.083   12.837  16.730 1.00 42.84  ? 560 HOH A O   1 
HETATM 1696 O  O   . HOH D 4 .   ? 15.702  -17.708 9.888  1.00 40.23  ? 561 HOH A O   1 
HETATM 1697 O  O   . HOH D 4 .   ? 18.481  4.535   15.291 1.00 21.91  ? 562 HOH A O   1 
HETATM 1698 O  O   . HOH D 4 .   ? -16.801 -17.580 -5.118 1.00 45.72  ? 563 HOH A O   1 
HETATM 1699 O  O   . HOH D 4 .   ? 8.817   -18.663 4.770  1.00 46.71  ? 564 HOH A O   1 
HETATM 1700 O  O   . HOH D 4 .   ? -0.050  -18.859 -0.615 0.50 38.96  ? 565 HOH A O   1 
HETATM 1701 O  O   . HOH D 4 .   ? 2.983   -9.136  9.962  1.00 26.49  ? 566 HOH A O   1 
HETATM 1702 O  O   . HOH D 4 .   ? -8.698  -1.719  12.864 1.00 45.12  ? 567 HOH A O   1 
HETATM 1703 O  O   . HOH D 4 .   ? 18.482  9.432   4.711  1.00 44.96  ? 568 HOH A O   1 
HETATM 1704 O  O   . HOH D 4 .   ? 17.689  -14.561 12.041 1.00 50.89  ? 569 HOH A O   1 
HETATM 1705 O  O   . HOH D 4 .   ? 1.802   10.587  21.524 1.00 50.25  ? 570 HOH A O   1 
HETATM 1706 O  O   . HOH D 4 .   ? -8.337  6.421   15.142 1.00 45.21  ? 571 HOH A O   1 
HETATM 1707 O  O   . HOH D 4 .   ? 18.153  -2.271  30.589 1.00 39.84  ? 572 HOH A O   1 
HETATM 1708 O  O   . HOH D 4 .   ? 13.303  6.148   -3.052 1.00 52.99  ? 573 HOH A O   1 
HETATM 1709 O  O   . HOH D 4 .   ? 1.332   14.722  4.789  1.00 55.61  ? 574 HOH A O   1 
HETATM 1710 O  O   . HOH D 4 .   ? 0.582   5.412   29.489 1.00 50.43  ? 575 HOH A O   1 
HETATM 1711 O  O   . HOH D 4 .   ? -6.462  -14.141 13.034 1.00 51.69  ? 576 HOH A O   1 
HETATM 1712 O  O   . HOH D 4 .   ? 14.286  -16.024 17.965 1.00 46.32  ? 577 HOH A O   1 
HETATM 1713 O  O   . HOH D 4 .   ? 17.206  17.532  12.099 1.00 56.01  ? 578 HOH A O   1 
HETATM 1714 O  O   . HOH D 4 .   ? -0.604  -21.068 3.269  1.00 48.50  ? 579 HOH A O   1 
HETATM 1715 O  O   . HOH D 4 .   ? 9.960   10.675  -2.331 1.00 42.30  ? 580 HOH A O   1 
HETATM 1716 O  O   . HOH D 4 .   ? 4.380   11.935  21.789 1.00 43.64  ? 581 HOH A O   1 
HETATM 1717 O  O   . HOH D 4 .   ? 29.372  -5.852  15.880 1.00 55.10  ? 582 HOH A O   1 
HETATM 1718 O  O   . HOH D 4 .   ? 11.121  0.746   32.824 1.00 46.20  ? 583 HOH A O   1 
HETATM 1719 O  O   . HOH D 4 .   ? -1.186  -4.995  15.434 1.00 56.25  ? 584 HOH A O   1 
HETATM 1720 O  O   . HOH D 4 .   ? -1.533  10.322  19.868 1.00 46.12  ? 585 HOH A O   1 
HETATM 1721 O  O   . HOH D 4 .   ? -15.748 10.274  7.923  1.00 49.42  ? 586 HOH A O   1 
HETATM 1722 O  O   . HOH D 4 .   ? -14.169 4.383   8.576  1.00 46.46  ? 587 HOH A O   1 
HETATM 1723 O  O   . HOH D 4 .   ? 8.065   17.764  16.261 1.00 48.74  ? 588 HOH A O   1 
HETATM 1724 O  O   . HOH D 4 .   ? 13.729  8.998   -0.223 1.00 51.58  ? 589 HOH A O   1 
HETATM 1725 O  O   . HOH D 4 .   ? -18.194 -0.998  3.440  1.00 45.89  ? 590 HOH A O   1 
HETATM 1726 O  O   . HOH D 4 .   ? 12.011  17.037  17.454 1.00 50.91  ? 591 HOH A O   1 
HETATM 1727 O  O   . HOH D 4 .   ? -5.154  17.024  9.973  1.00 54.38  ? 592 HOH A O   1 
HETATM 1728 O  O   . HOH D 4 .   ? -10.237 -5.454  10.931 1.00 45.08  ? 593 HOH A O   1 
HETATM 1729 O  O   . HOH D 4 .   ? -15.500 -14.864 4.442  1.00 57.66  ? 594 HOH A O   1 
HETATM 1730 O  O   . HOH D 4 .   ? 17.407  10.014  -0.143 1.00 48.32  ? 595 HOH A O   1 
HETATM 1731 O  O   . HOH D 4 .   ? 24.903  18.017  6.294  1.00 48.88  ? 596 HOH A O   1 
HETATM 1732 O  O   . HOH D 4 .   ? 9.743   13.272  23.444 1.00 48.37  ? 597 HOH A O   1 
HETATM 1733 O  O   . HOH D 4 .   ? -3.217  9.591   24.905 1.00 55.99  ? 598 HOH A O   1 
HETATM 1734 O  O   . HOH D 4 .   ? -17.257 2.018   5.910  1.00 53.62  ? 599 HOH A O   1 
HETATM 1735 O  O   . HOH D 4 .   ? -9.064  11.835  8.055  1.00 56.46  ? 600 HOH A O   1 
HETATM 1736 O  O   . HOH D 4 .   ? 17.953  11.597  1.938  1.00 53.49  ? 601 HOH A O   1 
HETATM 1737 O  O   . HOH D 4 .   ? 24.421  -2.114  1.713  1.00 49.06  ? 602 HOH A O   1 
HETATM 1738 O  O   . HOH D 4 .   ? -4.169  -11.750 13.031 1.00 44.23  ? 603 HOH A O   1 
HETATM 1739 O  O   . HOH D 4 .   ? 27.768  -1.480  24.594 0.50 54.62  ? 604 HOH A O   1 
HETATM 1740 O  O   . HOH D 4 .   ? 27.778  -5.763  24.649 0.50 48.56  ? 605 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   0   1   MET MET A . n 
A 1 2   MET 2   1   1   MET MET A . n 
A 1 3   TYR 3   2   2   TYR TYR A . n 
A 1 4   LYS 4   3   3   LYS LYS A . n 
A 1 5   GLU 5   4   4   GLU GLU A . n 
A 1 6   PRO 6   5   5   PRO PRO A . n 
A 1 7   PHE 7   6   6   PHE PHE A . n 
A 1 8   GLY 8   7   7   GLY GLY A . n 
A 1 9   VAL 9   8   8   VAL VAL A . n 
A 1 10  LYS 10  9   9   LYS LYS A . n 
A 1 11  VAL 11  10  10  VAL VAL A . n 
A 1 12  ASP 12  11  11  ASP ASP A . n 
A 1 13  PHE 13  12  12  PHE PHE A . n 
A 1 14  GLU 14  13  13  GLU GLU A . n 
A 1 15  THR 15  14  14  THR THR A . n 
A 1 16  GLY 16  15  15  GLY GLY A . n 
A 1 17  ILE 17  16  16  ILE ILE A . n 
A 1 18  ILE 18  17  17  ILE ILE A . n 
A 1 19  GLU 19  18  18  GLU GLU A . n 
A 1 20  GLY 20  19  19  GLY GLY A . n 
A 1 21  ALA 21  20  20  ALA ALA A . n 
A 1 22  LYS 22  21  21  LYS LYS A . n 
A 1 23  LYS 23  22  22  LYS LYS A . n 
A 1 24  SER 24  23  23  SER SER A . n 
A 1 25  VAL 25  24  24  VAL VAL A . n 
A 1 26  ARG 26  25  25  ARG ARG A . n 
A 1 27  ARG 27  26  26  ARG ARG A . n 
A 1 28  LEU 28  27  27  LEU LEU A . n 
A 1 29  SER 29  28  28  SER SER A . n 
A 1 30  ASP 30  29  29  ASP ASP A . n 
A 1 31  MET 31  30  30  MET MET A . n 
A 1 32  GLU 32  31  31  GLU GLU A . n 
A 1 33  GLY 33  32  32  GLY GLY A . n 
A 1 34  TYR 34  33  33  TYR TYR A . n 
A 1 35  PHE 35  34  34  PHE PHE A . n 
A 1 36  VAL 36  35  35  VAL VAL A . n 
A 1 37  ASP 37  36  36  ASP ASP A . n 
A 1 38  GLU 38  37  37  GLU GLU A . n 
A 1 39  ARG 39  38  38  ARG ARG A . n 
A 1 40  ALA 40  39  39  ALA ALA A . n 
A 1 41  TRP 41  40  40  TRP TRP A . n 
A 1 42  LYS 42  41  41  LYS LYS A . n 
A 1 43  GLU 43  42  42  GLU GLU A . n 
A 1 44  LEU 44  43  43  LEU LEU A . n 
A 1 45  VAL 45  44  44  VAL VAL A . n 
A 1 46  GLU 46  45  45  GLU GLU A . n 
A 1 47  LYS 47  46  46  LYS LYS A . n 
A 1 48  GLU 48  47  47  GLU GLU A . n 
A 1 49  ASP 49  48  48  ASP ASP A . n 
A 1 50  PRO 50  49  49  PRO PRO A . n 
A 1 51  VAL 51  50  50  VAL VAL A . n 
A 1 52  VAL 52  51  51  VAL VAL A . n 
A 1 53  TYR 53  52  52  TYR TYR A . n 
A 1 54  GLU 54  53  53  GLU GLU A . n 
A 1 55  VAL 55  54  54  VAL VAL A . n 
A 1 56  TYR 56  55  55  TYR TYR A . n 
A 1 57  ALA 57  56  56  ALA ALA A . n 
A 1 58  VAL 58  57  57  VAL VAL A . n 
A 1 59  GLU 59  58  58  GLU GLU A . n 
A 1 60  GLN 60  59  59  GLN GLN A . n 
A 1 61  GLU 61  60  60  GLU GLU A . n 
A 1 62  GLU 62  61  61  GLU GLU A . n 
A 1 63  LYS 63  62  62  LYS LYS A . n 
A 1 64  GLU 64  63  63  GLU GLU A . n 
A 1 65  GLY 65  64  64  GLY GLY A . n 
A 1 66  ASP 66  65  65  ASP ASP A . n 
A 1 67  LEU 67  66  66  LEU LEU A . n 
A 1 68  ASN 68  67  67  ASN ASN A . n 
A 1 69  PHE 69  68  68  PHE PHE A . n 
A 1 70  ALA 70  69  69  ALA ALA A . n 
A 1 71  THR 71  70  70  THR THR A . n 
A 1 72  THR 72  71  71  THR THR A . n 
A 1 73  VAL 73  72  72  VAL VAL A . n 
A 1 74  LEU 74  73  73  LEU LEU A . n 
A 1 75  TYR 75  74  74  TYR TYR A . n 
A 1 76  PRO 76  75  75  PRO PRO A . n 
A 1 77  GLY 77  76  76  GLY GLY A . n 
A 1 78  LYS 78  77  77  LYS LYS A . n 
A 1 79  VAL 79  78  78  VAL VAL A . n 
A 1 80  GLY 80  79  79  GLY GLY A . n 
A 1 81  LYS 81  80  80  LYS LYS A . n 
A 1 82  GLU 82  81  81  GLU GLU A . n 
A 1 83  PHE 83  82  82  PHE PHE A . n 
A 1 84  PHE 84  83  83  PHE PHE A . n 
A 1 85  PHE 85  84  84  PHE PHE A . n 
A 1 86  THR 86  85  85  THR THR A . n 
A 1 87  LYS 87  86  86  LYS LYS A . n 
A 1 88  GLY 88  87  87  GLY GLY A . n 
A 1 89  HIS 89  88  88  HIS HIS A . n 
A 1 90  PHE 90  89  89  PHE PHE A . n 
A 1 91  HIS 91  90  90  HIS HIS A . n 
A 1 92  ALA 92  91  91  ALA ALA A . n 
A 1 93  LYS 93  92  92  LYS LYS A . n 
A 1 94  LEU 94  93  93  LEU LEU A . n 
A 1 95  ASP 95  94  94  ASP ASP A . n 
A 1 96  ARG 96  95  95  ARG ARG A . n 
A 1 97  ALA 97  96  96  ALA ALA A . n 
A 1 98  GLU 98  97  97  GLU GLU A . n 
A 1 99  VAL 99  98  98  VAL VAL A . n 
A 1 100 TYR 100 99  99  TYR TYR A . n 
A 1 101 VAL 101 100 100 VAL VAL A . n 
A 1 102 ALA 102 101 101 ALA ALA A . n 
A 1 103 LEU 103 102 102 LEU LEU A . n 
A 1 104 LYS 104 103 103 LYS LYS A . n 
A 1 105 GLY 105 104 104 GLY GLY A . n 
A 1 106 LYS 106 105 105 LYS LYS A . n 
A 1 107 GLY 107 106 106 GLY GLY A . n 
A 1 108 GLY 108 107 107 GLY GLY A . n 
A 1 109 MET 109 108 108 MET MET A . n 
A 1 110 LEU 110 109 109 LEU LEU A . n 
A 1 111 LEU 111 110 110 LEU LEU A . n 
A 1 112 GLN 112 111 111 GLN GLN A . n 
A 1 113 THR 113 112 112 THR THR A . n 
A 1 114 PRO 114 113 113 PRO PRO A . n 
A 1 115 GLU 115 114 114 GLU GLU A . n 
A 1 116 GLY 116 115 115 GLY GLY A . n 
A 1 117 ASP 117 116 116 ASP ASP A . n 
A 1 118 ALA 118 117 117 ALA ALA A . n 
A 1 119 LYS 119 118 118 LYS LYS A . n 
A 1 120 TRP 120 119 119 TRP TRP A . n 
A 1 121 ILE 121 120 120 ILE ILE A . n 
A 1 122 SER 122 121 121 SER SER A . n 
A 1 123 MET 123 122 122 MET MET A . n 
A 1 124 GLU 124 123 123 GLU GLU A . n 
A 1 125 PRO 125 124 124 PRO PRO A . n 
A 1 126 GLY 126 125 125 GLY GLY A . n 
A 1 127 THR 127 126 126 THR THR A . n 
A 1 128 VAL 128 127 127 VAL VAL A . n 
A 1 129 VAL 129 128 128 VAL VAL A . n 
A 1 130 TYR 130 129 129 TYR TYR A . n 
A 1 131 VAL 131 130 130 VAL VAL A . n 
A 1 132 PRO 132 131 131 PRO PRO A . n 
A 1 133 PRO 133 132 132 PRO PRO A . n 
A 1 134 TYR 134 133 133 TYR TYR A . n 
A 1 135 TRP 135 134 134 TRP TRP A . n 
A 1 136 ALA 136 135 135 ALA ALA A . n 
A 1 137 HIS 137 136 136 HIS HIS A . n 
A 1 138 ARG 138 137 137 ARG ARG A . n 
A 1 139 THR 139 138 138 THR THR A . n 
A 1 140 VAL 140 139 139 VAL VAL A . n 
A 1 141 ASN 141 140 140 ASN ASN A . n 
A 1 142 ILE 142 141 141 ILE ILE A . n 
A 1 143 GLY 143 142 142 GLY GLY A . n 
A 1 144 ASP 144 143 143 ASP ASP A . n 
A 1 145 GLU 145 144 144 GLU GLU A . n 
A 1 146 PRO 146 145 145 PRO PRO A . n 
A 1 147 PHE 147 146 146 PHE PHE A . n 
A 1 148 ILE 148 147 147 ILE ILE A . n 
A 1 149 PHE 149 148 148 PHE PHE A . n 
A 1 150 LEU 150 149 149 LEU LEU A . n 
A 1 151 ALA 151 150 150 ALA ALA A . n 
A 1 152 ILE 152 151 151 ILE ILE A . n 
A 1 153 TYR 153 152 152 TYR TYR A . n 
A 1 154 PRO 154 153 153 PRO PRO A . n 
A 1 155 ALA 155 154 154 ALA ALA A . n 
A 1 156 ASP 156 155 155 ASP ASP A . n 
A 1 157 ALA 157 156 156 ALA ALA A . n 
A 1 158 GLY 158 157 157 GLY GLY A . n 
A 1 159 HIS 159 158 158 HIS HIS A . n 
A 1 160 ASP 160 159 159 ASP ASP A . n 
A 1 161 TYR 161 160 160 TYR TYR A . n 
A 1 162 GLY 162 161 161 GLY GLY A . n 
A 1 163 THR 163 162 162 THR THR A . n 
A 1 164 ILE 164 163 163 ILE ILE A . n 
A 1 165 ALA 165 164 164 ALA ALA A . n 
A 1 166 GLU 166 165 165 GLU GLU A . n 
A 1 167 LYS 167 166 166 LYS LYS A . n 
A 1 168 GLY 168 167 167 GLY GLY A . n 
A 1 169 PHE 169 168 168 PHE PHE A . n 
A 1 170 SER 170 169 169 SER SER A . n 
A 1 171 LYS 171 170 170 LYS LYS A . n 
A 1 172 ILE 172 171 171 ILE ILE A . n 
A 1 173 VAL 173 172 172 VAL VAL A . n 
A 1 174 ILE 174 173 173 ILE ILE A . n 
A 1 175 GLU 175 174 174 GLU GLU A . n 
A 1 176 GLU 176 175 175 GLU GLU A . n 
A 1 177 ASN 177 176 176 ASN ASN A . n 
A 1 178 GLY 178 177 177 GLY GLY A . n 
A 1 179 GLU 179 178 178 GLU GLU A . n 
A 1 180 VAL 180 179 179 VAL VAL A . n 
A 1 181 LYS 181 180 180 LYS LYS A . n 
A 1 182 VAL 182 181 181 VAL VAL A . n 
A 1 183 VAL 183 182 182 VAL VAL A . n 
A 1 184 ASP 184 183 183 ASP ASP A . n 
A 1 185 ASN 185 184 184 ASN ASN A . n 
A 1 186 PRO 186 185 185 PRO PRO A . n 
A 1 187 ARG 187 186 186 ARG ARG A . n 
A 1 188 TRP 188 187 187 TRP TRP A . n 
A 1 189 LYS 189 188 188 LYS LYS A . n 
A 1 190 LYS 190 189 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MN  1   400 200 MN  MN  A . 
C 3 PA5 1   301 1   PA5 PA5 A . 
D 4 HOH 1   401 1   HOH HOH A . 
D 4 HOH 2   402 2   HOH HOH A . 
D 4 HOH 3   403 3   HOH HOH A . 
D 4 HOH 4   404 4   HOH HOH A . 
D 4 HOH 5   405 5   HOH HOH A . 
D 4 HOH 6   406 6   HOH HOH A . 
D 4 HOH 7   407 7   HOH HOH A . 
D 4 HOH 8   408 8   HOH HOH A . 
D 4 HOH 9   409 9   HOH HOH A . 
D 4 HOH 10  410 10  HOH HOH A . 
D 4 HOH 11  411 11  HOH HOH A . 
D 4 HOH 12  412 12  HOH HOH A . 
D 4 HOH 13  413 13  HOH HOH A . 
D 4 HOH 14  414 14  HOH HOH A . 
D 4 HOH 15  415 15  HOH HOH A . 
D 4 HOH 16  416 16  HOH HOH A . 
D 4 HOH 17  417 17  HOH HOH A . 
D 4 HOH 18  418 18  HOH HOH A . 
D 4 HOH 19  419 19  HOH HOH A . 
D 4 HOH 20  420 20  HOH HOH A . 
D 4 HOH 21  421 21  HOH HOH A . 
D 4 HOH 22  422 22  HOH HOH A . 
D 4 HOH 23  423 23  HOH HOH A . 
D 4 HOH 24  424 24  HOH HOH A . 
D 4 HOH 25  425 25  HOH HOH A . 
D 4 HOH 26  426 26  HOH HOH A . 
D 4 HOH 27  427 27  HOH HOH A . 
D 4 HOH 28  428 28  HOH HOH A . 
D 4 HOH 29  429 29  HOH HOH A . 
D 4 HOH 30  430 30  HOH HOH A . 
D 4 HOH 31  431 31  HOH HOH A . 
D 4 HOH 32  432 32  HOH HOH A . 
D 4 HOH 33  433 33  HOH HOH A . 
D 4 HOH 34  434 34  HOH HOH A . 
D 4 HOH 35  435 35  HOH HOH A . 
D 4 HOH 36  436 36  HOH HOH A . 
D 4 HOH 37  437 37  HOH HOH A . 
D 4 HOH 38  438 38  HOH HOH A . 
D 4 HOH 39  439 39  HOH HOH A . 
D 4 HOH 40  440 40  HOH HOH A . 
D 4 HOH 41  441 41  HOH HOH A . 
D 4 HOH 42  442 42  HOH HOH A . 
D 4 HOH 43  443 43  HOH HOH A . 
D 4 HOH 44  444 44  HOH HOH A . 
D 4 HOH 45  445 45  HOH HOH A . 
D 4 HOH 46  446 46  HOH HOH A . 
D 4 HOH 47  447 47  HOH HOH A . 
D 4 HOH 48  448 48  HOH HOH A . 
D 4 HOH 49  449 49  HOH HOH A . 
D 4 HOH 50  450 50  HOH HOH A . 
D 4 HOH 51  451 51  HOH HOH A . 
D 4 HOH 52  452 52  HOH HOH A . 
D 4 HOH 53  453 53  HOH HOH A . 
D 4 HOH 54  454 54  HOH HOH A . 
D 4 HOH 55  455 55  HOH HOH A . 
D 4 HOH 56  456 56  HOH HOH A . 
D 4 HOH 57  457 57  HOH HOH A . 
D 4 HOH 58  458 58  HOH HOH A . 
D 4 HOH 59  459 59  HOH HOH A . 
D 4 HOH 60  460 60  HOH HOH A . 
D 4 HOH 61  461 61  HOH HOH A . 
D 4 HOH 62  462 62  HOH HOH A . 
D 4 HOH 63  463 63  HOH HOH A . 
D 4 HOH 64  464 64  HOH HOH A . 
D 4 HOH 65  465 65  HOH HOH A . 
D 4 HOH 66  466 66  HOH HOH A . 
D 4 HOH 67  467 67  HOH HOH A . 
D 4 HOH 68  468 68  HOH HOH A . 
D 4 HOH 69  469 69  HOH HOH A . 
D 4 HOH 70  470 70  HOH HOH A . 
D 4 HOH 71  471 71  HOH HOH A . 
D 4 HOH 72  472 72  HOH HOH A . 
D 4 HOH 73  473 73  HOH HOH A . 
D 4 HOH 74  474 74  HOH HOH A . 
D 4 HOH 75  475 75  HOH HOH A . 
D 4 HOH 76  476 76  HOH HOH A . 
D 4 HOH 77  477 77  HOH HOH A . 
D 4 HOH 78  478 78  HOH HOH A . 
D 4 HOH 79  479 79  HOH HOH A . 
D 4 HOH 80  480 80  HOH HOH A . 
D 4 HOH 81  481 81  HOH HOH A . 
D 4 HOH 82  482 82  HOH HOH A . 
D 4 HOH 83  483 83  HOH HOH A . 
D 4 HOH 84  484 84  HOH HOH A . 
D 4 HOH 85  485 85  HOH HOH A . 
D 4 HOH 86  486 86  HOH HOH A . 
D 4 HOH 87  487 87  HOH HOH A . 
D 4 HOH 88  488 88  HOH HOH A . 
D 4 HOH 89  489 89  HOH HOH A . 
D 4 HOH 90  490 90  HOH HOH A . 
D 4 HOH 91  491 91  HOH HOH A . 
D 4 HOH 92  492 92  HOH HOH A . 
D 4 HOH 93  493 93  HOH HOH A . 
D 4 HOH 94  494 94  HOH HOH A . 
D 4 HOH 95  495 95  HOH HOH A . 
D 4 HOH 96  496 96  HOH HOH A . 
D 4 HOH 97  497 97  HOH HOH A . 
D 4 HOH 98  498 98  HOH HOH A . 
D 4 HOH 99  499 99  HOH HOH A . 
D 4 HOH 100 500 100 HOH HOH A . 
D 4 HOH 101 501 101 HOH HOH A . 
D 4 HOH 102 502 102 HOH HOH A . 
D 4 HOH 103 503 103 HOH HOH A . 
D 4 HOH 104 504 104 HOH HOH A . 
D 4 HOH 105 505 105 HOH HOH A . 
D 4 HOH 106 506 106 HOH HOH A . 
D 4 HOH 107 507 107 HOH HOH A . 
D 4 HOH 108 508 108 HOH HOH A . 
D 4 HOH 109 509 109 HOH HOH A . 
D 4 HOH 110 510 110 HOH HOH A . 
D 4 HOH 111 511 111 HOH HOH A . 
D 4 HOH 112 512 112 HOH HOH A . 
D 4 HOH 113 513 113 HOH HOH A . 
D 4 HOH 114 514 114 HOH HOH A . 
D 4 HOH 115 515 115 HOH HOH A . 
D 4 HOH 116 516 116 HOH HOH A . 
D 4 HOH 117 517 117 HOH HOH A . 
D 4 HOH 118 518 118 HOH HOH A . 
D 4 HOH 119 519 119 HOH HOH A . 
D 4 HOH 120 520 120 HOH HOH A . 
D 4 HOH 121 521 121 HOH HOH A . 
D 4 HOH 122 522 122 HOH HOH A . 
D 4 HOH 123 523 123 HOH HOH A . 
D 4 HOH 124 524 124 HOH HOH A . 
D 4 HOH 125 525 125 HOH HOH A . 
D 4 HOH 126 526 126 HOH HOH A . 
D 4 HOH 127 527 127 HOH HOH A . 
D 4 HOH 128 528 128 HOH HOH A . 
D 4 HOH 129 529 129 HOH HOH A . 
D 4 HOH 130 530 130 HOH HOH A . 
D 4 HOH 131 531 131 HOH HOH A . 
D 4 HOH 132 532 132 HOH HOH A . 
D 4 HOH 133 533 133 HOH HOH A . 
D 4 HOH 134 534 134 HOH HOH A . 
D 4 HOH 135 535 135 HOH HOH A . 
D 4 HOH 136 536 136 HOH HOH A . 
D 4 HOH 137 537 137 HOH HOH A . 
D 4 HOH 138 538 138 HOH HOH A . 
D 4 HOH 139 539 139 HOH HOH A . 
D 4 HOH 140 540 140 HOH HOH A . 
D 4 HOH 141 541 141 HOH HOH A . 
D 4 HOH 142 542 142 HOH HOH A . 
D 4 HOH 143 543 143 HOH HOH A . 
D 4 HOH 144 544 144 HOH HOH A . 
D 4 HOH 145 545 145 HOH HOH A . 
D 4 HOH 146 546 146 HOH HOH A . 
D 4 HOH 147 547 147 HOH HOH A . 
D 4 HOH 148 548 148 HOH HOH A . 
D 4 HOH 149 549 149 HOH HOH A . 
D 4 HOH 150 550 150 HOH HOH A . 
D 4 HOH 151 551 151 HOH HOH A . 
D 4 HOH 152 552 152 HOH HOH A . 
D 4 HOH 153 553 153 HOH HOH A . 
D 4 HOH 154 554 154 HOH HOH A . 
D 4 HOH 155 555 155 HOH HOH A . 
D 4 HOH 156 556 156 HOH HOH A . 
D 4 HOH 157 557 157 HOH HOH A . 
D 4 HOH 158 558 158 HOH HOH A . 
D 4 HOH 159 559 159 HOH HOH A . 
D 4 HOH 160 560 160 HOH HOH A . 
D 4 HOH 161 561 161 HOH HOH A . 
D 4 HOH 162 562 162 HOH HOH A . 
D 4 HOH 163 563 163 HOH HOH A . 
D 4 HOH 164 564 164 HOH HOH A . 
D 4 HOH 165 565 165 HOH HOH A . 
D 4 HOH 166 566 166 HOH HOH A . 
D 4 HOH 167 567 167 HOH HOH A . 
D 4 HOH 168 568 168 HOH HOH A . 
D 4 HOH 169 569 169 HOH HOH A . 
D 4 HOH 170 570 170 HOH HOH A . 
D 4 HOH 171 571 171 HOH HOH A . 
D 4 HOH 172 572 172 HOH HOH A . 
D 4 HOH 173 573 173 HOH HOH A . 
D 4 HOH 174 574 174 HOH HOH A . 
D 4 HOH 175 575 175 HOH HOH A . 
D 4 HOH 176 576 176 HOH HOH A . 
D 4 HOH 177 577 177 HOH HOH A . 
D 4 HOH 178 578 178 HOH HOH A . 
D 4 HOH 179 579 179 HOH HOH A . 
D 4 HOH 180 580 180 HOH HOH A . 
D 4 HOH 181 581 181 HOH HOH A . 
D 4 HOH 182 582 182 HOH HOH A . 
D 4 HOH 183 583 183 HOH HOH A . 
D 4 HOH 184 584 184 HOH HOH A . 
D 4 HOH 185 585 185 HOH HOH A . 
D 4 HOH 186 586 186 HOH HOH A . 
D 4 HOH 187 587 187 HOH HOH A . 
D 4 HOH 188 588 188 HOH HOH A . 
D 4 HOH 189 589 189 HOH HOH A . 
D 4 HOH 190 590 190 HOH HOH A . 
D 4 HOH 191 591 191 HOH HOH A . 
D 4 HOH 192 592 192 HOH HOH A . 
D 4 HOH 193 593 193 HOH HOH A . 
D 4 HOH 194 594 194 HOH HOH A . 
D 4 HOH 195 595 195 HOH HOH A . 
D 4 HOH 196 596 196 HOH HOH A . 
D 4 HOH 197 597 197 HOH HOH A . 
D 4 HOH 198 598 198 HOH HOH A . 
D 4 HOH 199 599 199 HOH HOH A . 
D 4 HOH 200 600 200 HOH HOH A . 
D 4 HOH 201 601 201 HOH HOH A . 
D 4 HOH 202 602 202 HOH HOH A . 
D 4 HOH 203 603 203 HOH HOH A . 
D 4 HOH 204 604 204 HOH HOH A . 
D 4 HOH 205 605 205 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5190  ? 
1 MORE         -59   ? 
1 'SSA (A^2)'  16460 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 2_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 604 ? D HOH . 
2 1 A HOH 605 ? D HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? D HOH .   ? A HOH 407 ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 NE2 ? A HIS 91  ? A HIS 90  ? 1_555 88.9  ? 
2  O   ? D HOH .   ? A HOH 407 ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 NE2 ? A HIS 89  ? A HIS 88  ? 1_555 84.9  ? 
3  NE2 ? A HIS 91  ? A HIS 90  ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 NE2 ? A HIS 89  ? A HIS 88  ? 1_555 107.2 ? 
4  O   ? D HOH .   ? A HOH 407 ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 OE1 ? A GLU 98  ? A GLU 97  ? 1_555 96.2  ? 
5  NE2 ? A HIS 91  ? A HIS 90  ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 OE1 ? A GLU 98  ? A GLU 97  ? 1_555 75.5  ? 
6  NE2 ? A HIS 89  ? A HIS 88  ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 OE1 ? A GLU 98  ? A GLU 97  ? 1_555 177.1 ? 
7  O   ? D HOH .   ? A HOH 407 ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 NE2 ? A HIS 137 ? A HIS 136 ? 1_555 174.5 ? 
8  NE2 ? A HIS 91  ? A HIS 90  ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 NE2 ? A HIS 137 ? A HIS 136 ? 1_555 94.5  ? 
9  NE2 ? A HIS 89  ? A HIS 88  ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 NE2 ? A HIS 137 ? A HIS 136 ? 1_555 89.9  ? 
10 OE1 ? A GLU 98  ? A GLU 97  ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 NE2 ? A HIS 137 ? A HIS 136 ? 1_555 88.8  ? 
11 O   ? D HOH .   ? A HOH 407 ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 O1  ? C PA5 .   ? A PA5 301 ? 1_555 83.9  ? 
12 NE2 ? A HIS 91  ? A HIS 90  ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 O1  ? C PA5 .   ? A PA5 301 ? 1_555 165.1 ? 
13 NE2 ? A HIS 89  ? A HIS 88  ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 O1  ? C PA5 .   ? A PA5 301 ? 1_555 85.2  ? 
14 OE1 ? A GLU 98  ? A GLU 97  ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 O1  ? C PA5 .   ? A PA5 301 ? 1_555 92.2  ? 
15 NE2 ? A HIS 137 ? A HIS 136 ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 O1  ? C PA5 .   ? A PA5 301 ? 1_555 93.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-10-12 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2014-09-24 
5 'Structure model' 1 4 2018-06-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Database references'       
5 5 'Structure model' 'Data collection'           
6 5 'Structure model' 'Database references'       
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    5 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            struct_ref_seq_dif 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    5 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_struct_ref_seq_dif.details' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.1.24 ? 1 
DENZO     'data reduction' .      ? 2 
SCALEPACK 'data scaling'   .      ? 3 
AMoRE     phasing          .      ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 21  ? ? 89.24   105.77 
2 1 GLU A 47  ? ? -149.86 -37.82 
3 1 TYR A 133 ? ? 81.31   0.09   
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     LYS 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      189 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    LYS 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     190 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MANGANESE (II) ION'       MN  
3 '5-PHOSPHOARABINONIC ACID' PA5 
4 water                      HOH 
#