data_1X82
# 
_entry.id   1X82 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1X82         
RCSB  RCSB030056   
WWPDB D_1000030056 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2004-10-12 
_pdbx_database_PDB_obs_spr.pdb_id           1X82 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1PLZ 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1PLZ 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1X82 
_pdbx_database_status.recvd_initial_deposition_date   2004-08-17 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Berrisford, J.M.'  1  
'Akerboom, J.'      2  
'Brouns, S.'        3  
'Sedelnikova, S.E.' 4  
'Turnbull, A.P.'    5  
'van der Oost, J.'  6  
'Salmon, L.'        7  
'Hardre, R.'        8  
'Murray, I.A.'      9  
'Blackburn, G.M.'   10 
'Rice, D.W.'        11 
'Baker, P.J.'       12 
# 
_citation.id                        primary 
_citation.title                     
;The structures of inhibitor complexes of Pyrococcus furiosus phosphoglucose isomerase provide insights into substrate binding and catalysis.
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            343 
_citation.page_first                649 
_citation.page_last                 657 
_citation.year                      2004 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15465052 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2004.08.061 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Berrisford, J.M.'  1  
primary 'Akerboom, J.'      2  
primary 'Brouns, S.'        3  
primary 'Sedelnikova, S.E.' 4  
primary 'Turnbull, A.P.'    5  
primary 'van der Oost, J.'  6  
primary 'Salmon, L.'        7  
primary 'Hardre, R.'        8  
primary 'Murray, I.A.'      9  
primary 'Blackburn, G.M.'   10 
primary 'Rice, D.W.'        11 
primary 'Baker, P.J.'       12 
# 
_cell.entry_id           1X82 
_cell.length_a           84.506 
_cell.length_b           42.730 
_cell.length_c           57.308 
_cell.angle_alpha        90.00 
_cell.angle_beta         120.32 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1X82 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glucose-6-phosphate isomerase' 21871.107 1   5.3.1.9 ? ? ? 
2 non-polymer syn '5-PHOSPHOARABINONIC ACID'      246.109   1   ?       ? ? ? 
3 water       nat water                           18.015    246 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GPI, Phosphoglucose isomerase, PGI, Phosphohexose isomerase, PHI' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;(MSE)(MSE)YKEPFGVKVDFETGIIEGAKKSVRRLSD(MSE)EGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLN
FATTVLYPGKVGKEFFFTKGHFHAKLDRAEVYVALKGKGG(MSE)LLQTPEGDAKWIS(MSE)EPGTVVYVPPYWAHRTV
NIGDEPFIFLAIYPADAGHDYGTIAEKGFSKIVIEENGEVKVVDNPRWKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MMYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVG
KEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHD
YGTIAEKGFSKIVIEENGEVKVVDNPRWKK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MSE n 
1 2   MSE n 
1 3   TYR n 
1 4   LYS n 
1 5   GLU n 
1 6   PRO n 
1 7   PHE n 
1 8   GLY n 
1 9   VAL n 
1 10  LYS n 
1 11  VAL n 
1 12  ASP n 
1 13  PHE n 
1 14  GLU n 
1 15  THR n 
1 16  GLY n 
1 17  ILE n 
1 18  ILE n 
1 19  GLU n 
1 20  GLY n 
1 21  ALA n 
1 22  LYS n 
1 23  LYS n 
1 24  SER n 
1 25  VAL n 
1 26  ARG n 
1 27  ARG n 
1 28  LEU n 
1 29  SER n 
1 30  ASP n 
1 31  MSE n 
1 32  GLU n 
1 33  GLY n 
1 34  TYR n 
1 35  PHE n 
1 36  VAL n 
1 37  ASP n 
1 38  GLU n 
1 39  ARG n 
1 40  ALA n 
1 41  TRP n 
1 42  LYS n 
1 43  GLU n 
1 44  LEU n 
1 45  VAL n 
1 46  GLU n 
1 47  LYS n 
1 48  GLU n 
1 49  ASP n 
1 50  PRO n 
1 51  VAL n 
1 52  VAL n 
1 53  TYR n 
1 54  GLU n 
1 55  VAL n 
1 56  TYR n 
1 57  ALA n 
1 58  VAL n 
1 59  GLU n 
1 60  GLN n 
1 61  GLU n 
1 62  GLU n 
1 63  LYS n 
1 64  GLU n 
1 65  GLY n 
1 66  ASP n 
1 67  LEU n 
1 68  ASN n 
1 69  PHE n 
1 70  ALA n 
1 71  THR n 
1 72  THR n 
1 73  VAL n 
1 74  LEU n 
1 75  TYR n 
1 76  PRO n 
1 77  GLY n 
1 78  LYS n 
1 79  VAL n 
1 80  GLY n 
1 81  LYS n 
1 82  GLU n 
1 83  PHE n 
1 84  PHE n 
1 85  PHE n 
1 86  THR n 
1 87  LYS n 
1 88  GLY n 
1 89  HIS n 
1 90  PHE n 
1 91  HIS n 
1 92  ALA n 
1 93  LYS n 
1 94  LEU n 
1 95  ASP n 
1 96  ARG n 
1 97  ALA n 
1 98  GLU n 
1 99  VAL n 
1 100 TYR n 
1 101 VAL n 
1 102 ALA n 
1 103 LEU n 
1 104 LYS n 
1 105 GLY n 
1 106 LYS n 
1 107 GLY n 
1 108 GLY n 
1 109 MSE n 
1 110 LEU n 
1 111 LEU n 
1 112 GLN n 
1 113 THR n 
1 114 PRO n 
1 115 GLU n 
1 116 GLY n 
1 117 ASP n 
1 118 ALA n 
1 119 LYS n 
1 120 TRP n 
1 121 ILE n 
1 122 SER n 
1 123 MSE n 
1 124 GLU n 
1 125 PRO n 
1 126 GLY n 
1 127 THR n 
1 128 VAL n 
1 129 VAL n 
1 130 TYR n 
1 131 VAL n 
1 132 PRO n 
1 133 PRO n 
1 134 TYR n 
1 135 TRP n 
1 136 ALA n 
1 137 HIS n 
1 138 ARG n 
1 139 THR n 
1 140 VAL n 
1 141 ASN n 
1 142 ILE n 
1 143 GLY n 
1 144 ASP n 
1 145 GLU n 
1 146 PRO n 
1 147 PHE n 
1 148 ILE n 
1 149 PHE n 
1 150 LEU n 
1 151 ALA n 
1 152 ILE n 
1 153 TYR n 
1 154 PRO n 
1 155 ALA n 
1 156 ASP n 
1 157 ALA n 
1 158 GLY n 
1 159 HIS n 
1 160 ASP n 
1 161 TYR n 
1 162 GLY n 
1 163 THR n 
1 164 ILE n 
1 165 ALA n 
1 166 GLU n 
1 167 LYS n 
1 168 GLY n 
1 169 PHE n 
1 170 SER n 
1 171 LYS n 
1 172 ILE n 
1 173 VAL n 
1 174 ILE n 
1 175 GLU n 
1 176 GLU n 
1 177 ASN n 
1 178 GLY n 
1 179 GLU n 
1 180 VAL n 
1 181 LYS n 
1 182 VAL n 
1 183 VAL n 
1 184 ASP n 
1 185 ASN n 
1 186 PRO n 
1 187 ARG n 
1 188 TRP n 
1 189 LYS n 
1 190 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Pyrococcus 
_entity_src_gen.pdbx_gene_src_gene                 pgiA 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pyrococcus furiosus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2261 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET24-d 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    G6PI_PYRFU 
_struct_ref.pdbx_db_accession          P83194 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGK
EFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHDY
GTIAEKGFSKIVIEENGEVKVVDNPRWKK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1X82 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 190 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P83194 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  189 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       189 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1X82 MSE A 1   ? UNP P83194 ?   ?   'CLONING ARTIFACT' 0   1 
1 1X82 MSE A 2   ? UNP P83194 MET 1   'MODIFIED RESIDUE' 1   2 
1 1X82 MSE A 31  ? UNP P83194 MET 30  'MODIFIED RESIDUE' 30  3 
1 1X82 MSE A 109 ? UNP P83194 MET 108 'MODIFIED RESIDUE' 108 4 
1 1X82 MSE A 123 ? UNP P83194 MET 122 'MODIFIED RESIDUE' 122 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                      ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'  149.211 
MSE 'L-peptide linking' n SELENOMETHIONINE           ? 'C5 H11 N O2 Se' 196.106 
PA5 saccharide          . '5-PHOSPHOARABINONIC ACID' ? 'C5 H11 O9 P'    246.109 
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1X82 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.80 
_exptl_crystal.density_percent_sol   31.2 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.50 
_exptl_crystal_grow.pdbx_details    
'1.6M tri-sodium citrate, 50mM 5-phospho-D-arabinonate, 100mM MnCl2, pH 6.50, VAPOR DIFFUSION, HANGING DROP, temperature 290K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2003-07-25 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.89843 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE BM14' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   BM14 
_diffrn_source.pdbx_wavelength             0.89843 
_diffrn_source.pdbx_wavelength_list        0.89843 
# 
_reflns.entry_id                     1X82 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            1.50 
_reflns.d_resolution_low             21.0 
_reflns.number_all                   28461 
_reflns.number_obs                   26896 
_reflns.percent_possible_obs         94.5 
_reflns.pdbx_Rmerge_I_obs            0.054 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        30.0 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.50 
_reflns_shell.d_res_low              1.53 
_reflns_shell.percent_possible_all   90.6 
_reflns_shell.Rmerge_I_obs           0.314 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.85 
_reflns_shell.pdbx_redundancy        1.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1731 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1X82 
_refine.ls_number_reflns_obs                     25618 
_refine.ls_number_reflns_all                     25618 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            1.50 
_refine.ls_percent_reflns_obs                    94.54 
_refine.ls_R_factor_obs                          0.16301 
_refine.ls_R_factor_all                          0.16301 
_refine.ls_R_factor_R_work                       0.16078 
_refine.ls_R_factor_R_free                       0.20821 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.7 
_refine.ls_number_reflns_R_free                  1273 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.976 
_refine.correlation_coeff_Fo_to_Fc_free          0.959 
_refine.B_iso_mean                               23.687 
_refine.aniso_B[1][1]                            -0.68 
_refine.aniso_B[2][2]                            0.26 
_refine.aniso_B[3][3]                            -1.19 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -1.60 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1PLZ 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.078 
_refine.pdbx_overall_ESU_R_Free                  0.085 
_refine.overall_SU_ML                            0.062 
_refine.overall_SU_B                             1.737 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1528 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         15 
_refine_hist.number_atoms_solvent             246 
_refine_hist.number_atoms_total               1789 
_refine_hist.d_res_high                       1.50 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.008  0.022 ? 1584 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.002  0.020 ? 1404 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.232  1.960 ? 2142 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        0.743  3.000 ? 3285 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   6.909  5.000 ? 189  'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.076  0.200 ? 222  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.004  0.020 ? 1744 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.004  0.020 ? 326  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.197  0.200 ? 225  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.233  0.200 ? 1529 'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.077  0.200 ? 919  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.117  0.200 ? 151  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.084  0.200 ? 8    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.282  0.200 ? 73   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.137  0.200 ? 29   'X-RAY DIFFRACTION' ? 
r_mcbond_it              6.600  2.000 ? 941  'X-RAY DIFFRACTION' ? 
r_mcangle_it             9.270  3.000 ? 1518 'X-RAY DIFFRACTION' ? 
r_scbond_it              22.009 2.000 ? 643  'X-RAY DIFFRACTION' ? 
r_scangle_it             23.212 3.000 ? 624  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.500 
_refine_ls_shell.d_res_low                        1.539 
_refine_ls_shell.number_reflns_R_work             1800 
_refine_ls_shell.R_factor_R_work                  0.284 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.314 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             97 
_refine_ls_shell.number_reflns_obs                1731 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1X82 
_struct.title                     
'CRYSTAL STRUCTURE OF PHOSPHOGLUCOSE ISOMERASE FROM PYROCOCCUS FURIOSUS WITH BOUND 5-phospho-D-arabinonate' 
_struct.pdbx_descriptor           'CRYSTAL STRUCTURE OF PHOSPHOGLUCOSE ISOMERASE FROM PYROCOCCUS FURIOSUS' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1X82 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            
;CUPIN SUPERFAMILY, PYROCOCCUS FURIOSUS, HYPERTHERMOPHILE, PHOSPHOGLUCOSE ISOMERASE, EXTREMEOPHILE, 5-phospho-D-arabinonate, METAL BINDING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The biological dimer is built by 180 degree rotation around the y axis' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 29  ? GLU A 32  ? SER A 28  GLU A 31  5 ? 4  
HELX_P HELX_P2 2 ASP A 37  ? GLU A 48  ? ASP A 36  GLU A 47  1 ? 12 
HELX_P HELX_P3 3 TYR A 161 ? GLY A 168 ? TYR A 160 GLY A 167 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A MSE 1   C ? ? ? 1_555 A MSE 2   N ? ? A MSE 0   A MSE 1   1_555 ? ? ? ? ? ? ? 1.332 ? 
covale2 covale ? ? A MSE 2   C ? ? ? 1_555 A TYR 3   N ? ? A MSE 1   A TYR 2   1_555 ? ? ? ? ? ? ? 1.318 ? 
covale3 covale ? ? A ASP 30  C ? ? ? 1_555 A MSE 31  N ? ? A ASP 29  A MSE 30  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale4 covale ? ? A MSE 31  C ? ? ? 1_555 A GLU 32  N ? ? A MSE 30  A GLU 31  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale5 covale ? ? A GLY 108 C ? ? ? 1_555 A MSE 109 N ? ? A GLY 107 A MSE 108 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale6 covale ? ? A MSE 109 C ? ? ? 1_555 A LEU 110 N ? ? A MSE 108 A LEU 109 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale7 covale ? ? A SER 122 C ? ? ? 1_555 A MSE 123 N ? ? A SER 121 A MSE 122 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale8 covale ? ? A MSE 123 C ? ? ? 1_555 A GLU 124 N ? ? A MSE 122 A GLU 123 1_555 ? ? ? ? ? ? ? 1.327 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 3 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 23  ? ARG A 27  ? LYS A 22  ARG A 26  
A 2 VAL A 51  ? VAL A 58  ? VAL A 50  VAL A 57  
A 3 LEU A 67  ? LEU A 74  ? LEU A 66  LEU A 73  
A 4 PHE A 147 ? PRO A 154 ? PHE A 146 PRO A 153 
A 5 GLU A 98  ? LYS A 104 ? GLU A 97  LYS A 103 
A 6 VAL A 128 ? VAL A 131 ? VAL A 127 VAL A 130 
B 1 LYS A 78  ? VAL A 79  ? LYS A 77  VAL A 78  
B 2 GLU A 82  ? PHE A 83  ? GLU A 81  PHE A 82  
C 1 ALA A 118 ? MSE A 123 ? ALA A 117 MSE A 122 
C 2 GLY A 107 ? GLN A 112 ? GLY A 106 GLN A 111 
C 3 ALA A 136 ? ASN A 141 ? ALA A 135 ASN A 140 
D 1 LYS A 171 ? GLU A 176 ? LYS A 170 GLU A 175 
D 2 GLU A 179 ? ASP A 184 ? GLU A 178 ASP A 183 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 26  ? N ARG A 25  O TYR A 53  ? O TYR A 52  
A 2 3 N VAL A 58  ? N VAL A 57  O PHE A 69  ? O PHE A 68  
A 3 4 N ASN A 68  ? N ASN A 67  O TYR A 153 ? O TYR A 152 
A 4 5 O LEU A 150 ? O LEU A 149 N VAL A 101 ? N VAL A 100 
A 5 6 N GLU A 98  ? N GLU A 97  O VAL A 131 ? O VAL A 130 
B 1 2 N VAL A 79  ? N VAL A 78  O GLU A 82  ? O GLU A 81  
C 1 2 O LYS A 119 ? O LYS A 118 N LEU A 111 ? N LEU A 110 
C 2 3 N GLN A 112 ? N GLN A 111 O ALA A 136 ? O ALA A 135 
D 1 2 N ILE A 174 ? N ILE A 173 O LYS A 181 ? O LYS A 180 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    19 
_struct_site.details              'BINDING SITE FOR RESIDUE PA5 A 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 19 TYR A 53  ? TYR A 52  . ? 1_555 ? 
2  AC1 19 THR A 72  ? THR A 71  . ? 1_555 ? 
3  AC1 19 THR A 86  ? THR A 85  . ? 1_555 ? 
4  AC1 19 LYS A 87  ? LYS A 86  . ? 1_555 ? 
5  AC1 19 GLY A 88  ? GLY A 87  . ? 1_555 ? 
6  AC1 19 HIS A 89  ? HIS A 88  . ? 1_555 ? 
7  AC1 19 GLU A 98  ? GLU A 97  . ? 1_555 ? 
8  AC1 19 TYR A 100 ? TYR A 99  . ? 1_555 ? 
9  AC1 19 HIS A 137 ? HIS A 136 . ? 1_555 ? 
10 AC1 19 PHE A 149 ? PHE A 148 . ? 1_555 ? 
11 AC1 19 ALA A 151 ? ALA A 150 . ? 1_555 ? 
12 AC1 19 TYR A 153 ? TYR A 152 . ? 1_555 ? 
13 AC1 19 TYR A 161 ? TYR A 160 . ? 1_555 ? 
14 AC1 19 HOH C .   ? HOH A 302 . ? 1_555 ? 
15 AC1 19 HOH C .   ? HOH A 303 . ? 1_555 ? 
16 AC1 19 HOH C .   ? HOH A 304 . ? 1_555 ? 
17 AC1 19 HOH C .   ? HOH A 305 . ? 1_555 ? 
18 AC1 19 HOH C .   ? HOH A 306 . ? 1_555 ? 
19 AC1 19 HOH C .   ? HOH A 307 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1X82 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1X82 
_atom_sites.fract_transf_matrix[1][1]   0.011833 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.006920 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.023403 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.020215 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
HETATM 1    N  N   . MSE A 1 1   ? -20.804 -2.226 0.930  1.00 50.21  ? 0   MSE A N   1 
HETATM 2    C  CA  . MSE A 1 1   ? -19.661 -1.495 1.552  1.00 47.14  ? 0   MSE A CA  1 
HETATM 3    C  C   . MSE A 1 1   ? -19.986 -0.018 1.751  1.00 32.46  ? 0   MSE A C   1 
HETATM 4    O  O   . MSE A 1 1   ? -20.806 0.556  1.021  1.00 24.34  ? 0   MSE A O   1 
HETATM 5    C  CB  . MSE A 1 1   ? -18.424 -1.616 0.667  1.00 47.25  ? 0   MSE A CB  1 
HETATM 6    C  CG  . MSE A 1 1   ? -18.748 -1.591 -0.825 1.00 114.07 ? 0   MSE A CG  1 
HETATM 7    SE SE  . MSE A 1 1   ? -17.182 -1.594 -1.957 1.00 115.74 ? 0   MSE A SE  1 
HETATM 8    C  CE  . MSE A 1 1   ? -16.175 -0.415 -1.004 1.00 10.73  ? 0   MSE A CE  1 
HETATM 9    N  N   . MSE A 1 2   ? -19.344 0.596  2.744  1.00 33.28  ? 1   MSE A N   1 
HETATM 10   C  CA  . MSE A 1 2   ? -19.483 2.027  2.937  1.00 33.74  ? 1   MSE A CA  1 
HETATM 11   C  C   . MSE A 1 2   ? -18.382 2.707  2.167  1.00 31.84  ? 1   MSE A C   1 
HETATM 12   O  O   . MSE A 1 2   ? -17.195 2.386  2.296  1.00 34.18  ? 1   MSE A O   1 
HETATM 13   C  CB  . MSE A 1 2   ? -19.419 2.459  4.399  1.00 44.21  ? 1   MSE A CB  1 
HETATM 14   C  CG  . MSE A 1 2   ? -19.990 3.893  4.638  1.00 20.17  ? 1   MSE A CG  1 
HETATM 15   SE SE  . MSE A 1 2   ? -19.948 4.300  6.556  1.00 57.63  ? 1   MSE A SE  1 
HETATM 16   C  CE  . MSE A 1 2   ? -18.059 4.047  6.820  1.00 70.39  ? 1   MSE A CE  1 
ATOM   17   N  N   . TYR A 1 3   ? -18.815 3.625  1.326  1.00 26.41  ? 2   TYR A N   1 
ATOM   18   C  CA  . TYR A 1 3   ? -17.933 4.587  0.711  1.00 25.65  ? 2   TYR A CA  1 
ATOM   19   C  C   . TYR A 1 3   ? -17.808 5.722  1.708  1.00 23.53  ? 2   TYR A C   1 
ATOM   20   O  O   . TYR A 1 3   ? -18.808 6.321  2.115  1.00 24.57  ? 2   TYR A O   1 
ATOM   21   C  CB  . TYR A 1 3   ? -18.545 5.041  -0.604 1.00 21.54  ? 2   TYR A CB  1 
ATOM   22   C  CG  . TYR A 1 3   ? -18.727 3.900  -1.574 1.00 20.18  ? 2   TYR A CG  1 
ATOM   23   C  CD1 . TYR A 1 3   ? -19.990 3.448  -1.933 1.00 27.61  ? 2   TYR A CD1 1 
ATOM   24   C  CD2 . TYR A 1 3   ? -17.626 3.247  -2.124 1.00 24.60  ? 2   TYR A CD2 1 
ATOM   25   C  CE1 . TYR A 1 3   ? -20.150 2.391  -2.822 1.00 28.92  ? 2   TYR A CE1 1 
ATOM   26   C  CE2 . TYR A 1 3   ? -17.781 2.192  -3.024 1.00 25.90  ? 2   TYR A CE2 1 
ATOM   27   C  CZ  . TYR A 1 3   ? -19.045 1.772  -3.366 1.00 26.07  ? 2   TYR A CZ  1 
ATOM   28   O  OH  . TYR A 1 3   ? -19.180 0.732  -4.255 1.00 35.70  ? 2   TYR A OH  1 
ATOM   29   N  N   . LYS A 1 4   ? -16.590 5.974  2.175  1.00 18.11  ? 3   LYS A N   1 
ATOM   30   C  CA  . LYS A 1 4   ? -16.334 7.051  3.115  1.00 20.44  ? 3   LYS A CA  1 
ATOM   31   C  C   . LYS A 1 4   ? -16.710 8.397  2.507  1.00 18.53  ? 3   LYS A C   1 
ATOM   32   O  O   . LYS A 1 4   ? -16.656 8.591  1.302  1.00 16.56  ? 3   LYS A O   1 
ATOM   33   C  CB  . LYS A 1 4   ? -14.857 7.055  3.553  1.00 18.34  ? 3   LYS A CB  1 
ATOM   34   C  CG  . LYS A 1 4   ? -14.450 5.806  4.338  1.00 23.56  ? 3   LYS A CG  1 
ATOM   35   C  CD  . LYS A 1 4   ? -12.935 5.563  4.308  1.00 39.47  ? 3   LYS A CD  1 
ATOM   36   C  CE  . LYS A 1 4   ? -12.174 6.683  4.962  1.00 38.96  ? 3   LYS A CE  1 
ATOM   37   N  NZ  . LYS A 1 4   ? -10.780 6.297  5.308  1.00 18.13  ? 3   LYS A NZ  1 
ATOM   38   N  N   . GLU A 1 5   ? -17.135 9.316  3.358  1.00 20.92  ? 4   GLU A N   1 
ATOM   39   C  CA  . GLU A 1 5   ? -17.576 10.627 2.910  1.00 20.18  ? 4   GLU A CA  1 
ATOM   40   C  C   . GLU A 1 5   ? -16.373 11.507 2.537  1.00 17.03  ? 4   GLU A C   1 
ATOM   41   O  O   . GLU A 1 5   ? -15.501 11.739 3.371  1.00 20.51  ? 4   GLU A O   1 
ATOM   42   C  CB  . GLU A 1 5   ? -18.401 11.302 4.015  1.00 32.01  ? 4   GLU A CB  1 
ATOM   43   C  CG  . GLU A 1 5   ? -19.168 12.542 3.574  1.00 78.96  ? 4   GLU A CG  1 
ATOM   44   C  CD  . GLU A 1 5   ? -20.499 12.234 2.906  1.00 59.85  ? 4   GLU A CD  1 
ATOM   45   O  OE1 . GLU A 1 5   ? -20.735 11.069 2.507  1.00 49.52  ? 4   GLU A OE1 1 
ATOM   46   O  OE2 . GLU A 1 5   ? -21.314 13.172 2.774  1.00 70.25  ? 4   GLU A OE2 1 
ATOM   47   N  N   . PRO A 1 6   ? -16.319 12.000 1.290  1.00 16.96  ? 5   PRO A N   1 
ATOM   48   C  CA  . PRO A 1 6   ? -15.349 13.049 0.955  1.00 17.45  ? 5   PRO A CA  1 
ATOM   49   C  C   . PRO A 1 6   ? -15.609 14.315 1.761  1.00 20.93  ? 5   PRO A C   1 
ATOM   50   O  O   . PRO A 1 6   ? -16.750 14.585 2.120  1.00 21.55  ? 5   PRO A O   1 
ATOM   51   C  CB  . PRO A 1 6   ? -15.613 13.329 -0.531 1.00 17.96  ? 5   PRO A CB  1 
ATOM   52   C  CG  . PRO A 1 6   ? -16.308 12.140 -1.030 1.00 17.33  ? 5   PRO A CG  1 
ATOM   53   C  CD  . PRO A 1 6   ? -17.146 11.636 0.129  1.00 18.48  ? 5   PRO A CD  1 
ATOM   54   N  N   . PHE A 1 7   ? -14.569 15.089 2.029  1.00 18.51  ? 6   PHE A N   1 
ATOM   55   C  CA  . PHE A 1 7   ? -14.736 16.361 2.710  1.00 19.04  ? 6   PHE A CA  1 
ATOM   56   C  C   . PHE A 1 7   ? -13.640 17.348 2.354  1.00 20.06  ? 6   PHE A C   1 
ATOM   57   O  O   . PHE A 1 7   ? -12.568 16.956 1.908  1.00 20.18  ? 6   PHE A O   1 
ATOM   58   C  CB  . PHE A 1 7   ? -14.775 16.150 4.226  1.00 20.71  ? 6   PHE A CB  1 
ATOM   59   C  CG  . PHE A 1 7   ? -13.505 15.572 4.804  1.00 16.79  ? 6   PHE A CG  1 
ATOM   60   C  CD1 . PHE A 1 7   ? -13.397 14.212 5.050  1.00 19.02  ? 6   PHE A CD1 1 
ATOM   61   C  CD2 . PHE A 1 7   ? -12.432 16.393 5.113  1.00 21.91  ? 6   PHE A CD2 1 
ATOM   62   C  CE1 . PHE A 1 7   ? -12.239 13.675 5.578  1.00 25.11  ? 6   PHE A CE1 1 
ATOM   63   C  CE2 . PHE A 1 7   ? -11.271 15.850 5.649  1.00 18.67  ? 6   PHE A CE2 1 
ATOM   64   C  CZ  . PHE A 1 7   ? -11.183 14.494 5.883  1.00 21.31  ? 6   PHE A CZ  1 
ATOM   65   N  N   . GLY A 1 8   ? -13.925 18.626 2.567  1.00 21.35  ? 7   GLY A N   1 
ATOM   66   C  CA  . GLY A 1 8   ? -12.933 19.679 2.529  1.00 20.31  ? 7   GLY A CA  1 
ATOM   67   C  C   . GLY A 1 8   ? -12.790 20.296 3.907  1.00 25.04  ? 7   GLY A C   1 
ATOM   68   O  O   . GLY A 1 8   ? -13.749 20.354 4.683  1.00 21.93  ? 7   GLY A O   1 
ATOM   69   N  N   . VAL A 1 9   ? -11.581 20.719 4.235  1.00 18.46  ? 8   VAL A N   1 
ATOM   70   C  CA  . VAL A 1 9   ? -11.309 21.464 5.466  1.00 22.73  ? 8   VAL A CA  1 
ATOM   71   C  C   . VAL A 1 9   ? -10.486 22.701 5.141  1.00 22.25  ? 8   VAL A C   1 
ATOM   72   O  O   . VAL A 1 9   ? -9.587  22.658 4.310  1.00 21.92  ? 8   VAL A O   1 
ATOM   73   C  CB  . VAL A 1 9   ? -10.529 20.644 6.533  1.00 27.98  ? 8   VAL A CB  1 
ATOM   74   C  CG1 . VAL A 1 9   ? -11.370 19.533 7.073  1.00 35.17  ? 8   VAL A CG1 1 
ATOM   75   C  CG2 . VAL A 1 9   ? -9.191  20.109 5.989  1.00 24.09  ? 8   VAL A CG2 1 
ATOM   76   N  N   . LYS A 1 10  ? -10.764 23.796 5.829  1.00 20.49  ? 9   LYS A N   1 
ATOM   77   C  CA  . LYS A 1 10  ? -9.980  25.016 5.695  1.00 25.72  ? 9   LYS A CA  1 
ATOM   78   C  C   . LYS A 1 10  ? -8.679  24.953 6.490  1.00 25.57  ? 9   LYS A C   1 
ATOM   79   O  O   . LYS A 1 10  ? -8.679  24.698 7.700  1.00 26.83  ? 9   LYS A O   1 
ATOM   80   C  CB  . LYS A 1 10  ? -10.790 26.224 6.169  1.00 29.25  ? 9   LYS A CB  1 
ATOM   81   C  CG  . LYS A 1 10  ? -12.003 26.529 5.299  1.00 41.43  ? 9   LYS A CG  1 
ATOM   82   C  CD  . LYS A 1 10  ? -12.788 27.733 5.824  1.00 55.36  ? 9   LYS A CD  1 
ATOM   83   C  CE  . LYS A 1 10  ? -12.435 29.015 5.075  1.00 119.86 ? 9   LYS A CE  1 
ATOM   84   N  NZ  . LYS A 1 10  ? -12.618 30.227 5.921  1.00 100.13 ? 9   LYS A NZ  1 
ATOM   85   N  N   . VAL A 1 11  ? -7.571  25.183 5.796  1.00 21.32  ? 10  VAL A N   1 
ATOM   86   C  CA  . VAL A 1 11  ? -6.271  25.314 6.433  1.00 20.14  ? 10  VAL A CA  1 
ATOM   87   C  C   . VAL A 1 11  ? -5.838  26.757 6.268  1.00 25.41  ? 10  VAL A C   1 
ATOM   88   O  O   . VAL A 1 11  ? -5.815  27.283 5.151  1.00 27.08  ? 10  VAL A O   1 
ATOM   89   C  CB  . VAL A 1 11  ? -5.214  24.388 5.809  1.00 23.92  ? 10  VAL A CB  1 
ATOM   90   C  CG1 . VAL A 1 11  ? -3.867  24.573 6.521  1.00 26.66  ? 10  VAL A CG1 1 
ATOM   91   C  CG2 . VAL A 1 11  ? -5.689  22.936 5.858  1.00 24.34  ? 10  VAL A CG2 1 
ATOM   92   N  N   . ASP A 1 12  ? -5.515  27.390 7.396  1.00 24.17  ? 11  ASP A N   1 
ATOM   93   C  CA  . ASP A 1 12  ? -5.047  28.767 7.432  1.00 28.15  ? 11  ASP A CA  1 
ATOM   94   C  C   . ASP A 1 12  ? -3.536  28.763 7.218  1.00 23.24  ? 11  ASP A C   1 
ATOM   95   O  O   . ASP A 1 12  ? -2.790  28.327 8.094  1.00 23.88  ? 11  ASP A O   1 
ATOM   96   C  CB  . ASP A 1 12  ? -5.409  29.376 8.795  1.00 29.23  ? 11  ASP A CB  1 
ATOM   97   C  CG  . ASP A 1 12  ? -5.212  30.874 8.846  1.00 35.32  ? 11  ASP A CG  1 
ATOM   98   O  OD1 . ASP A 1 12  ? -4.391  31.409 8.070  1.00 32.21  ? 11  ASP A OD1 1 
ATOM   99   O  OD2 . ASP A 1 12  ? -5.843  31.608 9.642  1.00 32.68  ? 11  ASP A OD2 1 
ATOM   100  N  N   . PHE A 1 13  ? -3.078  29.227 6.056  1.00 23.31  ? 12  PHE A N   1 
ATOM   101  C  CA  . PHE A 1 13  ? -1.645  29.177 5.733  1.00 24.17  ? 12  PHE A CA  1 
ATOM   102  C  C   . PHE A 1 13  ? -0.813  30.127 6.604  1.00 29.46  ? 12  PHE A C   1 
ATOM   103  O  O   . PHE A 1 13  ? 0.405   29.991 6.662  1.00 29.32  ? 12  PHE A O   1 
ATOM   104  C  CB  . PHE A 1 13  ? -1.383  29.469 4.244  1.00 24.38  ? 12  PHE A CB  1 
ATOM   105  C  CG  . PHE A 1 13  ? -1.748  28.333 3.293  1.00 22.53  ? 12  PHE A CG  1 
ATOM   106  C  CD1 . PHE A 1 13  ? -2.372  27.169 3.733  1.00 23.40  ? 12  PHE A CD1 1 
ATOM   107  C  CD2 . PHE A 1 13  ? -1.469  28.457 1.935  1.00 29.79  ? 12  PHE A CD2 1 
ATOM   108  C  CE1 . PHE A 1 13  ? -2.708  26.158 2.838  1.00 24.11  ? 12  PHE A CE1 1 
ATOM   109  C  CE2 . PHE A 1 13  ? -1.798  27.441 1.038  1.00 27.17  ? 12  PHE A CE2 1 
ATOM   110  C  CZ  . PHE A 1 13  ? -2.419  26.294 1.493  1.00 26.13  ? 12  PHE A CZ  1 
ATOM   111  N  N   . GLU A 1 14  ? -1.468  31.074 7.280  1.00 27.29  ? 13  GLU A N   1 
ATOM   112  C  CA  . GLU A 1 14  ? -0.786  31.996 8.190  1.00 29.03  ? 13  GLU A CA  1 
ATOM   113  C  C   . GLU A 1 14  ? -0.572  31.450 9.602  1.00 24.23  ? 13  GLU A C   1 
ATOM   114  O  O   . GLU A 1 14  ? 0.370   31.857 10.278 1.00 32.22  ? 13  GLU A O   1 
ATOM   115  C  CB  . GLU A 1 14  ? -1.562  33.316 8.290  1.00 36.92  ? 13  GLU A CB  1 
ATOM   116  C  CG  . GLU A 1 14  ? -1.766  34.028 6.962  1.00 31.42  ? 13  GLU A CG  1 
ATOM   117  C  CD  . GLU A 1 14  ? -0.460  34.384 6.278  1.00 53.91  ? 13  GLU A CD  1 
ATOM   118  O  OE1 . GLU A 1 14  ? 0.336   35.135 6.876  1.00 42.05  ? 13  GLU A OE1 1 
ATOM   119  O  OE2 . GLU A 1 14  ? -0.229  33.909 5.146  1.00 53.18  ? 13  GLU A OE2 1 
ATOM   120  N  N   . THR A 1 15  ? -1.463  30.578 10.068 1.00 25.69  ? 14  THR A N   1 
ATOM   121  C  CA  . THR A 1 15  ? -1.379  30.022 11.425 1.00 25.19  ? 14  THR A CA  1 
ATOM   122  C  C   . THR A 1 15  ? -1.120  28.513 11.473 1.00 26.35  ? 14  THR A C   1 
ATOM   123  O  O   . THR A 1 15  ? -0.774  27.981 12.530 1.00 26.43  ? 14  THR A O   1 
ATOM   124  C  CB  . THR A 1 15  ? -2.682  30.285 12.191 1.00 26.57  ? 14  THR A CB  1 
ATOM   125  O  OG1 . THR A 1 15  ? -3.740  29.512 11.616 1.00 22.34  ? 14  THR A OG1 1 
ATOM   126  C  CG2 . THR A 1 15  ? -3.147  31.744 12.044 1.00 33.97  ? 14  THR A CG2 1 
ATOM   127  N  N   . GLY A 1 16  ? -1.320  27.833 10.346 1.00 26.93  ? 15  GLY A N   1 
ATOM   128  C  CA  . GLY A 1 16  ? -1.264  26.380 10.274 1.00 24.13  ? 15  GLY A CA  1 
ATOM   129  C  C   . GLY A 1 16  ? -2.414  25.629 10.932 1.00 26.09  ? 15  GLY A C   1 
ATOM   130  O  O   . GLY A 1 16  ? -2.393  24.401 11.006 1.00 26.50  ? 15  GLY A O   1 
ATOM   131  N  N   . ILE A 1 17  ? -3.438  26.337 11.400 1.00 22.13  ? 16  ILE A N   1 
ATOM   132  C  CA  . ILE A 1 17  ? -4.512  25.683 12.127 1.00 19.68  ? 16  ILE A CA  1 
ATOM   133  C  C   . ILE A 1 17  ? -5.460  25.043 11.113 1.00 20.03  ? 16  ILE A C   1 
ATOM   134  O  O   . ILE A 1 17  ? -5.888  25.695 10.153 1.00 25.09  ? 16  ILE A O   1 
ATOM   135  C  CB  . ILE A 1 17  ? -5.249  26.704 13.047 1.00 23.27  ? 16  ILE A CB  1 
ATOM   136  C  CG1 . ILE A 1 17  ? -4.293  27.239 14.121 1.00 24.25  ? 16  ILE A CG1 1 
ATOM   137  C  CG2 . ILE A 1 17  ? -6.465  26.058 13.686 1.00 28.67  ? 16  ILE A CG2 1 
ATOM   138  C  CD1 . ILE A 1 17  ? -4.771  28.507 14.829 1.00 29.98  ? 16  ILE A CD1 1 
ATOM   139  N  N   . ILE A 1 18  ? -5.754  23.763 11.318 1.00 21.32  ? 17  ILE A N   1 
ATOM   140  C  CA  . ILE A 1 18  ? -6.762  23.051 10.548 1.00 23.71  ? 17  ILE A CA  1 
ATOM   141  C  C   . ILE A 1 18  ? -8.043  23.109 11.362 1.00 23.94  ? 17  ILE A C   1 
ATOM   142  O  O   . ILE A 1 18  ? -8.090  22.609 12.484 1.00 27.21  ? 17  ILE A O   1 
ATOM   143  C  CB  . ILE A 1 18  ? -6.357  21.581 10.303 1.00 26.19  ? 17  ILE A CB  1 
ATOM   144  C  CG1 . ILE A 1 18  ? -5.034  21.513 9.530  1.00 22.24  ? 17  ILE A CG1 1 
ATOM   145  C  CG2 . ILE A 1 18  ? -7.469  20.828 9.542  1.00 26.43  ? 17  ILE A CG2 1 
ATOM   146  C  CD1 . ILE A 1 18  ? -4.532  20.114 9.288  1.00 21.57  ? 17  ILE A CD1 1 
ATOM   147  N  N   . GLU A 1 19  ? -9.078  23.710 10.779 1.00 34.86  ? 18  GLU A N   1 
ATOM   148  C  CA  . GLU A 1 19  ? -10.378 23.852 11.437 1.00 35.84  ? 18  GLU A CA  1 
ATOM   149  C  C   . GLU A 1 19  ? -10.909 22.501 11.907 1.00 34.73  ? 18  GLU A C   1 
ATOM   150  O  O   . GLU A 1 19  ? -10.911 21.532 11.148 1.00 31.33  ? 18  GLU A O   1 
ATOM   151  C  CB  . GLU A 1 19  ? -11.392 24.489 10.481 1.00 39.74  ? 18  GLU A CB  1 
ATOM   152  C  CG  . GLU A 1 19  ? -11.077 25.926 10.088 1.00 53.96  ? 18  GLU A CG  1 
ATOM   153  C  CD  . GLU A 1 19  ? -12.290 26.681 9.567  1.00 121.04 ? 18  GLU A CD  1 
ATOM   154  O  OE1 . GLU A 1 19  ? -13.279 26.039 9.140  1.00 37.64  ? 18  GLU A OE1 1 
ATOM   155  O  OE2 . GLU A 1 19  ? -12.251 27.927 9.580  1.00 50.12  ? 18  GLU A OE2 1 
ATOM   156  N  N   . GLY A 1 20  ? -11.331 22.447 13.171 1.00 32.40  ? 19  GLY A N   1 
ATOM   157  C  CA  . GLY A 1 20  ? -11.918 21.252 13.759 1.00 36.54  ? 19  GLY A CA  1 
ATOM   158  C  C   . GLY A 1 20  ? -10.996 20.084 14.094 1.00 36.01  ? 19  GLY A C   1 
ATOM   159  O  O   . GLY A 1 20  ? -11.486 19.029 14.496 1.00 39.69  ? 19  GLY A O   1 
ATOM   160  N  N   . ALA A 1 21  ? -9.679  20.265 13.980 1.00 27.50  ? 20  ALA A N   1 
ATOM   161  C  CA  . ALA A 1 21  ? -8.733  19.129 13.990 1.00 34.40  ? 20  ALA A CA  1 
ATOM   162  C  C   . ALA A 1 21  ? -8.225  18.672 15.365 1.00 56.54  ? 20  ALA A C   1 
ATOM   163  O  O   . ALA A 1 21  ? -7.962  17.481 15.556 1.00 61.30  ? 20  ALA A O   1 
ATOM   164  C  CB  . ALA A 1 21  ? -7.549  19.435 13.093 1.00 31.49  ? 20  ALA A CB  1 
ATOM   165  N  N   . LYS A 1 22  ? -8.056  19.616 16.293 1.00 44.54  ? 21  LYS A N   1 
ATOM   166  C  CA  . LYS A 1 22  ? -7.603  19.338 17.672 1.00 77.23  ? 21  LYS A CA  1 
ATOM   167  C  C   . LYS A 1 22  ? -6.071  19.254 17.822 1.00 40.52  ? 21  LYS A C   1 
ATOM   168  O  O   . LYS A 1 22  ? -5.428  18.298 17.379 1.00 36.23  ? 21  LYS A O   1 
ATOM   169  C  CB  . LYS A 1 22  ? -8.265  18.080 18.260 1.00 82.61  ? 21  LYS A CB  1 
ATOM   170  C  CG  . LYS A 1 22  ? -8.367  18.095 19.782 1.00 87.90  ? 21  LYS A CG  1 
ATOM   171  C  CD  . LYS A 1 22  ? -8.262  16.694 20.373 1.00 129.89 ? 21  LYS A CD  1 
ATOM   172  C  CE  . LYS A 1 22  ? -8.837  16.634 21.781 1.00 108.67 ? 21  LYS A CE  1 
ATOM   173  N  NZ  . LYS A 1 22  ? -8.263  17.684 22.668 1.00 86.23  ? 21  LYS A NZ  1 
ATOM   174  N  N   . LYS A 1 23  ? -5.520  20.264 18.486 1.00 30.17  ? 22  LYS A N   1 
ATOM   175  C  CA  . LYS A 1 23  ? -4.081  20.447 18.643 1.00 29.84  ? 22  LYS A CA  1 
ATOM   176  C  C   . LYS A 1 23  ? -3.442  19.376 19.543 1.00 47.40  ? 22  LYS A C   1 
ATOM   177  O  O   . LYS A 1 23  ? -3.968  19.063 20.612 1.00 36.00  ? 22  LYS A O   1 
ATOM   178  C  CB  . LYS A 1 23  ? -3.841  21.847 19.229 1.00 33.65  ? 22  LYS A CB  1 
ATOM   179  C  CG  . LYS A 1 23  ? -2.409  22.201 19.553 1.00 67.25  ? 22  LYS A CG  1 
ATOM   180  C  CD  . LYS A 1 23  ? -2.217  23.711 19.728 1.00 56.23  ? 22  LYS A CD  1 
ATOM   181  C  CE  . LYS A 1 23  ? -3.295  24.376 20.576 1.00 61.85  ? 22  LYS A CE  1 
ATOM   182  N  NZ  . LYS A 1 23  ? -3.446  23.724 21.906 1.00 49.33  ? 22  LYS A NZ  1 
ATOM   183  N  N   . SER A 1 24  ? -2.325  18.808 19.084 1.00 25.36  ? 23  SER A N   1 
ATOM   184  C  CA  . SER A 1 24  ? -1.407  18.038 19.924 1.00 22.86  ? 23  SER A CA  1 
ATOM   185  C  C   . SER A 1 24  ? -0.192  18.924 20.200 1.00 29.66  ? 23  SER A C   1 
ATOM   186  O  O   . SER A 1 24  ? 0.328   19.559 19.292 1.00 24.28  ? 23  SER A O   1 
ATOM   187  C  CB  . SER A 1 24  ? -0.964  16.753 19.231 1.00 29.57  ? 23  SER A CB  1 
ATOM   188  O  OG  . SER A 1 24  ? 0.024   16.083 20.000 1.00 31.04  ? 23  SER A OG  1 
ATOM   189  N  N   . VAL A 1 25  ? 0.260   18.957 21.450 1.00 25.78  ? 24  VAL A N   1 
ATOM   190  C  CA  . VAL A 1 25  ? 1.307   19.885 21.883 1.00 23.66  ? 24  VAL A CA  1 
ATOM   191  C  C   . VAL A 1 25  ? 2.516   19.114 22.401 1.00 23.84  ? 24  VAL A C   1 
ATOM   192  O  O   . VAL A 1 25  ? 2.385   18.232 23.255 1.00 25.23  ? 24  VAL A O   1 
ATOM   193  C  CB  . VAL A 1 25  ? 0.790   20.847 22.998 1.00 20.88  ? 24  VAL A CB  1 
ATOM   194  C  CG1 . VAL A 1 25  ? 1.864   21.874 23.380 1.00 27.83  ? 24  VAL A CG1 1 
ATOM   195  C  CG2 . VAL A 1 25  ? -0.481  21.547 22.560 1.00 37.59  ? 24  VAL A CG2 1 
ATOM   196  N  N   . ARG A 1 26  ? 3.689   19.434 21.852 1.00 20.04  ? 25  ARG A N   1 
ATOM   197  C  CA  . ARG A 1 26  ? 4.950   18.884 22.327 1.00 20.00  ? 25  ARG A CA  1 
ATOM   198  C  C   . ARG A 1 26  ? 5.741   20.008 22.992 1.00 21.18  ? 25  ARG A C   1 
ATOM   199  O  O   . ARG A 1 26  ? 6.161   20.943 22.330 1.00 18.72  ? 25  ARG A O   1 
ATOM   200  C  CB  . ARG A 1 26  ? 5.754   18.263 21.175 1.00 24.61  ? 25  ARG A CB  1 
ATOM   201  C  CG  . ARG A 1 26  ? 5.240   16.891 20.720 1.00 36.79  ? 25  ARG A CG  1 
ATOM   202  C  CD  . ARG A 1 26  ? 5.522   15.753 21.686 1.00 77.98  ? 25  ARG A CD  1 
ATOM   203  N  NE  . ARG A 1 26  ? 4.570   14.653 21.518 1.00 121.82 ? 25  ARG A NE  1 
ATOM   204  C  CZ  . ARG A 1 26  ? 4.297   13.724 22.436 1.00 143.66 ? 25  ARG A CZ  1 
ATOM   205  N  NH1 . ARG A 1 26  ? 4.903   13.725 23.622 1.00 76.14  ? 25  ARG A NH1 1 
ATOM   206  N  NH2 . ARG A 1 26  ? 3.407   12.776 22.162 1.00 104.56 ? 25  ARG A NH2 1 
ATOM   207  N  N   . ARG A 1 27  ? 5.890   19.936 24.313 1.00 18.26  ? 26  ARG A N   1 
ATOM   208  C  CA  . ARG A 1 27  ? 6.712   20.891 25.057 1.00 18.30  ? 26  ARG A CA  1 
ATOM   209  C  C   . ARG A 1 27  ? 8.142   20.383 25.136 1.00 21.90  ? 26  ARG A C   1 
ATOM   210  O  O   . ARG A 1 27  ? 8.412   19.200 24.929 1.00 18.85  ? 26  ARG A O   1 
ATOM   211  C  CB  . ARG A 1 27  ? 6.185   21.097 26.480 1.00 19.04  ? 26  ARG A CB  1 
ATOM   212  C  CG  . ARG A 1 27  ? 4.706   21.406 26.561 1.00 22.23  ? 26  ARG A CG  1 
ATOM   213  C  CD  . ARG A 1 27  ? 4.283   21.988 27.906 1.00 25.66  ? 26  ARG A CD  1 
ATOM   214  N  NE  . ARG A 1 27  ? 4.693   23.383 28.018 1.00 21.02  ? 26  ARG A NE  1 
ATOM   215  C  CZ  . ARG A 1 27  ? 3.931   24.432 27.709 1.00 26.31  ? 26  ARG A CZ  1 
ATOM   216  N  NH1 . ARG A 1 27  ? 2.683   24.275 27.282 1.00 23.12  ? 26  ARG A NH1 1 
ATOM   217  N  NH2 . ARG A 1 27  ? 4.417   25.660 27.836 1.00 31.07  ? 26  ARG A NH2 1 
ATOM   218  N  N   . LEU A 1 28  ? 9.056   21.279 25.482 1.00 18.08  ? 27  LEU A N   1 
ATOM   219  C  CA  . LEU A 1 28  ? 10.457  20.916 25.629 1.00 20.54  ? 27  LEU A CA  1 
ATOM   220  C  C   . LEU A 1 28  ? 10.657  19.756 26.625 1.00 18.10  ? 27  LEU A C   1 
ATOM   221  O  O   . LEU A 1 28  ? 11.507  18.893 26.406 1.00 18.78  ? 27  LEU A O   1 
ATOM   222  C  CB  . LEU A 1 28  ? 11.291  22.131 26.035 1.00 18.10  ? 27  LEU A CB  1 
ATOM   223  C  CG  . LEU A 1 28  ? 12.809  21.968 25.906 1.00 19.35  ? 27  LEU A CG  1 
ATOM   224  C  CD1 . LEU A 1 28  ? 13.202  21.620 24.490 1.00 18.01  ? 27  LEU A CD1 1 
ATOM   225  C  CD2 . LEU A 1 28  ? 13.517  23.243 26.353 1.00 20.33  ? 27  LEU A CD2 1 
ATOM   226  N  N   . SER A 1 29  ? 9.866   19.715 27.696 1.00 17.19  ? 28  SER A N   1 
ATOM   227  C  CA  . SER A 1 29  ? 9.965   18.648 28.703 1.00 19.37  ? 28  SER A CA  1 
ATOM   228  C  C   . SER A 1 29  ? 9.610   17.252 28.165 1.00 19.19  ? 28  SER A C   1 
ATOM   229  O  O   . SER A 1 29  ? 9.968   16.232 28.773 1.00 25.07  ? 28  SER A O   1 
ATOM   230  C  CB  . SER A 1 29  ? 9.067   18.966 29.912 1.00 19.97  ? 28  SER A CB  1 
ATOM   231  O  OG  . SER A 1 29  ? 7.725   19.217 29.521 1.00 23.94  ? 28  SER A OG  1 
ATOM   232  N  N   . ASP A 1 30  ? 8.900   17.207 27.041 1.00 17.85  ? 29  ASP A N   1 
ATOM   233  C  CA  . ASP A 1 30  ? 8.565   15.953 26.349 1.00 20.30  ? 29  ASP A CA  1 
ATOM   234  C  C   . ASP A 1 30  ? 9.719   15.415 25.508 1.00 23.04  ? 29  ASP A C   1 
ATOM   235  O  O   . ASP A 1 30  ? 9.566   14.373 24.866 1.00 23.46  ? 29  ASP A O   1 
ATOM   236  C  CB  . ASP A 1 30  ? 7.361   16.157 25.411 1.00 17.51  ? 29  ASP A CB  1 
ATOM   237  C  CG  . ASP A 1 30  ? 6.093   16.571 26.147 1.00 20.11  ? 29  ASP A CG  1 
ATOM   238  O  OD1 . ASP A 1 30  ? 5.791   15.947 27.188 1.00 28.30  ? 29  ASP A OD1 1 
ATOM   239  O  OD2 . ASP A 1 30  ? 5.321   17.471 25.739 1.00 23.52  ? 29  ASP A OD2 1 
HETATM 240  N  N   . MSE A 1 31  ? 10.855  16.114 25.502 1.00 17.55  ? 30  MSE A N   1 
HETATM 241  C  CA  . MSE A 1 31  ? 11.977  15.788 24.615 1.00 17.05  ? 30  MSE A CA  1 
HETATM 242  C  C   . MSE A 1 31  ? 13.308  15.578 25.345 1.00 20.90  ? 30  MSE A C   1 
HETATM 243  O  O   . MSE A 1 31  ? 14.366  16.004 24.872 1.00 20.30  ? 30  MSE A O   1 
HETATM 244  C  CB  . MSE A 1 31  ? 12.097  16.876 23.549 1.00 20.99  ? 30  MSE A CB  1 
HETATM 245  C  CG  . MSE A 1 31  ? 10.812  17.079 22.783 1.00 20.32  ? 30  MSE A CG  1 
HETATM 246  SE SE  . MSE A 1 31  ? 10.971  18.469 21.396 1.00 22.11  ? 30  MSE A SE  1 
HETATM 247  C  CE  . MSE A 1 31  ? 12.335  17.643 20.289 1.00 15.72  ? 30  MSE A CE  1 
ATOM   248  N  N   . GLU A 1 32  ? 13.260  14.903 26.485 1.00 23.67  ? 31  GLU A N   1 
ATOM   249  C  CA  . GLU A 1 32  ? 14.488  14.535 27.191 1.00 24.37  ? 31  GLU A CA  1 
ATOM   250  C  C   . GLU A 1 32  ? 15.300  13.580 26.324 1.00 19.21  ? 31  GLU A C   1 
ATOM   251  O  O   . GLU A 1 32  ? 14.736  12.684 25.687 1.00 21.64  ? 31  GLU A O   1 
ATOM   252  C  CB  . GLU A 1 32  ? 14.184  13.883 28.539 1.00 25.04  ? 31  GLU A CB  1 
ATOM   253  C  CG  . GLU A 1 32  ? 15.413  13.768 29.427 1.00 27.84  ? 31  GLU A CG  1 
ATOM   254  C  CD  . GLU A 1 32  ? 15.108  13.361 30.860 1.00 31.22  ? 31  GLU A CD  1 
ATOM   255  O  OE1 . GLU A 1 32  ? 13.932  13.080 31.187 1.00 40.48  ? 31  GLU A OE1 1 
ATOM   256  O  OE2 . GLU A 1 32  ? 16.060  13.338 31.669 1.00 44.31  ? 31  GLU A OE2 1 
ATOM   257  N  N   . GLY A 1 33  ? 16.609  13.807 26.278 1.00 21.82  ? 32  GLY A N   1 
ATOM   258  C  CA  . GLY A 1 33  ? 17.532  12.966 25.529 1.00 25.50  ? 32  GLY A CA  1 
ATOM   259  C  C   . GLY A 1 33  ? 17.617  13.248 24.035 1.00 26.10  ? 32  GLY A C   1 
ATOM   260  O  O   . GLY A 1 33  ? 18.145  12.420 23.301 1.00 30.62  ? 32  GLY A O   1 
ATOM   261  N  N   . TYR A 1 34  ? 17.099  14.395 23.588 1.00 21.78  ? 33  TYR A N   1 
ATOM   262  C  CA  . TYR A 1 34  ? 17.037  14.740 22.168 1.00 17.69  ? 33  TYR A CA  1 
ATOM   263  C  C   . TYR A 1 34  ? 18.101  15.744 21.714 1.00 17.71  ? 33  TYR A C   1 
ATOM   264  O  O   . TYR A 1 34  ? 18.606  15.655 20.594 1.00 21.87  ? 33  TYR A O   1 
ATOM   265  C  CB  . TYR A 1 34  ? 15.623  15.251 21.803 1.00 17.72  ? 33  TYR A CB  1 
ATOM   266  C  CG  . TYR A 1 34  ? 14.653  14.133 21.482 1.00 19.31  ? 33  TYR A CG  1 
ATOM   267  C  CD1 . TYR A 1 34  ? 13.895  13.527 22.482 1.00 18.03  ? 33  TYR A CD1 1 
ATOM   268  C  CD2 . TYR A 1 34  ? 14.509  13.659 20.181 1.00 18.51  ? 33  TYR A CD2 1 
ATOM   269  C  CE1 . TYR A 1 34  ? 13.017  12.487 22.196 1.00 22.29  ? 33  TYR A CE1 1 
ATOM   270  C  CE2 . TYR A 1 34  ? 13.621  12.618 19.883 1.00 19.33  ? 33  TYR A CE2 1 
ATOM   271  C  CZ  . TYR A 1 34  ? 12.882  12.034 20.892 1.00 21.84  ? 33  TYR A CZ  1 
ATOM   272  O  OH  . TYR A 1 34  ? 12.003  11.009 20.608 1.00 22.30  ? 33  TYR A OH  1 
ATOM   273  N  N   . PHE A 1 35  ? 18.435  16.712 22.572 1.00 20.37  ? 34  PHE A N   1 
ATOM   274  C  CA  . PHE A 1 35  ? 19.376  17.777 22.225 1.00 19.41  ? 34  PHE A CA  1 
ATOM   275  C  C   . PHE A 1 35  ? 20.799  17.459 22.715 1.00 17.55  ? 34  PHE A C   1 
ATOM   276  O  O   . PHE A 1 35  ? 20.977  16.758 23.708 1.00 24.03  ? 34  PHE A O   1 
ATOM   277  C  CB  . PHE A 1 35  ? 18.868  19.116 22.783 1.00 21.01  ? 34  PHE A CB  1 
ATOM   278  C  CG  . PHE A 1 35  ? 17.574  19.585 22.143 1.00 16.96  ? 34  PHE A CG  1 
ATOM   279  C  CD1 . PHE A 1 35  ? 16.337  19.196 22.654 1.00 18.77  ? 34  PHE A CD1 1 
ATOM   280  C  CD2 . PHE A 1 35  ? 17.598  20.389 21.009 1.00 18.68  ? 34  PHE A CD2 1 
ATOM   281  C  CE1 . PHE A 1 35  ? 15.154  19.607 22.051 1.00 19.93  ? 34  PHE A CE1 1 
ATOM   282  C  CE2 . PHE A 1 35  ? 16.411  20.814 20.410 1.00 19.45  ? 34  PHE A CE2 1 
ATOM   283  C  CZ  . PHE A 1 35  ? 15.195  20.411 20.927 1.00 18.95  ? 34  PHE A CZ  1 
ATOM   284  N  N   . VAL A 1 36  ? 21.800  17.968 22.004 1.00 21.69  ? 35  VAL A N   1 
ATOM   285  C  CA  . VAL A 1 36  ? 23.209  17.711 22.318 1.00 23.21  ? 35  VAL A CA  1 
ATOM   286  C  C   . VAL A 1 36  ? 23.634  18.283 23.676 1.00 24.69  ? 35  VAL A C   1 
ATOM   287  O  O   . VAL A 1 36  ? 24.353  17.628 24.435 1.00 23.74  ? 35  VAL A O   1 
ATOM   288  C  CB  . VAL A 1 36  ? 24.126  18.273 21.199 1.00 25.37  ? 35  VAL A CB  1 
ATOM   289  C  CG1 . VAL A 1 36  ? 25.606  18.274 21.611 1.00 39.43  ? 35  VAL A CG1 1 
ATOM   290  C  CG2 . VAL A 1 36  ? 23.928  17.481 19.900 1.00 38.97  ? 35  VAL A CG2 1 
ATOM   291  N  N   . ASP A 1 37  ? 23.156  19.483 23.991 1.00 21.29  ? 36  ASP A N   1 
ATOM   292  C  CA  . ASP A 1 37  ? 23.532  20.188 25.221 1.00 22.53  ? 36  ASP A CA  1 
ATOM   293  C  C   . ASP A 1 37  ? 22.472  19.877 26.272 1.00 19.07  ? 36  ASP A C   1 
ATOM   294  O  O   . ASP A 1 37  ? 21.479  20.590 26.401 1.00 22.85  ? 36  ASP A O   1 
ATOM   295  C  CB  . ASP A 1 37  ? 23.652  21.692 24.940 1.00 19.74  ? 36  ASP A CB  1 
ATOM   296  C  CG  . ASP A 1 37  ? 24.265  22.481 26.101 1.00 20.99  ? 36  ASP A CG  1 
ATOM   297  O  OD1 . ASP A 1 37  ? 24.245  21.997 27.243 1.00 23.04  ? 36  ASP A OD1 1 
ATOM   298  O  OD2 . ASP A 1 37  ? 24.796  23.604 25.941 1.00 29.89  ? 36  ASP A OD2 1 
ATOM   299  N  N   . GLU A 1 38  ? 22.676  18.796 27.020 1.00 19.62  ? 37  GLU A N   1 
ATOM   300  C  CA  . GLU A 1 38  ? 21.679  18.316 27.967 1.00 17.46  ? 37  GLU A CA  1 
ATOM   301  C  C   . GLU A 1 38  ? 21.434  19.286 29.110 1.00 25.72  ? 37  GLU A C   1 
ATOM   302  O  O   . GLU A 1 38  ? 20.328  19.341 29.641 1.00 21.44  ? 37  GLU A O   1 
ATOM   303  C  CB  . GLU A 1 38  ? 22.098  16.958 28.549 1.00 27.98  ? 37  GLU A CB  1 
ATOM   304  C  CG  . GLU A 1 38  ? 21.052  16.317 29.454 1.00 40.66  ? 37  GLU A CG  1 
ATOM   305  C  CD  . GLU A 1 38  ? 21.298  16.563 30.936 1.00 171.95 ? 37  GLU A CD  1 
ATOM   306  O  OE1 . GLU A 1 38  ? 20.383  17.079 31.617 1.00 78.03  ? 37  GLU A OE1 1 
ATOM   307  O  OE2 . GLU A 1 38  ? 22.403  16.240 31.424 1.00 153.25 ? 37  GLU A OE2 1 
ATOM   308  N  N   . ARG A 1 39  ? 22.460  20.030 29.503 1.00 22.31  ? 38  ARG A N   1 
ATOM   309  C  CA  . ARG A 1 39  ? 22.323  20.996 30.587 1.00 21.28  ? 38  ARG A CA  1 
ATOM   310  C  C   . ARG A 1 39  ? 21.504  22.202 30.122 1.00 20.32  ? 38  ARG A C   1 
ATOM   311  O  O   . ARG A 1 39  ? 20.696  22.737 30.887 1.00 22.15  ? 38  ARG A O   1 
ATOM   312  C  CB  . ARG A 1 39  ? 23.697  21.433 31.108 1.00 23.76  ? 38  ARG A CB  1 
ATOM   313  C  CG  . ARG A 1 39  ? 24.421  20.341 31.895 1.00 29.02  ? 38  ARG A CG  1 
ATOM   314  C  CD  . ARG A 1 39  ? 25.728  20.797 32.548 1.00 24.47  ? 38  ARG A CD  1 
ATOM   315  N  NE  . ARG A 1 39  ? 25.583  22.120 33.144 1.00 25.44  ? 38  ARG A NE  1 
ATOM   316  C  CZ  . ARG A 1 39  ? 24.983  22.363 34.304 1.00 21.49  ? 38  ARG A CZ  1 
ATOM   317  N  NH1 . ARG A 1 39  ? 24.518  21.374 35.058 1.00 24.51  ? 38  ARG A NH1 1 
ATOM   318  N  NH2 . ARG A 1 39  ? 24.875  23.612 34.722 1.00 23.85  ? 38  ARG A NH2 1 
ATOM   319  N  N   . ALA A 1 40  ? 21.692  22.615 28.872 1.00 20.29  ? 39  ALA A N   1 
ATOM   320  C  CA  . ALA A 1 40  ? 20.915  23.716 28.288 1.00 16.59  ? 39  ALA A CA  1 
ATOM   321  C  C   . ALA A 1 40  ? 19.448  23.308 28.205 1.00 20.55  ? 39  ALA A C   1 
ATOM   322  O  O   . ALA A 1 40  ? 18.538  24.105 28.496 1.00 19.41  ? 39  ALA A O   1 
ATOM   323  C  CB  . ALA A 1 40  ? 21.451  24.093 26.907 1.00 18.01  ? 39  ALA A CB  1 
ATOM   324  N  N   . TRP A 1 41  ? 19.209  22.056 27.825 1.00 18.14  ? 40  TRP A N   1 
ATOM   325  C  CA  . TRP A 1 41  ? 17.849  21.511 27.829 1.00 17.40  ? 40  TRP A CA  1 
ATOM   326  C  C   . TRP A 1 41  ? 17.211  21.610 29.208 1.00 22.06  ? 40  TRP A C   1 
ATOM   327  O  O   . TRP A 1 41  ? 16.090  22.121 29.348 1.00 18.08  ? 40  TRP A O   1 
ATOM   328  C  CB  . TRP A 1 41  ? 17.843  20.053 27.344 1.00 18.49  ? 40  TRP A CB  1 
ATOM   329  C  CG  . TRP A 1 41  ? 16.478  19.409 27.452 1.00 15.67  ? 40  TRP A CG  1 
ATOM   330  C  CD1 . TRP A 1 41  ? 15.463  19.485 26.537 1.00 18.72  ? 40  TRP A CD1 1 
ATOM   331  C  CD2 . TRP A 1 41  ? 15.979  18.612 28.537 1.00 19.61  ? 40  TRP A CD2 1 
ATOM   332  N  NE1 . TRP A 1 41  ? 14.371  18.783 26.988 1.00 20.05  ? 40  TRP A NE1 1 
ATOM   333  C  CE2 . TRP A 1 41  ? 14.661  18.235 28.210 1.00 19.15  ? 40  TRP A CE2 1 
ATOM   334  C  CE3 . TRP A 1 41  ? 16.518  18.171 29.758 1.00 23.62  ? 40  TRP A CE3 1 
ATOM   335  C  CZ2 . TRP A 1 41  ? 13.873  17.447 29.054 1.00 21.31  ? 40  TRP A CZ2 1 
ATOM   336  C  CZ3 . TRP A 1 41  ? 15.737  17.385 30.594 1.00 21.28  ? 40  TRP A CZ3 1 
ATOM   337  C  CH2 . TRP A 1 41  ? 14.429  17.034 30.236 1.00 22.06  ? 40  TRP A CH2 1 
ATOM   338  N  N   . LYS A 1 42  ? 17.919  21.141 30.233 1.00 20.05  ? 41  LYS A N   1 
ATOM   339  C  CA  . LYS A 1 42  ? 17.356  21.117 31.576 1.00 17.47  ? 41  LYS A CA  1 
ATOM   340  C  C   . LYS A 1 42  ? 17.084  22.526 32.085 1.00 19.89  ? 41  LYS A C   1 
ATOM   341  O  O   . LYS A 1 42  ? 16.061  22.757 32.717 1.00 20.07  ? 41  LYS A O   1 
ATOM   342  C  CB  . LYS A 1 42  ? 18.269  20.356 32.544 1.00 22.76  ? 41  LYS A CB  1 
ATOM   343  C  CG  . LYS A 1 42  ? 17.654  20.106 33.930 1.00 60.24  ? 41  LYS A CG  1 
ATOM   344  C  CD  . LYS A 1 42  ? 17.118  18.685 34.095 1.00 132.37 ? 41  LYS A CD  1 
ATOM   345  C  CE  . LYS A 1 42  ? 18.041  17.836 34.957 1.00 97.90  ? 41  LYS A CE  1 
ATOM   346  N  NZ  . LYS A 1 42  ? 17.686  16.392 34.906 1.00 81.86  ? 41  LYS A NZ  1 
ATOM   347  N  N   . GLU A 1 43  ? 17.979  23.465 31.803 1.00 20.14  ? 42  GLU A N   1 
ATOM   348  C  CA  . GLU A 1 43  ? 17.806  24.827 32.285 1.00 19.71  ? 42  GLU A CA  1 
ATOM   349  C  C   . GLU A 1 43  ? 16.582  25.471 31.632 1.00 19.84  ? 42  GLU A C   1 
ATOM   350  O  O   . GLU A 1 43  ? 15.815  26.144 32.297 1.00 19.00  ? 42  GLU A O   1 
ATOM   351  C  CB  . GLU A 1 43  ? 19.056  25.674 32.026 1.00 20.84  ? 42  GLU A CB  1 
ATOM   352  C  CG  . GLU A 1 43  ? 18.993  27.074 32.620 1.00 33.79  ? 42  GLU A CG  1 
ATOM   353  C  CD  . GLU A 1 43  ? 20.190  27.929 32.242 1.00 36.68  ? 42  GLU A CD  1 
ATOM   354  O  OE1 . GLU A 1 43  ? 20.019  28.924 31.509 1.00 35.68  ? 42  GLU A OE1 1 
ATOM   355  O  OE2 . GLU A 1 43  ? 21.310  27.607 32.684 1.00 44.50  ? 42  GLU A OE2 1 
ATOM   356  N  N   . LEU A 1 44  ? 16.399  25.282 30.331 1.00 19.17  ? 43  LEU A N   1 
ATOM   357  C  CA  . LEU A 1 44  ? 15.269  25.910 29.632 1.00 18.88  ? 43  LEU A CA  1 
ATOM   358  C  C   . LEU A 1 44  ? 13.935  25.295 30.054 1.00 18.53  ? 43  LEU A C   1 
ATOM   359  O  O   . LEU A 1 44  ? 12.921  25.985 30.117 1.00 18.31  ? 43  LEU A O   1 
ATOM   360  C  CB  . LEU A 1 44  ? 15.453  25.831 28.105 1.00 19.80  ? 43  LEU A CB  1 
ATOM   361  C  CG  . LEU A 1 44  ? 14.477  26.618 27.220 1.00 20.41  ? 43  LEU A CG  1 
ATOM   362  C  CD1 . LEU A 1 44  ? 14.370  28.088 27.638 1.00 21.09  ? 43  LEU A CD1 1 
ATOM   363  C  CD2 . LEU A 1 44  ? 14.898  26.504 25.759 1.00 20.35  ? 43  LEU A CD2 1 
ATOM   364  N  N   . VAL A 1 45  ? 13.927  24.005 30.364 1.00 18.28  ? 44  VAL A N   1 
ATOM   365  C  CA  . VAL A 1 45  ? 12.751  23.372 30.941 1.00 15.31  ? 44  VAL A CA  1 
ATOM   366  C  C   . VAL A 1 45  ? 12.410  23.992 32.294 1.00 22.04  ? 44  VAL A C   1 
ATOM   367  O  O   . VAL A 1 45  ? 11.250  24.306 32.548 1.00 18.04  ? 44  VAL A O   1 
ATOM   368  C  CB  . VAL A 1 45  ? 12.932  21.836 31.058 1.00 16.41  ? 44  VAL A CB  1 
ATOM   369  C  CG1 . VAL A 1 45  ? 11.848  21.201 31.906 1.00 20.68  ? 44  VAL A CG1 1 
ATOM   370  C  CG2 . VAL A 1 45  ? 12.940  21.188 29.672 1.00 19.00  ? 44  VAL A CG2 1 
ATOM   371  N  N   . GLU A 1 46  ? 13.407  24.153 33.160 1.00 20.43  ? 45  GLU A N   1 
ATOM   372  C  CA  . GLU A 1 46  ? 13.192  24.768 34.485 1.00 20.30  ? 45  GLU A CA  1 
ATOM   373  C  C   . GLU A 1 46  ? 12.667  26.207 34.402 1.00 18.55  ? 45  GLU A C   1 
ATOM   374  O  O   . GLU A 1 46  ? 11.790  26.608 35.162 1.00 18.77  ? 45  GLU A O   1 
ATOM   375  C  CB  . GLU A 1 46  ? 14.496  24.770 35.301 1.00 20.29  ? 45  GLU A CB  1 
ATOM   376  C  CG  . GLU A 1 46  ? 14.937  23.410 35.821 1.00 31.22  ? 45  GLU A CG  1 
ATOM   377  C  CD  . GLU A 1 46  ? 13.856  22.700 36.610 1.00 115.14 ? 45  GLU A CD  1 
ATOM   378  O  OE1 . GLU A 1 46  ? 13.399  23.241 37.640 1.00 32.88  ? 45  GLU A OE1 1 
ATOM   379  O  OE2 . GLU A 1 46  ? 13.459  21.599 36.189 1.00 40.35  ? 45  GLU A OE2 1 
ATOM   380  N  N   . LYS A 1 47  ? 13.225  26.993 33.493 1.00 20.05  ? 46  LYS A N   1 
ATOM   381  C  CA  . LYS A 1 47  ? 12.946  28.422 33.412 1.00 22.27  ? 46  LYS A CA  1 
ATOM   382  C  C   . LYS A 1 47  ? 11.636  28.738 32.693 1.00 20.23  ? 46  LYS A C   1 
ATOM   383  O  O   . LYS A 1 47  ? 10.981  29.733 33.010 1.00 21.34  ? 46  LYS A O   1 
ATOM   384  C  CB  . LYS A 1 47  ? 14.106  29.142 32.705 1.00 27.67  ? 46  LYS A CB  1 
ATOM   385  C  CG  . LYS A 1 47  ? 15.450  29.219 33.459 1.00 29.02  ? 46  LYS A CG  1 
ATOM   386  C  CD  . LYS A 1 47  ? 15.469  28.683 34.911 1.00 89.97  ? 46  LYS A CD  1 
ATOM   387  C  CE  . LYS A 1 47  ? 16.600  27.684 35.125 1.00 133.35 ? 46  LYS A CE  1 
ATOM   388  N  NZ  . LYS A 1 47  ? 16.735  27.259 36.543 1.00 70.05  ? 46  LYS A NZ  1 
ATOM   389  N  N   . GLU A 1 48  ? 11.242  27.894 31.743 1.00 20.86  ? 47  GLU A N   1 
ATOM   390  C  CA  . GLU A 1 48  ? 10.142  28.226 30.833 1.00 22.12  ? 47  GLU A CA  1 
ATOM   391  C  C   . GLU A 1 48  ? 9.314   27.014 30.385 1.00 22.44  ? 47  GLU A C   1 
ATOM   392  O  O   . GLU A 1 48  ? 8.085   27.090 30.325 1.00 22.74  ? 47  GLU A O   1 
ATOM   393  C  CB  . GLU A 1 48  ? 10.713  28.970 29.621 1.00 28.25  ? 47  GLU A CB  1 
ATOM   394  C  CG  . GLU A 1 48  ? 9.670   29.519 28.668 1.00 42.72  ? 47  GLU A CG  1 
ATOM   395  C  CD  . GLU A 1 48  ? 10.278  30.358 27.560 1.00 43.05  ? 47  GLU A CD  1 
ATOM   396  O  OE1 . GLU A 1 48  ? 9.535   30.712 26.622 1.00 45.36  ? 47  GLU A OE1 1 
ATOM   397  O  OE2 . GLU A 1 48  ? 11.492  30.660 27.622 1.00 44.65  ? 47  GLU A OE2 1 
ATOM   398  N  N   . ASP A 1 49  ? 9.993   25.907 30.084 1.00 20.62  ? 48  ASP A N   1 
ATOM   399  C  CA  . ASP A 1 49  ? 9.403   24.744 29.423 1.00 21.34  ? 48  ASP A CA  1 
ATOM   400  C  C   . ASP A 1 49  ? 8.496   25.152 28.254 1.00 19.70  ? 48  ASP A C   1 
ATOM   401  O  O   . ASP A 1 49  ? 7.297   24.901 28.277 1.00 19.69  ? 48  ASP A O   1 
ATOM   402  C  CB  . ASP A 1 49  ? 8.644   23.852 30.413 1.00 17.79  ? 48  ASP A CB  1 
ATOM   403  C  CG  . ASP A 1 49  ? 8.260   22.516 29.816 1.00 22.45  ? 48  ASP A CG  1 
ATOM   404  O  OD1 . ASP A 1 49  ? 8.831   22.156 28.768 1.00 20.71  ? 48  ASP A OD1 1 
ATOM   405  O  OD2 . ASP A 1 49  ? 7.389   21.760 30.306 1.00 25.10  ? 48  ASP A OD2 1 
ATOM   406  N  N   . PRO A 1 50  ? 9.077   25.750 27.221 1.00 16.40  ? 49  PRO A N   1 
ATOM   407  C  CA  . PRO A 1 50  ? 8.300   26.298 26.108 1.00 17.53  ? 49  PRO A CA  1 
ATOM   408  C  C   . PRO A 1 50  ? 7.670   25.223 25.224 1.00 22.80  ? 49  PRO A C   1 
ATOM   409  O  O   . PRO A 1 50  ? 8.121   24.081 25.211 1.00 18.61  ? 49  PRO A O   1 
ATOM   410  C  CB  . PRO A 1 50  ? 9.350   27.082 25.312 1.00 22.99  ? 49  PRO A CB  1 
ATOM   411  C  CG  . PRO A 1 50  ? 10.592  26.342 25.562 1.00 20.07  ? 49  PRO A CG  1 
ATOM   412  C  CD  . PRO A 1 50  ? 10.526  25.925 27.009 1.00 20.31  ? 49  PRO A CD  1 
ATOM   413  N  N   . VAL A 1 51  ? 6.618   25.590 24.503 1.00 19.31  ? 50  VAL A N   1 
ATOM   414  C  CA  . VAL A 1 51  ? 6.112   24.744 23.435 1.00 16.01  ? 50  VAL A CA  1 
ATOM   415  C  C   . VAL A 1 51  ? 7.138   24.732 22.303 1.00 16.93  ? 50  VAL A C   1 
ATOM   416  O  O   . VAL A 1 51  ? 7.597   25.781 21.856 1.00 19.52  ? 50  VAL A O   1 
ATOM   417  C  CB  . VAL A 1 51  ? 4.722   25.189 22.907 1.00 24.00  ? 50  VAL A CB  1 
ATOM   418  C  CG1 . VAL A 1 51  ? 4.300   24.317 21.724 1.00 17.64  ? 50  VAL A CG1 1 
ATOM   419  C  CG2 . VAL A 1 51  ? 3.685   25.143 24.019 1.00 23.41  ? 50  VAL A CG2 1 
ATOM   420  N  N   . VAL A 1 52  ? 7.527   23.527 21.896 1.00 18.66  ? 51  VAL A N   1 
ATOM   421  C  CA  . VAL A 1 52  ? 8.407   23.352 20.744 1.00 18.54  ? 51  VAL A CA  1 
ATOM   422  C  C   . VAL A 1 52  ? 7.575   23.257 19.464 1.00 15.06  ? 51  VAL A C   1 
ATOM   423  O  O   . VAL A 1 52  ? 7.848   23.955 18.513 1.00 16.03  ? 51  VAL A O   1 
ATOM   424  C  CB  . VAL A 1 52  ? 9.343   22.149 20.923 1.00 14.84  ? 51  VAL A CB  1 
ATOM   425  C  CG1 . VAL A 1 52  ? 10.357  22.076 19.768 1.00 15.28  ? 51  VAL A CG1 1 
ATOM   426  C  CG2 . VAL A 1 52  ? 10.096  22.283 22.239 1.00 17.99  ? 51  VAL A CG2 1 
ATOM   427  N  N   . TYR A 1 53  ? 6.558   22.407 19.450 1.00 15.83  ? 52  TYR A N   1 
ATOM   428  C  CA  . TYR A 1 53  ? 5.683   22.344 18.290 1.00 15.46  ? 52  TYR A CA  1 
ATOM   429  C  C   . TYR A 1 53  ? 4.284   21.867 18.581 1.00 15.10  ? 52  TYR A C   1 
ATOM   430  O  O   . TYR A 1 53  ? 4.028   21.197 19.570 1.00 20.83  ? 52  TYR A O   1 
ATOM   431  C  CB  . TYR A 1 53  ? 6.293   21.518 17.143 1.00 17.42  ? 52  TYR A CB  1 
ATOM   432  C  CG  . TYR A 1 53  ? 6.643   20.062 17.419 1.00 14.70  ? 52  TYR A CG  1 
ATOM   433  C  CD1 . TYR A 1 53  ? 5.842   19.017 16.945 1.00 16.61  ? 52  TYR A CD1 1 
ATOM   434  C  CD2 . TYR A 1 53  ? 7.811   19.728 18.103 1.00 17.56  ? 52  TYR A CD2 1 
ATOM   435  C  CE1 . TYR A 1 53  ? 6.186   17.668 17.169 1.00 17.36  ? 52  TYR A CE1 1 
ATOM   436  C  CE2 . TYR A 1 53  ? 8.147   18.402 18.338 1.00 16.92  ? 52  TYR A CE2 1 
ATOM   437  C  CZ  . TYR A 1 53  ? 7.349   17.385 17.858 1.00 19.31  ? 52  TYR A CZ  1 
ATOM   438  O  OH  . TYR A 1 53  ? 7.703   16.070 18.092 1.00 22.31  ? 52  TYR A OH  1 
ATOM   439  N  N   . GLU A 1 54  ? 3.385   22.230 17.675 1.00 17.22  ? 53  GLU A N   1 
ATOM   440  C  CA  . GLU A 1 54  ? 1.990   21.817 17.742 1.00 18.77  ? 53  GLU A CA  1 
ATOM   441  C  C   . GLU A 1 54  ? 1.626   21.132 16.426 1.00 17.15  ? 53  GLU A C   1 
ATOM   442  O  O   . GLU A 1 54  ? 2.088   21.549 15.372 1.00 18.39  ? 53  GLU A O   1 
ATOM   443  C  CB  . GLU A 1 54  ? 1.095   23.033 17.978 1.00 22.14  ? 53  GLU A CB  1 
ATOM   444  C  CG  . GLU A 1 54  ? 1.260   23.643 19.365 1.00 22.77  ? 53  GLU A CG  1 
ATOM   445  C  CD  . GLU A 1 54  ? 0.845   25.100 19.460 1.00 30.96  ? 53  GLU A CD  1 
ATOM   446  O  OE1 . GLU A 1 54  ? 0.672   25.759 18.415 1.00 24.63  ? 53  GLU A OE1 1 
ATOM   447  O  OE2 . GLU A 1 54  ? 0.719   25.594 20.603 1.00 39.23  ? 53  GLU A OE2 1 
ATOM   448  N  N   . VAL A 1 55  ? 0.809   20.086 16.495 1.00 18.47  ? 54  VAL A N   1 
ATOM   449  C  CA  . VAL A 1 55  ? 0.400   19.352 15.307 1.00 16.22  ? 54  VAL A CA  1 
ATOM   450  C  C   . VAL A 1 55  ? -1.128  19.232 15.244 1.00 18.87  ? 54  VAL A C   1 
ATOM   451  O  O   . VAL A 1 55  ? -1.781  18.917 16.246 1.00 22.78  ? 54  VAL A O   1 
ATOM   452  C  CB  . VAL A 1 55  ? 1.017   17.935 15.270 1.00 18.03  ? 54  VAL A CB  1 
ATOM   453  C  CG1 . VAL A 1 55  ? 0.566   17.192 14.021 1.00 20.03  ? 54  VAL A CG1 1 
ATOM   454  C  CG2 . VAL A 1 55  ? 2.542   17.990 15.353 1.00 21.18  ? 54  VAL A CG2 1 
ATOM   455  N  N   . TYR A 1 56  ? -1.675  19.487 14.057 1.00 16.81  ? 55  TYR A N   1 
ATOM   456  C  CA  . TYR A 1 56  ? -3.095  19.289 13.765 1.00 18.74  ? 55  TYR A CA  1 
ATOM   457  C  C   . TYR A 1 56  ? -3.202  18.183 12.717 1.00 19.03  ? 55  TYR A C   1 
ATOM   458  O  O   . TYR A 1 56  ? -2.797  18.382 11.576 1.00 21.63  ? 55  TYR A O   1 
ATOM   459  C  CB  . TYR A 1 56  ? -3.703  20.573 13.208 1.00 17.79  ? 55  TYR A CB  1 
ATOM   460  C  CG  . TYR A 1 56  ? -3.637  21.757 14.143 1.00 18.05  ? 55  TYR A CG  1 
ATOM   461  C  CD1 . TYR A 1 56  ? -2.518  22.582 14.189 1.00 21.43  ? 55  TYR A CD1 1 
ATOM   462  C  CD2 . TYR A 1 56  ? -4.711  22.056 14.971 1.00 25.31  ? 55  TYR A CD2 1 
ATOM   463  C  CE1 . TYR A 1 56  ? -2.457  23.677 15.057 1.00 23.38  ? 55  TYR A CE1 1 
ATOM   464  C  CE2 . TYR A 1 56  ? -4.670  23.140 15.834 1.00 23.81  ? 55  TYR A CE2 1 
ATOM   465  C  CZ  . TYR A 1 56  ? -3.551  23.944 15.876 1.00 20.22  ? 55  TYR A CZ  1 
ATOM   466  O  OH  . TYR A 1 56  ? -3.518  25.009 16.749 1.00 25.38  ? 55  TYR A OH  1 
ATOM   467  N  N   . ALA A 1 57  ? -3.741  17.023 13.084 1.00 20.72  ? 56  ALA A N   1 
ATOM   468  C  CA  . ALA A 1 57  ? -3.726  15.862 12.199 1.00 18.98  ? 56  ALA A CA  1 
ATOM   469  C  C   . ALA A 1 57  ? -5.141  15.413 11.853 1.00 21.90  ? 56  ALA A C   1 
ATOM   470  O  O   . ALA A 1 57  ? -6.030  15.422 12.707 1.00 24.66  ? 56  ALA A O   1 
ATOM   471  C  CB  . ALA A 1 57  ? -2.944  14.729 12.831 1.00 19.70  ? 56  ALA A CB  1 
ATOM   472  N  N   . VAL A 1 58  ? -5.335  15.030 10.594 1.00 17.08  ? 57  VAL A N   1 
ATOM   473  C  CA  . VAL A 1 58  ? -6.577  14.454 10.102 1.00 16.63  ? 57  VAL A CA  1 
ATOM   474  C  C   . VAL A 1 58  ? -6.224  13.057 9.603  1.00 19.03  ? 57  VAL A C   1 
ATOM   475  O  O   . VAL A 1 58  ? -5.566  12.916 8.569  1.00 19.12  ? 57  VAL A O   1 
ATOM   476  C  CB  . VAL A 1 58  ? -7.193  15.313 8.982  1.00 20.69  ? 57  VAL A CB  1 
ATOM   477  C  CG1 . VAL A 1 58  ? -8.465  14.659 8.426  1.00 18.93  ? 57  VAL A CG1 1 
ATOM   478  C  CG2 . VAL A 1 58  ? -7.515  16.709 9.515  1.00 20.78  ? 57  VAL A CG2 1 
ATOM   479  N  N   . GLU A 1 59  ? -6.646  12.030 10.338 1.00 19.63  ? 58  GLU A N   1 
ATOM   480  C  CA  . GLU A 1 59  ? -6.177  10.663 10.107 1.00 20.05  ? 58  GLU A CA  1 
ATOM   481  C  C   . GLU A 1 59  ? -7.323  9.677  9.870  1.00 19.86  ? 58  GLU A C   1 
ATOM   482  O  O   . GLU A 1 59  ? -8.423  9.824  10.418 1.00 23.60  ? 58  GLU A O   1 
ATOM   483  C  CB  . GLU A 1 59  ? -5.267  10.220 11.269 1.00 23.82  ? 58  GLU A CB  1 
ATOM   484  C  CG  . GLU A 1 59  ? -4.094  11.182 11.465 1.00 27.64  ? 58  GLU A CG  1 
ATOM   485  C  CD  . GLU A 1 59  ? -3.025  10.705 12.431 1.00 48.44  ? 58  GLU A CD  1 
ATOM   486  O  OE1 . GLU A 1 59  ? -3.369  10.452 13.595 1.00 38.64  ? 58  GLU A OE1 1 
ATOM   487  O  OE2 . GLU A 1 59  ? -1.830  10.628 12.041 1.00 35.76  ? 58  GLU A OE2 1 
ATOM   488  N  N   . GLN A 1 60  ? -7.057  8.692  9.015  1.00 17.92  ? 59  GLN A N   1 
ATOM   489  C  CA  . GLN A 1 60  ? -8.000  7.653  8.632  1.00 16.08  ? 59  GLN A CA  1 
ATOM   490  C  C   . GLN A 1 60  ? -7.668  6.360  9.367  1.00 20.02  ? 59  GLN A C   1 
ATOM   491  O  O   . GLN A 1 60  ? -6.599  6.227  9.942  1.00 19.42  ? 59  GLN A O   1 
ATOM   492  C  CB  . GLN A 1 60  ? -7.930  7.419  7.123  1.00 18.78  ? 59  GLN A CB  1 
ATOM   493  C  CG  . GLN A 1 60  ? -8.031  8.692  6.287  1.00 18.48  ? 59  GLN A CG  1 
ATOM   494  C  CD  . GLN A 1 60  ? -9.322  9.419  6.538  1.00 20.57  ? 59  GLN A CD  1 
ATOM   495  O  OE1 . GLN A 1 60  ? -10.360 8.779  6.636  1.00 20.83  ? 59  GLN A OE1 1 
ATOM   496  N  NE2 . GLN A 1 60  ? -9.271  10.736 6.638  1.00 18.58  ? 59  GLN A NE2 1 
ATOM   497  N  N   . GLU A 1 61  ? -8.608  5.421  9.341  1.00 22.93  ? 60  GLU A N   1 
ATOM   498  C  CA  . GLU A 1 61  ? -8.356  4.051  9.767  1.00 19.10  ? 60  GLU A CA  1 
ATOM   499  C  C   . GLU A 1 61  ? -7.118  3.536  9.037  1.00 19.52  ? 60  GLU A C   1 
ATOM   500  O  O   . GLU A 1 61  ? -6.959  3.773  7.839  1.00 23.28  ? 60  GLU A O   1 
ATOM   501  C  CB  . GLU A 1 61  ? -9.571  3.169  9.445  1.00 28.89  ? 60  GLU A CB  1 
ATOM   502  C  CG  . GLU A 1 61  ? -9.531  1.772  10.043 1.00 28.67  ? 60  GLU A CG  1 
ATOM   503  C  CD  . GLU A 1 61  ? -9.856  1.738  11.526 1.00 24.58  ? 60  GLU A CD  1 
ATOM   504  O  OE1 . GLU A 1 61  ? -10.259 2.771  12.099 1.00 23.97  ? 60  GLU A OE1 1 
ATOM   505  O  OE2 . GLU A 1 61  ? -9.702  0.653  12.117 1.00 27.19  ? 60  GLU A OE2 1 
ATOM   506  N  N   . GLU A 1 62  ? -6.245  2.841  9.754  1.00 23.45  ? 61  GLU A N   1 
ATOM   507  C  CA  . GLU A 1 62  ? -5.010  2.342  9.162  1.00 21.86  ? 61  GLU A CA  1 
ATOM   508  C  C   . GLU A 1 62  ? -5.360  1.286  8.119  1.00 31.42  ? 61  GLU A C   1 
ATOM   509  O  O   . GLU A 1 62  ? -5.906  0.226  8.434  1.00 34.24  ? 61  GLU A O   1 
ATOM   510  C  CB  . GLU A 1 62  ? -4.008  1.857  10.237 1.00 28.44  ? 61  GLU A CB  1 
ATOM   511  C  CG  . GLU A 1 62  ? -4.046  0.388  10.638 1.00 56.99  ? 61  GLU A CG  1 
ATOM   512  C  CD  . GLU A 1 62  ? -2.962  -0.425 9.954  1.00 135.19 ? 61  GLU A CD  1 
ATOM   513  O  OE1 . GLU A 1 62  ? -3.257  -1.077 8.931  1.00 93.97  ? 61  GLU A OE1 1 
ATOM   514  O  OE2 . GLU A 1 62  ? -1.808  -0.403 10.439 1.00 69.49  ? 61  GLU A OE2 1 
ATOM   515  N  N   . LYS A 1 63  ? -5.114  1.633  6.863  1.00 23.01  ? 62  LYS A N   1 
ATOM   516  C  CA  . LYS A 1 63  ? -5.450  0.784  5.736  1.00 20.27  ? 62  LYS A CA  1 
ATOM   517  C  C   . LYS A 1 63  ? -4.504  1.092  4.585  1.00 21.83  ? 62  LYS A C   1 
ATOM   518  O  O   . LYS A 1 63  ? -4.168  2.261  4.337  1.00 21.44  ? 62  LYS A O   1 
ATOM   519  C  CB  . LYS A 1 63  ? -6.894  1.022  5.299  1.00 28.45  ? 62  LYS A CB  1 
ATOM   520  C  CG  . LYS A 1 63  ? -7.546  -0.182 4.633  1.00 52.13  ? 62  LYS A CG  1 
ATOM   521  C  CD  . LYS A 1 63  ? -8.603  -0.842 5.524  1.00 105.14 ? 62  LYS A CD  1 
ATOM   522  C  CE  . LYS A 1 63  ? -10.014 -0.416 5.142  1.00 133.07 ? 62  LYS A CE  1 
ATOM   523  N  NZ  . LYS A 1 63  ? -10.914 -0.373 6.323  1.00 52.03  ? 62  LYS A NZ  1 
ATOM   524  N  N   . GLU A 1 64  ? -4.075  0.044  3.894  1.00 19.86  ? 63  GLU A N   1 
ATOM   525  C  CA  . GLU A 1 64  ? -3.219  0.189  2.720  1.00 20.37  ? 63  GLU A CA  1 
ATOM   526  C  C   . GLU A 1 64  ? -3.896  1.077  1.675  1.00 21.36  ? 63  GLU A C   1 
ATOM   527  O  O   . GLU A 1 64  ? -5.088  0.927  1.409  1.00 21.44  ? 63  GLU A O   1 
ATOM   528  C  CB  . GLU A 1 64  ? -2.839  -1.199 2.156  1.00 25.09  ? 63  GLU A CB  1 
ATOM   529  C  CG  . GLU A 1 64  ? -3.194  -1.485 0.704  1.00 116.38 ? 63  GLU A CG  1 
ATOM   530  C  CD  . GLU A 1 64  ? -2.802  -2.889 0.268  1.00 116.09 ? 63  GLU A CD  1 
ATOM   531  O  OE1 . GLU A 1 64  ? -2.018  -3.557 0.984  1.00 34.20  ? 63  GLU A OE1 1 
ATOM   532  O  OE2 . GLU A 1 64  ? -3.268  -3.323 -0.805 1.00 57.37  ? 63  GLU A OE2 1 
ATOM   533  N  N   . GLY A 1 65  ? -3.133  2.011  1.102  1.00 19.22  ? 64  GLY A N   1 
ATOM   534  C  CA  . GLY A 1 65  ? -3.610  2.858  0.024  1.00 18.71  ? 64  GLY A CA  1 
ATOM   535  C  C   . GLY A 1 65  ? -4.264  4.168  0.450  1.00 17.53  ? 64  GLY A C   1 
ATOM   536  O  O   . GLY A 1 65  ? -4.480  5.048  -0.382 1.00 16.62  ? 64  GLY A O   1 
ATOM   537  N  N   . ASP A 1 66  ? -4.591  4.304  1.730  1.00 15.01  ? 65  ASP A N   1 
ATOM   538  C  CA  . ASP A 1 66  ? -5.264  5.504  2.232  1.00 13.92  ? 65  ASP A CA  1 
ATOM   539  C  C   . ASP A 1 66  ? -4.239  6.540  2.705  1.00 16.59  ? 65  ASP A C   1 
ATOM   540  O  O   . ASP A 1 66  ? -3.047  6.226  2.851  1.00 17.55  ? 65  ASP A O   1 
ATOM   541  C  CB  . ASP A 1 66  ? -6.250  5.115  3.363  1.00 15.57  ? 65  ASP A CB  1 
ATOM   542  C  CG  . ASP A 1 66  ? -7.479  6.015  3.437  1.00 19.19  ? 65  ASP A CG  1 
ATOM   543  O  OD1 . ASP A 1 66  ? -7.477  7.140  2.878  1.00 15.69  ? 65  ASP A OD1 1 
ATOM   544  O  OD2 . ASP A 1 66  ? -8.505  5.645  4.061  1.00 19.13  ? 65  ASP A OD2 1 
ATOM   545  N  N   . LEU A 1 67  ? -4.704  7.767  2.967  1.00 14.98  ? 66  LEU A N   1 
ATOM   546  C  CA  . LEU A 1 67  ? -3.819  8.893  3.260  1.00 13.98  ? 66  LEU A CA  1 
ATOM   547  C  C   . LEU A 1 67  ? -4.240  9.693  4.478  1.00 17.47  ? 66  LEU A C   1 
ATOM   548  O  O   . LEU A 1 67  ? -5.425  9.984  4.673  1.00 17.39  ? 66  LEU A O   1 
ATOM   549  C  CB  . LEU A 1 67  ? -3.733  9.842  2.061  1.00 18.20  ? 66  LEU A CB  1 
ATOM   550  C  CG  . LEU A 1 67  ? -3.119  9.278  0.773  1.00 15.56  ? 66  LEU A CG  1 
ATOM   551  C  CD1 . LEU A 1 67  ? -3.295  10.270 -0.379 1.00 17.37  ? 66  LEU A CD1 1 
ATOM   552  C  CD2 . LEU A 1 67  ? -1.644  8.942  1.008  1.00 14.22  ? 66  LEU A CD2 1 
ATOM   553  N  N   . ASN A 1 68  ? -3.250  10.053 5.282  1.00 16.02  ? 67  ASN A N   1 
ATOM   554  C  CA  . ASN A 1 68  ? -3.387  11.016 6.371  1.00 15.46  ? 67  ASN A CA  1 
ATOM   555  C  C   . ASN A 1 68  ? -2.786  12.363 5.958  1.00 14.21  ? 67  ASN A C   1 
ATOM   556  O  O   . ASN A 1 68  ? -1.946  12.424 5.059  1.00 16.23  ? 67  ASN A O   1 
ATOM   557  C  CB  . ASN A 1 68  ? -2.628  10.514 7.592  1.00 15.04  ? 67  ASN A CB  1 
ATOM   558  C  CG  . ASN A 1 68  ? -3.256  9.297  8.228  1.00 16.29  ? 67  ASN A CG  1 
ATOM   559  O  OD1 . ASN A 1 68  ? -4.380  8.905  7.900  1.00 16.97  ? 67  ASN A OD1 1 
ATOM   560  N  ND2 . ASN A 1 68  ? -2.523  8.683  9.151  1.00 18.59  ? 67  ASN A ND2 1 
ATOM   561  N  N   . PHE A 1 69  ? -3.183  13.449 6.609  1.00 14.47  ? 68  PHE A N   1 
ATOM   562  C  CA  . PHE A 1 69  ? -2.441  14.701 6.468  1.00 14.02  ? 68  PHE A CA  1 
ATOM   563  C  C   . PHE A 1 69  ? -2.423  15.471 7.777  1.00 18.90  ? 68  PHE A C   1 
ATOM   564  O  O   . PHE A 1 69  ? -3.283  15.272 8.617  1.00 15.13  ? 68  PHE A O   1 
ATOM   565  C  CB  . PHE A 1 69  ? -2.970  15.554 5.325  1.00 14.99  ? 68  PHE A CB  1 
ATOM   566  C  CG  . PHE A 1 69  ? -4.394  16.014 5.493  1.00 13.49  ? 68  PHE A CG  1 
ATOM   567  C  CD1 . PHE A 1 69  ? -4.682  17.255 6.066  1.00 17.63  ? 68  PHE A CD1 1 
ATOM   568  C  CD2 . PHE A 1 69  ? -5.438  15.221 5.031  1.00 16.18  ? 68  PHE A CD2 1 
ATOM   569  C  CE1 . PHE A 1 69  ? -6.010  17.685 6.197  1.00 21.33  ? 68  PHE A CE1 1 
ATOM   570  C  CE2 . PHE A 1 69  ? -6.766  15.641 5.160  1.00 18.28  ? 68  PHE A CE2 1 
ATOM   571  C  CZ  . PHE A 1 69  ? -7.050  16.876 5.737  1.00 20.33  ? 68  PHE A CZ  1 
ATOM   572  N  N   . ALA A 1 70  ? -1.441  16.343 7.952  1.00 14.97  ? 69  ALA A N   1 
ATOM   573  C  CA  . ALA A 1 70  ? -1.299  17.086 9.204  1.00 15.99  ? 69  ALA A CA  1 
ATOM   574  C  C   . ALA A 1 70  ? -0.513  18.344 8.971  1.00 16.96  ? 69  ALA A C   1 
ATOM   575  O  O   . ALA A 1 70  ? 0.400   18.336 8.152  1.00 15.42  ? 69  ALA A O   1 
ATOM   576  C  CB  . ALA A 1 70  ? -0.590  16.253 10.240 1.00 14.86  ? 69  ALA A CB  1 
ATOM   577  N  N   . THR A 1 71  ? -0.834  19.414 9.698  1.00 13.89  ? 70  THR A N   1 
ATOM   578  C  CA  . THR A 1 71  ? 0.046   20.581 9.775  1.00 12.73  ? 70  THR A CA  1 
ATOM   579  C  C   . THR A 1 71  ? 0.841   20.563 11.078 1.00 15.10  ? 70  THR A C   1 
ATOM   580  O  O   . THR A 1 71  ? 0.406   19.992 12.089 1.00 15.82  ? 70  THR A O   1 
ATOM   581  C  CB  . THR A 1 71  ? -0.735  21.921 9.702  1.00 16.00  ? 70  THR A CB  1 
ATOM   582  O  OG1 . THR A 1 71  ? -1.793  21.923 10.676 1.00 17.77  ? 70  THR A OG1 1 
ATOM   583  C  CG2 . THR A 1 71  ? -1.406  22.099 8.359  1.00 16.77  ? 70  THR A CG2 1 
ATOM   584  N  N   . THR A 1 72  ? 2.005   21.202 11.043 1.00 14.23  ? 71  THR A N   1 
ATOM   585  C  CA  . THR A 1 72  ? 2.820   21.449 12.206 1.00 14.97  ? 71  THR A CA  1 
ATOM   586  C  C   . THR A 1 72  ? 3.168   22.923 12.274 1.00 15.40  ? 71  THR A C   1 
ATOM   587  O  O   . THR A 1 72  ? 3.468   23.556 11.250 1.00 15.89  ? 71  THR A O   1 
ATOM   588  C  CB  . THR A 1 72  ? 4.122   20.629 12.128 1.00 16.94  ? 71  THR A CB  1 
ATOM   589  O  OG1 . THR A 1 72  ? 3.818   19.235 12.028 1.00 17.45  ? 71  THR A OG1 1 
ATOM   590  C  CG2 . THR A 1 72  ? 4.953   20.777 13.397 1.00 19.21  ? 71  THR A CG2 1 
ATOM   591  N  N   . VAL A 1 73  ? 3.101   23.463 13.491 1.00 16.97  ? 72  VAL A N   1 
ATOM   592  C  CA  . VAL A 1 73  ? 3.637   24.774 13.808 1.00 17.07  ? 72  VAL A CA  1 
ATOM   593  C  C   . VAL A 1 73  ? 4.844   24.520 14.712 1.00 15.74  ? 72  VAL A C   1 
ATOM   594  O  O   . VAL A 1 73  ? 4.689   24.114 15.858 1.00 17.13  ? 72  VAL A O   1 
ATOM   595  C  CB  . VAL A 1 73  ? 2.597   25.646 14.548 1.00 15.43  ? 72  VAL A CB  1 
ATOM   596  C  CG1 . VAL A 1 73  ? 3.160   27.038 14.828 1.00 18.80  ? 72  VAL A CG1 1 
ATOM   597  C  CG2 . VAL A 1 73  ? 1.308   25.729 13.738 1.00 20.63  ? 72  VAL A CG2 1 
ATOM   598  N  N   . LEU A 1 74  ? 6.037   24.718 14.148 1.00 17.40  ? 73  LEU A N   1 
ATOM   599  C  CA  . LEU A 1 74  ? 7.311   24.512 14.823 1.00 16.63  ? 73  LEU A CA  1 
ATOM   600  C  C   . LEU A 1 74  ? 7.806   25.894 15.268 1.00 17.64  ? 73  LEU A C   1 
ATOM   601  O  O   . LEU A 1 74  ? 8.147   26.751 14.446 1.00 19.06  ? 73  LEU A O   1 
ATOM   602  C  CB  . LEU A 1 74  ? 8.307   23.841 13.858 1.00 19.52  ? 73  LEU A CB  1 
ATOM   603  C  CG  . LEU A 1 74  ? 9.264   22.761 14.368 1.00 41.38  ? 73  LEU A CG  1 
ATOM   604  C  CD1 . LEU A 1 74  ? 10.424  22.586 13.387 1.00 18.23  ? 73  LEU A CD1 1 
ATOM   605  C  CD2 . LEU A 1 74  ? 9.783   23.036 15.760 1.00 23.06  ? 73  LEU A CD2 1 
ATOM   606  N  N   . TYR A 1 75  ? 7.812   26.120 16.570 1.00 17.05  ? 74  TYR A N   1 
ATOM   607  C  CA  . TYR A 1 75  ? 8.149   27.434 17.113 1.00 16.26  ? 74  TYR A CA  1 
ATOM   608  C  C   . TYR A 1 75  ? 9.651   27.729 17.067 1.00 21.85  ? 74  TYR A C   1 
ATOM   609  O  O   . TYR A 1 75  ? 10.480  26.803 17.036 1.00 19.48  ? 74  TYR A O   1 
ATOM   610  C  CB  . TYR A 1 75  ? 7.580   27.555 18.527 1.00 17.88  ? 74  TYR A CB  1 
ATOM   611  C  CG  . TYR A 1 75  ? 6.079   27.693 18.511 1.00 22.37  ? 74  TYR A CG  1 
ATOM   612  C  CD1 . TYR A 1 75  ? 5.481   28.934 18.321 1.00 31.70  ? 74  TYR A CD1 1 
ATOM   613  C  CD2 . TYR A 1 75  ? 5.262   26.584 18.612 1.00 20.14  ? 74  TYR A CD2 1 
ATOM   614  C  CE1 . TYR A 1 75  ? 4.097   29.062 18.269 1.00 29.45  ? 74  TYR A CE1 1 
ATOM   615  C  CE2 . TYR A 1 75  ? 3.872   26.702 18.563 1.00 20.33  ? 74  TYR A CE2 1 
ATOM   616  C  CZ  . TYR A 1 75  ? 3.302   27.945 18.395 1.00 23.32  ? 74  TYR A CZ  1 
ATOM   617  O  OH  . TYR A 1 75  ? 1.930   28.065 18.350 1.00 23.74  ? 74  TYR A OH  1 
ATOM   618  N  N   . PRO A 1 76  ? 10.011  29.016 17.030 1.00 17.98  ? 75  PRO A N   1 
ATOM   619  C  CA  . PRO A 1 76  ? 11.418  29.400 16.997 1.00 18.62  ? 75  PRO A CA  1 
ATOM   620  C  C   . PRO A 1 76  ? 12.053  29.295 18.376 1.00 20.32  ? 75  PRO A C   1 
ATOM   621  O  O   . PRO A 1 76  ? 11.402  29.550 19.400 1.00 22.76  ? 75  PRO A O   1 
ATOM   622  C  CB  . PRO A 1 76  ? 11.369  30.846 16.514 1.00 18.24  ? 75  PRO A CB  1 
ATOM   623  C  CG  . PRO A 1 76  ? 10.084  31.365 17.039 1.00 20.17  ? 75  PRO A CG  1 
ATOM   624  C  CD  . PRO A 1 76  ? 9.126   30.199 16.983 1.00 17.72  ? 75  PRO A CD  1 
ATOM   625  N  N   . GLY A 1 77  ? 13.312  28.879 18.400 1.00 20.46  ? 76  GLY A N   1 
ATOM   626  C  CA  . GLY A 1 77  ? 14.045  28.726 19.642 1.00 21.28  ? 76  GLY A CA  1 
ATOM   627  C  C   . GLY A 1 77  ? 15.313  27.930 19.447 1.00 19.25  ? 76  GLY A C   1 
ATOM   628  O  O   . GLY A 1 77  ? 15.537  27.362 18.381 1.00 21.32  ? 76  GLY A O   1 
ATOM   629  N  N   . LYS A 1 78  ? 16.150  27.927 20.477 1.00 19.98  ? 77  LYS A N   1 
ATOM   630  C  CA  . LYS A 1 78  ? 17.343  27.096 20.529 1.00 21.83  ? 77  LYS A CA  1 
ATOM   631  C  C   . LYS A 1 78  ? 17.513  26.487 21.914 1.00 22.91  ? 77  LYS A C   1 
ATOM   632  O  O   . LYS A 1 78  ? 17.093  27.062 22.926 1.00 22.46  ? 77  LYS A O   1 
ATOM   633  C  CB  . LYS A 1 78  ? 18.584  27.919 20.201 1.00 20.79  ? 77  LYS A CB  1 
ATOM   634  C  CG  . LYS A 1 78  ? 18.538  28.604 18.839 1.00 27.74  ? 77  LYS A CG  1 
ATOM   635  C  CD  . LYS A 1 78  ? 19.833  29.344 18.526 1.00 29.75  ? 77  LYS A CD  1 
ATOM   636  C  CE  . LYS A 1 78  ? 19.892  30.691 19.218 1.00 42.48  ? 77  LYS A CE  1 
ATOM   637  N  NZ  . LYS A 1 78  ? 21.250  31.289 19.096 1.00 61.05  ? 77  LYS A NZ  1 
ATOM   638  N  N   . VAL A 1 79  ? 18.110  25.302 21.938 1.00 22.14  ? 78  VAL A N   1 
ATOM   639  C  CA  . VAL A 1 79  ? 18.587  24.674 23.157 1.00 20.26  ? 78  VAL A CA  1 
ATOM   640  C  C   . VAL A 1 79  ? 20.097  24.749 23.047 1.00 24.84  ? 78  VAL A C   1 
ATOM   641  O  O   . VAL A 1 79  ? 20.702  23.990 22.299 1.00 22.24  ? 78  VAL A O   1 
ATOM   642  C  CB  . VAL A 1 79  ? 18.107  23.215 23.260 1.00 25.17  ? 78  VAL A CB  1 
ATOM   643  C  CG1 . VAL A 1 79  ? 18.647  22.549 24.516 1.00 25.10  ? 78  VAL A CG1 1 
ATOM   644  C  CG2 . VAL A 1 79  ? 16.582  23.158 23.229 1.00 23.33  ? 78  VAL A CG2 1 
ATOM   645  N  N   . GLY A 1 80  ? 20.705  25.678 23.781 1.00 24.74  ? 79  GLY A N   1 
ATOM   646  C  CA  . GLY A 1 80  ? 22.089  26.032 23.534 1.00 24.69  ? 79  GLY A CA  1 
ATOM   647  C  C   . GLY A 1 80  ? 22.203  26.667 22.158 1.00 25.70  ? 79  GLY A C   1 
ATOM   648  O  O   . GLY A 1 80  ? 21.595  27.705 21.902 1.00 28.48  ? 79  GLY A O   1 
ATOM   649  N  N   . LYS A 1 81  ? 22.987  26.042 21.281 1.00 24.19  ? 80  LYS A N   1 
ATOM   650  C  CA  . LYS A 1 81  ? 23.175  26.508 19.908 1.00 24.00  ? 80  LYS A CA  1 
ATOM   651  C  C   . LYS A 1 81  ? 22.255  25.802 18.908 1.00 21.22  ? 80  LYS A C   1 
ATOM   652  O  O   . LYS A 1 81  ? 22.214  26.174 17.751 1.00 20.45  ? 80  LYS A O   1 
ATOM   653  C  CB  . LYS A 1 81  ? 24.619  26.262 19.463 1.00 27.15  ? 80  LYS A CB  1 
ATOM   654  C  CG  . LYS A 1 81  ? 25.675  26.982 20.286 1.00 32.57  ? 80  LYS A CG  1 
ATOM   655  C  CD  . LYS A 1 81  ? 27.071  26.499 19.917 1.00 29.52  ? 80  LYS A CD  1 
ATOM   656  C  CE  . LYS A 1 81  ? 28.145  27.411 20.497 1.00 69.09  ? 80  LYS A CE  1 
ATOM   657  N  NZ  . LYS A 1 81  ? 29.514  26.858 20.306 1.00 42.86  ? 80  LYS A NZ  1 
ATOM   658  N  N   . GLU A 1 82  ? 21.538  24.781 19.371 1.00 22.13  ? 81  GLU A N   1 
ATOM   659  C  CA  . GLU A 1 82  ? 20.795  23.872 18.503 1.00 18.79  ? 81  GLU A CA  1 
ATOM   660  C  C   . GLU A 1 82  ? 19.336  24.312 18.314 1.00 16.18  ? 81  GLU A C   1 
ATOM   661  O  O   . GLU A 1 82  ? 18.577  24.420 19.285 1.00 21.07  ? 81  GLU A O   1 
ATOM   662  C  CB  . GLU A 1 82  ? 20.848  22.487 19.126 1.00 25.13  ? 81  GLU A CB  1 
ATOM   663  C  CG  . GLU A 1 82  ? 20.472  21.340 18.209 1.00 27.31  ? 81  GLU A CG  1 
ATOM   664  C  CD  . GLU A 1 82  ? 20.787  19.988 18.825 1.00 27.02  ? 81  GLU A CD  1 
ATOM   665  O  OE1 . GLU A 1 82  ? 20.998  19.917 20.063 1.00 20.67  ? 81  GLU A OE1 1 
ATOM   666  O  OE2 . GLU A 1 82  ? 20.822  18.994 18.070 1.00 20.32  ? 81  GLU A OE2 1 
ATOM   667  N  N   . PHE A 1 83  ? 18.947  24.541 17.063 1.00 15.99  ? 82  PHE A N   1 
ATOM   668  C  CA  . PHE A 1 83  ? 17.588  25.000 16.748 1.00 17.25  ? 82  PHE A CA  1 
ATOM   669  C  C   . PHE A 1 83  ? 16.517  23.985 17.155 1.00 21.04  ? 82  PHE A C   1 
ATOM   670  O  O   . PHE A 1 83  ? 16.709  22.767 17.066 1.00 18.52  ? 82  PHE A O   1 
ATOM   671  C  CB  . PHE A 1 83  ? 17.459  25.316 15.253 1.00 18.78  ? 82  PHE A CB  1 
ATOM   672  C  CG  . PHE A 1 83  ? 18.176  26.566 14.826 1.00 18.30  ? 82  PHE A CG  1 
ATOM   673  C  CD1 . PHE A 1 83  ? 19.313  26.507 14.041 1.00 23.76  ? 82  PHE A CD1 1 
ATOM   674  C  CD2 . PHE A 1 83  ? 17.678  27.816 15.187 1.00 22.61  ? 82  PHE A CD2 1 
ATOM   675  C  CE1 . PHE A 1 83  ? 19.971  27.673 13.640 1.00 22.07  ? 82  PHE A CE1 1 
ATOM   676  C  CE2 . PHE A 1 83  ? 18.326  28.984 14.791 1.00 23.01  ? 82  PHE A CE2 1 
ATOM   677  C  CZ  . PHE A 1 83  ? 19.472  28.915 14.015 1.00 22.30  ? 82  PHE A CZ  1 
ATOM   678  N  N   . PHE A 1 84  ? 15.378  24.502 17.603 1.00 17.08  ? 83  PHE A N   1 
ATOM   679  C  CA  . PHE A 1 84  ? 14.186  23.690 17.844 1.00 18.50  ? 83  PHE A CA  1 
ATOM   680  C  C   . PHE A 1 84  ? 13.863  22.811 16.626 1.00 13.94  ? 83  PHE A C   1 
ATOM   681  O  O   . PHE A 1 84  ? 13.968  23.257 15.466 1.00 16.20  ? 83  PHE A O   1 
ATOM   682  C  CB  . PHE A 1 84  ? 12.966  24.588 18.118 1.00 18.15  ? 83  PHE A CB  1 
ATOM   683  C  CG  . PHE A 1 84  ? 12.874  25.129 19.524 1.00 19.10  ? 83  PHE A CG  1 
ATOM   684  C  CD1 . PHE A 1 84  ? 13.939  25.065 20.420 1.00 19.93  ? 83  PHE A CD1 1 
ATOM   685  C  CD2 . PHE A 1 84  ? 11.690  25.717 19.946 1.00 18.13  ? 83  PHE A CD2 1 
ATOM   686  C  CE1 . PHE A 1 84  ? 13.818  25.571 21.702 1.00 19.78  ? 83  PHE A CE1 1 
ATOM   687  C  CE2 . PHE A 1 84  ? 11.562  26.214 21.229 1.00 21.98  ? 83  PHE A CE2 1 
ATOM   688  C  CZ  . PHE A 1 84  ? 12.622  26.144 22.103 1.00 18.80  ? 83  PHE A CZ  1 
ATOM   689  N  N   . PHE A 1 85  ? 13.443  21.582 16.926 1.00 16.27  ? 84  PHE A N   1 
ATOM   690  C  CA  . PHE A 1 85  ? 13.104  20.586 15.918 1.00 15.69  ? 84  PHE A CA  1 
ATOM   691  C  C   . PHE A 1 85  ? 12.007  19.648 16.393 1.00 15.53  ? 84  PHE A C   1 
ATOM   692  O  O   . PHE A 1 85  ? 11.666  19.646 17.566 1.00 17.81  ? 84  PHE A O   1 
ATOM   693  C  CB  . PHE A 1 85  ? 14.360  19.808 15.458 1.00 17.16  ? 84  PHE A CB  1 
ATOM   694  C  CG  . PHE A 1 85  ? 15.148  19.108 16.563 1.00 16.02  ? 84  PHE A CG  1 
ATOM   695  C  CD1 . PHE A 1 85  ? 14.556  18.186 17.418 1.00 15.75  ? 84  PHE A CD1 1 
ATOM   696  C  CD2 . PHE A 1 85  ? 16.530  19.332 16.679 1.00 20.18  ? 84  PHE A CD2 1 
ATOM   697  C  CE1 . PHE A 1 85  ? 15.306  17.531 18.385 1.00 16.69  ? 84  PHE A CE1 1 
ATOM   698  C  CE2 . PHE A 1 85  ? 17.283  18.680 17.642 1.00 19.03  ? 84  PHE A CE2 1 
ATOM   699  C  CZ  . PHE A 1 85  ? 16.678  17.785 18.494 1.00 18.31  ? 84  PHE A CZ  1 
ATOM   700  N  N   . THR A 1 86  ? 11.454  18.859 15.472 1.00 15.40  ? 85  THR A N   1 
ATOM   701  C  CA  . THR A 1 86  ? 10.554  17.768 15.851 1.00 13.51  ? 85  THR A CA  1 
ATOM   702  C  C   . THR A 1 86  ? 11.320  16.540 16.304 1.00 16.05  ? 85  THR A C   1 
ATOM   703  O  O   . THR A 1 86  ? 12.485  16.380 15.960 1.00 17.11  ? 85  THR A O   1 
ATOM   704  C  CB  . THR A 1 86  ? 9.619   17.377 14.705 1.00 15.72  ? 85  THR A CB  1 
ATOM   705  O  OG1 . THR A 1 86  ? 10.390  16.961 13.574 1.00 17.29  ? 85  THR A OG1 1 
ATOM   706  C  CG2 . THR A 1 86  ? 8.799   18.582 14.238 1.00 15.83  ? 85  THR A CG2 1 
ATOM   707  N  N   . LYS A 1 87  ? 10.684  15.666 17.070 1.00 15.43  ? 86  LYS A N   1 
ATOM   708  C  CA  . LYS A 1 87  ? 11.364  14.473 17.585 1.00 18.16  ? 86  LYS A CA  1 
ATOM   709  C  C   . LYS A 1 87  ? 12.028  13.691 16.456 1.00 15.03  ? 86  LYS A C   1 
ATOM   710  O  O   . LYS A 1 87  ? 13.184  13.281 16.572 1.00 18.94  ? 86  LYS A O   1 
ATOM   711  C  CB  . LYS A 1 87  ? 10.399  13.560 18.343 1.00 15.63  ? 86  LYS A CB  1 
ATOM   712  C  CG  . LYS A 1 87  ? 10.008  14.079 19.718 1.00 18.00  ? 86  LYS A CG  1 
ATOM   713  C  CD  . LYS A 1 87  ? 9.013   13.131 20.384 1.00 26.41  ? 86  LYS A CD  1 
ATOM   714  C  CE  . LYS A 1 87  ? 8.771   13.515 21.836 1.00 45.74  ? 86  LYS A CE  1 
ATOM   715  N  NZ  . LYS A 1 87  ? 7.730   12.668 22.486 1.00 55.53  ? 86  LYS A NZ  1 
ATOM   716  N  N   . GLY A 1 88  ? 11.293  13.497 15.363 1.00 14.53  ? 87  GLY A N   1 
ATOM   717  C  CA  . GLY A 1 88  ? 11.782  12.726 14.231 1.00 16.79  ? 87  GLY A CA  1 
ATOM   718  C  C   . GLY A 1 88  ? 11.516  11.244 14.391 1.00 16.67  ? 87  GLY A C   1 
ATOM   719  O  O   . GLY A 1 88  ? 11.504  10.704 15.498 1.00 17.58  ? 87  GLY A O   1 
ATOM   720  N  N   . HIS A 1 89  ? 11.289  10.576 13.268 1.00 14.47  ? 88  HIS A N   1 
ATOM   721  C  CA  . HIS A 1 89  ? 10.901  9.167  13.300 1.00 15.28  ? 88  HIS A CA  1 
ATOM   722  C  C   . HIS A 1 89  ? 11.104  8.478  11.954 1.00 13.93  ? 88  HIS A C   1 
ATOM   723  O  O   . HIS A 1 89  ? 11.117  9.126  10.905 1.00 15.02  ? 88  HIS A O   1 
ATOM   724  C  CB  . HIS A 1 89  ? 9.423   9.007  13.763 1.00 16.29  ? 88  HIS A CB  1 
ATOM   725  C  CG  . HIS A 1 89  ? 8.408   9.645  12.859 1.00 13.64  ? 88  HIS A CG  1 
ATOM   726  N  ND1 . HIS A 1 89  ? 8.109   10.991 12.910 1.00 16.53  ? 88  HIS A ND1 1 
ATOM   727  C  CD2 . HIS A 1 89  ? 7.611   9.121  11.900 1.00 15.22  ? 88  HIS A CD2 1 
ATOM   728  C  CE1 . HIS A 1 89  ? 7.182   11.267 12.008 1.00 15.24  ? 88  HIS A CE1 1 
ATOM   729  N  NE2 . HIS A 1 89  ? 6.875   10.153 11.369 1.00 16.22  ? 88  HIS A NE2 1 
ATOM   730  N  N   . PHE A 1 90  ? 11.278  7.156  12.021 1.00 16.82  ? 89  PHE A N   1 
ATOM   731  C  CA  . PHE A 1 90  ? 11.079  6.252  10.892 1.00 18.20  ? 89  PHE A CA  1 
ATOM   732  C  C   . PHE A 1 90  ? 9.608   5.874  10.859 1.00 17.34  ? 89  PHE A C   1 
ATOM   733  O  O   . PHE A 1 90  ? 8.899   6.015  11.871 1.00 18.31  ? 89  PHE A O   1 
ATOM   734  C  CB  . PHE A 1 90  ? 11.906  4.952  11.048 1.00 14.82  ? 89  PHE A CB  1 
ATOM   735  C  CG  . PHE A 1 90  ? 13.392  5.113  10.788 1.00 15.23  ? 89  PHE A CG  1 
ATOM   736  C  CD1 . PHE A 1 90  ? 13.889  5.042  9.498  1.00 17.14  ? 89  PHE A CD1 1 
ATOM   737  C  CD2 . PHE A 1 90  ? 14.282  5.288  11.838 1.00 16.00  ? 89  PHE A CD2 1 
ATOM   738  C  CE1 . PHE A 1 90  ? 15.247  5.179  9.255  1.00 16.13  ? 89  PHE A CE1 1 
ATOM   739  C  CE2 . PHE A 1 90  ? 15.645  5.451  11.591 1.00 18.04  ? 89  PHE A CE2 1 
ATOM   740  C  CZ  . PHE A 1 90  ? 16.122  5.381  10.294 1.00 19.41  ? 89  PHE A CZ  1 
ATOM   741  N  N   . HIS A 1 91  ? 9.134   5.410  9.711  1.00 16.20  ? 90  HIS A N   1 
ATOM   742  C  CA  . HIS A 1 91  ? 7.834   4.736  9.651  1.00 17.50  ? 90  HIS A CA  1 
ATOM   743  C  C   . HIS A 1 91  ? 7.950   3.323  10.237 1.00 22.92  ? 90  HIS A C   1 
ATOM   744  O  O   . HIS A 1 91  ? 9.024   2.717  10.229 1.00 18.98  ? 90  HIS A O   1 
ATOM   745  C  CB  . HIS A 1 91  ? 7.329   4.700  8.210  1.00 15.22  ? 90  HIS A CB  1 
ATOM   746  C  CG  . HIS A 1 91  ? 7.041   6.056  7.645  1.00 15.92  ? 90  HIS A CG  1 
ATOM   747  N  ND1 . HIS A 1 91  ? 7.464   6.452  6.395  1.00 20.20  ? 90  HIS A ND1 1 
ATOM   748  C  CD2 . HIS A 1 91  ? 6.389   7.119  8.172  1.00 16.67  ? 90  HIS A CD2 1 
ATOM   749  C  CE1 . HIS A 1 91  ? 7.074   7.695  6.172  1.00 21.05  ? 90  HIS A CE1 1 
ATOM   750  N  NE2 . HIS A 1 91  ? 6.427   8.126  7.240  1.00 18.21  ? 90  HIS A NE2 1 
ATOM   751  N  N   . ALA A 1 92  ? 6.850   2.808  10.784 1.00 17.49  ? 91  ALA A N   1 
ATOM   752  C  CA  . ALA A 1 92  ? 6.801   1.415  11.216 1.00 17.09  ? 91  ALA A CA  1 
ATOM   753  C  C   . ALA A 1 92  ? 6.848   0.462  10.015 1.00 19.91  ? 91  ALA A C   1 
ATOM   754  O  O   . ALA A 1 92  ? 7.545   -0.559 10.052 1.00 22.20  ? 91  ALA A O   1 
ATOM   755  C  CB  . ALA A 1 92  ? 5.548   1.145  12.068 1.00 17.15  ? 91  ALA A CB  1 
ATOM   756  N  N   . LYS A 1 93  ? 6.085   0.786  8.971  1.00 18.04  ? 92  LYS A N   1 
ATOM   757  C  CA  . LYS A 1 93  ? 6.256   0.189  7.652  1.00 17.80  ? 92  LYS A CA  1 
ATOM   758  C  C   . LYS A 1 93  ? 7.249   1.079  6.932  1.00 19.04  ? 92  LYS A C   1 
ATOM   759  O  O   . LYS A 1 93  ? 6.891   2.143  6.404  1.00 17.69  ? 92  LYS A O   1 
ATOM   760  C  CB  . LYS A 1 93  ? 4.930   0.105  6.898  1.00 20.06  ? 92  LYS A CB  1 
ATOM   761  C  CG  . LYS A 1 93  ? 3.933   -0.802 7.577  1.00 23.65  ? 92  LYS A CG  1 
ATOM   762  C  CD  . LYS A 1 93  ? 2.745   -1.086 6.689  1.00 29.21  ? 92  LYS A CD  1 
ATOM   763  C  CE  . LYS A 1 93  ? 1.636   -1.773 7.465  1.00 32.09  ? 92  LYS A CE  1 
ATOM   764  N  NZ  . LYS A 1 93  ? 1.102   -2.972 6.761  1.00 96.31  ? 92  LYS A NZ  1 
ATOM   765  N  N   . LEU A 1 94  ? 8.504   0.633  6.932  1.00 17.89  ? 93  LEU A N   1 
ATOM   766  C  CA  . LEU A 1 94  ? 9.636   1.476  6.562  1.00 16.71  ? 93  LEU A CA  1 
ATOM   767  C  C   . LEU A 1 94  ? 9.575   2.047  5.153  1.00 19.50  ? 93  LEU A C   1 
ATOM   768  O  O   . LEU A 1 94  ? 10.037  3.164  4.938  1.00 19.91  ? 93  LEU A O   1 
ATOM   769  C  CB  . LEU A 1 94  ? 10.956  0.713  6.732  1.00 18.11  ? 93  LEU A CB  1 
ATOM   770  C  CG  . LEU A 1 94  ? 11.539  0.652  8.135  1.00 24.55  ? 93  LEU A CG  1 
ATOM   771  C  CD1 . LEU A 1 94  ? 12.602  -0.446 8.196  1.00 32.88  ? 93  LEU A CD1 1 
ATOM   772  C  CD2 . LEU A 1 94  ? 12.121  1.993  8.562  1.00 21.46  ? 93  LEU A CD2 1 
ATOM   773  N  N   . ASP A 1 95  ? 9.006   1.305  4.205  1.00 16.89  ? 94  ASP A N   1 
ATOM   774  C  CA  . ASP A 1 95  ? 9.014   1.730  2.800  1.00 22.24  ? 94  ASP A CA  1 
ATOM   775  C  C   . ASP A 1 95  ? 7.946   2.782  2.431  1.00 17.52  ? 94  ASP A C   1 
ATOM   776  O  O   . ASP A 1 95  ? 7.828   3.164  1.269  1.00 18.46  ? 94  ASP A O   1 
ATOM   777  C  CB  . ASP A 1 95  ? 8.961   0.533  1.845  1.00 21.09  ? 94  ASP A CB  1 
ATOM   778  C  CG  . ASP A 1 95  ? 7.692   -0.271 1.978  1.00 25.98  ? 94  ASP A CG  1 
ATOM   779  O  OD1 . ASP A 1 95  ? 7.515   -1.256 1.231  1.00 24.07  ? 94  ASP A OD1 1 
ATOM   780  O  OD2 . ASP A 1 95  ? 6.811   0.006  2.801  1.00 24.79  ? 94  ASP A OD2 1 
ATOM   781  N  N   . ARG A 1 96  ? 7.181   3.263  3.408  1.00 19.34  ? 95  ARG A N   1 
ATOM   782  C  CA  . ARG A 1 96  ? 6.247   4.353  3.132  1.00 19.25  ? 95  ARG A CA  1 
ATOM   783  C  C   . ARG A 1 96  ? 7.006   5.680  2.964  1.00 16.03  ? 95  ARG A C   1 
ATOM   784  O  O   . ARG A 1 96  ? 8.023   5.928  3.654  1.00 17.78  ? 95  ARG A O   1 
ATOM   785  C  CB  . ARG A 1 96  ? 5.187   4.463  4.231  1.00 17.11  ? 95  ARG A CB  1 
ATOM   786  C  CG  . ARG A 1 96  ? 3.966   3.556  4.036  1.00 18.37  ? 95  ARG A CG  1 
ATOM   787  C  CD  . ARG A 1 96  ? 4.279   2.116  3.678  1.00 21.44  ? 95  ARG A CD  1 
ATOM   788  N  NE  . ARG A 1 96  ? 3.054   1.323  3.529  1.00 19.29  ? 95  ARG A NE  1 
ATOM   789  C  CZ  . ARG A 1 96  ? 2.961   0.180  2.850  1.00 21.71  ? 95  ARG A CZ  1 
ATOM   790  N  NH1 . ARG A 1 96  ? 4.017   -0.342 2.252  1.00 20.47  ? 95  ARG A NH1 1 
ATOM   791  N  NH2 . ARG A 1 96  ? 1.795   -0.450 2.760  1.00 25.95  ? 95  ARG A NH2 1 
ATOM   792  N  N   . ALA A 1 97  ? 6.501   6.506  2.040  1.00 14.78  ? 96  ALA A N   1 
ATOM   793  C  CA  . ALA A 1 97  ? 7.005   7.863  1.779  1.00 15.60  ? 96  ALA A CA  1 
ATOM   794  C  C   . ALA A 1 97  ? 6.151   8.931  2.475  1.00 14.55  ? 96  ALA A C   1 
ATOM   795  O  O   . ALA A 1 97  ? 5.109   8.611  3.055  1.00 16.43  ? 96  ALA A O   1 
ATOM   796  C  CB  . ALA A 1 97  ? 7.019   8.138  0.287  1.00 16.43  ? 96  ALA A CB  1 
ATOM   797  N  N   . GLU A 1 98  ? 6.606   10.185 2.420  1.00 14.66  ? 97  GLU A N   1 
ATOM   798  C  CA  . GLU A 1 98  ? 5.772   11.359 2.720  1.00 12.98  ? 97  GLU A CA  1 
ATOM   799  C  C   . GLU A 1 98  ? 6.024   12.466 1.715  1.00 16.96  ? 97  GLU A C   1 
ATOM   800  O  O   . GLU A 1 98  ? 7.057   12.480 1.034  1.00 15.78  ? 97  GLU A O   1 
ATOM   801  C  CB  . GLU A 1 98  ? 6.021   11.924 4.129  1.00 16.16  ? 97  GLU A CB  1 
ATOM   802  C  CG  . GLU A 1 98  ? 6.063   10.898 5.247  1.00 15.41  ? 97  GLU A CG  1 
ATOM   803  C  CD  . GLU A 1 98  ? 5.515   11.383 6.593  1.00 14.85  ? 97  GLU A CD  1 
ATOM   804  O  OE1 . GLU A 1 98  ? 5.061   12.547 6.703  1.00 16.24  ? 97  GLU A OE1 1 
ATOM   805  O  OE2 . GLU A 1 98  ? 5.580   10.587 7.554  1.00 16.27  ? 97  GLU A OE2 1 
ATOM   806  N  N   . VAL A 1 99  ? 5.095   13.410 1.640  1.00 14.68  ? 98  VAL A N   1 
ATOM   807  C  CA  . VAL A 1 99  ? 5.266   14.649 0.883  1.00 13.17  ? 98  VAL A CA  1 
ATOM   808  C  C   . VAL A 1 99  ? 4.923   15.818 1.802  1.00 16.06  ? 98  VAL A C   1 
ATOM   809  O  O   . VAL A 1 99  ? 3.853   15.838 2.407  1.00 16.81  ? 98  VAL A O   1 
ATOM   810  C  CB  . VAL A 1 99  ? 4.366   14.715 -0.370 1.00 17.43  ? 98  VAL A CB  1 
ATOM   811  C  CG1 . VAL A 1 99  ? 4.439   16.086 -1.025 1.00 14.24  ? 98  VAL A CG1 1 
ATOM   812  C  CG2 . VAL A 1 99  ? 4.739   13.617 -1.365 1.00 16.79  ? 98  VAL A CG2 1 
ATOM   813  N  N   . TYR A 1 100 ? 5.836   16.781 1.902  1.00 15.29  ? 99  TYR A N   1 
ATOM   814  C  CA  . TYR A 1 100 ? 5.649   17.981 2.726  1.00 14.85  ? 99  TYR A CA  1 
ATOM   815  C  C   . TYR A 1 100 ? 5.516   19.222 1.848  1.00 19.37  ? 99  TYR A C   1 
ATOM   816  O  O   . TYR A 1 100 ? 6.158   19.323 0.804  1.00 16.93  ? 99  TYR A O   1 
ATOM   817  C  CB  . TYR A 1 100 ? 6.851   18.200 3.634  1.00 15.51  ? 99  TYR A CB  1 
ATOM   818  C  CG  . TYR A 1 100 ? 6.854   17.465 4.953  1.00 12.53  ? 99  TYR A CG  1 
ATOM   819  C  CD1 . TYR A 1 100 ? 6.742   16.077 5.026  1.00 14.35  ? 99  TYR A CD1 1 
ATOM   820  C  CD2 . TYR A 1 100 ? 7.031   18.154 6.142  1.00 15.83  ? 99  TYR A CD2 1 
ATOM   821  C  CE1 . TYR A 1 100 ? 6.787   15.413 6.259  1.00 14.62  ? 99  TYR A CE1 1 
ATOM   822  C  CE2 . TYR A 1 100 ? 7.076   17.496 7.369  1.00 15.08  ? 99  TYR A CE2 1 
ATOM   823  C  CZ  . TYR A 1 100 ? 6.943   16.135 7.432  1.00 16.31  ? 99  TYR A CZ  1 
ATOM   824  O  OH  . TYR A 1 100 ? 6.979   15.514 8.661  1.00 18.56  ? 99  TYR A OH  1 
ATOM   825  N  N   . VAL A 1 101 ? 4.706   20.181 2.282  1.00 15.94  ? 100 VAL A N   1 
ATOM   826  C  CA  . VAL A 1 101 ? 4.587   21.476 1.620  1.00 15.39  ? 100 VAL A CA  1 
ATOM   827  C  C   . VAL A 1 101 ? 4.861   22.595 2.640  1.00 15.75  ? 100 VAL A C   1 
ATOM   828  O  O   . VAL A 1 101 ? 4.124   22.728 3.614  1.00 18.50  ? 100 VAL A O   1 
ATOM   829  C  CB  . VAL A 1 101 ? 3.169   21.689 1.056  1.00 20.75  ? 100 VAL A CB  1 
ATOM   830  C  CG1 . VAL A 1 101 ? 3.131   22.925 0.178  1.00 23.15  ? 100 VAL A CG1 1 
ATOM   831  C  CG2 . VAL A 1 101 ? 2.679   20.435 0.312  1.00 21.70  ? 100 VAL A CG2 1 
ATOM   832  N  N   . ALA A 1 102 ? 5.934   23.366 2.443  1.00 15.94  ? 101 ALA A N   1 
ATOM   833  C  CA  . ALA A 1 102 ? 6.260   24.466 3.353  1.00 17.85  ? 101 ALA A CA  1 
ATOM   834  C  C   . ALA A 1 102 ? 5.316   25.644 3.106  1.00 16.55  ? 101 ALA A C   1 
ATOM   835  O  O   . ALA A 1 102 ? 5.077   25.993 1.959  1.00 17.49  ? 101 ALA A O   1 
ATOM   836  C  CB  . ALA A 1 102 ? 7.715   24.896 3.165  1.00 21.01  ? 101 ALA A CB  1 
ATOM   837  N  N   . LEU A 1 103 ? 4.785   26.243 4.181  1.00 18.31  ? 102 LEU A N   1 
ATOM   838  C  CA  . LEU A 1 103 ? 3.770   27.313 4.076  1.00 16.94  ? 102 LEU A CA  1 
ATOM   839  C  C   . LEU A 1 103 ? 4.227   28.683 4.590  1.00 22.28  ? 102 LEU A C   1 
ATOM   840  O  O   . LEU A 1 103 ? 3.864   29.715 4.023  1.00 21.49  ? 102 LEU A O   1 
ATOM   841  C  CB  . LEU A 1 103 ? 2.494   26.908 4.814  1.00 18.02  ? 102 LEU A CB  1 
ATOM   842  C  CG  . LEU A 1 103 ? 1.830   25.610 4.325  1.00 17.20  ? 102 LEU A CG  1 
ATOM   843  C  CD1 . LEU A 1 103 ? 0.705   25.178 5.243  1.00 18.14  ? 102 LEU A CD1 1 
ATOM   844  C  CD2 . LEU A 1 103 ? 1.341   25.736 2.907  1.00 21.64  ? 102 LEU A CD2 1 
ATOM   845  N  N   . LYS A 1 104 ? 4.997   28.698 5.673  1.00 20.25  ? 103 LYS A N   1 
ATOM   846  C  CA  . LYS A 1 104 ? 5.374   29.954 6.315  1.00 20.27  ? 103 LYS A CA  1 
ATOM   847  C  C   . LYS A 1 104 ? 6.653   29.760 7.098  1.00 26.21  ? 103 LYS A C   1 
ATOM   848  O  O   . LYS A 1 104 ? 6.894   28.680 7.637  1.00 20.71  ? 103 LYS A O   1 
ATOM   849  C  CB  . LYS A 1 104 ? 4.263   30.467 7.239  1.00 19.23  ? 103 LYS A CB  1 
ATOM   850  C  CG  . LYS A 1 104 ? 4.356   31.963 7.565  1.00 27.90  ? 103 LYS A CG  1 
ATOM   851  C  CD  . LYS A 1 104 ? 3.241   32.401 8.504  1.00 30.77  ? 103 LYS A CD  1 
ATOM   852  C  CE  . LYS A 1 104 ? 3.239   33.912 8.727  1.00 32.01  ? 103 LYS A CE  1 
ATOM   853  N  NZ  . LYS A 1 104 ? 2.048   34.351 9.510  1.00 42.26  ? 103 LYS A NZ  1 
ATOM   854  N  N   . GLY A 1 105 ? 7.478   30.802 7.143  1.00 19.62  ? 104 GLY A N   1 
ATOM   855  C  CA  . GLY A 1 105 ? 8.705   30.766 7.910  1.00 20.24  ? 104 GLY A CA  1 
ATOM   856  C  C   . GLY A 1 105 ? 9.888   30.182 7.160  1.00 18.68  ? 104 GLY A C   1 
ATOM   857  O  O   . GLY A 1 105 ? 9.868   30.031 5.936  1.00 23.55  ? 104 GLY A O   1 
ATOM   858  N  N   . LYS A 1 106 ? 10.936  29.880 7.915  1.00 20.43  ? 105 LYS A N   1 
ATOM   859  C  CA  . LYS A 1 106 ? 12.196  29.417 7.354  1.00 22.60  ? 105 LYS A CA  1 
ATOM   860  C  C   . LYS A 1 106 ? 12.698  28.225 8.165  1.00 17.49  ? 105 LYS A C   1 
ATOM   861  O  O   . LYS A 1 106 ? 12.851  28.302 9.383  1.00 20.28  ? 105 LYS A O   1 
ATOM   862  C  CB  . LYS A 1 106 ? 13.231  30.545 7.353  1.00 31.25  ? 105 LYS A CB  1 
ATOM   863  C  CG  . LYS A 1 106 ? 14.346  30.334 6.340  1.00 35.00  ? 105 LYS A CG  1 
ATOM   864  C  CD  . LYS A 1 106 ? 15.229  31.560 6.190  1.00 112.87 ? 105 LYS A CD  1 
ATOM   865  C  CE  . LYS A 1 106 ? 16.492  31.226 5.410  1.00 66.47  ? 105 LYS A CE  1 
ATOM   866  N  NZ  . LYS A 1 106 ? 17.231  32.444 4.980  1.00 49.28  ? 105 LYS A NZ  1 
ATOM   867  N  N   . GLY A 1 107 ? 12.914  27.112 7.478  1.00 20.24  ? 106 GLY A N   1 
ATOM   868  C  CA  . GLY A 1 107 ? 13.332  25.897 8.144  1.00 19.30  ? 106 GLY A CA  1 
ATOM   869  C  C   . GLY A 1 107 ? 13.959  24.923 7.181  1.00 19.52  ? 106 GLY A C   1 
ATOM   870  O  O   . GLY A 1 107 ? 14.523  25.298 6.153  1.00 21.34  ? 106 GLY A O   1 
ATOM   871  N  N   . GLY A 1 108 ? 13.840  23.650 7.511  1.00 16.45  ? 107 GLY A N   1 
ATOM   872  C  CA  . GLY A 1 108 ? 14.364  22.611 6.657  1.00 18.94  ? 107 GLY A CA  1 
ATOM   873  C  C   . GLY A 1 108 ? 14.124  21.234 7.226  1.00 17.82  ? 107 GLY A C   1 
ATOM   874  O  O   . GLY A 1 108 ? 13.609  21.078 8.331  1.00 17.33  ? 107 GLY A O   1 
HETATM 875  N  N   . MSE A 1 109 ? 14.495  20.226 6.451  1.00 16.36  ? 108 MSE A N   1 
HETATM 876  C  CA  . MSE A 1 109 ? 14.316  18.849 6.854  1.00 20.07  ? 108 MSE A CA  1 
HETATM 877  C  C   . MSE A 1 109 ? 15.652  18.142 6.930  1.00 19.26  ? 108 MSE A C   1 
HETATM 878  O  O   . MSE A 1 109 ? 16.472  18.276 6.022  1.00 17.14  ? 108 MSE A O   1 
HETATM 879  C  CB  . MSE A 1 109 ? 13.428  18.097 5.865  1.00 16.02  ? 108 MSE A CB  1 
HETATM 880  C  CG  . MSE A 1 109 ? 13.139  16.695 6.326  1.00 24.63  ? 108 MSE A CG  1 
HETATM 881  SE SE  . MSE A 1 109 ? 11.854  15.755 5.254  1.00 23.37  ? 108 MSE A SE  1 
HETATM 882  C  CE  . MSE A 1 109 ? 10.306  16.981 5.333  1.00 16.56  ? 108 MSE A CE  1 
ATOM   883  N  N   . LEU A 1 110 ? 15.864  17.423 8.024  1.00 16.76  ? 109 LEU A N   1 
ATOM   884  C  CA  . LEU A 1 110 ? 16.945  16.447 8.158  1.00 18.29  ? 109 LEU A CA  1 
ATOM   885  C  C   . LEU A 1 110 ? 16.365  15.075 7.899  1.00 18.44  ? 109 LEU A C   1 
ATOM   886  O  O   . LEU A 1 110 ? 15.355  14.717 8.509  1.00 16.73  ? 109 LEU A O   1 
ATOM   887  C  CB  . LEU A 1 110 ? 17.533  16.468 9.571  1.00 19.21  ? 109 LEU A CB  1 
ATOM   888  C  CG  . LEU A 1 110 ? 18.535  17.540 9.969  1.00 31.82  ? 109 LEU A CG  1 
ATOM   889  C  CD1 . LEU A 1 110 ? 18.902  17.320 11.430 1.00 40.34  ? 109 LEU A CD1 1 
ATOM   890  C  CD2 . LEU A 1 110 ? 19.789  17.521 9.093  1.00 25.31  ? 109 LEU A CD2 1 
ATOM   891  N  N   . LEU A 1 111 ? 16.998  14.303 7.014  1.00 17.06  ? 110 LEU A N   1 
ATOM   892  C  CA  . LEU A 1 111 ? 16.625  12.919 6.728  1.00 16.95  ? 110 LEU A CA  1 
ATOM   893  C  C   . LEU A 1 111 ? 17.799  11.990 7.001  1.00 17.14  ? 110 LEU A C   1 
ATOM   894  O  O   . LEU A 1 111 ? 18.946  12.404 6.868  1.00 20.11  ? 110 LEU A O   1 
ATOM   895  C  CB  . LEU A 1 111 ? 16.181  12.782 5.275  1.00 16.53  ? 110 LEU A CB  1 
ATOM   896  C  CG  . LEU A 1 111 ? 15.006  13.698 4.894  1.00 17.18  ? 110 LEU A CG  1 
ATOM   897  C  CD1 . LEU A 1 111 ? 15.488  14.942 4.171  1.00 18.86  ? 110 LEU A CD1 1 
ATOM   898  C  CD2 . LEU A 1 111 ? 13.962  12.960 4.059  1.00 17.15  ? 110 LEU A CD2 1 
ATOM   899  N  N   . GLN A 1 112 ? 17.511  10.743 7.361  1.00 16.29  ? 111 GLN A N   1 
ATOM   900  C  CA  . GLN A 1 112 ? 18.552  9.746  7.652  1.00 21.89  ? 111 GLN A CA  1 
ATOM   901  C  C   . GLN A 1 112 ? 18.121  8.315  7.286  1.00 21.53  ? 111 GLN A C   1 
ATOM   902  O  O   . GLN A 1 112 ? 16.992  7.923  7.550  1.00 18.77  ? 111 GLN A O   1 
ATOM   903  C  CB  . GLN A 1 112 ? 18.874  9.839  9.134  1.00 23.40  ? 111 GLN A CB  1 
ATOM   904  C  CG  . GLN A 1 112 ? 19.833  8.838  9.695  1.00 29.53  ? 111 GLN A CG  1 
ATOM   905  C  CD  . GLN A 1 112 ? 20.346  9.309  11.037 1.00 30.13  ? 111 GLN A CD  1 
ATOM   906  O  OE1 . GLN A 1 112 ? 20.860  10.411 11.127 1.00 24.70  ? 111 GLN A OE1 1 
ATOM   907  N  NE2 . GLN A 1 112 ? 20.161  8.510  12.077 1.00 34.07  ? 111 GLN A NE2 1 
ATOM   908  N  N   . THR A 1 113 ? 19.024  7.527  6.701  1.00 20.61  ? 112 THR A N   1 
ATOM   909  C  CA  . THR A 1 113 ? 18.727  6.133  6.368  1.00 21.58  ? 112 THR A CA  1 
ATOM   910  C  C   . THR A 1 113 ? 18.980  5.258  7.592  1.00 22.30  ? 112 THR A C   1 
ATOM   911  O  O   . THR A 1 113 ? 19.607  5.703  8.550  1.00 22.84  ? 112 THR A O   1 
ATOM   912  C  CB  . THR A 1 113 ? 19.602  5.618  5.188  1.00 18.91  ? 112 THR A CB  1 
ATOM   913  O  OG1 . THR A 1 113 ? 20.972  5.525  5.610  1.00 24.22  ? 112 THR A OG1 1 
ATOM   914  C  CG2 . THR A 1 113 ? 19.620  6.590  4.016  1.00 27.75  ? 112 THR A CG2 1 
ATOM   915  N  N   . PRO A 1 114 ? 18.514  4.008  7.566  1.00 23.60  ? 113 PRO A N   1 
ATOM   916  C  CA  . PRO A 1 114 ? 18.837  3.052  8.631  1.00 26.46  ? 113 PRO A CA  1 
ATOM   917  C  C   . PRO A 1 114 ? 20.338  2.829  8.802  1.00 26.75  ? 113 PRO A C   1 
ATOM   918  O  O   . PRO A 1 114 ? 20.769  2.459  9.889  1.00 35.94  ? 113 PRO A O   1 
ATOM   919  C  CB  . PRO A 1 114 ? 18.125  1.773  8.177  1.00 32.34  ? 113 PRO A CB  1 
ATOM   920  C  CG  . PRO A 1 114 ? 17.001  2.275  7.312  1.00 29.31  ? 113 PRO A CG  1 
ATOM   921  C  CD  . PRO A 1 114 ? 17.614  3.410  6.563  1.00 30.84  ? 113 PRO A CD  1 
ATOM   922  N  N   . GLU A 1 115 ? 21.113  3.076  7.749  1.00 24.75  ? 114 GLU A N   1 
ATOM   923  C  CA  . GLU A 1 115 ? 22.574  2.972  7.819  1.00 36.26  ? 114 GLU A CA  1 
ATOM   924  C  C   . GLU A 1 115 ? 23.243  4.203  8.447  1.00 41.08  ? 114 GLU A C   1 
ATOM   925  O  O   . GLU A 1 115 ? 24.403  4.134  8.858  1.00 41.56  ? 114 GLU A O   1 
ATOM   926  C  CB  . GLU A 1 115 ? 23.145  2.704  6.428  1.00 37.89  ? 114 GLU A CB  1 
ATOM   927  C  CG  . GLU A 1 115 ? 22.728  1.351  5.863  1.00 37.22  ? 114 GLU A CG  1 
ATOM   928  C  CD  . GLU A 1 115 ? 23.094  1.168  4.401  1.00 109.96 ? 114 GLU A CD  1 
ATOM   929  O  OE1 . GLU A 1 115 ? 23.768  2.049  3.820  1.00 66.29  ? 114 GLU A OE1 1 
ATOM   930  O  OE2 . GLU A 1 115 ? 22.694  0.136  3.825  1.00 67.13  ? 114 GLU A OE2 1 
ATOM   931  N  N   . GLY A 1 116 ? 22.523  5.322  8.511  1.00 28.99  ? 115 GLY A N   1 
ATOM   932  C  CA  . GLY A 1 116 ? 22.977  6.501  9.237  1.00 38.52  ? 115 GLY A CA  1 
ATOM   933  C  C   . GLY A 1 116 ? 23.379  7.683  8.372  1.00 33.77  ? 115 GLY A C   1 
ATOM   934  O  O   . GLY A 1 116 ? 23.771  8.723  8.903  1.00 36.59  ? 115 GLY A O   1 
ATOM   935  N  N   . ASP A 1 117 ? 23.294  7.533  7.051  1.00 30.41  ? 116 ASP A N   1 
ATOM   936  C  CA  . ASP A 1 117 ? 23.604  8.626  6.126  1.00 34.73  ? 116 ASP A CA  1 
ATOM   937  C  C   . ASP A 1 117 ? 22.515  9.682  6.204  1.00 27.17  ? 116 ASP A C   1 
ATOM   938  O  O   . ASP A 1 117 ? 21.341  9.338  6.194  1.00 21.30  ? 116 ASP A O   1 
ATOM   939  C  CB  . ASP A 1 117 ? 23.700  8.120  4.687  1.00 33.46  ? 116 ASP A CB  1 
ATOM   940  C  CG  . ASP A 1 117 ? 24.961  7.317  4.435  1.00 115.43 ? 116 ASP A CG  1 
ATOM   941  O  OD1 . ASP A 1 117 ? 25.150  6.278  5.102  1.00 88.34  ? 116 ASP A OD1 1 
ATOM   942  O  OD2 . ASP A 1 117 ? 25.821  7.648  3.593  1.00 102.34 ? 116 ASP A OD2 1 
ATOM   943  N  N   . ALA A 1 118 ? 22.903  10.953 6.275  1.00 28.56  ? 117 ALA A N   1 
ATOM   944  C  CA  . ALA A 1 118 ? 21.952  12.043 6.484  1.00 29.91  ? 117 ALA A CA  1 
ATOM   945  C  C   . ALA A 1 118 ? 21.982  13.096 5.378  1.00 33.56  ? 117 ALA A C   1 
ATOM   946  O  O   . ALA A 1 118 ? 23.021  13.349 4.774  1.00 42.89  ? 117 ALA A O   1 
ATOM   947  C  CB  . ALA A 1 118 ? 22.185  12.692 7.840  1.00 31.24  ? 117 ALA A CB  1 
ATOM   948  N  N   . LYS A 1 119 ? 20.823  13.711 5.143  1.00 21.35  ? 118 LYS A N   1 
ATOM   949  C  CA  . LYS A 1 119 ? 20.634  14.742 4.123  1.00 25.47  ? 118 LYS A CA  1 
ATOM   950  C  C   . LYS A 1 119 ? 19.856  15.914 4.720  1.00 22.36  ? 118 LYS A C   1 
ATOM   951  O  O   . LYS A 1 119 ? 18.971  15.707 5.543  1.00 20.21  ? 118 LYS A O   1 
ATOM   952  C  CB  . LYS A 1 119 ? 19.849  14.146 2.949  1.00 28.00  ? 118 LYS A CB  1 
ATOM   953  C  CG  . LYS A 1 119 ? 19.453  15.117 1.829  1.00 45.37  ? 118 LYS A CG  1 
ATOM   954  C  CD  . LYS A 1 119 ? 20.637  15.479 0.942  1.00 111.83 ? 118 LYS A CD  1 
ATOM   955  C  CE  . LYS A 1 119 ? 20.195  15.926 -0.448 1.00 73.93  ? 118 LYS A CE  1 
ATOM   956  N  NZ  . LYS A 1 119 ? 19.447  14.863 -1.175 1.00 44.81  ? 118 LYS A NZ  1 
ATOM   957  N  N   . TRP A 1 120 ? 20.179  17.128 4.290  1.00 20.84  ? 119 TRP A N   1 
ATOM   958  C  CA  . TRP A 1 120 ? 19.454  18.339 4.663  1.00 20.69  ? 119 TRP A CA  1 
ATOM   959  C  C   . TRP A 1 120 ? 18.839  18.961 3.410  1.00 23.61  ? 119 TRP A C   1 
ATOM   960  O  O   . TRP A 1 120 ? 19.509  19.105 2.386  1.00 21.95  ? 119 TRP A O   1 
ATOM   961  C  CB  . TRP A 1 120 ? 20.385  19.358 5.324  1.00 21.12  ? 119 TRP A CB  1 
ATOM   962  C  CG  . TRP A 1 120 ? 19.803  20.747 5.460  1.00 18.49  ? 119 TRP A CG  1 
ATOM   963  C  CD1 . TRP A 1 120 ? 19.983  21.795 4.604  1.00 22.85  ? 119 TRP A CD1 1 
ATOM   964  C  CD2 . TRP A 1 120 ? 18.970  21.240 6.517  1.00 16.16  ? 119 TRP A CD2 1 
ATOM   965  N  NE1 . TRP A 1 120 ? 19.308  22.902 5.056  1.00 24.14  ? 119 TRP A NE1 1 
ATOM   966  C  CE2 . TRP A 1 120 ? 18.671  22.586 6.225  1.00 20.78  ? 119 TRP A CE2 1 
ATOM   967  C  CE3 . TRP A 1 120 ? 18.418  20.672 7.669  1.00 21.73  ? 119 TRP A CE3 1 
ATOM   968  C  CZ2 . TRP A 1 120 ? 17.877  23.374 7.056  1.00 19.22  ? 119 TRP A CZ2 1 
ATOM   969  C  CZ3 . TRP A 1 120 ? 17.622  21.467 8.492  1.00 19.62  ? 119 TRP A CZ3 1 
ATOM   970  C  CH2 . TRP A 1 120 ? 17.365  22.793 8.181  1.00 18.84  ? 119 TRP A CH2 1 
ATOM   971  N  N   . ILE A 1 121 ? 17.562  19.322 3.511  1.00 18.23  ? 120 ILE A N   1 
ATOM   972  C  CA  . ILE A 1 121 ? 16.802  19.979 2.451  1.00 17.17  ? 120 ILE A CA  1 
ATOM   973  C  C   . ILE A 1 121 ? 16.230  21.270 3.025  1.00 19.35  ? 120 ILE A C   1 
ATOM   974  O  O   . ILE A 1 121 ? 15.443  21.236 3.967  1.00 21.29  ? 120 ILE A O   1 
ATOM   975  C  CB  . ILE A 1 121 ? 15.637  19.087 1.948  1.00 16.63  ? 120 ILE A CB  1 
ATOM   976  C  CG1 . ILE A 1 121 ? 16.145  17.737 1.427  1.00 25.74  ? 120 ILE A CG1 1 
ATOM   977  C  CG2 . ILE A 1 121 ? 14.818  19.814 0.848  1.00 22.47  ? 120 ILE A CG2 1 
ATOM   978  C  CD1 . ILE A 1 121 ? 17.042  17.823 0.220  1.00 27.16  ? 120 ILE A CD1 1 
ATOM   979  N  N   . SER A 1 122 ? 16.641  22.401 2.473  1.00 20.32  ? 121 SER A N   1 
ATOM   980  C  CA  . SER A 1 122 ? 16.163  23.701 2.913  1.00 21.47  ? 121 SER A CA  1 
ATOM   981  C  C   . SER A 1 122 ? 14.691  23.856 2.522  1.00 17.31  ? 121 SER A C   1 
ATOM   982  O  O   . SER A 1 122 ? 14.266  23.382 1.466  1.00 18.51  ? 121 SER A O   1 
ATOM   983  C  CB  . SER A 1 122 ? 17.007  24.829 2.293  1.00 26.23  ? 121 SER A CB  1 
ATOM   984  O  OG  . SER A 1 122 ? 18.306  24.888 2.874  1.00 33.28  ? 121 SER A OG  1 
HETATM 985  N  N   . MSE A 1 123 ? 13.920  24.536 3.375  1.00 18.74  ? 122 MSE A N   1 
HETATM 986  C  CA  . MSE A 1 123 ? 12.492  24.734 3.146  1.00 16.78  ? 122 MSE A CA  1 
HETATM 987  C  C   . MSE A 1 123 ? 12.094  26.186 3.382  1.00 22.34  ? 122 MSE A C   1 
HETATM 988  O  O   . MSE A 1 123 ? 12.307  26.733 4.461  1.00 22.56  ? 122 MSE A O   1 
HETATM 989  C  CB  . MSE A 1 123 ? 11.658  23.817 4.052  1.00 18.58  ? 122 MSE A CB  1 
HETATM 990  C  CG  . MSE A 1 123 ? 11.816  22.334 3.758  1.00 14.85  ? 122 MSE A CG  1 
HETATM 991  SE SE  . MSE A 1 123 ? 10.980  21.171 5.080  1.00 20.04  ? 122 MSE A SE  1 
HETATM 992  C  CE  . MSE A 1 123 ? 9.094   21.606 4.804  1.00 16.74  ? 122 MSE A CE  1 
ATOM   993  N  N   . GLU A 1 124 ? 11.543  26.805 2.346  1.00 21.59  ? 123 GLU A N   1 
ATOM   994  C  CA  . GLU A 1 124 ? 10.906  28.115 2.453  1.00 22.48  ? 123 GLU A CA  1 
ATOM   995  C  C   . GLU A 1 124 ? 9.521   27.973 1.855  1.00 20.98  ? 123 GLU A C   1 
ATOM   996  O  O   . GLU A 1 124 ? 9.243   26.947 1.221  1.00 21.23  ? 123 GLU A O   1 
ATOM   997  C  CB  . GLU A 1 124 ? 11.724  29.163 1.690  1.00 26.77  ? 123 GLU A CB  1 
ATOM   998  C  CG  . GLU A 1 124 ? 12.094  28.764 0.269  1.00 35.79  ? 123 GLU A CG  1 
ATOM   999  C  CD  . GLU A 1 124 ? 12.512  29.938 -0.598 1.00 152.29 ? 123 GLU A CD  1 
ATOM   1000 O  OE1 . GLU A 1 124 ? 12.253  29.891 -1.821 1.00 52.75  ? 123 GLU A OE1 1 
ATOM   1001 O  OE2 . GLU A 1 124 ? 13.103  30.899 -0.061 1.00 92.21  ? 123 GLU A OE2 1 
ATOM   1002 N  N   . PRO A 1 125 ? 8.641   28.961 2.036  1.00 21.89  ? 124 PRO A N   1 
ATOM   1003 C  CA  . PRO A 1 125 ? 7.270   28.837 1.524  1.00 21.00  ? 124 PRO A CA  1 
ATOM   1004 C  C   . PRO A 1 125 ? 7.240   28.471 0.040  1.00 23.78  ? 124 PRO A C   1 
ATOM   1005 O  O   . PRO A 1 125 ? 7.961   29.063 -0.773 1.00 23.29  ? 124 PRO A O   1 
ATOM   1006 C  CB  . PRO A 1 125 ? 6.665   30.212 1.801  1.00 21.81  ? 124 PRO A CB  1 
ATOM   1007 C  CG  . PRO A 1 125 ? 7.438   30.718 2.987  1.00 25.84  ? 124 PRO A CG  1 
ATOM   1008 C  CD  . PRO A 1 125 ? 8.848   30.248 2.735  1.00 22.65  ? 124 PRO A CD  1 
ATOM   1009 N  N   . GLY A 1 126 ? 6.458   27.446 -0.288 1.00 20.40  ? 125 GLY A N   1 
ATOM   1010 C  CA  . GLY A 1 126 ? 6.350   26.957 -1.652 1.00 19.72  ? 125 GLY A CA  1 
ATOM   1011 C  C   . GLY A 1 126 ? 7.204   25.736 -1.964 1.00 20.21  ? 125 GLY A C   1 
ATOM   1012 O  O   . GLY A 1 126 ? 7.005   25.110 -2.991 1.00 22.82  ? 125 GLY A O   1 
ATOM   1013 N  N   . THR A 1 127 ? 8.146   25.405 -1.088 1.00 17.82  ? 126 THR A N   1 
ATOM   1014 C  CA  . THR A 1 127 ? 9.008   24.244 -1.281 1.00 19.52  ? 126 THR A CA  1 
ATOM   1015 C  C   . THR A 1 127 ? 8.200   23.002 -0.968 1.00 19.55  ? 126 THR A C   1 
ATOM   1016 O  O   . THR A 1 127 ? 7.601   22.927 0.093  1.00 18.80  ? 126 THR A O   1 
ATOM   1017 C  CB  . THR A 1 127 ? 10.215  24.284 -0.320 1.00 22.50  ? 126 THR A CB  1 
ATOM   1018 O  OG1 . THR A 1 127 ? 11.031  25.425 -0.613 1.00 27.67  ? 126 THR A OG1 1 
ATOM   1019 C  CG2 . THR A 1 127 ? 11.147  23.076 -0.530 1.00 17.32  ? 126 THR A CG2 1 
ATOM   1020 N  N   . VAL A 1 128 ? 8.193   22.046 -1.888 1.00 18.44  ? 127 VAL A N   1 
ATOM   1021 C  CA  . VAL A 1 128 ? 7.639   20.720 -1.648 1.00 17.96  ? 127 VAL A CA  1 
ATOM   1022 C  C   . VAL A 1 128 ? 8.789   19.742 -1.478 1.00 18.33  ? 127 VAL A C   1 
ATOM   1023 O  O   . VAL A 1 128 ? 9.702   19.696 -2.314 1.00 18.19  ? 127 VAL A O   1 
ATOM   1024 C  CB  . VAL A 1 128 ? 6.735   20.258 -2.808 1.00 17.98  ? 127 VAL A CB  1 
ATOM   1025 C  CG1 . VAL A 1 128 ? 6.311   18.788 -2.627 1.00 18.98  ? 127 VAL A CG1 1 
ATOM   1026 C  CG2 . VAL A 1 128 ? 5.501   21.162 -2.919 1.00 20.85  ? 127 VAL A CG2 1 
ATOM   1027 N  N   . VAL A 1 129 ? 8.731   18.948 -0.416 1.00 17.31  ? 128 VAL A N   1 
ATOM   1028 C  CA  . VAL A 1 129 ? 9.785   17.990 -0.094 1.00 14.80  ? 128 VAL A CA  1 
ATOM   1029 C  C   . VAL A 1 129 ? 9.285   16.546 -0.235 1.00 18.51  ? 128 VAL A C   1 
ATOM   1030 O  O   . VAL A 1 129 ? 8.265   16.159 0.326  1.00 17.39  ? 128 VAL A O   1 
ATOM   1031 C  CB  . VAL A 1 129 ? 10.356  18.212 1.322  1.00 16.59  ? 128 VAL A CB  1 
ATOM   1032 C  CG1 . VAL A 1 129 ? 11.501  17.223 1.614  1.00 21.33  ? 128 VAL A CG1 1 
ATOM   1033 C  CG2 . VAL A 1 129 ? 10.831  19.653 1.485  1.00 17.35  ? 128 VAL A CG2 1 
ATOM   1034 N  N   . TYR A 1 130 ? 10.027  15.756 -0.994 1.00 16.08  ? 129 TYR A N   1 
ATOM   1035 C  CA  . TYR A 1 130 ? 9.791   14.330 -1.161 1.00 15.89  ? 129 TYR A CA  1 
ATOM   1036 C  C   . TYR A 1 130 ? 10.612  13.562 -0.129 1.00 18.11  ? 129 TYR A C   1 
ATOM   1037 O  O   . TYR A 1 130 ? 11.854  13.567 -0.173 1.00 15.13  ? 129 TYR A O   1 
ATOM   1038 C  CB  . TYR A 1 130 ? 10.183  13.872 -2.571 1.00 14.92  ? 129 TYR A CB  1 
ATOM   1039 C  CG  . TYR A 1 130 ? 10.094  12.378 -2.759 1.00 16.03  ? 129 TYR A CG  1 
ATOM   1040 C  CD1 . TYR A 1 130 ? 11.232  11.612 -2.989 1.00 19.69  ? 129 TYR A CD1 1 
ATOM   1041 C  CD2 . TYR A 1 130 ? 8.870   11.718 -2.699 1.00 15.74  ? 129 TYR A CD2 1 
ATOM   1042 C  CE1 . TYR A 1 130 ? 11.152  10.241 -3.153 1.00 18.36  ? 129 TYR A CE1 1 
ATOM   1043 C  CE2 . TYR A 1 130 ? 8.788   10.332 -2.855 1.00 15.57  ? 129 TYR A CE2 1 
ATOM   1044 C  CZ  . TYR A 1 130 ? 9.928   9.601  -3.096 1.00 17.33  ? 129 TYR A CZ  1 
ATOM   1045 O  OH  . TYR A 1 130 ? 9.825   8.231  -3.247 1.00 16.10  ? 129 TYR A OH  1 
ATOM   1046 N  N   . VAL A 1 131 ? 9.913   12.925 0.803  1.00 17.75  ? 130 VAL A N   1 
ATOM   1047 C  CA  . VAL A 1 131 ? 10.505  12.086 1.842  1.00 14.44  ? 130 VAL A CA  1 
ATOM   1048 C  C   . VAL A 1 131 ? 10.462  10.614 1.390  1.00 17.43  ? 130 VAL A C   1 
ATOM   1049 O  O   . VAL A 1 131 ? 9.408   9.979  1.421  1.00 17.46  ? 130 VAL A O   1 
ATOM   1050 C  CB  . VAL A 1 131 ? 9.727   12.250 3.172  1.00 16.02  ? 130 VAL A CB  1 
ATOM   1051 C  CG1 . VAL A 1 131 ? 10.381  11.471 4.279  1.00 21.91  ? 130 VAL A CG1 1 
ATOM   1052 C  CG2 . VAL A 1 131 ? 9.598   13.725 3.533  1.00 21.88  ? 130 VAL A CG2 1 
ATOM   1053 N  N   . PRO A 1 132 ? 11.579  10.054 0.922  1.00 15.41  ? 131 PRO A N   1 
ATOM   1054 C  CA  . PRO A 1 132 ? 11.521  8.734  0.298  1.00 15.58  ? 131 PRO A CA  1 
ATOM   1055 C  C   . PRO A 1 132 ? 11.320  7.565  1.247  1.00 15.29  ? 131 PRO A C   1 
ATOM   1056 O  O   . PRO A 1 132 ? 11.520  7.665  2.460  1.00 15.82  ? 131 PRO A O   1 
ATOM   1057 C  CB  . PRO A 1 132 ? 12.880  8.614  -0.412 1.00 17.74  ? 131 PRO A CB  1 
ATOM   1058 C  CG  . PRO A 1 132 ? 13.414  9.977  -0.409 1.00 14.39  ? 131 PRO A CG  1 
ATOM   1059 C  CD  . PRO A 1 132 ? 12.939  10.611 0.869  1.00 16.00  ? 131 PRO A CD  1 
ATOM   1060 N  N   . PRO A 1 133 ? 10.931  6.428  0.677  1.00 17.16  ? 132 PRO A N   1 
ATOM   1061 C  CA  . PRO A 1 133 ? 10.884  5.177  1.432  1.00 17.01  ? 132 PRO A CA  1 
ATOM   1062 C  C   . PRO A 1 133 ? 12.172  4.928  2.211  1.00 17.09  ? 132 PRO A C   1 
ATOM   1063 O  O   . PRO A 1 133 ? 13.248  5.227  1.679  1.00 18.53  ? 132 PRO A O   1 
ATOM   1064 C  CB  . PRO A 1 133 ? 10.704  4.130  0.339  1.00 16.81  ? 132 PRO A CB  1 
ATOM   1065 C  CG  . PRO A 1 133 ? 9.957   4.836  -0.702 1.00 20.27  ? 132 PRO A CG  1 
ATOM   1066 C  CD  . PRO A 1 133 ? 10.521  6.231  -0.726 1.00 18.75  ? 132 PRO A CD  1 
ATOM   1067 N  N   . TYR A 1 134 ? 12.050  4.447  3.440  1.00 15.90  ? 133 TYR A N   1 
ATOM   1068 C  CA  . TYR A 1 134 ? 13.150  3.978  4.290  1.00 18.56  ? 133 TYR A CA  1 
ATOM   1069 C  C   . TYR A 1 134 ? 13.900  5.063  5.062  1.00 15.81  ? 133 TYR A C   1 
ATOM   1070 O  O   . TYR A 1 134 ? 14.740  4.732  5.901  1.00 24.53  ? 133 TYR A O   1 
ATOM   1071 C  CB  . TYR A 1 134 ? 14.152  3.090  3.512  1.00 18.27  ? 133 TYR A CB  1 
ATOM   1072 C  CG  . TYR A 1 134 ? 13.548  1.807  3.011  1.00 20.43  ? 133 TYR A CG  1 
ATOM   1073 C  CD1 . TYR A 1 134 ? 13.384  0.719  3.859  1.00 25.58  ? 133 TYR A CD1 1 
ATOM   1074 C  CD2 . TYR A 1 134 ? 13.134  1.682  1.692  1.00 25.90  ? 133 TYR A CD2 1 
ATOM   1075 C  CE1 . TYR A 1 134 ? 12.829  -0.466 3.403  1.00 28.95  ? 133 TYR A CE1 1 
ATOM   1076 C  CE2 . TYR A 1 134 ? 12.568  0.506  1.232  1.00 27.78  ? 133 TYR A CE2 1 
ATOM   1077 C  CZ  . TYR A 1 134 ? 12.428  -0.564 2.093  1.00 24.80  ? 133 TYR A CZ  1 
ATOM   1078 O  OH  . TYR A 1 134 ? 11.863  -1.729 1.630  1.00 31.26  ? 133 TYR A OH  1 
ATOM   1079 N  N   . TRP A 1 135 ? 13.604  6.336  4.810  1.00 14.53  ? 134 TRP A N   1 
ATOM   1080 C  CA  . TRP A 1 135 ? 14.278  7.436  5.500  1.00 14.80  ? 134 TRP A CA  1 
ATOM   1081 C  C   . TRP A 1 135 ? 13.497  7.873  6.744  1.00 17.49  ? 134 TRP A C   1 
ATOM   1082 O  O   . TRP A 1 135 ? 12.267  7.928  6.723  1.00 25.88  ? 134 TRP A O   1 
ATOM   1083 C  CB  . TRP A 1 135 ? 14.437  8.650  4.587  1.00 14.83  ? 134 TRP A CB  1 
ATOM   1084 C  CG  . TRP A 1 135 ? 15.379  8.461  3.405  1.00 14.68  ? 134 TRP A CG  1 
ATOM   1085 C  CD1 . TRP A 1 135 ? 15.099  7.802  2.255  1.00 16.37  ? 134 TRP A CD1 1 
ATOM   1086 C  CD2 . TRP A 1 135 ? 16.709  8.971  3.263  1.00 16.62  ? 134 TRP A CD2 1 
ATOM   1087 N  NE1 . TRP A 1 135 ? 16.179  7.847  1.400  1.00 17.46  ? 134 TRP A NE1 1 
ATOM   1088 C  CE2 . TRP A 1 135 ? 17.175  8.566  1.995  1.00 16.79  ? 134 TRP A CE2 1 
ATOM   1089 C  CE3 . TRP A 1 135 ? 17.554  9.737  4.078  1.00 17.50  ? 134 TRP A CE3 1 
ATOM   1090 C  CZ2 . TRP A 1 135 ? 18.447  8.885  1.527  1.00 19.93  ? 134 TRP A CZ2 1 
ATOM   1091 C  CZ3 . TRP A 1 135 ? 18.828  10.054 3.610  1.00 20.42  ? 134 TRP A CZ3 1 
ATOM   1092 C  CH2 . TRP A 1 135 ? 19.254  9.631  2.347  1.00 19.06  ? 134 TRP A CH2 1 
ATOM   1093 N  N   . ALA A 1 136 ? 14.216  8.170  7.818  1.00 16.34  ? 135 ALA A N   1 
ATOM   1094 C  CA  . ALA A 1 136 ? 13.673  8.909  8.955  1.00 15.43  ? 135 ALA A CA  1 
ATOM   1095 C  C   . ALA A 1 136 ? 13.707  10.389 8.617  1.00 15.82  ? 135 ALA A C   1 
ATOM   1096 O  O   . ALA A 1 136 ? 14.507  10.820 7.794  1.00 16.93  ? 135 ALA A O   1 
ATOM   1097 C  CB  . ALA A 1 136 ? 14.477  8.659  10.201 1.00 15.20  ? 135 ALA A CB  1 
ATOM   1098 N  N   . HIS A 1 137 ? 12.863  11.184 9.263  1.00 15.66  ? 136 HIS A N   1 
ATOM   1099 C  CA  . HIS A 1 137 ? 12.794  12.608 8.953  1.00 14.46  ? 136 HIS A CA  1 
ATOM   1100 C  C   . HIS A 1 137 ? 12.421  13.444 10.176 1.00 16.47  ? 136 HIS A C   1 
ATOM   1101 O  O   . HIS A 1 137 ? 11.628  13.018 11.008 1.00 15.36  ? 136 HIS A O   1 
ATOM   1102 C  CB  . HIS A 1 137 ? 11.865  12.875 7.756  1.00 16.36  ? 136 HIS A CB  1 
ATOM   1103 C  CG  . HIS A 1 137 ? 10.407  12.753 8.067  1.00 14.13  ? 136 HIS A CG  1 
ATOM   1104 N  ND1 . HIS A 1 137 ? 9.795   11.543 8.300  1.00 17.28  ? 136 HIS A ND1 1 
ATOM   1105 C  CD2 . HIS A 1 137 ? 9.430   13.687 8.116  1.00 29.04  ? 136 HIS A CD2 1 
ATOM   1106 C  CE1 . HIS A 1 137 ? 8.512   11.745 8.549  1.00 20.76  ? 136 HIS A CE1 1 
ATOM   1107 N  NE2 . HIS A 1 137 ? 8.269   13.039 8.454  1.00 20.01  ? 136 HIS A NE2 1 
ATOM   1108 N  N   . ARG A 1 138 ? 13.055  14.613 10.265 1.00 16.00  ? 137 ARG A N   1 
ATOM   1109 C  CA  . ARG A 1 138 ? 12.907  15.576 11.345 1.00 13.98  ? 137 ARG A CA  1 
ATOM   1110 C  C   . ARG A 1 138 ? 12.879  16.974 10.704 1.00 15.78  ? 137 ARG A C   1 
ATOM   1111 O  O   . ARG A 1 138 ? 13.673  17.246 9.804  1.00 17.86  ? 137 ARG A O   1 
ATOM   1112 C  CB  . ARG A 1 138 ? 14.095  15.453 12.303 1.00 17.90  ? 137 ARG A CB  1 
ATOM   1113 C  CG  . ARG A 1 138 ? 14.403  16.697 13.137 1.00 15.51  ? 137 ARG A CG  1 
ATOM   1114 C  CD  . ARG A 1 138 ? 15.574  16.520 14.097 1.00 15.23  ? 137 ARG A CD  1 
ATOM   1115 N  NE  . ARG A 1 138 ? 15.299  15.577 15.178 1.00 14.68  ? 137 ARG A NE  1 
ATOM   1116 C  CZ  . ARG A 1 138 ? 16.218  15.065 15.991 1.00 16.78  ? 137 ARG A CZ  1 
ATOM   1117 N  NH1 . ARG A 1 138 ? 17.498  15.370 15.843 1.00 18.05  ? 137 ARG A NH1 1 
ATOM   1118 N  NH2 . ARG A 1 138 ? 15.874  14.220 16.934 1.00 18.77  ? 137 ARG A NH2 1 
ATOM   1119 N  N   . THR A 1 139 ? 11.987  17.859 11.146 1.00 16.05  ? 138 THR A N   1 
ATOM   1120 C  CA  . THR A 1 139 ? 11.996  19.258 10.671 1.00 17.09  ? 138 THR A CA  1 
ATOM   1121 C  C   . THR A 1 139 ? 12.607  20.200 11.719 1.00 13.72  ? 138 THR A C   1 
ATOM   1122 O  O   . THR A 1 139 ? 12.567  19.919 12.910 1.00 14.91  ? 138 THR A O   1 
ATOM   1123 C  CB  . THR A 1 139 ? 10.603  19.737 10.273 1.00 19.50  ? 138 THR A CB  1 
ATOM   1124 O  OG1 . THR A 1 139 ? 9.659   19.344 11.265 1.00 18.56  ? 138 THR A OG1 1 
ATOM   1125 C  CG2 . THR A 1 139 ? 10.132  19.025 9.003  1.00 20.06  ? 138 THR A CG2 1 
ATOM   1126 N  N   . VAL A 1 140 ? 13.209  21.287 11.232 1.00 15.93  ? 139 VAL A N   1 
ATOM   1127 C  CA  . VAL A 1 140 ? 13.998  22.224 12.038 1.00 15.89  ? 139 VAL A CA  1 
ATOM   1128 C  C   . VAL A 1 140 ? 13.625  23.656 11.673 1.00 14.55  ? 139 VAL A C   1 
ATOM   1129 O  O   . VAL A 1 140 ? 13.466  23.962 10.496 1.00 15.56  ? 139 VAL A O   1 
ATOM   1130 C  CB  . VAL A 1 140 ? 15.515  22.061 11.749 1.00 14.65  ? 139 VAL A CB  1 
ATOM   1131 C  CG1 . VAL A 1 140 ? 16.349  23.022 12.602 1.00 17.17  ? 139 VAL A CG1 1 
ATOM   1132 C  CG2 . VAL A 1 140 ? 15.960  20.613 11.945 1.00 16.08  ? 139 VAL A CG2 1 
ATOM   1133 N  N   . ASN A 1 141 ? 13.456  24.513 12.686 1.00 17.28  ? 140 ASN A N   1 
ATOM   1134 C  CA  . ASN A 1 141 ? 13.155  25.936 12.481 1.00 17.05  ? 140 ASN A CA  1 
ATOM   1135 C  C   . ASN A 1 141 ? 14.431  26.747 12.687 1.00 16.62  ? 140 ASN A C   1 
ATOM   1136 O  O   . ASN A 1 141 ? 14.950  26.798 13.797 1.00 18.36  ? 140 ASN A O   1 
ATOM   1137 C  CB  . ASN A 1 141 ? 12.040  26.404 13.440 1.00 17.53  ? 140 ASN A CB  1 
ATOM   1138 C  CG  . ASN A 1 141 ? 11.637  27.861 13.218 1.00 18.96  ? 140 ASN A CG  1 
ATOM   1139 O  OD1 . ASN A 1 141 ? 12.317  28.612 12.500 1.00 19.06  ? 140 ASN A OD1 1 
ATOM   1140 N  ND2 . ASN A 1 141 ? 10.519  28.264 13.825 1.00 18.07  ? 140 ASN A ND2 1 
ATOM   1141 N  N   . ILE A 1 142 ? 14.930  27.354 11.610 1.00 19.85  ? 141 ILE A N   1 
ATOM   1142 C  CA  . ILE A 1 142 ? 16.193  28.123 11.639 1.00 16.57  ? 141 ILE A CA  1 
ATOM   1143 C  C   . ILE A 1 142 ? 15.977  29.654 11.667 1.00 22.97  ? 141 ILE A C   1 
ATOM   1144 O  O   . ILE A 1 142 ? 16.918  30.429 11.521 1.00 22.40  ? 141 ILE A O   1 
ATOM   1145 C  CB  . ILE A 1 142 ? 17.123  27.714 10.453 1.00 20.11  ? 141 ILE A CB  1 
ATOM   1146 C  CG1 . ILE A 1 142 ? 16.536  28.127 9.095  1.00 19.46  ? 141 ILE A CG1 1 
ATOM   1147 C  CG2 . ILE A 1 142 ? 17.378  26.204 10.480 1.00 19.77  ? 141 ILE A CG2 1 
ATOM   1148 C  CD1 . ILE A 1 142 ? 17.522  27.998 7.938  1.00 25.45  ? 141 ILE A CD1 1 
ATOM   1149 N  N   . GLY A 1 143 ? 14.737  30.077 11.876 1.00 21.39  ? 142 GLY A N   1 
ATOM   1150 C  CA  . GLY A 1 143 ? 14.376  31.485 11.867 1.00 24.12  ? 142 GLY A CA  1 
ATOM   1151 C  C   . GLY A 1 143 ? 13.797  31.986 13.180 1.00 22.86  ? 142 GLY A C   1 
ATOM   1152 O  O   . GLY A 1 143 ? 13.840  31.305 14.207 1.00 22.58  ? 142 GLY A O   1 
ATOM   1153 N  N   . ASP A 1 144 ? 13.246  33.198 13.124 1.00 27.63  ? 143 ASP A N   1 
ATOM   1154 C  CA  . ASP A 1 144 ? 12.777  33.923 14.303 1.00 24.60  ? 143 ASP A CA  1 
ATOM   1155 C  C   . ASP A 1 144 ? 11.262  33.872 14.492 1.00 24.51  ? 143 ASP A C   1 
ATOM   1156 O  O   . ASP A 1 144 ? 10.753  34.360 15.500 1.00 30.56  ? 143 ASP A O   1 
ATOM   1157 C  CB  . ASP A 1 144 ? 13.189  35.396 14.196 1.00 29.34  ? 143 ASP A CB  1 
ATOM   1158 C  CG  . ASP A 1 144 ? 14.690  35.582 14.122 1.00 65.34  ? 143 ASP A CG  1 
ATOM   1159 O  OD1 . ASP A 1 144 ? 15.385  35.192 15.082 1.00 63.11  ? 143 ASP A OD1 1 
ATOM   1160 O  OD2 . ASP A 1 144 ? 15.259  36.115 13.147 1.00 115.02 ? 143 ASP A OD2 1 
ATOM   1161 N  N   . GLU A 1 145 ? 10.544  33.307 13.523 1.00 21.32  ? 144 GLU A N   1 
ATOM   1162 C  CA  . GLU A 1 145 ? 9.088   33.179 13.602 1.00 24.03  ? 144 GLU A CA  1 
ATOM   1163 C  C   . GLU A 1 145 ? 8.691   31.711 13.399 1.00 21.69  ? 144 GLU A C   1 
ATOM   1164 O  O   . GLU A 1 145 ? 9.525   30.906 13.005 1.00 21.30  ? 144 GLU A O   1 
ATOM   1165 C  CB  . GLU A 1 145 ? 8.407   34.091 12.566 1.00 25.91  ? 144 GLU A CB  1 
ATOM   1166 C  CG  . GLU A 1 145 ? 8.811   33.857 11.111 1.00 55.50  ? 144 GLU A CG  1 
ATOM   1167 C  CD  . GLU A 1 145 ? 7.789   34.364 10.093 1.00 117.24 ? 144 GLU A CD  1 
ATOM   1168 O  OE1 . GLU A 1 145 ? 6.605   34.560 10.436 1.00 51.01  ? 144 GLU A OE1 1 
ATOM   1169 O  OE2 . GLU A 1 145 ? 8.162   34.560 8.922  1.00 51.71  ? 144 GLU A OE2 1 
ATOM   1170 N  N   . PRO A 1 146 ? 7.450   31.342 13.703 1.00 21.92  ? 145 PRO A N   1 
ATOM   1171 C  CA  . PRO A 1 146 ? 7.015   29.961 13.492 1.00 20.17  ? 145 PRO A CA  1 
ATOM   1172 C  C   . PRO A 1 146 ? 7.255   29.464 12.067 1.00 21.80  ? 145 PRO A C   1 
ATOM   1173 O  O   . PRO A 1 146 ? 7.110   30.218 11.100 1.00 21.25  ? 145 PRO A O   1 
ATOM   1174 C  CB  . PRO A 1 146 ? 5.523   30.019 13.793 1.00 24.35  ? 145 PRO A CB  1 
ATOM   1175 C  CG  . PRO A 1 146 ? 5.396   31.127 14.799 1.00 22.99  ? 145 PRO A CG  1 
ATOM   1176 C  CD  . PRO A 1 146 ? 6.377   32.151 14.322 1.00 19.16  ? 145 PRO A CD  1 
ATOM   1177 N  N   . PHE A 1 147 ? 7.639   28.193 11.973 1.00 18.92  ? 146 PHE A N   1 
ATOM   1178 C  CA  . PHE A 1 147 ? 7.844   27.499 10.718 1.00 18.15  ? 146 PHE A CA  1 
ATOM   1179 C  C   . PHE A 1 147 ? 6.663   26.540 10.584 1.00 13.35  ? 146 PHE A C   1 
ATOM   1180 O  O   . PHE A 1 147 ? 6.475   25.663 11.427 1.00 16.94  ? 146 PHE A O   1 
ATOM   1181 C  CB  . PHE A 1 147 ? 9.187   26.754 10.784 1.00 17.48  ? 146 PHE A CB  1 
ATOM   1182 C  CG  . PHE A 1 147 ? 9.476   25.870 9.597  1.00 15.93  ? 146 PHE A CG  1 
ATOM   1183 C  CD1 . PHE A 1 147 ? 9.312   26.341 8.304  1.00 18.71  ? 146 PHE A CD1 1 
ATOM   1184 C  CD2 . PHE A 1 147 ? 9.939   24.572 9.785  1.00 19.47  ? 146 PHE A CD2 1 
ATOM   1185 C  CE1 . PHE A 1 147 ? 9.592   25.523 7.207  1.00 18.41  ? 146 PHE A CE1 1 
ATOM   1186 C  CE2 . PHE A 1 147 ? 10.220  23.754 8.696  1.00 19.22  ? 146 PHE A CE2 1 
ATOM   1187 C  CZ  . PHE A 1 147 ? 10.052  24.239 7.413  1.00 16.90  ? 146 PHE A CZ  1 
ATOM   1188 N  N   . ILE A 1 148 ? 5.875   26.732 9.527  1.00 15.26  ? 147 ILE A N   1 
ATOM   1189 C  CA  . ILE A 1 148 ? 4.595   26.056 9.365  1.00 18.86  ? 147 ILE A CA  1 
ATOM   1190 C  C   . ILE A 1 148 ? 4.583   25.280 8.056  1.00 16.17  ? 147 ILE A C   1 
ATOM   1191 O  O   . ILE A 1 148 ? 4.941   25.817 7.009  1.00 16.27  ? 147 ILE A O   1 
ATOM   1192 C  CB  . ILE A 1 148 ? 3.448   27.085 9.377  1.00 21.19  ? 147 ILE A CB  1 
ATOM   1193 C  CG1 . ILE A 1 148 ? 3.489   27.912 10.669 1.00 21.13  ? 147 ILE A CG1 1 
ATOM   1194 C  CG2 . ILE A 1 148 ? 2.114   26.378 9.224  1.00 19.91  ? 147 ILE A CG2 1 
ATOM   1195 C  CD1 . ILE A 1 148 ? 2.427   29.005 10.741 1.00 23.74  ? 147 ILE A CD1 1 
ATOM   1196 N  N   . PHE A 1 149 ? 4.155   24.019 8.128  1.00 16.00  ? 148 PHE A N   1 
ATOM   1197 C  CA  . PHE A 1 149 ? 4.112   23.153 6.960  1.00 16.60  ? 148 PHE A CA  1 
ATOM   1198 C  C   . PHE A 1 149 ? 2.988   22.117 7.046  1.00 17.28  ? 148 PHE A C   1 
ATOM   1199 O  O   . PHE A 1 149 ? 2.437   21.862 8.117  1.00 16.75  ? 148 PHE A O   1 
ATOM   1200 C  CB  . PHE A 1 149 ? 5.474   22.462 6.755  1.00 17.86  ? 148 PHE A CB  1 
ATOM   1201 C  CG  . PHE A 1 149 ? 5.985   21.733 7.969  1.00 15.19  ? 148 PHE A CG  1 
ATOM   1202 C  CD1 . PHE A 1 149 ? 6.917   22.326 8.821  1.00 19.58  ? 148 PHE A CD1 1 
ATOM   1203 C  CD2 . PHE A 1 149 ? 5.518   20.461 8.292  1.00 18.83  ? 148 PHE A CD2 1 
ATOM   1204 C  CE1 . PHE A 1 149 ? 7.371   21.644 9.956  1.00 18.56  ? 148 PHE A CE1 1 
ATOM   1205 C  CE2 . PHE A 1 149 ? 5.976   19.794 9.417  1.00 18.63  ? 148 PHE A CE2 1 
ATOM   1206 C  CZ  . PHE A 1 149 ? 6.897   20.365 10.231 1.00 14.07  ? 148 PHE A CZ  1 
ATOM   1207 N  N   . LEU A 1 150 ? 2.690   21.522 5.898  1.00 14.99  ? 149 LEU A N   1 
ATOM   1208 C  CA  . LEU A 1 150 ? 1.660   20.514 5.724  1.00 16.73  ? 149 LEU A CA  1 
ATOM   1209 C  C   . LEU A 1 150 ? 2.351   19.234 5.266  1.00 15.97  ? 149 LEU A C   1 
ATOM   1210 O  O   . LEU A 1 150 ? 3.209   19.282 4.387  1.00 17.74  ? 149 LEU A O   1 
ATOM   1211 C  CB  . LEU A 1 150 ? 0.657   20.989 4.673  1.00 15.53  ? 149 LEU A CB  1 
ATOM   1212 C  CG  . LEU A 1 150 ? -0.412  20.001 4.198  1.00 16.47  ? 149 LEU A CG  1 
ATOM   1213 C  CD1 . LEU A 1 150 ? -1.400  19.655 5.313  1.00 18.30  ? 149 LEU A CD1 1 
ATOM   1214 C  CD2 . LEU A 1 150 ? -1.147  20.566 2.978  1.00 21.61  ? 149 LEU A CD2 1 
ATOM   1215 N  N   . ALA A 1 151 ? 1.977   18.101 5.849  1.00 13.48  ? 150 ALA A N   1 
ATOM   1216 C  CA  . ALA A 1 151 ? 2.511   16.786 5.479  1.00 16.22  ? 150 ALA A CA  1 
ATOM   1217 C  C   . ALA A 1 151 ? 1.395   15.850 5.053  1.00 18.19  ? 150 ALA A C   1 
ATOM   1218 O  O   . ALA A 1 151 ? 0.342   15.833 5.680  1.00 16.77  ? 150 ALA A O   1 
ATOM   1219 C  CB  . ALA A 1 151 ? 3.245   16.194 6.639  1.00 17.83  ? 150 ALA A CB  1 
ATOM   1220 N  N   . ILE A 1 152 ? 1.624   15.068 3.998  1.00 14.85  ? 151 ILE A N   1 
ATOM   1221 C  CA  . ILE A 1 152 ? 0.684   14.040 3.543  1.00 14.42  ? 151 ILE A CA  1 
ATOM   1222 C  C   . ILE A 1 152 ? 1.435   12.696 3.553  1.00 15.89  ? 151 ILE A C   1 
ATOM   1223 O  O   . ILE A 1 152 ? 2.553   12.604 3.052  1.00 14.58  ? 151 ILE A O   1 
ATOM   1224 C  CB  . ILE A 1 152 ? 0.103   14.364 2.138  1.00 15.36  ? 151 ILE A CB  1 
ATOM   1225 C  CG1 . ILE A 1 152 ? -0.627  15.722 2.160  1.00 20.19  ? 151 ILE A CG1 1 
ATOM   1226 C  CG2 . ILE A 1 152 ? -0.810  13.228 1.682  1.00 14.96  ? 151 ILE A CG2 1 
ATOM   1227 C  CD1 . ILE A 1 152 ? 0.235   16.879 1.748  1.00 33.26  ? 151 ILE A CD1 1 
ATOM   1228 N  N   . TYR A 1 153 ? 0.857   11.668 4.154  1.00 15.02  ? 152 TYR A N   1 
ATOM   1229 C  CA  . TYR A 1 153 ? 1.590   10.414 4.409  1.00 13.46  ? 152 TYR A CA  1 
ATOM   1230 C  C   . TYR A 1 153 ? 0.623   9.240  4.480  1.00 15.74  ? 152 TYR A C   1 
ATOM   1231 O  O   . TYR A 1 153 ? -0.544  9.436  4.808  1.00 16.39  ? 152 TYR A O   1 
ATOM   1232 C  CB  . TYR A 1 153 ? 2.403   10.529 5.698  1.00 16.58  ? 152 TYR A CB  1 
ATOM   1233 C  CG  . TYR A 1 153 ? 1.618   10.995 6.919  1.00 17.97  ? 152 TYR A CG  1 
ATOM   1234 C  CD1 . TYR A 1 153 ? 1.329   12.350 7.117  1.00 17.60  ? 152 TYR A CD1 1 
ATOM   1235 C  CD2 . TYR A 1 153 ? 1.194   10.090 7.894  1.00 18.99  ? 152 TYR A CD2 1 
ATOM   1236 C  CE1 . TYR A 1 153 ? 0.633   12.788 8.235  1.00 18.42  ? 152 TYR A CE1 1 
ATOM   1237 C  CE2 . TYR A 1 153 ? 0.496   10.529 9.028  1.00 19.31  ? 152 TYR A CE2 1 
ATOM   1238 C  CZ  . TYR A 1 153 ? 0.214   11.879 9.181  1.00 19.12  ? 152 TYR A CZ  1 
ATOM   1239 O  OH  . TYR A 1 153 ? -0.486  12.346 10.283 1.00 21.57  ? 152 TYR A OH  1 
ATOM   1240 N  N   . PRO A 1 154 ? 1.061   8.037  4.128  1.00 13.88  ? 153 PRO A N   1 
ATOM   1241 C  CA  . PRO A 1 154 ? 0.184   6.860  4.134  1.00 15.70  ? 153 PRO A CA  1 
ATOM   1242 C  C   . PRO A 1 154 ? -0.448  6.542  5.504  1.00 15.66  ? 153 PRO A C   1 
ATOM   1243 O  O   . PRO A 1 154 ? 0.191   6.653  6.554  1.00 15.73  ? 153 PRO A O   1 
ATOM   1244 C  CB  . PRO A 1 154 ? 1.108   5.747  3.651  1.00 18.43  ? 153 PRO A CB  1 
ATOM   1245 C  CG  . PRO A 1 154 ? 2.086   6.498  2.788  1.00 15.15  ? 153 PRO A CG  1 
ATOM   1246 C  CD  . PRO A 1 154 ? 2.389   7.703  3.593  1.00 17.16  ? 153 PRO A CD  1 
ATOM   1247 N  N   . ALA A 1 155 ? -1.716  6.155  5.459  1.00 17.92  ? 154 ALA A N   1 
ATOM   1248 C  CA  . ALA A 1 155 ? -2.488  5.878  6.666  1.00 19.54  ? 154 ALA A CA  1 
ATOM   1249 C  C   . ALA A 1 155 ? -1.964  4.669  7.437  1.00 18.30  ? 154 ALA A C   1 
ATOM   1250 O  O   . ALA A 1 155 ? -2.272  4.508  8.607  1.00 19.15  ? 154 ALA A O   1 
ATOM   1251 C  CB  . ALA A 1 155 ? -3.949  5.673  6.310  1.00 17.14  ? 154 ALA A CB  1 
ATOM   1252 N  N   . ASP A 1 156 ? -1.182  3.820  6.777  1.00 17.41  ? 155 ASP A N   1 
ATOM   1253 C  CA  . ASP A 1 156 ? -0.653  2.613  7.395  1.00 19.56  ? 155 ASP A CA  1 
ATOM   1254 C  C   . ASP A 1 156 ? 0.854   2.692  7.627  1.00 16.73  ? 155 ASP A C   1 
ATOM   1255 O  O   . ASP A 1 156 ? 1.493   1.679  7.909  1.00 21.09  ? 155 ASP A O   1 
ATOM   1256 C  CB  . ASP A 1 156 ? -1.011  1.385  6.549  1.00 24.13  ? 155 ASP A CB  1 
ATOM   1257 C  CG  . ASP A 1 156 ? -0.252  1.316  5.226  1.00 20.44  ? 155 ASP A CG  1 
ATOM   1258 O  OD1 . ASP A 1 156 ? 0.482   2.277  4.838  1.00 20.18  ? 155 ASP A OD1 1 
ATOM   1259 O  OD2 . ASP A 1 156 ? -0.347  0.320  4.482  1.00 23.22  ? 155 ASP A OD2 1 
ATOM   1260 N  N   . ALA A 1 157 ? 1.410   3.895  7.552  1.00 16.12  ? 156 ALA A N   1 
ATOM   1261 C  CA  . ALA A 1 157 ? 2.853   4.064  7.686  1.00 17.38  ? 156 ALA A CA  1 
ATOM   1262 C  C   . ALA A 1 157 ? 3.321   3.819  9.121  1.00 19.70  ? 156 ALA A C   1 
ATOM   1263 O  O   . ALA A 1 157 ? 4.389   3.263  9.347  1.00 15.96  ? 156 ALA A O   1 
ATOM   1264 C  CB  . ALA A 1 157 ? 3.259   5.441  7.230  1.00 19.09  ? 156 ALA A CB  1 
ATOM   1265 N  N   . GLY A 1 158 ? 2.533   4.251  10.101 1.00 18.01  ? 157 GLY A N   1 
ATOM   1266 C  CA  . GLY A 1 158 ? 2.905   4.101  11.486 1.00 17.41  ? 157 GLY A CA  1 
ATOM   1267 C  C   . GLY A 1 158 ? 4.110   4.937  11.875 1.00 15.23  ? 157 GLY A C   1 
ATOM   1268 O  O   . GLY A 1 158 ? 4.580   5.778  11.102 1.00 18.64  ? 157 GLY A O   1 
ATOM   1269 N  N   . HIS A 1 159 ? 4.610   4.685  13.088 1.00 16.88  ? 158 HIS A N   1 
ATOM   1270 C  CA  . HIS A 1 159 ? 5.680   5.459  13.688 1.00 18.29  ? 158 HIS A CA  1 
ATOM   1271 C  C   . HIS A 1 159 ? 6.699   4.599  14.454 1.00 23.08  ? 158 HIS A C   1 
ATOM   1272 O  O   . HIS A 1 159 ? 6.343   3.739  15.263 1.00 22.26  ? 158 HIS A O   1 
ATOM   1273 C  CB  . HIS A 1 159 ? 5.091   6.489  14.654 1.00 18.09  ? 158 HIS A CB  1 
ATOM   1274 C  CG  . HIS A 1 159 ? 4.313   7.578  13.990 1.00 17.72  ? 158 HIS A CG  1 
ATOM   1275 N  ND1 . HIS A 1 159 ? 2.963   7.477  13.732 1.00 20.52  ? 158 HIS A ND1 1 
ATOM   1276 C  CD2 . HIS A 1 159 ? 4.692   8.800  13.547 1.00 18.50  ? 158 HIS A CD2 1 
ATOM   1277 C  CE1 . HIS A 1 159 ? 2.547   8.587  13.146 1.00 20.15  ? 158 HIS A CE1 1 
ATOM   1278 N  NE2 . HIS A 1 159 ? 3.579   9.403  13.018 1.00 18.82  ? 158 HIS A NE2 1 
ATOM   1279 N  N   . ASP A 1 160 ? 7.976   4.876  14.214 1.00 17.14  ? 159 ASP A N   1 
ATOM   1280 C  CA  . ASP A 1 160 ? 9.069   4.383  15.038 1.00 17.59  ? 159 ASP A CA  1 
ATOM   1281 C  C   . ASP A 1 160 ? 9.863   5.576  15.549 1.00 20.81  ? 159 ASP A C   1 
ATOM   1282 O  O   . ASP A 1 160 ? 10.775  6.072  14.880 1.00 18.99  ? 159 ASP A O   1 
ATOM   1283 C  CB  . ASP A 1 160 ? 9.987   3.460  14.244 1.00 16.42  ? 159 ASP A CB  1 
ATOM   1284 C  CG  . ASP A 1 160 ? 11.301  3.173  14.962 1.00 22.35  ? 159 ASP A CG  1 
ATOM   1285 O  OD1 . ASP A 1 160 ? 11.367  3.277  16.216 1.00 23.65  ? 159 ASP A OD1 1 
ATOM   1286 O  OD2 . ASP A 1 160 ? 12.333  2.844  14.338 1.00 25.56  ? 159 ASP A OD2 1 
ATOM   1287 N  N   . TYR A 1 161 ? 9.474   6.068  16.720 1.00 18.36  ? 160 TYR A N   1 
ATOM   1288 C  CA  . TYR A 1 161 ? 10.207  7.126  17.413 1.00 18.53  ? 160 TYR A CA  1 
ATOM   1289 C  C   . TYR A 1 161 ? 11.416  6.604  18.191 1.00 19.80  ? 160 TYR A C   1 
ATOM   1290 O  O   . TYR A 1 161 ? 12.362  7.346  18.415 1.00 19.51  ? 160 TYR A O   1 
ATOM   1291 C  CB  . TYR A 1 161 ? 9.279   7.871  18.384 1.00 18.39  ? 160 TYR A CB  1 
ATOM   1292 C  CG  . TYR A 1 161 ? 8.255   8.747  17.724 1.00 16.62  ? 160 TYR A CG  1 
ATOM   1293 C  CD1 . TYR A 1 161 ? 6.949   8.308  17.518 1.00 19.86  ? 160 TYR A CD1 1 
ATOM   1294 C  CD2 . TYR A 1 161 ? 8.583   10.028 17.277 1.00 14.59  ? 160 TYR A CD2 1 
ATOM   1295 C  CE1 . TYR A 1 161 ? 6.002   9.122  16.892 1.00 23.48  ? 160 TYR A CE1 1 
ATOM   1296 C  CE2 . TYR A 1 161 ? 7.656   10.829 16.654 1.00 16.05  ? 160 TYR A CE2 1 
ATOM   1297 C  CZ  . TYR A 1 161 ? 6.363   10.380 16.465 1.00 17.97  ? 160 TYR A CZ  1 
ATOM   1298 O  OH  . TYR A 1 161 ? 5.446   11.199 15.855 1.00 21.35  ? 160 TYR A OH  1 
ATOM   1299 N  N   . GLY A 1 162 ? 11.380  5.334  18.601 1.00 20.66  ? 161 GLY A N   1 
ATOM   1300 C  CA  . GLY A 1 162 ? 12.354  4.781  19.526 1.00 19.62  ? 161 GLY A CA  1 
ATOM   1301 C  C   . GLY A 1 162 ? 13.779  4.793  19.046 1.00 20.82  ? 161 GLY A C   1 
ATOM   1302 O  O   . GLY A 1 162 ? 14.690  5.124  19.802 1.00 20.31  ? 161 GLY A O   1 
ATOM   1303 N  N   . THR A 1 163 ? 13.958  4.455  17.778 1.00 21.82  ? 162 THR A N   1 
ATOM   1304 C  CA  . THR A 1 163 ? 15.284  4.416  17.184 1.00 21.13  ? 162 THR A CA  1 
ATOM   1305 C  C   . THR A 1 163 ? 15.944  5.781  17.250 1.00 26.17  ? 162 THR A C   1 
ATOM   1306 O  O   . THR A 1 163 ? 17.112  5.899  17.622 1.00 26.10  ? 162 THR A O   1 
ATOM   1307 C  CB  . THR A 1 163 ? 15.180  3.921  15.738 1.00 23.33  ? 162 THR A CB  1 
ATOM   1308 O  OG1 . THR A 1 163 ? 14.622  2.600  15.740 1.00 24.26  ? 162 THR A OG1 1 
ATOM   1309 C  CG2 . THR A 1 163 ? 16.554  3.762  15.105 1.00 31.38  ? 162 THR A CG2 1 
ATOM   1310 N  N   . ILE A 1 164 ? 15.187  6.820  16.925 1.00 22.69  ? 163 ILE A N   1 
ATOM   1311 C  CA  . ILE A 1 164 ? 15.720  8.175  16.975 1.00 22.22  ? 163 ILE A CA  1 
ATOM   1312 C  C   . ILE A 1 164 ? 15.901  8.652  18.423 1.00 18.30  ? 163 ILE A C   1 
ATOM   1313 O  O   . ILE A 1 164 ? 16.853  9.355  18.717 1.00 22.37  ? 163 ILE A O   1 
ATOM   1314 C  CB  . ILE A 1 164 ? 14.791  9.140  16.190 1.00 20.54  ? 163 ILE A CB  1 
ATOM   1315 C  CG1 . ILE A 1 164 ? 14.731  8.746  14.704 1.00 20.98  ? 163 ILE A CG1 1 
ATOM   1316 C  CG2 . ILE A 1 164 ? 15.244  10.594 16.356 1.00 22.99  ? 163 ILE A CG2 1 
ATOM   1317 C  CD1 . ILE A 1 164 ? 16.058  8.746  13.986 1.00 21.16  ? 163 ILE A CD1 1 
ATOM   1318 N  N   . ALA A 1 165 ? 14.966  8.297  19.308 1.00 17.94  ? 164 ALA A N   1 
ATOM   1319 C  CA  . ALA A 1 165 ? 15.055  8.679  20.720 1.00 27.20  ? 164 ALA A CA  1 
ATOM   1320 C  C   . ALA A 1 165 ? 16.361  8.217  21.374 1.00 29.83  ? 164 ALA A C   1 
ATOM   1321 O  O   . ALA A 1 165 ? 16.880  8.896  22.263 1.00 26.88  ? 164 ALA A O   1 
ATOM   1322 C  CB  . ALA A 1 165 ? 13.862  8.128  21.492 1.00 21.17  ? 164 ALA A CB  1 
ATOM   1323 N  N   . GLU A 1 166 ? 16.886  7.075  20.924 1.00 27.54  ? 165 GLU A N   1 
ATOM   1324 C  CA  . GLU A 1 166 ? 18.117  6.505  21.485 1.00 28.65  ? 165 GLU A CA  1 
ATOM   1325 C  C   . GLU A 1 166 ? 19.398  6.997  20.791 1.00 39.71  ? 165 GLU A C   1 
ATOM   1326 O  O   . GLU A 1 166 ? 20.381  7.313  21.462 1.00 42.99  ? 165 GLU A O   1 
ATOM   1327 C  CB  . GLU A 1 166 ? 18.058  4.967  21.481 1.00 44.44  ? 165 GLU A CB  1 
ATOM   1328 C  CG  . GLU A 1 166 ? 17.983  4.305  20.110 1.00 101.32 ? 165 GLU A CG  1 
ATOM   1329 C  CD  . GLU A 1 166 ? 18.330  2.829  20.145 1.00 140.69 ? 165 GLU A CD  1 
ATOM   1330 O  OE1 . GLU A 1 166 ? 17.473  2.006  19.756 1.00 83.61  ? 165 GLU A OE1 1 
ATOM   1331 O  OE2 . GLU A 1 166 ? 19.462  2.492  20.553 1.00 94.10  ? 165 GLU A OE2 1 
ATOM   1332 N  N   . LYS A 1 167 ? 19.377  7.087  19.461 1.00 32.82  ? 166 LYS A N   1 
ATOM   1333 C  CA  . LYS A 1 167 ? 20.594  7.353  18.679 1.00 33.35  ? 166 LYS A CA  1 
ATOM   1334 C  C   . LYS A 1 167 ? 20.728  8.797  18.188 1.00 35.92  ? 166 LYS A C   1 
ATOM   1335 O  O   . LYS A 1 167 ? 21.833  9.251  17.900 1.00 31.03  ? 166 LYS A O   1 
ATOM   1336 C  CB  . LYS A 1 167 ? 20.662  6.402  17.478 1.00 58.58  ? 166 LYS A CB  1 
ATOM   1337 C  CG  . LYS A 1 167 ? 21.155  4.999  17.819 1.00 68.95  ? 166 LYS A CG  1 
ATOM   1338 C  CD  . LYS A 1 167 ? 21.440  4.183  16.563 1.00 103.73 ? 166 LYS A CD  1 
ATOM   1339 C  CE  . LYS A 1 167 ? 20.166  3.859  15.784 1.00 94.46  ? 166 LYS A CE  1 
ATOM   1340 N  NZ  . LYS A 1 167 ? 20.051  2.407  15.463 1.00 50.68  ? 166 LYS A NZ  1 
ATOM   1341 N  N   . GLY A 1 168 ? 19.606  9.503  18.079 1.00 27.64  ? 167 GLY A N   1 
ATOM   1342 C  CA  . GLY A 1 168 ? 19.573  10.823 17.471 1.00 25.31  ? 167 GLY A CA  1 
ATOM   1343 C  C   . GLY A 1 168 ? 19.844  10.758 15.976 1.00 20.71  ? 167 GLY A C   1 
ATOM   1344 O  O   . GLY A 1 168 ? 19.837  9.678  15.383 1.00 25.09  ? 167 GLY A O   1 
ATOM   1345 N  N   . PHE A 1 169 ? 20.068  11.923 15.375 1.00 21.22  ? 168 PHE A N   1 
ATOM   1346 C  CA  . PHE A 1 169 ? 20.497  12.040 13.980 1.00 20.91  ? 168 PHE A CA  1 
ATOM   1347 C  C   . PHE A 1 169 ? 22.009  12.225 13.900 1.00 22.89  ? 168 PHE A C   1 
ATOM   1348 O  O   . PHE A 1 169 ? 22.642  12.703 14.845 1.00 22.05  ? 168 PHE A O   1 
ATOM   1349 C  CB  . PHE A 1 169 ? 19.792  13.219 13.301 1.00 19.80  ? 168 PHE A CB  1 
ATOM   1350 C  CG  . PHE A 1 169 ? 18.415  12.888 12.783 1.00 20.82  ? 168 PHE A CG  1 
ATOM   1351 C  CD1 . PHE A 1 169 ? 17.353  12.699 13.662 1.00 18.48  ? 168 PHE A CD1 1 
ATOM   1352 C  CD2 . PHE A 1 169 ? 18.182  12.747 11.422 1.00 22.69  ? 168 PHE A CD2 1 
ATOM   1353 C  CE1 . PHE A 1 169 ? 16.085  12.390 13.189 1.00 19.74  ? 168 PHE A CE1 1 
ATOM   1354 C  CE2 . PHE A 1 169 ? 16.910  12.441 10.946 1.00 17.66  ? 168 PHE A CE2 1 
ATOM   1355 C  CZ  . PHE A 1 169 ? 15.863  12.265 11.839 1.00 18.53  ? 168 PHE A CZ  1 
ATOM   1356 N  N   . SER A 1 170 ? 22.582  11.872 12.758 1.00 19.19  ? 169 SER A N   1 
ATOM   1357 C  CA  . SER A 1 170 ? 24.036  11.941 12.605 1.00 22.71  ? 169 SER A CA  1 
ATOM   1358 C  C   . SER A 1 170 ? 24.509  13.365 12.319 1.00 30.30  ? 169 SER A C   1 
ATOM   1359 O  O   . SER A 1 170 ? 25.708  13.628 12.313 1.00 21.73  ? 169 SER A O   1 
ATOM   1360 C  CB  . SER A 1 170 ? 24.496  10.993 11.501 1.00 21.85  ? 169 SER A CB  1 
ATOM   1361 O  OG  . SER A 1 170 ? 24.080  11.439 10.232 1.00 24.37  ? 169 SER A OG  1 
ATOM   1362 N  N   . LYS A 1 171 ? 23.570  14.279 12.076 1.00 20.05  ? 170 LYS A N   1 
ATOM   1363 C  CA  . LYS A 1 171 ? 23.877  15.685 11.867 1.00 19.90  ? 170 LYS A CA  1 
ATOM   1364 C  C   . LYS A 1 171 ? 22.995  16.534 12.774 1.00 21.72  ? 170 LYS A C   1 
ATOM   1365 O  O   . LYS A 1 171 ? 21.885  16.131 13.119 1.00 23.57  ? 170 LYS A O   1 
ATOM   1366 C  CB  . LYS A 1 171 ? 23.655  16.091 10.411 1.00 26.14  ? 170 LYS A CB  1 
ATOM   1367 C  CG  . LYS A 1 171 ? 24.646  15.476 9.433  1.00 25.09  ? 170 LYS A CG  1 
ATOM   1368 C  CD  . LYS A 1 171 ? 24.458  16.018 8.027  1.00 76.14  ? 170 LYS A CD  1 
ATOM   1369 C  CE  . LYS A 1 171 ? 25.422  15.367 7.046  1.00 82.16  ? 170 LYS A CE  1 
ATOM   1370 N  NZ  . LYS A 1 171 ? 26.827  15.400 7.538  1.00 56.18  ? 170 LYS A NZ  1 
ATOM   1371 N  N   . ILE A 1 172 ? 23.527  17.684 13.172 1.00 22.47  ? 171 ILE A N   1 
ATOM   1372 C  CA  . ILE A 1 172 ? 22.788  18.689 13.934 1.00 17.31  ? 171 ILE A CA  1 
ATOM   1373 C  C   . ILE A 1 172 ? 22.784  20.010 13.183 1.00 17.24  ? 171 ILE A C   1 
ATOM   1374 O  O   . ILE A 1 172 ? 23.647  20.276 12.350 1.00 20.61  ? 171 ILE A O   1 
ATOM   1375 C  CB  . ILE A 1 172 ? 23.382  18.869 15.367 1.00 24.35  ? 171 ILE A CB  1 
ATOM   1376 C  CG1 . ILE A 1 172 ? 24.838  19.355 15.321 1.00 24.26  ? 171 ILE A CG1 1 
ATOM   1377 C  CG2 . ILE A 1 172 ? 23.290  17.566 16.149 1.00 21.95  ? 171 ILE A CG2 1 
ATOM   1378 C  CD1 . ILE A 1 172 ? 25.425  19.676 16.695 1.00 23.99  ? 171 ILE A CD1 1 
ATOM   1379 N  N   . VAL A 1 173 ? 21.800  20.847 13.492 1.00 22.70  ? 172 VAL A N   1 
ATOM   1380 C  CA  . VAL A 1 173 ? 21.660  22.145 12.856 1.00 20.50  ? 172 VAL A CA  1 
ATOM   1381 C  C   . VAL A 1 173 ? 21.745  23.197 13.955 1.00 16.88  ? 172 VAL A C   1 
ATOM   1382 O  O   . VAL A 1 173 ? 20.905  23.221 14.859 1.00 18.86  ? 172 VAL A O   1 
ATOM   1383 C  CB  . VAL A 1 173 ? 20.324  22.251 12.089 1.00 18.90  ? 172 VAL A CB  1 
ATOM   1384 C  CG1 . VAL A 1 173 ? 20.246  23.571 11.330 1.00 19.33  ? 172 VAL A CG1 1 
ATOM   1385 C  CG2 . VAL A 1 173 ? 20.176  21.064 11.144 1.00 21.03  ? 172 VAL A CG2 1 
ATOM   1386 N  N   . ILE A 1 174 ? 22.788  24.025 13.888 1.00 20.98  ? 173 ILE A N   1 
ATOM   1387 C  CA  . ILE A 1 174 ? 23.117  24.984 14.938 1.00 19.32  ? 173 ILE A CA  1 
ATOM   1388 C  C   . ILE A 1 174 ? 23.357  26.386 14.393 1.00 17.09  ? 173 ILE A C   1 
ATOM   1389 O  O   . ILE A 1 174 ? 23.446  26.570 13.194 1.00 20.89  ? 173 ILE A O   1 
ATOM   1390 C  CB  . ILE A 1 174 ? 24.388  24.524 15.703 1.00 19.12  ? 173 ILE A CB  1 
ATOM   1391 C  CG1 . ILE A 1 174 ? 25.596  24.443 14.761 1.00 25.29  ? 173 ILE A CG1 1 
ATOM   1392 C  CG2 . ILE A 1 174 ? 24.160  23.181 16.361 1.00 21.53  ? 173 ILE A CG2 1 
ATOM   1393 C  CD1 . ILE A 1 174 ? 26.890  24.130 15.483 1.00 27.07  ? 173 ILE A CD1 1 
ATOM   1394 N  N   . GLU A 1 175 ? 23.444  27.358 15.303 1.00 21.18  ? 174 GLU A N   1 
ATOM   1395 C  CA  . GLU A 1 175 ? 23.876  28.711 14.977 1.00 24.30  ? 174 GLU A CA  1 
ATOM   1396 C  C   . GLU A 1 175 ? 25.180  29.020 15.714 1.00 25.71  ? 174 GLU A C   1 
ATOM   1397 O  O   . GLU A 1 175 ? 25.244  28.871 16.936 1.00 26.31  ? 174 GLU A O   1 
ATOM   1398 C  CB  . GLU A 1 175 ? 22.815  29.735 15.383 1.00 25.14  ? 174 GLU A CB  1 
ATOM   1399 C  CG  . GLU A 1 175 ? 23.078  31.131 14.824 1.00 37.12  ? 174 GLU A CG  1 
ATOM   1400 C  CD  . GLU A 1 175 ? 21.914  32.087 15.028 1.00 52.13  ? 174 GLU A CD  1 
ATOM   1401 O  OE1 . GLU A 1 175 ? 21.286  32.054 16.107 1.00 44.32  ? 174 GLU A OE1 1 
ATOM   1402 O  OE2 . GLU A 1 175 ? 21.629  32.877 14.105 1.00 57.25  ? 174 GLU A OE2 1 
ATOM   1403 N  N   . GLU A 1 176 ? 26.204  29.416 14.957 1.00 24.82  ? 175 GLU A N   1 
ATOM   1404 C  CA  . GLU A 1 176 ? 27.463  29.935 15.506 1.00 30.02  ? 175 GLU A CA  1 
ATOM   1405 C  C   . GLU A 1 176 ? 27.886  31.201 14.754 1.00 28.96  ? 175 GLU A C   1 
ATOM   1406 O  O   . GLU A 1 176 ? 27.899  31.219 13.524 1.00 31.83  ? 175 GLU A O   1 
ATOM   1407 C  CB  . GLU A 1 176 ? 28.577  28.893 15.386 1.00 39.91  ? 175 GLU A CB  1 
ATOM   1408 C  CG  . GLU A 1 176 ? 28.334  27.617 16.172 1.00 36.21  ? 175 GLU A CG  1 
ATOM   1409 C  CD  . GLU A 1 176 ? 29.548  26.702 16.209 1.00 34.56  ? 175 GLU A CD  1 
ATOM   1410 O  OE1 . GLU A 1 176 ? 30.357  26.715 15.260 1.00 30.27  ? 175 GLU A OE1 1 
ATOM   1411 O  OE2 . GLU A 1 176 ? 29.692  25.951 17.190 1.00 32.17  ? 175 GLU A OE2 1 
ATOM   1412 N  N   . ASN A 1 177 ? 28.253  32.245 15.494 1.00 38.87  ? 176 ASN A N   1 
ATOM   1413 C  CA  . ASN A 1 177 ? 28.685  33.519 14.907 1.00 48.18  ? 176 ASN A CA  1 
ATOM   1414 C  C   . ASN A 1 177 ? 27.625  34.137 13.986 1.00 50.56  ? 176 ASN A C   1 
ATOM   1415 O  O   . ASN A 1 177 ? 27.949  34.724 12.950 1.00 35.12  ? 176 ASN A O   1 
ATOM   1416 C  CB  . ASN A 1 177 ? 30.013  33.348 14.154 1.00 53.08  ? 176 ASN A CB  1 
ATOM   1417 C  CG  . ASN A 1 177 ? 31.029  32.535 14.938 1.00 144.13 ? 176 ASN A CG  1 
ATOM   1418 O  OD1 . ASN A 1 177 ? 31.477  31.478 14.490 1.00 64.58  ? 176 ASN A OD1 1 
ATOM   1419 N  ND2 . ASN A 1 177 ? 31.395  33.025 16.116 1.00 57.23  ? 176 ASN A ND2 1 
ATOM   1420 N  N   . GLY A 1 178 ? 26.360  33.993 14.373 1.00 33.62  ? 177 GLY A N   1 
ATOM   1421 C  CA  . GLY A 1 178 ? 25.242  34.508 13.599 1.00 62.37  ? 177 GLY A CA  1 
ATOM   1422 C  C   . GLY A 1 178 ? 24.950  33.783 12.293 1.00 61.57  ? 177 GLY A C   1 
ATOM   1423 O  O   . GLY A 1 178 ? 24.185  34.299 11.476 1.00 40.06  ? 177 GLY A O   1 
ATOM   1424 N  N   . GLU A 1 179 ? 25.537  32.600 12.092 1.00 27.39  ? 178 GLU A N   1 
ATOM   1425 C  CA  . GLU A 1 179 ? 25.335  31.833 10.864 1.00 23.63  ? 178 GLU A CA  1 
ATOM   1426 C  C   . GLU A 1 179 ? 24.839  30.415 11.164 1.00 26.47  ? 178 GLU A C   1 
ATOM   1427 O  O   . GLU A 1 179 ? 25.290  29.765 12.109 1.00 26.22  ? 178 GLU A O   1 
ATOM   1428 C  CB  . GLU A 1 179 ? 26.617  31.778 10.020 1.00 30.52  ? 178 GLU A CB  1 
ATOM   1429 C  CG  . GLU A 1 179 ? 27.270  33.132 9.730  1.00 54.19  ? 178 GLU A CG  1 
ATOM   1430 C  CD  . GLU A 1 179 ? 26.517  34.002 8.727  1.00 71.30  ? 178 GLU A CD  1 
ATOM   1431 O  OE1 . GLU A 1 179 ? 25.691  33.488 7.942  1.00 37.03  ? 178 GLU A OE1 1 
ATOM   1432 O  OE2 . GLU A 1 179 ? 26.764  35.226 8.716  1.00 57.94  ? 178 GLU A OE2 1 
ATOM   1433 N  N   . VAL A 1 180 ? 23.886  29.952 10.361 1.00 31.83  ? 179 VAL A N   1 
ATOM   1434 C  CA  . VAL A 1 180 ? 23.315  28.616 10.511 1.00 25.06  ? 179 VAL A CA  1 
ATOM   1435 C  C   . VAL A 1 180 ? 24.293  27.593 9.926  1.00 23.48  ? 179 VAL A C   1 
ATOM   1436 O  O   . VAL A 1 180 ? 24.783  27.785 8.817  1.00 31.46  ? 179 VAL A O   1 
ATOM   1437 C  CB  . VAL A 1 180 ? 21.945  28.525 9.784  1.00 41.24  ? 179 VAL A CB  1 
ATOM   1438 C  CG1 . VAL A 1 180 ? 21.333  27.131 9.917  1.00 28.96  ? 179 VAL A CG1 1 
ATOM   1439 C  CG2 . VAL A 1 180 ? 20.985  29.582 10.321 1.00 32.62  ? 179 VAL A CG2 1 
ATOM   1440 N  N   . LYS A 1 181 ? 24.571  26.523 10.673 1.00 25.87  ? 180 LYS A N   1 
ATOM   1441 C  CA  . LYS A 1 181 ? 25.468  25.447 10.232 1.00 22.88  ? 180 LYS A CA  1 
ATOM   1442 C  C   . LYS A 1 181 ? 24.797  24.081 10.315 1.00 23.99  ? 180 LYS A C   1 
ATOM   1443 O  O   . LYS A 1 181 ? 24.097  23.788 11.271 1.00 25.66  ? 180 LYS A O   1 
ATOM   1444 C  CB  . LYS A 1 181 ? 26.717  25.364 11.115 1.00 28.68  ? 180 LYS A CB  1 
ATOM   1445 C  CG  . LYS A 1 181 ? 27.596  26.585 11.151 1.00 30.77  ? 180 LYS A CG  1 
ATOM   1446 C  CD  . LYS A 1 181 ? 28.820  26.295 12.008 1.00 31.59  ? 180 LYS A CD  1 
ATOM   1447 C  CE  . LYS A 1 181 ? 29.934  27.298 11.807 1.00 30.05  ? 180 LYS A CE  1 
ATOM   1448 N  NZ  . LYS A 1 181 ? 31.183  26.823 12.484 1.00 29.06  ? 180 LYS A NZ  1 
ATOM   1449 N  N   . VAL A 1 182 ? 25.062  23.233 9.329  1.00 24.33  ? 181 VAL A N   1 
ATOM   1450 C  CA  . VAL A 1 182 ? 24.765  21.814 9.429  1.00 17.11  ? 181 VAL A CA  1 
ATOM   1451 C  C   . VAL A 1 182 ? 26.088  21.073 9.558  1.00 22.21  ? 181 VAL A C   1 
ATOM   1452 O  O   . VAL A 1 182 ? 26.938  21.155 8.665  1.00 25.02  ? 181 VAL A O   1 
ATOM   1453 C  CB  . VAL A 1 182 ? 23.983  21.306 8.209  1.00 20.62  ? 181 VAL A CB  1 
ATOM   1454 C  CG1 . VAL A 1 182 ? 23.677  19.829 8.351  1.00 22.17  ? 181 VAL A CG1 1 
ATOM   1455 C  CG2 . VAL A 1 182 ? 22.701  22.114 8.036  1.00 23.93  ? 181 VAL A CG2 1 
ATOM   1456 N  N   . VAL A 1 183 ? 26.258  20.387 10.684 1.00 23.01  ? 182 VAL A N   1 
ATOM   1457 C  CA  . VAL A 1 183 ? 27.529  19.764 11.060 1.00 27.11  ? 182 VAL A CA  1 
ATOM   1458 C  C   . VAL A 1 183 ? 27.330  18.365 11.654 1.00 24.62  ? 182 VAL A C   1 
ATOM   1459 O  O   . VAL A 1 183 ? 26.236  18.007 12.108 1.00 23.19  ? 182 VAL A O   1 
ATOM   1460 C  CB  . VAL A 1 183 ? 28.293  20.651 12.076 1.00 23.35  ? 182 VAL A CB  1 
ATOM   1461 C  CG1 . VAL A 1 183 ? 28.540  22.029 11.486 1.00 28.03  ? 182 VAL A CG1 1 
ATOM   1462 C  CG2 . VAL A 1 183 ? 27.525  20.760 13.400 1.00 23.84  ? 182 VAL A CG2 1 
ATOM   1463 N  N   . ASP A 1 184 ? 28.391  17.564 11.676 1.00 21.95  ? 183 ASP A N   1 
ATOM   1464 C  CA  . ASP A 1 184 ? 28.304  16.239 12.284 1.00 22.69  ? 183 ASP A CA  1 
ATOM   1465 C  C   . ASP A 1 184 ? 27.867  16.361 13.744 1.00 23.91  ? 183 ASP A C   1 
ATOM   1466 O  O   . ASP A 1 184 ? 28.252  17.286 14.455 1.00 25.49  ? 183 ASP A O   1 
ATOM   1467 C  CB  . ASP A 1 184 ? 29.651  15.493 12.203 1.00 25.77  ? 183 ASP A CB  1 
ATOM   1468 C  CG  . ASP A 1 184 ? 29.999  15.046 10.792 1.00 40.27  ? 183 ASP A CG  1 
ATOM   1469 O  OD1 . ASP A 1 184 ? 29.095  14.954 9.934  1.00 37.18  ? 183 ASP A OD1 1 
ATOM   1470 O  OD2 . ASP A 1 184 ? 31.164  14.762 10.448 1.00 69.01  ? 183 ASP A OD2 1 
ATOM   1471 N  N   . ASN A 1 185 ? 27.040  15.420 14.183 1.00 20.45  ? 184 ASN A N   1 
ATOM   1472 C  CA  . ASN A 1 185 ? 26.589  15.364 15.559 1.00 18.41  ? 184 ASN A CA  1 
ATOM   1473 C  C   . ASN A 1 185 ? 27.701  14.733 16.372 1.00 23.54  ? 184 ASN A C   1 
ATOM   1474 O  O   . ASN A 1 185 ? 28.006  13.565 16.142 1.00 24.45  ? 184 ASN A O   1 
ATOM   1475 C  CB  . ASN A 1 185 ? 25.336  14.486 15.663 1.00 23.22  ? 184 ASN A CB  1 
ATOM   1476 C  CG  . ASN A 1 185 ? 24.773  14.427 17.068 1.00 26.21  ? 184 ASN A CG  1 
ATOM   1477 O  OD1 . ASN A 1 185 ? 25.420  14.830 18.025 1.00 26.80  ? 184 ASN A OD1 1 
ATOM   1478 N  ND2 . ASN A 1 185 ? 23.556  13.919 17.197 1.00 21.56  ? 184 ASN A ND2 1 
ATOM   1479 N  N   . PRO A 1 186 ? 28.302  15.467 17.311 1.00 25.75  ? 185 PRO A N   1 
ATOM   1480 C  CA  . PRO A 1 186 ? 29.417  14.919 18.101 1.00 33.02  ? 185 PRO A CA  1 
ATOM   1481 C  C   . PRO A 1 186 ? 29.037  13.690 18.945 1.00 25.41  ? 185 PRO A C   1 
ATOM   1482 O  O   . PRO A 1 186 ? 29.904  12.869 19.231 1.00 41.48  ? 185 PRO A O   1 
ATOM   1483 C  CB  . PRO A 1 186 ? 29.829  16.099 18.998 1.00 33.07  ? 185 PRO A CB  1 
ATOM   1484 C  CG  . PRO A 1 186 ? 28.636  16.992 19.046 1.00 42.80  ? 185 PRO A CG  1 
ATOM   1485 C  CD  . PRO A 1 186 ? 27.972  16.849 17.717 1.00 27.18  ? 185 PRO A CD  1 
ATOM   1486 N  N   . ARG A 1 187 ? 27.764  13.570 19.319 1.00 26.85  ? 186 ARG A N   1 
ATOM   1487 C  CA  . ARG A 1 187 ? 27.266  12.448 20.133 1.00 30.70  ? 186 ARG A CA  1 
ATOM   1488 C  C   . ARG A 1 187 ? 26.653  11.284 19.334 1.00 44.39  ? 186 ARG A C   1 
ATOM   1489 O  O   . ARG A 1 187 ? 26.001  10.410 19.915 1.00 37.84  ? 186 ARG A O   1 
ATOM   1490 C  CB  . ARG A 1 187 ? 26.217  12.964 21.133 1.00 47.87  ? 186 ARG A CB  1 
ATOM   1491 C  CG  . ARG A 1 187 ? 26.795  13.759 22.298 1.00 89.00  ? 186 ARG A CG  1 
ATOM   1492 C  CD  . ARG A 1 187 ? 25.864  14.835 22.852 1.00 92.18  ? 186 ARG A CD  1 
ATOM   1493 N  NE  . ARG A 1 187 ? 24.952  14.328 23.882 1.00 144.93 ? 186 ARG A NE  1 
ATOM   1494 C  CZ  . ARG A 1 187 ? 25.090  14.501 25.202 1.00 149.72 ? 186 ARG A CZ  1 
ATOM   1495 N  NH1 . ARG A 1 187 ? 26.119  15.173 25.713 1.00 138.67 ? 186 ARG A NH1 1 
ATOM   1496 N  NH2 . ARG A 1 187 ? 24.182  13.990 26.028 1.00 92.66  ? 186 ARG A NH2 1 
ATOM   1497 N  N   . TRP A 1 188 ? 26.870  11.253 18.020 1.00 34.96  ? 187 TRP A N   1 
ATOM   1498 C  CA  . TRP A 1 188 ? 26.213  10.264 17.149 1.00 30.11  ? 187 TRP A CA  1 
ATOM   1499 C  C   . TRP A 1 188 ? 26.793  8.861  17.332 1.00 96.39  ? 187 TRP A C   1 
ATOM   1500 O  O   . TRP A 1 188 ? 27.965  8.629  17.043 1.00 45.79  ? 187 TRP A O   1 
ATOM   1501 C  CB  . TRP A 1 188 ? 26.301  10.691 15.676 1.00 37.76  ? 187 TRP A CB  1 
ATOM   1502 C  CG  . TRP A 1 188 ? 26.107  9.573  14.688 1.00 50.33  ? 187 TRP A CG  1 
ATOM   1503 C  CD1 . TRP A 1 188 ? 27.039  9.069  13.829 1.00 29.03  ? 187 TRP A CD1 1 
ATOM   1504 C  CD2 . TRP A 1 188 ? 24.911  8.827  14.459 1.00 33.69  ? 187 TRP A CD2 1 
ATOM   1505 N  NE1 . TRP A 1 188 ? 26.496  8.055  13.078 1.00 40.70  ? 187 TRP A NE1 1 
ATOM   1506 C  CE2 . TRP A 1 188 ? 25.187  7.886  13.446 1.00 41.03  ? 187 TRP A CE2 1 
ATOM   1507 C  CE3 . TRP A 1 188 ? 23.620  8.863  15.002 1.00 35.10  ? 187 TRP A CE3 1 
ATOM   1508 C  CZ2 . TRP A 1 188 ? 24.229  6.990  12.968 1.00 49.99  ? 187 TRP A CZ2 1 
ATOM   1509 C  CZ3 . TRP A 1 188 ? 22.671  7.971  14.526 1.00 32.68  ? 187 TRP A CZ3 1 
ATOM   1510 C  CH2 . TRP A 1 188 ? 22.981  7.047  13.522 1.00 50.68  ? 187 TRP A CH2 1 
ATOM   1511 N  N   . LYS A 1 189 ? 25.952  7.934  17.789 0.50 96.32  ? 188 LYS A N   1 
ATOM   1512 C  CA  . LYS A 1 189 ? 26.380  6.576  18.118 0.50 100.63 ? 188 LYS A CA  1 
ATOM   1513 C  C   . LYS A 1 189 ? 26.282  5.638  16.917 0.50 110.68 ? 188 LYS A C   1 
ATOM   1514 O  O   . LYS A 1 189 ? 25.192  5.210  16.533 0.50 31.48  ? 188 LYS A O   1 
ATOM   1515 C  CB  . LYS A 1 189 ? 25.542  6.023  19.275 0.50 122.30 ? 188 LYS A CB  1 
ATOM   1516 C  CG  . LYS A 1 189 ? 25.497  6.926  20.502 0.50 118.46 ? 188 LYS A CG  1 
ATOM   1517 C  CD  . LYS A 1 189 ? 24.952  6.195  21.722 0.50 93.49  ? 188 LYS A CD  1 
ATOM   1518 C  CE  . LYS A 1 189 ? 23.499  5.782  21.531 0.50 66.06  ? 188 LYS A CE  1 
ATOM   1519 N  NZ  . LYS A 1 189 ? 22.828  5.478  22.824 0.50 85.65  ? 188 LYS A NZ  1 
ATOM   1520 N  N   . LYS A 1 190 ? 27.432  5.323  16.329 0.50 46.64  ? 189 LYS A N   1 
ATOM   1521 C  CA  . LYS A 1 190 ? 27.506  4.337  15.252 0.50 47.54  ? 189 LYS A CA  1 
ATOM   1522 C  C   . LYS A 1 190 ? 28.904  4.277  14.639 0.50 84.93  ? 189 LYS A C   1 
ATOM   1523 O  O   . LYS A 1 190 ? 29.476  5.302  14.266 0.50 30.46  ? 189 LYS A O   1 
ATOM   1524 C  CB  . LYS A 1 190 ? 26.472  4.638  14.163 0.50 58.69  ? 189 LYS A CB  1 
ATOM   1525 C  CG  . LYS A 1 190 ? 26.204  3.464  13.219 0.50 54.12  ? 189 LYS A CG  1 
ATOM   1526 C  CD  . LYS A 1 190 ? 26.853  3.665  11.850 0.50 48.93  ? 189 LYS A CD  1 
ATOM   1527 C  CE  . LYS A 1 190 ? 26.970  2.357  11.069 0.50 53.82  ? 189 LYS A CE  1 
ATOM   1528 N  NZ  . LYS A 1 190 ? 25.813  2.129  10.158 0.50 40.50  ? 189 LYS A NZ  1 
HETATM 1529 O  O1A . PA5 B 2 .   ? 3.909   13.698 8.720  1.00 23.44  ? 301 PA5 A O1A 1 
HETATM 1530 C  C1  . PA5 B 2 .   ? 4.655   13.905 9.681  1.00 21.95  ? 301 PA5 A C1  1 
HETATM 1531 O  O1  . PA5 B 2 .   ? 5.587   13.127 9.947  1.00 26.86  ? 301 PA5 A O1  1 
HETATM 1532 C  C2  . PA5 B 2 .   ? 4.432   15.134 10.542 1.00 22.73  ? 301 PA5 A C2  1 
HETATM 1533 O  O2  . PA5 B 2 .   ? 3.040   15.451 10.680 1.00 19.26  ? 301 PA5 A O2  1 
HETATM 1534 C  C3  . PA5 B 2 .   ? 5.082   14.970 11.928 1.00 23.41  ? 301 PA5 A C3  1 
HETATM 1535 O  O3  . PA5 B 2 .   ? 4.448   13.944 12.678 1.00 27.00  ? 301 PA5 A O3  1 
HETATM 1536 C  C4  . PA5 B 2 .   ? 5.031   16.271 12.737 1.00 21.64  ? 301 PA5 A C4  1 
HETATM 1537 O  O4  . PA5 B 2 .   ? 5.707   17.290 12.031 1.00 22.59  ? 301 PA5 A O4  1 
HETATM 1538 C  C5  . PA5 B 2 .   ? 5.670   16.149 14.133 1.00 24.46  ? 301 PA5 A C5  1 
HETATM 1539 O  O5  . PA5 B 2 .   ? 6.955   15.501 14.121 1.00 23.18  ? 301 PA5 A O5  1 
HETATM 1540 P  P   . PA5 B 2 .   ? 7.218   14.096 14.907 1.00 24.51  ? 301 PA5 A P   1 
HETATM 1541 O  O1P . PA5 B 2 .   ? 6.061   13.224 14.511 1.00 25.66  ? 301 PA5 A O1P 1 
HETATM 1542 O  O2P . PA5 B 2 .   ? 8.518   13.558 14.321 1.00 18.64  ? 301 PA5 A O2P 1 
HETATM 1543 O  O3P . PA5 B 2 .   ? 7.283   14.422 16.384 1.00 22.63  ? 301 PA5 A O3P 1 
HETATM 1544 O  O   . HOH C 3 .   ? 9.476   14.772 12.057 1.00 16.06  ? 302 HOH A O   1 
HETATM 1545 O  O   . HOH C 3 .   ? 5.930   13.647 18.462 1.00 36.63  ? 303 HOH A O   1 
HETATM 1546 O  O   . HOH C 3 .   ? 8.006   16.775 10.805 1.00 17.72  ? 304 HOH A O   1 
HETATM 1547 O  O   . HOH C 3 .   ? 3.383   11.766 11.779 1.00 21.52  ? 305 HOH A O   1 
HETATM 1548 O  O   . HOH C 3 .   ? 1.297   13.680 11.863 1.00 24.19  ? 306 HOH A O   1 
HETATM 1549 O  O   . HOH C 3 .   ? 2.886   18.128 9.760  1.00 17.82  ? 307 HOH A O   1 
HETATM 1550 O  O   . HOH C 3 .   ? 4.471   10.131 9.876  1.00 17.74  ? 308 HOH A O   1 
HETATM 1551 O  O   . HOH C 3 .   ? 6.353   28.291 28.394 1.00 26.28  ? 309 HOH A O   1 
HETATM 1552 O  O   . HOH C 3 .   ? 10.706  13.607 27.849 1.00 27.95  ? 310 HOH A O   1 
HETATM 1553 O  O   . HOH C 3 .   ? 12.045  10.225 18.072 1.00 18.19  ? 311 HOH A O   1 
HETATM 1554 O  O   . HOH C 3 .   ? 21.842  21.442 22.082 1.00 22.03  ? 312 HOH A O   1 
HETATM 1555 O  O   . HOH C 3 .   ? -6.831  12.098 6.065  1.00 18.24  ? 313 HOH A O   1 
HETATM 1556 O  O   . HOH C 3 .   ? 18.714  22.493 0.359  1.00 26.20  ? 314 HOH A O   1 
HETATM 1557 O  O   . HOH C 3 .   ? 14.222  4.867  -0.862 1.00 19.85  ? 315 HOH A O   1 
HETATM 1558 O  O   . HOH C 3 .   ? 20.032  19.449 15.478 1.00 16.04  ? 316 HOH A O   1 
HETATM 1559 O  O   . HOH C 3 .   ? 14.421  28.973 15.488 1.00 19.55  ? 317 HOH A O   1 
HETATM 1560 O  O   . HOH C 3 .   ? -8.923  3.861  6.005  1.00 22.25  ? 318 HOH A O   1 
HETATM 1561 O  O   . HOH C 3 .   ? 9.730   23.750 34.645 1.00 17.46  ? 319 HOH A O   1 
HETATM 1562 O  O   . HOH C 3 .   ? 20.599  16.414 18.875 1.00 21.00  ? 320 HOH A O   1 
HETATM 1563 O  O   . HOH C 3 .   ? -11.354 5.756  8.146  1.00 21.71  ? 321 HOH A O   1 
HETATM 1564 O  O   . HOH C 3 .   ? -0.319  2.484  2.044  1.00 22.99  ? 322 HOH A O   1 
HETATM 1565 O  O   . HOH C 3 .   ? -1.025  5.075  0.935  1.00 18.36  ? 323 HOH A O   1 
HETATM 1566 O  O   . HOH C 3 .   ? 19.110  26.824 28.170 1.00 22.57  ? 324 HOH A O   1 
HETATM 1567 O  O   . HOH C 3 .   ? -1.491  26.560 16.924 1.00 29.86  ? 325 HOH A O   1 
HETATM 1568 O  O   . HOH C 3 .   ? 7.518   28.475 21.961 1.00 25.08  ? 326 HOH A O   1 
HETATM 1569 O  O   . HOH C 3 .   ? 22.097  14.318 20.020 1.00 28.90  ? 327 HOH A O   1 
HETATM 1570 O  O   . HOH C 3 .   ? 10.420  0.633  11.472 1.00 22.85  ? 328 HOH A O   1 
HETATM 1571 O  O   . HOH C 3 .   ? 19.614  16.890 14.467 1.00 19.86  ? 329 HOH A O   1 
HETATM 1572 O  O   . HOH C 3 .   ? -12.699 10.132 7.157  1.00 22.99  ? 330 HOH A O   1 
HETATM 1573 O  O   . HOH C 3 .   ? -4.800  -2.798 4.733  1.00 31.45  ? 331 HOH A O   1 
HETATM 1574 O  O   . HOH C 3 .   ? 21.740  30.001 29.677 1.00 55.07  ? 332 HOH A O   1 
HETATM 1575 O  O   . HOH C 3 .   ? -3.787  6.106  10.222 1.00 21.22  ? 333 HOH A O   1 
HETATM 1576 O  O   . HOH C 3 .   ? 0.946   21.678 27.020 1.00 34.60  ? 334 HOH A O   1 
HETATM 1577 O  O   . HOH C 3 .   ? 15.656  27.551 4.784  1.00 26.55  ? 335 HOH A O   1 
HETATM 1578 O  O   . HOH C 3 .   ? 24.162  23.278 21.343 1.00 28.84  ? 336 HOH A O   1 
HETATM 1579 O  O   . HOH C 3 .   ? 2.432   29.815 1.620  1.00 34.69  ? 337 HOH A O   1 
HETATM 1580 O  O   . HOH C 3 .   ? 10.556  5.158  6.963  1.00 19.05  ? 338 HOH A O   1 
HETATM 1581 O  O   . HOH C 3 .   ? 22.796  5.050  3.682  1.00 28.45  ? 339 HOH A O   1 
HETATM 1582 O  O   . HOH C 3 .   ? -16.794 19.025 3.202  1.00 27.41  ? 340 HOH A O   1 
HETATM 1583 O  O   . HOH C 3 .   ? 10.444  9.571  22.290 1.00 30.27  ? 341 HOH A O   1 
HETATM 1584 O  O   . HOH C 3 .   ? 19.260  27.440 25.531 1.00 26.70  ? 342 HOH A O   1 
HETATM 1585 O  O   . HOH C 3 .   ? -5.637  25.700 18.250 1.00 39.14  ? 343 HOH A O   1 
HETATM 1586 O  O   . HOH C 3 .   ? 24.939  24.101 29.004 1.00 34.75  ? 344 HOH A O   1 
HETATM 1587 O  O   . HOH C 3 .   ? 15.980  30.737 17.074 1.00 27.87  ? 345 HOH A O   1 
HETATM 1588 O  O   . HOH C 3 .   ? 17.863  13.618 18.999 1.00 20.80  ? 346 HOH A O   1 
HETATM 1589 O  O   . HOH C 3 .   ? 10.941  30.340 10.795 1.00 22.26  ? 347 HOH A O   1 
HETATM 1590 O  O   . HOH C 3 .   ? 20.174  14.767 16.764 1.00 25.12  ? 348 HOH A O   1 
HETATM 1591 O  O   . HOH C 3 .   ? -0.819  28.817 15.066 1.00 28.27  ? 349 HOH A O   1 
HETATM 1592 O  O   . HOH C 3 .   ? -12.600 2.733  2.443  1.00 28.81  ? 350 HOH A O   1 
HETATM 1593 O  O   . HOH C 3 .   ? -14.422 19.077 7.009  1.00 38.33  ? 351 HOH A O   1 
HETATM 1594 O  O   . HOH C 3 .   ? 10.760  32.236 33.471 1.00 33.54  ? 352 HOH A O   1 
HETATM 1595 O  O   . HOH C 3 .   ? 5.564   28.383 25.059 1.00 27.73  ? 353 HOH A O   1 
HETATM 1596 O  O   . HOH C 3 .   ? 21.599  23.084 33.508 1.00 25.93  ? 354 HOH A O   1 
HETATM 1597 O  O   . HOH C 3 .   ? 9.920   7.737  4.657  1.00 30.13  ? 355 HOH A O   1 
HETATM 1598 O  O   . HOH C 3 .   ? 9.161   -2.122 7.868  1.00 26.31  ? 356 HOH A O   1 
HETATM 1599 O  O   . HOH C 3 .   ? 17.882  11.438 20.549 1.00 23.00  ? 357 HOH A O   1 
HETATM 1600 O  O   . HOH C 3 .   ? -2.223  30.918 15.777 1.00 33.73  ? 358 HOH A O   1 
HETATM 1601 O  O   . HOH C 3 .   ? 28.608  31.479 18.699 1.00 50.97  ? 359 HOH A O   1 
HETATM 1602 O  O   . HOH C 3 .   ? 22.999  17.086 3.072  1.00 29.93  ? 360 HOH A O   1 
HETATM 1603 O  O   . HOH C 3 .   ? 12.217  11.512 25.957 1.00 37.39  ? 361 HOH A O   1 
HETATM 1604 O  O   . HOH C 3 .   ? -9.999  1.247  2.079  1.00 33.94  ? 362 HOH A O   1 
HETATM 1605 O  O   . HOH C 3 .   ? 14.423  30.659 2.636  1.00 61.47  ? 363 HOH A O   1 
HETATM 1606 O  O   . HOH C 3 .   ? -9.685  8.030  12.136 1.00 43.25  ? 364 HOH A O   1 
HETATM 1607 O  O   . HOH C 3 .   ? -6.127  -3.778 2.230  1.00 45.42  ? 365 HOH A O   1 
HETATM 1608 O  O   . HOH C 3 .   ? -6.461  29.977 12.005 1.00 33.12  ? 366 HOH A O   1 
HETATM 1609 O  O   . HOH C 3 .   ? 5.385   22.946 31.514 1.00 32.02  ? 367 HOH A O   1 
HETATM 1610 O  O   . HOH C 3 .   ? 0.488   7.088  9.384  1.00 24.73  ? 368 HOH A O   1 
HETATM 1611 O  O   . HOH C 3 .   ? 13.687  25.970 38.637 1.00 28.12  ? 369 HOH A O   1 
HETATM 1612 O  O   . HOH C 3 .   ? -1.401  17.748 23.524 1.00 30.10  ? 370 HOH A O   1 
HETATM 1613 O  O   . HOH C 3 .   ? 23.696  31.462 7.774  1.00 32.13  ? 371 HOH A O   1 
HETATM 1614 O  O   . HOH C 3 .   ? 29.810  36.012 9.081  1.00 30.94  ? 372 HOH A O   1 
HETATM 1615 O  O   . HOH C 3 .   ? 14.913  29.354 23.070 1.00 36.83  ? 373 HOH A O   1 
HETATM 1616 O  O   . HOH C 3 .   ? 6.863   33.244 5.551  1.00 27.88  ? 374 HOH A O   1 
HETATM 1617 O  O   . HOH C 3 .   ? 10.346  -2.020 10.433 1.00 29.23  ? 375 HOH A O   1 
HETATM 1618 O  O   . HOH C 3 .   ? 4.180   32.405 3.813  1.00 37.40  ? 376 HOH A O   1 
HETATM 1619 O  O   . HOH C 3 .   ? 5.657   32.379 10.739 1.00 26.31  ? 377 HOH A O   1 
HETATM 1620 O  O   . HOH C 3 .   ? -11.216 2.731  5.477  1.00 36.63  ? 378 HOH A O   1 
HETATM 1621 O  O   . HOH C 3 .   ? -11.297 18.859 10.888 1.00 44.44  ? 379 HOH A O   1 
HETATM 1622 O  O   . HOH C 3 .   ? 17.035  16.869 25.405 1.00 29.23  ? 380 HOH A O   1 
HETATM 1623 O  O   . HOH C 3 .   ? 27.850  22.626 26.586 1.00 38.37  ? 381 HOH A O   1 
HETATM 1624 O  O   . HOH C 3 .   ? 23.357  16.605 0.163  1.00 47.52  ? 382 HOH A O   1 
HETATM 1625 O  O   . HOH C 3 .   ? 5.823   17.398 29.436 1.00 36.50  ? 383 HOH A O   1 
HETATM 1626 O  O   . HOH C 3 .   ? 27.750  14.758 4.498  1.00 50.78  ? 384 HOH A O   1 
HETATM 1627 O  O   . HOH C 3 .   ? -8.524  28.155 4.540  1.00 38.47  ? 385 HOH A O   1 
HETATM 1628 O  O   . HOH C 3 .   ? 20.354  25.479 1.276  1.00 31.11  ? 386 HOH A O   1 
HETATM 1629 O  O   . HOH C 3 .   ? 10.846  32.439 4.467  1.00 42.96  ? 387 HOH A O   1 
HETATM 1630 O  O   . HOH C 3 .   ? -12.905 3.521  8.159  1.00 32.40  ? 388 HOH A O   1 
HETATM 1631 O  O   . HOH C 3 .   ? 17.835  31.764 9.306  1.00 34.47  ? 389 HOH A O   1 
HETATM 1632 O  O   . HOH C 3 .   ? 10.727  15.722 31.361 1.00 34.52  ? 390 HOH A O   1 
HETATM 1633 O  O   . HOH C 3 .   ? 19.706  5.691  11.374 1.00 31.85  ? 391 HOH A O   1 
HETATM 1634 O  O   . HOH C 3 .   ? 21.286  26.433 35.678 1.00 39.46  ? 392 HOH A O   1 
HETATM 1635 O  O   . HOH C 3 .   ? 2.969   15.605 18.732 1.00 40.87  ? 393 HOH A O   1 
HETATM 1636 O  O   . HOH C 3 .   ? 11.682  22.019 39.031 1.00 40.33  ? 394 HOH A O   1 
HETATM 1637 O  O   . HOH C 3 .   ? -11.992 17.105 8.644  1.00 42.25  ? 395 HOH A O   1 
HETATM 1638 O  O   . HOH C 3 .   ? -15.006 10.754 5.822  1.00 26.31  ? 396 HOH A O   1 
HETATM 1639 O  O   . HOH C 3 .   ? 25.570  24.487 23.483 1.00 39.14  ? 397 HOH A O   1 
HETATM 1640 O  O   . HOH C 3 .   ? 13.372  -2.919 10.616 1.00 51.89  ? 398 HOH A O   1 
HETATM 1641 O  O   . HOH C 3 .   ? 21.191  33.075 11.605 1.00 48.16  ? 399 HOH A O   1 
HETATM 1642 O  O   . HOH C 3 .   ? 13.567  -1.150 13.141 1.00 46.59  ? 400 HOH A O   1 
HETATM 1643 O  O   . HOH C 3 .   ? 4.119   32.851 17.892 1.00 45.79  ? 401 HOH A O   1 
HETATM 1644 O  O   . HOH C 3 .   ? 9.019   -0.223 13.874 1.00 31.51  ? 402 HOH A O   1 
HETATM 1645 O  O   . HOH C 3 .   ? 17.786  28.428 29.755 1.00 32.49  ? 403 HOH A O   1 
HETATM 1646 O  O   . HOH C 3 .   ? 12.944  1.424  12.165 1.00 28.10  ? 404 HOH A O   1 
HETATM 1647 O  O   . HOH C 3 .   ? -16.609 8.776  6.324  1.00 26.96  ? 405 HOH A O   1 
HETATM 1648 O  O   . HOH C 3 .   ? -13.185 23.673 7.632  1.00 31.58  ? 406 HOH A O   1 
HETATM 1649 O  O   . HOH C 3 .   ? 9.120   30.047 20.648 1.00 30.91  ? 407 HOH A O   1 
HETATM 1650 O  O   . HOH C 3 .   ? 15.156  1.941  10.715 1.00 27.86  ? 408 HOH A O   1 
HETATM 1651 O  O   . HOH C 3 .   ? 16.551  10.583 28.556 1.00 45.78  ? 409 HOH A O   1 
HETATM 1652 O  O   . HOH C 3 .   ? 6.980   32.726 17.699 1.00 37.90  ? 410 HOH A O   1 
HETATM 1653 O  O   . HOH C 3 .   ? 2.844   28.058 27.342 1.00 35.17  ? 411 HOH A O   1 
HETATM 1654 O  O   . HOH C 3 .   ? 27.226  18.147 24.872 0.50 32.33  ? 412 HOH A O   1 
HETATM 1655 O  O   . HOH C 3 .   ? 10.107  8.961  7.617  1.00 32.68  ? 413 HOH A O   1 
HETATM 1656 O  O   . HOH C 3 .   ? 18.007  32.308 13.163 1.00 31.48  ? 414 HOH A O   1 
HETATM 1657 O  O   . HOH C 3 .   ? 11.248  -3.210 5.995  1.00 38.87  ? 415 HOH A O   1 
HETATM 1658 O  O   . HOH C 3 .   ? -4.946  29.582 3.702  1.00 31.72  ? 416 HOH A O   1 
HETATM 1659 O  O   . HOH C 3 .   ? 14.662  4.425  22.379 1.00 39.17  ? 417 HOH A O   1 
HETATM 1660 O  O   . HOH C 3 .   ? 22.719  25.716 33.310 1.00 36.53  ? 418 HOH A O   1 
HETATM 1661 O  O   . HOH C 3 .   ? -6.836  7.204  12.616 1.00 42.96  ? 419 HOH A O   1 
HETATM 1662 O  O   . HOH C 3 .   ? 7.697   20.754 32.772 1.00 39.90  ? 420 HOH A O   1 
HETATM 1663 O  O   . HOH C 3 .   ? 18.987  9.699  24.216 1.00 43.06  ? 421 HOH A O   1 
HETATM 1664 O  O   . HOH C 3 .   ? 6.737   14.052 28.928 1.00 41.11  ? 422 HOH A O   1 
HETATM 1665 O  O   . HOH C 3 .   ? 16.474  30.949 28.818 1.00 43.59  ? 423 HOH A O   1 
HETATM 1666 O  O   . HOH C 3 .   ? 9.555   19.383 33.941 1.00 35.42  ? 424 HOH A O   1 
HETATM 1667 O  O   . HOH C 3 .   ? -0.571  0.774  0.032  0.50 26.13  ? 425 HOH A O   1 
HETATM 1668 O  O   . HOH C 3 .   ? 17.521  29.147 24.482 1.00 36.10  ? 426 HOH A O   1 
HETATM 1669 O  O   . HOH C 3 .   ? -7.342  12.601 13.208 1.00 32.90  ? 427 HOH A O   1 
HETATM 1670 O  O   . HOH C 3 .   ? 25.478  19.806 28.649 1.00 26.90  ? 428 HOH A O   1 
HETATM 1671 O  O   . HOH C 3 .   ? 11.755  12.728 30.136 1.00 42.58  ? 429 HOH A O   1 
HETATM 1672 O  O   . HOH C 3 .   ? 33.197  16.070 11.577 1.00 52.99  ? 430 HOH A O   1 
HETATM 1673 O  O   . HOH C 3 .   ? -2.427  28.868 18.527 1.00 47.18  ? 431 HOH A O   1 
HETATM 1674 O  O   . HOH C 3 .   ? 0.240   32.178 2.564  1.00 44.14  ? 432 HOH A O   1 
HETATM 1675 O  O   . HOH C 3 .   ? 15.296  10.396 24.227 1.00 33.31  ? 433 HOH A O   1 
HETATM 1676 O  O   . HOH C 3 .   ? 26.232  0.547  3.170  1.00 45.61  ? 434 HOH A O   1 
HETATM 1677 O  O   . HOH C 3 .   ? 26.920  21.964 19.723 1.00 41.92  ? 435 HOH A O   1 
HETATM 1678 O  O   . HOH C 3 .   ? 1.086   33.964 0.708  1.00 42.75  ? 436 HOH A O   1 
HETATM 1679 O  O   . HOH C 3 .   ? -2.013  32.190 1.546  1.00 36.83  ? 437 HOH A O   1 
HETATM 1680 O  O   . HOH C 3 .   ? 29.026  29.324 8.831  1.00 31.51  ? 438 HOH A O   1 
HETATM 1681 O  O   . HOH C 3 .   ? 26.357  36.862 11.254 1.00 47.64  ? 439 HOH A O   1 
HETATM 1682 O  O   . HOH C 3 .   ? 14.211  35.006 10.617 1.00 41.09  ? 440 HOH A O   1 
HETATM 1683 O  O   . HOH C 3 .   ? -11.473 12.103 8.576  1.00 29.05  ? 441 HOH A O   1 
HETATM 1684 O  O   . HOH C 3 .   ? 24.339  -0.373 1.687  1.00 41.60  ? 442 HOH A O   1 
HETATM 1685 O  O   . HOH C 3 .   ? 10.754  21.485 35.704 1.00 28.81  ? 443 HOH A O   1 
HETATM 1686 O  O   . HOH C 3 .   ? 32.446  25.484 19.196 1.00 33.29  ? 444 HOH A O   1 
HETATM 1687 O  O   . HOH C 3 .   ? 7.634   2.341  -1.239 1.00 21.93  ? 445 HOH A O   1 
HETATM 1688 O  O   . HOH C 3 .   ? 30.616  18.507 9.738  1.00 40.16  ? 446 HOH A O   1 
HETATM 1689 O  O   . HOH C 3 .   ? 7.391   1.070  15.449 1.00 31.50  ? 447 HOH A O   1 
HETATM 1690 O  O   . HOH C 3 .   ? 7.696   4.504  18.377 1.00 20.74  ? 448 HOH A O   1 
HETATM 1691 O  O   . HOH C 3 .   ? 10.275  2.433  18.416 1.00 31.83  ? 449 HOH A O   1 
HETATM 1692 O  O   . HOH C 3 .   ? 18.050  15.849 27.958 1.00 33.97  ? 450 HOH A O   1 
HETATM 1693 O  O   . HOH C 3 .   ? 10.375  19.899 38.285 1.00 33.11  ? 451 HOH A O   1 
HETATM 1694 O  O   . HOH C 3 .   ? -15.283 3.091  6.929  1.00 34.01  ? 452 HOH A O   1 
HETATM 1695 O  O   . HOH C 3 .   ? -7.585  -0.147 14.049 1.00 41.96  ? 453 HOH A O   1 
HETATM 1696 O  O   . HOH C 3 .   ? 30.857  18.299 14.549 1.00 27.25  ? 454 HOH A O   1 
HETATM 1697 O  O   . HOH C 3 .   ? 25.777  17.724 27.231 1.00 35.40  ? 455 HOH A O   1 
HETATM 1698 O  O   . HOH C 3 .   ? -3.897  16.632 16.057 1.00 31.99  ? 456 HOH A O   1 
HETATM 1699 O  O   . HOH C 3 .   ? 28.795  23.892 18.387 1.00 32.46  ? 457 HOH A O   1 
HETATM 1700 O  O   . HOH C 3 .   ? -1.317  14.813 16.340 1.00 35.92  ? 458 HOH A O   1 
HETATM 1701 O  O   . HOH C 3 .   ? 14.843  22.801 -1.217 1.00 30.84  ? 459 HOH A O   1 
HETATM 1702 O  O   . HOH C 3 .   ? 6.785   -1.215 -1.411 1.00 31.54  ? 460 HOH A O   1 
HETATM 1703 O  O   . HOH C 3 .   ? 16.879  32.612 15.431 1.00 34.90  ? 461 HOH A O   1 
HETATM 1704 O  O   . HOH C 3 .   ? 26.952  28.081 7.588  1.00 41.40  ? 462 HOH A O   1 
HETATM 1705 O  O   . HOH C 3 .   ? 26.954  18.349 7.318  1.00 43.63  ? 463 HOH A O   1 
HETATM 1706 O  O   . HOH C 3 .   ? 1.101   26.706 25.916 1.00 40.10  ? 464 HOH A O   1 
HETATM 1707 O  O   . HOH C 3 .   ? -17.607 -1.256 4.733  1.00 37.84  ? 465 HOH A O   1 
HETATM 1708 O  O   . HOH C 3 .   ? 9.087   31.596 -0.713 1.00 38.25  ? 466 HOH A O   1 
HETATM 1709 O  O   . HOH C 3 .   ? -0.410  25.364 22.976 1.00 33.11  ? 467 HOH A O   1 
HETATM 1710 O  O   . HOH C 3 .   ? 12.646  29.156 24.292 1.00 39.92  ? 468 HOH A O   1 
HETATM 1711 O  O   . HOH C 3 .   ? 22.507  4.089  11.720 1.00 42.39  ? 469 HOH A O   1 
HETATM 1712 O  O   . HOH C 3 .   ? 5.966   35.214 7.134  1.00 38.17  ? 470 HOH A O   1 
HETATM 1713 O  O   . HOH C 3 .   ? 4.672   33.277 0.985  1.00 37.07  ? 471 HOH A O   1 
HETATM 1714 O  O   . HOH C 3 .   ? -14.812 23.773 5.371  1.00 43.25  ? 472 HOH A O   1 
HETATM 1715 O  O   . HOH C 3 .   ? 1.877   19.088 26.285 1.00 44.89  ? 473 HOH A O   1 
HETATM 1716 O  O   . HOH C 3 .   ? 2.566   15.473 28.948 1.00 49.51  ? 474 HOH A O   1 
HETATM 1717 O  O   . HOH C 3 .   ? 2.309   32.471 12.293 1.00 38.85  ? 475 HOH A O   1 
HETATM 1718 O  O   . HOH C 3 .   ? 1.191   30.097 16.710 1.00 32.45  ? 476 HOH A O   1 
HETATM 1719 O  O   . HOH C 3 .   ? 16.451  -1.553 7.558  1.00 42.38  ? 477 HOH A O   1 
HETATM 1720 O  O   . HOH C 3 .   ? 15.660  -0.778 9.852  1.00 38.40  ? 478 HOH A O   1 
HETATM 1721 O  O   . HOH C 3 .   ? 18.572  21.692 15.269 1.00 18.92  ? 479 HOH A O   1 
HETATM 1722 O  O   . HOH C 3 .   ? -16.614 -0.557 -5.120 1.00 45.76  ? 480 HOH A O   1 
HETATM 1723 O  O   . HOH C 3 .   ? 22.048  -1.856 1.651  1.00 56.08  ? 481 HOH A O   1 
HETATM 1724 O  O   . HOH C 3 .   ? 8.863   -1.787 4.580  1.00 37.67  ? 482 HOH A O   1 
HETATM 1725 O  O   . HOH C 3 .   ? -0.078  -1.891 -0.410 0.50 38.20  ? 483 HOH A O   1 
HETATM 1726 O  O   . HOH C 3 .   ? 3.093   7.738  9.878  1.00 19.47  ? 484 HOH A O   1 
HETATM 1727 O  O   . HOH C 3 .   ? -2.102  3.557  3.792  1.00 30.39  ? 485 HOH A O   1 
HETATM 1728 O  O   . HOH C 3 .   ? -8.703  15.370 13.236 1.00 32.69  ? 486 HOH A O   1 
HETATM 1729 O  O   . HOH C 3 .   ? 18.471  26.872 4.761  1.00 39.40  ? 487 HOH A O   1 
HETATM 1730 O  O   . HOH C 3 .   ? -5.411  8.656  14.258 1.00 56.70  ? 488 HOH A O   1 
HETATM 1731 O  O   . HOH C 3 .   ? 17.406  1.965  12.145 1.00 42.13  ? 489 HOH A O   1 
HETATM 1732 O  O   . HOH C 3 .   ? 2.021   27.855 21.713 1.00 34.91  ? 490 HOH A O   1 
HETATM 1733 O  O   . HOH C 3 .   ? -8.400  23.358 15.168 1.00 37.05  ? 491 HOH A O   1 
HETATM 1734 O  O   . HOH C 3 .   ? 18.417  14.677 30.545 1.00 39.84  ? 492 HOH A O   1 
HETATM 1735 O  O   . HOH C 3 .   ? 13.339  23.530 -3.228 1.00 44.11  ? 493 HOH A O   1 
HETATM 1736 O  O   . HOH C 3 .   ? 28.041  12.231 11.876 1.00 40.46  ? 494 HOH A O   1 
HETATM 1737 O  O   . HOH C 3 .   ? 1.635   32.059 4.819  1.00 42.67  ? 495 HOH A O   1 
HETATM 1738 O  O   . HOH C 3 .   ? 0.878   22.217 29.775 1.00 44.27  ? 496 HOH A O   1 
HETATM 1739 O  O   . HOH C 3 .   ? -6.281  3.234  12.840 1.00 42.86  ? 497 HOH A O   1 
HETATM 1740 O  O   . HOH C 3 .   ? 14.420  1.003  18.003 1.00 39.78  ? 498 HOH A O   1 
HETATM 1741 O  O   . HOH C 3 .   ? 17.403  34.880 12.186 1.00 47.63  ? 499 HOH A O   1 
HETATM 1742 O  O   . HOH C 3 .   ? -1.126  -4.289 3.315  1.00 44.66  ? 500 HOH A O   1 
HETATM 1743 O  O   . HOH C 3 .   ? 9.987   27.729 -2.288 1.00 38.03  ? 501 HOH A O   1 
HETATM 1744 O  O   . HOH C 3 .   ? 4.612   29.258 21.861 1.00 39.65  ? 502 HOH A O   1 
HETATM 1745 O  O   . HOH C 3 .   ? 16.094  31.151 25.784 1.00 39.73  ? 503 HOH A O   1 
HETATM 1746 O  O   . HOH C 3 .   ? 29.575  10.750 16.444 1.00 51.14  ? 504 HOH A O   1 
HETATM 1747 O  O   . HOH C 3 .   ? 10.482  34.048 8.378  1.00 45.27  ? 505 HOH A O   1 
HETATM 1748 O  O   . HOH C 3 .   ? 11.148  17.569 33.127 1.00 38.01  ? 506 HOH A O   1 
HETATM 1749 O  O   . HOH C 3 .   ? 11.622  32.879 10.364 1.00 35.63  ? 507 HOH A O   1 
HETATM 1750 O  O   . HOH C 3 .   ? 0.918   13.281 14.540 1.00 40.74  ? 508 HOH A O   1 
HETATM 1751 O  O   . HOH C 3 .   ? -1.048  27.689 20.553 1.00 43.39  ? 509 HOH A O   1 
HETATM 1752 O  O   . HOH C 3 .   ? -15.484 27.525 8.063  1.00 45.40  ? 510 HOH A O   1 
HETATM 1753 O  O   . HOH C 3 .   ? -13.801 21.363 9.182  1.00 46.71  ? 511 HOH A O   1 
HETATM 1754 O  O   . HOH C 3 .   ? 8.489   35.270 16.536 1.00 48.01  ? 512 HOH A O   1 
HETATM 1755 O  O   . HOH C 3 .   ? 13.705  25.796 -0.162 1.00 44.50  ? 513 HOH A O   1 
HETATM 1756 O  O   . HOH C 3 .   ? 26.069  37.687 7.549  1.00 47.41  ? 514 HOH A O   1 
HETATM 1757 O  O   . HOH C 3 .   ? 10.859  41.332 15.256 1.00 44.51  ? 515 HOH A O   1 
HETATM 1758 O  O   . HOH C 3 .   ? 22.888  13.739 30.440 1.00 51.95  ? 516 HOH A O   1 
HETATM 1759 O  O   . HOH C 3 .   ? -18.122 16.294 3.572  1.00 37.49  ? 517 HOH A O   1 
HETATM 1760 O  O   . HOH C 3 .   ? 29.598  12.332 14.509 1.00 41.64  ? 518 HOH A O   1 
HETATM 1761 O  O   . HOH C 3 .   ? 12.185  34.502 17.813 1.00 46.44  ? 519 HOH A O   1 
HETATM 1762 O  O   . HOH C 3 .   ? -5.332  34.143 10.405 1.00 45.09  ? 520 HOH A O   1 
HETATM 1763 O  O   . HOH C 3 .   ? 2.231   36.814 14.072 1.00 48.39  ? 521 HOH A O   1 
HETATM 1764 O  O   . HOH C 3 .   ? 15.007  27.838 2.139  1.00 48.82  ? 522 HOH A O   1 
HETATM 1765 O  O   . HOH C 3 .   ? 25.738  11.486 8.090  1.00 37.06  ? 523 HOH A O   1 
HETATM 1766 O  O   . HOH C 3 .   ? -10.221 11.787 10.803 1.00 42.39  ? 524 HOH A O   1 
HETATM 1767 O  O   . HOH C 3 .   ? -15.876 2.084  4.539  1.00 56.57  ? 525 HOH A O   1 
HETATM 1768 O  O   . HOH C 3 .   ? 4.458   35.395 13.921 1.00 37.85  ? 526 HOH A O   1 
HETATM 1769 O  O   . HOH C 3 .   ? 7.686   18.135 35.921 1.00 43.51  ? 527 HOH A O   1 
HETATM 1770 O  O   . HOH C 3 .   ? 17.090  27.166 -0.324 1.00 43.80  ? 528 HOH A O   1 
HETATM 1771 O  O   . HOH C 3 .   ? -10.727 15.830 11.586 1.00 47.21  ? 529 HOH A O   1 
HETATM 1772 O  O   . HOH C 3 .   ? -18.076 14.937 6.120  1.00 58.13  ? 530 HOH A O   1 
HETATM 1773 O  O   . HOH C 3 .   ? -4.147  30.533 1.069  1.00 38.10  ? 531 HOH A O   1 
HETATM 1774 O  O   . HOH C 3 .   ? 8.788   34.076 3.770  1.00 43.43  ? 532 HOH A O   1 
HETATM 1775 O  O   . HOH C 3 .   ? -12.709 -0.227 8.244  1.00 50.43  ? 533 HOH A O   1 
HETATM 1776 O  O   . HOH C 3 .   ? 18.087  22.820 35.508 1.00 70.76  ? 534 HOH A O   1 
HETATM 1777 O  O   . HOH C 3 .   ? 9.945   30.294 23.508 1.00 43.14  ? 535 HOH A O   1 
HETATM 1778 O  O   . HOH C 3 .   ? 16.331  5.738  24.261 1.00 42.08  ? 536 HOH A O   1 
HETATM 1779 O  O   . HOH C 3 .   ? 13.826  31.204 29.447 1.00 43.75  ? 537 HOH A O   1 
HETATM 1780 O  O   . HOH C 3 .   ? 3.175   28.898 24.005 1.00 47.79  ? 538 HOH A O   1 
HETATM 1781 O  O   . HOH C 3 .   ? 29.817  30.628 11.066 1.00 50.30  ? 539 HOH A O   1 
HETATM 1782 O  O   . HOH C 3 .   ? -17.233 19.305 5.926  1.00 43.30  ? 540 HOH A O   1 
HETATM 1783 O  O   . HOH C 3 .   ? -8.418  -2.495 2.877  1.00 47.20  ? 541 HOH A O   1 
HETATM 1784 O  O   . HOH C 3 .   ? 32.341  29.479 16.217 1.00 52.08  ? 542 HOH A O   1 
HETATM 1785 O  O   . HOH C 3 .   ? -6.511  31.435 14.292 1.00 45.76  ? 543 HOH A O   1 
HETATM 1786 O  O   . HOH C 3 .   ? 29.467  13.601 6.229  1.00 49.28  ? 544 HOH A O   1 
HETATM 1787 O  O   . HOH C 3 .   ? 17.831  28.898 1.789  1.00 44.25  ? 545 HOH A O   1 
HETATM 1788 O  O   . HOH C 3 .   ? 16.197  31.750 19.553 1.00 43.58  ? 546 HOH A O   1 
HETATM 1789 O  O   . HOH C 3 .   ? 18.202  34.066 19.596 1.00 47.77  ? 547 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MSE 1   0   1   MSE MSE A . n 
A 1 2   MSE 2   1   1   MSE MSE A . n 
A 1 3   TYR 3   2   2   TYR TYR A . n 
A 1 4   LYS 4   3   3   LYS LYS A . n 
A 1 5   GLU 5   4   4   GLU GLU A . n 
A 1 6   PRO 6   5   5   PRO PRO A . n 
A 1 7   PHE 7   6   6   PHE PHE A . n 
A 1 8   GLY 8   7   7   GLY GLY A . n 
A 1 9   VAL 9   8   8   VAL VAL A . n 
A 1 10  LYS 10  9   9   LYS LYS A . n 
A 1 11  VAL 11  10  10  VAL VAL A . n 
A 1 12  ASP 12  11  11  ASP ASP A . n 
A 1 13  PHE 13  12  12  PHE PHE A . n 
A 1 14  GLU 14  13  13  GLU GLU A . n 
A 1 15  THR 15  14  14  THR THR A . n 
A 1 16  GLY 16  15  15  GLY GLY A . n 
A 1 17  ILE 17  16  16  ILE ILE A . n 
A 1 18  ILE 18  17  17  ILE ILE A . n 
A 1 19  GLU 19  18  18  GLU GLU A . n 
A 1 20  GLY 20  19  19  GLY GLY A . n 
A 1 21  ALA 21  20  20  ALA ALA A . n 
A 1 22  LYS 22  21  21  LYS LYS A . n 
A 1 23  LYS 23  22  22  LYS LYS A . n 
A 1 24  SER 24  23  23  SER SER A . n 
A 1 25  VAL 25  24  24  VAL VAL A . n 
A 1 26  ARG 26  25  25  ARG ARG A . n 
A 1 27  ARG 27  26  26  ARG ARG A . n 
A 1 28  LEU 28  27  27  LEU LEU A . n 
A 1 29  SER 29  28  28  SER SER A . n 
A 1 30  ASP 30  29  29  ASP ASP A . n 
A 1 31  MSE 31  30  30  MSE MSE A . n 
A 1 32  GLU 32  31  31  GLU GLU A . n 
A 1 33  GLY 33  32  32  GLY GLY A . n 
A 1 34  TYR 34  33  33  TYR TYR A . n 
A 1 35  PHE 35  34  34  PHE PHE A . n 
A 1 36  VAL 36  35  35  VAL VAL A . n 
A 1 37  ASP 37  36  36  ASP ASP A . n 
A 1 38  GLU 38  37  37  GLU GLU A . n 
A 1 39  ARG 39  38  38  ARG ARG A . n 
A 1 40  ALA 40  39  39  ALA ALA A . n 
A 1 41  TRP 41  40  40  TRP TRP A . n 
A 1 42  LYS 42  41  41  LYS LYS A . n 
A 1 43  GLU 43  42  42  GLU GLU A . n 
A 1 44  LEU 44  43  43  LEU LEU A . n 
A 1 45  VAL 45  44  44  VAL VAL A . n 
A 1 46  GLU 46  45  45  GLU GLU A . n 
A 1 47  LYS 47  46  46  LYS LYS A . n 
A 1 48  GLU 48  47  47  GLU GLU A . n 
A 1 49  ASP 49  48  48  ASP ASP A . n 
A 1 50  PRO 50  49  49  PRO PRO A . n 
A 1 51  VAL 51  50  50  VAL VAL A . n 
A 1 52  VAL 52  51  51  VAL VAL A . n 
A 1 53  TYR 53  52  52  TYR TYR A . n 
A 1 54  GLU 54  53  53  GLU GLU A . n 
A 1 55  VAL 55  54  54  VAL VAL A . n 
A 1 56  TYR 56  55  55  TYR TYR A . n 
A 1 57  ALA 57  56  56  ALA ALA A . n 
A 1 58  VAL 58  57  57  VAL VAL A . n 
A 1 59  GLU 59  58  58  GLU GLU A . n 
A 1 60  GLN 60  59  59  GLN GLN A . n 
A 1 61  GLU 61  60  60  GLU GLU A . n 
A 1 62  GLU 62  61  61  GLU GLU A . n 
A 1 63  LYS 63  62  62  LYS LYS A . n 
A 1 64  GLU 64  63  63  GLU GLU A . n 
A 1 65  GLY 65  64  64  GLY GLY A . n 
A 1 66  ASP 66  65  65  ASP ASP A . n 
A 1 67  LEU 67  66  66  LEU LEU A . n 
A 1 68  ASN 68  67  67  ASN ASN A . n 
A 1 69  PHE 69  68  68  PHE PHE A . n 
A 1 70  ALA 70  69  69  ALA ALA A . n 
A 1 71  THR 71  70  70  THR THR A . n 
A 1 72  THR 72  71  71  THR THR A . n 
A 1 73  VAL 73  72  72  VAL VAL A . n 
A 1 74  LEU 74  73  73  LEU LEU A . n 
A 1 75  TYR 75  74  74  TYR TYR A . n 
A 1 76  PRO 76  75  75  PRO PRO A . n 
A 1 77  GLY 77  76  76  GLY GLY A . n 
A 1 78  LYS 78  77  77  LYS LYS A . n 
A 1 79  VAL 79  78  78  VAL VAL A . n 
A 1 80  GLY 80  79  79  GLY GLY A . n 
A 1 81  LYS 81  80  80  LYS LYS A . n 
A 1 82  GLU 82  81  81  GLU GLU A . n 
A 1 83  PHE 83  82  82  PHE PHE A . n 
A 1 84  PHE 84  83  83  PHE PHE A . n 
A 1 85  PHE 85  84  84  PHE PHE A . n 
A 1 86  THR 86  85  85  THR THR A . n 
A 1 87  LYS 87  86  86  LYS LYS A . n 
A 1 88  GLY 88  87  87  GLY GLY A . n 
A 1 89  HIS 89  88  88  HIS HIS A . n 
A 1 90  PHE 90  89  89  PHE PHE A . n 
A 1 91  HIS 91  90  90  HIS HIS A . n 
A 1 92  ALA 92  91  91  ALA ALA A . n 
A 1 93  LYS 93  92  92  LYS LYS A . n 
A 1 94  LEU 94  93  93  LEU LEU A . n 
A 1 95  ASP 95  94  94  ASP ASP A . n 
A 1 96  ARG 96  95  95  ARG ARG A . n 
A 1 97  ALA 97  96  96  ALA ALA A . n 
A 1 98  GLU 98  97  97  GLU GLU A . n 
A 1 99  VAL 99  98  98  VAL VAL A . n 
A 1 100 TYR 100 99  99  TYR TYR A . n 
A 1 101 VAL 101 100 100 VAL VAL A . n 
A 1 102 ALA 102 101 101 ALA ALA A . n 
A 1 103 LEU 103 102 102 LEU LEU A . n 
A 1 104 LYS 104 103 103 LYS LYS A . n 
A 1 105 GLY 105 104 104 GLY GLY A . n 
A 1 106 LYS 106 105 105 LYS LYS A . n 
A 1 107 GLY 107 106 106 GLY GLY A . n 
A 1 108 GLY 108 107 107 GLY GLY A . n 
A 1 109 MSE 109 108 108 MSE MSE A . n 
A 1 110 LEU 110 109 109 LEU LEU A . n 
A 1 111 LEU 111 110 110 LEU LEU A . n 
A 1 112 GLN 112 111 111 GLN GLN A . n 
A 1 113 THR 113 112 112 THR THR A . n 
A 1 114 PRO 114 113 113 PRO PRO A . n 
A 1 115 GLU 115 114 114 GLU GLU A . n 
A 1 116 GLY 116 115 115 GLY GLY A . n 
A 1 117 ASP 117 116 116 ASP ASP A . n 
A 1 118 ALA 118 117 117 ALA ALA A . n 
A 1 119 LYS 119 118 118 LYS LYS A . n 
A 1 120 TRP 120 119 119 TRP TRP A . n 
A 1 121 ILE 121 120 120 ILE ILE A . n 
A 1 122 SER 122 121 121 SER SER A . n 
A 1 123 MSE 123 122 122 MSE MSE A . n 
A 1 124 GLU 124 123 123 GLU GLU A . n 
A 1 125 PRO 125 124 124 PRO PRO A . n 
A 1 126 GLY 126 125 125 GLY GLY A . n 
A 1 127 THR 127 126 126 THR THR A . n 
A 1 128 VAL 128 127 127 VAL VAL A . n 
A 1 129 VAL 129 128 128 VAL VAL A . n 
A 1 130 TYR 130 129 129 TYR TYR A . n 
A 1 131 VAL 131 130 130 VAL VAL A . n 
A 1 132 PRO 132 131 131 PRO PRO A . n 
A 1 133 PRO 133 132 132 PRO PRO A . n 
A 1 134 TYR 134 133 133 TYR TYR A . n 
A 1 135 TRP 135 134 134 TRP TRP A . n 
A 1 136 ALA 136 135 135 ALA ALA A . n 
A 1 137 HIS 137 136 136 HIS HIS A . n 
A 1 138 ARG 138 137 137 ARG ARG A . n 
A 1 139 THR 139 138 138 THR THR A . n 
A 1 140 VAL 140 139 139 VAL VAL A . n 
A 1 141 ASN 141 140 140 ASN ASN A . n 
A 1 142 ILE 142 141 141 ILE ILE A . n 
A 1 143 GLY 143 142 142 GLY GLY A . n 
A 1 144 ASP 144 143 143 ASP ASP A . n 
A 1 145 GLU 145 144 144 GLU GLU A . n 
A 1 146 PRO 146 145 145 PRO PRO A . n 
A 1 147 PHE 147 146 146 PHE PHE A . n 
A 1 148 ILE 148 147 147 ILE ILE A . n 
A 1 149 PHE 149 148 148 PHE PHE A . n 
A 1 150 LEU 150 149 149 LEU LEU A . n 
A 1 151 ALA 151 150 150 ALA ALA A . n 
A 1 152 ILE 152 151 151 ILE ILE A . n 
A 1 153 TYR 153 152 152 TYR TYR A . n 
A 1 154 PRO 154 153 153 PRO PRO A . n 
A 1 155 ALA 155 154 154 ALA ALA A . n 
A 1 156 ASP 156 155 155 ASP ASP A . n 
A 1 157 ALA 157 156 156 ALA ALA A . n 
A 1 158 GLY 158 157 157 GLY GLY A . n 
A 1 159 HIS 159 158 158 HIS HIS A . n 
A 1 160 ASP 160 159 159 ASP ASP A . n 
A 1 161 TYR 161 160 160 TYR TYR A . n 
A 1 162 GLY 162 161 161 GLY GLY A . n 
A 1 163 THR 163 162 162 THR THR A . n 
A 1 164 ILE 164 163 163 ILE ILE A . n 
A 1 165 ALA 165 164 164 ALA ALA A . n 
A 1 166 GLU 166 165 165 GLU GLU A . n 
A 1 167 LYS 167 166 166 LYS LYS A . n 
A 1 168 GLY 168 167 167 GLY GLY A . n 
A 1 169 PHE 169 168 168 PHE PHE A . n 
A 1 170 SER 170 169 169 SER SER A . n 
A 1 171 LYS 171 170 170 LYS LYS A . n 
A 1 172 ILE 172 171 171 ILE ILE A . n 
A 1 173 VAL 173 172 172 VAL VAL A . n 
A 1 174 ILE 174 173 173 ILE ILE A . n 
A 1 175 GLU 175 174 174 GLU GLU A . n 
A 1 176 GLU 176 175 175 GLU GLU A . n 
A 1 177 ASN 177 176 176 ASN ASN A . n 
A 1 178 GLY 178 177 177 GLY GLY A . n 
A 1 179 GLU 179 178 178 GLU GLU A . n 
A 1 180 VAL 180 179 179 VAL VAL A . n 
A 1 181 LYS 181 180 180 LYS LYS A . n 
A 1 182 VAL 182 181 181 VAL VAL A . n 
A 1 183 VAL 183 182 182 VAL VAL A . n 
A 1 184 ASP 184 183 183 ASP ASP A . n 
A 1 185 ASN 185 184 184 ASN ASN A . n 
A 1 186 PRO 186 185 185 PRO PRO A . n 
A 1 187 ARG 187 186 186 ARG ARG A . n 
A 1 188 TRP 188 187 187 TRP TRP A . n 
A 1 189 LYS 189 188 188 LYS LYS A . n 
A 1 190 LYS 190 189 189 LYS LYS A . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A MSE 1   A MSE 0   ? MET SELENOMETHIONINE 
2 A MSE 2   A MSE 1   ? MET SELENOMETHIONINE 
3 A MSE 31  A MSE 30  ? MET SELENOMETHIONINE 
4 A MSE 109 A MSE 108 ? MET SELENOMETHIONINE 
5 A MSE 123 A MSE 122 ? MET SELENOMETHIONINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4870  ? 
1 MORE         -41   ? 
1 'SSA (A^2)'  16720 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 2_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-10-12 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2014-09-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Database references'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .      ? 1 
SCALEPACK 'data scaling'   .      ? 2 
REFMAC    refinement       5.1.24 ? 3 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_1              48 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_2              48 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             OD2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_3              48 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                123.70 
_pdbx_validate_rmsd_angle.angle_target_value         118.30 
_pdbx_validate_rmsd_angle.angle_deviation            5.40 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.90 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 21  ? ? 84.72   109.75 
2 1 GLU A 47  ? ? -147.45 -41.47 
3 1 TYR A 133 ? ? 83.11   -6.76  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '5-PHOSPHOARABINONIC ACID' PA5 
3 water                      HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 PA5 1   301 1   PA5 PA5 A . 
C 3 HOH 1   302 1   HOH HOH A . 
C 3 HOH 2   303 2   HOH HOH A . 
C 3 HOH 3   304 3   HOH HOH A . 
C 3 HOH 4   305 4   HOH HOH A . 
C 3 HOH 5   306 5   HOH HOH A . 
C 3 HOH 6   307 6   HOH HOH A . 
C 3 HOH 7   308 7   HOH HOH A . 
C 3 HOH 8   309 8   HOH HOH A . 
C 3 HOH 9   310 9   HOH HOH A . 
C 3 HOH 10  311 10  HOH HOH A . 
C 3 HOH 11  312 11  HOH HOH A . 
C 3 HOH 12  313 12  HOH HOH A . 
C 3 HOH 13  314 13  HOH HOH A . 
C 3 HOH 14  315 14  HOH HOH A . 
C 3 HOH 15  316 15  HOH HOH A . 
C 3 HOH 16  317 16  HOH HOH A . 
C 3 HOH 17  318 17  HOH HOH A . 
C 3 HOH 18  319 18  HOH HOH A . 
C 3 HOH 19  320 19  HOH HOH A . 
C 3 HOH 20  321 20  HOH HOH A . 
C 3 HOH 21  322 21  HOH HOH A . 
C 3 HOH 22  323 22  HOH HOH A . 
C 3 HOH 23  324 23  HOH HOH A . 
C 3 HOH 24  325 24  HOH HOH A . 
C 3 HOH 25  326 25  HOH HOH A . 
C 3 HOH 26  327 26  HOH HOH A . 
C 3 HOH 27  328 27  HOH HOH A . 
C 3 HOH 28  329 28  HOH HOH A . 
C 3 HOH 29  330 29  HOH HOH A . 
C 3 HOH 30  331 30  HOH HOH A . 
C 3 HOH 31  332 31  HOH HOH A . 
C 3 HOH 32  333 32  HOH HOH A . 
C 3 HOH 33  334 33  HOH HOH A . 
C 3 HOH 34  335 34  HOH HOH A . 
C 3 HOH 35  336 35  HOH HOH A . 
C 3 HOH 36  337 36  HOH HOH A . 
C 3 HOH 37  338 37  HOH HOH A . 
C 3 HOH 38  339 38  HOH HOH A . 
C 3 HOH 39  340 39  HOH HOH A . 
C 3 HOH 40  341 40  HOH HOH A . 
C 3 HOH 41  342 41  HOH HOH A . 
C 3 HOH 42  343 42  HOH HOH A . 
C 3 HOH 43  344 43  HOH HOH A . 
C 3 HOH 44  345 44  HOH HOH A . 
C 3 HOH 45  346 45  HOH HOH A . 
C 3 HOH 46  347 46  HOH HOH A . 
C 3 HOH 47  348 47  HOH HOH A . 
C 3 HOH 48  349 48  HOH HOH A . 
C 3 HOH 49  350 49  HOH HOH A . 
C 3 HOH 50  351 50  HOH HOH A . 
C 3 HOH 51  352 51  HOH HOH A . 
C 3 HOH 52  353 52  HOH HOH A . 
C 3 HOH 53  354 53  HOH HOH A . 
C 3 HOH 54  355 54  HOH HOH A . 
C 3 HOH 55  356 55  HOH HOH A . 
C 3 HOH 56  357 56  HOH HOH A . 
C 3 HOH 57  358 57  HOH HOH A . 
C 3 HOH 58  359 58  HOH HOH A . 
C 3 HOH 59  360 59  HOH HOH A . 
C 3 HOH 60  361 60  HOH HOH A . 
C 3 HOH 61  362 61  HOH HOH A . 
C 3 HOH 62  363 62  HOH HOH A . 
C 3 HOH 63  364 63  HOH HOH A . 
C 3 HOH 64  365 64  HOH HOH A . 
C 3 HOH 65  366 65  HOH HOH A . 
C 3 HOH 66  367 66  HOH HOH A . 
C 3 HOH 67  368 67  HOH HOH A . 
C 3 HOH 68  369 68  HOH HOH A . 
C 3 HOH 69  370 69  HOH HOH A . 
C 3 HOH 70  371 70  HOH HOH A . 
C 3 HOH 71  372 71  HOH HOH A . 
C 3 HOH 72  373 72  HOH HOH A . 
C 3 HOH 73  374 73  HOH HOH A . 
C 3 HOH 74  375 74  HOH HOH A . 
C 3 HOH 75  376 75  HOH HOH A . 
C 3 HOH 76  377 76  HOH HOH A . 
C 3 HOH 77  378 77  HOH HOH A . 
C 3 HOH 78  379 78  HOH HOH A . 
C 3 HOH 79  380 79  HOH HOH A . 
C 3 HOH 80  381 80  HOH HOH A . 
C 3 HOH 81  382 81  HOH HOH A . 
C 3 HOH 82  383 82  HOH HOH A . 
C 3 HOH 83  384 83  HOH HOH A . 
C 3 HOH 84  385 84  HOH HOH A . 
C 3 HOH 85  386 85  HOH HOH A . 
C 3 HOH 86  387 86  HOH HOH A . 
C 3 HOH 87  388 87  HOH HOH A . 
C 3 HOH 88  389 88  HOH HOH A . 
C 3 HOH 89  390 89  HOH HOH A . 
C 3 HOH 90  391 90  HOH HOH A . 
C 3 HOH 91  392 91  HOH HOH A . 
C 3 HOH 92  393 92  HOH HOH A . 
C 3 HOH 93  394 93  HOH HOH A . 
C 3 HOH 94  395 94  HOH HOH A . 
C 3 HOH 95  396 95  HOH HOH A . 
C 3 HOH 96  397 96  HOH HOH A . 
C 3 HOH 97  398 97  HOH HOH A . 
C 3 HOH 98  399 98  HOH HOH A . 
C 3 HOH 99  400 99  HOH HOH A . 
C 3 HOH 100 401 100 HOH HOH A . 
C 3 HOH 101 402 101 HOH HOH A . 
C 3 HOH 102 403 102 HOH HOH A . 
C 3 HOH 103 404 103 HOH HOH A . 
C 3 HOH 104 405 104 HOH HOH A . 
C 3 HOH 105 406 105 HOH HOH A . 
C 3 HOH 106 407 106 HOH HOH A . 
C 3 HOH 107 408 107 HOH HOH A . 
C 3 HOH 108 409 108 HOH HOH A . 
C 3 HOH 109 410 109 HOH HOH A . 
C 3 HOH 110 411 110 HOH HOH A . 
C 3 HOH 111 412 111 HOH HOH A . 
C 3 HOH 112 413 112 HOH HOH A . 
C 3 HOH 113 414 113 HOH HOH A . 
C 3 HOH 114 415 114 HOH HOH A . 
C 3 HOH 115 416 115 HOH HOH A . 
C 3 HOH 116 417 116 HOH HOH A . 
C 3 HOH 117 418 117 HOH HOH A . 
C 3 HOH 118 419 118 HOH HOH A . 
C 3 HOH 119 420 119 HOH HOH A . 
C 3 HOH 120 421 120 HOH HOH A . 
C 3 HOH 121 422 121 HOH HOH A . 
C 3 HOH 122 423 122 HOH HOH A . 
C 3 HOH 123 424 123 HOH HOH A . 
C 3 HOH 124 425 124 HOH HOH A . 
C 3 HOH 125 426 125 HOH HOH A . 
C 3 HOH 126 427 126 HOH HOH A . 
C 3 HOH 127 428 127 HOH HOH A . 
C 3 HOH 128 429 128 HOH HOH A . 
C 3 HOH 129 430 129 HOH HOH A . 
C 3 HOH 130 431 130 HOH HOH A . 
C 3 HOH 131 432 131 HOH HOH A . 
C 3 HOH 132 433 132 HOH HOH A . 
C 3 HOH 133 434 133 HOH HOH A . 
C 3 HOH 134 435 134 HOH HOH A . 
C 3 HOH 135 436 135 HOH HOH A . 
C 3 HOH 136 437 136 HOH HOH A . 
C 3 HOH 137 438 137 HOH HOH A . 
C 3 HOH 138 439 138 HOH HOH A . 
C 3 HOH 139 440 139 HOH HOH A . 
C 3 HOH 140 441 140 HOH HOH A . 
C 3 HOH 141 442 141 HOH HOH A . 
C 3 HOH 142 443 142 HOH HOH A . 
C 3 HOH 143 444 143 HOH HOH A . 
C 3 HOH 144 445 144 HOH HOH A . 
C 3 HOH 145 446 145 HOH HOH A . 
C 3 HOH 146 447 146 HOH HOH A . 
C 3 HOH 147 448 147 HOH HOH A . 
C 3 HOH 148 449 148 HOH HOH A . 
C 3 HOH 149 450 149 HOH HOH A . 
C 3 HOH 150 451 150 HOH HOH A . 
C 3 HOH 151 452 151 HOH HOH A . 
C 3 HOH 152 453 152 HOH HOH A . 
C 3 HOH 153 454 153 HOH HOH A . 
C 3 HOH 154 455 154 HOH HOH A . 
C 3 HOH 155 456 155 HOH HOH A . 
C 3 HOH 156 457 156 HOH HOH A . 
C 3 HOH 157 458 157 HOH HOH A . 
C 3 HOH 158 459 158 HOH HOH A . 
C 3 HOH 159 460 159 HOH HOH A . 
C 3 HOH 160 461 160 HOH HOH A . 
C 3 HOH 161 462 161 HOH HOH A . 
C 3 HOH 162 463 162 HOH HOH A . 
C 3 HOH 163 464 163 HOH HOH A . 
C 3 HOH 164 465 164 HOH HOH A . 
C 3 HOH 165 466 165 HOH HOH A . 
C 3 HOH 166 467 166 HOH HOH A . 
C 3 HOH 167 468 167 HOH HOH A . 
C 3 HOH 168 469 168 HOH HOH A . 
C 3 HOH 169 470 169 HOH HOH A . 
C 3 HOH 170 471 170 HOH HOH A . 
C 3 HOH 171 472 171 HOH HOH A . 
C 3 HOH 172 473 172 HOH HOH A . 
C 3 HOH 173 474 173 HOH HOH A . 
C 3 HOH 174 475 174 HOH HOH A . 
C 3 HOH 175 476 175 HOH HOH A . 
C 3 HOH 176 477 176 HOH HOH A . 
C 3 HOH 177 478 177 HOH HOH A . 
C 3 HOH 178 479 178 HOH HOH A . 
C 3 HOH 179 480 179 HOH HOH A . 
C 3 HOH 180 481 180 HOH HOH A . 
C 3 HOH 181 482 181 HOH HOH A . 
C 3 HOH 182 483 182 HOH HOH A . 
C 3 HOH 183 484 183 HOH HOH A . 
C 3 HOH 184 485 184 HOH HOH A . 
C 3 HOH 185 486 185 HOH HOH A . 
C 3 HOH 186 487 186 HOH HOH A . 
C 3 HOH 187 488 187 HOH HOH A . 
C 3 HOH 188 489 188 HOH HOH A . 
C 3 HOH 189 490 189 HOH HOH A . 
C 3 HOH 190 491 190 HOH HOH A . 
C 3 HOH 191 492 191 HOH HOH A . 
C 3 HOH 192 493 192 HOH HOH A . 
C 3 HOH 193 494 193 HOH HOH A . 
C 3 HOH 194 495 194 HOH HOH A . 
C 3 HOH 195 496 195 HOH HOH A . 
C 3 HOH 196 497 196 HOH HOH A . 
C 3 HOH 197 498 197 HOH HOH A . 
C 3 HOH 198 499 198 HOH HOH A . 
C 3 HOH 199 500 199 HOH HOH A . 
C 3 HOH 200 501 200 HOH HOH A . 
C 3 HOH 201 502 201 HOH HOH A . 
C 3 HOH 202 503 202 HOH HOH A . 
C 3 HOH 203 504 203 HOH HOH A . 
C 3 HOH 204 505 204 HOH HOH A . 
C 3 HOH 205 506 205 HOH HOH A . 
C 3 HOH 206 507 206 HOH HOH A . 
C 3 HOH 207 508 207 HOH HOH A . 
C 3 HOH 208 509 208 HOH HOH A . 
C 3 HOH 209 510 209 HOH HOH A . 
C 3 HOH 210 511 210 HOH HOH A . 
C 3 HOH 211 512 211 HOH HOH A . 
C 3 HOH 212 513 212 HOH HOH A . 
C 3 HOH 213 514 213 HOH HOH A . 
C 3 HOH 214 515 214 HOH HOH A . 
C 3 HOH 215 516 215 HOH HOH A . 
C 3 HOH 216 517 216 HOH HOH A . 
C 3 HOH 217 518 217 HOH HOH A . 
C 3 HOH 218 519 218 HOH HOH A . 
C 3 HOH 219 520 219 HOH HOH A . 
C 3 HOH 220 521 220 HOH HOH A . 
C 3 HOH 221 522 221 HOH HOH A . 
C 3 HOH 222 523 222 HOH HOH A . 
C 3 HOH 223 524 223 HOH HOH A . 
C 3 HOH 224 525 224 HOH HOH A . 
C 3 HOH 225 526 225 HOH HOH A . 
C 3 HOH 226 527 226 HOH HOH A . 
C 3 HOH 227 528 227 HOH HOH A . 
C 3 HOH 228 529 228 HOH HOH A . 
C 3 HOH 229 530 229 HOH HOH A . 
C 3 HOH 230 531 230 HOH HOH A . 
C 3 HOH 231 532 231 HOH HOH A . 
C 3 HOH 232 533 232 HOH HOH A . 
C 3 HOH 233 534 233 HOH HOH A . 
C 3 HOH 234 535 234 HOH HOH A . 
C 3 HOH 235 536 235 HOH HOH A . 
C 3 HOH 236 537 236 HOH HOH A . 
C 3 HOH 237 538 237 HOH HOH A . 
C 3 HOH 238 539 238 HOH HOH A . 
C 3 HOH 239 540 239 HOH HOH A . 
C 3 HOH 240 541 240 HOH HOH A . 
C 3 HOH 241 542 241 HOH HOH A . 
C 3 HOH 242 543 242 HOH HOH A . 
C 3 HOH 243 544 243 HOH HOH A . 
C 3 HOH 244 545 244 HOH HOH A . 
C 3 HOH 245 546 245 HOH HOH A . 
C 3 HOH 246 547 246 HOH HOH A . 
#