data_1X8E
# 
_entry.id   1X8E 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1X8E         
RCSB  RCSB030068   
WWPDB D_1000030068 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1PLZ . unspecified 
PDB 1X82 . unspecified 
PDB 1X7N . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1X8E 
_pdbx_database_status.recvd_initial_deposition_date   2004-08-18 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Berrisford, J.M.'  1  
'Akerboom, J.'      2  
'Brouns, S.'        3  
'Sedelnikova, S.E.' 4  
'Turnbull, A.P.'    5  
'van der Oost, J.'  6  
'Salmon, L.'        7  
'Hardre, R.'        8  
'Murray, I.A.'      9  
'Blackburn, G.M.'   10 
'Rice, D.W.'        11 
'Baker, P.J.'       12 
# 
_citation.id                        primary 
_citation.title                     
;The structures of inhibitor complexes of Pyrococcus furiosus phosphoglucose isomerase provide insights into substrate binding and catalysis.
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            343 
_citation.page_first                649 
_citation.page_last                 657 
_citation.year                      2004 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15465052 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2004.08.061 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Berrisford, J.M.'  1  
primary 'Akerboom, J.'      2  
primary 'Brouns, S.'        3  
primary 'Sedelnikova, S.E.' 4  
primary 'Turnbull, A.P.'    5  
primary 'van der Oost, J.'  6  
primary 'Salmon, L.'        7  
primary 'Hardre, R.'        8  
primary 'Murray, I.A.'      9  
primary 'Blackburn, G.M.'   10 
primary 'Rice, D.W.'        11 
primary 'Baker, P.J.'       12 
# 
_cell.entry_id           1X8E 
_cell.length_a           68.236 
_cell.length_b           73.865 
_cell.length_c           77.666 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1X8E 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Glucose-6-phosphate isomerase' 
_entity.formula_weight             21636.633 
_entity.pdbx_number_of_molecules   2 
_entity.pdbx_ec                    5.3.1.9 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GPI, Phosphoglucose isomerase, PGI, Phosphohexose isomerase, PHI' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MMYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVG
KEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHD
YGTIAEKGFSKIVIEENGEVKVVDNPRWKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MMYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVG
KEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHD
YGTIAEKGFSKIVIEENGEVKVVDNPRWKK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   MET n 
1 3   TYR n 
1 4   LYS n 
1 5   GLU n 
1 6   PRO n 
1 7   PHE n 
1 8   GLY n 
1 9   VAL n 
1 10  LYS n 
1 11  VAL n 
1 12  ASP n 
1 13  PHE n 
1 14  GLU n 
1 15  THR n 
1 16  GLY n 
1 17  ILE n 
1 18  ILE n 
1 19  GLU n 
1 20  GLY n 
1 21  ALA n 
1 22  LYS n 
1 23  LYS n 
1 24  SER n 
1 25  VAL n 
1 26  ARG n 
1 27  ARG n 
1 28  LEU n 
1 29  SER n 
1 30  ASP n 
1 31  MET n 
1 32  GLU n 
1 33  GLY n 
1 34  TYR n 
1 35  PHE n 
1 36  VAL n 
1 37  ASP n 
1 38  GLU n 
1 39  ARG n 
1 40  ALA n 
1 41  TRP n 
1 42  LYS n 
1 43  GLU n 
1 44  LEU n 
1 45  VAL n 
1 46  GLU n 
1 47  LYS n 
1 48  GLU n 
1 49  ASP n 
1 50  PRO n 
1 51  VAL n 
1 52  VAL n 
1 53  TYR n 
1 54  GLU n 
1 55  VAL n 
1 56  TYR n 
1 57  ALA n 
1 58  VAL n 
1 59  GLU n 
1 60  GLN n 
1 61  GLU n 
1 62  GLU n 
1 63  LYS n 
1 64  GLU n 
1 65  GLY n 
1 66  ASP n 
1 67  LEU n 
1 68  ASN n 
1 69  PHE n 
1 70  ALA n 
1 71  THR n 
1 72  THR n 
1 73  VAL n 
1 74  LEU n 
1 75  TYR n 
1 76  PRO n 
1 77  GLY n 
1 78  LYS n 
1 79  VAL n 
1 80  GLY n 
1 81  LYS n 
1 82  GLU n 
1 83  PHE n 
1 84  PHE n 
1 85  PHE n 
1 86  THR n 
1 87  LYS n 
1 88  GLY n 
1 89  HIS n 
1 90  PHE n 
1 91  HIS n 
1 92  ALA n 
1 93  LYS n 
1 94  LEU n 
1 95  ASP n 
1 96  ARG n 
1 97  ALA n 
1 98  GLU n 
1 99  VAL n 
1 100 TYR n 
1 101 VAL n 
1 102 ALA n 
1 103 LEU n 
1 104 LYS n 
1 105 GLY n 
1 106 LYS n 
1 107 GLY n 
1 108 GLY n 
1 109 MET n 
1 110 LEU n 
1 111 LEU n 
1 112 GLN n 
1 113 THR n 
1 114 PRO n 
1 115 GLU n 
1 116 GLY n 
1 117 ASP n 
1 118 ALA n 
1 119 LYS n 
1 120 TRP n 
1 121 ILE n 
1 122 SER n 
1 123 MET n 
1 124 GLU n 
1 125 PRO n 
1 126 GLY n 
1 127 THR n 
1 128 VAL n 
1 129 VAL n 
1 130 TYR n 
1 131 VAL n 
1 132 PRO n 
1 133 PRO n 
1 134 TYR n 
1 135 TRP n 
1 136 ALA n 
1 137 HIS n 
1 138 ARG n 
1 139 THR n 
1 140 VAL n 
1 141 ASN n 
1 142 ILE n 
1 143 GLY n 
1 144 ASP n 
1 145 GLU n 
1 146 PRO n 
1 147 PHE n 
1 148 ILE n 
1 149 PHE n 
1 150 LEU n 
1 151 ALA n 
1 152 ILE n 
1 153 TYR n 
1 154 PRO n 
1 155 ALA n 
1 156 ASP n 
1 157 ALA n 
1 158 GLY n 
1 159 HIS n 
1 160 ASP n 
1 161 TYR n 
1 162 GLY n 
1 163 THR n 
1 164 ILE n 
1 165 ALA n 
1 166 GLU n 
1 167 LYS n 
1 168 GLY n 
1 169 PHE n 
1 170 SER n 
1 171 LYS n 
1 172 ILE n 
1 173 VAL n 
1 174 ILE n 
1 175 GLU n 
1 176 GLU n 
1 177 ASN n 
1 178 GLY n 
1 179 GLU n 
1 180 VAL n 
1 181 LYS n 
1 182 VAL n 
1 183 VAL n 
1 184 ASP n 
1 185 ASN n 
1 186 PRO n 
1 187 ARG n 
1 188 TRP n 
1 189 LYS n 
1 190 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Pyrococcus 
_entity_src_gen.pdbx_gene_src_gene                 pgiA 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pyrococcus furiosus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2261 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET24-d 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    G6PI_PYRFU 
_struct_ref.pdbx_db_accession          P83194 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGK
EFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHDY
GTIAEKGFSKIVIEENGEVKVVDNPRWKK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1X8E A 2 ? 190 ? P83194 1 ? 189 ? 1 189 
2 1 1X8E B 2 ? 190 ? P83194 1 ? 189 ? 1 189 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1X8E MET A 1 ? UNP P83194 ? ? 'INITIATING METHIONINE' 0 1 
2 1X8E MET B 1 ? UNP P83194 ? ? 'INITIATING METHIONINE' 0 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1X8E 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.1 
_exptl_crystal.density_percent_sol   41.7 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    '1.6M tri-sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 290K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2003-08-27 
_diffrn_detector.details                'YALE MIRRORS' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54 
# 
_reflns.entry_id                     1X8E 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.80 
_reflns.d_resolution_low             53.45 
_reflns.number_all                   10198 
_reflns.number_obs                   10096 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            0.141 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        4.9 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.95 
_reflns_shell.percent_possible_all   4.1 
_reflns_shell.Rmerge_I_obs           0.439 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.7 
_reflns_shell.pdbx_redundancy        4.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1359 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1X8E 
_refine.ls_number_reflns_obs                     9481 
_refine.ls_number_reflns_all                     9481 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             53.45 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    98.42 
_refine.ls_R_factor_obs                          0.2177 
_refine.ls_R_factor_all                          0.2177 
_refine.ls_R_factor_R_work                       0.21484 
_refine.ls_R_factor_R_free                       0.27586 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  481 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.913 
_refine.correlation_coeff_Fo_to_Fc_free          0.850 
_refine.B_iso_mean                               24.614 
_refine.aniso_B[1][1]                            3.74 
_refine.aniso_B[2][2]                            -4.43 
_refine.aniso_B[3][3]                            0.68 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1X82 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.447 
_refine.overall_SU_ML                            0.373 
_refine.overall_SU_B                             19.835 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3038 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               3038 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        53.45 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.020 0.022 ? 3122 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.002 0.020 ? 2778 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.763 1.950 ? 4222 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        0.906 3.000 ? 6492 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   8.785 5.000 ? 376  'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.105 0.200 ? 436  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.005 0.020 ? 3466 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.003 0.020 ? 650  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.201 0.200 ? 567  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.231 0.200 ? 3105 'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.092 0.200 ? 2004 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.185 0.200 ? 35   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.250 0.200 ? 9    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.284 0.200 ? 54   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.039 0.200 ? 1    'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.795 1.500 ? 1872 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.479 2.000 ? 3020 'X-RAY DIFFRACTION' ? 
r_scbond_it              1.660 3.000 ? 1250 'X-RAY DIFFRACTION' ? 
r_scangle_it             2.901 4.500 ? 1202 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.800 
_refine_ls_shell.d_res_low                        2.873 
_refine_ls_shell.number_reflns_R_work             687 
_refine_ls_shell.R_factor_R_work                  0.321 
_refine_ls_shell.percent_reflns_obs               99.0 
_refine_ls_shell.R_factor_R_free                  0.324 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             37 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1X8E 
_struct.title                     'Crystal structure of Pyrococcus furiosus phosphoglucose isomerase free enzyme' 
_struct.pdbx_descriptor           'Glucose-6-phosphate isomerase (E.C.5.3.1.9)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1X8E 
_struct_keywords.pdbx_keywords   ISOMERASE 
_struct_keywords.text            
'CUPIN SUPERFAMILY, PYROCOCCUS FURIOSUS, HYPERTHERMOPHILE, PHOSPHOGLUCOSE ISOMERASE, EXTREMEOPHILE, ISOMERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'Subunits A and B generate the biological dimer' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 29  ? MET A 31  ? SER A 28  MET A 30  5 ? 3  
HELX_P HELX_P2 2 ASP A 37  ? GLU A 48  ? ASP A 36  GLU A 47  1 ? 12 
HELX_P HELX_P3 3 SER B 29  ? GLU B 32  ? SER B 28  GLU B 31  5 ? 4  
HELX_P HELX_P4 4 ASP B 37  ? GLU B 48  ? ASP B 36  GLU B 47  1 ? 12 
HELX_P HELX_P5 5 TYR B 161 ? LYS B 167 ? TYR B 160 LYS B 166 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 7 ? 
C ? 2 ? 
D ? 3 ? 
E ? 2 ? 
F ? 2 ? 
G ? 3 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 7   ? LYS A 10  ? PHE A 6   LYS A 9   
A 2 THR B 127 ? VAL B 131 ? THR B 126 VAL B 130 
A 3 GLU B 98  ? LYS B 104 ? GLU B 97  LYS B 103 
A 4 PHE B 147 ? PRO B 154 ? PHE B 146 PRO B 153 
A 5 LEU B 67  ? LEU B 74  ? LEU B 66  LEU B 73  
A 6 VAL B 51  ? VAL B 58  ? VAL B 50  VAL B 57  
A 7 LYS B 23  ? ARG B 27  ? LYS B 22  ARG B 26  
B 1 LYS A 22  ? ARG A 27  ? LYS A 21  ARG A 26  
B 2 VAL A 51  ? VAL A 58  ? VAL A 50  VAL A 57  
B 3 LEU A 67  ? LEU A 74  ? LEU A 66  LEU A 73  
B 4 PHE A 147 ? PRO A 154 ? PHE A 146 PRO A 153 
B 5 GLU A 98  ? LYS A 104 ? GLU A 97  LYS A 103 
B 6 THR A 127 ? VAL A 131 ? THR A 126 VAL A 130 
B 7 PHE B 7   ? LYS B 10  ? PHE B 6   LYS B 9   
C 1 LYS A 78  ? VAL A 79  ? LYS A 77  VAL A 78  
C 2 GLU A 82  ? PHE A 83  ? GLU A 81  PHE A 82  
D 1 ALA A 118 ? MET A 123 ? ALA A 117 MET A 122 
D 2 GLY A 107 ? GLN A 112 ? GLY A 106 GLN A 111 
D 3 ALA A 136 ? ASN A 141 ? ALA A 135 ASN A 140 
E 1 LYS A 171 ? GLU A 176 ? LYS A 170 GLU A 175 
E 2 GLU A 179 ? ASP A 184 ? GLU A 178 ASP A 183 
F 1 LYS B 78  ? VAL B 79  ? LYS B 77  VAL B 78  
F 2 GLU B 82  ? PHE B 83  ? GLU B 81  PHE B 82  
G 1 ALA B 118 ? MET B 123 ? ALA B 117 MET B 122 
G 2 GLY B 107 ? GLN B 112 ? GLY B 106 GLN B 111 
G 3 ALA B 136 ? ASN B 141 ? ALA B 135 ASN B 140 
H 1 LYS B 171 ? GLU B 176 ? LYS B 170 GLU B 175 
H 2 GLU B 179 ? ASP B 184 ? GLU B 178 ASP B 183 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 9   ? N VAL A 8   O VAL B 128 ? O VAL B 127 
A 2 3 O VAL B 129 ? O VAL B 128 N TYR B 100 ? N TYR B 99  
A 3 4 N VAL B 101 ? N VAL B 100 O LEU B 150 ? O LEU B 149 
A 4 5 O TYR B 153 ? O TYR B 152 N ASN B 68  ? N ASN B 67  
A 5 6 O PHE B 69  ? O PHE B 68  N VAL B 58  ? N VAL B 57  
A 6 7 O TYR B 53  ? O TYR B 52  N ARG B 26  ? N ARG B 25  
B 1 2 N SER A 24  ? N SER A 23  O VAL A 55  ? O VAL A 54  
B 2 3 N VAL A 58  ? N VAL A 57  O PHE A 69  ? O PHE A 68  
B 3 4 N LEU A 74  ? N LEU A 73  O PHE A 147 ? O PHE A 146 
B 4 5 O ILE A 148 ? O ILE A 147 N LYS A 104 ? N LYS A 103 
B 5 6 N ALA A 102 ? N ALA A 101 O THR A 127 ? O THR A 126 
B 6 7 N VAL A 128 ? N VAL A 127 O VAL B 9   ? O VAL B 8   
C 1 2 N VAL A 79  ? N VAL A 78  O GLU A 82  ? O GLU A 81  
D 1 2 O LYS A 119 ? O LYS A 118 N LEU A 111 ? N LEU A 110 
D 2 3 N LEU A 110 ? N LEU A 109 O ARG A 138 ? O ARG A 137 
E 1 2 N ILE A 172 ? N ILE A 171 O VAL A 183 ? O VAL A 182 
F 1 2 N VAL B 79  ? N VAL B 78  O GLU B 82  ? O GLU B 81  
G 1 2 O MET B 123 ? O MET B 122 N GLY B 107 ? N GLY B 106 
G 2 3 N GLY B 108 ? N GLY B 107 O VAL B 140 ? O VAL B 139 
H 1 2 N ILE B 174 ? N ILE B 173 O LYS B 181 ? O LYS B 180 
# 
_database_PDB_matrix.entry_id          1X8E 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1X8E 
_atom_sites.fract_transf_matrix[1][1]   0.014655 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013538 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012876 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . MET A 1 1   ? 68.952 6.333   -5.075  1.00 34.89 ? 0   MET A N   1 
ATOM 2    C CA  . MET A 1 1   ? 69.309 7.733   -4.831  1.00 36.01 ? 0   MET A CA  1 
ATOM 3    C C   . MET A 1 1   ? 69.401 7.944   -3.347  1.00 36.23 ? 0   MET A C   1 
ATOM 4    O O   . MET A 1 1   ? 68.999 7.076   -2.597  1.00 36.07 ? 0   MET A O   1 
ATOM 5    C CB  . MET A 1 1   ? 68.273 8.681   -5.442  1.00 36.05 ? 0   MET A CB  1 
ATOM 6    C CG  . MET A 1 1   ? 66.887 8.061   -5.584  1.00 36.89 ? 0   MET A CG  1 
ATOM 7    S SD  . MET A 1 1   ? 65.590 9.232   -6.072  1.00 37.17 ? 0   MET A SD  1 
ATOM 8    C CE  . MET A 1 1   ? 65.647 10.468  -4.710  1.00 38.06 ? 0   MET A CE  1 
ATOM 9    N N   . MET A 1 2   ? 69.954 9.086   -2.926  1.00 37.01 ? 1   MET A N   1 
ATOM 10   C CA  . MET A 1 2   ? 70.054 9.399   -1.506  1.00 37.48 ? 1   MET A CA  1 
ATOM 11   C C   . MET A 1 2   ? 68.855 10.245  -1.161  1.00 37.14 ? 1   MET A C   1 
ATOM 12   O O   . MET A 1 2   ? 68.749 11.397  -1.613  1.00 38.98 ? 1   MET A O   1 
ATOM 13   C CB  . MET A 1 2   ? 71.316 10.177  -1.138  1.00 38.33 ? 1   MET A CB  1 
ATOM 14   C CG  . MET A 1 2   ? 71.593 10.222  0.441   1.00 40.05 ? 1   MET A CG  1 
ATOM 15   S SD  . MET A 1 2   ? 72.485 11.782  1.049   1.00 42.25 ? 1   MET A SD  1 
ATOM 16   C CE  . MET A 1 2   ? 71.373 12.310  2.435   1.00 43.55 ? 1   MET A CE  1 
ATOM 17   N N   . TYR A 1 3   ? 67.996 9.689   -0.312  1.00 34.98 ? 2   TYR A N   1 
ATOM 18   C CA  . TYR A 1 3   ? 66.791 10.331  0.145   1.00 32.44 ? 2   TYR A CA  1 
ATOM 19   C C   . TYR A 1 3   ? 67.067 11.175  1.354   1.00 31.02 ? 2   TYR A C   1 
ATOM 20   O O   . TYR A 1 3   ? 67.948 10.886  2.150   1.00 31.16 ? 2   TYR A O   1 
ATOM 21   C CB  . TYR A 1 3   ? 65.845 9.243   0.540   1.00 32.15 ? 2   TYR A CB  1 
ATOM 22   C CG  . TYR A 1 3   ? 65.542 8.308   -0.589  1.00 32.21 ? 2   TYR A CG  1 
ATOM 23   C CD1 . TYR A 1 3   ? 66.153 7.046   -0.668  1.00 31.36 ? 2   TYR A CD1 1 
ATOM 24   C CD2 . TYR A 1 3   ? 64.623 8.677   -1.599  1.00 31.85 ? 2   TYR A CD2 1 
ATOM 25   C CE1 . TYR A 1 3   ? 65.835 6.170   -1.722  1.00 31.49 ? 2   TYR A CE1 1 
ATOM 26   C CE2 . TYR A 1 3   ? 64.327 7.817   -2.673  1.00 30.86 ? 2   TYR A CE2 1 
ATOM 27   C CZ  . TYR A 1 3   ? 64.922 6.578   -2.719  1.00 30.55 ? 2   TYR A CZ  1 
ATOM 28   O OH  . TYR A 1 3   ? 64.594 5.769   -3.745  1.00 31.34 ? 2   TYR A OH  1 
ATOM 29   N N   . LYS A 1 4   ? 66.297 12.227  1.513   1.00 29.83 ? 3   LYS A N   1 
ATOM 30   C CA  . LYS A 1 4   ? 66.424 13.062  2.704   1.00 28.97 ? 3   LYS A CA  1 
ATOM 31   C C   . LYS A 1 4   ? 65.909 12.336  3.932   1.00 28.30 ? 3   LYS A C   1 
ATOM 32   O O   . LYS A 1 4   ? 65.036 11.505  3.874   1.00 27.39 ? 3   LYS A O   1 
ATOM 33   C CB  . LYS A 1 4   ? 65.668 14.358  2.519   1.00 28.73 ? 3   LYS A CB  1 
ATOM 34   C CG  . LYS A 1 4   ? 66.269 15.550  3.161   1.00 28.17 ? 3   LYS A CG  1 
ATOM 35   C CD  . LYS A 1 4   ? 66.305 16.725  2.176   1.00 28.44 ? 3   LYS A CD  1 
ATOM 36   C CE  . LYS A 1 4   ? 65.648 17.982  2.687   1.00 29.94 ? 3   LYS A CE  1 
ATOM 37   N NZ  . LYS A 1 4   ? 64.940 18.767  1.615   1.00 30.80 ? 3   LYS A NZ  1 
ATOM 38   N N   . GLU A 1 5   ? 66.479 12.668  5.061   1.00 28.77 ? 4   GLU A N   1 
ATOM 39   C CA  . GLU A 1 5   ? 66.115 12.047  6.320   1.00 28.69 ? 4   GLU A CA  1 
ATOM 40   C C   . GLU A 1 5   ? 64.838 12.763  6.860   1.00 27.01 ? 4   GLU A C   1 
ATOM 41   O O   . GLU A 1 5   ? 64.809 13.994  7.005   1.00 27.14 ? 4   GLU A O   1 
ATOM 42   C CB  . GLU A 1 5   ? 67.361 12.126  7.262   1.00 29.52 ? 4   GLU A CB  1 
ATOM 43   C CG  . GLU A 1 5   ? 67.206 11.483  8.650   1.00 32.93 ? 4   GLU A CG  1 
ATOM 44   C CD  . GLU A 1 5   ? 67.245 9.952   8.601   1.00 37.21 ? 4   GLU A CD  1 
ATOM 45   O OE1 . GLU A 1 5   ? 67.085 9.377   7.472   1.00 36.75 ? 4   GLU A OE1 1 
ATOM 46   O OE2 . GLU A 1 5   ? 67.421 9.332   9.703   1.00 38.34 ? 4   GLU A OE2 1 
ATOM 47   N N   . PRO A 1 6   ? 63.759 12.027  7.075   1.00 25.39 ? 5   PRO A N   1 
ATOM 48   C CA  . PRO A 1 6   ? 62.584 12.599  7.717   1.00 24.79 ? 5   PRO A CA  1 
ATOM 49   C C   . PRO A 1 6   ? 62.842 12.778  9.203   1.00 24.11 ? 5   PRO A C   1 
ATOM 50   O O   . PRO A 1 6   ? 63.682 12.057  9.736   1.00 24.30 ? 5   PRO A O   1 
ATOM 51   C CB  . PRO A 1 6   ? 61.484 11.570  7.472   1.00 23.91 ? 5   PRO A CB  1 
ATOM 52   C CG  . PRO A 1 6   ? 62.016 10.686  6.476   1.00 24.69 ? 5   PRO A CG  1 
ATOM 53   C CD  . PRO A 1 6   ? 63.506 10.640  6.689   1.00 26.16 ? 5   PRO A CD  1 
ATOM 54   N N   . PHE A 1 7   ? 62.146 13.743  9.819   1.00 23.16 ? 6   PHE A N   1 
ATOM 55   C CA  . PHE A 1 7   ? 62.198 14.008  11.244  1.00 22.32 ? 6   PHE A CA  1 
ATOM 56   C C   . PHE A 1 7   ? 60.883 14.472  11.810  1.00 22.12 ? 6   PHE A C   1 
ATOM 57   O O   . PHE A 1 7   ? 59.965 14.847  11.073  1.00 21.89 ? 6   PHE A O   1 
ATOM 58   C CB  . PHE A 1 7   ? 63.250 15.054  11.554  1.00 22.19 ? 6   PHE A CB  1 
ATOM 59   C CG  . PHE A 1 7   ? 63.107 16.341  10.773  1.00 21.19 ? 6   PHE A CG  1 
ATOM 60   C CD1 . PHE A 1 7   ? 63.527 16.437  9.457   1.00 20.02 ? 6   PHE A CD1 1 
ATOM 61   C CD2 . PHE A 1 7   ? 62.655 17.477  11.388  1.00 21.40 ? 6   PHE A CD2 1 
ATOM 62   C CE1 . PHE A 1 7   ? 63.423 17.629  8.769   1.00 18.63 ? 6   PHE A CE1 1 
ATOM 63   C CE2 . PHE A 1 7   ? 62.569 18.642  10.705  1.00 20.61 ? 6   PHE A CE2 1 
ATOM 64   C CZ  . PHE A 1 7   ? 62.938 18.703  9.379   1.00 18.87 ? 6   PHE A CZ  1 
ATOM 65   N N   . GLY A 1 8   ? 60.815 14.454  13.140  1.00 22.12 ? 7   GLY A N   1 
ATOM 66   C CA  . GLY A 1 8   ? 59.717 15.064  13.888  1.00 21.75 ? 7   GLY A CA  1 
ATOM 67   C C   . GLY A 1 8   ? 60.314 16.018  14.905  1.00 21.47 ? 7   GLY A C   1 
ATOM 68   O O   . GLY A 1 8   ? 61.326 15.745  15.510  1.00 20.51 ? 7   GLY A O   1 
ATOM 69   N N   . VAL A 1 9   ? 59.683 17.167  15.073  1.00 22.22 ? 8   VAL A N   1 
ATOM 70   C CA  . VAL A 1 9   ? 60.085 18.130  16.091  1.00 22.23 ? 8   VAL A CA  1 
ATOM 71   C C   . VAL A 1 9   ? 58.900 18.546  16.870  1.00 22.41 ? 8   VAL A C   1 
ATOM 72   O O   . VAL A 1 9   ? 57.808 18.596  16.356  1.00 22.48 ? 8   VAL A O   1 
ATOM 73   C CB  . VAL A 1 9   ? 60.721 19.421  15.531  1.00 21.86 ? 8   VAL A CB  1 
ATOM 74   C CG1 . VAL A 1 9   ? 62.173 19.176  15.192  1.00 24.01 ? 8   VAL A CG1 1 
ATOM 75   C CG2 . VAL A 1 9   ? 60.003 19.892  14.366  1.00 21.69 ? 8   VAL A CG2 1 
ATOM 76   N N   . LYS A 1 10  ? 59.152 18.912  18.118  1.00 23.07 ? 9   LYS A N   1 
ATOM 77   C CA  . LYS A 1 10  ? 58.101 19.248  19.024  1.00 23.42 ? 9   LYS A CA  1 
ATOM 78   C C   . LYS A 1 10  ? 57.934 20.716  18.914  1.00 23.30 ? 9   LYS A C   1 
ATOM 79   O O   . LYS A 1 10  ? 58.921 21.434  18.699  1.00 22.49 ? 9   LYS A O   1 
ATOM 80   C CB  . LYS A 1 10  ? 58.475 18.854  20.447  1.00 24.21 ? 9   LYS A CB  1 
ATOM 81   C CG  . LYS A 1 10  ? 59.296 17.535  20.545  1.00 27.04 ? 9   LYS A CG  1 
ATOM 82   C CD  . LYS A 1 10  ? 59.239 16.893  21.993  1.00 30.42 ? 9   LYS A CD  1 
ATOM 83   C CE  . LYS A 1 10  ? 59.384 17.942  23.139  1.00 31.68 ? 9   LYS A CE  1 
ATOM 84   N NZ  . LYS A 1 10  ? 59.978 17.298  24.396  1.00 33.28 ? 9   LYS A NZ  1 
ATOM 85   N N   . VAL A 1 11  ? 56.682 21.160  19.075  1.00 23.58 ? 10  VAL A N   1 
ATOM 86   C CA  . VAL A 1 11  ? 56.356 22.566  19.126  1.00 23.89 ? 10  VAL A CA  1 
ATOM 87   C C   . VAL A 1 11  ? 55.465 22.765  20.354  1.00 24.53 ? 10  VAL A C   1 
ATOM 88   O O   . VAL A 1 11  ? 54.475 22.049  20.528  1.00 24.47 ? 10  VAL A O   1 
ATOM 89   C CB  . VAL A 1 11  ? 55.597 23.009  17.865  1.00 24.04 ? 10  VAL A CB  1 
ATOM 90   C CG1 . VAL A 1 11  ? 55.199 24.475  17.963  1.00 24.16 ? 10  VAL A CG1 1 
ATOM 91   C CG2 . VAL A 1 11  ? 56.397 22.754  16.647  1.00 23.39 ? 10  VAL A CG2 1 
ATOM 92   N N   . ASP A 1 12  ? 55.802 23.747  21.195  1.00 25.00 ? 11  ASP A N   1 
ATOM 93   C CA  . ASP A 1 12  ? 54.897 24.165  22.266  1.00 25.15 ? 11  ASP A CA  1 
ATOM 94   C C   . ASP A 1 12  ? 53.841 25.129  21.695  1.00 25.93 ? 11  ASP A C   1 
ATOM 95   O O   . ASP A 1 12  ? 54.199 26.230  21.248  1.00 25.49 ? 11  ASP A O   1 
ATOM 96   C CB  . ASP A 1 12  ? 55.697 24.860  23.384  1.00 24.95 ? 11  ASP A CB  1 
ATOM 97   C CG  . ASP A 1 12  ? 54.983 24.824  24.727  1.00 24.51 ? 11  ASP A CG  1 
ATOM 98   O OD1 . ASP A 1 12  ? 53.713 24.917  24.795  1.00 23.29 ? 11  ASP A OD1 1 
ATOM 99   O OD2 . ASP A 1 12  ? 55.620 24.682  25.780  1.00 26.63 ? 11  ASP A OD2 1 
ATOM 100  N N   . PHE A 1 13  ? 52.561 24.737  21.727  1.00 26.40 ? 12  PHE A N   1 
ATOM 101  C CA  . PHE A 1 13  ? 51.477 25.622  21.256  1.00 26.91 ? 12  PHE A CA  1 
ATOM 102  C C   . PHE A 1 13  ? 51.224 26.831  22.146  1.00 26.97 ? 12  PHE A C   1 
ATOM 103  O O   . PHE A 1 13  ? 50.617 27.800  21.717  1.00 27.36 ? 12  PHE A O   1 
ATOM 104  C CB  . PHE A 1 13  ? 50.149 24.861  21.125  1.00 27.16 ? 12  PHE A CB  1 
ATOM 105  C CG  . PHE A 1 13  ? 50.078 23.920  19.939  1.00 27.90 ? 12  PHE A CG  1 
ATOM 106  C CD1 . PHE A 1 13  ? 51.211 23.600  19.183  1.00 28.88 ? 12  PHE A CD1 1 
ATOM 107  C CD2 . PHE A 1 13  ? 48.843 23.374  19.571  1.00 27.03 ? 12  PHE A CD2 1 
ATOM 108  C CE1 . PHE A 1 13  ? 51.100 22.747  18.098  1.00 29.04 ? 12  PHE A CE1 1 
ATOM 109  C CE2 . PHE A 1 13  ? 48.738 22.540  18.522  1.00 26.91 ? 12  PHE A CE2 1 
ATOM 110  C CZ  . PHE A 1 13  ? 49.863 22.212  17.777  1.00 28.80 ? 12  PHE A CZ  1 
ATOM 111  N N   . GLU A 1 14  ? 51.659 26.759  23.389  1.00 27.23 ? 13  GLU A N   1 
ATOM 112  C CA  . GLU A 1 14  ? 51.592 27.898  24.307  1.00 27.39 ? 13  GLU A CA  1 
ATOM 113  C C   . GLU A 1 14  ? 52.757 28.894  24.195  1.00 26.57 ? 13  GLU A C   1 
ATOM 114  O O   . GLU A 1 14  ? 52.639 30.014  24.634  1.00 26.66 ? 13  GLU A O   1 
ATOM 115  C CB  . GLU A 1 14  ? 51.540 27.365  25.749  1.00 28.30 ? 13  GLU A CB  1 
ATOM 116  C CG  . GLU A 1 14  ? 50.363 26.417  26.036  1.00 30.50 ? 13  GLU A CG  1 
ATOM 117  C CD  . GLU A 1 14  ? 49.000 27.054  25.771  1.00 33.54 ? 13  GLU A CD  1 
ATOM 118  O OE1 . GLU A 1 14  ? 48.919 28.302  25.704  1.00 34.46 ? 13  GLU A OE1 1 
ATOM 119  O OE2 . GLU A 1 14  ? 48.002 26.319  25.649  1.00 35.51 ? 13  GLU A OE2 1 
ATOM 120  N N   . THR A 1 15  ? 53.886 28.483  23.648  1.00 26.35 ? 14  THR A N   1 
ATOM 121  C CA  . THR A 1 15  ? 55.031 29.358  23.502  1.00 26.41 ? 14  THR A CA  1 
ATOM 122  C C   . THR A 1 15  ? 55.591 29.462  22.087  1.00 26.99 ? 14  THR A C   1 
ATOM 123  O O   . THR A 1 15  ? 56.523 30.236  21.851  1.00 27.63 ? 14  THR A O   1 
ATOM 124  C CB  . THR A 1 15  ? 56.177 28.907  24.426  1.00 26.01 ? 14  THR A CB  1 
ATOM 125  O OG1 . THR A 1 15  ? 56.905 27.848  23.826  1.00 24.64 ? 14  THR A OG1 1 
ATOM 126  C CG2 . THR A 1 15  ? 55.658 28.301  25.694  1.00 27.44 ? 14  THR A CG2 1 
ATOM 127  N N   . GLY A 1 16  ? 55.071 28.691  21.145  1.00 27.24 ? 15  GLY A N   1 
ATOM 128  C CA  . GLY A 1 16  ? 55.589 28.708  19.785  1.00 27.24 ? 15  GLY A CA  1 
ATOM 129  C C   . GLY A 1 16  ? 57.048 28.274  19.595  1.00 27.95 ? 15  GLY A C   1 
ATOM 130  O O   . GLY A 1 16  ? 57.529 28.214  18.475  1.00 27.55 ? 15  GLY A O   1 
ATOM 131  N N   . ILE A 1 17  ? 57.764 27.958  20.673  1.00 28.49 ? 16  ILE A N   1 
ATOM 132  C CA  . ILE A 1 17  ? 59.146 27.525  20.574  1.00 28.35 ? 16  ILE A CA  1 
ATOM 133  C C   . ILE A 1 17  ? 59.186 26.166  19.893  1.00 28.64 ? 16  ILE A C   1 
ATOM 134  O O   . ILE A 1 17  ? 58.399 25.266  20.211  1.00 29.60 ? 16  ILE A O   1 
ATOM 135  C CB  . ILE A 1 17  ? 59.786 27.433  22.013  1.00 28.83 ? 16  ILE A CB  1 
ATOM 136  C CG1 . ILE A 1 17  ? 59.882 28.812  22.663  1.00 28.94 ? 16  ILE A CG1 1 
ATOM 137  C CG2 . ILE A 1 17  ? 61.218 26.773  21.991  1.00 28.61 ? 16  ILE A CG2 1 
ATOM 138  C CD1 . ILE A 1 17  ? 60.798 28.880  23.917  1.00 27.95 ? 16  ILE A CD1 1 
ATOM 139  N N   . ILE A 1 18  ? 60.105 26.019  18.957  1.00 28.99 ? 17  ILE A N   1 
ATOM 140  C CA  . ILE A 1 18  ? 60.468 24.738  18.400  1.00 29.55 ? 17  ILE A CA  1 
ATOM 141  C C   . ILE A 1 18  ? 61.895 24.461  18.871  1.00 31.07 ? 17  ILE A C   1 
ATOM 142  O O   . ILE A 1 18  ? 62.762 25.346  18.788  1.00 31.21 ? 17  ILE A O   1 
ATOM 143  C CB  . ILE A 1 18  ? 60.433 24.770  16.867  1.00 29.04 ? 17  ILE A CB  1 
ATOM 144  C CG1 . ILE A 1 18  ? 59.190 25.494  16.358  1.00 29.17 ? 17  ILE A CG1 1 
ATOM 145  C CG2 . ILE A 1 18  ? 60.485 23.348  16.302  1.00 29.82 ? 17  ILE A CG2 1 
ATOM 146  C CD1 . ILE A 1 18  ? 58.727 25.136  14.920  1.00 29.59 ? 17  ILE A CD1 1 
ATOM 147  N N   . GLU A 1 19  ? 62.165 23.240  19.345  1.00 32.46 ? 18  GLU A N   1 
ATOM 148  C CA  . GLU A 1 19  ? 63.539 22.888  19.729  1.00 33.19 ? 18  GLU A CA  1 
ATOM 149  C C   . GLU A 1 19  ? 64.447 22.731  18.477  1.00 33.21 ? 18  GLU A C   1 
ATOM 150  O O   . GLU A 1 19  ? 64.101 21.970  17.574  1.00 33.83 ? 18  GLU A O   1 
ATOM 151  C CB  . GLU A 1 19  ? 63.556 21.619  20.603  1.00 33.91 ? 18  GLU A CB  1 
ATOM 152  C CG  . GLU A 1 19  ? 62.420 20.604  20.361  1.00 34.41 ? 18  GLU A CG  1 
ATOM 153  C CD  . GLU A 1 19  ? 62.828 19.147  20.705  1.00 35.92 ? 18  GLU A CD  1 
ATOM 154  O OE1 . GLU A 1 19  ? 63.899 18.711  20.193  1.00 37.09 ? 18  GLU A OE1 1 
ATOM 155  O OE2 . GLU A 1 19  ? 62.110 18.438  21.482  1.00 33.68 ? 18  GLU A OE2 1 
ATOM 156  N N   . GLY A 1 20  ? 65.562 23.459  18.426  1.00 32.72 ? 19  GLY A N   1 
ATOM 157  C CA  . GLY A 1 20  ? 66.564 23.297  17.397  1.00 33.55 ? 19  GLY A CA  1 
ATOM 158  C C   . GLY A 1 20  ? 66.438 24.235  16.188  1.00 34.93 ? 19  GLY A C   1 
ATOM 159  O O   . GLY A 1 20  ? 67.375 24.348  15.362  1.00 34.75 ? 19  GLY A O   1 
ATOM 160  N N   . ALA A 1 21  ? 65.293 24.918  16.087  1.00 35.56 ? 20  ALA A N   1 
ATOM 161  C CA  . ALA A 1 21  ? 64.991 25.819  14.980  1.00 35.83 ? 20  ALA A CA  1 
ATOM 162  C C   . ALA A 1 21  ? 65.956 26.995  14.880  1.00 36.27 ? 20  ALA A C   1 
ATOM 163  O O   . ALA A 1 21  ? 66.664 27.290  15.842  1.00 35.63 ? 20  ALA A O   1 
ATOM 164  C CB  . ALA A 1 21  ? 63.567 26.345  15.154  1.00 35.96 ? 20  ALA A CB  1 
ATOM 165  N N   . LYS A 1 22  ? 65.948 27.667  13.722  1.00 37.23 ? 21  LYS A N   1 
ATOM 166  C CA  . LYS A 1 22  ? 66.736 28.879  13.517  1.00 38.74 ? 21  LYS A CA  1 
ATOM 167  C C   . LYS A 1 22  ? 65.965 30.078  14.041  1.00 39.09 ? 21  LYS A C   1 
ATOM 168  O O   . LYS A 1 22  ? 65.055 30.573  13.368  1.00 40.15 ? 21  LYS A O   1 
ATOM 169  C CB  . LYS A 1 22  ? 67.131 29.109  12.050  1.00 39.22 ? 21  LYS A CB  1 
ATOM 170  C CG  . LYS A 1 22  ? 68.680 29.364  11.830  1.00 42.89 ? 21  LYS A CG  1 
ATOM 171  C CD  . LYS A 1 22  ? 69.202 30.757  12.380  1.00 45.48 ? 21  LYS A CD  1 
ATOM 172  C CE  . LYS A 1 22  ? 70.599 30.627  13.135  1.00 46.42 ? 21  LYS A CE  1 
ATOM 173  N NZ  . LYS A 1 22  ? 70.934 31.901  13.963  1.00 46.93 ? 21  LYS A NZ  1 
ATOM 174  N N   . LYS A 1 23  ? 66.354 30.542  15.234  1.00 38.90 ? 22  LYS A N   1 
ATOM 175  C CA  . LYS A 1 23  ? 65.655 31.597  15.944  1.00 38.56 ? 22  LYS A CA  1 
ATOM 176  C C   . LYS A 1 23  ? 66.046 32.935  15.317  1.00 37.41 ? 22  LYS A C   1 
ATOM 177  O O   . LYS A 1 23  ? 67.153 33.106  14.792  1.00 37.84 ? 22  LYS A O   1 
ATOM 178  C CB  . LYS A 1 23  ? 66.007 31.538  17.449  1.00 39.65 ? 22  LYS A CB  1 
ATOM 179  C CG  . LYS A 1 23  ? 65.047 32.307  18.406  1.00 42.10 ? 22  LYS A CG  1 
ATOM 180  C CD  . LYS A 1 23  ? 65.837 33.234  19.445  1.00 45.94 ? 22  LYS A CD  1 
ATOM 181  C CE  . LYS A 1 23  ? 66.421 32.500  20.770  1.00 46.90 ? 22  LYS A CE  1 
ATOM 182  N NZ  . LYS A 1 23  ? 67.106 33.484  21.732  1.00 44.45 ? 22  LYS A NZ  1 
ATOM 183  N N   . SER A 1 24  ? 65.119 33.882  15.364  1.00 36.03 ? 23  SER A N   1 
ATOM 184  C CA  . SER A 1 24  ? 65.349 35.213  14.848  1.00 34.49 ? 23  SER A CA  1 
ATOM 185  C C   . SER A 1 24  ? 64.420 36.173  15.565  1.00 33.30 ? 23  SER A C   1 
ATOM 186  O O   . SER A 1 24  ? 63.270 35.869  15.780  1.00 31.76 ? 23  SER A O   1 
ATOM 187  C CB  . SER A 1 24  ? 65.103 35.223  13.371  1.00 34.29 ? 23  SER A CB  1 
ATOM 188  O OG  . SER A 1 24  ? 64.902 36.541  12.989  1.00 35.95 ? 23  SER A OG  1 
ATOM 189  N N   . VAL A 1 25  ? 64.956 37.315  15.979  1.00 33.52 ? 24  VAL A N   1 
ATOM 190  C CA  . VAL A 1 25  ? 64.213 38.277  16.802  1.00 33.54 ? 24  VAL A CA  1 
ATOM 191  C C   . VAL A 1 25  ? 64.225 39.544  16.046  1.00 33.17 ? 24  VAL A C   1 
ATOM 192  O O   . VAL A 1 25  ? 65.257 39.887  15.535  1.00 32.55 ? 24  VAL A O   1 
ATOM 193  C CB  . VAL A 1 25  ? 64.850 38.524  18.217  1.00 33.77 ? 24  VAL A CB  1 
ATOM 194  C CG1 . VAL A 1 25  ? 63.916 39.331  19.093  1.00 33.25 ? 24  VAL A CG1 1 
ATOM 195  C CG2 . VAL A 1 25  ? 65.179 37.187  18.931  1.00 33.78 ? 24  VAL A CG2 1 
ATOM 196  N N   . ARG A 1 26  ? 63.049 40.184  15.924  1.00 33.74 ? 25  ARG A N   1 
ATOM 197  C CA  . ARG A 1 26  ? 62.886 41.507  15.310  1.00 34.12 ? 25  ARG A CA  1 
ATOM 198  C C   . ARG A 1 26  ? 62.336 42.460  16.356  1.00 34.13 ? 25  ARG A C   1 
ATOM 199  O O   . ARG A 1 26  ? 61.214 42.294  16.871  1.00 34.41 ? 25  ARG A O   1 
ATOM 200  C CB  . ARG A 1 26  ? 61.963 41.505  14.069  1.00 34.14 ? 25  ARG A CB  1 
ATOM 201  C CG  . ARG A 1 26  ? 62.422 40.629  12.894  1.00 36.89 ? 25  ARG A CG  1 
ATOM 202  C CD  . ARG A 1 26  ? 63.928 40.784  12.512  1.00 40.29 ? 25  ARG A CD  1 
ATOM 203  N NE  . ARG A 1 26  ? 64.431 39.667  11.710  1.00 42.56 ? 25  ARG A NE  1 
ATOM 204  C CZ  . ARG A 1 26  ? 65.609 39.654  11.063  1.00 45.38 ? 25  ARG A CZ  1 
ATOM 205  N NH1 . ARG A 1 26  ? 66.423 40.737  11.116  1.00 45.50 ? 25  ARG A NH1 1 
ATOM 206  N NH2 . ARG A 1 26  ? 65.968 38.555  10.344  1.00 44.10 ? 25  ARG A NH2 1 
ATOM 207  N N   . ARG A 1 27  ? 63.141 43.464  16.668  1.00 33.94 ? 26  ARG A N   1 
ATOM 208  C CA  . ARG A 1 27  ? 62.756 44.502  17.612  1.00 33.82 ? 26  ARG A CA  1 
ATOM 209  C C   . ARG A 1 27  ? 62.131 45.580  16.751  1.00 32.64 ? 26  ARG A C   1 
ATOM 210  O O   . ARG A 1 27  ? 62.159 45.475  15.558  1.00 32.54 ? 26  ARG A O   1 
ATOM 211  C CB  . ARG A 1 27  ? 64.007 45.003  18.386  1.00 34.07 ? 26  ARG A CB  1 
ATOM 212  C CG  . ARG A 1 27  ? 64.943 43.860  18.831  1.00 35.00 ? 26  ARG A CG  1 
ATOM 213  C CD  . ARG A 1 27  ? 66.046 44.230  19.823  1.00 36.62 ? 26  ARG A CD  1 
ATOM 214  N NE  . ARG A 1 27  ? 65.509 44.649  21.114  1.00 37.10 ? 26  ARG A NE  1 
ATOM 215  C CZ  . ARG A 1 27  ? 65.086 43.835  22.064  1.00 38.02 ? 26  ARG A CZ  1 
ATOM 216  N NH1 . ARG A 1 27  ? 65.134 42.506  21.893  1.00 38.31 ? 26  ARG A NH1 1 
ATOM 217  N NH2 . ARG A 1 27  ? 64.614 44.358  23.207  1.00 37.84 ? 26  ARG A NH2 1 
ATOM 218  N N   . LEU A 1 28  ? 61.589 46.614  17.366  1.00 32.04 ? 27  LEU A N   1 
ATOM 219  C CA  . LEU A 1 28  ? 60.975 47.717  16.654  1.00 31.40 ? 27  LEU A CA  1 
ATOM 220  C C   . LEU A 1 28  ? 62.017 48.511  15.870  1.00 30.89 ? 27  LEU A C   1 
ATOM 221  O O   . LEU A 1 28  ? 61.697 49.025  14.803  1.00 30.63 ? 27  LEU A O   1 
ATOM 222  C CB  . LEU A 1 28  ? 60.246 48.620  17.653  1.00 31.64 ? 27  LEU A CB  1 
ATOM 223  C CG  . LEU A 1 28  ? 59.145 49.532  17.114  1.00 32.82 ? 27  LEU A CG  1 
ATOM 224  C CD1 . LEU A 1 28  ? 57.928 48.768  16.594  1.00 32.99 ? 27  LEU A CD1 1 
ATOM 225  C CD2 . LEU A 1 28  ? 58.733 50.504  18.231  1.00 32.85 ? 27  LEU A CD2 1 
ATOM 226  N N   . SER A 1 29  ? 63.258 48.578  16.378  1.00 30.05 ? 28  SER A N   1 
ATOM 227  C CA  . SER A 1 29  ? 64.352 49.303  15.715  1.00 29.80 ? 28  SER A CA  1 
ATOM 228  C C   . SER A 1 29  ? 64.816 48.613  14.440  1.00 29.50 ? 28  SER A C   1 
ATOM 229  O O   . SER A 1 29  ? 65.653 49.144  13.708  1.00 30.39 ? 28  SER A O   1 
ATOM 230  C CB  . SER A 1 29  ? 65.549 49.525  16.684  1.00 30.24 ? 28  SER A CB  1 
ATOM 231  O OG  . SER A 1 29  ? 66.439 48.404  16.782  1.00 28.61 ? 28  SER A OG  1 
ATOM 232  N N   . ASP A 1 30  ? 64.302 47.408  14.222  1.00 29.16 ? 29  ASP A N   1 
ATOM 233  C CA  . ASP A 1 30  ? 64.516 46.652  13.005  1.00 29.04 ? 29  ASP A CA  1 
ATOM 234  C C   . ASP A 1 30  ? 63.400 46.832  12.033  1.00 28.53 ? 29  ASP A C   1 
ATOM 235  O O   . ASP A 1 30  ? 63.428 46.192  10.999  1.00 28.86 ? 29  ASP A O   1 
ATOM 236  C CB  . ASP A 1 30  ? 64.656 45.163  13.285  1.00 28.92 ? 29  ASP A CB  1 
ATOM 237  C CG  . ASP A 1 30  ? 65.873 44.833  14.156  1.00 30.78 ? 29  ASP A CG  1 
ATOM 238  O OD1 . ASP A 1 30  ? 66.883 45.586  14.129  1.00 34.18 ? 29  ASP A OD1 1 
ATOM 239  O OD2 . ASP A 1 30  ? 65.918 43.840  14.915  1.00 31.29 ? 29  ASP A OD2 1 
ATOM 240  N N   . MET A 1 31  ? 62.455 47.726  12.330  1.00 28.50 ? 30  MET A N   1 
ATOM 241  C CA  . MET A 1 31  ? 61.280 47.982  11.473  1.00 27.96 ? 30  MET A CA  1 
ATOM 242  C C   . MET A 1 31  ? 61.137 49.488  11.168  1.00 28.03 ? 30  MET A C   1 
ATOM 243  O O   . MET A 1 31  ? 60.016 50.082  11.278  1.00 27.33 ? 30  MET A O   1 
ATOM 244  C CB  . MET A 1 31  ? 59.981 47.421  12.104  1.00 27.84 ? 30  MET A CB  1 
ATOM 245  C CG  . MET A 1 31  ? 60.100 46.006  12.671  1.00 27.63 ? 30  MET A CG  1 
ATOM 246  S SD  . MET A 1 31  ? 58.590 45.103  13.095  1.00 30.43 ? 30  MET A SD  1 
ATOM 247  C CE  . MET A 1 31  ? 57.505 45.416  11.610  1.00 30.54 ? 30  MET A CE  1 
ATOM 248  N N   . GLU A 1 32  ? 62.256 50.115  10.764  1.00 27.85 ? 31  GLU A N   1 
ATOM 249  C CA  . GLU A 1 32  ? 62.150 51.503  10.299  1.00 28.09 ? 31  GLU A CA  1 
ATOM 250  C C   . GLU A 1 32  ? 61.424 51.559  8.969   1.00 26.83 ? 31  GLU A C   1 
ATOM 251  O O   . GLU A 1 32  ? 61.548 50.667  8.156   1.00 27.39 ? 31  GLU A O   1 
ATOM 252  C CB  . GLU A 1 32  ? 63.502 52.196  10.194  1.00 28.71 ? 31  GLU A CB  1 
ATOM 253  C CG  . GLU A 1 32  ? 63.412 53.609  9.565   1.00 30.86 ? 31  GLU A CG  1 
ATOM 254  C CD  . GLU A 1 32  ? 64.449 54.613  10.081  1.00 32.55 ? 31  GLU A CD  1 
ATOM 255  O OE1 . GLU A 1 32  ? 65.671 54.250  10.183  1.00 30.64 ? 31  GLU A OE1 1 
ATOM 256  O OE2 . GLU A 1 32  ? 63.994 55.763  10.399  1.00 32.97 ? 31  GLU A OE2 1 
ATOM 257  N N   . GLY A 1 33  ? 60.646 52.602  8.764   1.00 26.07 ? 32  GLY A N   1 
ATOM 258  C CA  . GLY A 1 33  ? 59.836 52.728  7.565   1.00 25.59 ? 32  GLY A CA  1 
ATOM 259  C C   . GLY A 1 33  ? 58.503 51.998  7.607   1.00 24.78 ? 32  GLY A C   1 
ATOM 260  O O   . GLY A 1 33  ? 57.638 52.299  6.798   1.00 25.65 ? 32  GLY A O   1 
ATOM 261  N N   . TYR A 1 34  ? 58.296 51.085  8.560   1.00 23.76 ? 33  TYR A N   1 
ATOM 262  C CA  . TYR A 1 34  ? 57.144 50.197  8.484   1.00 22.28 ? 33  TYR A CA  1 
ATOM 263  C C   . TYR A 1 34  ? 55.874 50.790  9.064   1.00 21.70 ? 33  TYR A C   1 
ATOM 264  O O   . TYR A 1 34  ? 54.808 50.610  8.467   1.00 21.24 ? 33  TYR A O   1 
ATOM 265  C CB  . TYR A 1 34  ? 57.472 48.876  9.124   1.00 22.04 ? 33  TYR A CB  1 
ATOM 266  C CG  . TYR A 1 34  ? 58.347 48.037  8.254   1.00 21.65 ? 33  TYR A CG  1 
ATOM 267  C CD1 . TYR A 1 34  ? 59.716 48.189  8.297   1.00 22.95 ? 33  TYR A CD1 1 
ATOM 268  C CD2 . TYR A 1 34  ? 57.822 47.105  7.367   1.00 21.43 ? 33  TYR A CD2 1 
ATOM 269  C CE1 . TYR A 1 34  ? 60.556 47.445  7.497   1.00 22.35 ? 33  TYR A CE1 1 
ATOM 270  C CE2 . TYR A 1 34  ? 58.669 46.345  6.561   1.00 22.24 ? 33  TYR A CE2 1 
ATOM 271  C CZ  . TYR A 1 34  ? 60.042 46.536  6.635   1.00 21.80 ? 33  TYR A CZ  1 
ATOM 272  O OH  . TYR A 1 34  ? 60.942 45.848  5.853   1.00 23.48 ? 33  TYR A OH  1 
ATOM 273  N N   . PHE A 1 35  ? 55.972 51.513  10.190  1.00 20.96 ? 34  PHE A N   1 
ATOM 274  C CA  . PHE A 1 35  ? 54.769 52.110  10.803  1.00 20.64 ? 34  PHE A CA  1 
ATOM 275  C C   . PHE A 1 35  ? 54.539 53.543  10.357  1.00 20.85 ? 34  PHE A C   1 
ATOM 276  O O   . PHE A 1 35  ? 55.473 54.283  10.123  1.00 21.28 ? 34  PHE A O   1 
ATOM 277  C CB  . PHE A 1 35  ? 54.831 52.039  12.319  1.00 20.60 ? 34  PHE A CB  1 
ATOM 278  C CG  . PHE A 1 35  ? 55.005 50.673  12.837  1.00 18.08 ? 34  PHE A CG  1 
ATOM 279  C CD1 . PHE A 1 35  ? 56.274 50.140  13.039  1.00 15.60 ? 34  PHE A CD1 1 
ATOM 280  C CD2 . PHE A 1 35  ? 53.908 49.914  13.132  1.00 16.76 ? 34  PHE A CD2 1 
ATOM 281  C CE1 . PHE A 1 35  ? 56.431 48.869  13.531  1.00 14.97 ? 34  PHE A CE1 1 
ATOM 282  C CE2 . PHE A 1 35  ? 54.073 48.628  13.637  1.00 16.35 ? 34  PHE A CE2 1 
ATOM 283  C CZ  . PHE A 1 35  ? 55.339 48.118  13.834  1.00 14.51 ? 34  PHE A CZ  1 
ATOM 284  N N   . VAL A 1 36  ? 53.273 53.905  10.251  1.00 21.19 ? 35  VAL A N   1 
ATOM 285  C CA  . VAL A 1 36  ? 52.821 55.200  9.775   1.00 21.92 ? 35  VAL A CA  1 
ATOM 286  C C   . VAL A 1 36  ? 53.230 56.372  10.650  1.00 22.46 ? 35  VAL A C   1 
ATOM 287  O O   . VAL A 1 36  ? 53.826 57.308  10.185  1.00 22.45 ? 35  VAL A O   1 
ATOM 288  C CB  . VAL A 1 36  ? 51.311 55.181  9.717   1.00 21.82 ? 35  VAL A CB  1 
ATOM 289  C CG1 . VAL A 1 36  ? 50.758 56.538  9.496   1.00 21.55 ? 35  VAL A CG1 1 
ATOM 290  C CG2 . VAL A 1 36  ? 50.891 54.170  8.625   1.00 23.96 ? 35  VAL A CG2 1 
ATOM 291  N N   . ASP A 1 37  ? 52.883 56.318  11.921  1.00 24.09 ? 36  ASP A N   1 
ATOM 292  C CA  . ASP A 1 37  ? 53.260 57.338  12.898  1.00 24.78 ? 36  ASP A CA  1 
ATOM 293  C C   . ASP A 1 37  ? 54.744 57.223  13.225  1.00 25.33 ? 36  ASP A C   1 
ATOM 294  O O   . ASP A 1 37  ? 55.134 56.541  14.140  1.00 25.18 ? 36  ASP A O   1 
ATOM 295  C CB  . ASP A 1 37  ? 52.426 57.149  14.164  1.00 24.68 ? 36  ASP A CB  1 
ATOM 296  C CG  . ASP A 1 37  ? 52.548 58.291  15.100  1.00 24.84 ? 36  ASP A CG  1 
ATOM 297  O OD1 . ASP A 1 37  ? 53.693 58.726  15.387  1.00 26.54 ? 36  ASP A OD1 1 
ATOM 298  O OD2 . ASP A 1 37  ? 51.545 58.831  15.580  1.00 23.99 ? 36  ASP A OD2 1 
ATOM 299  N N   . GLU A 1 38  ? 55.572 57.911  12.470  1.00 26.62 ? 37  GLU A N   1 
ATOM 300  C CA  . GLU A 1 38  ? 57.021 57.658  12.512  1.00 27.28 ? 37  GLU A CA  1 
ATOM 301  C C   . GLU A 1 38  ? 57.661 58.245  13.791  1.00 28.09 ? 37  GLU A C   1 
ATOM 302  O O   . GLU A 1 38  ? 58.774 57.878  14.159  1.00 28.03 ? 37  GLU A O   1 
ATOM 303  C CB  . GLU A 1 38  ? 57.707 58.243  11.266  1.00 27.11 ? 37  GLU A CB  1 
ATOM 304  C CG  . GLU A 1 38  ? 58.496 57.267  10.417  1.00 28.16 ? 37  GLU A CG  1 
ATOM 305  C CD  . GLU A 1 38  ? 58.736 57.753  8.964   1.00 32.06 ? 37  GLU A CD  1 
ATOM 306  O OE1 . GLU A 1 38  ? 58.394 58.911  8.550   1.00 32.96 ? 37  GLU A OE1 1 
ATOM 307  O OE2 . GLU A 1 38  ? 59.266 56.950  8.170   1.00 34.39 ? 37  GLU A OE2 1 
ATOM 308  N N   . ARG A 1 39  ? 56.963 59.175  14.445  1.00 28.98 ? 38  ARG A N   1 
ATOM 309  C CA  . ARG A 1 39  ? 57.476 59.807  15.652  1.00 29.03 ? 38  ARG A CA  1 
ATOM 310  C C   . ARG A 1 39  ? 57.224 58.904  16.855  1.00 29.23 ? 38  ARG A C   1 
ATOM 311  O O   . ARG A 1 39  ? 58.077 58.775  17.724  1.00 30.48 ? 38  ARG A O   1 
ATOM 312  C CB  . ARG A 1 39  ? 56.822 61.182  15.877  1.00 28.94 ? 38  ARG A CB  1 
ATOM 313  C CG  . ARG A 1 39  ? 57.464 62.275  15.087  1.00 28.58 ? 38  ARG A CG  1 
ATOM 314  C CD  . ARG A 1 39  ? 57.010 63.670  15.460  1.00 29.31 ? 38  ARG A CD  1 
ATOM 315  N NE  . ARG A 1 39  ? 57.533 64.132  16.741  1.00 30.44 ? 38  ARG A NE  1 
ATOM 316  C CZ  . ARG A 1 39  ? 58.810 64.472  16.963  1.00 32.25 ? 38  ARG A CZ  1 
ATOM 317  N NH1 . ARG A 1 39  ? 59.726 64.398  16.010  1.00 35.80 ? 38  ARG A NH1 1 
ATOM 318  N NH2 . ARG A 1 39  ? 59.195 64.848  18.155  1.00 32.05 ? 38  ARG A NH2 1 
ATOM 319  N N   . ALA A 1 40  ? 56.062 58.284  16.924  1.00 29.03 ? 39  ALA A N   1 
ATOM 320  C CA  . ALA A 1 40  ? 55.801 57.306  17.977  1.00 29.18 ? 39  ALA A CA  1 
ATOM 321  C C   . ALA A 1 40  ? 56.845 56.189  17.933  1.00 29.17 ? 39  ALA A C   1 
ATOM 322  O O   . ALA A 1 40  ? 57.337 55.713  18.949  1.00 29.25 ? 39  ALA A O   1 
ATOM 323  C CB  . ALA A 1 40  ? 54.410 56.731  17.806  1.00 28.93 ? 39  ALA A CB  1 
ATOM 324  N N   . TRP A 1 41  ? 57.165 55.782  16.720  1.00 29.43 ? 40  TRP A N   1 
ATOM 325  C CA  . TRP A 1 41  ? 58.178 54.794  16.478  1.00 29.42 ? 40  TRP A CA  1 
ATOM 326  C C   . TRP A 1 41  ? 59.517 55.249  17.074  1.00 30.49 ? 40  TRP A C   1 
ATOM 327  O O   . TRP A 1 41  ? 60.210 54.473  17.698  1.00 30.49 ? 40  TRP A O   1 
ATOM 328  C CB  . TRP A 1 41  ? 58.290 54.530  14.967  1.00 29.03 ? 40  TRP A CB  1 
ATOM 329  C CG  . TRP A 1 41  ? 59.341 53.522  14.649  1.00 27.64 ? 40  TRP A CG  1 
ATOM 330  C CD1 . TRP A 1 41  ? 59.164 52.200  14.579  1.00 27.08 ? 40  TRP A CD1 1 
ATOM 331  C CD2 . TRP A 1 41  ? 60.749 53.750  14.422  1.00 25.78 ? 40  TRP A CD2 1 
ATOM 332  N NE1 . TRP A 1 41  ? 60.354 51.570  14.301  1.00 25.56 ? 40  TRP A NE1 1 
ATOM 333  C CE2 . TRP A 1 41  ? 61.342 52.504  14.196  1.00 24.99 ? 40  TRP A CE2 1 
ATOM 334  C CE3 . TRP A 1 41  ? 61.566 54.888  14.383  1.00 26.57 ? 40  TRP A CE3 1 
ATOM 335  C CZ2 . TRP A 1 41  ? 62.706 52.349  13.924  1.00 26.25 ? 40  TRP A CZ2 1 
ATOM 336  C CZ3 . TRP A 1 41  ? 62.936 54.736  14.095  1.00 26.53 ? 40  TRP A CZ3 1 
ATOM 337  C CH2 . TRP A 1 41  ? 63.486 53.473  13.873  1.00 26.29 ? 40  TRP A CH2 1 
ATOM 338  N N   . LYS A 1 42  ? 59.900 56.494  16.879  1.00 31.77 ? 41  LYS A N   1 
ATOM 339  C CA  . LYS A 1 42  ? 61.168 56.975  17.424  1.00 33.23 ? 41  LYS A CA  1 
ATOM 340  C C   . LYS A 1 42  ? 61.158 56.974  18.949  1.00 34.01 ? 41  LYS A C   1 
ATOM 341  O O   . LYS A 1 42  ? 62.127 56.522  19.581  1.00 34.39 ? 41  LYS A O   1 
ATOM 342  C CB  . LYS A 1 42  ? 61.476 58.378  16.913  1.00 33.36 ? 41  LYS A CB  1 
ATOM 343  C CG  . LYS A 1 42  ? 62.877 58.903  17.262  1.00 35.85 ? 41  LYS A CG  1 
ATOM 344  C CD  . LYS A 1 42  ? 63.958 58.552  16.188  1.00 39.21 ? 41  LYS A CD  1 
ATOM 345  C CE  . LYS A 1 42  ? 64.269 59.738  15.201  1.00 40.84 ? 41  LYS A CE  1 
ATOM 346  N NZ  . LYS A 1 42  ? 64.728 59.244  13.821  1.00 39.90 ? 41  LYS A NZ  1 
ATOM 347  N N   . GLU A 1 43  ? 60.077 57.486  19.534  1.00 34.83 ? 42  GLU A N   1 
ATOM 348  C CA  . GLU A 1 43  ? 59.949 57.573  20.986  1.00 36.09 ? 42  GLU A CA  1 
ATOM 349  C C   . GLU A 1 43  ? 59.995 56.199  21.656  1.00 36.00 ? 42  GLU A C   1 
ATOM 350  O O   . GLU A 1 43  ? 60.597 56.012  22.710  1.00 35.50 ? 42  GLU A O   1 
ATOM 351  C CB  . GLU A 1 43  ? 58.646 58.282  21.358  1.00 36.75 ? 42  GLU A CB  1 
ATOM 352  C CG  . GLU A 1 43  ? 58.643 58.922  22.735  1.00 38.88 ? 42  GLU A CG  1 
ATOM 353  C CD  . GLU A 1 43  ? 57.258 58.956  23.342  1.00 41.96 ? 42  GLU A CD  1 
ATOM 354  O OE1 . GLU A 1 43  ? 57.095 58.424  24.457  1.00 44.60 ? 42  GLU A OE1 1 
ATOM 355  O OE2 . GLU A 1 43  ? 56.327 59.509  22.704  1.00 44.72 ? 42  GLU A OE2 1 
ATOM 356  N N   . LEU A 1 44  ? 59.397 55.226  20.994  1.00 36.73 ? 43  LEU A N   1 
ATOM 357  C CA  . LEU A 1 44  ? 59.300 53.878  21.543  1.00 37.24 ? 43  LEU A CA  1 
ATOM 358  C C   . LEU A 1 44  ? 60.573 53.063  21.376  1.00 37.35 ? 43  LEU A C   1 
ATOM 359  O O   . LEU A 1 44  ? 60.787 52.148  22.118  1.00 36.93 ? 43  LEU A O   1 
ATOM 360  C CB  . LEU A 1 44  ? 58.107 53.143  20.945  1.00 36.97 ? 43  LEU A CB  1 
ATOM 361  C CG  . LEU A 1 44  ? 57.310 52.122  21.799  1.00 37.78 ? 43  LEU A CG  1 
ATOM 362  C CD1 . LEU A 1 44  ? 57.895 51.805  23.153  1.00 38.27 ? 43  LEU A CD1 1 
ATOM 363  C CD2 . LEU A 1 44  ? 55.847 52.547  21.987  1.00 39.41 ? 43  LEU A CD2 1 
ATOM 364  N N   . VAL A 1 45  ? 61.414 53.416  20.409  1.00 38.68 ? 44  VAL A N   1 
ATOM 365  C CA  . VAL A 1 45  ? 62.682 52.745  20.171  1.00 39.25 ? 44  VAL A CA  1 
ATOM 366  C C   . VAL A 1 45  ? 63.665 53.103  21.270  1.00 40.33 ? 44  VAL A C   1 
ATOM 367  O O   . VAL A 1 45  ? 64.112 52.230  22.014  1.00 41.18 ? 44  VAL A O   1 
ATOM 368  C CB  . VAL A 1 45  ? 63.282 53.139  18.816  1.00 39.09 ? 44  VAL A CB  1 
ATOM 369  C CG1 . VAL A 1 45  ? 64.765 52.717  18.715  1.00 40.48 ? 44  VAL A CG1 1 
ATOM 370  C CG2 . VAL A 1 45  ? 62.520 52.516  17.728  1.00 38.36 ? 44  VAL A CG2 1 
ATOM 371  N N   . GLU A 1 46  ? 64.007 54.381  21.379  1.00 41.20 ? 45  GLU A N   1 
ATOM 372  C CA  . GLU A 1 46  ? 64.995 54.835  22.366  1.00 42.00 ? 45  GLU A CA  1 
ATOM 373  C C   . GLU A 1 46  ? 64.678 54.420  23.815  1.00 41.46 ? 45  GLU A C   1 
ATOM 374  O O   . GLU A 1 46  ? 65.588 54.249  24.637  1.00 42.46 ? 45  GLU A O   1 
ATOM 375  C CB  . GLU A 1 46  ? 65.057 56.366  22.344  1.00 42.94 ? 45  GLU A CB  1 
ATOM 376  C CG  . GLU A 1 46  ? 65.750 56.992  21.146  1.00 44.61 ? 45  GLU A CG  1 
ATOM 377  C CD  . GLU A 1 46  ? 65.967 58.485  21.351  1.00 46.83 ? 45  GLU A CD  1 
ATOM 378  O OE1 . GLU A 1 46  ? 66.881 58.828  22.160  1.00 51.35 ? 45  GLU A OE1 1 
ATOM 379  O OE2 . GLU A 1 46  ? 65.238 59.300  20.744  1.00 43.17 ? 45  GLU A OE2 1 
ATOM 380  N N   . LYS A 1 47  ? 63.384 54.332  24.124  1.00 40.47 ? 46  LYS A N   1 
ATOM 381  C CA  . LYS A 1 47  ? 62.913 54.191  25.492  1.00 40.19 ? 46  LYS A CA  1 
ATOM 382  C C   . LYS A 1 47  ? 62.635 52.710  25.943  1.00 39.50 ? 46  LYS A C   1 
ATOM 383  O O   . LYS A 1 47  ? 62.490 52.435  27.149  1.00 40.87 ? 46  LYS A O   1 
ATOM 384  C CB  . LYS A 1 47  ? 61.682 55.129  25.710  1.00 40.04 ? 46  LYS A CB  1 
ATOM 385  C CG  . LYS A 1 47  ? 61.986 56.723  25.689  1.00 41.99 ? 46  LYS A CG  1 
ATOM 386  C CD  . LYS A 1 47  ? 63.540 57.203  25.713  1.00 42.96 ? 46  LYS A CD  1 
ATOM 387  C CE  . LYS A 1 47  ? 63.892 58.093  26.952  1.00 42.26 ? 46  LYS A CE  1 
ATOM 388  N NZ  . LYS A 1 47  ? 65.347 58.273  27.159  1.00 40.77 ? 46  LYS A NZ  1 
ATOM 389  N N   . GLU A 1 48  ? 62.601 51.767  25.004  1.00 37.30 ? 47  GLU A N   1 
ATOM 390  C CA  . GLU A 1 48  ? 62.342 50.354  25.292  1.00 35.51 ? 47  GLU A CA  1 
ATOM 391  C C   . GLU A 1 48  ? 62.922 49.482  24.181  1.00 33.96 ? 47  GLU A C   1 
ATOM 392  O O   . GLU A 1 48  ? 63.664 48.530  24.457  1.00 33.07 ? 47  GLU A O   1 
ATOM 393  C CB  . GLU A 1 48  ? 60.841 50.099  25.394  1.00 36.06 ? 47  GLU A CB  1 
ATOM 394  C CG  . GLU A 1 48  ? 60.423 48.698  25.848  1.00 37.14 ? 47  GLU A CG  1 
ATOM 395  C CD  . GLU A 1 48  ? 58.882 48.488  25.815  1.00 40.31 ? 47  GLU A CD  1 
ATOM 396  O OE1 . GLU A 1 48  ? 58.398 47.338  26.067  1.00 41.53 ? 47  GLU A OE1 1 
ATOM 397  O OE2 . GLU A 1 48  ? 58.132 49.463  25.534  1.00 39.20 ? 47  GLU A OE2 1 
ATOM 398  N N   . ASP A 1 49  ? 62.579 49.831  22.931  1.00 32.55 ? 48  ASP A N   1 
ATOM 399  C CA  . ASP A 1 49  ? 62.919 49.087  21.715  1.00 31.12 ? 48  ASP A CA  1 
ATOM 400  C C   . ASP A 1 49  ? 62.358 47.699  21.881  1.00 30.69 ? 48  ASP A C   1 
ATOM 401  O O   . ASP A 1 49  ? 63.106 46.741  22.038  1.00 31.12 ? 48  ASP A O   1 
ATOM 402  C CB  . ASP A 1 49  ? 64.440 49.049  21.490  1.00 30.73 ? 48  ASP A CB  1 
ATOM 403  C CG  . ASP A 1 49  ? 64.820 48.641  20.081  1.00 29.24 ? 48  ASP A CG  1 
ATOM 404  O OD1 . ASP A 1 49  ? 63.935 48.530  19.241  1.00 27.75 ? 48  ASP A OD1 1 
ATOM 405  O OD2 . ASP A 1 49  ? 65.976 48.422  19.696  1.00 27.83 ? 48  ASP A OD2 1 
ATOM 406  N N   . PRO A 1 50  ? 61.045 47.585  21.974  1.00 29.87 ? 49  PRO A N   1 
ATOM 407  C CA  . PRO A 1 50  ? 60.431 46.325  22.379  1.00 29.18 ? 49  PRO A CA  1 
ATOM 408  C C   . PRO A 1 50  ? 60.648 45.269  21.344  1.00 28.94 ? 49  PRO A C   1 
ATOM 409  O O   . PRO A 1 50  ? 60.989 45.582  20.185  1.00 27.65 ? 49  PRO A O   1 
ATOM 410  C CB  . PRO A 1 50  ? 58.936 46.663  22.491  1.00 29.63 ? 49  PRO A CB  1 
ATOM 411  C CG  . PRO A 1 50  ? 58.724 47.843  21.649  1.00 29.90 ? 49  PRO A CG  1 
ATOM 412  C CD  . PRO A 1 50  ? 60.047 48.632  21.766  1.00 30.23 ? 49  PRO A CD  1 
ATOM 413  N N   . VAL A 1 51  ? 60.460 44.015  21.765  1.00 28.60 ? 50  VAL A N   1 
ATOM 414  C CA  . VAL A 1 51  ? 60.398 42.932  20.798  1.00 27.96 ? 50  VAL A CA  1 
ATOM 415  C C   . VAL A 1 51  ? 59.023 42.962  20.143  1.00 26.20 ? 50  VAL A C   1 
ATOM 416  O O   . VAL A 1 51  ? 58.033 43.015  20.836  1.00 25.88 ? 50  VAL A O   1 
ATOM 417  C CB  . VAL A 1 51  ? 60.658 41.596  21.448  1.00 28.27 ? 50  VAL A CB  1 
ATOM 418  C CG1 . VAL A 1 51  ? 60.113 40.452  20.560  1.00 29.00 ? 50  VAL A CG1 1 
ATOM 419  C CG2 . VAL A 1 51  ? 62.163 41.437  21.673  1.00 27.87 ? 50  VAL A CG2 1 
ATOM 420  N N   . VAL A 1 52  ? 58.999 42.977  18.809  1.00 25.17 ? 51  VAL A N   1 
ATOM 421  C CA  . VAL A 1 52  ? 57.754 42.913  18.019  1.00 24.17 ? 51  VAL A CA  1 
ATOM 422  C C   . VAL A 1 52  ? 57.374 41.473  17.667  1.00 23.25 ? 51  VAL A C   1 
ATOM 423  O O   . VAL A 1 52  ? 56.244 41.105  17.848  1.00 22.12 ? 51  VAL A O   1 
ATOM 424  C CB  . VAL A 1 52  ? 57.808 43.823  16.789  1.00 23.89 ? 51  VAL A CB  1 
ATOM 425  C CG1 . VAL A 1 52  ? 56.568 43.683  15.954  1.00 24.56 ? 51  VAL A CG1 1 
ATOM 426  C CG2 . VAL A 1 52  ? 57.885 45.265  17.250  1.00 22.45 ? 51  VAL A CG2 1 
ATOM 427  N N   . TYR A 1 53  ? 58.335 40.664  17.227  1.00 23.22 ? 52  TYR A N   1 
ATOM 428  C CA  . TYR A 1 53  ? 58.108 39.239  17.025  1.00 22.76 ? 52  TYR A CA  1 
ATOM 429  C C   . TYR A 1 53  ? 59.363 38.343  16.970  1.00 22.57 ? 52  TYR A C   1 
ATOM 430  O O   . TYR A 1 53  ? 60.452 38.763  16.593  1.00 22.27 ? 52  TYR A O   1 
ATOM 431  C CB  . TYR A 1 53  ? 57.249 39.027  15.758  1.00 23.29 ? 52  TYR A CB  1 
ATOM 432  C CG  . TYR A 1 53  ? 57.848 39.480  14.409  1.00 23.26 ? 52  TYR A CG  1 
ATOM 433  C CD1 . TYR A 1 53  ? 58.251 38.541  13.446  1.00 22.88 ? 52  TYR A CD1 1 
ATOM 434  C CD2 . TYR A 1 53  ? 57.948 40.823  14.078  1.00 22.35 ? 52  TYR A CD2 1 
ATOM 435  C CE1 . TYR A 1 53  ? 58.732 38.928  12.244  1.00 21.51 ? 52  TYR A CE1 1 
ATOM 436  C CE2 . TYR A 1 53  ? 58.455 41.223  12.849  1.00 21.53 ? 52  TYR A CE2 1 
ATOM 437  C CZ  . TYR A 1 53  ? 58.841 40.271  11.941  1.00 21.24 ? 52  TYR A CZ  1 
ATOM 438  O OH  . TYR A 1 53  ? 59.360 40.653  10.722  1.00 21.52 ? 52  TYR A OH  1 
ATOM 439  N N   . GLU A 1 54  ? 59.168 37.087  17.355  1.00 22.61 ? 53  GLU A N   1 
ATOM 440  C CA  . GLU A 1 54  ? 60.178 36.013  17.274  1.00 22.65 ? 53  GLU A CA  1 
ATOM 441  C C   . GLU A 1 54  ? 59.754 35.008  16.202  1.00 22.52 ? 53  GLU A C   1 
ATOM 442  O O   . GLU A 1 54  ? 58.547 34.629  16.138  1.00 22.05 ? 53  GLU A O   1 
ATOM 443  C CB  . GLU A 1 54  ? 60.243 35.204  18.577  1.00 22.96 ? 53  GLU A CB  1 
ATOM 444  C CG  . GLU A 1 54  ? 61.367 35.519  19.560  1.00 24.24 ? 53  GLU A CG  1 
ATOM 445  C CD  . GLU A 1 54  ? 60.871 35.513  21.011  1.00 27.62 ? 53  GLU A CD  1 
ATOM 446  O OE1 . GLU A 1 54  ? 59.920 34.724  21.377  1.00 27.61 ? 53  GLU A OE1 1 
ATOM 447  O OE2 . GLU A 1 54  ? 61.442 36.327  21.789  1.00 30.83 ? 53  GLU A OE2 1 
ATOM 448  N N   . VAL A 1 55  ? 60.721 34.522  15.409  1.00 21.18 ? 54  VAL A N   1 
ATOM 449  C CA  . VAL A 1 55  ? 60.415 33.458  14.478  1.00 20.58 ? 54  VAL A CA  1 
ATOM 450  C C   . VAL A 1 55  ? 61.249 32.222  14.762  1.00 19.80 ? 54  VAL A C   1 
ATOM 451  O O   . VAL A 1 55  ? 62.366 32.320  15.131  1.00 20.22 ? 54  VAL A O   1 
ATOM 452  C CB  . VAL A 1 55  ? 60.537 33.946  13.004  1.00 20.23 ? 54  VAL A CB  1 
ATOM 453  C CG1 . VAL A 1 55  ? 59.977 32.903  12.037  1.00 19.08 ? 54  VAL A CG1 1 
ATOM 454  C CG2 . VAL A 1 55  ? 59.795 35.198  12.839  1.00 19.77 ? 54  VAL A CG2 1 
ATOM 455  N N   . TYR A 1 56  ? 60.682 31.061  14.534  1.00 19.92 ? 55  TYR A N   1 
ATOM 456  C CA  . TYR A 1 56  ? 61.342 29.804  14.755  1.00 20.72 ? 55  TYR A CA  1 
ATOM 457  C C   . TYR A 1 56  ? 61.244 28.968  13.493  1.00 20.73 ? 55  TYR A C   1 
ATOM 458  O O   . TYR A 1 56  ? 60.312 28.164  13.400  1.00 20.61 ? 55  TYR A O   1 
ATOM 459  C CB  . TYR A 1 56  ? 60.635 29.056  15.896  1.00 20.83 ? 55  TYR A CB  1 
ATOM 460  C CG  . TYR A 1 56  ? 60.813 29.669  17.289  1.00 23.62 ? 55  TYR A CG  1 
ATOM 461  C CD1 . TYR A 1 56  ? 59.772 30.364  17.914  1.00 25.67 ? 55  TYR A CD1 1 
ATOM 462  C CD2 . TYR A 1 56  ? 62.019 29.529  17.991  1.00 25.14 ? 55  TYR A CD2 1 
ATOM 463  C CE1 . TYR A 1 56  ? 59.957 30.923  19.205  1.00 27.18 ? 55  TYR A CE1 1 
ATOM 464  C CE2 . TYR A 1 56  ? 62.195 30.053  19.257  1.00 25.60 ? 55  TYR A CE2 1 
ATOM 465  C CZ  . TYR A 1 56  ? 61.178 30.744  19.862  1.00 26.74 ? 55  TYR A CZ  1 
ATOM 466  O OH  . TYR A 1 56  ? 61.411 31.275  21.108  1.00 27.50 ? 55  TYR A OH  1 
ATOM 467  N N   . ALA A 1 57  ? 62.197 29.102  12.549  1.00 20.80 ? 56  ALA A N   1 
ATOM 468  C CA  . ALA A 1 57  ? 62.028 28.513  11.203  1.00 20.87 ? 56  ALA A CA  1 
ATOM 469  C C   . ALA A 1 57  ? 62.638 27.161  11.097  1.00 20.82 ? 56  ALA A C   1 
ATOM 470  O O   . ALA A 1 57  ? 63.668 26.917  11.679  1.00 21.93 ? 56  ALA A O   1 
ATOM 471  C CB  . ALA A 1 57  ? 62.612 29.400  10.156  1.00 21.25 ? 56  ALA A CB  1 
ATOM 472  N N   . VAL A 1 58  ? 61.992 26.273  10.361  1.00 21.33 ? 57  VAL A N   1 
ATOM 473  C CA  . VAL A 1 58  ? 62.570 24.978  9.994   1.00 22.00 ? 57  VAL A CA  1 
ATOM 474  C C   . VAL A 1 58  ? 62.455 24.867  8.457   1.00 22.57 ? 57  VAL A C   1 
ATOM 475  O O   . VAL A 1 58  ? 61.493 24.363  7.890   1.00 22.79 ? 57  VAL A O   1 
ATOM 476  C CB  . VAL A 1 58  ? 61.909 23.827  10.723  1.00 22.48 ? 57  VAL A CB  1 
ATOM 477  C CG1 . VAL A 1 58  ? 62.660 22.560  10.537  1.00 22.94 ? 57  VAL A CG1 1 
ATOM 478  C CG2 . VAL A 1 58  ? 61.756 24.144  12.234  1.00 23.40 ? 57  VAL A CG2 1 
ATOM 479  N N   . GLU A 1 59  ? 63.503 25.356  7.810   1.00 23.53 ? 58  GLU A N   1 
ATOM 480  C CA  . GLU A 1 59  ? 63.576 25.508  6.403   1.00 24.16 ? 58  GLU A CA  1 
ATOM 481  C C   . GLU A 1 59  ? 64.545 24.524  5.821   1.00 24.73 ? 58  GLU A C   1 
ATOM 482  O O   . GLU A 1 59  ? 65.585 24.234  6.376   1.00 25.28 ? 58  GLU A O   1 
ATOM 483  C CB  . GLU A 1 59  ? 64.053 26.901  6.045   1.00 24.82 ? 58  GLU A CB  1 
ATOM 484  C CG  . GLU A 1 59  ? 63.740 28.016  7.048   1.00 25.94 ? 58  GLU A CG  1 
ATOM 485  C CD  . GLU A 1 59  ? 64.544 29.284  6.726   1.00 28.69 ? 58  GLU A CD  1 
ATOM 486  O OE1 . GLU A 1 59  ? 65.452 29.628  7.539   1.00 29.97 ? 58  GLU A OE1 1 
ATOM 487  O OE2 . GLU A 1 59  ? 64.287 29.909  5.663   1.00 26.75 ? 58  GLU A OE2 1 
ATOM 488  N N   . GLN A 1 60  ? 64.189 24.039  4.650   1.00 25.99 ? 59  GLN A N   1 
ATOM 489  C CA  . GLN A 1 60  ? 64.999 23.124  3.890   1.00 26.41 ? 59  GLN A CA  1 
ATOM 490  C C   . GLN A 1 60  ? 65.851 23.864  2.853   1.00 26.09 ? 59  GLN A C   1 
ATOM 491  O O   . GLN A 1 60  ? 66.087 25.046  2.932   1.00 24.92 ? 59  GLN A O   1 
ATOM 492  C CB  . GLN A 1 60  ? 64.051 22.124  3.209   1.00 26.90 ? 59  GLN A CB  1 
ATOM 493  C CG  . GLN A 1 60  ? 63.169 21.409  4.188   1.00 27.16 ? 59  GLN A CG  1 
ATOM 494  C CD  . GLN A 1 60  ? 63.972 20.586  5.129   1.00 26.89 ? 59  GLN A CD  1 
ATOM 495  O OE1 . GLN A 1 60  ? 64.987 20.026  4.735   1.00 27.36 ? 59  GLN A OE1 1 
ATOM 496  N NE2 . GLN A 1 60  ? 63.562 20.536  6.379   1.00 29.04 ? 59  GLN A NE2 1 
ATOM 497  N N   . GLU A 1 61  ? 66.452 23.037  2.020   1.00 26.84 ? 60  GLU A N   1 
ATOM 498  C CA  . GLU A 1 61  ? 67.037 23.631  0.811   1.00 27.67 ? 60  GLU A CA  1 
ATOM 499  C C   . GLU A 1 61  ? 65.935 23.870  -0.229  1.00 27.24 ? 60  GLU A C   1 
ATOM 500  O O   . GLU A 1 61  ? 64.897 23.189  -0.228  1.00 27.23 ? 60  GLU A O   1 
ATOM 501  C CB  . GLU A 1 61  ? 68.105 22.683  0.222   1.00 27.78 ? 60  GLU A CB  1 
ATOM 502  C CG  . GLU A 1 61  ? 68.382 21.455  1.112   1.00 31.18 ? 60  GLU A CG  1 
ATOM 503  C CD  . GLU A 1 61  ? 69.685 20.706  0.757   1.00 38.32 ? 60  GLU A CD  1 
ATOM 504  O OE1 . GLU A 1 61  ? 70.832 21.187  1.108   1.00 42.57 ? 60  GLU A OE1 1 
ATOM 505  O OE2 . GLU A 1 61  ? 69.639 19.589  0.108   1.00 36.35 ? 60  GLU A OE2 1 
ATOM 506  N N   . GLU A 1 62  ? 65.868 25.148  -0.792  1.00 25.99 ? 61  GLU A N   1 
ATOM 507  C CA  . GLU A 1 62  ? 64.846 25.721  -1.689  1.00 25.12 ? 61  GLU A CA  1 
ATOM 508  C C   . GLU A 1 62  ? 64.458 24.973  -2.968  1.00 24.16 ? 61  GLU A C   1 
ATOM 509  O O   . GLU A 1 62  ? 64.532 25.566  -4.037  1.00 25.37 ? 61  GLU A O   1 
ATOM 510  C CB  . GLU A 1 62  ? 65.303 27.147  -2.194  1.00 25.11 ? 61  GLU A CB  1 
ATOM 511  C CG  . GLU A 1 62  ? 65.921 28.081  -1.134  1.00 24.42 ? 61  GLU A CG  1 
ATOM 512  C CD  . GLU A 1 62  ? 67.431 27.999  -1.063  1.00 20.64 ? 61  GLU A CD  1 
ATOM 513  O OE1 . GLU A 1 62  ? 67.988 27.709  0.005   1.00 17.63 ? 61  GLU A OE1 1 
ATOM 514  O OE2 . GLU A 1 62  ? 68.058 28.209  -2.107  1.00 20.65 ? 61  GLU A OE2 1 
ATOM 515  N N   . LYS A 1 63  ? 63.956 23.748  -2.892  1.00 23.60 ? 62  LYS A N   1 
ATOM 516  C CA  . LYS A 1 63  ? 63.507 22.992  -4.106  1.00 23.24 ? 62  LYS A CA  1 
ATOM 517  C C   . LYS A 1 63  ? 61.994 23.092  -4.418  1.00 23.44 ? 62  LYS A C   1 
ATOM 518  O O   . LYS A 1 63  ? 61.139 23.262  -3.503  1.00 23.74 ? 62  LYS A O   1 
ATOM 519  C CB  . LYS A 1 63  ? 63.880 21.500  -3.961  1.00 22.74 ? 62  LYS A CB  1 
ATOM 520  C CG  . LYS A 1 63  ? 63.885 20.688  -5.256  1.00 21.06 ? 62  LYS A CG  1 
ATOM 521  C CD  . LYS A 1 63  ? 64.732 19.457  -5.129  1.00 17.68 ? 62  LYS A CD  1 
ATOM 522  C CE  . LYS A 1 63  ? 64.369 18.384  -6.081  1.00 19.46 ? 62  LYS A CE  1 
ATOM 523  N NZ  . LYS A 1 63  ? 65.120 17.104  -5.757  1.00 19.86 ? 62  LYS A NZ  1 
ATOM 524  N N   . GLU A 1 64  ? 61.635 22.950  -5.692  1.00 23.40 ? 63  GLU A N   1 
ATOM 525  C CA  . GLU A 1 64  ? 60.211 22.896  -6.025  1.00 23.23 ? 63  GLU A CA  1 
ATOM 526  C C   . GLU A 1 64  ? 59.681 21.637  -5.397  1.00 21.87 ? 63  GLU A C   1 
ATOM 527  O O   . GLU A 1 64  ? 60.324 20.618  -5.442  1.00 21.17 ? 63  GLU A O   1 
ATOM 528  C CB  . GLU A 1 64  ? 59.926 22.939  -7.537  1.00 24.14 ? 63  GLU A CB  1 
ATOM 529  C CG  . GLU A 1 64  ? 58.570 22.297  -7.923  1.00 27.78 ? 63  GLU A CG  1 
ATOM 530  C CD  . GLU A 1 64  ? 58.211 22.294  -9.437  1.00 31.72 ? 63  GLU A CD  1 
ATOM 531  O OE1 . GLU A 1 64  ? 57.647 23.327  -9.890  1.00 28.74 ? 63  GLU A OE1 1 
ATOM 532  O OE2 . GLU A 1 64  ? 58.447 21.220  -10.139 1.00 33.10 ? 63  GLU A OE2 1 
ATOM 533  N N   . GLY A 1 65  ? 58.499 21.733  -4.788  1.00 21.74 ? 64  GLY A N   1 
ATOM 534  C CA  . GLY A 1 65  ? 57.829 20.615  -4.141  1.00 20.98 ? 64  GLY A CA  1 
ATOM 535  C C   . GLY A 1 65  ? 58.033 20.549  -2.626  1.00 20.50 ? 64  GLY A C   1 
ATOM 536  O O   . GLY A 1 65  ? 57.194 20.041  -1.920  1.00 21.04 ? 64  GLY A O   1 
ATOM 537  N N   . ASP A 1 66  ? 59.139 21.067  -2.117  1.00 19.25 ? 65  ASP A N   1 
ATOM 538  C CA  . ASP A 1 66  ? 59.497 20.900  -0.718  1.00 18.39 ? 65  ASP A CA  1 
ATOM 539  C C   . ASP A 1 66  ? 58.817 21.989  0.174   1.00 17.49 ? 65  ASP A C   1 
ATOM 540  O O   . ASP A 1 66  ? 58.450 23.061  -0.280  1.00 17.08 ? 65  ASP A O   1 
ATOM 541  C CB  . ASP A 1 66  ? 61.047 20.982  -0.648  1.00 18.81 ? 65  ASP A CB  1 
ATOM 542  C CG  . ASP A 1 66  ? 61.647 20.288  0.562   1.00 19.18 ? 65  ASP A CG  1 
ATOM 543  O OD1 . ASP A 1 66  ? 60.907 19.792  1.485   1.00 17.05 ? 65  ASP A OD1 1 
ATOM 544  O OD2 . ASP A 1 66  ? 62.897 20.241  0.657   1.00 18.25 ? 65  ASP A OD2 1 
ATOM 545  N N   . LEU A 1 67  ? 58.690 21.722  1.457   1.00 16.71 ? 66  LEU A N   1 
ATOM 546  C CA  . LEU A 1 67  ? 57.998 22.631  2.354   1.00 16.34 ? 66  LEU A CA  1 
ATOM 547  C C   . LEU A 1 67  ? 58.911 23.089  3.494   1.00 15.55 ? 66  LEU A C   1 
ATOM 548  O O   . LEU A 1 67  ? 59.648 22.290  4.025   1.00 16.13 ? 66  LEU A O   1 
ATOM 549  C CB  . LEU A 1 67  ? 56.730 21.939  2.902   1.00 16.30 ? 66  LEU A CB  1 
ATOM 550  C CG  . LEU A 1 67  ? 55.720 21.549  1.832   1.00 15.35 ? 66  LEU A CG  1 
ATOM 551  C CD1 . LEU A 1 67  ? 54.622 20.785  2.429   1.00 18.08 ? 66  LEU A CD1 1 
ATOM 552  C CD2 . LEU A 1 67  ? 55.161 22.732  1.197   1.00 15.14 ? 66  LEU A CD2 1 
ATOM 553  N N   . ASN A 1 68  ? 58.877 24.387  3.803   1.00 14.98 ? 67  ASN A N   1 
ATOM 554  C CA  . ASN A 1 68  ? 59.386 24.989  5.036   1.00 14.52 ? 67  ASN A CA  1 
ATOM 555  C C   . ASN A 1 68  ? 58.235 25.192  6.036   1.00 14.85 ? 67  ASN A C   1 
ATOM 556  O O   . ASN A 1 68  ? 57.115 25.480  5.610   1.00 14.90 ? 67  ASN A O   1 
ATOM 557  C CB  . ASN A 1 68  ? 59.907 26.370  4.741   1.00 14.25 ? 67  ASN A CB  1 
ATOM 558  C CG  . ASN A 1 68  ? 61.053 26.379  3.777   1.00 15.14 ? 67  ASN A CG  1 
ATOM 559  O OD1 . ASN A 1 68  ? 61.722 25.353  3.548   1.00 16.94 ? 67  ASN A OD1 1 
ATOM 560  N ND2 . ASN A 1 68  ? 61.292 27.552  3.178   1.00 12.28 ? 67  ASN A ND2 1 
ATOM 561  N N   . PHE A 1 69  ? 58.495 25.104  7.343   1.00 14.85 ? 68  PHE A N   1 
ATOM 562  C CA  . PHE A 1 69  ? 57.548 25.671  8.321   1.00 15.81 ? 68  PHE A CA  1 
ATOM 563  C C   . PHE A 1 69  ? 58.141 26.665  9.336   1.00 16.14 ? 68  PHE A C   1 
ATOM 564  O O   . PHE A 1 69  ? 59.342 26.749  9.518   1.00 16.54 ? 68  PHE A O   1 
ATOM 565  C CB  . PHE A 1 69  ? 56.756 24.572  9.031   1.00 16.09 ? 68  PHE A CB  1 
ATOM 566  C CG  . PHE A 1 69  ? 57.613 23.570  9.789   1.00 15.73 ? 68  PHE A CG  1 
ATOM 567  C CD1 . PHE A 1 69  ? 57.828 23.716  11.136  1.00 18.56 ? 68  PHE A CD1 1 
ATOM 568  C CD2 . PHE A 1 69  ? 58.103 22.465  9.171   1.00 16.08 ? 68  PHE A CD2 1 
ATOM 569  C CE1 . PHE A 1 69  ? 58.568 22.815  11.852  1.00 19.33 ? 68  PHE A CE1 1 
ATOM 570  C CE2 . PHE A 1 69  ? 58.852 21.571  9.841   1.00 18.76 ? 68  PHE A CE2 1 
ATOM 571  C CZ  . PHE A 1 69  ? 59.098 21.739  11.194  1.00 20.67 ? 68  PHE A CZ  1 
ATOM 572  N N   . ALA A 1 70  ? 57.283 27.386  10.040  1.00 16.60 ? 69  ALA A N   1 
ATOM 573  C CA  . ALA A 1 70  ? 57.737 28.472  10.925  1.00 16.90 ? 69  ALA A CA  1 
ATOM 574  C C   . ALA A 1 70  ? 56.695 28.845  12.008  1.00 16.94 ? 69  ALA A C   1 
ATOM 575  O O   . ALA A 1 70  ? 55.537 29.118  11.670  1.00 17.68 ? 69  ALA A O   1 
ATOM 576  C CB  . ALA A 1 70  ? 57.980 29.679  10.049  1.00 16.92 ? 69  ALA A CB  1 
ATOM 577  N N   . THR A 1 71  ? 57.069 28.904  13.283  1.00 16.43 ? 70  THR A N   1 
ATOM 578  C CA  . THR A 1 71  ? 56.171 29.567  14.262  1.00 16.28 ? 70  THR A CA  1 
ATOM 579  C C   . THR A 1 71  ? 56.604 31.013  14.500  1.00 17.22 ? 70  THR A C   1 
ATOM 580  O O   . THR A 1 71  ? 57.785 31.329  14.434  1.00 17.78 ? 70  THR A O   1 
ATOM 581  C CB  . THR A 1 71  ? 56.063 28.876  15.620  1.00 15.32 ? 70  THR A CB  1 
ATOM 582  O OG1 . THR A 1 71  ? 57.360 28.728  16.181  1.00 16.36 ? 70  THR A OG1 1 
ATOM 583  C CG2 . THR A 1 71  ? 55.519 27.500  15.525  1.00 14.45 ? 70  THR A CG2 1 
ATOM 584  N N   . THR A 1 72  ? 55.632 31.901  14.738  1.00 17.74 ? 71  THR A N   1 
ATOM 585  C CA  . THR A 1 72  ? 55.910 33.265  15.105  1.00 17.61 ? 71  THR A CA  1 
ATOM 586  C C   . THR A 1 72  ? 55.177 33.584  16.393  1.00 18.07 ? 71  THR A C   1 
ATOM 587  O O   . THR A 1 72  ? 54.042 33.322  16.509  1.00 17.47 ? 71  THR A O   1 
ATOM 588  C CB  . THR A 1 72  ? 55.436 34.207  14.035  1.00 17.40 ? 71  THR A CB  1 
ATOM 589  O OG1 . THR A 1 72  ? 56.165 33.971  12.803  1.00 18.59 ? 71  THR A OG1 1 
ATOM 590  C CG2 . THR A 1 72  ? 55.779 35.684  14.407  1.00 17.61 ? 71  THR A CG2 1 
ATOM 591  N N   . VAL A 1 73  ? 55.886 34.153  17.364  1.00 19.04 ? 72  VAL A N   1 
ATOM 592  C CA  . VAL A 1 73  ? 55.291 34.864  18.478  1.00 18.34 ? 72  VAL A CA  1 
ATOM 593  C C   . VAL A 1 73  ? 55.320 36.300  18.095  1.00 17.80 ? 72  VAL A C   1 
ATOM 594  O O   . VAL A 1 73  ? 56.384 36.891  17.992  1.00 18.47 ? 72  VAL A O   1 
ATOM 595  C CB  . VAL A 1 73  ? 56.138 34.693  19.806  1.00 18.96 ? 72  VAL A CB  1 
ATOM 596  C CG1 . VAL A 1 73  ? 55.344 35.216  21.041  1.00 19.24 ? 72  VAL A CG1 1 
ATOM 597  C CG2 . VAL A 1 73  ? 56.530 33.233  20.019  1.00 18.59 ? 72  VAL A CG2 1 
ATOM 598  N N   . LEU A 1 74  ? 54.161 36.866  17.850  1.00 17.85 ? 73  LEU A N   1 
ATOM 599  C CA  . LEU A 1 74  ? 54.000 38.307  17.559  1.00 18.00 ? 73  LEU A CA  1 
ATOM 600  C C   . LEU A 1 74  ? 53.473 39.035  18.854  1.00 18.67 ? 73  LEU A C   1 
ATOM 601  O O   . LEU A 1 74  ? 52.293 38.877  19.265  1.00 19.28 ? 73  LEU A O   1 
ATOM 602  C CB  . LEU A 1 74  ? 52.979 38.448  16.409  1.00 17.66 ? 73  LEU A CB  1 
ATOM 603  C CG  . LEU A 1 74  ? 53.037 39.540  15.362  1.00 17.98 ? 73  LEU A CG  1 
ATOM 604  C CD1 . LEU A 1 74  ? 51.623 39.917  14.891  1.00 16.66 ? 73  LEU A CD1 1 
ATOM 605  C CD2 . LEU A 1 74  ? 53.821 40.725  15.833  1.00 18.56 ? 73  LEU A CD2 1 
ATOM 606  N N   . TYR A 1 75  ? 54.319 39.803  19.521  1.00 18.40 ? 74  TYR A N   1 
ATOM 607  C CA  . TYR A 1 75  ? 53.909 40.394  20.792  1.00 18.55 ? 74  TYR A CA  1 
ATOM 608  C C   . TYR A 1 75  ? 52.893 41.509  20.614  1.00 18.40 ? 74  TYR A C   1 
ATOM 609  O O   . TYR A 1 75  ? 52.855 42.161  19.590  1.00 18.94 ? 74  TYR A O   1 
ATOM 610  C CB  . TYR A 1 75  ? 55.134 40.880  21.569  1.00 18.52 ? 74  TYR A CB  1 
ATOM 611  C CG  . TYR A 1 75  ? 56.042 39.711  22.011  1.00 20.59 ? 74  TYR A CG  1 
ATOM 612  C CD1 . TYR A 1 75  ? 56.044 39.253  23.325  1.00 21.52 ? 74  TYR A CD1 1 
ATOM 613  C CD2 . TYR A 1 75  ? 56.863 39.060  21.105  1.00 20.00 ? 74  TYR A CD2 1 
ATOM 614  C CE1 . TYR A 1 75  ? 56.863 38.230  23.724  1.00 21.94 ? 74  TYR A CE1 1 
ATOM 615  C CE2 . TYR A 1 75  ? 57.687 38.020  21.498  1.00 21.61 ? 74  TYR A CE2 1 
ATOM 616  C CZ  . TYR A 1 75  ? 57.688 37.606  22.799  1.00 21.77 ? 74  TYR A CZ  1 
ATOM 617  O OH  . TYR A 1 75  ? 58.505 36.558  23.154  1.00 19.79 ? 74  TYR A OH  1 
ATOM 618  N N   . PRO A 1 76  ? 52.107 41.781  21.650  1.00 18.23 ? 75  PRO A N   1 
ATOM 619  C CA  . PRO A 1 76  ? 51.125 42.843  21.594  1.00 17.71 ? 75  PRO A CA  1 
ATOM 620  C C   . PRO A 1 76  ? 51.775 44.244  21.654  1.00 17.20 ? 75  PRO A C   1 
ATOM 621  O O   . PRO A 1 76  ? 52.817 44.426  22.263  1.00 16.61 ? 75  PRO A O   1 
ATOM 622  C CB  . PRO A 1 76  ? 50.289 42.560  22.831  1.00 17.05 ? 75  PRO A CB  1 
ATOM 623  C CG  . PRO A 1 76  ? 51.243 42.072  23.754  1.00 17.68 ? 75  PRO A CG  1 
ATOM 624  C CD  . PRO A 1 76  ? 52.123 41.165  22.985  1.00 18.73 ? 75  PRO A CD  1 
ATOM 625  N N   . GLY A 1 77  ? 51.129 45.224  21.043  1.00 17.02 ? 76  GLY A N   1 
ATOM 626  C CA  . GLY A 1 77  ? 51.603 46.576  21.163  1.00 17.07 ? 76  GLY A CA  1 
ATOM 627  C C   . GLY A 1 77  ? 51.009 47.462  20.107  1.00 17.37 ? 76  GLY A C   1 
ATOM 628  O O   . GLY A 1 77  ? 50.179 47.049  19.289  1.00 17.11 ? 76  GLY A O   1 
ATOM 629  N N   . LYS A 1 78  ? 51.441 48.706  20.161  1.00 17.89 ? 77  LYS A N   1 
ATOM 630  C CA  . LYS A 1 78  ? 51.025 49.726  19.228  1.00 18.35 ? 77  LYS A CA  1 
ATOM 631  C C   . LYS A 1 78  ? 52.151 50.663  19.026  1.00 18.73 ? 77  LYS A C   1 
ATOM 632  O O   . LYS A 1 78  ? 53.007 50.852  19.931  1.00 19.42 ? 77  LYS A O   1 
ATOM 633  C CB  . LYS A 1 78  ? 49.831 50.525  19.756  1.00 18.86 ? 77  LYS A CB  1 
ATOM 634  C CG  . LYS A 1 78  ? 48.470 49.888  19.453  1.00 19.71 ? 77  LYS A CG  1 
ATOM 635  C CD  . LYS A 1 78  ? 47.546 49.848  20.639  1.00 21.64 ? 77  LYS A CD  1 
ATOM 636  C CE  . LYS A 1 78  ? 46.264 50.571  20.320  1.00 23.72 ? 77  LYS A CE  1 
ATOM 637  N NZ  . LYS A 1 78  ? 46.489 52.029  20.042  1.00 26.75 ? 77  LYS A NZ  1 
ATOM 638  N N   . VAL A 1 79  ? 52.169 51.164  17.896  1.00 18.93 ? 78  VAL A N   1 
ATOM 639  C CA  . VAL A 1 79  ? 53.032 52.255  17.436  1.00 19.36 ? 78  VAL A CA  1 
ATOM 640  C C   . VAL A 1 79  ? 52.173 53.408  16.931  1.00 20.02 ? 78  VAL A C   1 
ATOM 641  O O   . VAL A 1 79  ? 51.585 53.333  15.846  1.00 20.70 ? 78  VAL A O   1 
ATOM 642  C CB  . VAL A 1 79  ? 53.930 51.753  16.305  1.00 19.21 ? 78  VAL A CB  1 
ATOM 643  C CG1 . VAL A 1 79  ? 54.948 52.795  15.834  1.00 17.82 ? 78  VAL A CG1 1 
ATOM 644  C CG2 . VAL A 1 79  ? 54.746 50.523  16.703  1.00 19.82 ? 78  VAL A CG2 1 
ATOM 645  N N   . GLY A 1 80  ? 51.841 54.241  17.915  1.00 20.30 ? 79  GLY A N   1 
ATOM 646  C CA  . GLY A 1 80  ? 50.819 55.221  17.710  1.00 20.71 ? 79  GLY A CA  1 
ATOM 647  C C   . GLY A 1 80  ? 49.486 54.542  17.968  1.00 22.01 ? 79  GLY A C   1 
ATOM 648  O O   . GLY A 1 80  ? 49.213 54.099  19.106  1.00 21.97 ? 79  GLY A O   1 
ATOM 649  N N   . LYS A 1 81  ? 48.672 54.460  16.907  1.00 22.61 ? 80  LYS A N   1 
ATOM 650  C CA  . LYS A 1 81  ? 47.372 53.804  16.924  1.00 22.86 ? 80  LYS A CA  1 
ATOM 651  C C   . LYS A 1 81  ? 47.429 52.505  16.181  1.00 22.69 ? 80  LYS A C   1 
ATOM 652  O O   . LYS A 1 81  ? 46.463 51.775  16.165  1.00 23.72 ? 80  LYS A O   1 
ATOM 653  C CB  . LYS A 1 81  ? 46.321 54.669  16.224  1.00 23.56 ? 80  LYS A CB  1 
ATOM 654  C CG  . LYS A 1 81  ? 46.194 56.076  16.841  1.00 26.19 ? 80  LYS A CG  1 
ATOM 655  C CD  . LYS A 1 81  ? 44.972 56.841  16.322  1.00 27.47 ? 80  LYS A CD  1 
ATOM 656  C CE  . LYS A 1 81  ? 44.977 58.257  16.883  1.00 28.30 ? 80  LYS A CE  1 
ATOM 657  N NZ  . LYS A 1 81  ? 44.123 58.299  18.103  1.00 30.60 ? 80  LYS A NZ  1 
ATOM 658  N N   . GLU A 1 82  ? 48.542 52.207  15.544  1.00 22.44 ? 81  GLU A N   1 
ATOM 659  C CA  . GLU A 1 82  ? 48.616 51.063  14.651  1.00 22.23 ? 81  GLU A CA  1 
ATOM 660  C C   . GLU A 1 82  ? 49.170 49.851  15.413  1.00 21.71 ? 81  GLU A C   1 
ATOM 661  O O   . GLU A 1 82  ? 50.136 49.938  16.181  1.00 21.38 ? 81  GLU A O   1 
ATOM 662  C CB  . GLU A 1 82  ? 49.484 51.450  13.437  1.00 22.24 ? 81  GLU A CB  1 
ATOM 663  C CG  . GLU A 1 82  ? 49.752 50.365  12.435  1.00 23.14 ? 81  GLU A CG  1 
ATOM 664  C CD  . GLU A 1 82  ? 50.454 50.890  11.212  1.00 23.61 ? 81  GLU A CD  1 
ATOM 665  O OE1 . GLU A 1 82  ? 51.344 51.728  11.405  1.00 24.05 ? 81  GLU A OE1 1 
ATOM 666  O OE2 . GLU A 1 82  ? 50.151 50.429  10.073  1.00 25.10 ? 81  GLU A OE2 1 
ATOM 667  N N   . PHE A 1 83  ? 48.565 48.712  15.146  1.00 21.34 ? 82  PHE A N   1 
ATOM 668  C CA  . PHE A 1 83  ? 48.908 47.468  15.809  1.00 20.98 ? 82  PHE A CA  1 
ATOM 669  C C   . PHE A 1 83  ? 50.209 46.825  15.303  1.00 20.78 ? 82  PHE A C   1 
ATOM 670  O O   . PHE A 1 83  ? 50.547 46.925  14.137  1.00 20.46 ? 82  PHE A O   1 
ATOM 671  C CB  . PHE A 1 83  ? 47.779 46.485  15.630  1.00 20.45 ? 82  PHE A CB  1 
ATOM 672  C CG  . PHE A 1 83  ? 46.654 46.690  16.570  1.00 19.83 ? 82  PHE A CG  1 
ATOM 673  C CD1 . PHE A 1 83  ? 45.364 46.999  16.094  1.00 19.66 ? 82  PHE A CD1 1 
ATOM 674  C CD2 . PHE A 1 83  ? 46.855 46.517  17.949  1.00 19.43 ? 82  PHE A CD2 1 
ATOM 675  C CE1 . PHE A 1 83  ? 44.300 47.143  16.989  1.00 19.14 ? 82  PHE A CE1 1 
ATOM 676  C CE2 . PHE A 1 83  ? 45.794 46.661  18.863  1.00 16.89 ? 82  PHE A CE2 1 
ATOM 677  C CZ  . PHE A 1 83  ? 44.547 46.977  18.404  1.00 18.84 ? 82  PHE A CZ  1 
ATOM 678  N N   . PHE A 1 84  ? 50.917 46.195  16.237  1.00 20.82 ? 83  PHE A N   1 
ATOM 679  C CA  . PHE A 1 84  ? 52.155 45.516  15.990  1.00 21.06 ? 83  PHE A CA  1 
ATOM 680  C C   . PHE A 1 84  ? 51.897 44.476  14.891  1.00 22.09 ? 83  PHE A C   1 
ATOM 681  O O   . PHE A 1 84  ? 50.831 43.863  14.852  1.00 22.54 ? 83  PHE A O   1 
ATOM 682  C CB  . PHE A 1 84  ? 52.628 44.797  17.256  1.00 20.98 ? 83  PHE A CB  1 
ATOM 683  C CG  . PHE A 1 84  ? 53.500 45.608  18.156  1.00 19.76 ? 83  PHE A CG  1 
ATOM 684  C CD1 . PHE A 1 84  ? 53.569 46.979  18.046  1.00 19.25 ? 83  PHE A CD1 1 
ATOM 685  C CD2 . PHE A 1 84  ? 54.251 44.965  19.148  1.00 18.66 ? 83  PHE A CD2 1 
ATOM 686  C CE1 . PHE A 1 84  ? 54.391 47.709  18.881  1.00 18.64 ? 83  PHE A CE1 1 
ATOM 687  C CE2 . PHE A 1 84  ? 55.047 45.690  20.004  1.00 19.70 ? 83  PHE A CE2 1 
ATOM 688  C CZ  . PHE A 1 84  ? 55.124 47.070  19.863  1.00 20.00 ? 83  PHE A CZ  1 
ATOM 689  N N   . PHE A 1 85  ? 52.873 44.281  14.000  1.00 22.50 ? 84  PHE A N   1 
ATOM 690  C CA  . PHE A 1 85  ? 52.734 43.289  12.948  1.00 22.21 ? 84  PHE A CA  1 
ATOM 691  C C   . PHE A 1 85  ? 54.069 42.768  12.483  1.00 21.68 ? 84  PHE A C   1 
ATOM 692  O O   . PHE A 1 85  ? 55.092 43.324  12.813  1.00 21.37 ? 84  PHE A O   1 
ATOM 693  C CB  . PHE A 1 85  ? 51.945 43.881  11.770  1.00 22.40 ? 84  PHE A CB  1 
ATOM 694  C CG  . PHE A 1 85  ? 52.454 45.229  11.252  1.00 21.96 ? 84  PHE A CG  1 
ATOM 695  C CD1 . PHE A 1 85  ? 53.746 45.402  10.741  1.00 22.18 ? 84  PHE A CD1 1 
ATOM 696  C CD2 . PHE A 1 85  ? 51.577 46.310  11.182  1.00 24.41 ? 84  PHE A CD2 1 
ATOM 697  C CE1 . PHE A 1 85  ? 54.178 46.656  10.196  1.00 20.54 ? 84  PHE A CE1 1 
ATOM 698  C CE2 . PHE A 1 85  ? 51.993 47.571  10.644  1.00 22.34 ? 84  PHE A CE2 1 
ATOM 699  C CZ  . PHE A 1 85  ? 53.300 47.726  10.158  1.00 20.12 ? 84  PHE A CZ  1 
ATOM 700  N N   . THR A 1 86  ? 54.042 41.721  11.682  1.00 21.84 ? 85  THR A N   1 
ATOM 701  C CA  . THR A 1 86  ? 55.258 41.223  11.033  1.00 22.62 ? 85  THR A CA  1 
ATOM 702  C C   . THR A 1 86  ? 55.605 42.078  9.845   1.00 23.29 ? 85  THR A C   1 
ATOM 703  O O   . THR A 1 86  ? 54.802 42.916  9.431   1.00 22.76 ? 85  THR A O   1 
ATOM 704  C CB  . THR A 1 86  ? 55.083 39.780  10.602  1.00 22.74 ? 85  THR A CB  1 
ATOM 705  O OG1 . THR A 1 86  ? 53.840 39.640  9.899   1.00 23.47 ? 85  THR A OG1 1 
ATOM 706  C CG2 . THR A 1 86  ? 54.904 38.857  11.834  1.00 22.41 ? 85  THR A CG2 1 
ATOM 707  N N   . LYS A 1 87  ? 56.809 41.891  9.303   1.00 24.64 ? 86  LYS A N   1 
ATOM 708  C CA  . LYS A 1 87  ? 57.328 42.817  8.276   1.00 26.32 ? 86  LYS A CA  1 
ATOM 709  C C   . LYS A 1 87  ? 56.526 42.708  6.953   1.00 27.81 ? 86  LYS A C   1 
ATOM 710  O O   . LYS A 1 87  ? 56.326 43.692  6.216   1.00 27.58 ? 86  LYS A O   1 
ATOM 711  C CB  . LYS A 1 87  ? 58.823 42.591  8.012   1.00 26.13 ? 86  LYS A CB  1 
ATOM 712  C CG  . LYS A 1 87  ? 59.774 43.515  8.753   1.00 26.91 ? 86  LYS A CG  1 
ATOM 713  C CD  . LYS A 1 87  ? 61.145 42.826  9.076   1.00 29.03 ? 86  LYS A CD  1 
ATOM 714  C CE  . LYS A 1 87  ? 62.394 43.555  8.507   1.00 28.66 ? 86  LYS A CE  1 
ATOM 715  N NZ  . LYS A 1 87  ? 63.412 42.518  7.986   1.00 29.99 ? 86  LYS A NZ  1 
ATOM 716  N N   . GLY A 1 88  ? 56.074 41.494  6.669   1.00 29.41 ? 87  GLY A N   1 
ATOM 717  C CA  . GLY A 1 88  ? 55.239 41.231  5.519   1.00 30.67 ? 87  GLY A CA  1 
ATOM 718  C C   . GLY A 1 88  ? 56.005 40.491  4.441   1.00 32.37 ? 87  GLY A C   1 
ATOM 719  O O   . GLY A 1 88  ? 57.044 40.953  3.976   1.00 33.67 ? 87  GLY A O   1 
ATOM 720  N N   . HIS A 1 89  ? 55.489 39.339  4.040   1.00 33.62 ? 88  HIS A N   1 
ATOM 721  C CA  . HIS A 1 89  ? 56.101 38.556  3.009   1.00 34.50 ? 88  HIS A CA  1 
ATOM 722  C C   . HIS A 1 89  ? 55.426 38.937  1.680   1.00 34.55 ? 88  HIS A C   1 
ATOM 723  O O   . HIS A 1 89  ? 54.180 38.925  1.547   1.00 32.75 ? 88  HIS A O   1 
ATOM 724  C CB  . HIS A 1 89  ? 55.985 37.027  3.274   1.00 35.34 ? 88  HIS A CB  1 
ATOM 725  C CG  . HIS A 1 89  ? 56.180 36.606  4.715   1.00 39.32 ? 88  HIS A CG  1 
ATOM 726  N ND1 . HIS A 1 89  ? 55.936 37.441  5.798   1.00 43.24 ? 88  HIS A ND1 1 
ATOM 727  C CD2 . HIS A 1 89  ? 56.611 35.429  5.243   1.00 40.93 ? 88  HIS A CD2 1 
ATOM 728  C CE1 . HIS A 1 89  ? 56.216 36.805  6.923   1.00 43.17 ? 88  HIS A CE1 1 
ATOM 729  N NE2 . HIS A 1 89  ? 56.627 35.583  6.615   1.00 42.84 ? 88  HIS A NE2 1 
ATOM 730  N N   . PHE A 1 90  ? 56.270 39.282  0.705   1.00 34.95 ? 89  PHE A N   1 
ATOM 731  C CA  . PHE A 1 90  ? 55.885 39.205  -0.696  1.00 35.43 ? 89  PHE A CA  1 
ATOM 732  C C   . PHE A 1 90  ? 56.873 38.303  -1.448  1.00 34.54 ? 89  PHE A C   1 
ATOM 733  O O   . PHE A 1 90  ? 58.066 38.557  -1.397  1.00 34.30 ? 89  PHE A O   1 
ATOM 734  C CB  . PHE A 1 90  ? 55.800 40.606  -1.313  1.00 35.93 ? 89  PHE A CB  1 
ATOM 735  C CG  . PHE A 1 90  ? 54.574 40.808  -2.250  1.00 39.06 ? 89  PHE A CG  1 
ATOM 736  C CD1 . PHE A 1 90  ? 54.066 39.753  -3.045  1.00 40.24 ? 89  PHE A CD1 1 
ATOM 737  C CD2 . PHE A 1 90  ? 53.923 42.062  -2.315  1.00 40.18 ? 89  PHE A CD2 1 
ATOM 738  C CE1 . PHE A 1 90  ? 52.947 39.970  -3.879  1.00 41.50 ? 89  PHE A CE1 1 
ATOM 739  C CE2 . PHE A 1 90  ? 52.805 42.269  -3.148  1.00 40.40 ? 89  PHE A CE2 1 
ATOM 740  C CZ  . PHE A 1 90  ? 52.330 41.235  -3.930  1.00 41.37 ? 89  PHE A CZ  1 
ATOM 741  N N   . HIS A 1 91  ? 56.366 37.258  -2.129  1.00 33.84 ? 90  HIS A N   1 
ATOM 742  C CA  . HIS A 1 91  ? 57.215 36.174  -2.673  1.00 33.17 ? 90  HIS A CA  1 
ATOM 743  C C   . HIS A 1 91  ? 58.054 36.548  -3.921  1.00 32.61 ? 90  HIS A C   1 
ATOM 744  O O   . HIS A 1 91  ? 57.790 37.527  -4.612  1.00 33.17 ? 90  HIS A O   1 
ATOM 745  C CB  . HIS A 1 91  ? 56.371 34.944  -2.980  1.00 32.99 ? 90  HIS A CB  1 
ATOM 746  C CG  . HIS A 1 91  ? 55.830 34.249  -1.761  1.00 34.77 ? 90  HIS A CG  1 
ATOM 747  N ND1 . HIS A 1 91  ? 54.647 33.518  -1.786  1.00 35.43 ? 90  HIS A ND1 1 
ATOM 748  C CD2 . HIS A 1 91  ? 56.311 34.154  -0.489  1.00 34.72 ? 90  HIS A CD2 1 
ATOM 749  C CE1 . HIS A 1 91  ? 54.429 33.002  -0.582  1.00 35.97 ? 90  HIS A CE1 1 
ATOM 750  N NE2 . HIS A 1 91  ? 55.417 33.381  0.225   1.00 35.19 ? 90  HIS A NE2 1 
ATOM 751  N N   . ALA A 1 92  ? 59.093 35.771  -4.177  1.00 31.42 ? 91  ALA A N   1 
ATOM 752  C CA  . ALA A 1 92  ? 59.888 35.934  -5.365  1.00 30.60 ? 91  ALA A CA  1 
ATOM 753  C C   . ALA A 1 92  ? 59.203 35.195  -6.482  1.00 30.01 ? 91  ALA A C   1 
ATOM 754  O O   . ALA A 1 92  ? 59.083 35.732  -7.570  1.00 30.77 ? 91  ALA A O   1 
ATOM 755  C CB  . ALA A 1 92  ? 61.278 35.360  -5.135  1.00 30.94 ? 91  ALA A CB  1 
ATOM 756  N N   . LYS A 1 93  ? 58.813 33.939  -6.226  1.00 28.95 ? 92  LYS A N   1 
ATOM 757  C CA  . LYS A 1 93  ? 57.932 33.146  -7.118  1.00 27.90 ? 92  LYS A CA  1 
ATOM 758  C C   . LYS A 1 93  ? 56.506 33.388  -6.659  1.00 27.22 ? 92  LYS A C   1 
ATOM 759  O O   . LYS A 1 93  ? 56.115 32.932  -5.592  1.00 26.80 ? 92  LYS A O   1 
ATOM 760  C CB  . LYS A 1 93  ? 58.243 31.629  -7.082  1.00 27.37 ? 92  LYS A CB  1 
ATOM 761  C CG  . LYS A 1 93  ? 59.514 31.255  -7.842  1.00 27.27 ? 92  LYS A CG  1 
ATOM 762  C CD  . LYS A 1 93  ? 59.687 29.761  -8.022  1.00 27.95 ? 92  LYS A CD  1 
ATOM 763  C CE  . LYS A 1 93  ? 61.187 29.377  -8.229  1.00 28.23 ? 92  LYS A CE  1 
ATOM 764  N NZ  . LYS A 1 93  ? 61.546 27.952  -7.910  1.00 26.93 ? 92  LYS A NZ  1 
ATOM 765  N N   . LEU A 1 94  ? 55.734 34.102  -7.474  1.00 26.74 ? 93  LEU A N   1 
ATOM 766  C CA  . LEU A 1 94  ? 54.509 34.719  -6.998  1.00 26.43 ? 93  LEU A CA  1 
ATOM 767  C C   . LEU A 1 94  ? 53.384 33.744  -6.771  1.00 26.13 ? 93  LEU A C   1 
ATOM 768  O O   . LEU A 1 94  ? 52.590 33.930  -5.841  1.00 26.15 ? 93  LEU A O   1 
ATOM 769  C CB  . LEU A 1 94  ? 54.058 35.860  -7.928  1.00 26.65 ? 93  LEU A CB  1 
ATOM 770  C CG  . LEU A 1 94  ? 54.557 37.295  -7.589  1.00 26.71 ? 93  LEU A CG  1 
ATOM 771  C CD1 . LEU A 1 94  ? 53.741 38.392  -8.310  1.00 26.78 ? 93  LEU A CD1 1 
ATOM 772  C CD2 . LEU A 1 94  ? 54.571 37.593  -6.090  1.00 26.14 ? 93  LEU A CD2 1 
ATOM 773  N N   . ASP A 1 95  ? 53.311 32.691  -7.566  1.00 26.20 ? 94  ASP A N   1 
ATOM 774  C CA  . ASP A 1 95  ? 52.131 31.850  -7.495  1.00 26.90 ? 94  ASP A CA  1 
ATOM 775  C C   . ASP A 1 95  ? 52.240 30.674  -6.491  1.00 26.29 ? 94  ASP A C   1 
ATOM 776  O O   . ASP A 1 95  ? 51.511 29.658  -6.570  1.00 26.81 ? 94  ASP A O   1 
ATOM 777  C CB  . ASP A 1 95  ? 51.647 31.428  -8.894  1.00 27.14 ? 94  ASP A CB  1 
ATOM 778  C CG  . ASP A 1 95  ? 52.318 30.265  -9.346  1.00 27.89 ? 94  ASP A CG  1 
ATOM 779  O OD1 . ASP A 1 95  ? 51.904 29.702  -10.380 1.00 29.37 ? 94  ASP A OD1 1 
ATOM 780  O OD2 . ASP A 1 95  ? 53.287 29.850  -8.675  1.00 31.37 ? 94  ASP A OD2 1 
ATOM 781  N N   . ARG A 1 96  ? 53.075 30.870  -5.493  1.00 25.10 ? 95  ARG A N   1 
ATOM 782  C CA  . ARG A 1 96  ? 53.015 30.039  -4.319  1.00 24.26 ? 95  ARG A CA  1 
ATOM 783  C C   . ARG A 1 96  ? 51.791 30.416  -3.365  1.00 22.82 ? 95  ARG A C   1 
ATOM 784  O O   . ARG A 1 96  ? 51.477 31.578  -3.133  1.00 22.25 ? 95  ARG A O   1 
ATOM 785  C CB  . ARG A 1 96  ? 54.369 30.170  -3.620  1.00 24.20 ? 95  ARG A CB  1 
ATOM 786  C CG  . ARG A 1 96  ? 55.602 29.587  -4.360  1.00 26.03 ? 95  ARG A CG  1 
ATOM 787  C CD  . ARG A 1 96  ? 55.422 29.015  -5.810  1.00 27.22 ? 95  ARG A CD  1 
ATOM 788  N NE  . ARG A 1 96  ? 56.351 27.885  -6.144  1.00 25.58 ? 95  ARG A NE  1 
ATOM 789  C CZ  . ARG A 1 96  ? 56.441 27.318  -7.355  1.00 21.45 ? 95  ARG A CZ  1 
ATOM 790  N NH1 . ARG A 1 96  ? 55.699 27.747  -8.347  1.00 22.32 ? 95  ARG A NH1 1 
ATOM 791  N NH2 . ARG A 1 96  ? 57.267 26.330  -7.572  1.00 20.52 ? 95  ARG A NH2 1 
ATOM 792  N N   . ALA A 1 97  ? 51.129 29.406  -2.818  1.00 21.60 ? 96  ALA A N   1 
ATOM 793  C CA  . ALA A 1 97  ? 50.277 29.529  -1.628  1.00 20.84 ? 96  ALA A CA  1 
ATOM 794  C C   . ALA A 1 97  ? 51.048 29.347  -0.268  1.00 20.29 ? 96  ALA A C   1 
ATOM 795  O O   . ALA A 1 97  ? 52.239 29.062  -0.236  1.00 19.59 ? 96  ALA A O   1 
ATOM 796  C CB  . ALA A 1 97  ? 49.169 28.529  -1.726  1.00 20.74 ? 96  ALA A CB  1 
ATOM 797  N N   . GLU A 1 98  ? 50.359 29.606  0.845   1.00 20.04 ? 97  GLU A N   1 
ATOM 798  C CA  . GLU A 1 98  ? 50.903 29.452  2.213   1.00 19.18 ? 97  GLU A CA  1 
ATOM 799  C C   . GLU A 1 98  ? 49.741 29.002  3.081   1.00 19.01 ? 97  GLU A C   1 
ATOM 800  O O   . GLU A 1 98  ? 48.593 29.377  2.838   1.00 19.63 ? 97  GLU A O   1 
ATOM 801  C CB  . GLU A 1 98  ? 51.461 30.768  2.789   1.00 18.28 ? 97  GLU A CB  1 
ATOM 802  C CG  . GLU A 1 98  ? 52.840 31.131  2.267   1.00 20.02 ? 97  GLU A CG  1 
ATOM 803  C CD  . GLU A 1 98  ? 53.716 32.071  3.169   1.00 23.10 ? 97  GLU A CD  1 
ATOM 804  O OE1 . GLU A 1 98  ? 53.947 31.856  4.384   1.00 23.94 ? 97  GLU A OE1 1 
ATOM 805  O OE2 . GLU A 1 98  ? 54.262 33.058  2.647   1.00 25.52 ? 97  GLU A OE2 1 
ATOM 806  N N   . VAL A 1 99  ? 50.002 28.210  4.101   1.00 18.19 ? 98  VAL A N   1 
ATOM 807  C CA  . VAL A 1 99  ? 48.934 27.910  5.031   1.00 17.51 ? 98  VAL A CA  1 
ATOM 808  C C   . VAL A 1 99  ? 49.385 28.322  6.428   1.00 16.91 ? 98  VAL A C   1 
ATOM 809  O O   . VAL A 1 99  ? 50.404 27.843  6.918   1.00 15.95 ? 98  VAL A O   1 
ATOM 810  C CB  . VAL A 1 99  ? 48.528 26.423  4.965   1.00 17.62 ? 98  VAL A CB  1 
ATOM 811  C CG1 . VAL A 1 99  ? 47.726 26.029  6.195   1.00 18.75 ? 98  VAL A CG1 1 
ATOM 812  C CG2 . VAL A 1 99  ? 47.711 26.141  3.704   1.00 15.81 ? 98  VAL A CG2 1 
ATOM 813  N N   . TYR A 1 100 ? 48.623 29.235  7.031   1.00 16.11 ? 99  TYR A N   1 
ATOM 814  C CA  . TYR A 1 100 ? 48.893 29.694  8.366   1.00 16.08 ? 99  TYR A CA  1 
ATOM 815  C C   . TYR A 1 100 ? 47.937 28.991  9.300   1.00 16.84 ? 99  TYR A C   1 
ATOM 816  O O   . TYR A 1 100 ? 46.875 28.577  8.923   1.00 17.31 ? 99  TYR A O   1 
ATOM 817  C CB  . TYR A 1 100 ? 48.765 31.211  8.485   1.00 15.97 ? 99  TYR A CB  1 
ATOM 818  C CG  . TYR A 1 100 ? 49.995 31.956  8.021   1.00 17.02 ? 99  TYR A CG  1 
ATOM 819  C CD1 . TYR A 1 100 ? 50.430 31.862  6.699   1.00 18.53 ? 99  TYR A CD1 1 
ATOM 820  C CD2 . TYR A 1 100 ? 50.770 32.703  8.918   1.00 18.27 ? 99  TYR A CD2 1 
ATOM 821  C CE1 . TYR A 1 100 ? 51.569 32.508  6.270   1.00 20.23 ? 99  TYR A CE1 1 
ATOM 822  C CE2 . TYR A 1 100 ? 51.917 33.347  8.515   1.00 18.12 ? 99  TYR A CE2 1 
ATOM 823  C CZ  . TYR A 1 100 ? 52.319 33.258  7.175   1.00 21.65 ? 99  TYR A CZ  1 
ATOM 824  O OH  . TYR A 1 100 ? 53.457 33.915  6.727   1.00 23.83 ? 99  TYR A OH  1 
ATOM 825  N N   . VAL A 1 101 ? 48.352 28.836  10.547  1.00 17.53 ? 100 VAL A N   1 
ATOM 826  C CA  . VAL A 1 101 ? 47.570 28.157  11.546  1.00 16.80 ? 100 VAL A CA  1 
ATOM 827  C C   . VAL A 1 101 ? 47.698 28.877  12.830  1.00 16.50 ? 100 VAL A C   1 
ATOM 828  O O   . VAL A 1 101 ? 48.761 29.021  13.349  1.00 16.00 ? 100 VAL A O   1 
ATOM 829  C CB  . VAL A 1 101 ? 48.074 26.782  11.734  1.00 17.09 ? 100 VAL A CB  1 
ATOM 830  C CG1 . VAL A 1 101 ? 47.471 26.157  12.999  1.00 16.95 ? 100 VAL A CG1 1 
ATOM 831  C CG2 . VAL A 1 101 ? 47.741 25.966  10.494  1.00 17.82 ? 100 VAL A CG2 1 
ATOM 832  N N   . ALA A 1 102 ? 46.574 29.320  13.346  1.00 17.91 ? 101 ALA A N   1 
ATOM 833  C CA  . ALA A 1 102 ? 46.493 30.022  14.621  1.00 19.27 ? 101 ALA A CA  1 
ATOM 834  C C   . ALA A 1 102 ? 46.603 29.067  15.799  1.00 19.80 ? 101 ALA A C   1 
ATOM 835  O O   . ALA A 1 102 ? 45.948 28.073  15.821  1.00 20.59 ? 101 ALA A O   1 
ATOM 836  C CB  . ALA A 1 102 ? 45.191 30.701  14.683  1.00 20.11 ? 101 ALA A CB  1 
ATOM 837  N N   . LEU A 1 103 ? 47.430 29.387  16.773  1.00 20.68 ? 102 LEU A N   1 
ATOM 838  C CA  . LEU A 1 103 ? 47.719 28.487  17.896  1.00 21.21 ? 102 LEU A CA  1 
ATOM 839  C C   . LEU A 1 103 ? 47.275 29.079  19.262  1.00 21.59 ? 102 LEU A C   1 
ATOM 840  O O   . LEU A 1 103 ? 46.716 28.399  20.105  1.00 21.51 ? 102 LEU A O   1 
ATOM 841  C CB  . LEU A 1 103 ? 49.238 28.208  17.948  1.00 21.01 ? 102 LEU A CB  1 
ATOM 842  C CG  . LEU A 1 103 ? 49.849 27.464  16.756  1.00 20.97 ? 102 LEU A CG  1 
ATOM 843  C CD1 . LEU A 1 103 ? 51.262 26.968  17.055  1.00 19.30 ? 102 LEU A CD1 1 
ATOM 844  C CD2 . LEU A 1 103 ? 48.956 26.300  16.353  1.00 21.63 ? 102 LEU A CD2 1 
ATOM 845  N N   . LYS A 1 104 ? 47.576 30.346  19.485  1.00 21.66 ? 103 LYS A N   1 
ATOM 846  C CA  . LYS A 1 104 ? 47.213 30.997  20.712  1.00 21.43 ? 103 LYS A CA  1 
ATOM 847  C C   . LYS A 1 104 ? 47.197 32.485  20.437  1.00 20.66 ? 103 LYS A C   1 
ATOM 848  O O   . LYS A 1 104 ? 48.192 33.019  19.994  1.00 20.43 ? 103 LYS A O   1 
ATOM 849  C CB  . LYS A 1 104 ? 48.252 30.651  21.785  1.00 21.81 ? 103 LYS A CB  1 
ATOM 850  C CG  . LYS A 1 104 ? 47.786 30.920  23.200  1.00 23.40 ? 103 LYS A CG  1 
ATOM 851  C CD  . LYS A 1 104 ? 48.976 30.983  24.175  1.00 23.76 ? 103 LYS A CD  1 
ATOM 852  C CE  . LYS A 1 104 ? 48.497 31.104  25.617  1.00 24.01 ? 103 LYS A CE  1 
ATOM 853  N NZ  . LYS A 1 104 ? 49.581 30.727  26.594  1.00 24.38 ? 103 LYS A NZ  1 
ATOM 854  N N   . GLY A 1 105 ? 46.046 33.123  20.674  1.00 20.49 ? 104 GLY A N   1 
ATOM 855  C CA  . GLY A 1 105 ? 45.919 34.573  20.865  1.00 19.59 ? 104 GLY A CA  1 
ATOM 856  C C   . GLY A 1 105 ? 44.795 35.172  20.064  1.00 18.69 ? 104 GLY A C   1 
ATOM 857  O O   . GLY A 1 105 ? 44.006 34.464  19.557  1.00 18.28 ? 104 GLY A O   1 
ATOM 858  N N   . LYS A 1 106 ? 44.764 36.481  19.929  1.00 19.30 ? 105 LYS A N   1 
ATOM 859  C CA  . LYS A 1 106 ? 43.842 37.139  19.018  1.00 20.76 ? 105 LYS A CA  1 
ATOM 860  C C   . LYS A 1 106 ? 44.611 37.966  17.917  1.00 21.02 ? 105 LYS A C   1 
ATOM 861  O O   . LYS A 1 106 ? 45.454 38.822  18.236  1.00 21.58 ? 105 LYS A O   1 
ATOM 862  C CB  . LYS A 1 106 ? 42.902 38.068  19.822  1.00 21.14 ? 105 LYS A CB  1 
ATOM 863  C CG  . LYS A 1 106 ? 41.640 38.465  19.087  1.00 22.58 ? 105 LYS A CG  1 
ATOM 864  C CD  . LYS A 1 106 ? 40.414 37.638  19.670  1.00 27.79 ? 105 LYS A CD  1 
ATOM 865  C CE  . LYS A 1 106 ? 39.003 38.032  19.011  1.00 28.34 ? 105 LYS A CE  1 
ATOM 866  N NZ  . LYS A 1 106 ? 39.068 39.342  18.224  1.00 27.55 ? 105 LYS A NZ  1 
ATOM 867  N N   . GLY A 1 107 ? 44.296 37.741  16.643  1.00 20.42 ? 106 GLY A N   1 
ATOM 868  C CA  . GLY A 1 107 ? 44.901 38.506  15.550  1.00 19.10 ? 106 GLY A CA  1 
ATOM 869  C C   . GLY A 1 107 ? 44.158 38.440  14.207  1.00 18.38 ? 106 GLY A C   1 
ATOM 870  O O   . GLY A 1 107 ? 42.942 38.193  14.105  1.00 16.51 ? 106 GLY A O   1 
ATOM 871  N N   . GLY A 1 108 ? 44.941 38.603  13.151  1.00 18.10 ? 107 GLY A N   1 
ATOM 872  C CA  . GLY A 1 108 ? 44.431 38.508  11.800  1.00 17.45 ? 107 GLY A CA  1 
ATOM 873  C C   . GLY A 1 108 ? 45.499 38.716  10.760  1.00 17.41 ? 107 GLY A C   1 
ATOM 874  O O   . GLY A 1 108 ? 46.678 39.003  11.050  1.00 16.60 ? 107 GLY A O   1 
ATOM 875  N N   . MET A 1 109 ? 45.077 38.558  9.520   1.00 17.80 ? 108 MET A N   1 
ATOM 876  C CA  . MET A 1 109 ? 45.981 38.602  8.414   1.00 18.04 ? 108 MET A CA  1 
ATOM 877  C C   . MET A 1 109 ? 45.557 39.647  7.418   1.00 18.54 ? 108 MET A C   1 
ATOM 878  O O   . MET A 1 109 ? 44.415 39.643  6.940   1.00 19.54 ? 108 MET A O   1 
ATOM 879  C CB  . MET A 1 109 ? 46.024 37.257  7.750   1.00 17.88 ? 108 MET A CB  1 
ATOM 880  C CG  . MET A 1 109 ? 47.267 37.187  6.889   1.00 20.86 ? 108 MET A CG  1 
ATOM 881  S SD  . MET A 1 109 ? 47.582 35.688  6.128   1.00 22.96 ? 108 MET A SD  1 
ATOM 882  C CE  . MET A 1 109 ? 48.065 34.671  7.578   1.00 20.90 ? 108 MET A CE  1 
ATOM 883  N N   . LEU A 1 110 ? 46.472 40.559  7.109   1.00 18.52 ? 109 LEU A N   1 
ATOM 884  C CA  . LEU A 1 110 ? 46.239 41.573  6.095   1.00 18.21 ? 109 LEU A CA  1 
ATOM 885  C C   . LEU A 1 110 ? 46.765 40.954  4.811   1.00 18.70 ? 109 LEU A C   1 
ATOM 886  O O   . LEU A 1 110 ? 47.889 40.412  4.793   1.00 17.51 ? 109 LEU A O   1 
ATOM 887  C CB  . LEU A 1 110 ? 47.005 42.854  6.409   1.00 17.67 ? 109 LEU A CB  1 
ATOM 888  C CG  . LEU A 1 110 ? 46.418 44.225  6.021   1.00 18.14 ? 109 LEU A CG  1 
ATOM 889  C CD1 . LEU A 1 110 ? 47.529 45.151  5.620   1.00 19.87 ? 109 LEU A CD1 1 
ATOM 890  C CD2 . LEU A 1 110 ? 45.367 44.254  4.907   1.00 16.35 ? 109 LEU A CD2 1 
ATOM 891  N N   . LEU A 1 111 ? 45.922 40.971  3.764   1.00 19.16 ? 110 LEU A N   1 
ATOM 892  C CA  . LEU A 1 111 ? 46.324 40.445  2.457   1.00 19.68 ? 110 LEU A CA  1 
ATOM 893  C C   . LEU A 1 111 ? 46.093 41.450  1.350   1.00 19.54 ? 110 LEU A C   1 
ATOM 894  O O   . LEU A 1 111 ? 45.244 42.299  1.493   1.00 18.99 ? 110 LEU A O   1 
ATOM 895  C CB  . LEU A 1 111 ? 45.614 39.152  2.139   1.00 19.39 ? 110 LEU A CB  1 
ATOM 896  C CG  . LEU A 1 111 ? 45.908 38.067  3.144   1.00 19.19 ? 110 LEU A CG  1 
ATOM 897  C CD1 . LEU A 1 111 ? 44.721 37.905  4.146   1.00 18.76 ? 110 LEU A CD1 1 
ATOM 898  C CD2 . LEU A 1 111 ? 46.203 36.795  2.424   1.00 19.92 ? 110 LEU A CD2 1 
ATOM 899  N N   . GLN A 1 112 ? 46.913 41.377  0.292   1.00 20.17 ? 111 GLN A N   1 
ATOM 900  C CA  . GLN A 1 112 ? 46.721 42.235  -0.868  1.00 21.36 ? 111 GLN A CA  1 
ATOM 901  C C   . GLN A 1 112 ? 47.346 41.745  -2.164  1.00 22.14 ? 111 GLN A C   1 
ATOM 902  O O   . GLN A 1 112 ? 48.478 41.282  -2.189  1.00 20.31 ? 111 GLN A O   1 
ATOM 903  C CB  . GLN A 1 112 ? 47.237 43.640  -0.607  1.00 21.48 ? 111 GLN A CB  1 
ATOM 904  C CG  . GLN A 1 112 ? 48.718 43.747  -0.690  1.00 20.87 ? 111 GLN A CG  1 
ATOM 905  C CD  . GLN A 1 112 ? 49.156 45.135  -0.618  1.00 21.43 ? 111 GLN A CD  1 
ATOM 906  O OE1 . GLN A 1 112 ? 48.462 45.979  -0.068  1.00 23.18 ? 111 GLN A OE1 1 
ATOM 907  N NE2 . GLN A 1 112 ? 50.306 45.409  -1.206  1.00 24.52 ? 111 GLN A NE2 1 
ATOM 908  N N   . THR A 1 113 ? 46.570 41.925  -3.247  1.00 23.93 ? 112 THR A N   1 
ATOM 909  C CA  . THR A 1 113 ? 47.007 41.578  -4.601  1.00 24.82 ? 112 THR A CA  1 
ATOM 910  C C   . THR A 1 113 ? 48.147 42.496  -4.933  1.00 25.37 ? 112 THR A C   1 
ATOM 911  O O   . THR A 1 113 ? 48.299 43.479  -4.249  1.00 25.56 ? 112 THR A O   1 
ATOM 912  C CB  . THR A 1 113 ? 45.837 41.729  -5.627  1.00 24.86 ? 112 THR A CB  1 
ATOM 913  O OG1 . THR A 1 113 ? 45.483 43.106  -5.844  1.00 24.77 ? 112 THR A OG1 1 
ATOM 914  C CG2 . THR A 1 113 ? 44.559 41.109  -5.088  1.00 24.72 ? 112 THR A CG2 1 
ATOM 915  N N   . PRO A 1 114 ? 48.948 42.178  -5.951  1.00 26.75 ? 113 PRO A N   1 
ATOM 916  C CA  . PRO A 1 114 ? 50.027 43.062  -6.419  1.00 27.65 ? 113 PRO A CA  1 
ATOM 917  C C   . PRO A 1 114 ? 49.585 44.481  -6.674  1.00 28.75 ? 113 PRO A C   1 
ATOM 918  O O   . PRO A 1 114 ? 50.401 45.357  -6.455  1.00 29.45 ? 113 PRO A O   1 
ATOM 919  C CB  . PRO A 1 114 ? 50.506 42.412  -7.728  1.00 27.26 ? 113 PRO A CB  1 
ATOM 920  C CG  . PRO A 1 114 ? 50.194 40.993  -7.590  1.00 27.45 ? 113 PRO A CG  1 
ATOM 921  C CD  . PRO A 1 114 ? 48.930 40.922  -6.710  1.00 27.33 ? 113 PRO A CD  1 
ATOM 922  N N   . GLU A 1 115 ? 48.355 44.716  -7.112  1.00 30.18 ? 114 GLU A N   1 
ATOM 923  C CA  . GLU A 1 115 ? 47.909 46.085  -7.337  1.00 31.91 ? 114 GLU A CA  1 
ATOM 924  C C   . GLU A 1 115 ? 47.413 46.802  -6.034  1.00 32.68 ? 114 GLU A C   1 
ATOM 925  O O   . GLU A 1 115 ? 47.248 48.053  -6.044  1.00 32.48 ? 114 GLU A O   1 
ATOM 926  C CB  . GLU A 1 115 ? 46.824 46.106  -8.393  1.00 32.49 ? 114 GLU A CB  1 
ATOM 927  C CG  . GLU A 1 115 ? 47.216 45.305  -9.602  1.00 33.95 ? 114 GLU A CG  1 
ATOM 928  C CD  . GLU A 1 115 ? 46.589 43.919  -9.578  1.00 38.10 ? 114 GLU A CD  1 
ATOM 929  O OE1 . GLU A 1 115 ? 45.309 43.792  -9.342  1.00 36.98 ? 114 GLU A OE1 1 
ATOM 930  O OE2 . GLU A 1 115 ? 47.400 42.963  -9.804  1.00 38.74 ? 114 GLU A OE2 1 
ATOM 931  N N   . GLY A 1 116 ? 47.162 46.004  -4.965  1.00 32.81 ? 115 GLY A N   1 
ATOM 932  C CA  . GLY A 1 116 ? 46.770 46.463  -3.621  1.00 32.61 ? 115 GLY A CA  1 
ATOM 933  C C   . GLY A 1 116 ? 45.255 46.349  -3.282  1.00 32.70 ? 115 GLY A C   1 
ATOM 934  O O   . GLY A 1 116 ? 44.721 47.120  -2.487  1.00 32.17 ? 115 GLY A O   1 
ATOM 935  N N   . ASP A 1 117 ? 44.548 45.400  -3.891  1.00 32.60 ? 116 ASP A N   1 
ATOM 936  C CA  . ASP A 1 117 ? 43.198 45.095  -3.454  1.00 32.42 ? 116 ASP A CA  1 
ATOM 937  C C   . ASP A 1 117 ? 43.238 44.190  -2.219  1.00 32.05 ? 116 ASP A C   1 
ATOM 938  O O   . ASP A 1 117 ? 43.727 43.061  -2.277  1.00 31.21 ? 116 ASP A O   1 
ATOM 939  C CB  . ASP A 1 117 ? 42.400 44.482  -4.590  1.00 32.57 ? 116 ASP A CB  1 
ATOM 940  C CG  . ASP A 1 117 ? 42.009 45.520  -5.610  1.00 32.58 ? 116 ASP A CG  1 
ATOM 941  O OD1 . ASP A 1 117 ? 41.938 45.189  -6.806  1.00 34.71 ? 116 ASP A OD1 1 
ATOM 942  O OD2 . ASP A 1 117 ? 41.764 46.699  -5.305  1.00 29.68 ? 116 ASP A OD2 1 
ATOM 943  N N   . ALA A 1 118 ? 42.694 44.730  -1.115  1.00 31.11 ? 117 ALA A N   1 
ATOM 944  C CA  . ALA A 1 118 ? 43.007 44.271  0.221   1.00 30.20 ? 117 ALA A CA  1 
ATOM 945  C C   . ALA A 1 118 ? 41.944 43.385  0.852   1.00 29.42 ? 117 ALA A C   1 
ATOM 946  O O   . ALA A 1 118 ? 40.732 43.532  0.607   1.00 29.34 ? 117 ALA A O   1 
ATOM 947  C CB  . ALA A 1 118 ? 43.283 45.464  1.118   1.00 30.65 ? 117 ALA A CB  1 
ATOM 948  N N   . LYS A 1 119 ? 42.429 42.461  1.682   1.00 28.07 ? 118 LYS A N   1 
ATOM 949  C CA  . LYS A 1 119 ? 41.571 41.547  2.390   1.00 26.90 ? 118 LYS A CA  1 
ATOM 950  C C   . LYS A 1 119 ? 42.076 41.338  3.807   1.00 25.50 ? 118 LYS A C   1 
ATOM 951  O O   . LYS A 1 119 ? 43.300 41.185  4.034   1.00 25.00 ? 118 LYS A O   1 
ATOM 952  C CB  . LYS A 1 119 ? 41.514 40.218  1.647   1.00 26.88 ? 118 LYS A CB  1 
ATOM 953  C CG  . LYS A 1 119 ? 40.472 39.259  2.201   1.00 28.08 ? 118 LYS A CG  1 
ATOM 954  C CD  . LYS A 1 119 ? 39.052 39.751  1.951   1.00 30.34 ? 118 LYS A CD  1 
ATOM 955  C CE  . LYS A 1 119 ? 38.055 38.688  2.417   1.00 32.70 ? 118 LYS A CE  1 
ATOM 956  N NZ  . LYS A 1 119 ? 38.723 37.329  2.657   1.00 30.22 ? 118 LYS A NZ  1 
ATOM 957  N N   . TRP A 1 120 ? 41.114 41.295  4.737   1.00 23.59 ? 119 TRP A N   1 
ATOM 958  C CA  . TRP A 1 120 ? 41.394 41.097  6.151   1.00 22.37 ? 119 TRP A CA  1 
ATOM 959  C C   . TRP A 1 120 ? 40.739 39.869  6.605   1.00 21.42 ? 119 TRP A C   1 
ATOM 960  O O   . TRP A 1 120 ? 39.549 39.705  6.339   1.00 22.56 ? 119 TRP A O   1 
ATOM 961  C CB  . TRP A 1 120 ? 40.804 42.241  6.936   1.00 22.31 ? 119 TRP A CB  1 
ATOM 962  C CG  . TRP A 1 120 ? 40.908 42.122  8.411   1.00 20.43 ? 119 TRP A CG  1 
ATOM 963  C CD1 . TRP A 1 120 ? 39.876 42.112  9.293   1.00 19.50 ? 119 TRP A CD1 1 
ATOM 964  C CD2 . TRP A 1 120 ? 42.114 42.073  9.190   1.00 18.82 ? 119 TRP A CD2 1 
ATOM 965  N NE1 . TRP A 1 120 ? 40.366 42.014  10.574  1.00 19.98 ? 119 TRP A NE1 1 
ATOM 966  C CE2 . TRP A 1 120 ? 41.735 42.002  10.541  1.00 17.02 ? 119 TRP A CE2 1 
ATOM 967  C CE3 . TRP A 1 120 ? 43.475 42.021  8.875   1.00 18.45 ? 119 TRP A CE3 1 
ATOM 968  C CZ2 . TRP A 1 120 ? 42.634 41.894  11.554  1.00 16.15 ? 119 TRP A CZ2 1 
ATOM 969  C CZ3 . TRP A 1 120 ? 44.376 41.939  9.891   1.00 18.37 ? 119 TRP A CZ3 1 
ATOM 970  C CH2 . TRP A 1 120 ? 43.955 41.879  11.223  1.00 17.82 ? 119 TRP A CH2 1 
ATOM 971  N N   . ILE A 1 121 ? 41.481 39.008  7.292   1.00 20.45 ? 120 ILE A N   1 
ATOM 972  C CA  . ILE A 1 121 ? 40.918 37.784  7.866   1.00 19.72 ? 120 ILE A CA  1 
ATOM 973  C C   . ILE A 1 121 ? 41.282 37.718  9.326   1.00 19.42 ? 120 ILE A C   1 
ATOM 974  O O   . ILE A 1 121 ? 42.426 37.793  9.679   1.00 18.06 ? 120 ILE A O   1 
ATOM 975  C CB  . ILE A 1 121 ? 41.440 36.539  7.168   1.00 19.89 ? 120 ILE A CB  1 
ATOM 976  C CG1 . ILE A 1 121 ? 41.252 36.639  5.624   1.00 19.03 ? 120 ILE A CG1 1 
ATOM 977  C CG2 . ILE A 1 121 ? 40.829 35.248  7.824   1.00 20.12 ? 120 ILE A CG2 1 
ATOM 978  C CD1 . ILE A 1 121 ? 40.192 35.876  5.027   1.00 18.53 ? 120 ILE A CD1 1 
ATOM 979  N N   . SER A 1 122 ? 40.266 37.565  10.166  1.00 20.33 ? 121 SER A N   1 
ATOM 980  C CA  . SER A 1 122 ? 40.440 37.426  11.601  1.00 20.35 ? 121 SER A CA  1 
ATOM 981  C C   . SER A 1 122 ? 40.973 36.063  11.916  1.00 20.45 ? 121 SER A C   1 
ATOM 982  O O   . SER A 1 122 ? 40.745 35.141  11.171  1.00 20.47 ? 121 SER A O   1 
ATOM 983  C CB  . SER A 1 122 ? 39.116 37.559  12.295  1.00 20.30 ? 121 SER A CB  1 
ATOM 984  O OG  . SER A 1 122 ? 39.306 38.438  13.344  1.00 22.20 ? 121 SER A OG  1 
ATOM 985  N N   . MET A 1 123 ? 41.655 35.934  13.050  1.00 21.12 ? 122 MET A N   1 
ATOM 986  C CA  . MET A 1 123 ? 42.377 34.702  13.412  1.00 20.96 ? 122 MET A CA  1 
ATOM 987  C C   . MET A 1 123 ? 42.324 34.509  14.917  1.00 21.44 ? 122 MET A C   1 
ATOM 988  O O   . MET A 1 123 ? 42.916 35.308  15.679  1.00 22.08 ? 122 MET A O   1 
ATOM 989  C CB  . MET A 1 123 ? 43.838 34.780  12.956  1.00 20.92 ? 122 MET A CB  1 
ATOM 990  C CG  . MET A 1 123 ? 44.058 34.604  11.443  1.00 20.54 ? 122 MET A CG  1 
ATOM 991  S SD  . MET A 1 123 ? 45.832 34.665  11.009  1.00 22.99 ? 122 MET A SD  1 
ATOM 992  C CE  . MET A 1 123 ? 46.329 33.010  11.506  1.00 22.40 ? 122 MET A CE  1 
ATOM 993  N N   . GLU A 1 124 ? 41.554 33.505  15.352  1.00 21.52 ? 123 GLU A N   1 
ATOM 994  C CA  . GLU A 1 124 ? 41.556 33.048  16.760  1.00 21.41 ? 123 GLU A CA  1 
ATOM 995  C C   . GLU A 1 124 ? 42.176 31.661  16.747  1.00 20.08 ? 123 GLU A C   1 
ATOM 996  O O   . GLU A 1 124 ? 42.408 31.084  15.699  1.00 20.52 ? 123 GLU A O   1 
ATOM 997  C CB  . GLU A 1 124 ? 40.136 33.021  17.410  1.00 22.41 ? 123 GLU A CB  1 
ATOM 998  C CG  . GLU A 1 124 ? 38.886 33.237  16.498  1.00 25.06 ? 123 GLU A CG  1 
ATOM 999  C CD  . GLU A 1 124 ? 37.872 32.027  16.477  1.00 28.18 ? 123 GLU A CD  1 
ATOM 1000 O OE1 . GLU A 1 124 ? 38.293 30.837  16.176  1.00 26.44 ? 123 GLU A OE1 1 
ATOM 1001 O OE2 . GLU A 1 124 ? 36.624 32.285  16.707  1.00 28.16 ? 123 GLU A OE2 1 
ATOM 1002 N N   . PRO A 1 125 ? 42.487 31.120  17.898  1.00 18.95 ? 124 PRO A N   1 
ATOM 1003 C CA  . PRO A 1 125 ? 43.011 29.767  17.941  1.00 18.35 ? 124 PRO A CA  1 
ATOM 1004 C C   . PRO A 1 125 ? 42.111 28.857  17.122  1.00 17.90 ? 124 PRO A C   1 
ATOM 1005 O O   . PRO A 1 125 ? 40.882 28.939  17.286  1.00 16.89 ? 124 PRO A O   1 
ATOM 1006 C CB  . PRO A 1 125 ? 42.946 29.442  19.434  1.00 17.97 ? 124 PRO A CB  1 
ATOM 1007 C CG  . PRO A 1 125 ? 43.092 30.736  20.081  1.00 17.55 ? 124 PRO A CG  1 
ATOM 1008 C CD  . PRO A 1 125 ? 42.423 31.724  19.239  1.00 18.29 ? 124 PRO A CD  1 
ATOM 1009 N N   . GLY A 1 126 ? 42.717 28.006  16.283  1.00 17.43 ? 125 GLY A N   1 
ATOM 1010 C CA  . GLY A 1 126 ? 41.977 27.088  15.436  1.00 17.42 ? 125 GLY A CA  1 
ATOM 1011 C C   . GLY A 1 126 ? 41.771 27.511  13.975  1.00 17.01 ? 125 GLY A C   1 
ATOM 1012 O O   . GLY A 1 126 ? 41.667 26.666  13.104  1.00 17.59 ? 125 GLY A O   1 
ATOM 1013 N N   . THR A 1 127 ? 41.698 28.805  13.704  1.00 16.36 ? 126 THR A N   1 
ATOM 1014 C CA  . THR A 1 127 ? 41.604 29.303  12.339  1.00 15.51 ? 126 THR A CA  1 
ATOM 1015 C C   . THR A 1 127 ? 42.855 28.984  11.495  1.00 14.80 ? 126 THR A C   1 
ATOM 1016 O O   . THR A 1 127 ? 43.958 29.238  11.886  1.00 13.20 ? 126 THR A O   1 
ATOM 1017 C CB  . THR A 1 127 ? 41.443 30.801  12.357  1.00 15.98 ? 126 THR A CB  1 
ATOM 1018 O OG1 . THR A 1 127 ? 40.844 31.234  13.589  1.00 15.25 ? 126 THR A OG1 1 
ATOM 1019 C CG2 . THR A 1 127 ? 40.437 31.247  11.296  1.00 16.36 ? 126 THR A CG2 1 
ATOM 1020 N N   . VAL A 1 128 ? 42.633 28.365  10.346  1.00 15.70 ? 127 VAL A N   1 
ATOM 1021 C CA  . VAL A 1 128 ? 43.664 28.053  9.360   1.00 15.38 ? 127 VAL A CA  1 
ATOM 1022 C C   . VAL A 1 128 ? 43.351 28.889  8.134   1.00 16.16 ? 127 VAL A C   1 
ATOM 1023 O O   . VAL A 1 128 ? 42.227 28.883  7.629   1.00 16.69 ? 127 VAL A O   1 
ATOM 1024 C CB  . VAL A 1 128 ? 43.605 26.627  8.973   1.00 15.37 ? 127 VAL A CB  1 
ATOM 1025 C CG1 . VAL A 1 128 ? 44.487 26.380  7.811   1.00 16.61 ? 127 VAL A CG1 1 
ATOM 1026 C CG2 . VAL A 1 128 ? 44.023 25.732  10.151  1.00 15.39 ? 127 VAL A CG2 1 
ATOM 1027 N N   . VAL A 1 129 ? 44.331 29.670  7.699   1.00 16.56 ? 128 VAL A N   1 
ATOM 1028 C CA  . VAL A 1 129 ? 44.159 30.579  6.595   1.00 16.70 ? 128 VAL A CA  1 
ATOM 1029 C C   . VAL A 1 129 ? 44.966 30.055  5.407   1.00 17.55 ? 128 VAL A C   1 
ATOM 1030 O O   . VAL A 1 129 ? 46.156 29.724  5.524   1.00 18.53 ? 128 VAL A O   1 
ATOM 1031 C CB  . VAL A 1 129 ? 44.660 31.968  6.937   1.00 16.14 ? 128 VAL A CB  1 
ATOM 1032 C CG1 . VAL A 1 129 ? 44.293 32.953  5.857   1.00 16.57 ? 128 VAL A CG1 1 
ATOM 1033 C CG2 . VAL A 1 129 ? 44.064 32.419  8.260   1.00 17.05 ? 128 VAL A CG2 1 
ATOM 1034 N N   . TYR A 1 130 ? 44.287 29.995  4.273   1.00 17.45 ? 129 TYR A N   1 
ATOM 1035 C CA  . TYR A 1 130 ? 44.868 29.704  3.007   1.00 17.31 ? 129 TYR A CA  1 
ATOM 1036 C C   . TYR A 1 130 ? 45.170 31.056  2.332   1.00 16.79 ? 129 TYR A C   1 
ATOM 1037 O O   . TYR A 1 130 ? 44.271 31.779  1.979   1.00 17.79 ? 129 TYR A O   1 
ATOM 1038 C CB  . TYR A 1 130 ? 43.857 28.844  2.192   1.00 17.79 ? 129 TYR A CB  1 
ATOM 1039 C CG  . TYR A 1 130 ? 44.147 28.758  0.712   1.00 17.75 ? 129 TYR A CG  1 
ATOM 1040 C CD1 . TYR A 1 130 ? 43.480 29.588  -0.205  1.00 18.16 ? 129 TYR A CD1 1 
ATOM 1041 C CD2 . TYR A 1 130 ? 45.102 27.879  0.243   1.00 17.85 ? 129 TYR A CD2 1 
ATOM 1042 C CE1 . TYR A 1 130 ? 43.746 29.527  -1.546  1.00 17.80 ? 129 TYR A CE1 1 
ATOM 1043 C CE2 . TYR A 1 130 ? 45.384 27.808  -1.100  1.00 20.35 ? 129 TYR A CE2 1 
ATOM 1044 C CZ  . TYR A 1 130 ? 44.707 28.636  -1.984  1.00 19.59 ? 129 TYR A CZ  1 
ATOM 1045 O OH  . TYR A 1 130 ? 45.046 28.530  -3.285  1.00 20.63 ? 129 TYR A OH  1 
ATOM 1046 N N   . VAL A 1 131 ? 46.449 31.383  2.199   1.00 16.42 ? 130 VAL A N   1 
ATOM 1047 C CA  . VAL A 1 131 ? 46.932 32.453  1.357   1.00 15.84 ? 130 VAL A CA  1 
ATOM 1048 C C   . VAL A 1 131 ? 47.099 31.926  -0.080  1.00 15.44 ? 130 VAL A C   1 
ATOM 1049 O O   . VAL A 1 131 ? 48.042 31.140  -0.341  1.00 15.40 ? 130 VAL A O   1 
ATOM 1050 C CB  . VAL A 1 131 ? 48.336 32.892  1.802   1.00 16.06 ? 130 VAL A CB  1 
ATOM 1051 C CG1 . VAL A 1 131 ? 48.786 34.221  1.034   1.00 16.61 ? 130 VAL A CG1 1 
ATOM 1052 C CG2 . VAL A 1 131 ? 48.420 33.081  3.317   1.00 15.66 ? 130 VAL A CG2 1 
ATOM 1053 N N   . PRO A 1 132 ? 46.265 32.369  -1.011  1.00 13.57 ? 131 PRO A N   1 
ATOM 1054 C CA  . PRO A 1 132 ? 46.359 31.912  -2.397  1.00 13.94 ? 131 PRO A CA  1 
ATOM 1055 C C   . PRO A 1 132 ? 47.532 32.518  -3.198  1.00 12.71 ? 131 PRO A C   1 
ATOM 1056 O O   . PRO A 1 132 ? 48.153 33.488  -2.830  1.00 12.87 ? 131 PRO A O   1 
ATOM 1057 C CB  . PRO A 1 132 ? 45.004 32.389  -3.025  1.00 14.23 ? 131 PRO A CB  1 
ATOM 1058 C CG  . PRO A 1 132 ? 44.269 32.987  -1.966  1.00 14.23 ? 131 PRO A CG  1 
ATOM 1059 C CD  . PRO A 1 132 ? 45.225 33.367  -0.871  1.00 13.89 ? 131 PRO A CD  1 
ATOM 1060 N N   . PRO A 1 133 ? 47.816 31.944  -4.320  1.00 12.50 ? 132 PRO A N   1 
ATOM 1061 C CA  . PRO A 1 133 ? 48.844 32.494  -5.214  1.00 13.33 ? 132 PRO A CA  1 
ATOM 1062 C C   . PRO A 1 133 ? 48.671 33.978  -5.458  1.00 13.46 ? 132 PRO A C   1 
ATOM 1063 O O   . PRO A 1 133 ? 47.548 34.474  -5.385  1.00 14.61 ? 132 PRO A O   1 
ATOM 1064 C CB  . PRO A 1 133 ? 48.657 31.672  -6.498  1.00 13.46 ? 132 PRO A CB  1 
ATOM 1065 C CG  . PRO A 1 133 ? 48.235 30.278  -5.943  1.00 13.16 ? 132 PRO A CG  1 
ATOM 1066 C CD  . PRO A 1 133 ? 47.262 30.677  -4.820  1.00 13.23 ? 132 PRO A CD  1 
ATOM 1067 N N   . TYR A 1 134 ? 49.780 34.662  -5.712  1.00 12.99 ? 133 TYR A N   1 
ATOM 1068 C CA  . TYR A 1 134 ? 49.823 36.091  -5.988  1.00 13.65 ? 133 TYR A CA  1 
ATOM 1069 C C   . TYR A 1 134 ? 49.463 37.083  -4.831  1.00 13.69 ? 133 TYR A C   1 
ATOM 1070 O O   . TYR A 1 134 ? 49.403 38.299  -5.028  1.00 13.38 ? 133 TYR A O   1 
ATOM 1071 C CB  . TYR A 1 134 ? 48.999 36.399  -7.280  1.00 14.29 ? 133 TYR A CB  1 
ATOM 1072 C CG  . TYR A 1 134 ? 49.427 35.614  -8.493  1.00 14.69 ? 133 TYR A CG  1 
ATOM 1073 C CD1 . TYR A 1 134 ? 50.394 36.108  -9.363  1.00 14.59 ? 133 TYR A CD1 1 
ATOM 1074 C CD2 . TYR A 1 134 ? 48.863 34.364  -8.769  1.00 14.82 ? 133 TYR A CD2 1 
ATOM 1075 C CE1 . TYR A 1 134 ? 50.782 35.380  -10.473 1.00 16.84 ? 133 TYR A CE1 1 
ATOM 1076 C CE2 . TYR A 1 134 ? 49.263 33.614  -9.876  1.00 15.04 ? 133 TYR A CE2 1 
ATOM 1077 C CZ  . TYR A 1 134 ? 50.222 34.114  -10.739 1.00 16.42 ? 133 TYR A CZ  1 
ATOM 1078 O OH  . TYR A 1 134 ? 50.630 33.369  -11.872 1.00 15.15 ? 133 TYR A OH  1 
ATOM 1079 N N   . TRP A 1 135 ? 49.233 36.591  -3.626  1.00 14.87 ? 134 TRP A N   1 
ATOM 1080 C CA  . TRP A 1 135 ? 48.848 37.469  -2.476  1.00 15.52 ? 134 TRP A CA  1 
ATOM 1081 C C   . TRP A 1 135 ? 50.016 37.799  -1.531  1.00 14.76 ? 134 TRP A C   1 
ATOM 1082 O O   . TRP A 1 135 ? 50.683 36.925  -1.048  1.00 15.01 ? 134 TRP A O   1 
ATOM 1083 C CB  . TRP A 1 135 ? 47.658 36.850  -1.681  1.00 15.24 ? 134 TRP A CB  1 
ATOM 1084 C CG  . TRP A 1 135 ? 46.311 36.949  -2.424  1.00 16.81 ? 134 TRP A CG  1 
ATOM 1085 C CD1 . TRP A 1 135 ? 45.806 36.089  -3.384  1.00 16.96 ? 134 TRP A CD1 1 
ATOM 1086 C CD2 . TRP A 1 135 ? 45.325 37.988  -2.289  1.00 20.11 ? 134 TRP A CD2 1 
ATOM 1087 N NE1 . TRP A 1 135 ? 44.572 36.518  -3.823  1.00 16.59 ? 134 TRP A NE1 1 
ATOM 1088 C CE2 . TRP A 1 135 ? 44.248 37.679  -3.170  1.00 18.91 ? 134 TRP A CE2 1 
ATOM 1089 C CE3 . TRP A 1 135 ? 45.223 39.150  -1.490  1.00 19.56 ? 134 TRP A CE3 1 
ATOM 1090 C CZ2 . TRP A 1 135 ? 43.109 38.484  -3.263  1.00 16.65 ? 134 TRP A CZ2 1 
ATOM 1091 C CZ3 . TRP A 1 135 ? 44.084 39.944  -1.603  1.00 16.90 ? 134 TRP A CZ3 1 
ATOM 1092 C CH2 . TRP A 1 135 ? 43.049 39.602  -2.486  1.00 15.70 ? 134 TRP A CH2 1 
ATOM 1093 N N   . ALA A 1 136 ? 50.242 39.063  -1.284  1.00 14.29 ? 135 ALA A N   1 
ATOM 1094 C CA  . ALA A 1 136 ? 51.050 39.458  -0.158  1.00 14.87 ? 135 ALA A CA  1 
ATOM 1095 C C   . ALA A 1 136 ? 50.284 39.282  1.146   1.00 15.28 ? 135 ALA A C   1 
ATOM 1096 O O   . ALA A 1 136 ? 49.087 39.279  1.180   1.00 14.83 ? 135 ALA A O   1 
ATOM 1097 C CB  . ALA A 1 136 ? 51.499 40.881  -0.294  1.00 14.44 ? 135 ALA A CB  1 
ATOM 1098 N N   . HIS A 1 137 ? 51.012 39.145  2.241   1.00 16.96 ? 136 HIS A N   1 
ATOM 1099 C CA  . HIS A 1 137 ? 50.359 38.992  3.515   1.00 17.78 ? 136 HIS A CA  1 
ATOM 1100 C C   . HIS A 1 137 ? 51.258 39.355  4.704   1.00 17.14 ? 136 HIS A C   1 
ATOM 1101 O O   . HIS A 1 137 ? 52.443 39.203  4.671   1.00 15.96 ? 136 HIS A O   1 
ATOM 1102 C CB  . HIS A 1 137 ? 49.832 37.574  3.635   1.00 18.09 ? 136 HIS A CB  1 
ATOM 1103 C CG  . HIS A 1 137 ? 50.919 36.584  3.745   1.00 21.59 ? 136 HIS A CG  1 
ATOM 1104 N ND1 . HIS A 1 137 ? 52.102 36.712  3.040   1.00 25.01 ? 136 HIS A ND1 1 
ATOM 1105 C CD2 . HIS A 1 137 ? 51.040 35.476  4.514   1.00 24.91 ? 136 HIS A CD2 1 
ATOM 1106 C CE1 . HIS A 1 137 ? 52.904 35.716  3.378   1.00 28.45 ? 136 HIS A CE1 1 
ATOM 1107 N NE2 . HIS A 1 137 ? 52.283 34.945  4.262   1.00 27.19 ? 136 HIS A NE2 1 
ATOM 1108 N N   . ARG A 1 138 ? 50.606 39.818  5.768   1.00 17.76 ? 137 ARG A N   1 
ATOM 1109 C CA  . ARG A 1 138 ? 51.258 40.306  6.978   1.00 17.77 ? 137 ARG A CA  1 
ATOM 1110 C C   . ARG A 1 138 ? 50.298 40.021  8.101   1.00 17.15 ? 137 ARG A C   1 
ATOM 1111 O O   . ARG A 1 138 ? 49.099 40.156  7.948   1.00 16.71 ? 137 ARG A O   1 
ATOM 1112 C CB  . ARG A 1 138 ? 51.481 41.809  6.859   1.00 17.67 ? 137 ARG A CB  1 
ATOM 1113 C CG  . ARG A 1 138 ? 51.670 42.518  8.147   1.00 19.24 ? 137 ARG A CG  1 
ATOM 1114 C CD  . ARG A 1 138 ? 51.575 44.032  8.010   1.00 18.87 ? 137 ARG A CD  1 
ATOM 1115 N NE  . ARG A 1 138 ? 52.812 44.597  7.433   1.00 18.88 ? 137 ARG A NE  1 
ATOM 1116 C CZ  . ARG A 1 138 ? 52.947 45.865  7.048   1.00 16.56 ? 137 ARG A CZ  1 
ATOM 1117 N NH1 . ARG A 1 138 ? 51.930 46.704  7.182   1.00 15.43 ? 137 ARG A NH1 1 
ATOM 1118 N NH2 . ARG A 1 138 ? 54.098 46.301  6.555   1.00 16.75 ? 137 ARG A NH2 1 
ATOM 1119 N N   . THR A 1 139 ? 50.823 39.659  9.243   1.00 17.11 ? 138 THR A N   1 
ATOM 1120 C CA  . THR A 1 139 ? 49.963 39.254  10.329  1.00 17.21 ? 138 THR A CA  1 
ATOM 1121 C C   . THR A 1 139 ? 50.038 40.364  11.377  1.00 17.41 ? 138 THR A C   1 
ATOM 1122 O O   . THR A 1 139 ? 51.086 40.999  11.563  1.00 17.02 ? 138 THR A O   1 
ATOM 1123 C CB  . THR A 1 139 ? 50.392 37.927  10.855  1.00 16.62 ? 138 THR A CB  1 
ATOM 1124 O OG1 . THR A 1 139 ? 51.712 38.060  11.402  1.00 18.87 ? 138 THR A OG1 1 
ATOM 1125 C CG2 . THR A 1 139 ? 50.577 36.956  9.710   1.00 16.64 ? 138 THR A CG2 1 
ATOM 1126 N N   . VAL A 1 140 ? 48.883 40.621  11.997  1.00 17.37 ? 139 VAL A N   1 
ATOM 1127 C CA  . VAL A 1 140 ? 48.745 41.659  12.984  1.00 17.45 ? 139 VAL A CA  1 
ATOM 1128 C C   . VAL A 1 140 ? 48.221 41.107  14.318  1.00 17.26 ? 139 VAL A C   1 
ATOM 1129 O O   . VAL A 1 140 ? 47.321 40.303  14.347  1.00 16.69 ? 139 VAL A O   1 
ATOM 1130 C CB  . VAL A 1 140 ? 47.780 42.762  12.475  1.00 16.73 ? 139 VAL A CB  1 
ATOM 1131 C CG1 . VAL A 1 140 ? 47.499 43.740  13.574  1.00 17.33 ? 139 VAL A CG1 1 
ATOM 1132 C CG2 . VAL A 1 140 ? 48.375 43.460  11.334  1.00 16.66 ? 139 VAL A CG2 1 
ATOM 1133 N N   . ASN A 1 141 ? 48.783 41.581  15.421  1.00 17.95 ? 140 ASN A N   1 
ATOM 1134 C CA  . ASN A 1 141 ? 48.248 41.265  16.740  1.00 18.27 ? 140 ASN A CA  1 
ATOM 1135 C C   . ASN A 1 141 ? 47.229 42.307  17.182  1.00 18.76 ? 140 ASN A C   1 
ATOM 1136 O O   . ASN A 1 141 ? 47.573 43.494  17.347  1.00 19.86 ? 140 ASN A O   1 
ATOM 1137 C CB  . ASN A 1 141 ? 49.369 41.200  17.763  1.00 17.81 ? 140 ASN A CB  1 
ATOM 1138 C CG  . ASN A 1 141 ? 48.896 40.618  19.037  1.00 17.04 ? 140 ASN A CG  1 
ATOM 1139 O OD1 . ASN A 1 141 ? 47.715 40.745  19.369  1.00 15.32 ? 140 ASN A OD1 1 
ATOM 1140 N ND2 . ASN A 1 141 ? 49.790 39.941  19.758  1.00 18.11 ? 140 ASN A ND2 1 
ATOM 1141 N N   . ILE A 1 142 ? 45.995 41.889  17.405  1.00 18.34 ? 141 ILE A N   1 
ATOM 1142 C CA  . ILE A 1 142 ? 44.923 42.864  17.751  1.00 18.23 ? 141 ILE A CA  1 
ATOM 1143 C C   . ILE A 1 142 ? 44.403 42.697  19.181  1.00 18.91 ? 141 ILE A C   1 
ATOM 1144 O O   . ILE A 1 142 ? 43.417 43.322  19.544  1.00 18.91 ? 141 ILE A O   1 
ATOM 1145 C CB  . ILE A 1 142 ? 43.739 42.855  16.728  1.00 16.57 ? 141 ILE A CB  1 
ATOM 1146 C CG1 . ILE A 1 142 ? 42.946 41.580  16.813  1.00 14.99 ? 141 ILE A CG1 1 
ATOM 1147 C CG2 . ILE A 1 142 ? 44.289 43.046  15.350  1.00 16.48 ? 141 ILE A CG2 1 
ATOM 1148 C CD1 . ILE A 1 142 ? 41.739 41.494  15.829  1.00 14.62 ? 141 ILE A CD1 1 
ATOM 1149 N N   . GLY A 1 143 ? 45.091 41.872  19.966  1.00 19.62 ? 142 GLY A N   1 
ATOM 1150 C CA  . GLY A 1 143 ? 44.730 41.618  21.335  1.00 20.64 ? 142 GLY A CA  1 
ATOM 1151 C C   . GLY A 1 143 ? 45.833 42.024  22.333  1.00 22.44 ? 142 GLY A C   1 
ATOM 1152 O O   . GLY A 1 143 ? 46.754 42.816  22.024  1.00 21.99 ? 142 GLY A O   1 
ATOM 1153 N N   . ASP A 1 144 ? 45.745 41.448  23.536  1.00 23.46 ? 143 ASP A N   1 
ATOM 1154 C CA  . ASP A 1 144 ? 46.539 41.858  24.670  1.00 24.06 ? 143 ASP A CA  1 
ATOM 1155 C C   . ASP A 1 144 ? 47.506 40.765  25.054  1.00 24.46 ? 143 ASP A C   1 
ATOM 1156 O O   . ASP A 1 144 ? 48.402 41.000  25.910  1.00 24.10 ? 143 ASP A O   1 
ATOM 1157 C CB  . ASP A 1 144 ? 45.593 42.128  25.830  1.00 24.64 ? 143 ASP A CB  1 
ATOM 1158 C CG  . ASP A 1 144 ? 44.899 43.506  25.716  1.00 28.25 ? 143 ASP A CG  1 
ATOM 1159 O OD1 . ASP A 1 144 ? 45.239 44.420  26.523  1.00 30.30 ? 143 ASP A OD1 1 
ATOM 1160 O OD2 . ASP A 1 144 ? 43.987 43.777  24.865  1.00 31.99 ? 143 ASP A OD2 1 
ATOM 1161 N N   . GLU A 1 145 ? 47.326 39.565  24.461  1.00 24.78 ? 144 GLU A N   1 
ATOM 1162 C CA  . GLU A 1 145 ? 48.308 38.444  24.648  1.00 25.35 ? 144 GLU A CA  1 
ATOM 1163 C C   . GLU A 1 145 ? 49.124 38.176  23.348  1.00 24.65 ? 144 GLU A C   1 
ATOM 1164 O O   . GLU A 1 145 ? 48.699 38.544  22.255  1.00 25.13 ? 144 GLU A O   1 
ATOM 1165 C CB  . GLU A 1 145 ? 47.664 37.143  25.193  1.00 25.41 ? 144 GLU A CB  1 
ATOM 1166 C CG  . GLU A 1 145 ? 46.124 37.026  25.119  1.00 27.10 ? 144 GLU A CG  1 
ATOM 1167 C CD  . GLU A 1 145 ? 45.657 35.595  24.798  1.00 29.89 ? 144 GLU A CD  1 
ATOM 1168 O OE1 . GLU A 1 145 ? 46.362 34.611  25.283  1.00 26.80 ? 144 GLU A OE1 1 
ATOM 1169 O OE2 . GLU A 1 145 ? 44.613 35.463  24.023  1.00 28.17 ? 144 GLU A OE2 1 
ATOM 1170 N N   . PRO A 1 146 ? 50.315 37.613  23.464  1.00 23.88 ? 145 PRO A N   1 
ATOM 1171 C CA  . PRO A 1 146 ? 51.085 37.217  22.276  1.00 23.24 ? 145 PRO A CA  1 
ATOM 1172 C C   . PRO A 1 146 ? 50.259 36.393  21.277  1.00 22.39 ? 145 PRO A C   1 
ATOM 1173 O O   . PRO A 1 146 ? 49.542 35.486  21.665  1.00 21.86 ? 145 PRO A O   1 
ATOM 1174 C CB  . PRO A 1 146 ? 52.228 36.358  22.870  1.00 22.93 ? 145 PRO A CB  1 
ATOM 1175 C CG  . PRO A 1 146 ? 52.424 36.893  24.179  1.00 23.51 ? 145 PRO A CG  1 
ATOM 1176 C CD  . PRO A 1 146 ? 51.057 37.327  24.703  1.00 23.94 ? 145 PRO A CD  1 
ATOM 1177 N N   . PHE A 1 147 ? 50.350 36.729  19.995  1.00 21.77 ? 146 PHE A N   1 
ATOM 1178 C CA  . PHE A 1 147 ? 49.696 35.953  18.942  1.00 20.34 ? 146 PHE A CA  1 
ATOM 1179 C C   . PHE A 1 147 ? 50.765 35.012  18.417  1.00 19.25 ? 146 PHE A C   1 
ATOM 1180 O O   . PHE A 1 147 ? 51.815 35.470  18.000  1.00 18.57 ? 146 PHE A O   1 
ATOM 1181 C CB  . PHE A 1 147 ? 49.236 36.894  17.852  1.00 20.44 ? 146 PHE A CB  1 
ATOM 1182 C CG  . PHE A 1 147 ? 48.429 36.259  16.806  1.00 20.36 ? 146 PHE A CG  1 
ATOM 1183 C CD1 . PHE A 1 147 ? 47.247 35.650  17.116  1.00 22.08 ? 146 PHE A CD1 1 
ATOM 1184 C CD2 . PHE A 1 147 ? 48.840 36.295  15.480  1.00 21.30 ? 146 PHE A CD2 1 
ATOM 1185 C CE1 . PHE A 1 147 ? 46.449 35.048  16.098  1.00 22.39 ? 146 PHE A CE1 1 
ATOM 1186 C CE2 . PHE A 1 147 ? 48.054 35.721  14.453  1.00 21.60 ? 146 PHE A CE2 1 
ATOM 1187 C CZ  . PHE A 1 147 ? 46.872 35.097  14.760  1.00 20.14 ? 146 PHE A CZ  1 
ATOM 1188 N N   . ILE A 1 148 ? 50.487 33.702  18.457  1.00 18.00 ? 147 ILE A N   1 
ATOM 1189 C CA  . ILE A 1 148 ? 51.396 32.662  18.016  1.00 16.33 ? 147 ILE A CA  1 
ATOM 1190 C C   . ILE A 1 148 ? 50.781 31.852  16.865  1.00 16.42 ? 147 ILE A C   1 
ATOM 1191 O O   . ILE A 1 148 ? 49.582 31.454  16.934  1.00 15.09 ? 147 ILE A O   1 
ATOM 1192 C CB  . ILE A 1 148 ? 51.743 31.741  19.151  1.00 16.11 ? 147 ILE A CB  1 
ATOM 1193 C CG1 . ILE A 1 148 ? 51.884 32.521  20.468  1.00 17.49 ? 147 ILE A CG1 1 
ATOM 1194 C CG2 . ILE A 1 148 ? 53.022 31.009  18.834  1.00 16.65 ? 147 ILE A CG2 1 
ATOM 1195 C CD1 . ILE A 1 148 ? 52.611 31.774  21.618  1.00 16.51 ? 147 ILE A CD1 1 
ATOM 1196 N N   . PHE A 1 149 ? 51.603 31.578  15.824  1.00 15.51 ? 148 PHE A N   1 
ATOM 1197 C CA  . PHE A 1 149 ? 51.111 30.854  14.683  1.00 14.69 ? 148 PHE A CA  1 
ATOM 1198 C C   . PHE A 1 149 ? 52.137 30.022  13.964  1.00 14.53 ? 148 PHE A C   1 
ATOM 1199 O O   . PHE A 1 149 ? 53.315 30.330  14.023  1.00 14.37 ? 148 PHE A O   1 
ATOM 1200 C CB  . PHE A 1 149 ? 50.442 31.801  13.725  1.00 14.63 ? 148 PHE A CB  1 
ATOM 1201 C CG  . PHE A 1 149 ? 51.317 32.931  13.257  1.00 14.92 ? 148 PHE A CG  1 
ATOM 1202 C CD1 . PHE A 1 149 ? 51.113 34.212  13.735  1.00 15.15 ? 148 PHE A CD1 1 
ATOM 1203 C CD2 . PHE A 1 149 ? 52.295 32.724  12.246  1.00 16.11 ? 148 PHE A CD2 1 
ATOM 1204 C CE1 . PHE A 1 149 ? 51.871 35.257  13.267  1.00 15.76 ? 148 PHE A CE1 1 
ATOM 1205 C CE2 . PHE A 1 149 ? 53.066 33.771  11.765  1.00 14.70 ? 148 PHE A CE2 1 
ATOM 1206 C CZ  . PHE A 1 149 ? 52.868 35.039  12.272  1.00 14.36 ? 148 PHE A CZ  1 
ATOM 1207 N N   . LEU A 1 150 ? 51.666 28.957  13.295  1.00 13.97 ? 149 LEU A N   1 
ATOM 1208 C CA  . LEU A 1 150 ? 52.493 28.110  12.472  1.00 13.40 ? 149 LEU A CA  1 
ATOM 1209 C C   . LEU A 1 150 ? 52.222 28.438  11.012  1.00 14.00 ? 149 LEU A C   1 
ATOM 1210 O O   . LEU A 1 150 ? 51.085 28.519  10.612  1.00 13.24 ? 149 LEU A O   1 
ATOM 1211 C CB  . LEU A 1 150 ? 52.180 26.652  12.732  1.00 13.17 ? 149 LEU A CB  1 
ATOM 1212 C CG  . LEU A 1 150 ? 52.822 25.679  11.725  1.00 13.48 ? 149 LEU A CG  1 
ATOM 1213 C CD1 . LEU A 1 150 ? 54.326 25.712  11.832  1.00 14.39 ? 149 LEU A CD1 1 
ATOM 1214 C CD2 . LEU A 1 150 ? 52.359 24.263  11.978  1.00 13.44 ? 149 LEU A CD2 1 
ATOM 1215 N N   . ALA A 1 151 ? 53.240 28.485  10.267  1.00 14.52 ? 150 ALA A N   1 
ATOM 1216 C CA  . ALA A 1 151 ? 53.248 28.884  8.864   1.00 15.30 ? 150 ALA A CA  1 
ATOM 1217 C C   . ALA A 1 151 ? 53.897 27.784  8.018   1.00 17.19 ? 150 ALA A C   1 
ATOM 1218 O O   . ALA A 1 151 ? 54.936 27.222  8.393   1.00 18.46 ? 150 ALA A O   1 
ATOM 1219 C CB  . ALA A 1 151 ? 54.040 30.177  8.722   1.00 15.72 ? 150 ALA A CB  1 
ATOM 1220 N N   . ILE A 1 152 ? 53.314 27.430  6.865   1.00 18.34 ? 151 ILE A N   1 
ATOM 1221 C CA  . ILE A 1 152 ? 53.826 26.425  5.995   1.00 18.66 ? 151 ILE A CA  1 
ATOM 1222 C C   . ILE A 1 152 ? 53.831 27.032  4.598   1.00 20.38 ? 151 ILE A C   1 
ATOM 1223 O O   . ILE A 1 152 ? 52.802 27.271  3.999   1.00 19.92 ? 151 ILE A O   1 
ATOM 1224 C CB  . ILE A 1 152 ? 52.944 25.213  6.060   1.00 18.28 ? 151 ILE A CB  1 
ATOM 1225 C CG1 . ILE A 1 152 ? 52.865 24.659  7.458   1.00 18.27 ? 151 ILE A CG1 1 
ATOM 1226 C CG2 . ILE A 1 152 ? 53.468 24.155  5.186   1.00 19.81 ? 151 ILE A CG2 1 
ATOM 1227 C CD1 . ILE A 1 152 ? 51.580 25.064  8.161   1.00 19.85 ? 151 ILE A CD1 1 
ATOM 1228 N N   . TYR A 1 153 ? 55.030 27.307  4.106   1.00 23.07 ? 152 TYR A N   1 
ATOM 1229 C CA  . TYR A 1 153 ? 55.274 27.855  2.761   1.00 24.02 ? 152 TYR A CA  1 
ATOM 1230 C C   . TYR A 1 153 ? 56.036 26.826  1.916   1.00 23.96 ? 152 TYR A C   1 
ATOM 1231 O O   . TYR A 1 153 ? 56.585 25.888  2.441   1.00 23.65 ? 152 TYR A O   1 
ATOM 1232 C CB  . TYR A 1 153 ? 56.056 29.196  2.792   1.00 24.20 ? 152 TYR A CB  1 
ATOM 1233 C CG  . TYR A 1 153 ? 57.076 29.429  3.913   1.00 27.97 ? 152 TYR A CG  1 
ATOM 1234 C CD1 . TYR A 1 153 ? 56.666 29.474  5.266   1.00 31.58 ? 152 TYR A CD1 1 
ATOM 1235 C CD2 . TYR A 1 153 ? 58.443 29.686  3.634   1.00 30.10 ? 152 TYR A CD2 1 
ATOM 1236 C CE1 . TYR A 1 153 ? 57.573 29.705  6.293   1.00 31.34 ? 152 TYR A CE1 1 
ATOM 1237 C CE2 . TYR A 1 153 ? 59.368 29.907  4.671   1.00 29.53 ? 152 TYR A CE2 1 
ATOM 1238 C CZ  . TYR A 1 153 ? 58.903 29.915  5.995   1.00 31.67 ? 152 TYR A CZ  1 
ATOM 1239 O OH  . TYR A 1 153 ? 59.736 30.107  7.076   1.00 34.12 ? 152 TYR A OH  1 
ATOM 1240 N N   . PRO A 1 154 ? 56.037 26.970  0.603   1.00 24.90 ? 153 PRO A N   1 
ATOM 1241 C CA  . PRO A 1 154 ? 57.016 26.262  -0.233  1.00 25.99 ? 153 PRO A CA  1 
ATOM 1242 C C   . PRO A 1 154 ? 58.473 26.727  -0.031  1.00 26.93 ? 153 PRO A C   1 
ATOM 1243 O O   . PRO A 1 154 ? 58.751 27.885  0.269   1.00 28.27 ? 153 PRO A O   1 
ATOM 1244 C CB  . PRO A 1 154 ? 56.538 26.567  -1.645  1.00 25.62 ? 153 PRO A CB  1 
ATOM 1245 C CG  . PRO A 1 154 ? 55.091 26.950  -1.477  1.00 25.23 ? 153 PRO A CG  1 
ATOM 1246 C CD  . PRO A 1 154 ? 55.095 27.739  -0.217  1.00 24.89 ? 153 PRO A CD  1 
ATOM 1247 N N   . ALA A 1 155 ? 59.406 25.813  -0.209  1.00 27.78 ? 154 ALA A N   1 
ATOM 1248 C CA  . ALA A 1 155 ? 60.821 26.109  -0.035  1.00 28.50 ? 154 ALA A CA  1 
ATOM 1249 C C   . ALA A 1 155 ? 61.363 27.069  -1.078  1.00 29.10 ? 154 ALA A C   1 
ATOM 1250 O O   . ALA A 1 155 ? 62.366 27.744  -0.816  1.00 29.19 ? 154 ALA A O   1 
ATOM 1251 C CB  . ALA A 1 155 ? 61.628 24.830  -0.065  1.00 28.49 ? 154 ALA A CB  1 
ATOM 1252 N N   . ASP A 1 156 ? 60.691 27.134  -2.230  1.00 30.07 ? 155 ASP A N   1 
ATOM 1253 C CA  . ASP A 1 156 ? 61.166 27.878  -3.379  1.00 31.37 ? 155 ASP A CA  1 
ATOM 1254 C C   . ASP A 1 156 ? 60.398 29.136  -3.685  1.00 32.94 ? 155 ASP A C   1 
ATOM 1255 O O   . ASP A 1 156 ? 60.493 29.638  -4.784  1.00 32.20 ? 155 ASP A O   1 
ATOM 1256 C CB  . ASP A 1 156 ? 61.228 26.970  -4.605  1.00 31.38 ? 155 ASP A CB  1 
ATOM 1257 C CG  . ASP A 1 156 ? 59.877 26.780  -5.306  1.00 30.92 ? 155 ASP A CG  1 
ATOM 1258 O OD1 . ASP A 1 156 ? 58.841 26.954  -4.642  1.00 27.67 ? 155 ASP A OD1 1 
ATOM 1259 O OD2 . ASP A 1 156 ? 59.778 26.424  -6.539  1.00 30.19 ? 155 ASP A OD2 1 
ATOM 1260 N N   . ALA A 1 157 ? 59.683 29.654  -2.683  1.00 35.54 ? 156 ALA A N   1 
ATOM 1261 C CA  . ALA A 1 157 ? 58.880 30.856  -2.827  1.00 37.28 ? 156 ALA A CA  1 
ATOM 1262 C C   . ALA A 1 157 ? 59.738 32.090  -2.694  1.00 39.54 ? 156 ALA A C   1 
ATOM 1263 O O   . ALA A 1 157 ? 59.733 32.924  -3.584  1.00 39.80 ? 156 ALA A O   1 
ATOM 1264 C CB  . ALA A 1 157 ? 57.791 30.878  -1.823  1.00 37.31 ? 156 ALA A CB  1 
ATOM 1265 N N   . GLY A 1 158 ? 60.469 32.220  -1.590  1.00 42.61 ? 157 GLY A N   1 
ATOM 1266 C CA  . GLY A 1 158 ? 61.401 33.338  -1.417  1.00 45.47 ? 157 GLY A CA  1 
ATOM 1267 C C   . GLY A 1 158 ? 60.744 34.588  -0.845  1.00 48.06 ? 157 GLY A C   1 
ATOM 1268 O O   . GLY A 1 158 ? 59.546 34.574  -0.505  1.00 48.22 ? 157 GLY A O   1 
ATOM 1269 N N   . HIS A 1 159 ? 61.546 35.646  -0.692  1.00 51.03 ? 158 HIS A N   1 
ATOM 1270 C CA  . HIS A 1 159 ? 61.063 36.964  -0.258  1.00 53.38 ? 158 HIS A CA  1 
ATOM 1271 C C   . HIS A 1 159 ? 61.841 38.045  -1.020  1.00 55.00 ? 158 HIS A C   1 
ATOM 1272 O O   . HIS A 1 159 ? 63.027 38.248  -0.725  1.00 55.44 ? 158 HIS A O   1 
ATOM 1273 C CB  . HIS A 1 159 ? 61.312 37.265  1.251   1.00 53.84 ? 158 HIS A CB  1 
ATOM 1274 C CG  . HIS A 1 159 ? 60.976 36.159  2.204   1.00 55.98 ? 158 HIS A CG  1 
ATOM 1275 N ND1 . HIS A 1 159 ? 61.605 34.930  2.181   1.00 58.30 ? 158 HIS A ND1 1 
ATOM 1276 C CD2 . HIS A 1 159 ? 60.135 36.133  3.273   1.00 58.17 ? 158 HIS A CD2 1 
ATOM 1277 C CE1 . HIS A 1 159 ? 61.122 34.172  3.156   1.00 59.34 ? 158 HIS A CE1 1 
ATOM 1278 N NE2 . HIS A 1 159 ? 60.231 34.879  3.837   1.00 59.71 ? 158 HIS A NE2 1 
ATOM 1279 N N   . ASP A 1 160 ? 61.214 38.740  -1.971  1.00 56.92 ? 159 ASP A N   1 
ATOM 1280 C CA  . ASP A 1 160 ? 61.777 40.017  -2.449  1.00 58.97 ? 159 ASP A CA  1 
ATOM 1281 C C   . ASP A 1 160 ? 60.795 40.820  -3.321  1.00 59.98 ? 159 ASP A C   1 
ATOM 1282 O O   . ASP A 1 160 ? 59.612 40.839  -3.012  1.00 60.50 ? 159 ASP A O   1 
ATOM 1283 C CB  . ASP A 1 160 ? 63.184 39.849  -3.117  1.00 59.68 ? 159 ASP A CB  1 
ATOM 1284 C CG  . ASP A 1 160 ? 64.266 40.805  -2.502  1.00 60.89 ? 159 ASP A CG  1 
ATOM 1285 O OD1 . ASP A 1 160 ? 64.447 40.790  -1.251  1.00 62.15 ? 159 ASP A OD1 1 
ATOM 1286 O OD2 . ASP A 1 160 ? 64.985 41.596  -3.193  1.00 61.96 ? 159 ASP A OD2 1 
ATOM 1287 N N   . TYR A 1 161 ? 61.267 41.436  -4.408  1.00 61.08 ? 160 TYR A N   1 
ATOM 1288 C CA  . TYR A 1 161 ? 60.745 42.760  -4.829  1.00 62.52 ? 160 TYR A CA  1 
ATOM 1289 C C   . TYR A 1 161 ? 59.191 42.928  -5.184  1.00 63.01 ? 160 TYR A C   1 
ATOM 1290 O O   . TYR A 1 161 ? 58.464 41.942  -5.441  1.00 62.64 ? 160 TYR A O   1 
ATOM 1291 C CB  . TYR A 1 161 ? 61.720 43.459  -5.842  1.00 62.65 ? 160 TYR A CB  1 
ATOM 1292 C CG  . TYR A 1 161 ? 62.840 44.270  -5.145  1.00 63.48 ? 160 TYR A CG  1 
ATOM 1293 C CD1 . TYR A 1 161 ? 63.316 45.455  -5.693  1.00 64.39 ? 160 TYR A CD1 1 
ATOM 1294 C CD2 . TYR A 1 161 ? 63.408 43.839  -3.925  1.00 64.25 ? 160 TYR A CD2 1 
ATOM 1295 C CE1 . TYR A 1 161 ? 64.346 46.198  -5.044  1.00 65.83 ? 160 TYR A CE1 1 
ATOM 1296 C CE2 . TYR A 1 161 ? 64.429 44.567  -3.269  1.00 64.82 ? 160 TYR A CE2 1 
ATOM 1297 C CZ  . TYR A 1 161 ? 64.894 45.746  -3.829  1.00 65.58 ? 160 TYR A CZ  1 
ATOM 1298 O OH  . TYR A 1 161 ? 65.905 46.466  -3.195  1.00 65.03 ? 160 TYR A OH  1 
ATOM 1299 N N   . GLY A 1 162 ? 58.757 44.210  -5.176  1.00 62.83 ? 161 GLY A N   1 
ATOM 1300 C CA  . GLY A 1 162 ? 57.443 44.654  -4.691  1.00 62.29 ? 161 GLY A CA  1 
ATOM 1301 C C   . GLY A 1 162 ? 57.526 45.214  -3.250  1.00 62.11 ? 161 GLY A C   1 
ATOM 1302 O O   . GLY A 1 162 ? 56.532 45.222  -2.559  1.00 61.34 ? 161 GLY A O   1 
ATOM 1303 N N   . THR A 1 163 ? 58.704 45.729  -2.845  1.00 62.39 ? 162 THR A N   1 
ATOM 1304 C CA  . THR A 1 163 ? 59.120 45.974  -1.428  1.00 62.35 ? 162 THR A CA  1 
ATOM 1305 C C   . THR A 1 163 ? 58.095 46.711  -0.520  1.00 62.20 ? 162 THR A C   1 
ATOM 1306 O O   . THR A 1 163 ? 57.405 47.649  -0.957  1.00 62.53 ? 162 THR A O   1 
ATOM 1307 C CB  . THR A 1 163 ? 60.587 46.697  -1.372  1.00 62.62 ? 162 THR A CB  1 
ATOM 1308 O OG1 . THR A 1 163 ? 61.650 45.726  -1.521  1.00 61.78 ? 162 THR A OG1 1 
ATOM 1309 C CG2 . THR A 1 163 ? 60.903 47.356  -0.010  1.00 61.58 ? 162 THR A CG2 1 
ATOM 1310 N N   . ILE A 1 164 ? 58.065 46.275  0.751   1.00 61.62 ? 163 ILE A N   1 
ATOM 1311 C CA  . ILE A 1 164 ? 57.127 46.716  1.800   1.00 60.86 ? 163 ILE A CA  1 
ATOM 1312 C C   . ILE A 1 164 ? 57.714 47.851  2.670   1.00 60.61 ? 163 ILE A C   1 
ATOM 1313 O O   . ILE A 1 164 ? 56.971 48.647  3.266   1.00 60.70 ? 163 ILE A O   1 
ATOM 1314 C CB  . ILE A 1 164 ? 56.831 45.515  2.733   1.00 60.81 ? 163 ILE A CB  1 
ATOM 1315 C CG1 . ILE A 1 164 ? 56.345 44.252  1.949   1.00 61.36 ? 163 ILE A CG1 1 
ATOM 1316 C CG2 . ILE A 1 164 ? 55.868 45.913  3.853   1.00 61.13 ? 163 ILE A CG2 1 
ATOM 1317 C CD1 . ILE A 1 164 ? 54.940 44.312  1.220   1.00 59.55 ? 163 ILE A CD1 1 
ATOM 1318 N N   . ALA A 1 165 ? 59.050 47.881  2.782   1.00 59.93 ? 164 ALA A N   1 
ATOM 1319 C CA  . ALA A 1 165 ? 59.766 48.844  3.625   1.00 59.27 ? 164 ALA A CA  1 
ATOM 1320 C C   . ALA A 1 165 ? 59.679 50.286  3.098   1.00 58.81 ? 164 ALA A C   1 
ATOM 1321 O O   . ALA A 1 165 ? 59.656 51.245  3.917   1.00 58.96 ? 164 ALA A O   1 
ATOM 1322 C CB  . ALA A 1 165 ? 61.249 48.432  3.780   1.00 59.37 ? 164 ALA A CB  1 
ATOM 1323 N N   . GLU A 1 166 ? 59.657 50.436  1.759   1.00 57.48 ? 165 GLU A N   1 
ATOM 1324 C CA  . GLU A 1 166 ? 59.444 51.757  1.120   1.00 56.39 ? 165 GLU A CA  1 
ATOM 1325 C C   . GLU A 1 166 ? 57.978 51.924  0.704   1.00 54.46 ? 165 GLU A C   1 
ATOM 1326 O O   . GLU A 1 166 ? 57.386 52.988  0.956   1.00 53.75 ? 165 GLU A O   1 
ATOM 1327 C CB  . GLU A 1 166 ? 60.429 52.063  -0.065  1.00 56.68 ? 165 GLU A CB  1 
ATOM 1328 C CG  . GLU A 1 166 ? 60.600 50.979  -1.138  1.00 57.99 ? 165 GLU A CG  1 
ATOM 1329 C CD  . GLU A 1 166 ? 60.500 51.526  -2.575  1.00 59.23 ? 165 GLU A CD  1 
ATOM 1330 O OE1 . GLU A 1 166 ? 59.566 51.121  -3.327  1.00 58.49 ? 165 GLU A OE1 1 
ATOM 1331 O OE2 . GLU A 1 166 ? 61.373 52.344  -2.964  1.00 59.56 ? 165 GLU A OE2 1 
ATOM 1332 N N   . LYS A 1 167 ? 57.400 50.877  0.092   1.00 52.44 ? 166 LYS A N   1 
ATOM 1333 C CA  . LYS A 1 167 ? 55.997 50.953  -0.372  1.00 51.06 ? 166 LYS A CA  1 
ATOM 1334 C C   . LYS A 1 167 ? 55.002 50.556  0.771   1.00 48.70 ? 166 LYS A C   1 
ATOM 1335 O O   . LYS A 1 167 ? 54.409 51.427  1.430   1.00 47.97 ? 166 LYS A O   1 
ATOM 1336 C CB  . LYS A 1 167 ? 55.774 50.178  -1.712  1.00 51.07 ? 166 LYS A CB  1 
ATOM 1337 C CG  . LYS A 1 167 ? 54.786 50.930  -2.721  1.00 51.83 ? 166 LYS A CG  1 
ATOM 1338 C CD  . LYS A 1 167 ? 54.143 50.007  -3.830  1.00 51.17 ? 166 LYS A CD  1 
ATOM 1339 C CE  . LYS A 1 167 ? 55.097 49.797  -5.009  1.00 50.84 ? 166 LYS A CE  1 
ATOM 1340 N NZ  . LYS A 1 167 ? 54.453 49.000  -6.094  1.00 50.15 ? 166 LYS A NZ  1 
ATOM 1341 N N   . GLY A 1 168 ? 54.859 49.260  1.018   1.00 45.90 ? 167 GLY A N   1 
ATOM 1342 C CA  . GLY A 1 168 ? 53.978 48.800  2.069   1.00 43.69 ? 167 GLY A CA  1 
ATOM 1343 C C   . GLY A 1 168 ? 52.597 48.385  1.566   1.00 41.40 ? 167 GLY A C   1 
ATOM 1344 O O   . GLY A 1 168 ? 52.429 47.919  0.413   1.00 40.30 ? 167 GLY A O   1 
ATOM 1345 N N   . PHE A 1 169 ? 51.617 48.542  2.461   1.00 38.21 ? 168 PHE A N   1 
ATOM 1346 C CA  . PHE A 1 169 ? 50.308 47.928  2.288   1.00 35.81 ? 168 PHE A CA  1 
ATOM 1347 C C   . PHE A 1 169 ? 49.256 48.981  2.133   1.00 33.84 ? 168 PHE A C   1 
ATOM 1348 O O   . PHE A 1 169 ? 49.346 50.037  2.760   1.00 33.98 ? 168 PHE A O   1 
ATOM 1349 C CB  . PHE A 1 169 ? 49.965 47.065  3.503   1.00 35.58 ? 168 PHE A CB  1 
ATOM 1350 C CG  . PHE A 1 169 ? 50.560 45.712  3.454   1.00 32.82 ? 168 PHE A CG  1 
ATOM 1351 C CD1 . PHE A 1 169 ? 51.886 45.535  3.791   1.00 32.91 ? 168 PHE A CD1 1 
ATOM 1352 C CD2 . PHE A 1 169 ? 49.803 44.624  3.056   1.00 30.38 ? 168 PHE A CD2 1 
ATOM 1353 C CE1 . PHE A 1 169 ? 52.484 44.262  3.739   1.00 31.55 ? 168 PHE A CE1 1 
ATOM 1354 C CE2 . PHE A 1 169 ? 50.344 43.392  3.012   1.00 30.97 ? 168 PHE A CE2 1 
ATOM 1355 C CZ  . PHE A 1 169 ? 51.718 43.193  3.353   1.00 31.16 ? 168 PHE A CZ  1 
ATOM 1356 N N   . SER A 1 170 ? 48.250 48.673  1.322   1.00 31.37 ? 169 SER A N   1 
ATOM 1357 C CA  . SER A 1 170 ? 47.206 49.638  0.964   1.00 29.90 ? 169 SER A CA  1 
ATOM 1358 C C   . SER A 1 170 ? 46.410 50.075  2.183   1.00 28.49 ? 169 SER A C   1 
ATOM 1359 O O   . SER A 1 170 ? 45.968 51.184  2.264   1.00 28.00 ? 169 SER A O   1 
ATOM 1360 C CB  . SER A 1 170 ? 46.267 49.038  -0.088  1.00 29.46 ? 169 SER A CB  1 
ATOM 1361 O OG  . SER A 1 170 ? 45.558 47.937  0.472   1.00 30.25 ? 169 SER A OG  1 
ATOM 1362 N N   . LYS A 1 171 ? 46.237 49.177  3.137   1.00 27.74 ? 170 LYS A N   1 
ATOM 1363 C CA  . LYS A 1 171 ? 45.503 49.457  4.354   1.00 26.77 ? 170 LYS A CA  1 
ATOM 1364 C C   . LYS A 1 171 ? 46.366 49.190  5.621   1.00 25.91 ? 170 LYS A C   1 
ATOM 1365 O O   . LYS A 1 171 ? 47.332 48.454  5.582   1.00 25.77 ? 170 LYS A O   1 
ATOM 1366 C CB  . LYS A 1 171 ? 44.232 48.637  4.319   1.00 26.61 ? 170 LYS A CB  1 
ATOM 1367 C CG  . LYS A 1 171 ? 43.385 48.924  3.071   1.00 27.64 ? 170 LYS A CG  1 
ATOM 1368 C CD  . LYS A 1 171 ? 41.812 48.725  3.300   1.00 29.66 ? 170 LYS A CD  1 
ATOM 1369 C CE  . LYS A 1 171 ? 40.951 50.034  3.272   1.00 30.05 ? 170 LYS A CE  1 
ATOM 1370 N NZ  . LYS A 1 171 ? 39.515 49.960  3.821   1.00 29.60 ? 170 LYS A NZ  1 
ATOM 1371 N N   . ILE A 1 172 ? 46.065 49.889  6.706   1.00 25.32 ? 171 ILE A N   1 
ATOM 1372 C CA  . ILE A 1 172 ? 46.700 49.663  7.987   1.00 24.97 ? 171 ILE A CA  1 
ATOM 1373 C C   . ILE A 1 172 ? 45.616 49.195  8.952   1.00 25.21 ? 171 ILE A C   1 
ATOM 1374 O O   . ILE A 1 172 ? 44.418 49.291  8.642   1.00 23.96 ? 171 ILE A O   1 
ATOM 1375 C CB  . ILE A 1 172 ? 47.422 50.922  8.543   1.00 24.48 ? 171 ILE A CB  1 
ATOM 1376 C CG1 . ILE A 1 172 ? 46.482 52.120  8.652   1.00 23.51 ? 171 ILE A CG1 1 
ATOM 1377 C CG2 . ILE A 1 172 ? 48.626 51.269  7.713   1.00 25.32 ? 171 ILE A CG2 1 
ATOM 1378 C CD1 . ILE A 1 172 ? 47.156 53.359  9.125   1.00 22.42 ? 171 ILE A CD1 1 
ATOM 1379 N N   . VAL A 1 173 ? 46.058 48.689  10.112  1.00 25.45 ? 172 VAL A N   1 
ATOM 1380 C CA  . VAL A 1 173 ? 45.163 48.207  11.152  1.00 25.73 ? 172 VAL A CA  1 
ATOM 1381 C C   . VAL A 1 173 ? 45.464 48.932  12.447  1.00 26.16 ? 172 VAL A C   1 
ATOM 1382 O O   . VAL A 1 173 ? 46.588 48.884  12.942  1.00 25.33 ? 172 VAL A O   1 
ATOM 1383 C CB  . VAL A 1 173 ? 45.338 46.683  11.352  1.00 26.05 ? 172 VAL A CB  1 
ATOM 1384 C CG1 . VAL A 1 173 ? 44.253 46.087  12.254  1.00 25.19 ? 172 VAL A CG1 1 
ATOM 1385 C CG2 . VAL A 1 173 ? 45.320 45.977  10.001  1.00 26.61 ? 172 VAL A CG2 1 
ATOM 1386 N N   . ILE A 1 174 ? 44.429 49.562  12.999  1.00 27.05 ? 173 ILE A N   1 
ATOM 1387 C CA  . ILE A 1 174 ? 44.556 50.500  14.112  1.00 28.05 ? 173 ILE A CA  1 
ATOM 1388 C C   . ILE A 1 174 ? 43.502 50.301  15.192  1.00 30.07 ? 173 ILE A C   1 
ATOM 1389 O O   . ILE A 1 174 ? 42.508 49.584  14.954  1.00 30.95 ? 173 ILE A O   1 
ATOM 1390 C CB  . ILE A 1 174 ? 44.392 51.912  13.563  1.00 27.68 ? 173 ILE A CB  1 
ATOM 1391 C CG1 . ILE A 1 174 ? 43.015 52.089  12.930  1.00 25.12 ? 173 ILE A CG1 1 
ATOM 1392 C CG2 . ILE A 1 174 ? 45.489 52.221  12.504  1.00 28.05 ? 173 ILE A CG2 1 
ATOM 1393 C CD1 . ILE A 1 174 ? 42.650 53.492  12.699  1.00 23.99 ? 173 ILE A CD1 1 
ATOM 1394 N N   . GLU A 1 175 ? 43.683 50.960  16.351  1.00 31.42 ? 174 GLU A N   1 
ATOM 1395 C CA  . GLU A 1 175 ? 42.669 50.958  17.433  1.00 32.43 ? 174 GLU A CA  1 
ATOM 1396 C C   . GLU A 1 175 ? 42.090 52.365  17.586  1.00 33.00 ? 174 GLU A C   1 
ATOM 1397 O O   . GLU A 1 175 ? 42.777 53.272  18.024  1.00 32.69 ? 174 GLU A O   1 
ATOM 1398 C CB  . GLU A 1 175 ? 43.240 50.458  18.787  1.00 32.64 ? 174 GLU A CB  1 
ATOM 1399 C CG  . GLU A 1 175 ? 42.176 50.109  19.841  1.00 33.35 ? 174 GLU A CG  1 
ATOM 1400 C CD  . GLU A 1 175 ? 42.731 49.439  21.110  1.00 33.51 ? 174 GLU A CD  1 
ATOM 1401 O OE1 . GLU A 1 175 ? 43.378 50.136  21.901  1.00 34.23 ? 174 GLU A OE1 1 
ATOM 1402 O OE2 . GLU A 1 175 ? 42.488 48.232  21.351  1.00 31.53 ? 174 GLU A OE2 1 
ATOM 1403 N N   . GLU A 1 176 ? 40.817 52.509  17.203  1.00 34.16 ? 175 GLU A N   1 
ATOM 1404 C CA  . GLU A 1 176 ? 40.001 53.701  17.405  1.00 34.69 ? 175 GLU A CA  1 
ATOM 1405 C C   . GLU A 1 176 ? 38.922 53.372  18.468  1.00 35.47 ? 175 GLU A C   1 
ATOM 1406 O O   . GLU A 1 176 ? 38.048 52.542  18.217  1.00 35.37 ? 175 GLU A O   1 
ATOM 1407 C CB  . GLU A 1 176 ? 39.310 54.050  16.084  1.00 34.54 ? 175 GLU A CB  1 
ATOM 1408 C CG  . GLU A 1 176 ? 39.621 55.411  15.515  1.00 35.23 ? 175 GLU A CG  1 
ATOM 1409 C CD  . GLU A 1 176 ? 38.994 55.621  14.130  1.00 35.01 ? 175 GLU A CD  1 
ATOM 1410 O OE1 . GLU A 1 176 ? 37.802 55.302  13.958  1.00 34.86 ? 175 GLU A OE1 1 
ATOM 1411 O OE2 . GLU A 1 176 ? 39.689 56.096  13.201  1.00 34.79 ? 175 GLU A OE2 1 
ATOM 1412 N N   . ASN A 1 177 ? 38.984 54.001  19.646  1.00 36.24 ? 176 ASN A N   1 
ATOM 1413 C CA  . ASN A 1 177 ? 37.873 53.966  20.614  1.00 36.76 ? 176 ASN A CA  1 
ATOM 1414 C C   . ASN A 1 177 ? 37.535 52.566  21.090  1.00 37.39 ? 176 ASN A C   1 
ATOM 1415 O O   . ASN A 1 177 ? 36.347 52.179  21.190  1.00 37.98 ? 176 ASN A O   1 
ATOM 1416 C CB  . ASN A 1 177 ? 36.620 54.653  20.017  1.00 36.83 ? 176 ASN A CB  1 
ATOM 1417 C CG  . ASN A 1 177 ? 36.834 56.168  19.791  1.00 37.71 ? 176 ASN A CG  1 
ATOM 1418 O OD1 . ASN A 1 177 ? 36.489 56.717  18.723  1.00 35.01 ? 176 ASN A OD1 1 
ATOM 1419 N ND2 . ASN A 1 177 ? 37.417 56.847  20.814  1.00 36.82 ? 176 ASN A ND2 1 
ATOM 1420 N N   . GLY A 1 178 ? 38.584 51.792  21.382  1.00 38.12 ? 177 GLY A N   1 
ATOM 1421 C CA  . GLY A 1 178 ? 38.434 50.407  21.804  1.00 38.15 ? 177 GLY A CA  1 
ATOM 1422 C C   . GLY A 1 178 ? 38.335 49.431  20.646  1.00 38.37 ? 177 GLY A C   1 
ATOM 1423 O O   . GLY A 1 178 ? 38.852 48.339  20.775  1.00 39.71 ? 177 GLY A O   1 
ATOM 1424 N N   . GLU A 1 179 ? 37.711 49.821  19.530  1.00 37.84 ? 178 GLU A N   1 
ATOM 1425 C CA  . GLU A 1 179 ? 37.413 48.938  18.414  1.00 38.01 ? 178 GLU A CA  1 
ATOM 1426 C C   . GLU A 1 179 ? 38.564 48.788  17.373  1.00 38.07 ? 178 GLU A C   1 
ATOM 1427 O O   . GLU A 1 179 ? 39.325 49.718  17.125  1.00 38.14 ? 178 GLU A O   1 
ATOM 1428 C CB  . GLU A 1 179 ? 36.099 49.420  17.731  1.00 38.21 ? 178 GLU A CB  1 
ATOM 1429 C CG  . GLU A 1 179 ? 35.805 48.838  16.341  1.00 38.68 ? 178 GLU A CG  1 
ATOM 1430 C CD  . GLU A 1 179 ? 34.336 48.933  15.948  1.00 41.76 ? 178 GLU A CD  1 
ATOM 1431 O OE1 . GLU A 1 179 ? 34.018 49.599  14.908  1.00 44.41 ? 178 GLU A OE1 1 
ATOM 1432 O OE2 . GLU A 1 179 ? 33.484 48.335  16.669  1.00 42.22 ? 178 GLU A OE2 1 
ATOM 1433 N N   . VAL A 1 180 ? 38.649 47.612  16.749  1.00 37.90 ? 179 VAL A N   1 
ATOM 1434 C CA  . VAL A 1 180 ? 39.604 47.341  15.677  1.00 37.95 ? 179 VAL A CA  1 
ATOM 1435 C C   . VAL A 1 180 ? 39.061 47.797  14.314  1.00 38.28 ? 179 VAL A C   1 
ATOM 1436 O O   . VAL A 1 180 ? 37.885 47.568  13.983  1.00 37.92 ? 179 VAL A O   1 
ATOM 1437 C CB  . VAL A 1 180 ? 39.965 45.821  15.609  1.00 38.17 ? 179 VAL A CB  1 
ATOM 1438 C CG1 . VAL A 1 180 ? 40.883 45.489  14.390  1.00 37.80 ? 179 VAL A CG1 1 
ATOM 1439 C CG2 . VAL A 1 180 ? 40.611 45.363  16.909  1.00 37.30 ? 179 VAL A CG2 1 
ATOM 1440 N N   . LYS A 1 181 ? 39.948 48.402  13.515  1.00 38.49 ? 180 LYS A N   1 
ATOM 1441 C CA  . LYS A 1 181 ? 39.553 49.043  12.274  1.00 38.84 ? 180 LYS A CA  1 
ATOM 1442 C C   . LYS A 1 181 ? 40.581 48.924  11.129  1.00 38.61 ? 180 LYS A C   1 
ATOM 1443 O O   . LYS A 1 181 ? 41.670 49.469  11.203  1.00 38.47 ? 180 LYS A O   1 
ATOM 1444 C CB  . LYS A 1 181 ? 39.268 50.526  12.550  1.00 39.14 ? 180 LYS A CB  1 
ATOM 1445 C CG  . LYS A 1 181 ? 38.008 50.773  13.405  1.00 40.46 ? 180 LYS A CG  1 
ATOM 1446 C CD  . LYS A 1 181 ? 37.337 52.113  13.105  1.00 41.92 ? 180 LYS A CD  1 
ATOM 1447 C CE  . LYS A 1 181 ? 36.003 52.264  13.864  1.00 42.52 ? 180 LYS A CE  1 
ATOM 1448 N NZ  . LYS A 1 181 ? 36.113 53.341  14.889  1.00 42.57 ? 180 LYS A NZ  1 
ATOM 1449 N N   . VAL A 1 182 ? 40.194 48.250  10.051  1.00 38.43 ? 181 VAL A N   1 
ATOM 1450 C CA  . VAL A 1 182 ? 40.999 48.246  8.828   1.00 38.29 ? 181 VAL A CA  1 
ATOM 1451 C C   . VAL A 1 182 ? 40.657 49.483  8.009   1.00 38.62 ? 181 VAL A C   1 
ATOM 1452 O O   . VAL A 1 182 ? 39.563 49.602  7.468   1.00 38.63 ? 181 VAL A O   1 
ATOM 1453 C CB  . VAL A 1 182 ? 40.714 47.025  7.966   1.00 37.96 ? 181 VAL A CB  1 
ATOM 1454 C CG1 . VAL A 1 182 ? 41.796 46.867  6.914   1.00 37.08 ? 181 VAL A CG1 1 
ATOM 1455 C CG2 . VAL A 1 182 ? 40.588 45.778  8.838   1.00 37.66 ? 181 VAL A CG2 1 
ATOM 1456 N N   . VAL A 1 183 ? 41.584 50.418  7.933   1.00 38.82 ? 182 VAL A N   1 
ATOM 1457 C CA  . VAL A 1 183 ? 41.346 51.663  7.208   1.00 38.94 ? 182 VAL A CA  1 
ATOM 1458 C C   . VAL A 1 183 ? 42.459 51.920  6.184   1.00 39.50 ? 182 VAL A C   1 
ATOM 1459 O O   . VAL A 1 183 ? 43.461 51.200  6.156   1.00 39.43 ? 182 VAL A O   1 
ATOM 1460 C CB  . VAL A 1 183 ? 41.315 52.823  8.166   1.00 38.49 ? 182 VAL A CB  1 
ATOM 1461 C CG1 . VAL A 1 183 ? 40.412 52.507  9.338   1.00 39.27 ? 182 VAL A CG1 1 
ATOM 1462 C CG2 . VAL A 1 183 ? 42.733 53.111  8.645   1.00 38.99 ? 182 VAL A CG2 1 
ATOM 1463 N N   . ASP A 1 184 ? 42.295 52.956  5.358   1.00 39.82 ? 183 ASP A N   1 
ATOM 1464 C CA  . ASP A 1 184 ? 43.311 53.284  4.360   1.00 39.90 ? 183 ASP A CA  1 
ATOM 1465 C C   . ASP A 1 184 ? 44.634 53.725  4.987   1.00 40.09 ? 183 ASP A C   1 
ATOM 1466 O O   . ASP A 1 184 ? 44.662 54.324  6.056   1.00 39.88 ? 183 ASP A O   1 
ATOM 1467 C CB  . ASP A 1 184 ? 42.831 54.373  3.399   1.00 39.85 ? 183 ASP A CB  1 
ATOM 1468 C CG  . ASP A 1 184 ? 41.848 53.864  2.365   1.00 40.07 ? 183 ASP A CG  1 
ATOM 1469 O OD1 . ASP A 1 184 ? 41.759 52.654  2.136   1.00 38.04 ? 183 ASP A OD1 1 
ATOM 1470 O OD2 . ASP A 1 184 ? 41.100 54.627  1.718   1.00 41.89 ? 183 ASP A OD2 1 
ATOM 1471 N N   . ASN A 1 185 ? 45.715 53.440  4.259   1.00 40.47 ? 184 ASN A N   1 
ATOM 1472 C CA  . ASN A 1 185 ? 47.076 53.826  4.598   1.00 40.37 ? 184 ASN A CA  1 
ATOM 1473 C C   . ASN A 1 185 ? 47.384 55.107  3.822   1.00 40.96 ? 184 ASN A C   1 
ATOM 1474 O O   . ASN A 1 185 ? 47.359 55.102  2.580   1.00 40.17 ? 184 ASN A O   1 
ATOM 1475 C CB  . ASN A 1 185 ? 48.058 52.688  4.217   1.00 40.34 ? 184 ASN A CB  1 
ATOM 1476 C CG  . ASN A 1 185 ? 49.519 52.915  4.703   1.00 39.11 ? 184 ASN A CG  1 
ATOM 1477 O OD1 . ASN A 1 185 ? 49.821 53.823  5.478   1.00 38.75 ? 184 ASN A OD1 1 
ATOM 1478 N ND2 . ASN A 1 185 ? 50.415 52.068  4.233   1.00 35.60 ? 184 ASN A ND2 1 
ATOM 1479 N N   . PRO A 1 186 ? 47.658 56.200  4.543   1.00 41.84 ? 185 PRO A N   1 
ATOM 1480 C CA  . PRO A 1 186 ? 47.994 57.469  3.907   1.00 42.51 ? 185 PRO A CA  1 
ATOM 1481 C C   . PRO A 1 186 ? 49.316 57.433  3.140   1.00 43.63 ? 185 PRO A C   1 
ATOM 1482 O O   . PRO A 1 186 ? 49.449 58.204  2.165   1.00 44.25 ? 185 PRO A O   1 
ATOM 1483 C CB  . PRO A 1 186 ? 48.078 58.418  5.082   1.00 42.35 ? 185 PRO A CB  1 
ATOM 1484 C CG  . PRO A 1 186 ? 48.387 57.560  6.228   1.00 41.96 ? 185 PRO A CG  1 
ATOM 1485 C CD  . PRO A 1 186 ? 47.643 56.334  6.007   1.00 41.85 ? 185 PRO A CD  1 
ATOM 1486 N N   . ARG A 1 187 ? 50.246 56.553  3.527   1.00 44.20 ? 186 ARG A N   1 
ATOM 1487 C CA  . ARG A 1 187 ? 51.562 56.458  2.848   1.00 44.95 ? 186 ARG A CA  1 
ATOM 1488 C C   . ARG A 1 187 ? 51.634 55.561  1.592   1.00 45.43 ? 186 ARG A C   1 
ATOM 1489 O O   . ARG A 1 187 ? 52.757 55.289  1.109   1.00 45.19 ? 186 ARG A O   1 
ATOM 1490 C CB  . ARG A 1 187 ? 52.640 55.945  3.813   1.00 45.06 ? 186 ARG A CB  1 
ATOM 1491 C CG  . ARG A 1 187 ? 52.685 56.659  5.162   1.00 45.95 ? 186 ARG A CG  1 
ATOM 1492 C CD  . ARG A 1 187 ? 53.854 56.233  6.016   1.00 45.38 ? 186 ARG A CD  1 
ATOM 1493 N NE  . ARG A 1 187 ? 53.914 54.785  6.108   1.00 46.16 ? 186 ARG A NE  1 
ATOM 1494 C CZ  . ARG A 1 187 ? 54.891 54.122  6.722   1.00 47.65 ? 186 ARG A CZ  1 
ATOM 1495 N NH1 . ARG A 1 187 ? 54.872 52.786  6.739   1.00 47.72 ? 186 ARG A NH1 1 
ATOM 1496 N NH2 . ARG A 1 187 ? 55.884 54.783  7.335   1.00 46.85 ? 186 ARG A NH2 1 
ATOM 1497 N N   . TRP A 1 188 ? 50.470 55.103  1.083   1.00 45.77 ? 187 TRP A N   1 
ATOM 1498 C CA  . TRP A 1 188 ? 50.423 54.135  -0.033  1.00 45.69 ? 187 TRP A CA  1 
ATOM 1499 C C   . TRP A 1 188 ? 50.007 54.884  -1.277  1.00 45.34 ? 187 TRP A C   1 
ATOM 1500 O O   . TRP A 1 188 ? 48.929 55.471  -1.300  1.00 45.84 ? 187 TRP A O   1 
ATOM 1501 C CB  . TRP A 1 188 ? 49.451 52.976  0.281   1.00 45.55 ? 187 TRP A CB  1 
ATOM 1502 C CG  . TRP A 1 188 ? 48.809 52.317  -0.932  1.00 46.63 ? 187 TRP A CG  1 
ATOM 1503 C CD1 . TRP A 1 188 ? 47.592 52.639  -1.511  1.00 47.35 ? 187 TRP A CD1 1 
ATOM 1504 C CD2 . TRP A 1 188 ? 49.330 51.217  -1.704  1.00 46.63 ? 187 TRP A CD2 1 
ATOM 1505 N NE1 . TRP A 1 188 ? 47.347 51.824  -2.598  1.00 46.61 ? 187 TRP A NE1 1 
ATOM 1506 C CE2 . TRP A 1 188 ? 48.386 50.945  -2.741  1.00 46.09 ? 187 TRP A CE2 1 
ATOM 1507 C CE3 . TRP A 1 188 ? 50.498 50.440  -1.632  1.00 45.88 ? 187 TRP A CE3 1 
ATOM 1508 C CZ2 . TRP A 1 188 ? 48.577 49.951  -3.683  1.00 46.56 ? 187 TRP A CZ2 1 
ATOM 1509 C CZ3 . TRP A 1 188 ? 50.692 49.445  -2.575  1.00 46.81 ? 187 TRP A CZ3 1 
ATOM 1510 C CH2 . TRP A 1 188 ? 49.740 49.209  -3.594  1.00 47.24 ? 187 TRP A CH2 1 
ATOM 1511 N N   . LYS A 1 189 ? 50.860 54.858  -2.296  0.50 45.15 ? 188 LYS A N   1 
ATOM 1512 C CA  . LYS A 1 189 ? 50.685 55.679  -3.492  0.50 44.98 ? 188 LYS A CA  1 
ATOM 1513 C C   . LYS A 1 189 ? 49.918 54.929  -4.592  0.50 44.50 ? 188 LYS A C   1 
ATOM 1514 O O   . LYS A 1 189 ? 49.945 53.703  -4.651  0.50 43.77 ? 188 LYS A O   1 
ATOM 1515 C CB  . LYS A 1 189 ? 52.067 56.148  -3.998  0.50 45.01 ? 188 LYS A CB  1 
ATOM 1516 C CG  . LYS A 1 189 ? 52.527 57.466  -3.393  0.50 44.93 ? 188 LYS A CG  1 
ATOM 1517 C CD  . LYS A 1 189 ? 54.044 57.671  -3.506  0.50 45.18 ? 188 LYS A CD  1 
ATOM 1518 C CE  . LYS A 1 189 ? 54.726 57.698  -2.128  0.50 45.13 ? 188 LYS A CE  1 
ATOM 1519 N NZ  . LYS A 1 189 ? 56.105 58.272  -2.214  0.50 44.30 ? 188 LYS A NZ  1 
ATOM 1520 N N   . MET B 1 1   ? 43.639 40.633  -13.901 1.00 41.40 ? 0   MET B N   1 
ATOM 1521 C CA  . MET B 1 1   ? 43.905 39.219  -13.491 1.00 41.57 ? 0   MET B CA  1 
ATOM 1522 C C   . MET B 1 1   ? 42.731 38.617  -12.767 1.00 40.81 ? 0   MET B C   1 
ATOM 1523 O O   . MET B 1 1   ? 41.967 39.307  -12.064 1.00 39.83 ? 0   MET B O   1 
ATOM 1524 C CB  . MET B 1 1   ? 45.097 39.102  -12.509 1.00 42.27 ? 0   MET B CB  1 
ATOM 1525 C CG  . MET B 1 1   ? 46.490 38.936  -13.171 1.00 44.02 ? 0   MET B CG  1 
ATOM 1526 S SD  . MET B 1 1   ? 46.750 40.219  -14.490 1.00 44.97 ? 0   MET B SD  1 
ATOM 1527 C CE  . MET B 1 1   ? 46.385 41.663  -13.671 1.00 42.95 ? 0   MET B CE  1 
ATOM 1528 N N   . MET B 1 2   ? 42.661 37.298  -12.883 1.00 40.18 ? 1   MET B N   1 
ATOM 1529 C CA  . MET B 1 2   ? 41.823 36.519  -12.005 1.00 39.43 ? 1   MET B CA  1 
ATOM 1530 C C   . MET B 1 2   ? 42.667 35.946  -10.823 1.00 37.53 ? 1   MET B C   1 
ATOM 1531 O O   . MET B 1 2   ? 43.562 35.112  -11.026 1.00 37.69 ? 1   MET B O   1 
ATOM 1532 C CB  . MET B 1 2   ? 41.113 35.446  -12.827 1.00 39.95 ? 1   MET B CB  1 
ATOM 1533 C CG  . MET B 1 2   ? 39.679 35.179  -12.287 1.00 42.32 ? 1   MET B CG  1 
ATOM 1534 S SD  . MET B 1 2   ? 39.589 35.084  -10.401 1.00 44.93 ? 1   MET B SD  1 
ATOM 1535 C CE  . MET B 1 2   ? 40.331 33.509  -10.098 1.00 43.32 ? 1   MET B CE  1 
ATOM 1536 N N   . TYR B 1 3   ? 42.398 36.433  -9.610  1.00 34.86 ? 2   TYR B N   1 
ATOM 1537 C CA  . TYR B 1 3   ? 43.043 35.929  -8.392  1.00 33.48 ? 2   TYR B CA  1 
ATOM 1538 C C   . TYR B 1 3   ? 42.080 35.045  -7.543  1.00 32.37 ? 2   TYR B C   1 
ATOM 1539 O O   . TYR B 1 3   ? 40.865 35.345  -7.415  1.00 32.10 ? 2   TYR B O   1 
ATOM 1540 C CB  . TYR B 1 3   ? 43.520 37.096  -7.521  1.00 33.05 ? 2   TYR B CB  1 
ATOM 1541 C CG  . TYR B 1 3   ? 44.545 38.020  -8.132  1.00 32.30 ? 2   TYR B CG  1 
ATOM 1542 C CD1 . TYR B 1 3   ? 44.313 39.400  -8.210  1.00 31.72 ? 2   TYR B CD1 1 
ATOM 1543 C CD2 . TYR B 1 3   ? 45.770 37.530  -8.603  1.00 32.12 ? 2   TYR B CD2 1 
ATOM 1544 C CE1 . TYR B 1 3   ? 45.274 40.276  -8.779  1.00 31.45 ? 2   TYR B CE1 1 
ATOM 1545 C CE2 . TYR B 1 3   ? 46.735 38.381  -9.153  1.00 30.77 ? 2   TYR B CE2 1 
ATOM 1546 C CZ  . TYR B 1 3   ? 46.484 39.757  -9.246  1.00 31.80 ? 2   TYR B CZ  1 
ATOM 1547 O OH  . TYR B 1 3   ? 47.436 40.599  -9.813  1.00 30.01 ? 2   TYR B OH  1 
ATOM 1548 N N   . LYS B 1 4   ? 42.604 33.991  -6.920  1.00 30.50 ? 3   LYS B N   1 
ATOM 1549 C CA  . LYS B 1 4   ? 41.765 33.253  -5.981  1.00 29.92 ? 3   LYS B CA  1 
ATOM 1550 C C   . LYS B 1 4   ? 41.480 34.061  -4.671  1.00 29.96 ? 3   LYS B C   1 
ATOM 1551 O O   . LYS B 1 4   ? 42.295 34.883  -4.233  1.00 29.93 ? 3   LYS B O   1 
ATOM 1552 C CB  . LYS B 1 4   ? 42.369 31.917  -5.676  1.00 29.27 ? 3   LYS B CB  1 
ATOM 1553 C CG  . LYS B 1 4   ? 42.459 31.044  -6.881  1.00 29.01 ? 3   LYS B CG  1 
ATOM 1554 C CD  . LYS B 1 4   ? 43.446 29.908  -6.676  1.00 28.80 ? 3   LYS B CD  1 
ATOM 1555 C CE  . LYS B 1 4   ? 42.832 28.733  -5.950  1.00 28.44 ? 3   LYS B CE  1 
ATOM 1556 N NZ  . LYS B 1 4   ? 43.367 27.428  -6.464  1.00 29.16 ? 3   LYS B NZ  1 
ATOM 1557 N N   . GLU B 1 5   ? 40.292 33.852  -4.078  1.00 29.37 ? 4   GLU B N   1 
ATOM 1558 C CA  . GLU B 1 5   ? 39.922 34.483  -2.804  1.00 28.02 ? 4   GLU B CA  1 
ATOM 1559 C C   . GLU B 1 5   ? 40.651 33.777  -1.648  1.00 26.38 ? 4   GLU B C   1 
ATOM 1560 O O   . GLU B 1 5   ? 40.570 32.578  -1.515  1.00 26.40 ? 4   GLU B O   1 
ATOM 1561 C CB  . GLU B 1 5   ? 38.407 34.347  -2.613  1.00 28.15 ? 4   GLU B CB  1 
ATOM 1562 C CG  . GLU B 1 5   ? 37.816 35.124  -1.448  1.00 29.77 ? 4   GLU B CG  1 
ATOM 1563 C CD  . GLU B 1 5   ? 37.943 36.654  -1.643  1.00 35.63 ? 4   GLU B CD  1 
ATOM 1564 O OE1 . GLU B 1 5   ? 38.222 37.086  -2.851  1.00 31.76 ? 4   GLU B OE1 1 
ATOM 1565 O OE2 . GLU B 1 5   ? 37.759 37.422  -0.580  1.00 35.86 ? 4   GLU B OE2 1 
ATOM 1566 N N   . PRO B 1 6   ? 41.373 34.510  -0.824  1.00 25.01 ? 5   PRO B N   1 
ATOM 1567 C CA  . PRO B 1 6   ? 41.839 33.983  0.467   1.00 24.03 ? 5   PRO B CA  1 
ATOM 1568 C C   . PRO B 1 6   ? 40.659 33.712  1.377   1.00 23.65 ? 5   PRO B C   1 
ATOM 1569 O O   . PRO B 1 6   ? 39.612 34.312  1.216   1.00 24.21 ? 5   PRO B O   1 
ATOM 1570 C CB  . PRO B 1 6   ? 42.639 35.127  1.066   1.00 23.64 ? 5   PRO B CB  1 
ATOM 1571 C CG  . PRO B 1 6   ? 42.929 36.054  -0.096  1.00 24.85 ? 5   PRO B CG  1 
ATOM 1572 C CD  . PRO B 1 6   ? 41.802 35.898  -1.068  1.00 25.28 ? 5   PRO B CD  1 
ATOM 1573 N N   . PHE B 1 7   ? 40.833 32.834  2.350   1.00 22.99 ? 6   PHE B N   1 
ATOM 1574 C CA  . PHE B 1 7   ? 39.819 32.626  3.358   1.00 22.04 ? 6   PHE B CA  1 
ATOM 1575 C C   . PHE B 1 7   ? 40.391 32.040  4.630   1.00 21.37 ? 6   PHE B C   1 
ATOM 1576 O O   . PHE B 1 7   ? 41.490 31.487  4.638   1.00 19.84 ? 6   PHE B O   1 
ATOM 1577 C CB  . PHE B 1 7   ? 38.734 31.700  2.818   1.00 22.10 ? 6   PHE B CB  1 
ATOM 1578 C CG  . PHE B 1 7   ? 39.273 30.401  2.287   1.00 23.33 ? 6   PHE B CG  1 
ATOM 1579 C CD1 . PHE B 1 7   ? 39.562 30.253  0.927   1.00 21.48 ? 6   PHE B CD1 1 
ATOM 1580 C CD2 . PHE B 1 7   ? 39.506 29.327  3.157   1.00 25.27 ? 6   PHE B CD2 1 
ATOM 1581 C CE1 . PHE B 1 7   ? 40.038 29.089  0.427   1.00 21.86 ? 6   PHE B CE1 1 
ATOM 1582 C CE2 . PHE B 1 7   ? 40.012 28.106  2.669   1.00 24.97 ? 6   PHE B CE2 1 
ATOM 1583 C CZ  . PHE B 1 7   ? 40.271 27.986  1.294   1.00 25.61 ? 6   PHE B CZ  1 
ATOM 1584 N N   . GLY B 1 8   ? 39.591 32.158  5.693   1.00 21.48 ? 7   GLY B N   1 
ATOM 1585 C CA  . GLY B 1 8   ? 39.797 31.434  6.922   1.00 21.92 ? 7   GLY B CA  1 
ATOM 1586 C C   . GLY B 1 8   ? 38.841 30.273  7.011   1.00 21.80 ? 7   GLY B C   1 
ATOM 1587 O O   . GLY B 1 8   ? 37.803 30.302  6.446   1.00 22.32 ? 7   GLY B O   1 
ATOM 1588 N N   . VAL B 1 9   ? 39.235 29.212  7.679   1.00 22.64 ? 8   VAL B N   1 
ATOM 1589 C CA  . VAL B 1 9   ? 38.301 28.195  8.130   1.00 22.94 ? 8   VAL B CA  1 
ATOM 1590 C C   . VAL B 1 9   ? 38.591 27.920  9.596   1.00 24.07 ? 8   VAL B C   1 
ATOM 1591 O O   . VAL B 1 9   ? 39.635 28.302  10.140  1.00 24.23 ? 8   VAL B O   1 
ATOM 1592 C CB  . VAL B 1 9   ? 38.404 26.889  7.340   1.00 22.59 ? 8   VAL B CB  1 
ATOM 1593 C CG1 . VAL B 1 9   ? 38.160 27.157  5.885   1.00 21.79 ? 8   VAL B CG1 1 
ATOM 1594 C CG2 . VAL B 1 9   ? 39.748 26.193  7.557   1.00 22.16 ? 8   VAL B CG2 1 
ATOM 1595 N N   . LYS B 1 10  ? 37.668 27.237  10.242  1.00 25.22 ? 9   LYS B N   1 
ATOM 1596 C CA  . LYS B 1 10  ? 37.807 26.978  11.674  1.00 26.71 ? 9   LYS B CA  1 
ATOM 1597 C C   . LYS B 1 10  ? 38.007 25.469  11.952  1.00 26.21 ? 9   LYS B C   1 
ATOM 1598 O O   . LYS B 1 10  ? 37.149 24.640  11.631  1.00 26.60 ? 9   LYS B O   1 
ATOM 1599 C CB  . LYS B 1 10  ? 36.586 27.572  12.444  1.00 27.46 ? 9   LYS B CB  1 
ATOM 1600 C CG  . LYS B 1 10  ? 36.272 29.081  12.070  1.00 29.63 ? 9   LYS B CG  1 
ATOM 1601 C CD  . LYS B 1 10  ? 34.992 29.661  12.727  1.00 32.90 ? 9   LYS B CD  1 
ATOM 1602 C CE  . LYS B 1 10  ? 35.117 29.705  14.314  1.00 35.52 ? 9   LYS B CE  1 
ATOM 1603 N NZ  . LYS B 1 10  ? 34.134 28.749  15.068  1.00 34.98 ? 9   LYS B NZ  1 
ATOM 1604 N N   . VAL B 1 11  ? 39.161 25.142  12.525  1.00 25.78 ? 10  VAL B N   1 
ATOM 1605 C CA  . VAL B 1 11  ? 39.527 23.791  12.851  1.00 25.67 ? 10  VAL B CA  1 
ATOM 1606 C C   . VAL B 1 11  ? 39.466 23.625  14.355  1.00 26.37 ? 10  VAL B C   1 
ATOM 1607 O O   . VAL B 1 11  ? 40.071 24.398  15.120  1.00 26.49 ? 10  VAL B O   1 
ATOM 1608 C CB  . VAL B 1 11  ? 40.966 23.439  12.374  1.00 25.66 ? 10  VAL B CB  1 
ATOM 1609 C CG1 . VAL B 1 11  ? 41.273 22.026  12.690  1.00 26.05 ? 10  VAL B CG1 1 
ATOM 1610 C CG2 . VAL B 1 11  ? 41.137 23.663  10.864  1.00 25.64 ? 10  VAL B CG2 1 
ATOM 1611 N N   . ASP B 1 12  ? 38.740 22.592  14.791  1.00 26.44 ? 11  ASP B N   1 
ATOM 1612 C CA  . ASP B 1 12  ? 38.609 22.298  16.207  1.00 25.96 ? 11  ASP B CA  1 
ATOM 1613 C C   . ASP B 1 12  ? 39.765 21.405  16.551  1.00 25.70 ? 11  ASP B C   1 
ATOM 1614 O O   . ASP B 1 12  ? 39.950 20.388  15.882  1.00 25.90 ? 11  ASP B O   1 
ATOM 1615 C CB  . ASP B 1 12  ? 37.289 21.573  16.470  1.00 26.17 ? 11  ASP B CB  1 
ATOM 1616 C CG  . ASP B 1 12  ? 36.803 21.742  17.911  1.00 26.46 ? 11  ASP B CG  1 
ATOM 1617 O OD1 . ASP B 1 12  ? 37.625 21.575  18.839  1.00 25.40 ? 11  ASP B OD1 1 
ATOM 1618 O OD2 . ASP B 1 12  ? 35.612 22.010  18.205  1.00 24.51 ? 11  ASP B OD2 1 
ATOM 1619 N N   . PHE B 1 13  ? 40.550 21.763  17.567  1.00 24.88 ? 12  PHE B N   1 
ATOM 1620 C CA  . PHE B 1 13  ? 41.733 20.975  17.893  1.00 25.08 ? 12  PHE B CA  1 
ATOM 1621 C C   . PHE B 1 13  ? 41.374 19.918  18.867  1.00 25.70 ? 12  PHE B C   1 
ATOM 1622 O O   . PHE B 1 13  ? 42.230 19.088  19.238  1.00 25.37 ? 12  PHE B O   1 
ATOM 1623 C CB  . PHE B 1 13  ? 42.847 21.829  18.487  1.00 25.22 ? 12  PHE B CB  1 
ATOM 1624 C CG  . PHE B 1 13  ? 43.555 22.717  17.510  1.00 23.68 ? 12  PHE B CG  1 
ATOM 1625 C CD1 . PHE B 1 13  ? 43.193 22.768  16.141  1.00 23.60 ? 12  PHE B CD1 1 
ATOM 1626 C CD2 . PHE B 1 13  ? 44.577 23.505  17.948  1.00 22.22 ? 12  PHE B CD2 1 
ATOM 1627 C CE1 . PHE B 1 13  ? 43.862 23.579  15.259  1.00 21.90 ? 12  PHE B CE1 1 
ATOM 1628 C CE2 . PHE B 1 13  ? 45.250 24.343  17.054  1.00 23.37 ? 12  PHE B CE2 1 
ATOM 1629 C CZ  . PHE B 1 13  ? 44.899 24.385  15.716  1.00 21.37 ? 12  PHE B CZ  1 
ATOM 1630 N N   . GLU B 1 14  ? 40.109 19.958  19.311  1.00 26.39 ? 13  GLU B N   1 
ATOM 1631 C CA  . GLU B 1 14  ? 39.575 18.920  20.197  1.00 26.12 ? 13  GLU B CA  1 
ATOM 1632 C C   . GLU B 1 14  ? 38.853 17.886  19.395  1.00 25.63 ? 13  GLU B C   1 
ATOM 1633 O O   . GLU B 1 14  ? 38.755 16.767  19.843  1.00 27.72 ? 13  GLU B O   1 
ATOM 1634 C CB  . GLU B 1 14  ? 38.658 19.496  21.287  1.00 26.16 ? 13  GLU B CB  1 
ATOM 1635 C CG  . GLU B 1 14  ? 39.345 20.366  22.330  1.00 26.45 ? 13  GLU B CG  1 
ATOM 1636 C CD  . GLU B 1 14  ? 40.352 19.629  23.209  1.00 27.70 ? 13  GLU B CD  1 
ATOM 1637 O OE1 . GLU B 1 14  ? 40.063 18.552  23.762  1.00 27.81 ? 13  GLU B OE1 1 
ATOM 1638 O OE2 . GLU B 1 14  ? 41.464 20.143  23.374  1.00 29.00 ? 13  GLU B OE2 1 
ATOM 1639 N N   . THR B 1 15  ? 38.364 18.209  18.214  1.00 24.98 ? 14  THR B N   1 
ATOM 1640 C CA  . THR B 1 15  ? 37.617 17.212  17.437  1.00 25.37 ? 14  THR B CA  1 
ATOM 1641 C C   . THR B 1 15  ? 38.080 16.910  15.985  1.00 25.25 ? 14  THR B C   1 
ATOM 1642 O O   . THR B 1 15  ? 37.540 16.017  15.353  1.00 24.68 ? 14  THR B O   1 
ATOM 1643 C CB  . THR B 1 15  ? 36.089 17.577  17.379  1.00 26.01 ? 14  THR B CB  1 
ATOM 1644 O OG1 . THR B 1 15  ? 35.787 18.299  16.167  1.00 24.92 ? 14  THR B OG1 1 
ATOM 1645 C CG2 . THR B 1 15  ? 35.672 18.545  18.501  1.00 26.91 ? 14  THR B CG2 1 
ATOM 1646 N N   . GLY B 1 16  ? 39.042 17.648  15.451  1.00 24.83 ? 15  GLY B N   1 
ATOM 1647 C CA  . GLY B 1 16  ? 39.399 17.507  14.060  1.00 24.37 ? 15  GLY B CA  1 
ATOM 1648 C C   . GLY B 1 16  ? 38.479 18.183  13.037  1.00 24.48 ? 15  GLY B C   1 
ATOM 1649 O O   . GLY B 1 16  ? 38.951 18.561  11.956  1.00 24.06 ? 15  GLY B O   1 
ATOM 1650 N N   . ILE B 1 17  ? 37.197 18.360  13.364  1.00 24.99 ? 16  ILE B N   1 
ATOM 1651 C CA  . ILE B 1 17  ? 36.181 18.839  12.390  1.00 25.64 ? 16  ILE B CA  1 
ATOM 1652 C C   . ILE B 1 17  ? 36.512 20.214  11.819  1.00 25.99 ? 16  ILE B C   1 
ATOM 1653 O O   . ILE B 1 17  ? 36.470 21.203  12.514  1.00 26.69 ? 16  ILE B O   1 
ATOM 1654 C CB  . ILE B 1 17  ? 34.734 18.893  13.015  1.00 25.15 ? 16  ILE B CB  1 
ATOM 1655 C CG1 . ILE B 1 17  ? 34.161 17.511  13.298  1.00 24.78 ? 16  ILE B CG1 1 
ATOM 1656 C CG2 . ILE B 1 17  ? 33.775 19.552  12.088  1.00 26.03 ? 16  ILE B CG2 1 
ATOM 1657 C CD1 . ILE B 1 17  ? 33.109 17.540  14.340  1.00 24.25 ? 16  ILE B CD1 1 
ATOM 1658 N N   . ILE B 1 18  ? 36.809 20.272  10.534  1.00 26.84 ? 17  ILE B N   1 
ATOM 1659 C CA  . ILE B 1 18  ? 36.803 21.543  9.807   1.00 27.19 ? 17  ILE B CA  1 
ATOM 1660 C C   . ILE B 1 18  ? 35.352 21.786  9.310   1.00 27.39 ? 17  ILE B C   1 
ATOM 1661 O O   . ILE B 1 18  ? 34.759 20.965  8.561   1.00 26.44 ? 17  ILE B O   1 
ATOM 1662 C CB  . ILE B 1 18  ? 37.845 21.509  8.588   1.00 27.45 ? 17  ILE B CB  1 
ATOM 1663 C CG1 . ILE B 1 18  ? 39.259 21.144  9.067   1.00 27.24 ? 17  ILE B CG1 1 
ATOM 1664 C CG2 . ILE B 1 18  ? 37.857 22.810  7.819   1.00 26.31 ? 17  ILE B CG2 1 
ATOM 1665 C CD1 . ILE B 1 18  ? 40.280 20.891  7.935   1.00 27.69 ? 17  ILE B CD1 1 
ATOM 1666 N N   . GLU B 1 19  ? 34.807 22.919  9.737   1.00 27.78 ? 18  GLU B N   1 
ATOM 1667 C CA  . GLU B 1 19  ? 33.516 23.435  9.244   1.00 28.83 ? 18  GLU B CA  1 
ATOM 1668 C C   . GLU B 1 19  ? 33.348 23.519  7.730   1.00 28.00 ? 18  GLU B C   1 
ATOM 1669 O O   . GLU B 1 19  ? 34.044 24.231  7.064   1.00 27.68 ? 18  GLU B O   1 
ATOM 1670 C CB  . GLU B 1 19  ? 33.311 24.854  9.795   1.00 30.13 ? 18  GLU B CB  1 
ATOM 1671 C CG  . GLU B 1 19  ? 32.055 25.048  10.665  1.00 33.65 ? 18  GLU B CG  1 
ATOM 1672 C CD  . GLU B 1 19  ? 31.862 26.513  11.125  1.00 36.89 ? 18  GLU B CD  1 
ATOM 1673 O OE1 . GLU B 1 19  ? 30.787 27.096  10.777  1.00 36.93 ? 18  GLU B OE1 1 
ATOM 1674 O OE2 . GLU B 1 19  ? 32.780 27.057  11.835  1.00 36.67 ? 18  GLU B OE2 1 
ATOM 1675 N N   . GLY B 1 20  ? 32.368 22.832  7.187   1.00 28.90 ? 19  GLY B N   1 
ATOM 1676 C CA  . GLY B 1 20  ? 32.085 22.920  5.755   1.00 29.04 ? 19  GLY B CA  1 
ATOM 1677 C C   . GLY B 1 20  ? 33.222 22.451  4.838   1.00 29.02 ? 19  GLY B C   1 
ATOM 1678 O O   . GLY B 1 20  ? 33.331 22.957  3.739   1.00 28.25 ? 19  GLY B O   1 
ATOM 1679 N N   . ALA B 1 21  ? 34.006 21.450  5.276   1.00 29.47 ? 20  ALA B N   1 
ATOM 1680 C CA  . ALA B 1 21  ? 35.223 20.968  4.580   1.00 29.71 ? 20  ALA B CA  1 
ATOM 1681 C C   . ALA B 1 21  ? 35.010 19.722  3.797   1.00 30.04 ? 20  ALA B C   1 
ATOM 1682 O O   . ALA B 1 21  ? 35.828 19.318  2.978   1.00 28.56 ? 20  ALA B O   1 
ATOM 1683 C CB  . ALA B 1 21  ? 36.320 20.710  5.588   1.00 29.81 ? 20  ALA B CB  1 
ATOM 1684 N N   . LYS B 1 22  ? 33.914 19.053  4.098   1.00 31.31 ? 21  LYS B N   1 
ATOM 1685 C CA  . LYS B 1 22  ? 33.587 17.806  3.362   1.00 32.78 ? 21  LYS B CA  1 
ATOM 1686 C C   . LYS B 1 22  ? 34.459 16.562  3.750   1.00 31.42 ? 21  LYS B C   1 
ATOM 1687 O O   . LYS B 1 22  ? 35.667 16.493  3.443   1.00 30.26 ? 21  LYS B O   1 
ATOM 1688 C CB  . LYS B 1 22  ? 33.538 18.021  1.815   1.00 33.97 ? 21  LYS B CB  1 
ATOM 1689 C CG  . LYS B 1 22  ? 32.758 19.357  1.297   1.00 35.91 ? 21  LYS B CG  1 
ATOM 1690 C CD  . LYS B 1 22  ? 31.177 19.348  1.477   1.00 37.24 ? 21  LYS B CD  1 
ATOM 1691 C CE  . LYS B 1 22  ? 30.587 20.848  1.555   1.00 38.63 ? 21  LYS B CE  1 
ATOM 1692 N NZ  . LYS B 1 22  ? 29.875 21.179  2.912   1.00 39.48 ? 21  LYS B NZ  1 
ATOM 1693 N N   . LYS B 1 23  ? 33.757 15.647  4.441   1.00 29.85 ? 22  LYS B N   1 
ATOM 1694 C CA  . LYS B 1 23  ? 34.248 14.459  5.102   1.00 28.71 ? 22  LYS B CA  1 
ATOM 1695 C C   . LYS B 1 23  ? 34.578 13.416  4.031   1.00 28.10 ? 22  LYS B C   1 
ATOM 1696 O O   . LYS B 1 23  ? 33.895 13.331  3.004   1.00 27.84 ? 22  LYS B O   1 
ATOM 1697 C CB  . LYS B 1 23  ? 33.101 13.862  6.020   1.00 28.42 ? 22  LYS B CB  1 
ATOM 1698 C CG  . LYS B 1 23  ? 32.980 14.278  7.496   1.00 26.89 ? 22  LYS B CG  1 
ATOM 1699 C CD  . LYS B 1 23  ? 32.522 13.056  8.432   1.00 27.06 ? 22  LYS B CD  1 
ATOM 1700 C CE  . LYS B 1 23  ? 31.279 13.283  9.367   1.00 27.00 ? 22  LYS B CE  1 
ATOM 1701 N NZ  . LYS B 1 23  ? 29.895 13.260  8.653   1.00 26.64 ? 22  LYS B NZ  1 
ATOM 1702 N N   . SER B 1 24  ? 35.596 12.604  4.294   1.00 27.29 ? 23  SER B N   1 
ATOM 1703 C CA  . SER B 1 24  ? 35.687 11.263  3.728   1.00 27.01 ? 23  SER B CA  1 
ATOM 1704 C C   . SER B 1 24  ? 35.677 10.289  4.906   1.00 27.20 ? 23  SER B C   1 
ATOM 1705 O O   . SER B 1 24  ? 36.394 10.475  5.896   1.00 27.07 ? 23  SER B O   1 
ATOM 1706 C CB  . SER B 1 24  ? 36.959 11.049  2.906   1.00 26.71 ? 23  SER B CB  1 
ATOM 1707 O OG  . SER B 1 24  ? 37.041 11.942  1.841   1.00 26.54 ? 23  SER B OG  1 
ATOM 1708 N N   . VAL B 1 25  ? 34.857 9.245   4.795   1.00 27.41 ? 24  VAL B N   1 
ATOM 1709 C CA  . VAL B 1 25  ? 34.735 8.238   5.836   1.00 26.64 ? 24  VAL B CA  1 
ATOM 1710 C C   . VAL B 1 25  ? 35.242 6.939   5.256   1.00 26.41 ? 24  VAL B C   1 
ATOM 1711 O O   . VAL B 1 25  ? 34.742 6.468   4.245   1.00 26.04 ? 24  VAL B O   1 
ATOM 1712 C CB  . VAL B 1 25  ? 33.267 8.119   6.311   1.00 26.25 ? 24  VAL B CB  1 
ATOM 1713 C CG1 . VAL B 1 25  ? 33.199 7.352   7.622   1.00 27.22 ? 24  VAL B CG1 1 
ATOM 1714 C CG2 . VAL B 1 25  ? 32.643 9.445   6.448   1.00 24.28 ? 24  VAL B CG2 1 
ATOM 1715 N N   . ARG B 1 26  ? 36.284 6.400   5.864   1.00 27.29 ? 25  ARG B N   1 
ATOM 1716 C CA  . ARG B 1 26  ? 36.798 5.096   5.463   1.00 28.69 ? 25  ARG B CA  1 
ATOM 1717 C C   . ARG B 1 26  ? 36.533 4.136   6.629   1.00 28.79 ? 25  ARG B C   1 
ATOM 1718 O O   . ARG B 1 26  ? 37.077 4.301   7.720   1.00 27.28 ? 25  ARG B O   1 
ATOM 1719 C CB  . ARG B 1 26  ? 38.292 5.133   5.073   1.00 29.53 ? 25  ARG B CB  1 
ATOM 1720 C CG  . ARG B 1 26  ? 38.711 6.199   3.996   1.00 31.08 ? 25  ARG B CG  1 
ATOM 1721 C CD  . ARG B 1 26  ? 37.918 6.176   2.669   1.00 34.64 ? 25  ARG B CD  1 
ATOM 1722 N NE  . ARG B 1 26  ? 38.835 6.435   1.544   1.00 39.04 ? 25  ARG B NE  1 
ATOM 1723 C CZ  . ARG B 1 26  ? 39.138 5.571   0.528   1.00 44.34 ? 25  ARG B CZ  1 
ATOM 1724 N NH1 . ARG B 1 26  ? 38.546 4.354   0.448   1.00 45.09 ? 25  ARG B NH1 1 
ATOM 1725 N NH2 . ARG B 1 26  ? 40.020 5.936   -0.446  1.00 44.51 ? 25  ARG B NH2 1 
ATOM 1726 N N   . ARG B 1 27  ? 35.590 3.202   6.402   1.00 29.38 ? 26  ARG B N   1 
ATOM 1727 C CA  . ARG B 1 27  ? 35.228 2.217   7.406   1.00 28.88 ? 26  ARG B CA  1 
ATOM 1728 C C   . ARG B 1 27  ? 36.079 1.025   7.096   1.00 27.92 ? 26  ARG B C   1 
ATOM 1729 O O   . ARG B 1 27  ? 36.594 0.866   5.980   1.00 26.94 ? 26  ARG B O   1 
ATOM 1730 C CB  . ARG B 1 27  ? 33.727 1.849   7.430   1.00 28.94 ? 26  ARG B CB  1 
ATOM 1731 C CG  . ARG B 1 27  ? 32.839 2.455   6.365   1.00 31.66 ? 26  ARG B CG  1 
ATOM 1732 C CD  . ARG B 1 27  ? 31.333 2.048   6.511   1.00 33.86 ? 26  ARG B CD  1 
ATOM 1733 N NE  . ARG B 1 27  ? 30.718 2.705   7.670   1.00 33.96 ? 26  ARG B NE  1 
ATOM 1734 C CZ  . ARG B 1 27  ? 29.932 3.774   7.607   1.00 35.01 ? 26  ARG B CZ  1 
ATOM 1735 N NH1 . ARG B 1 27  ? 29.650 4.329   6.433   1.00 35.24 ? 26  ARG B NH1 1 
ATOM 1736 N NH2 . ARG B 1 27  ? 29.411 4.298   8.731   1.00 36.40 ? 26  ARG B NH2 1 
ATOM 1737 N N   . LEU B 1 28  ? 36.229 0.186   8.104   1.00 27.12 ? 27  LEU B N   1 
ATOM 1738 C CA  . LEU B 1 28  ? 37.028 -0.994  7.964   1.00 26.81 ? 27  LEU B CA  1 
ATOM 1739 C C   . LEU B 1 28  ? 36.768 -1.744  6.616   1.00 26.80 ? 27  LEU B C   1 
ATOM 1740 O O   . LEU B 1 28  ? 37.743 -2.211  5.987   1.00 27.04 ? 27  LEU B O   1 
ATOM 1741 C CB  . LEU B 1 28  ? 36.799 -1.879  9.178   1.00 26.23 ? 27  LEU B CB  1 
ATOM 1742 C CG  . LEU B 1 28  ? 37.765 -3.015  9.392   1.00 26.16 ? 27  LEU B CG  1 
ATOM 1743 C CD1 . LEU B 1 28  ? 39.267 -2.504  9.316   1.00 26.51 ? 27  LEU B CD1 1 
ATOM 1744 C CD2 . LEU B 1 28  ? 37.439 -3.671  10.725  1.00 25.11 ? 27  LEU B CD2 1 
ATOM 1745 N N   . SER B 1 29  ? 35.499 -1.836  6.159   1.00 26.05 ? 28  SER B N   1 
ATOM 1746 C CA  . SER B 1 29  ? 35.189 -2.536  4.889   1.00 25.94 ? 28  SER B CA  1 
ATOM 1747 C C   . SER B 1 29  ? 35.873 -1.921  3.627   1.00 26.13 ? 28  SER B C   1 
ATOM 1748 O O   . SER B 1 29  ? 36.032 -2.588  2.601   1.00 25.67 ? 28  SER B O   1 
ATOM 1749 C CB  . SER B 1 29  ? 33.686 -2.691  4.668   1.00 24.86 ? 28  SER B CB  1 
ATOM 1750 O OG  . SER B 1 29  ? 33.041 -1.460  4.536   1.00 24.35 ? 28  SER B OG  1 
ATOM 1751 N N   . ASP B 1 30  ? 36.302 -0.669  3.735   1.00 26.16 ? 29  ASP B N   1 
ATOM 1752 C CA  . ASP B 1 30  ? 37.009 0.021   2.659   1.00 26.48 ? 29  ASP B CA  1 
ATOM 1753 C C   . ASP B 1 30  ? 38.539 -0.271  2.585   1.00 25.58 ? 29  ASP B C   1 
ATOM 1754 O O   . ASP B 1 30  ? 39.211 0.053   1.608   1.00 23.24 ? 29  ASP B O   1 
ATOM 1755 C CB  . ASP B 1 30  ? 36.750 1.505   2.794   1.00 27.13 ? 29  ASP B CB  1 
ATOM 1756 C CG  . ASP B 1 30  ? 35.268 1.836   2.780   1.00 29.28 ? 29  ASP B CG  1 
ATOM 1757 O OD1 . ASP B 1 30  ? 34.711 2.043   1.691   1.00 33.05 ? 29  ASP B OD1 1 
ATOM 1758 O OD2 . ASP B 1 30  ? 34.562 1.927   3.811   1.00 33.18 ? 29  ASP B OD2 1 
ATOM 1759 N N   . MET B 1 31  ? 39.045 -0.943  3.612   1.00 25.91 ? 30  MET B N   1 
ATOM 1760 C CA  . MET B 1 31  ? 40.467 -1.282  3.697   1.00 26.21 ? 30  MET B CA  1 
ATOM 1761 C C   . MET B 1 31  ? 40.741 -2.768  3.561   1.00 26.47 ? 30  MET B C   1 
ATOM 1762 O O   . MET B 1 31  ? 41.621 -3.288  4.230   1.00 26.67 ? 30  MET B O   1 
ATOM 1763 C CB  . MET B 1 31  ? 41.070 -0.780  5.027   1.00 26.07 ? 30  MET B CB  1 
ATOM 1764 C CG  . MET B 1 31  ? 40.869 0.714   5.308   1.00 25.65 ? 30  MET B CG  1 
ATOM 1765 S SD  . MET B 1 31  ? 41.404 1.273   6.902   1.00 25.41 ? 30  MET B SD  1 
ATOM 1766 C CE  . MET B 1 31  ? 43.253 1.189   6.737   1.00 24.00 ? 30  MET B CE  1 
ATOM 1767 N N   . GLU B 1 32  ? 40.013 -3.451  2.690   1.00 27.29 ? 31  GLU B N   1 
ATOM 1768 C CA  . GLU B 1 32  ? 40.295 -4.868  2.455   1.00 28.40 ? 31  GLU B CA  1 
ATOM 1769 C C   . GLU B 1 32  ? 41.695 -5.079  1.913   1.00 28.44 ? 31  GLU B C   1 
ATOM 1770 O O   . GLU B 1 32  ? 42.095 -4.373  1.019   1.00 28.88 ? 31  GLU B O   1 
ATOM 1771 C CB  . GLU B 1 32  ? 39.309 -5.485  1.458   1.00 28.83 ? 31  GLU B CB  1 
ATOM 1772 C CG  . GLU B 1 32  ? 39.391 -7.017  1.337   1.00 29.42 ? 31  GLU B CG  1 
ATOM 1773 C CD  . GLU B 1 32  ? 38.402 -7.579  0.336   1.00 30.56 ? 31  GLU B CD  1 
ATOM 1774 O OE1 . GLU B 1 32  ? 37.173 -7.591  0.601   1.00 33.01 ? 31  GLU B OE1 1 
ATOM 1775 O OE2 . GLU B 1 32  ? 38.846 -7.990  -0.742  1.00 32.34 ? 31  GLU B OE2 1 
ATOM 1776 N N   . GLY B 1 33  ? 42.434 -6.041  2.453   1.00 28.24 ? 32  GLY B N   1 
ATOM 1777 C CA  . GLY B 1 33  ? 43.768 -6.323  1.968   1.00 28.31 ? 32  GLY B CA  1 
ATOM 1778 C C   . GLY B 1 33  ? 44.915 -5.634  2.691   1.00 28.80 ? 32  GLY B C   1 
ATOM 1779 O O   . GLY B 1 33  ? 46.081 -5.912  2.355   1.00 29.98 ? 32  GLY B O   1 
ATOM 1780 N N   . TYR B 1 34  ? 44.611 -4.787  3.687   1.00 28.40 ? 33  TYR B N   1 
ATOM 1781 C CA  . TYR B 1 34  ? 45.614 -3.913  4.343   1.00 28.19 ? 33  TYR B CA  1 
ATOM 1782 C C   . TYR B 1 34  ? 46.287 -4.472  5.619   1.00 27.38 ? 33  TYR B C   1 
ATOM 1783 O O   . TYR B 1 34  ? 47.451 -4.210  5.860   1.00 26.94 ? 33  TYR B O   1 
ATOM 1784 C CB  . TYR B 1 34  ? 44.997 -2.535  4.669   1.00 28.10 ? 33  TYR B CB  1 
ATOM 1785 C CG  . TYR B 1 34  ? 44.866 -1.621  3.477   1.00 28.42 ? 33  TYR B CG  1 
ATOM 1786 C CD1 . TYR B 1 34  ? 43.974 -1.896  2.460   1.00 29.75 ? 33  TYR B CD1 1 
ATOM 1787 C CD2 . TYR B 1 34  ? 45.658 -0.509  3.359   1.00 29.28 ? 33  TYR B CD2 1 
ATOM 1788 C CE1 . TYR B 1 34  ? 43.864 -1.080  1.354   1.00 29.46 ? 33  TYR B CE1 1 
ATOM 1789 C CE2 . TYR B 1 34  ? 45.581 0.305   2.271   1.00 30.79 ? 33  TYR B CE2 1 
ATOM 1790 C CZ  . TYR B 1 34  ? 44.659 0.021   1.259   1.00 31.90 ? 33  TYR B CZ  1 
ATOM 1791 O OH  . TYR B 1 34  ? 44.569 0.828   0.131   1.00 31.84 ? 33  TYR B OH  1 
ATOM 1792 N N   . PHE B 1 35  ? 45.529 -5.198  6.432   1.00 26.77 ? 34  PHE B N   1 
ATOM 1793 C CA  . PHE B 1 35  ? 46.017 -5.709  7.700   1.00 26.44 ? 34  PHE B CA  1 
ATOM 1794 C C   . PHE B 1 35  ? 46.446 -7.165  7.572   1.00 26.61 ? 34  PHE B C   1 
ATOM 1795 O O   . PHE B 1 35  ? 45.717 -7.970  7.039   1.00 26.95 ? 34  PHE B O   1 
ATOM 1796 C CB  . PHE B 1 35  ? 44.908 -5.643  8.751   1.00 26.51 ? 34  PHE B CB  1 
ATOM 1797 C CG  . PHE B 1 35  ? 44.439 -4.268  9.064   1.00 24.61 ? 34  PHE B CG  1 
ATOM 1798 C CD1 . PHE B 1 35  ? 43.439 -3.671  8.289   1.00 24.27 ? 34  PHE B CD1 1 
ATOM 1799 C CD2 . PHE B 1 35  ? 44.982 -3.574  10.120  1.00 22.67 ? 34  PHE B CD2 1 
ATOM 1800 C CE1 . PHE B 1 35  ? 42.999 -2.398  8.565   1.00 23.44 ? 34  PHE B CE1 1 
ATOM 1801 C CE2 . PHE B 1 35  ? 44.558 -2.283  10.408  1.00 24.14 ? 34  PHE B CE2 1 
ATOM 1802 C CZ  . PHE B 1 35  ? 43.567 -1.690  9.630   1.00 24.40 ? 34  PHE B CZ  1 
ATOM 1803 N N   . VAL B 1 36  ? 47.633 -7.486  8.071   1.00 27.12 ? 35  VAL B N   1 
ATOM 1804 C CA  . VAL B 1 36  ? 48.162 -8.838  8.108   1.00 27.45 ? 35  VAL B CA  1 
ATOM 1805 C C   . VAL B 1 36  ? 47.065 -9.899  8.370   1.00 28.24 ? 35  VAL B C   1 
ATOM 1806 O O   . VAL B 1 36  ? 46.879 -10.814 7.558   1.00 28.45 ? 35  VAL B O   1 
ATOM 1807 C CB  . VAL B 1 36  ? 49.221 -8.960  9.203   1.00 27.32 ? 35  VAL B CB  1 
ATOM 1808 C CG1 . VAL B 1 36  ? 49.777 -10.404 9.274   1.00 28.04 ? 35  VAL B CG1 1 
ATOM 1809 C CG2 . VAL B 1 36  ? 50.340 -7.978  8.981   1.00 27.96 ? 35  VAL B CG2 1 
ATOM 1810 N N   . ASP B 1 37  ? 46.350 -9.761  9.491   1.00 28.55 ? 36  ASP B N   1 
ATOM 1811 C CA  . ASP B 1 37  ? 45.357 -10.722 9.943   1.00 28.54 ? 36  ASP B CA  1 
ATOM 1812 C C   . ASP B 1 37  ? 44.030 -10.580 9.213   1.00 29.88 ? 36  ASP B C   1 
ATOM 1813 O O   . ASP B 1 37  ? 43.085 -10.010 9.730   1.00 29.23 ? 36  ASP B O   1 
ATOM 1814 C CB  . ASP B 1 37  ? 45.116 -10.524 11.438  1.00 28.61 ? 36  ASP B CB  1 
ATOM 1815 C CG  . ASP B 1 37  ? 44.500 -11.721 12.105  1.00 26.52 ? 36  ASP B CG  1 
ATOM 1816 O OD1 . ASP B 1 37  ? 43.881 -12.549 11.406  1.00 26.28 ? 36  ASP B OD1 1 
ATOM 1817 O OD2 . ASP B 1 37  ? 44.603 -11.912 13.325  1.00 23.24 ? 36  ASP B OD2 1 
ATOM 1818 N N   . GLU B 1 38  ? 43.945 -11.172 8.028   1.00 31.72 ? 37  GLU B N   1 
ATOM 1819 C CA  . GLU B 1 38  ? 42.727 -11.139 7.212   1.00 32.78 ? 37  GLU B CA  1 
ATOM 1820 C C   . GLU B 1 38  ? 41.540 -11.696 7.958   1.00 33.26 ? 37  GLU B C   1 
ATOM 1821 O O   . GLU B 1 38  ? 40.434 -11.202 7.818   1.00 33.56 ? 37  GLU B O   1 
ATOM 1822 C CB  . GLU B 1 38  ? 42.907 -11.955 5.935   1.00 33.33 ? 37  GLU B CB  1 
ATOM 1823 C CG  . GLU B 1 38  ? 43.699 -11.251 4.815   1.00 36.01 ? 37  GLU B CG  1 
ATOM 1824 C CD  . GLU B 1 38  ? 43.245 -11.677 3.418   1.00 38.71 ? 37  GLU B CD  1 
ATOM 1825 O OE1 . GLU B 1 38  ? 42.006 -11.708 3.181   1.00 40.82 ? 37  GLU B OE1 1 
ATOM 1826 O OE2 . GLU B 1 38  ? 44.104 -11.979 2.566   1.00 38.49 ? 37  GLU B OE2 1 
ATOM 1827 N N   . ARG B 1 39  ? 41.744 -12.730 8.742   1.00 33.85 ? 38  ARG B N   1 
ATOM 1828 C CA  . ARG B 1 39  ? 40.599 -13.360 9.400   1.00 34.97 ? 38  ARG B CA  1 
ATOM 1829 C C   . ARG B 1 39  ? 40.016 -12.542 10.541  1.00 35.41 ? 38  ARG B C   1 
ATOM 1830 O O   . ARG B 1 39  ? 38.830 -12.602 10.813  1.00 36.19 ? 38  ARG B O   1 
ATOM 1831 C CB  . ARG B 1 39  ? 40.952 -14.777 9.909   1.00 35.14 ? 38  ARG B CB  1 
ATOM 1832 C CG  . ARG B 1 39  ? 40.567 -15.839 8.909   1.00 36.52 ? 38  ARG B CG  1 
ATOM 1833 C CD  . ARG B 1 39  ? 40.922 -17.275 9.303   1.00 37.78 ? 38  ARG B CD  1 
ATOM 1834 N NE  . ARG B 1 39  ? 39.916 -17.897 10.170  1.00 36.77 ? 38  ARG B NE  1 
ATOM 1835 C CZ  . ARG B 1 39  ? 38.691 -18.219 9.791   1.00 36.70 ? 38  ARG B CZ  1 
ATOM 1836 N NH1 . ARG B 1 39  ? 38.255 -17.986 8.543   1.00 35.42 ? 38  ARG B NH1 1 
ATOM 1837 N NH2 . ARG B 1 39  ? 37.875 -18.760 10.695  1.00 38.86 ? 38  ARG B NH2 1 
ATOM 1838 N N   . ALA B 1 40  ? 40.844 -11.797 11.241  1.00 36.16 ? 39  ALA B N   1 
ATOM 1839 C CA  . ALA B 1 40  ? 40.331 -10.926 12.299  1.00 36.49 ? 39  ALA B CA  1 
ATOM 1840 C C   . ALA B 1 40  ? 39.637 -9.708  11.667  1.00 36.48 ? 39  ALA B C   1 
ATOM 1841 O O   . ALA B 1 40  ? 38.759 -9.116  12.260  1.00 36.44 ? 39  ALA B O   1 
ATOM 1842 C CB  . ALA B 1 40  ? 41.472 -10.489 13.250  1.00 36.53 ? 39  ALA B CB  1 
ATOM 1843 N N   . TRP B 1 41  ? 40.034 -9.373  10.442  1.00 36.62 ? 40  TRP B N   1 
ATOM 1844 C CA  . TRP B 1 41  ? 39.451 -8.269  9.700   1.00 36.25 ? 40  TRP B CA  1 
ATOM 1845 C C   . TRP B 1 41  ? 38.022 -8.599  9.309   1.00 36.95 ? 40  TRP B C   1 
ATOM 1846 O O   . TRP B 1 41  ? 37.162 -7.754  9.463   1.00 37.09 ? 40  TRP B O   1 
ATOM 1847 C CB  . TRP B 1 41  ? 40.334 -7.931  8.472   1.00 35.79 ? 40  TRP B CB  1 
ATOM 1848 C CG  . TRP B 1 41  ? 39.728 -6.948  7.547   1.00 35.08 ? 40  TRP B CG  1 
ATOM 1849 C CD1 . TRP B 1 41  ? 39.799 -5.612  7.637   1.00 33.30 ? 40  TRP B CD1 1 
ATOM 1850 C CD2 . TRP B 1 41  ? 38.927 -7.235  6.384   1.00 35.72 ? 40  TRP B CD2 1 
ATOM 1851 N NE1 . TRP B 1 41  ? 39.090 -5.029  6.616   1.00 34.25 ? 40  TRP B NE1 1 
ATOM 1852 C CE2 . TRP B 1 41  ? 38.535 -6.008  5.835   1.00 35.12 ? 40  TRP B CE2 1 
ATOM 1853 C CE3 . TRP B 1 41  ? 38.479 -8.415  5.767   1.00 37.14 ? 40  TRP B CE3 1 
ATOM 1854 C CZ2 . TRP B 1 41  ? 37.721 -5.915  4.693   1.00 35.09 ? 40  TRP B CZ2 1 
ATOM 1855 C CZ3 . TRP B 1 41  ? 37.674 -8.324  4.614   1.00 36.79 ? 40  TRP B CZ3 1 
ATOM 1856 C CH2 . TRP B 1 41  ? 37.311 -7.080  4.099   1.00 35.39 ? 40  TRP B CH2 1 
ATOM 1857 N N   . LYS B 1 42  ? 37.784 -9.811  8.781   1.00 37.56 ? 41  LYS B N   1 
ATOM 1858 C CA  . LYS B 1 42  ? 36.427 -10.322 8.480   1.00 37.86 ? 41  LYS B CA  1 
ATOM 1859 C C   . LYS B 1 42  ? 35.553 -10.283 9.724   1.00 37.75 ? 41  LYS B C   1 
ATOM 1860 O O   . LYS B 1 42  ? 34.435 -9.841  9.691   1.00 36.59 ? 41  LYS B O   1 
ATOM 1861 C CB  . LYS B 1 42  ? 36.485 -11.795 8.029   1.00 38.85 ? 41  LYS B CB  1 
ATOM 1862 C CG  . LYS B 1 42  ? 35.782 -12.130 6.696   1.00 40.83 ? 41  LYS B CG  1 
ATOM 1863 C CD  . LYS B 1 42  ? 36.815 -12.232 5.488   1.00 42.81 ? 41  LYS B CD  1 
ATOM 1864 C CE  . LYS B 1 42  ? 36.087 -12.099 4.114   1.00 42.93 ? 41  LYS B CE  1 
ATOM 1865 N NZ  . LYS B 1 42  ? 35.868 -13.449 3.510   1.00 42.26 ? 41  LYS B NZ  1 
ATOM 1866 N N   . GLU B 1 43  ? 36.080 -10.771 10.840  1.00 38.33 ? 42  GLU B N   1 
ATOM 1867 C CA  . GLU B 1 43  ? 35.259 -10.953 12.046  1.00 38.70 ? 42  GLU B CA  1 
ATOM 1868 C C   . GLU B 1 43  ? 34.799 -9.589  12.523  1.00 37.64 ? 42  GLU B C   1 
ATOM 1869 O O   . GLU B 1 43  ? 33.670 -9.419  12.860  1.00 37.54 ? 42  GLU B O   1 
ATOM 1870 C CB  . GLU B 1 43  ? 36.034 -11.740 13.167  1.00 39.14 ? 42  GLU B CB  1 
ATOM 1871 C CG  . GLU B 1 43  ? 35.152 -12.284 14.318  1.00 40.15 ? 42  GLU B CG  1 
ATOM 1872 C CD  . GLU B 1 43  ? 35.981 -12.723 15.556  1.00 42.54 ? 42  GLU B CD  1 
ATOM 1873 O OE1 . GLU B 1 43  ? 36.494 -11.874 16.333  1.00 41.56 ? 42  GLU B OE1 1 
ATOM 1874 O OE2 . GLU B 1 43  ? 36.123 -13.941 15.788  1.00 43.85 ? 42  GLU B OE2 1 
ATOM 1875 N N   . LEU B 1 44  ? 35.711 -8.630  12.526  1.00 37.52 ? 43  LEU B N   1 
ATOM 1876 C CA  . LEU B 1 44  ? 35.467 -7.307  13.073  1.00 37.22 ? 43  LEU B CA  1 
ATOM 1877 C C   . LEU B 1 44  ? 34.604 -6.475  12.144  1.00 37.61 ? 43  LEU B C   1 
ATOM 1878 O O   . LEU B 1 44  ? 33.974 -5.548  12.614  1.00 38.30 ? 43  LEU B O   1 
ATOM 1879 C CB  . LEU B 1 44  ? 36.793 -6.592  13.353  1.00 36.86 ? 43  LEU B CB  1 
ATOM 1880 C CG  . LEU B 1 44  ? 36.857 -5.260  14.097  1.00 36.10 ? 43  LEU B CG  1 
ATOM 1881 C CD1 . LEU B 1 44  ? 35.933 -5.216  15.284  1.00 36.89 ? 43  LEU B CD1 1 
ATOM 1882 C CD2 . LEU B 1 44  ? 38.288 -5.037  14.573  1.00 35.45 ? 43  LEU B CD2 1 
ATOM 1883 N N   . VAL B 1 45  ? 34.582 -6.815  10.846  1.00 37.66 ? 44  VAL B N   1 
ATOM 1884 C CA  . VAL B 1 45  ? 33.656 -6.250  9.862   1.00 37.64 ? 44  VAL B CA  1 
ATOM 1885 C C   . VAL B 1 45  ? 32.209 -6.733  10.072  1.00 38.29 ? 44  VAL B C   1 
ATOM 1886 O O   . VAL B 1 45  ? 31.279 -5.918  10.107  1.00 38.78 ? 44  VAL B O   1 
ATOM 1887 C CB  . VAL B 1 45  ? 34.066 -6.635  8.434   1.00 37.69 ? 44  VAL B CB  1 
ATOM 1888 C CG1 . VAL B 1 45  ? 32.907 -6.500  7.450   1.00 37.24 ? 44  VAL B CG1 1 
ATOM 1889 C CG2 . VAL B 1 45  ? 35.243 -5.809  7.977   1.00 38.42 ? 44  VAL B CG2 1 
ATOM 1890 N N   . GLU B 1 46  ? 32.020 -8.048  10.197  1.00 38.43 ? 45  GLU B N   1 
ATOM 1891 C CA  . GLU B 1 46  ? 30.684 -8.631  10.312  1.00 38.58 ? 45  GLU B CA  1 
ATOM 1892 C C   . GLU B 1 46  ? 29.908 -7.998  11.462  1.00 38.10 ? 45  GLU B C   1 
ATOM 1893 O O   . GLU B 1 46  ? 28.748 -7.601  11.305  1.00 37.72 ? 45  GLU B O   1 
ATOM 1894 C CB  . GLU B 1 46  ? 30.769 -10.137 10.529  1.00 39.00 ? 45  GLU B CB  1 
ATOM 1895 C CG  . GLU B 1 46  ? 31.654 -10.882 9.537   1.00 41.51 ? 45  GLU B CG  1 
ATOM 1896 C CD  . GLU B 1 46  ? 30.898 -11.628 8.435   1.00 45.31 ? 45  GLU B CD  1 
ATOM 1897 O OE1 . GLU B 1 46  ? 29.767 -12.120 8.696   1.00 50.36 ? 45  GLU B OE1 1 
ATOM 1898 O OE2 . GLU B 1 46  ? 31.441 -11.734 7.301   1.00 45.33 ? 45  GLU B OE2 1 
ATOM 1899 N N   . LYS B 1 47  ? 30.597 -7.877  12.593  1.00 37.96 ? 46  LYS B N   1 
ATOM 1900 C CA  . LYS B 1 47  ? 30.010 -7.495  13.873  1.00 38.10 ? 46  LYS B CA  1 
ATOM 1901 C C   . LYS B 1 47  ? 29.633 -6.029  13.966  1.00 37.57 ? 46  LYS B C   1 
ATOM 1902 O O   . LYS B 1 47  ? 28.582 -5.701  14.510  1.00 38.43 ? 46  LYS B O   1 
ATOM 1903 C CB  . LYS B 1 47  ? 31.007 -7.823  15.015  1.00 38.60 ? 46  LYS B CB  1 
ATOM 1904 C CG  . LYS B 1 47  ? 30.940 -9.288  15.606  1.00 40.70 ? 46  LYS B CG  1 
ATOM 1905 C CD  . LYS B 1 47  ? 30.524 -10.424 14.557  1.00 42.88 ? 46  LYS B CD  1 
ATOM 1906 C CE  . LYS B 1 47  ? 29.807 -11.653 15.263  1.00 44.22 ? 46  LYS B CE  1 
ATOM 1907 N NZ  . LYS B 1 47  ? 30.589 -12.951 15.136  1.00 44.36 ? 46  LYS B NZ  1 
ATOM 1908 N N   . GLU B 1 48  ? 30.493 -5.150  13.450  1.00 36.81 ? 47  GLU B N   1 
ATOM 1909 C CA  . GLU B 1 48  ? 30.390 -3.709  13.725  1.00 35.62 ? 47  GLU B CA  1 
ATOM 1910 C C   . GLU B 1 48  ? 30.827 -2.821  12.550  1.00 34.47 ? 47  GLU B C   1 
ATOM 1911 O O   . GLU B 1 48  ? 30.146 -1.858  12.248  1.00 34.66 ? 47  GLU B O   1 
ATOM 1912 C CB  . GLU B 1 48  ? 31.211 -3.390  14.970  1.00 35.62 ? 47  GLU B CB  1 
ATOM 1913 C CG  . GLU B 1 48  ? 31.181 -1.932  15.382  1.00 36.77 ? 47  GLU B CG  1 
ATOM 1914 C CD  . GLU B 1 48  ? 32.304 -1.577  16.351  1.00 38.78 ? 47  GLU B CD  1 
ATOM 1915 O OE1 . GLU B 1 48  ? 32.422 -0.375  16.743  1.00 40.97 ? 47  GLU B OE1 1 
ATOM 1916 O OE2 . GLU B 1 48  ? 33.076 -2.490  16.727  1.00 38.78 ? 47  GLU B OE2 1 
ATOM 1917 N N   . ASP B 1 49  ? 31.957 -3.146  11.907  1.00 33.28 ? 48  ASP B N   1 
ATOM 1918 C CA  . ASP B 1 49  ? 32.525 -2.392  10.767  1.00 32.32 ? 48  ASP B CA  1 
ATOM 1919 C C   . ASP B 1 49  ? 32.634 -0.880  11.087  1.00 31.58 ? 48  ASP B C   1 
ATOM 1920 O O   . ASP B 1 49  ? 31.853 -0.064  10.588  1.00 31.92 ? 48  ASP B O   1 
ATOM 1921 C CB  . ASP B 1 49  ? 31.698 -2.655  9.492   1.00 32.30 ? 48  ASP B CB  1 
ATOM 1922 C CG  . ASP B 1 49  ? 32.366 -2.153  8.227   1.00 32.48 ? 48  ASP B CG  1 
ATOM 1923 O OD1 . ASP B 1 49  ? 33.601 -1.999  8.194   1.00 32.06 ? 48  ASP B OD1 1 
ATOM 1924 O OD2 . ASP B 1 49  ? 31.724 -1.876  7.195   1.00 33.26 ? 48  ASP B OD2 1 
ATOM 1925 N N   . PRO B 1 50  ? 33.608 -0.505  11.920  1.00 30.33 ? 49  PRO B N   1 
ATOM 1926 C CA  . PRO B 1 50  ? 33.619 0.836   12.482  1.00 29.11 ? 49  PRO B CA  1 
ATOM 1927 C C   . PRO B 1 50  ? 34.330 1.740   11.546  1.00 27.86 ? 49  PRO B C   1 
ATOM 1928 O O   . PRO B 1 50  ? 35.004 1.302   10.625  1.00 27.09 ? 49  PRO B O   1 
ATOM 1929 C CB  . PRO B 1 50  ? 34.432 0.685   13.794  1.00 29.37 ? 49  PRO B CB  1 
ATOM 1930 C CG  . PRO B 1 50  ? 35.386 -0.467  13.562  1.00 29.64 ? 49  PRO B CG  1 
ATOM 1931 C CD  . PRO B 1 50  ? 34.781 -1.281  12.390  1.00 30.68 ? 49  PRO B CD  1 
ATOM 1932 N N   . VAL B 1 51  ? 34.153 3.021   11.796  1.00 26.73 ? 50  VAL B N   1 
ATOM 1933 C CA  . VAL B 1 51  ? 34.885 4.017   11.086  1.00 25.58 ? 50  VAL B CA  1 
ATOM 1934 C C   . VAL B 1 51  ? 36.320 3.993   11.667  1.00 25.62 ? 50  VAL B C   1 
ATOM 1935 O O   . VAL B 1 51  ? 36.566 4.293   12.858  1.00 25.64 ? 50  VAL B O   1 
ATOM 1936 C CB  . VAL B 1 51  ? 34.215 5.376   11.273  1.00 25.78 ? 50  VAL B CB  1 
ATOM 1937 C CG1 . VAL B 1 51  ? 34.993 6.472   10.496  1.00 25.04 ? 50  VAL B CG1 1 
ATOM 1938 C CG2 . VAL B 1 51  ? 32.675 5.312   10.895  1.00 23.41 ? 50  VAL B CG2 1 
ATOM 1939 N N   . VAL B 1 52  ? 37.253 3.595   10.810  1.00 24.66 ? 51  VAL B N   1 
ATOM 1940 C CA  . VAL B 1 52  ? 38.652 3.640   11.104  1.00 23.21 ? 51  VAL B CA  1 
ATOM 1941 C C   . VAL B 1 52  ? 39.121 5.088   11.107  1.00 22.41 ? 51  VAL B C   1 
ATOM 1942 O O   . VAL B 1 52  ? 39.855 5.466   12.007  1.00 24.23 ? 51  VAL B O   1 
ATOM 1943 C CB  . VAL B 1 52  ? 39.391 2.840   10.067  1.00 23.43 ? 51  VAL B CB  1 
ATOM 1944 C CG1 . VAL B 1 52  ? 40.926 3.078   10.113  1.00 23.08 ? 51  VAL B CG1 1 
ATOM 1945 C CG2 . VAL B 1 52  ? 39.051 1.368   10.310  1.00 24.41 ? 51  VAL B CG2 1 
ATOM 1946 N N   . TYR B 1 53  ? 38.726 5.894   10.132  1.00 20.28 ? 52  TYR B N   1 
ATOM 1947 C CA  . TYR B 1 53  ? 39.148 7.283   10.100  1.00 19.44 ? 52  TYR B CA  1 
ATOM 1948 C C   . TYR B 1 53  ? 38.358 8.175   9.191   1.00 18.65 ? 52  TYR B C   1 
ATOM 1949 O O   . TYR B 1 53  ? 37.803 7.768   8.187   1.00 18.21 ? 52  TYR B O   1 
ATOM 1950 C CB  . TYR B 1 53  ? 40.615 7.430   9.727   1.00 19.75 ? 52  TYR B CB  1 
ATOM 1951 C CG  . TYR B 1 53  ? 41.019 7.037   8.325   1.00 19.04 ? 52  TYR B CG  1 
ATOM 1952 C CD1 . TYR B 1 53  ? 41.155 7.994   7.328   1.00 21.19 ? 52  TYR B CD1 1 
ATOM 1953 C CD2 . TYR B 1 53  ? 41.380 5.722   8.019   1.00 19.04 ? 52  TYR B CD2 1 
ATOM 1954 C CE1 . TYR B 1 53  ? 41.608 7.645   6.031   1.00 20.47 ? 52  TYR B CE1 1 
ATOM 1955 C CE2 . TYR B 1 53  ? 41.809 5.356   6.741   1.00 18.35 ? 52  TYR B CE2 1 
ATOM 1956 C CZ  . TYR B 1 53  ? 41.913 6.313   5.769   1.00 19.30 ? 52  TYR B CZ  1 
ATOM 1957 O OH  . TYR B 1 53  ? 42.323 5.943   4.547   1.00 18.94 ? 52  TYR B OH  1 
ATOM 1958 N N   . GLU B 1 54  ? 38.346 9.431   9.589   1.00 18.25 ? 53  GLU B N   1 
ATOM 1959 C CA  . GLU B 1 54  ? 37.630 10.479  8.890   1.00 18.30 ? 53  GLU B CA  1 
ATOM 1960 C C   . GLU B 1 54  ? 38.634 11.566  8.447   1.00 17.44 ? 53  GLU B C   1 
ATOM 1961 O O   . GLU B 1 54  ? 39.621 11.826  9.137   1.00 17.16 ? 53  GLU B O   1 
ATOM 1962 C CB  . GLU B 1 54  ? 36.516 11.049  9.811   1.00 18.21 ? 53  GLU B CB  1 
ATOM 1963 C CG  . GLU B 1 54  ? 35.417 10.042  10.171  1.00 17.29 ? 53  GLU B CG  1 
ATOM 1964 C CD  . GLU B 1 54  ? 34.480 10.567  11.241  1.00 19.17 ? 53  GLU B CD  1 
ATOM 1965 O OE1 . GLU B 1 54  ? 34.979 11.202  12.197  1.00 22.03 ? 53  GLU B OE1 1 
ATOM 1966 O OE2 . GLU B 1 54  ? 33.252 10.384  11.147  1.00 19.80 ? 53  GLU B OE2 1 
ATOM 1967 N N   . VAL B 1 55  ? 38.392 12.175  7.296   1.00 16.79 ? 54  VAL B N   1 
ATOM 1968 C CA  . VAL B 1 55  ? 39.274 13.228  6.789   1.00 17.48 ? 54  VAL B CA  1 
ATOM 1969 C C   . VAL B 1 55  ? 38.467 14.464  6.453   1.00 17.94 ? 54  VAL B C   1 
ATOM 1970 O O   . VAL B 1 55  ? 37.566 14.360  5.656   1.00 18.83 ? 54  VAL B O   1 
ATOM 1971 C CB  . VAL B 1 55  ? 40.071 12.777  5.532   1.00 16.87 ? 54  VAL B CB  1 
ATOM 1972 C CG1 . VAL B 1 55  ? 41.046 13.800  5.136   1.00 15.34 ? 54  VAL B CG1 1 
ATOM 1973 C CG2 . VAL B 1 55  ? 40.812 11.486  5.818   1.00 17.58 ? 54  VAL B CG2 1 
ATOM 1974 N N   . TYR B 1 56  ? 38.741 15.610  7.080   1.00 18.65 ? 55  TYR B N   1 
ATOM 1975 C CA  . TYR B 1 56  ? 38.079 16.868  6.719   1.00 19.67 ? 55  TYR B CA  1 
ATOM 1976 C C   . TYR B 1 56  ? 39.058 17.692  5.851   1.00 20.01 ? 55  TYR B C   1 
ATOM 1977 O O   . TYR B 1 56  ? 40.125 18.151  6.336   1.00 20.24 ? 55  TYR B O   1 
ATOM 1978 C CB  . TYR B 1 56  ? 37.654 17.625  7.964   1.00 19.71 ? 55  TYR B CB  1 
ATOM 1979 C CG  . TYR B 1 56  ? 36.579 16.923  8.780   1.00 22.96 ? 55  TYR B CG  1 
ATOM 1980 C CD1 . TYR B 1 56  ? 36.891 16.077  9.848   1.00 23.29 ? 55  TYR B CD1 1 
ATOM 1981 C CD2 . TYR B 1 56  ? 35.238 17.129  8.494   1.00 26.58 ? 55  TYR B CD2 1 
ATOM 1982 C CE1 . TYR B 1 56  ? 35.889 15.463  10.593  1.00 24.98 ? 55  TYR B CE1 1 
ATOM 1983 C CE2 . TYR B 1 56  ? 34.238 16.507  9.223   1.00 26.76 ? 55  TYR B CE2 1 
ATOM 1984 C CZ  . TYR B 1 56  ? 34.575 15.673  10.271  1.00 26.75 ? 55  TYR B CZ  1 
ATOM 1985 O OH  . TYR B 1 56  ? 33.543 15.074  10.983  1.00 30.08 ? 55  TYR B OH  1 
ATOM 1986 N N   . ALA B 1 57  ? 38.714 17.866  4.574   1.00 19.50 ? 56  ALA B N   1 
ATOM 1987 C CA  . ALA B 1 57  ? 39.702 18.297  3.574   1.00 19.84 ? 56  ALA B CA  1 
ATOM 1988 C C   . ALA B 1 57  ? 39.387 19.571  2.826   1.00 19.91 ? 56  ALA B C   1 
ATOM 1989 O O   . ALA B 1 57  ? 38.301 19.719  2.300   1.00 21.59 ? 56  ALA B O   1 
ATOM 1990 C CB  . ALA B 1 57  ? 39.901 17.205  2.577   1.00 19.71 ? 56  ALA B CB  1 
ATOM 1991 N N   . VAL B 1 58  ? 40.347 20.478  2.767   1.00 19.90 ? 57  VAL B N   1 
ATOM 1992 C CA  . VAL B 1 58  ? 40.195 21.726  2.053   1.00 20.44 ? 57  VAL B CA  1 
ATOM 1993 C C   . VAL B 1 58  ? 41.204 21.690  0.897   1.00 21.38 ? 57  VAL B C   1 
ATOM 1994 O O   . VAL B 1 58  ? 42.412 21.912  1.087   1.00 21.45 ? 57  VAL B O   1 
ATOM 1995 C CB  . VAL B 1 58  ? 40.408 22.928  2.985   1.00 19.90 ? 57  VAL B CB  1 
ATOM 1996 C CG1 . VAL B 1 58  ? 40.541 24.279  2.197   1.00 19.71 ? 57  VAL B CG1 1 
ATOM 1997 C CG2 . VAL B 1 58  ? 39.286 22.976  3.999   1.00 18.74 ? 57  VAL B CG2 1 
ATOM 1998 N N   . GLU B 1 59  ? 40.693 21.398  -0.298  1.00 21.96 ? 58  GLU B N   1 
ATOM 1999 C CA  . GLU B 1 59  ? 41.536 21.262  -1.474  1.00 22.63 ? 58  GLU B CA  1 
ATOM 2000 C C   . GLU B 1 59  ? 41.343 22.360  -2.484  1.00 23.02 ? 58  GLU B C   1 
ATOM 2001 O O   . GLU B 1 59  ? 40.305 22.989  -2.588  1.00 22.62 ? 58  GLU B O   1 
ATOM 2002 C CB  . GLU B 1 59  ? 41.291 19.949  -2.167  1.00 22.69 ? 58  GLU B CB  1 
ATOM 2003 C CG  . GLU B 1 59  ? 41.301 18.758  -1.243  1.00 24.00 ? 58  GLU B CG  1 
ATOM 2004 C CD  . GLU B 1 59  ? 41.341 17.431  -1.979  1.00 24.70 ? 58  GLU B CD  1 
ATOM 2005 O OE1 . GLU B 1 59  ? 40.780 17.352  -3.120  1.00 25.17 ? 58  GLU B OE1 1 
ATOM 2006 O OE2 . GLU B 1 59  ? 41.917 16.471  -1.384  1.00 23.38 ? 58  GLU B OE2 1 
ATOM 2007 N N   . GLN B 1 60  ? 42.403 22.574  -3.238  1.00 24.83 ? 59  GLN B N   1 
ATOM 2008 C CA  . GLN B 1 60  ? 42.382 23.497  -4.356  1.00 25.88 ? 59  GLN B CA  1 
ATOM 2009 C C   . GLN B 1 60  ? 42.476 22.644  -5.579  1.00 26.62 ? 59  GLN B C   1 
ATOM 2010 O O   . GLN B 1 60  ? 42.857 21.503  -5.484  1.00 26.55 ? 59  GLN B O   1 
ATOM 2011 C CB  . GLN B 1 60  ? 43.570 24.453  -4.294  1.00 25.36 ? 59  GLN B CB  1 
ATOM 2012 C CG  . GLN B 1 60  ? 43.726 25.110  -2.969  1.00 24.38 ? 59  GLN B CG  1 
ATOM 2013 C CD  . GLN B 1 60  ? 42.637 26.058  -2.709  1.00 23.58 ? 59  GLN B CD  1 
ATOM 2014 O OE1 . GLN B 1 60  ? 42.403 26.937  -3.525  1.00 24.39 ? 59  GLN B OE1 1 
ATOM 2015 N NE2 . GLN B 1 60  ? 41.960 25.921  -1.571  1.00 23.67 ? 59  GLN B NE2 1 
ATOM 2016 N N   . GLU B 1 61  ? 42.099 23.207  -6.715  1.00 28.35 ? 60  GLU B N   1 
ATOM 2017 C CA  . GLU B 1 61  ? 42.444 22.640  -8.005  1.00 29.85 ? 60  GLU B CA  1 
ATOM 2018 C C   . GLU B 1 61  ? 43.964 22.420  -8.082  1.00 30.75 ? 60  GLU B C   1 
ATOM 2019 O O   . GLU B 1 61  ? 44.717 23.379  -7.909  1.00 31.93 ? 60  GLU B O   1 
ATOM 2020 C CB  . GLU B 1 61  ? 41.987 23.610  -9.105  1.00 29.90 ? 60  GLU B CB  1 
ATOM 2021 C CG  . GLU B 1 61  ? 40.727 23.124  -9.820  1.00 31.57 ? 60  GLU B CG  1 
ATOM 2022 C CD  . GLU B 1 61  ? 39.463 23.938  -9.585  1.00 33.01 ? 60  GLU B CD  1 
ATOM 2023 O OE1 . GLU B 1 61  ? 39.551 25.024  -8.973  1.00 36.58 ? 60  GLU B OE1 1 
ATOM 2024 O OE2 . GLU B 1 61  ? 38.376 23.492  -10.038 1.00 31.45 ? 60  GLU B OE2 1 
ATOM 2025 N N   . GLU B 1 62  ? 44.425 21.191  -8.316  1.00 31.41 ? 61  GLU B N   1 
ATOM 2026 C CA  . GLU B 1 62  ? 45.881 20.910  -8.380  1.00 32.36 ? 61  GLU B CA  1 
ATOM 2027 C C   . GLU B 1 62  ? 46.630 21.801  -9.370  1.00 32.00 ? 61  GLU B C   1 
ATOM 2028 O O   . GLU B 1 62  ? 46.240 21.879  -10.540 1.00 33.68 ? 61  GLU B O   1 
ATOM 2029 C CB  . GLU B 1 62  ? 46.190 19.422  -8.681  1.00 33.17 ? 61  GLU B CB  1 
ATOM 2030 C CG  . GLU B 1 62  ? 45.813 18.820  -10.040 1.00 35.86 ? 61  GLU B CG  1 
ATOM 2031 C CD  . GLU B 1 62  ? 46.913 17.862  -10.642 1.00 41.21 ? 61  GLU B CD  1 
ATOM 2032 O OE1 . GLU B 1 62  ? 47.996 18.375  -11.090 1.00 40.53 ? 61  GLU B OE1 1 
ATOM 2033 O OE2 . GLU B 1 62  ? 46.704 16.593  -10.717 1.00 40.93 ? 61  GLU B OE2 1 
ATOM 2034 N N   . LYS B 1 63  ? 47.666 22.486  -8.902  1.00 30.95 ? 62  LYS B N   1 
ATOM 2035 C CA  . LYS B 1 63  ? 48.310 23.533  -9.682  1.00 31.33 ? 62  LYS B CA  1 
ATOM 2036 C C   . LYS B 1 63  ? 49.698 23.912  -9.088  1.00 31.27 ? 62  LYS B C   1 
ATOM 2037 O O   . LYS B 1 63  ? 49.838 24.950  -8.393  1.00 31.84 ? 62  LYS B O   1 
ATOM 2038 C CB  . LYS B 1 63  ? 47.401 24.783  -9.784  1.00 31.24 ? 62  LYS B CB  1 
ATOM 2039 C CG  . LYS B 1 63  ? 48.033 25.995  -10.503 1.00 32.17 ? 62  LYS B CG  1 
ATOM 2040 C CD  . LYS B 1 63  ? 47.470 26.185  -11.911 1.00 35.18 ? 62  LYS B CD  1 
ATOM 2041 C CE  . LYS B 1 63  ? 47.230 27.671  -12.274 1.00 36.89 ? 62  LYS B CE  1 
ATOM 2042 N NZ  . LYS B 1 63  ? 48.564 28.370  -12.572 1.00 35.02 ? 62  LYS B NZ  1 
ATOM 2043 N N   . GLU B 1 64  ? 50.706 23.092  -9.402  1.00 29.87 ? 63  GLU B N   1 
ATOM 2044 C CA  . GLU B 1 64  ? 52.090 23.369  -9.050  1.00 28.95 ? 63  GLU B CA  1 
ATOM 2045 C C   . GLU B 1 64  ? 52.228 24.650  -8.182  1.00 28.03 ? 63  GLU B C   1 
ATOM 2046 O O   . GLU B 1 64  ? 51.980 25.765  -8.662  1.00 29.23 ? 63  GLU B O   1 
ATOM 2047 C CB  . GLU B 1 64  ? 52.882 23.493  -10.334 1.00 28.97 ? 63  GLU B CB  1 
ATOM 2048 C CG  . GLU B 1 64  ? 54.405 23.494  -10.195 1.00 30.56 ? 63  GLU B CG  1 
ATOM 2049 C CD  . GLU B 1 64  ? 55.081 23.677  -11.565 1.00 35.04 ? 63  GLU B CD  1 
ATOM 2050 O OE1 . GLU B 1 64  ? 54.825 22.839  -12.492 1.00 34.70 ? 63  GLU B OE1 1 
ATOM 2051 O OE2 . GLU B 1 64  ? 55.854 24.679  -11.730 1.00 37.99 ? 63  GLU B OE2 1 
ATOM 2052 N N   . GLY B 1 65  ? 52.628 24.510  -6.920  1.00 25.67 ? 64  GLY B N   1 
ATOM 2053 C CA  . GLY B 1 65  ? 52.791 25.665  -6.061  1.00 23.63 ? 64  GLY B CA  1 
ATOM 2054 C C   . GLY B 1 65  ? 51.547 26.016  -5.217  1.00 21.51 ? 64  GLY B C   1 
ATOM 2055 O O   . GLY B 1 65  ? 51.572 26.951  -4.434  1.00 21.06 ? 64  GLY B O   1 
ATOM 2056 N N   . ASP B 1 66  ? 50.474 25.270  -5.356  1.00 19.13 ? 65  ASP B N   1 
ATOM 2057 C CA  . ASP B 1 66  ? 49.302 25.451  -4.485  1.00 17.77 ? 65  ASP B CA  1 
ATOM 2058 C C   . ASP B 1 66  ? 49.379 24.383  -3.318  1.00 16.77 ? 65  ASP B C   1 
ATOM 2059 O O   . ASP B 1 66  ? 50.088 23.374  -3.403  1.00 15.02 ? 65  ASP B O   1 
ATOM 2060 C CB  . ASP B 1 66  ? 47.988 25.307  -5.304  1.00 16.98 ? 65  ASP B CB  1 
ATOM 2061 C CG  . ASP B 1 66  ? 47.010 26.348  -4.994  1.00 16.65 ? 65  ASP B CG  1 
ATOM 2062 O OD1 . ASP B 1 66  ? 47.137 26.956  -3.931  1.00 18.87 ? 65  ASP B OD1 1 
ATOM 2063 O OD2 . ASP B 1 66  ? 46.052 26.652  -5.733  1.00 19.54 ? 65  ASP B OD2 1 
ATOM 2064 N N   . LEU B 1 67  ? 48.645 24.620  -2.236  1.00 15.23 ? 66  LEU B N   1 
ATOM 2065 C CA  . LEU B 1 67  ? 48.707 23.743  -1.106  1.00 13.91 ? 66  LEU B CA  1 
ATOM 2066 C C   . LEU B 1 67  ? 47.312 23.368  -0.721  1.00 13.01 ? 66  LEU B C   1 
ATOM 2067 O O   . LEU B 1 67  ? 46.456 24.231  -0.719  1.00 12.04 ? 66  LEU B O   1 
ATOM 2068 C CB  . LEU B 1 67  ? 49.362 24.495  0.075   1.00 14.42 ? 66  LEU B CB  1 
ATOM 2069 C CG  . LEU B 1 67  ? 50.800 24.978  -0.009  1.00 12.06 ? 66  LEU B CG  1 
ATOM 2070 C CD1 . LEU B 1 67  ? 51.054 25.842  1.149   1.00 13.28 ? 66  LEU B CD1 1 
ATOM 2071 C CD2 . LEU B 1 67  ? 51.717 23.840  0.017   1.00 11.94 ? 66  LEU B CD2 1 
ATOM 2072 N N   . ASN B 1 68  ? 47.102 22.089  -0.371  1.00 12.99 ? 67  ASN B N   1 
ATOM 2073 C CA  . ASN B 1 68  ? 45.886 21.679  0.389   1.00 13.34 ? 67  ASN B CA  1 
ATOM 2074 C C   . ASN B 1 68  ? 46.207 21.471  1.834   1.00 13.00 ? 67  ASN B C   1 
ATOM 2075 O O   . ASN B 1 68  ? 47.363 21.519  2.248   1.00 13.96 ? 67  ASN B O   1 
ATOM 2076 C CB  . ASN B 1 68  ? 45.301 20.377  -0.119  1.00 13.25 ? 67  ASN B CB  1 
ATOM 2077 C CG  . ASN B 1 68  ? 45.221 20.326  -1.641  1.00 14.87 ? 67  ASN B CG  1 
ATOM 2078 O OD1 . ASN B 1 68  ? 44.962 21.363  -2.319  1.00 14.77 ? 67  ASN B OD1 1 
ATOM 2079 N ND2 . ASN B 1 68  ? 45.450 19.136  -2.196  1.00 12.62 ? 67  ASN B ND2 1 
ATOM 2080 N N   . PHE B 1 69  ? 45.175 21.234  2.607   1.00 12.59 ? 68  PHE B N   1 
ATOM 2081 C CA  . PHE B 1 69  ? 45.348 20.829  3.957   1.00 12.01 ? 68  PHE B CA  1 
ATOM 2082 C C   . PHE B 1 69  ? 44.116 20.080  4.406   1.00 11.75 ? 68  PHE B C   1 
ATOM 2083 O O   . PHE B 1 69  ? 43.058 20.258  3.830   1.00 11.20 ? 68  PHE B O   1 
ATOM 2084 C CB  . PHE B 1 69  ? 45.661 22.026  4.852   1.00 11.59 ? 68  PHE B CB  1 
ATOM 2085 C CG  . PHE B 1 69  ? 44.544 22.961  5.011   1.00 11.29 ? 68  PHE B CG  1 
ATOM 2086 C CD1 . PHE B 1 69  ? 43.572 22.763  5.969   1.00 12.24 ? 68  PHE B CD1 1 
ATOM 2087 C CD2 . PHE B 1 69  ? 44.493 24.106  4.250   1.00 12.33 ? 68  PHE B CD2 1 
ATOM 2088 C CE1 . PHE B 1 69  ? 42.535 23.710  6.136   1.00 10.68 ? 68  PHE B CE1 1 
ATOM 2089 C CE2 . PHE B 1 69  ? 43.459 25.029  4.388   1.00 10.35 ? 68  PHE B CE2 1 
ATOM 2090 C CZ  . PHE B 1 69  ? 42.503 24.844  5.335   1.00 10.85 ? 68  PHE B CZ  1 
ATOM 2091 N N   . ALA B 1 70  ? 44.292 19.235  5.434   1.00 11.55 ? 69  ALA B N   1 
ATOM 2092 C CA  . ALA B 1 70  ? 43.286 18.340  5.894   1.00 10.63 ? 69  ALA B CA  1 
ATOM 2093 C C   . ALA B 1 70  ? 43.672 17.804  7.251   1.00 11.05 ? 69  ALA B C   1 
ATOM 2094 O O   . ALA B 1 70  ? 44.834 17.492  7.503   1.00 8.99  ? 69  ALA B O   1 
ATOM 2095 C CB  . ALA B 1 70  ? 43.138 17.234  4.932   1.00 10.03 ? 69  ALA B CB  1 
ATOM 2096 N N   . THR B 1 71  ? 42.640 17.670  8.121   1.00 12.49 ? 70  THR B N   1 
ATOM 2097 C CA  . THR B 1 71  ? 42.778 16.938  9.385   1.00 12.79 ? 70  THR B CA  1 
ATOM 2098 C C   . THR B 1 71  ? 42.297 15.510  9.237   1.00 13.65 ? 70  THR B C   1 
ATOM 2099 O O   . THR B 1 71  ? 41.479 15.244  8.373   1.00 13.66 ? 70  THR B O   1 
ATOM 2100 C CB  . THR B 1 71  ? 42.020 17.591  10.490  1.00 12.55 ? 70  THR B CB  1 
ATOM 2101 O OG1 . THR B 1 71  ? 40.678 17.859  10.076  1.00 10.82 ? 70  THR B OG1 1 
ATOM 2102 C CG2 . THR B 1 71  ? 42.638 18.917  10.826  1.00 13.35 ? 70  THR B CG2 1 
ATOM 2103 N N   . THR B 1 72  ? 42.800 14.600  10.088  1.00 14.22 ? 71  THR B N   1 
ATOM 2104 C CA  . THR B 1 72  ? 42.316 13.225  10.130  1.00 14.42 ? 71  THR B CA  1 
ATOM 2105 C C   . THR B 1 72  ? 41.949 12.849  11.562  1.00 15.07 ? 71  THR B C   1 
ATOM 2106 O O   . THR B 1 72  ? 42.788 12.876  12.427  1.00 17.11 ? 71  THR B O   1 
ATOM 2107 C CB  . THR B 1 72  ? 43.429 12.256  9.615   1.00 13.70 ? 71  THR B CB  1 
ATOM 2108 O OG1 . THR B 1 72  ? 43.791 12.546  8.269   1.00 13.12 ? 71  THR B OG1 1 
ATOM 2109 C CG2 . THR B 1 72  ? 42.910 10.872  9.465   1.00 15.01 ? 71  THR B CG2 1 
ATOM 2110 N N   . VAL B 1 73  ? 40.717 12.482  11.831  1.00 15.69 ? 72  VAL B N   1 
ATOM 2111 C CA  . VAL B 1 73  ? 40.410 11.753  13.044  1.00 16.15 ? 72  VAL B CA  1 
ATOM 2112 C C   . VAL B 1 73  ? 40.612 10.252  12.763  1.00 17.20 ? 72  VAL B C   1 
ATOM 2113 O O   . VAL B 1 73  ? 39.723 9.534   12.272  1.00 17.87 ? 72  VAL B O   1 
ATOM 2114 C CB  . VAL B 1 73  ? 38.972 12.037  13.531  1.00 16.64 ? 72  VAL B CB  1 
ATOM 2115 C CG1 . VAL B 1 73  ? 38.677 11.300  14.848  1.00 17.06 ? 72  VAL B CG1 1 
ATOM 2116 C CG2 . VAL B 1 73  ? 38.694 13.514  13.660  1.00 14.35 ? 72  VAL B CG2 1 
ATOM 2117 N N   . LEU B 1 74  ? 41.818 9.772   13.050  1.00 18.40 ? 73  LEU B N   1 
ATOM 2118 C CA  . LEU B 1 74  ? 42.093 8.315   13.083  1.00 18.42 ? 73  LEU B CA  1 
ATOM 2119 C C   . LEU B 1 74  ? 41.603 7.720   14.436  1.00 19.00 ? 73  LEU B C   1 
ATOM 2120 O O   . LEU B 1 74  ? 42.196 7.954   15.488  1.00 17.47 ? 73  LEU B O   1 
ATOM 2121 C CB  . LEU B 1 74  ? 43.588 8.017   12.875  1.00 17.59 ? 73  LEU B CB  1 
ATOM 2122 C CG  . LEU B 1 74  ? 43.998 6.828   11.996  1.00 16.64 ? 73  LEU B CG  1 
ATOM 2123 C CD1 . LEU B 1 74  ? 45.461 6.396   12.274  1.00 16.69 ? 73  LEU B CD1 1 
ATOM 2124 C CD2 . LEU B 1 74  ? 43.132 5.686   12.127  1.00 14.44 ? 73  LEU B CD2 1 
ATOM 2125 N N   . TYR B 1 75  ? 40.483 7.002   14.364  1.00 19.79 ? 74  TYR B N   1 
ATOM 2126 C CA  . TYR B 1 75  ? 39.890 6.345   15.512  1.00 21.04 ? 74  TYR B CA  1 
ATOM 2127 C C   . TYR B 1 75  ? 40.803 5.247   16.038  1.00 21.97 ? 74  TYR B C   1 
ATOM 2128 O O   . TYR B 1 75  ? 41.688 4.801   15.322  1.00 21.34 ? 74  TYR B O   1 
ATOM 2129 C CB  . TYR B 1 75  ? 38.456 5.826   15.207  1.00 20.95 ? 74  TYR B CB  1 
ATOM 2130 C CG  . TYR B 1 75  ? 37.511 6.987   15.066  1.00 22.09 ? 74  TYR B CG  1 
ATOM 2131 C CD1 . TYR B 1 75  ? 37.090 7.672   16.188  1.00 22.14 ? 74  TYR B CD1 1 
ATOM 2132 C CD2 . TYR B 1 75  ? 37.117 7.464   13.813  1.00 24.20 ? 74  TYR B CD2 1 
ATOM 2133 C CE1 . TYR B 1 75  ? 36.282 8.789   16.118  1.00 22.94 ? 74  TYR B CE1 1 
ATOM 2134 C CE2 . TYR B 1 75  ? 36.273 8.617   13.711  1.00 27.25 ? 74  TYR B CE2 1 
ATOM 2135 C CZ  . TYR B 1 75  ? 35.857 9.274   14.896  1.00 26.18 ? 74  TYR B CZ  1 
ATOM 2136 O OH  . TYR B 1 75  ? 35.033 10.396  14.883  1.00 23.57 ? 74  TYR B OH  1 
ATOM 2137 N N   . PRO B 1 76  ? 40.595 4.843   17.311  1.00 23.08 ? 75  PRO B N   1 
ATOM 2138 C CA  . PRO B 1 76  ? 41.471 3.857   17.971  1.00 23.20 ? 75  PRO B CA  1 
ATOM 2139 C C   . PRO B 1 76  ? 40.918 2.491   17.799  1.00 23.07 ? 75  PRO B C   1 
ATOM 2140 O O   . PRO B 1 76  ? 39.703 2.374   17.678  1.00 24.32 ? 75  PRO B O   1 
ATOM 2141 C CB  . PRO B 1 76  ? 41.373 4.248   19.453  1.00 23.86 ? 75  PRO B CB  1 
ATOM 2142 C CG  . PRO B 1 76  ? 39.908 4.785   19.610  1.00 22.95 ? 75  PRO B CG  1 
ATOM 2143 C CD  . PRO B 1 76  ? 39.513 5.307   18.229  1.00 22.73 ? 75  PRO B CD  1 
ATOM 2144 N N   . GLY B 1 77  ? 41.783 1.493   17.781  1.00 23.04 ? 76  GLY B N   1 
ATOM 2145 C CA  . GLY B 1 77  ? 41.372 0.120   17.591  1.00 22.96 ? 76  GLY B CA  1 
ATOM 2146 C C   . GLY B 1 77  ? 42.489 -0.755  17.069  1.00 23.45 ? 76  GLY B C   1 
ATOM 2147 O O   . GLY B 1 77  ? 43.609 -0.311  16.857  1.00 23.27 ? 76  GLY B O   1 
ATOM 2148 N N   . LYS B 1 78  ? 42.166 -2.017  16.856  1.00 23.80 ? 77  LYS B N   1 
ATOM 2149 C CA  . LYS B 1 78  ? 43.119 -2.979  16.327  1.00 23.69 ? 77  LYS B CA  1 
ATOM 2150 C C   . LYS B 1 78  ? 42.437 -4.012  15.439  1.00 23.76 ? 77  LYS B C   1 
ATOM 2151 O O   . LYS B 1 78  ? 41.233 -4.270  15.557  1.00 24.41 ? 77  LYS B O   1 
ATOM 2152 C CB  . LYS B 1 78  ? 43.751 -3.724  17.486  1.00 24.08 ? 77  LYS B CB  1 
ATOM 2153 C CG  . LYS B 1 78  ? 44.987 -3.111  17.986  1.00 24.84 ? 77  LYS B CG  1 
ATOM 2154 C CD  . LYS B 1 78  ? 45.559 -3.928  19.106  1.00 26.95 ? 77  LYS B CD  1 
ATOM 2155 C CE  . LYS B 1 78  ? 45.149 -3.396  20.423  1.00 29.58 ? 77  LYS B CE  1 
ATOM 2156 N NZ  . LYS B 1 78  ? 45.575 -4.325  21.450  1.00 30.11 ? 77  LYS B NZ  1 
ATOM 2157 N N   . VAL B 1 79  ? 43.230 -4.594  14.554  1.00 23.48 ? 78  VAL B N   1 
ATOM 2158 C CA  . VAL B 1 79  ? 42.838 -5.732  13.765  1.00 23.27 ? 78  VAL B CA  1 
ATOM 2159 C C   . VAL B 1 79  ? 43.796 -6.806  14.153  1.00 22.96 ? 78  VAL B C   1 
ATOM 2160 O O   . VAL B 1 79  ? 44.921 -6.835  13.674  1.00 23.71 ? 78  VAL B O   1 
ATOM 2161 C CB  . VAL B 1 79  ? 42.969 -5.448  12.268  1.00 23.89 ? 78  VAL B CB  1 
ATOM 2162 C CG1 . VAL B 1 79  ? 42.385 -6.631  11.418  1.00 22.09 ? 78  VAL B CG1 1 
ATOM 2163 C CG2 . VAL B 1 79  ? 42.338 -4.061  11.921  1.00 24.13 ? 78  VAL B CG2 1 
ATOM 2164 N N   . GLY B 1 80  ? 43.341 -7.684  15.024  1.00 23.10 ? 79  GLY B N   1 
ATOM 2165 C CA  . GLY B 1 80  ? 44.198 -8.653  15.678  1.00 23.44 ? 79  GLY B CA  1 
ATOM 2166 C C   . GLY B 1 80  ? 45.125 -7.988  16.680  1.00 23.38 ? 79  GLY B C   1 
ATOM 2167 O O   . GLY B 1 80  ? 44.683 -7.470  17.701  1.00 23.53 ? 79  GLY B O   1 
ATOM 2168 N N   . LYS B 1 81  ? 46.409 -7.987  16.354  1.00 23.72 ? 80  LYS B N   1 
ATOM 2169 C CA  . LYS B 1 81  ? 47.460 -7.326  17.150  1.00 24.03 ? 80  LYS B CA  1 
ATOM 2170 C C   . LYS B 1 81  ? 47.854 -5.939  16.600  1.00 22.93 ? 80  LYS B C   1 
ATOM 2171 O O   . LYS B 1 81  ? 48.541 -5.184  17.286  1.00 21.27 ? 80  LYS B O   1 
ATOM 2172 C CB  . LYS B 1 81  ? 48.727 -8.236  17.182  1.00 24.63 ? 80  LYS B CB  1 
ATOM 2173 C CG  . LYS B 1 81  ? 48.439 -9.710  17.510  1.00 25.32 ? 80  LYS B CG  1 
ATOM 2174 C CD  . LYS B 1 81  ? 49.710 -10.494 18.003  1.00 28.77 ? 80  LYS B CD  1 
ATOM 2175 C CE  . LYS B 1 81  ? 49.402 -11.356 19.278  1.00 30.73 ? 80  LYS B CE  1 
ATOM 2176 N NZ  . LYS B 1 81  ? 49.339 -12.831 19.022  1.00 30.90 ? 80  LYS B NZ  1 
ATOM 2177 N N   . GLU B 1 82  ? 47.392 -5.637  15.372  1.00 22.70 ? 81  GLU B N   1 
ATOM 2178 C CA  . GLU B 1 82  ? 47.850 -4.486  14.535  1.00 22.33 ? 81  GLU B CA  1 
ATOM 2179 C C   . GLU B 1 82  ? 46.948 -3.318  14.631  1.00 22.00 ? 81  GLU B C   1 
ATOM 2180 O O   . GLU B 1 82  ? 45.803 -3.442  14.305  1.00 22.45 ? 81  GLU B O   1 
ATOM 2181 C CB  . GLU B 1 82  ? 47.868 -4.907  13.080  1.00 22.14 ? 81  GLU B CB  1 
ATOM 2182 C CG  . GLU B 1 82  ? 48.389 -3.922  12.071  1.00 22.92 ? 81  GLU B CG  1 
ATOM 2183 C CD  . GLU B 1 82  ? 48.769 -4.578  10.718  1.00 22.25 ? 81  GLU B CD  1 
ATOM 2184 O OE1 . GLU B 1 82  ? 48.409 -5.741  10.424  1.00 17.74 ? 81  GLU B OE1 1 
ATOM 2185 O OE2 . GLU B 1 82  ? 49.426 -3.882  9.929   1.00 26.30 ? 81  GLU B OE2 1 
ATOM 2186 N N   . PHE B 1 83  ? 47.469 -2.174  15.076  1.00 21.91 ? 82  PHE B N   1 
ATOM 2187 C CA  . PHE B 1 83  ? 46.694 -0.949  15.264  1.00 20.83 ? 82  PHE B CA  1 
ATOM 2188 C C   . PHE B 1 83  ? 46.217 -0.384  13.973  1.00 20.37 ? 82  PHE B C   1 
ATOM 2189 O O   . PHE B 1 83  ? 46.817 -0.622  12.959  1.00 21.43 ? 82  PHE B O   1 
ATOM 2190 C CB  . PHE B 1 83  ? 47.549 0.128   15.878  1.00 21.17 ? 82  PHE B CB  1 
ATOM 2191 C CG  . PHE B 1 83  ? 47.973 -0.132  17.299  1.00 20.67 ? 82  PHE B CG  1 
ATOM 2192 C CD1 . PHE B 1 83  ? 49.288 -0.515  17.595  1.00 18.58 ? 82  PHE B CD1 1 
ATOM 2193 C CD2 . PHE B 1 83  ? 47.068 0.092   18.349  1.00 21.64 ? 82  PHE B CD2 1 
ATOM 2194 C CE1 . PHE B 1 83  ? 49.677 -0.723  18.916  1.00 19.96 ? 82  PHE B CE1 1 
ATOM 2195 C CE2 . PHE B 1 83  ? 47.443 -0.117  19.707  1.00 20.41 ? 82  PHE B CE2 1 
ATOM 2196 C CZ  . PHE B 1 83  ? 48.757 -0.515  19.985  1.00 19.97 ? 82  PHE B CZ  1 
ATOM 2197 N N   . PHE B 1 84  ? 45.182 0.438   14.056  1.00 20.39 ? 83  PHE B N   1 
ATOM 2198 C CA  . PHE B 1 84  ? 44.456 1.000   12.915  1.00 20.29 ? 83  PHE B CA  1 
ATOM 2199 C C   . PHE B 1 84  ? 45.250 2.083   12.295  1.00 19.57 ? 83  PHE B C   1 
ATOM 2200 O O   . PHE B 1 84  ? 45.852 2.838   13.001  1.00 20.68 ? 83  PHE B O   1 
ATOM 2201 C CB  . PHE B 1 84  ? 43.163 1.695   13.402  1.00 20.45 ? 83  PHE B CB  1 
ATOM 2202 C CG  . PHE B 1 84  ? 42.010 0.792   13.686  1.00 20.28 ? 83  PHE B CG  1 
ATOM 2203 C CD1 . PHE B 1 84  ? 42.066 -0.575  13.449  1.00 20.43 ? 83  PHE B CD1 1 
ATOM 2204 C CD2 . PHE B 1 84  ? 40.832 1.342   14.184  1.00 21.71 ? 83  PHE B CD2 1 
ATOM 2205 C CE1 . PHE B 1 84  ? 40.961 -1.389  13.712  1.00 20.90 ? 83  PHE B CE1 1 
ATOM 2206 C CE2 . PHE B 1 84  ? 39.720 0.535   14.463  1.00 21.68 ? 83  PHE B CE2 1 
ATOM 2207 C CZ  . PHE B 1 84  ? 39.780 -0.827  14.229  1.00 20.49 ? 83  PHE B CZ  1 
ATOM 2208 N N   . PHE B 1 85  ? 45.219 2.202   10.992  1.00 19.32 ? 84  PHE B N   1 
ATOM 2209 C CA  . PHE B 1 85  ? 45.994 3.229   10.337  1.00 20.04 ? 84  PHE B CA  1 
ATOM 2210 C C   . PHE B 1 85  ? 45.193 3.835   9.236   1.00 20.40 ? 84  PHE B C   1 
ATOM 2211 O O   . PHE B 1 85  ? 44.134 3.341   8.931   1.00 19.98 ? 84  PHE B O   1 
ATOM 2212 C CB  . PHE B 1 85  ? 47.325 2.663   9.753   1.00 20.09 ? 84  PHE B CB  1 
ATOM 2213 C CG  . PHE B 1 85  ? 47.219 1.252   9.186   1.00 19.06 ? 84  PHE B CG  1 
ATOM 2214 C CD1 . PHE B 1 85  ? 46.709 1.027   7.934   1.00 19.18 ? 84  PHE B CD1 1 
ATOM 2215 C CD2 . PHE B 1 85  ? 47.664 0.173   9.913   1.00 18.95 ? 84  PHE B CD2 1 
ATOM 2216 C CE1 . PHE B 1 85  ? 46.628 -0.235  7.433   1.00 19.53 ? 84  PHE B CE1 1 
ATOM 2217 C CE2 . PHE B 1 85  ? 47.595 -1.093  9.406   1.00 18.24 ? 84  PHE B CE2 1 
ATOM 2218 C CZ  . PHE B 1 85  ? 47.075 -1.290  8.174   1.00 18.61 ? 84  PHE B CZ  1 
ATOM 2219 N N   . THR B 1 86  ? 45.747 4.875   8.607   1.00 21.45 ? 85  THR B N   1 
ATOM 2220 C CA  . THR B 1 86  ? 45.347 5.306   7.267   1.00 21.56 ? 85  THR B CA  1 
ATOM 2221 C C   . THR B 1 86  ? 45.883 4.359   6.207   1.00 22.13 ? 85  THR B C   1 
ATOM 2222 O O   . THR B 1 86  ? 46.819 3.644   6.444   1.00 20.33 ? 85  THR B O   1 
ATOM 2223 C CB  . THR B 1 86  ? 45.825 6.720   6.947   1.00 21.61 ? 85  THR B CB  1 
ATOM 2224 O OG1 . THR B 1 86  ? 47.249 6.819   7.035   1.00 19.39 ? 85  THR B OG1 1 
ATOM 2225 C CG2 . THR B 1 86  ? 45.285 7.693   7.954   1.00 22.24 ? 85  THR B CG2 1 
ATOM 2226 N N   . LYS B 1 87  ? 45.220 4.340   5.057   1.00 24.27 ? 86  LYS B N   1 
ATOM 2227 C CA  . LYS B 1 87  ? 45.610 3.496   3.952   1.00 26.14 ? 86  LYS B CA  1 
ATOM 2228 C C   . LYS B 1 87  ? 47.005 3.919   3.552   1.00 27.91 ? 86  LYS B C   1 
ATOM 2229 O O   . LYS B 1 87  ? 47.896 3.095   3.327   1.00 27.41 ? 86  LYS B O   1 
ATOM 2230 C CB  . LYS B 1 87  ? 44.645 3.674   2.783   1.00 26.89 ? 86  LYS B CB  1 
ATOM 2231 C CG  . LYS B 1 87  ? 43.166 3.181   3.026   1.00 28.08 ? 86  LYS B CG  1 
ATOM 2232 C CD  . LYS B 1 87  ? 42.527 2.532   1.738   1.00 31.74 ? 86  LYS B CD  1 
ATOM 2233 C CE  . LYS B 1 87  ? 41.406 3.416   1.093   1.00 35.31 ? 86  LYS B CE  1 
ATOM 2234 N NZ  . LYS B 1 87  ? 41.206 3.199   -0.401  1.00 36.57 ? 86  LYS B NZ  1 
ATOM 2235 N N   . GLY B 1 88  ? 47.223 5.224   3.505   1.00 30.38 ? 87  GLY B N   1 
ATOM 2236 C CA  . GLY B 1 88  ? 48.571 5.727   3.269   1.00 32.26 ? 87  GLY B CA  1 
ATOM 2237 C C   . GLY B 1 88  ? 48.853 5.896   1.779   1.00 33.82 ? 87  GLY B C   1 
ATOM 2238 O O   . GLY B 1 88  ? 48.323 5.177   0.936   1.00 34.05 ? 87  GLY B O   1 
ATOM 2239 N N   . HIS B 1 89  ? 49.655 6.897   1.447   1.00 35.42 ? 88  HIS B N   1 
ATOM 2240 C CA  . HIS B 1 89  ? 49.904 7.203   0.066   1.00 36.25 ? 88  HIS B CA  1 
ATOM 2241 C C   . HIS B 1 89  ? 51.393 7.345   -0.223  1.00 36.06 ? 88  HIS B C   1 
ATOM 2242 O O   . HIS B 1 89  ? 52.183 7.804   0.600   1.00 34.97 ? 88  HIS B O   1 
ATOM 2243 C CB  . HIS B 1 89  ? 49.085 8.439   -0.406  1.00 36.81 ? 88  HIS B CB  1 
ATOM 2244 C CG  . HIS B 1 89  ? 48.898 9.539   0.626   1.00 40.37 ? 88  HIS B CG  1 
ATOM 2245 N ND1 . HIS B 1 89  ? 47.702 9.736   1.307   1.00 45.43 ? 88  HIS B ND1 1 
ATOM 2246 C CD2 . HIS B 1 89  ? 49.710 10.562  1.008   1.00 41.33 ? 88  HIS B CD2 1 
ATOM 2247 C CE1 . HIS B 1 89  ? 47.804 10.796  2.101   1.00 44.31 ? 88  HIS B CE1 1 
ATOM 2248 N NE2 . HIS B 1 89  ? 49.019 11.304  1.953   1.00 43.23 ? 88  HIS B NE2 1 
ATOM 2249 N N   . PHE B 1 90  ? 51.760 6.868   -1.401  1.00 36.75 ? 89  PHE B N   1 
ATOM 2250 C CA  . PHE B 1 90  ? 52.875 7.449   -2.153  1.00 37.56 ? 89  PHE B CA  1 
ATOM 2251 C C   . PHE B 1 90  ? 52.199 8.576   -2.941  1.00 37.12 ? 89  PHE B C   1 
ATOM 2252 O O   . PHE B 1 90  ? 51.006 8.527   -3.198  1.00 36.55 ? 89  PHE B O   1 
ATOM 2253 C CB  . PHE B 1 90  ? 53.520 6.430   -3.129  1.00 37.80 ? 89  PHE B CB  1 
ATOM 2254 C CG  . PHE B 1 90  ? 54.924 5.995   -2.742  1.00 39.11 ? 89  PHE B CG  1 
ATOM 2255 C CD1 . PHE B 1 90  ? 55.943 6.949   -2.562  1.00 40.09 ? 89  PHE B CD1 1 
ATOM 2256 C CD2 . PHE B 1 90  ? 55.235 4.615   -2.570  1.00 39.94 ? 89  PHE B CD2 1 
ATOM 2257 C CE1 . PHE B 1 90  ? 57.267 6.546   -2.227  1.00 39.64 ? 89  PHE B CE1 1 
ATOM 2258 C CE2 . PHE B 1 90  ? 56.538 4.208   -2.214  1.00 39.80 ? 89  PHE B CE2 1 
ATOM 2259 C CZ  . PHE B 1 90  ? 57.553 5.177   -2.030  1.00 39.74 ? 89  PHE B CZ  1 
ATOM 2260 N N   . HIS B 1 91  ? 52.968 9.584   -3.321  1.00 36.51 ? 90  HIS B N   1 
ATOM 2261 C CA  . HIS B 1 91  ? 52.459 10.651  -4.173  1.00 35.71 ? 90  HIS B CA  1 
ATOM 2262 C C   . HIS B 1 91  ? 52.563 10.248  -5.639  1.00 34.41 ? 90  HIS B C   1 
ATOM 2263 O O   . HIS B 1 91  ? 53.476 9.513   -6.010  1.00 35.26 ? 90  HIS B O   1 
ATOM 2264 C CB  . HIS B 1 91  ? 53.254 11.934  -3.886  1.00 35.60 ? 90  HIS B CB  1 
ATOM 2265 C CG  . HIS B 1 91  ? 52.994 12.489  -2.519  1.00 36.60 ? 90  HIS B CG  1 
ATOM 2266 N ND1 . HIS B 1 91  ? 53.806 13.438  -1.935  1.00 37.82 ? 90  HIS B ND1 1 
ATOM 2267 C CD2 . HIS B 1 91  ? 52.003 12.234  -1.627  1.00 37.00 ? 90  HIS B CD2 1 
ATOM 2268 C CE1 . HIS B 1 91  ? 53.326 13.745  -0.742  1.00 37.76 ? 90  HIS B CE1 1 
ATOM 2269 N NE2 . HIS B 1 91  ? 52.237 13.023  -0.528  1.00 37.93 ? 90  HIS B NE2 1 
ATOM 2270 N N   . ALA B 1 92  ? 51.636 10.724  -6.465  1.00 33.11 ? 91  ALA B N   1 
ATOM 2271 C CA  . ALA B 1 92  ? 51.735 10.593  -7.925  1.00 32.45 ? 91  ALA B CA  1 
ATOM 2272 C C   . ALA B 1 92  ? 52.922 11.386  -8.532  1.00 31.21 ? 91  ALA B C   1 
ATOM 2273 O O   . ALA B 1 92  ? 53.676 10.866  -9.339  1.00 31.69 ? 91  ALA B O   1 
ATOM 2274 C CB  . ALA B 1 92  ? 50.431 11.031  -8.574  1.00 32.68 ? 91  ALA B CB  1 
ATOM 2275 N N   . LYS B 1 93  ? 53.068 12.643  -8.168  1.00 29.47 ? 92  LYS B N   1 
ATOM 2276 C CA  . LYS B 1 93  ? 54.322 13.325  -8.382  1.00 29.12 ? 92  LYS B CA  1 
ATOM 2277 C C   . LYS B 1 93  ? 55.197 13.059  -7.149  1.00 28.92 ? 92  LYS B C   1 
ATOM 2278 O O   . LYS B 1 93  ? 54.904 13.537  -6.054  1.00 28.91 ? 92  LYS B O   1 
ATOM 2279 C CB  . LYS B 1 93  ? 54.098 14.801  -8.614  1.00 28.87 ? 92  LYS B CB  1 
ATOM 2280 C CG  . LYS B 1 93  ? 53.148 15.037  -9.764  1.00 30.72 ? 92  LYS B CG  1 
ATOM 2281 C CD  . LYS B 1 93  ? 53.235 16.406  -10.415 1.00 31.91 ? 92  LYS B CD  1 
ATOM 2282 C CE  . LYS B 1 93  ? 53.463 16.275  -11.937 1.00 33.45 ? 92  LYS B CE  1 
ATOM 2283 N NZ  . LYS B 1 93  ? 52.908 17.465  -12.644 1.00 36.59 ? 92  LYS B NZ  1 
ATOM 2284 N N   . LEU B 1 94  ? 56.261 12.279  -7.323  1.00 28.41 ? 93  LEU B N   1 
ATOM 2285 C CA  . LEU B 1 94  ? 57.004 11.766  -6.178  1.00 27.73 ? 93  LEU B CA  1 
ATOM 2286 C C   . LEU B 1 94  ? 57.727 12.829  -5.383  1.00 27.00 ? 93  LEU B C   1 
ATOM 2287 O O   . LEU B 1 94  ? 57.785 12.700  -4.158  1.00 26.82 ? 93  LEU B O   1 
ATOM 2288 C CB  . LEU B 1 94  ? 57.998 10.645  -6.560  1.00 27.93 ? 93  LEU B CB  1 
ATOM 2289 C CG  . LEU B 1 94  ? 57.380 9.216   -6.696  1.00 28.69 ? 93  LEU B CG  1 
ATOM 2290 C CD1 . LEU B 1 94  ? 58.289 8.272   -7.419  1.00 26.19 ? 93  LEU B CD1 1 
ATOM 2291 C CD2 . LEU B 1 94  ? 56.958 8.576   -5.391  1.00 26.72 ? 93  LEU B CD2 1 
ATOM 2292 N N   . ASP B 1 95  ? 58.275 13.873  -6.015  1.00 26.36 ? 94  ASP B N   1 
ATOM 2293 C CA  . ASP B 1 95  ? 59.169 14.752  -5.204  1.00 26.45 ? 94  ASP B CA  1 
ATOM 2294 C C   . ASP B 1 95  ? 58.440 15.905  -4.687  1.00 24.28 ? 94  ASP B C   1 
ATOM 2295 O O   . ASP B 1 95  ? 58.447 16.979  -5.275  1.00 23.18 ? 94  ASP B O   1 
ATOM 2296 C CB  . ASP B 1 95  ? 60.610 15.064  -5.760  1.00 27.18 ? 94  ASP B CB  1 
ATOM 2297 C CG  . ASP B 1 95  ? 60.650 16.097  -6.789  1.00 28.73 ? 94  ASP B CG  1 
ATOM 2298 O OD1 . ASP B 1 95  ? 61.733 16.769  -6.881  1.00 29.04 ? 94  ASP B OD1 1 
ATOM 2299 O OD2 . ASP B 1 95  ? 59.689 16.233  -7.586  1.00 31.25 ? 94  ASP B OD2 1 
ATOM 2300 N N   . ARG B 1 96  ? 57.788 15.600  -3.563  1.00 23.12 ? 95  ARG B N   1 
ATOM 2301 C CA  . ARG B 1 96  ? 56.821 16.461  -2.892  1.00 22.00 ? 95  ARG B CA  1 
ATOM 2302 C C   . ARG B 1 96  ? 56.892 16.111  -1.418  1.00 21.47 ? 95  ARG B C   1 
ATOM 2303 O O   . ARG B 1 96  ? 56.795 14.934  -1.030  1.00 21.21 ? 95  ARG B O   1 
ATOM 2304 C CB  . ARG B 1 96  ? 55.381 16.212  -3.381  1.00 21.81 ? 95  ARG B CB  1 
ATOM 2305 C CG  . ARG B 1 96  ? 55.048 16.626  -4.779  1.00 21.03 ? 95  ARG B CG  1 
ATOM 2306 C CD  . ARG B 1 96  ? 55.230 18.074  -4.985  1.00 22.41 ? 95  ARG B CD  1 
ATOM 2307 N NE  . ARG B 1 96  ? 54.792 18.577  -6.306  1.00 23.55 ? 95  ARG B NE  1 
ATOM 2308 C CZ  . ARG B 1 96  ? 55.593 18.948  -7.331  1.00 21.57 ? 95  ARG B CZ  1 
ATOM 2309 N NH1 . ARG B 1 96  ? 56.923 18.827  -7.270  1.00 21.56 ? 95  ARG B NH1 1 
ATOM 2310 N NH2 . ARG B 1 96  ? 55.039 19.435  -8.437  1.00 19.80 ? 95  ARG B NH2 1 
ATOM 2311 N N   . ALA B 1 97  ? 57.068 17.154  -0.607  1.00 20.79 ? 96  ALA B N   1 
ATOM 2312 C CA  . ALA B 1 97  ? 57.092 17.066  0.830   1.00 19.72 ? 96  ALA B CA  1 
ATOM 2313 C C   . ALA B 1 97  ? 55.672 17.155  1.319   1.00 19.77 ? 96  ALA B C   1 
ATOM 2314 O O   . ALA B 1 97  ? 54.802 17.633  0.565   1.00 19.52 ? 96  ALA B O   1 
ATOM 2315 C CB  . ALA B 1 97  ? 57.874 18.198  1.351   1.00 19.62 ? 96  ALA B CB  1 
ATOM 2316 N N   . GLU B 1 98  ? 55.424 16.696  2.556   1.00 19.66 ? 97  GLU B N   1 
ATOM 2317 C CA  . GLU B 1 98  ? 54.254 17.162  3.354   1.00 19.72 ? 97  GLU B CA  1 
ATOM 2318 C C   . GLU B 1 98  ? 54.733 17.543  4.705   1.00 18.93 ? 97  GLU B C   1 
ATOM 2319 O O   . GLU B 1 98  ? 55.860 17.281  5.033   1.00 20.21 ? 97  GLU B O   1 
ATOM 2320 C CB  . GLU B 1 98  ? 53.169 16.101  3.534   1.00 20.30 ? 97  GLU B CB  1 
ATOM 2321 C CG  . GLU B 1 98  ? 52.809 15.312  2.283   1.00 21.86 ? 97  GLU B CG  1 
ATOM 2322 C CD  . GLU B 1 98  ? 51.467 14.608  2.368   1.00 25.17 ? 97  GLU B CD  1 
ATOM 2323 O OE1 . GLU B 1 98  ? 50.638 14.889  3.290   1.00 25.34 ? 97  GLU B OE1 1 
ATOM 2324 O OE2 . GLU B 1 98  ? 51.241 13.739  1.479   1.00 30.49 ? 97  GLU B OE2 1 
ATOM 2325 N N   . VAL B 1 99  ? 53.870 18.179  5.474   1.00 17.95 ? 98  VAL B N   1 
ATOM 2326 C CA  . VAL B 1 99  ? 54.122 18.535  6.838   1.00 16.92 ? 98  VAL B CA  1 
ATOM 2327 C C   . VAL B 1 99  ? 52.869 18.186  7.637   1.00 17.30 ? 98  VAL B C   1 
ATOM 2328 O O   . VAL B 1 99  ? 51.763 18.603  7.309   1.00 14.87 ? 98  VAL B O   1 
ATOM 2329 C CB  . VAL B 1 99  ? 54.345 19.993  6.984   1.00 17.09 ? 98  VAL B CB  1 
ATOM 2330 C CG1 . VAL B 1 99  ? 54.338 20.419  8.516   1.00 16.88 ? 98  VAL B CG1 1 
ATOM 2331 C CG2 . VAL B 1 99  ? 55.625 20.382  6.284   1.00 17.14 ? 98  VAL B CG2 1 
ATOM 2332 N N   . TYR B 1 100 ? 53.080 17.429  8.712   1.00 17.76 ? 99  TYR B N   1 
ATOM 2333 C CA  . TYR B 1 100 ? 52.014 16.997  9.575   1.00 18.40 ? 99  TYR B CA  1 
ATOM 2334 C C   . TYR B 1 100 ? 52.157 17.758  10.869  1.00 18.52 ? 99  TYR B C   1 
ATOM 2335 O O   . TYR B 1 100 ? 53.254 18.235  11.165  1.00 18.95 ? 99  TYR B O   1 
ATOM 2336 C CB  . TYR B 1 100 ? 52.088 15.490  9.778   1.00 19.23 ? 99  TYR B CB  1 
ATOM 2337 C CG  . TYR B 1 100 ? 51.463 14.677  8.617   1.00 22.38 ? 99  TYR B CG  1 
ATOM 2338 C CD1 . TYR B 1 100 ? 51.955 14.760  7.316   1.00 24.46 ? 99  TYR B CD1 1 
ATOM 2339 C CD2 . TYR B 1 100 ? 50.363 13.867  8.824   1.00 26.36 ? 99  TYR B CD2 1 
ATOM 2340 C CE1 . TYR B 1 100 ? 51.377 14.044  6.259   1.00 26.14 ? 99  TYR B CE1 1 
ATOM 2341 C CE2 . TYR B 1 100 ? 49.761 13.137  7.766   1.00 27.50 ? 99  TYR B CE2 1 
ATOM 2342 C CZ  . TYR B 1 100 ? 50.259 13.225  6.482   1.00 28.58 ? 99  TYR B CZ  1 
ATOM 2343 O OH  . TYR B 1 100 ? 49.663 12.475  5.430   1.00 27.72 ? 99  TYR B OH  1 
ATOM 2344 N N   . VAL B 1 101 ? 51.035 17.946  11.583  1.00 17.78 ? 100 VAL B N   1 
ATOM 2345 C CA  . VAL B 1 101 ? 50.996 18.617  12.886  1.00 17.23 ? 100 VAL B CA  1 
ATOM 2346 C C   . VAL B 1 101 ? 50.026 17.863  13.774  1.00 17.18 ? 100 VAL B C   1 
ATOM 2347 O O   . VAL B 1 101 ? 48.843 17.770  13.440  1.00 16.43 ? 100 VAL B O   1 
ATOM 2348 C CB  . VAL B 1 101 ? 50.488 20.064  12.782  1.00 17.25 ? 100 VAL B CB  1 
ATOM 2349 C CG1 . VAL B 1 101 ? 50.081 20.630  14.170  1.00 15.33 ? 100 VAL B CG1 1 
ATOM 2350 C CG2 . VAL B 1 101 ? 51.514 20.920  12.152  1.00 16.48 ? 100 VAL B CG2 1 
ATOM 2351 N N   . ALA B 1 102 ? 50.496 17.332  14.896  1.00 17.02 ? 101 ALA B N   1 
ATOM 2352 C CA  . ALA B 1 102 ? 49.637 16.441  15.673  1.00 17.58 ? 101 ALA B CA  1 
ATOM 2353 C C   . ALA B 1 102 ? 48.859 17.257  16.684  1.00 18.15 ? 101 ALA B C   1 
ATOM 2354 O O   . ALA B 1 102 ? 49.471 18.067  17.405  1.00 18.28 ? 101 ALA B O   1 
ATOM 2355 C CB  . ALA B 1 102 ? 50.446 15.401  16.361  1.00 17.87 ? 101 ALA B CB  1 
ATOM 2356 N N   . LEU B 1 103 ? 47.531 17.073  16.732  1.00 17.95 ? 102 LEU B N   1 
ATOM 2357 C CA  . LEU B 1 103 ? 46.660 17.945  17.562  1.00 18.72 ? 102 LEU B CA  1 
ATOM 2358 C C   . LEU B 1 103 ? 46.205 17.360  18.927  1.00 19.09 ? 102 LEU B C   1 
ATOM 2359 O O   . LEU B 1 103 ? 46.169 18.057  19.908  1.00 18.68 ? 102 LEU B O   1 
ATOM 2360 C CB  . LEU B 1 103 ? 45.441 18.385  16.761  1.00 18.69 ? 102 LEU B CB  1 
ATOM 2361 C CG  . LEU B 1 103 ? 45.804 19.153  15.495  1.00 19.36 ? 102 LEU B CG  1 
ATOM 2362 C CD1 . LEU B 1 103 ? 44.519 19.590  14.759  1.00 18.79 ? 102 LEU B CD1 1 
ATOM 2363 C CD2 . LEU B 1 103 ? 46.768 20.316  15.828  1.00 16.93 ? 102 LEU B CD2 1 
ATOM 2364 N N   . LYS B 1 104 ? 45.873 16.069  18.941  1.00 19.92 ? 103 LYS B N   1 
ATOM 2365 C CA  . LYS B 1 104 ? 45.349 15.343  20.089  1.00 19.68 ? 103 LYS B CA  1 
ATOM 2366 C C   . LYS B 1 104 ? 45.662 13.883  19.914  1.00 20.42 ? 103 LYS B C   1 
ATOM 2367 O O   . LYS B 1 104 ? 45.973 13.441  18.809  1.00 21.89 ? 103 LYS B O   1 
ATOM 2368 C CB  . LYS B 1 104 ? 43.850 15.480  20.154  1.00 19.93 ? 103 LYS B CB  1 
ATOM 2369 C CG  . LYS B 1 104 ? 43.295 15.550  21.563  1.00 20.85 ? 103 LYS B CG  1 
ATOM 2370 C CD  . LYS B 1 104 ? 41.744 15.360  21.594  1.00 21.62 ? 103 LYS B CD  1 
ATOM 2371 C CE  . LYS B 1 104 ? 41.179 15.946  22.917  1.00 22.10 ? 103 LYS B CE  1 
ATOM 2372 N NZ  . LYS B 1 104 ? 39.757 15.473  23.264  1.00 22.77 ? 103 LYS B NZ  1 
ATOM 2373 N N   . GLY B 1 105 ? 45.593 13.102  20.985  1.00 21.22 ? 104 GLY B N   1 
ATOM 2374 C CA  . GLY B 1 105 ? 45.711 11.644  20.871  1.00 20.76 ? 104 GLY B CA  1 
ATOM 2375 C C   . GLY B 1 105 ? 47.145 11.216  20.906  1.00 21.39 ? 104 GLY B C   1 
ATOM 2376 O O   . GLY B 1 105 ? 48.048 12.015  21.197  1.00 22.01 ? 104 GLY B O   1 
ATOM 2377 N N   . LYS B 1 106 ? 47.382 9.949   20.622  1.00 21.84 ? 105 LYS B N   1 
ATOM 2378 C CA  . LYS B 1 106 ? 48.734 9.390   20.750  1.00 21.77 ? 105 LYS B CA  1 
ATOM 2379 C C   . LYS B 1 106 ? 48.938 8.450   19.551  1.00 21.50 ? 105 LYS B C   1 
ATOM 2380 O O   . LYS B 1 106 ? 48.127 7.563   19.311  1.00 21.85 ? 105 LYS B O   1 
ATOM 2381 C CB  . LYS B 1 106 ? 48.874 8.684   22.105  1.00 21.95 ? 105 LYS B CB  1 
ATOM 2382 C CG  . LYS B 1 106 ? 50.258 8.148   22.366  1.00 23.84 ? 105 LYS B CG  1 
ATOM 2383 C CD  . LYS B 1 106 ? 50.737 8.437   23.796  1.00 26.98 ? 105 LYS B CD  1 
ATOM 2384 C CE  . LYS B 1 106 ? 52.222 7.907   24.040  1.00 27.84 ? 105 LYS B CE  1 
ATOM 2385 N NZ  . LYS B 1 106 ? 52.308 6.383   24.087  1.00 26.47 ? 105 LYS B NZ  1 
ATOM 2386 N N   . GLY B 1 107 ? 50.010 8.659   18.785  1.00 20.94 ? 106 GLY B N   1 
ATOM 2387 C CA  . GLY B 1 107 ? 50.178 7.940   17.531  1.00 20.28 ? 106 GLY B CA  1 
ATOM 2388 C C   . GLY B 1 107 ? 51.567 8.041   16.935  1.00 19.77 ? 106 GLY B C   1 
ATOM 2389 O O   . GLY B 1 107 ? 52.541 8.295   17.648  1.00 20.29 ? 106 GLY B O   1 
ATOM 2390 N N   . GLY B 1 108 ? 51.664 7.835   15.633  1.00 18.61 ? 107 GLY B N   1 
ATOM 2391 C CA  . GLY B 1 108 ? 52.948 7.913   14.969  1.00 18.97 ? 107 GLY B CA  1 
ATOM 2392 C C   . GLY B 1 108 ? 52.879 7.781   13.471  1.00 19.00 ? 107 GLY B C   1 
ATOM 2393 O O   . GLY B 1 108 ? 51.803 7.505   12.904  1.00 19.70 ? 107 GLY B O   1 
ATOM 2394 N N   . MET B 1 109 ? 54.011 7.995   12.810  1.00 19.01 ? 108 MET B N   1 
ATOM 2395 C CA  . MET B 1 109 ? 54.040 7.886   11.372  1.00 19.31 ? 108 MET B CA  1 
ATOM 2396 C C   . MET B 1 109 ? 54.964 6.842   10.861  1.00 19.81 ? 108 MET B C   1 
ATOM 2397 O O   . MET B 1 109 ? 56.062 6.699   11.335  1.00 20.50 ? 108 MET B O   1 
ATOM 2398 C CB  . MET B 1 109 ? 54.390 9.185   10.715  1.00 18.92 ? 108 MET B CB  1 
ATOM 2399 C CG  . MET B 1 109 ? 53.593 9.348   9.432   1.00 20.08 ? 108 MET B CG  1 
ATOM 2400 S SD  . MET B 1 109 ? 54.428 10.290  8.230   1.00 19.00 ? 108 MET B SD  1 
ATOM 2401 C CE  . MET B 1 109 ? 53.785 11.844  8.686   1.00 22.22 ? 108 MET B CE  1 
ATOM 2402 N N   . LEU B 1 110 ? 54.514 6.118   9.852   1.00 20.49 ? 109 LEU B N   1 
ATOM 2403 C CA  . LEU B 1 110 ? 55.328 5.106   9.243   1.00 20.83 ? 109 LEU B CA  1 
ATOM 2404 C C   . LEU B 1 110 ? 55.633 5.638   7.871   1.00 21.30 ? 109 LEU B C   1 
ATOM 2405 O O   . LEU B 1 110 ? 54.745 6.115   7.163   1.00 20.79 ? 109 LEU B O   1 
ATOM 2406 C CB  . LEU B 1 110 ? 54.538 3.825   9.153   1.00 21.40 ? 109 LEU B CB  1 
ATOM 2407 C CG  . LEU B 1 110 ? 55.135 2.507   9.613   1.00 21.52 ? 109 LEU B CG  1 
ATOM 2408 C CD1 . LEU B 1 110 ? 54.399 1.380   8.871   1.00 21.79 ? 109 LEU B CD1 1 
ATOM 2409 C CD2 . LEU B 1 110 ? 56.605 2.473   9.325   1.00 22.40 ? 109 LEU B CD2 1 
ATOM 2410 N N   . LEU B 1 111 ? 56.902 5.537   7.512   1.00 21.69 ? 110 LEU B N   1 
ATOM 2411 C CA  . LEU B 1 111 ? 57.417 6.146   6.309   1.00 21.86 ? 110 LEU B CA  1 
ATOM 2412 C C   . LEU B 1 111 ? 58.358 5.184   5.614   1.00 21.88 ? 110 LEU B C   1 
ATOM 2413 O O   . LEU B 1 111 ? 58.973 4.330   6.259   1.00 20.38 ? 110 LEU B O   1 
ATOM 2414 C CB  . LEU B 1 111 ? 58.180 7.404   6.709   1.00 22.89 ? 110 LEU B CB  1 
ATOM 2415 C CG  . LEU B 1 111 ? 57.357 8.610   7.221   1.00 21.86 ? 110 LEU B CG  1 
ATOM 2416 C CD1 . LEU B 1 111 ? 57.939 9.077   8.519   1.00 21.19 ? 110 LEU B CD1 1 
ATOM 2417 C CD2 . LEU B 1 111 ? 57.400 9.780   6.151   1.00 21.76 ? 110 LEU B CD2 1 
ATOM 2418 N N   . GLN B 1 112 ? 58.495 5.336   4.294   1.00 22.87 ? 111 GLN B N   1 
ATOM 2419 C CA  . GLN B 1 112 ? 59.178 4.331   3.478   1.00 22.80 ? 111 GLN B CA  1 
ATOM 2420 C C   . GLN B 1 112 ? 59.549 4.783   2.096   1.00 23.06 ? 111 GLN B C   1 
ATOM 2421 O O   . GLN B 1 112 ? 58.724 5.337   1.374   1.00 24.12 ? 111 GLN B O   1 
ATOM 2422 C CB  . GLN B 1 112 ? 58.236 3.154   3.375   1.00 23.15 ? 111 GLN B CB  1 
ATOM 2423 C CG  . GLN B 1 112 ? 58.648 2.059   2.449   1.00 24.15 ? 111 GLN B CG  1 
ATOM 2424 C CD  . GLN B 1 112 ? 57.682 0.956   2.533   1.00 25.19 ? 111 GLN B CD  1 
ATOM 2425 O OE1 . GLN B 1 112 ? 57.789 0.162   3.435   1.00 26.01 ? 111 GLN B OE1 1 
ATOM 2426 N NE2 . GLN B 1 112 ? 56.674 0.938   1.642   1.00 27.19 ? 111 GLN B NE2 1 
ATOM 2427 N N   . THR B 1 113 ? 60.784 4.506   1.690   1.00 24.48 ? 112 THR B N   1 
ATOM 2428 C CA  . THR B 1 113 ? 61.303 4.945   0.356   1.00 25.17 ? 112 THR B CA  1 
ATOM 2429 C C   . THR B 1 113 ? 60.861 3.939   -0.660  1.00 25.62 ? 112 THR B C   1 
ATOM 2430 O O   . THR B 1 113 ? 60.543 2.815   -0.285  1.00 26.46 ? 112 THR B O   1 
ATOM 2431 C CB  . THR B 1 113 ? 62.857 4.997   0.340   1.00 24.57 ? 112 THR B CB  1 
ATOM 2432 O OG1 . THR B 1 113 ? 63.375 3.657   0.298   1.00 25.71 ? 112 THR B OG1 1 
ATOM 2433 C CG2 . THR B 1 113 ? 63.425 5.549   1.627   1.00 23.02 ? 112 THR B CG2 1 
ATOM 2434 N N   . PRO B 1 114 ? 60.900 4.282   -1.940  1.00 26.44 ? 113 PRO B N   1 
ATOM 2435 C CA  . PRO B 1 114 ? 60.478 3.332   -2.965  1.00 27.30 ? 113 PRO B CA  1 
ATOM 2436 C C   . PRO B 1 114 ? 61.165 1.974   -2.816  1.00 28.53 ? 113 PRO B C   1 
ATOM 2437 O O   . PRO B 1 114 ? 60.506 0.987   -3.143  1.00 30.34 ? 113 PRO B O   1 
ATOM 2438 C CB  . PRO B 1 114 ? 60.842 4.041   -4.265  1.00 27.35 ? 113 PRO B CB  1 
ATOM 2439 C CG  . PRO B 1 114 ? 60.795 5.464   -3.954  1.00 25.49 ? 113 PRO B CG  1 
ATOM 2440 C CD  . PRO B 1 114 ? 61.313 5.560   -2.540  1.00 26.03 ? 113 PRO B CD  1 
ATOM 2441 N N   . GLU B 1 115 ? 62.391 1.899   -2.298  1.00 29.06 ? 114 GLU B N   1 
ATOM 2442 C CA  . GLU B 1 115 ? 63.101 0.612   -2.162  1.00 30.45 ? 114 GLU B CA  1 
ATOM 2443 C C   . GLU B 1 115 ? 62.753 -0.234  -0.907  1.00 31.64 ? 114 GLU B C   1 
ATOM 2444 O O   . GLU B 1 115 ? 63.090 -1.424  -0.848  1.00 31.97 ? 114 GLU B O   1 
ATOM 2445 C CB  . GLU B 1 115 ? 64.638 0.790   -2.228  1.00 30.34 ? 114 GLU B CB  1 
ATOM 2446 C CG  . GLU B 1 115 ? 65.130 1.443   -3.531  1.00 30.71 ? 114 GLU B CG  1 
ATOM 2447 C CD  . GLU B 1 115 ? 65.418 2.960   -3.399  1.00 31.96 ? 114 GLU B CD  1 
ATOM 2448 O OE1 . GLU B 1 115 ? 65.376 3.542   -2.263  1.00 30.96 ? 114 GLU B OE1 1 
ATOM 2449 O OE2 . GLU B 1 115 ? 65.700 3.583   -4.438  1.00 30.61 ? 114 GLU B OE2 1 
ATOM 2450 N N   . GLY B 1 116 ? 62.131 0.364   0.104   1.00 32.41 ? 115 GLY B N   1 
ATOM 2451 C CA  . GLY B 1 116 ? 61.628 -0.421  1.230   1.00 32.69 ? 115 GLY B CA  1 
ATOM 2452 C C   . GLY B 1 116 ? 62.079 -0.017  2.630   1.00 32.75 ? 115 GLY B C   1 
ATOM 2453 O O   . GLY B 1 116 ? 61.357 -0.288  3.590   1.00 32.60 ? 115 GLY B O   1 
ATOM 2454 N N   . ASP B 1 117 ? 63.234 0.641   2.746   1.00 32.86 ? 116 ASP B N   1 
ATOM 2455 C CA  . ASP B 1 117 ? 63.724 1.125   4.047   1.00 33.02 ? 116 ASP B CA  1 
ATOM 2456 C C   . ASP B 1 117 ? 62.661 1.940   4.794   1.00 32.17 ? 116 ASP B C   1 
ATOM 2457 O O   . ASP B 1 117 ? 62.244 3.002   4.333   1.00 31.63 ? 116 ASP B O   1 
ATOM 2458 C CB  . ASP B 1 117 ? 64.954 2.023   3.881   1.00 33.53 ? 116 ASP B CB  1 
ATOM 2459 C CG  . ASP B 1 117 ? 66.094 1.345   3.144   1.00 36.00 ? 116 ASP B CG  1 
ATOM 2460 O OD1 . ASP B 1 117 ? 65.963 1.177   1.891   1.00 36.71 ? 116 ASP B OD1 1 
ATOM 2461 O OD2 . ASP B 1 117 ? 67.168 0.981   3.741   1.00 39.46 ? 116 ASP B OD2 1 
ATOM 2462 N N   . ALA B 1 118 ? 62.282 1.453   5.973   1.00 31.60 ? 117 ALA B N   1 
ATOM 2463 C CA  . ALA B 1 118 ? 61.242 2.076   6.788   1.00 30.94 ? 117 ALA B CA  1 
ATOM 2464 C C   . ALA B 1 118 ? 61.793 3.185   7.714   1.00 30.56 ? 117 ALA B C   1 
ATOM 2465 O O   . ALA B 1 118 ? 63.013 3.335   7.871   1.00 30.91 ? 117 ALA B O   1 
ATOM 2466 C CB  . ALA B 1 118 ? 60.551 1.008   7.611   1.00 30.73 ? 117 ALA B CB  1 
ATOM 2467 N N   . LYS B 1 119 ? 60.868 3.957   8.307   1.00 29.62 ? 118 LYS B N   1 
ATOM 2468 C CA  . LYS B 1 119 ? 61.141 4.855   9.439   1.00 28.22 ? 118 LYS B CA  1 
ATOM 2469 C C   . LYS B 1 119 ? 59.886 5.207   10.240  1.00 27.19 ? 118 LYS B C   1 
ATOM 2470 O O   . LYS B 1 119 ? 58.850 5.585   9.686   1.00 26.24 ? 118 LYS B O   1 
ATOM 2471 C CB  . LYS B 1 119 ? 61.833 6.151   9.026   1.00 28.20 ? 118 LYS B CB  1 
ATOM 2472 C CG  . LYS B 1 119 ? 62.158 7.052   10.279  1.00 28.28 ? 118 LYS B CG  1 
ATOM 2473 C CD  . LYS B 1 119 ? 63.512 7.813   10.165  1.00 29.43 ? 118 LYS B CD  1 
ATOM 2474 C CE  . LYS B 1 119 ? 64.331 7.887   11.491  1.00 29.62 ? 118 LYS B CE  1 
ATOM 2475 N NZ  . LYS B 1 119 ? 64.463 9.285   12.034  1.00 28.68 ? 118 LYS B NZ  1 
ATOM 2476 N N   . TRP B 1 120 ? 60.012 5.099   11.563  1.00 26.58 ? 119 TRP B N   1 
ATOM 2477 C CA  . TRP B 1 120 ? 58.923 5.362   12.485  1.00 25.21 ? 119 TRP B CA  1 
ATOM 2478 C C   . TRP B 1 120 ? 59.230 6.645   13.220  1.00 24.96 ? 119 TRP B C   1 
ATOM 2479 O O   . TRP B 1 120 ? 60.324 6.816   13.674  1.00 25.43 ? 119 TRP B O   1 
ATOM 2480 C CB  . TRP B 1 120 ? 58.803 4.189   13.434  1.00 24.28 ? 119 TRP B CB  1 
ATOM 2481 C CG  . TRP B 1 120 ? 57.810 4.368   14.554  1.00 24.32 ? 119 TRP B CG  1 
ATOM 2482 C CD1 . TRP B 1 120 ? 58.097 4.577   15.857  1.00 20.78 ? 119 TRP B CD1 1 
ATOM 2483 C CD2 . TRP B 1 120 ? 56.367 4.339   14.458  1.00 22.35 ? 119 TRP B CD2 1 
ATOM 2484 N NE1 . TRP B 1 120 ? 56.935 4.674   16.576  1.00 20.57 ? 119 TRP B NE1 1 
ATOM 2485 C CE2 . TRP B 1 120 ? 55.860 4.541   15.742  1.00 20.98 ? 119 TRP B CE2 1 
ATOM 2486 C CE3 . TRP B 1 120 ? 55.458 4.208   13.404  1.00 21.44 ? 119 TRP B CE3 1 
ATOM 2487 C CZ2 . TRP B 1 120 ? 54.483 4.606   16.009  1.00 21.42 ? 119 TRP B CZ2 1 
ATOM 2488 C CZ3 . TRP B 1 120 ? 54.088 4.257   13.676  1.00 21.49 ? 119 TRP B CZ3 1 
ATOM 2489 C CH2 . TRP B 1 120 ? 53.617 4.441   14.960  1.00 20.91 ? 119 TRP B CH2 1 
ATOM 2490 N N   . ILE B 1 121 ? 58.268 7.554   13.304  1.00 25.16 ? 120 ILE B N   1 
ATOM 2491 C CA  . ILE B 1 121 ? 58.354 8.805   14.106  1.00 25.24 ? 120 ILE B CA  1 
ATOM 2492 C C   . ILE B 1 121 ? 57.172 8.918   15.119  1.00 25.21 ? 120 ILE B C   1 
ATOM 2493 O O   . ILE B 1 121 ? 56.005 9.011   14.699  1.00 24.01 ? 120 ILE B O   1 
ATOM 2494 C CB  . ILE B 1 121 ? 58.306 10.063  13.196  1.00 25.04 ? 120 ILE B CB  1 
ATOM 2495 C CG1 . ILE B 1 121 ? 59.443 10.056  12.155  1.00 26.84 ? 120 ILE B CG1 1 
ATOM 2496 C CG2 . ILE B 1 121 ? 58.320 11.304  14.010  1.00 23.73 ? 120 ILE B CG2 1 
ATOM 2497 C CD1 . ILE B 1 121 ? 60.868 10.081  12.747  1.00 29.38 ? 120 ILE B CD1 1 
ATOM 2498 N N   . SER B 1 122 ? 57.488 8.895   16.429  1.00 24.79 ? 121 SER B N   1 
ATOM 2499 C CA  . SER B 1 122 ? 56.526 9.222   17.475  1.00 24.45 ? 121 SER B CA  1 
ATOM 2500 C C   . SER B 1 122 ? 55.760 10.505  17.124  1.00 24.13 ? 121 SER B C   1 
ATOM 2501 O O   . SER B 1 122 ? 56.346 11.484  16.706  1.00 23.75 ? 121 SER B O   1 
ATOM 2502 C CB  . SER B 1 122 ? 57.265 9.487   18.792  1.00 24.72 ? 121 SER B CB  1 
ATOM 2503 O OG  . SER B 1 122 ? 57.280 8.303   19.552  1.00 26.39 ? 121 SER B OG  1 
ATOM 2504 N N   . MET B 1 123 ? 54.456 10.510  17.335  1.00 23.43 ? 122 MET B N   1 
ATOM 2505 C CA  . MET B 1 123 ? 53.682 11.732  17.270  1.00 23.05 ? 122 MET B CA  1 
ATOM 2506 C C   . MET B 1 123 ? 52.771 11.845  18.513  1.00 23.74 ? 122 MET B C   1 
ATOM 2507 O O   . MET B 1 123 ? 51.898 10.964  18.767  1.00 23.07 ? 122 MET B O   1 
ATOM 2508 C CB  . MET B 1 123 ? 52.791 11.742  16.017  1.00 23.38 ? 122 MET B CB  1 
ATOM 2509 C CG  . MET B 1 123 ? 53.498 11.628  14.666  1.00 22.30 ? 122 MET B CG  1 
ATOM 2510 S SD  . MET B 1 123 ? 52.362 11.667  13.246  1.00 21.72 ? 122 MET B SD  1 
ATOM 2511 C CE  . MET B 1 123 ? 52.053 13.423  13.046  1.00 21.89 ? 122 MET B CE  1 
ATOM 2512 N N   . GLU B 1 124 ? 52.999 12.902  19.301  1.00 23.76 ? 123 GLU B N   1 
ATOM 2513 C CA  . GLU B 1 124 ? 52.012 13.383  20.273  1.00 24.30 ? 123 GLU B CA  1 
ATOM 2514 C C   . GLU B 1 124 ? 51.781 14.897  20.045  1.00 23.24 ? 123 GLU B C   1 
ATOM 2515 O O   . GLU B 1 124 ? 52.486 15.495  19.241  1.00 22.32 ? 123 GLU B O   1 
ATOM 2516 C CB  . GLU B 1 124 ? 52.464 13.069  21.699  1.00 25.13 ? 123 GLU B CB  1 
ATOM 2517 C CG  . GLU B 1 124 ? 52.968 11.633  21.910  1.00 27.94 ? 123 GLU B CG  1 
ATOM 2518 C CD  . GLU B 1 124 ? 54.396 11.587  22.446  1.00 33.37 ? 123 GLU B CD  1 
ATOM 2519 O OE1 . GLU B 1 124 ? 55.273 12.329  21.890  1.00 34.58 ? 123 GLU B OE1 1 
ATOM 2520 O OE2 . GLU B 1 124 ? 54.622 10.825  23.444  1.00 36.35 ? 123 GLU B OE2 1 
ATOM 2521 N N   . PRO B 1 125 ? 50.777 15.505  20.694  1.00 22.34 ? 124 PRO B N   1 
ATOM 2522 C CA  . PRO B 1 125 ? 50.504 16.934  20.453  1.00 21.45 ? 124 PRO B CA  1 
ATOM 2523 C C   . PRO B 1 125 ? 51.754 17.748  20.456  1.00 20.27 ? 124 PRO B C   1 
ATOM 2524 O O   . PRO B 1 125 ? 52.588 17.534  21.303  1.00 20.02 ? 124 PRO B O   1 
ATOM 2525 C CB  . PRO B 1 125 ? 49.600 17.346  21.631  1.00 21.80 ? 124 PRO B CB  1 
ATOM 2526 C CG  . PRO B 1 125 ? 48.920 16.054  22.114  1.00 21.19 ? 124 PRO B CG  1 
ATOM 2527 C CD  . PRO B 1 125 ? 49.817 14.908  21.657  1.00 21.64 ? 124 PRO B CD  1 
ATOM 2528 N N   . GLY B 1 126 ? 51.877 18.659  19.490  1.00 20.41 ? 125 GLY B N   1 
ATOM 2529 C CA  . GLY B 1 126 ? 53.074 19.474  19.272  1.00 19.63 ? 125 GLY B CA  1 
ATOM 2530 C C   . GLY B 1 126 ? 54.017 18.936  18.208  1.00 19.29 ? 125 GLY B C   1 
ATOM 2531 O O   . GLY B 1 126 ? 54.832 19.660  17.669  1.00 20.25 ? 125 GLY B O   1 
ATOM 2532 N N   . THR B 1 127 ? 53.904 17.662  17.891  1.00 18.71 ? 126 THR B N   1 
ATOM 2533 C CA  . THR B 1 127 ? 54.784 17.027  16.938  1.00 18.08 ? 126 THR B CA  1 
ATOM 2534 C C   . THR B 1 127 ? 54.484 17.435  15.517  1.00 18.25 ? 126 THR B C   1 
ATOM 2535 O O   . THR B 1 127 ? 53.510 16.959  14.927  1.00 20.54 ? 126 THR B O   1 
ATOM 2536 C CB  . THR B 1 127 ? 54.678 15.509  17.039  1.00 17.21 ? 126 THR B CB  1 
ATOM 2537 O OG1 . THR B 1 127 ? 55.210 15.058  18.305  1.00 18.07 ? 126 THR B OG1 1 
ATOM 2538 C CG2 . THR B 1 127 ? 55.590 14.890  16.025  1.00 17.20 ? 126 THR B CG2 1 
ATOM 2539 N N   . VAL B 1 128 ? 55.323 18.274  14.941  1.00 17.39 ? 127 VAL B N   1 
ATOM 2540 C CA  . VAL B 1 128 ? 55.275 18.512  13.530  1.00 17.16 ? 127 VAL B CA  1 
ATOM 2541 C C   . VAL B 1 128 ? 56.216 17.509  12.886  1.00 16.62 ? 127 VAL B C   1 
ATOM 2542 O O   . VAL B 1 128 ? 57.314 17.330  13.354  1.00 16.60 ? 127 VAL B O   1 
ATOM 2543 C CB  . VAL B 1 128 ? 55.653 19.969  13.220  1.00 17.94 ? 127 VAL B CB  1 
ATOM 2544 C CG1 . VAL B 1 128 ? 55.335 20.307  11.779  1.00 19.53 ? 127 VAL B CG1 1 
ATOM 2545 C CG2 . VAL B 1 128 ? 54.881 20.936  14.172  1.00 16.35 ? 127 VAL B CG2 1 
ATOM 2546 N N   . VAL B 1 129 ? 55.765 16.812  11.841  1.00 16.39 ? 128 VAL B N   1 
ATOM 2547 C CA  . VAL B 1 129 ? 56.625 15.905  11.057  1.00 15.60 ? 128 VAL B CA  1 
ATOM 2548 C C   . VAL B 1 129 ? 56.841 16.398  9.614   1.00 15.44 ? 128 VAL B C   1 
ATOM 2549 O O   . VAL B 1 129 ? 55.903 16.724  8.912   1.00 15.91 ? 128 VAL B O   1 
ATOM 2550 C CB  . VAL B 1 129 ? 56.001 14.519  10.943  1.00 15.53 ? 128 VAL B CB  1 
ATOM 2551 C CG1 . VAL B 1 129 ? 56.841 13.615  10.025  1.00 16.16 ? 128 VAL B CG1 1 
ATOM 2552 C CG2 . VAL B 1 129 ? 55.832 13.888  12.261  1.00 15.77 ? 128 VAL B CG2 1 
ATOM 2553 N N   . TYR B 1 130 ? 58.090 16.419  9.180   1.00 15.29 ? 129 TYR B N   1 
ATOM 2554 C CA  . TYR B 1 130 ? 58.447 16.725  7.833   1.00 14.80 ? 129 TYR B CA  1 
ATOM 2555 C C   . TYR B 1 130 ? 58.530 15.394  7.091   1.00 14.74 ? 129 TYR B C   1 
ATOM 2556 O O   . TYR B 1 130 ? 59.394 14.553  7.368   1.00 14.90 ? 129 TYR B O   1 
ATOM 2557 C CB  . TYR B 1 130 ? 59.803 17.461  7.843   1.00 15.41 ? 129 TYR B CB  1 
ATOM 2558 C CG  . TYR B 1 130 ? 60.415 17.634  6.457   1.00 16.34 ? 129 TYR B CG  1 
ATOM 2559 C CD1 . TYR B 1 130 ? 61.503 16.881  6.070   1.00 17.49 ? 129 TYR B CD1 1 
ATOM 2560 C CD2 . TYR B 1 130 ? 59.889 18.545  5.541   1.00 16.70 ? 129 TYR B CD2 1 
ATOM 2561 C CE1 . TYR B 1 130 ? 62.093 17.036  4.810   1.00 18.71 ? 129 TYR B CE1 1 
ATOM 2562 C CE2 . TYR B 1 130 ? 60.451 18.699  4.269   1.00 18.00 ? 129 TYR B CE2 1 
ATOM 2563 C CZ  . TYR B 1 130 ? 61.566 17.927  3.905   1.00 18.78 ? 129 TYR B CZ  1 
ATOM 2564 O OH  . TYR B 1 130 ? 62.138 17.976  2.639   1.00 15.89 ? 129 TYR B OH  1 
ATOM 2565 N N   . VAL B 1 131 ? 57.615 15.194  6.158   1.00 14.21 ? 130 VAL B N   1 
ATOM 2566 C CA  . VAL B 1 131 ? 57.619 14.049  5.250   1.00 13.97 ? 130 VAL B CA  1 
ATOM 2567 C C   . VAL B 1 131 ? 58.355 14.490  4.014   1.00 14.16 ? 130 VAL B C   1 
ATOM 2568 O O   . VAL B 1 131 ? 57.787 15.234  3.238   1.00 16.27 ? 130 VAL B O   1 
ATOM 2569 C CB  . VAL B 1 131 ? 56.161 13.737  4.806   1.00 14.49 ? 130 VAL B CB  1 
ATOM 2570 C CG1 . VAL B 1 131 ? 56.108 12.720  3.707   1.00 14.35 ? 130 VAL B CG1 1 
ATOM 2571 C CG2 . VAL B 1 131 ? 55.299 13.250  5.976   1.00 15.84 ? 130 VAL B CG2 1 
ATOM 2572 N N   . PRO B 1 132 ? 59.599 14.085  3.788   1.00 13.95 ? 131 PRO B N   1 
ATOM 2573 C CA  . PRO B 1 132 ? 60.387 14.623  2.679   1.00 13.64 ? 131 PRO B CA  1 
ATOM 2574 C C   . PRO B 1 132 ? 59.989 14.040  1.336   1.00 13.80 ? 131 PRO B C   1 
ATOM 2575 O O   . PRO B 1 132 ? 59.267 13.055  1.261   1.00 14.11 ? 131 PRO B O   1 
ATOM 2576 C CB  . PRO B 1 132 ? 61.835 14.195  3.017   1.00 12.79 ? 131 PRO B CB  1 
ATOM 2577 C CG  . PRO B 1 132 ? 61.798 13.579  4.265   1.00 12.72 ? 131 PRO B CG  1 
ATOM 2578 C CD  . PRO B 1 132 ? 60.386 13.090  4.514   1.00 14.14 ? 131 PRO B CD  1 
ATOM 2579 N N   . PRO B 1 133 ? 60.484 14.638  0.264   1.00 14.63 ? 132 PRO B N   1 
ATOM 2580 C CA  . PRO B 1 133 ? 60.270 14.094  -1.085  1.00 15.25 ? 132 PRO B CA  1 
ATOM 2581 C C   . PRO B 1 133 ? 60.585 12.606  -1.215  1.00 15.19 ? 132 PRO B C   1 
ATOM 2582 O O   . PRO B 1 133 ? 61.518 12.126  -0.610  1.00 15.29 ? 132 PRO B O   1 
ATOM 2583 C CB  . PRO B 1 133 ? 61.229 14.948  -1.925  1.00 15.12 ? 132 PRO B CB  1 
ATOM 2584 C CG  . PRO B 1 133 ? 61.236 16.231  -1.221  1.00 13.73 ? 132 PRO B CG  1 
ATOM 2585 C CD  . PRO B 1 133 ? 61.258 15.894  0.205   1.00 14.16 ? 132 PRO B CD  1 
ATOM 2586 N N   . TYR B 1 134 ? 59.776 11.912  -1.996  1.00 16.23 ? 133 TYR B N   1 
ATOM 2587 C CA  . TYR B 1 134 ? 59.967 10.491  -2.386  1.00 16.82 ? 133 TYR B CA  1 
ATOM 2588 C C   . TYR B 1 134 ? 59.647 9.479   -1.287  1.00 17.29 ? 133 TYR B C   1 
ATOM 2589 O O   . TYR B 1 134 ? 59.994 8.320   -1.405  1.00 18.15 ? 133 TYR B O   1 
ATOM 2590 C CB  . TYR B 1 134 ? 61.368 10.222  -2.949  1.00 16.95 ? 133 TYR B CB  1 
ATOM 2591 C CG  . TYR B 1 134 ? 61.680 10.936  -4.233  1.00 17.47 ? 133 TYR B CG  1 
ATOM 2592 C CD1 . TYR B 1 134 ? 61.455 10.316  -5.468  1.00 17.13 ? 133 TYR B CD1 1 
ATOM 2593 C CD2 . TYR B 1 134 ? 62.185 12.237  -4.220  1.00 16.84 ? 133 TYR B CD2 1 
ATOM 2594 C CE1 . TYR B 1 134 ? 61.750 10.986  -6.659  1.00 18.86 ? 133 TYR B CE1 1 
ATOM 2595 C CE2 . TYR B 1 134 ? 62.488 12.899  -5.393  1.00 18.25 ? 133 TYR B CE2 1 
ATOM 2596 C CZ  . TYR B 1 134 ? 62.270 12.280  -6.613  1.00 18.95 ? 133 TYR B CZ  1 
ATOM 2597 O OH  . TYR B 1 134 ? 62.571 12.966  -7.769  1.00 20.07 ? 133 TYR B OH  1 
ATOM 2598 N N   . TRP B 1 135 ? 58.965 9.898   -0.222  1.00 17.77 ? 134 TRP B N   1 
ATOM 2599 C CA  . TRP B 1 135 ? 58.593 8.961   0.854   1.00 17.50 ? 134 TRP B CA  1 
ATOM 2600 C C   . TRP B 1 135 ? 57.105 8.721   0.900   1.00 16.71 ? 134 TRP B C   1 
ATOM 2601 O O   . TRP B 1 135 ? 56.304 9.641   0.770   1.00 16.16 ? 134 TRP B O   1 
ATOM 2602 C CB  . TRP B 1 135 ? 59.022 9.493   2.213   1.00 18.40 ? 134 TRP B CB  1 
ATOM 2603 C CG  . TRP B 1 135 ? 60.528 9.578   2.450   1.00 17.46 ? 134 TRP B CG  1 
ATOM 2604 C CD1 . TRP B 1 135 ? 61.375 10.526  2.005   1.00 18.31 ? 134 TRP B CD1 1 
ATOM 2605 C CD2 . TRP B 1 135 ? 61.294 8.727   3.271   1.00 17.29 ? 134 TRP B CD2 1 
ATOM 2606 N NE1 . TRP B 1 135 ? 62.649 10.316  2.489   1.00 15.58 ? 134 TRP B NE1 1 
ATOM 2607 C CE2 . TRP B 1 135 ? 62.624 9.215   3.271   1.00 13.76 ? 134 TRP B CE2 1 
ATOM 2608 C CE3 . TRP B 1 135 ? 60.983 7.627   4.067   1.00 17.30 ? 134 TRP B CE3 1 
ATOM 2609 C CZ2 . TRP B 1 135 ? 63.614 8.637   3.953   1.00 14.46 ? 134 TRP B CZ2 1 
ATOM 2610 C CZ3 . TRP B 1 135 ? 62.010 7.029   4.747   1.00 19.11 ? 134 TRP B CZ3 1 
ATOM 2611 C CH2 . TRP B 1 135 ? 63.313 7.553   4.705   1.00 16.41 ? 134 TRP B CH2 1 
ATOM 2612 N N   . ALA B 1 136 ? 56.748 7.454   1.028   1.00 16.45 ? 135 ALA B N   1 
ATOM 2613 C CA  . ALA B 1 136 ? 55.373 7.091   1.289   1.00 16.59 ? 135 ALA B CA  1 
ATOM 2614 C C   . ALA B 1 136 ? 55.163 7.214   2.796   1.00 16.09 ? 135 ALA B C   1 
ATOM 2615 O O   . ALA B 1 136 ? 56.121 7.282   3.565   1.00 16.32 ? 135 ALA B O   1 
ATOM 2616 C CB  . ALA B 1 136 ? 55.126 5.672   0.821   1.00 16.84 ? 135 ALA B CB  1 
ATOM 2617 N N   . HIS B 1 137 ? 53.922 7.195   3.221   1.00 15.22 ? 136 HIS B N   1 
ATOM 2618 C CA  . HIS B 1 137 ? 53.652 7.252   4.608   1.00 15.34 ? 136 HIS B CA  1 
ATOM 2619 C C   . HIS B 1 137 ? 52.234 6.935   4.974   1.00 15.54 ? 136 HIS B C   1 
ATOM 2620 O O   . HIS B 1 137 ? 51.315 7.032   4.149   1.00 16.16 ? 136 HIS B O   1 
ATOM 2621 C CB  . HIS B 1 137 ? 53.983 8.633   5.107   1.00 16.06 ? 136 HIS B CB  1 
ATOM 2622 C CG  . HIS B 1 137 ? 52.998 9.680   4.710   1.00 17.07 ? 136 HIS B CG  1 
ATOM 2623 N ND1 . HIS B 1 137 ? 52.384 9.690   3.486   1.00 20.27 ? 136 HIS B ND1 1 
ATOM 2624 C CD2 . HIS B 1 137 ? 52.568 10.783  5.353   1.00 19.19 ? 136 HIS B CD2 1 
ATOM 2625 C CE1 . HIS B 1 137 ? 51.606 10.749  3.397   1.00 22.21 ? 136 HIS B CE1 1 
ATOM 2626 N NE2 . HIS B 1 137 ? 51.693 11.429  4.517   1.00 20.19 ? 136 HIS B NE2 1 
ATOM 2627 N N   . ARG B 1 138 ? 52.071 6.636   6.254   1.00 15.36 ? 137 ARG B N   1 
ATOM 2628 C CA  . ARG B 1 138 ? 50.844 6.093   6.811   1.00 15.77 ? 137 ARG B CA  1 
ATOM 2629 C C   . ARG B 1 138 ? 50.786 6.525   8.284   1.00 16.04 ? 137 ARG B C   1 
ATOM 2630 O O   . ARG B 1 138 ? 51.770 6.388   8.963   1.00 17.25 ? 137 ARG B O   1 
ATOM 2631 C CB  . ARG B 1 138 ? 50.890 4.572   6.670   1.00 14.89 ? 137 ARG B CB  1 
ATOM 2632 C CG  . ARG B 1 138 ? 50.183 3.818   7.757   1.00 15.99 ? 137 ARG B CG  1 
ATOM 2633 C CD  . ARG B 1 138 ? 50.056 2.304   7.533   1.00 16.42 ? 137 ARG B CD  1 
ATOM 2634 N NE  . ARG B 1 138 ? 49.299 1.945   6.319   1.00 17.83 ? 137 ARG B NE  1 
ATOM 2635 C CZ  . ARG B 1 138 ? 49.204 0.705   5.826   1.00 17.08 ? 137 ARG B CZ  1 
ATOM 2636 N NH1 . ARG B 1 138 ? 49.811 -0.314  6.430   1.00 17.18 ? 137 ARG B NH1 1 
ATOM 2637 N NH2 . ARG B 1 138 ? 48.528 0.491   4.718   1.00 16.22 ? 137 ARG B NH2 1 
ATOM 2638 N N   . THR B 1 139 ? 49.682 7.063   8.770   1.00 15.94 ? 138 THR B N   1 
ATOM 2639 C CA  . THR B 1 139 ? 49.593 7.430   10.169  1.00 16.88 ? 138 THR B CA  1 
ATOM 2640 C C   . THR B 1 139 ? 48.981 6.299   10.977  1.00 17.37 ? 138 THR B C   1 
ATOM 2641 O O   . THR B 1 139 ? 48.105 5.621   10.481  1.00 17.52 ? 138 THR B O   1 
ATOM 2642 C CB  . THR B 1 139 ? 48.777 8.676   10.359  1.00 17.14 ? 138 THR B CB  1 
ATOM 2643 O OG1 . THR B 1 139 ? 48.093 9.021   9.157   1.00 18.51 ? 138 THR B OG1 1 
ATOM 2644 C CG2 . THR B 1 139 ? 49.682 9.865   10.631  1.00 17.01 ? 138 THR B CG2 1 
ATOM 2645 N N   . VAL B 1 140 ? 49.451 6.083   12.211  1.00 17.09 ? 139 VAL B N   1 
ATOM 2646 C CA  . VAL B 1 140 ? 49.052 4.913   12.973  1.00 17.62 ? 139 VAL B CA  1 
ATOM 2647 C C   . VAL B 1 140 ? 48.614 5.397   14.356  1.00 18.71 ? 139 VAL B C   1 
ATOM 2648 O O   . VAL B 1 140 ? 49.388 6.104   15.018  1.00 19.76 ? 139 VAL B O   1 
ATOM 2649 C CB  . VAL B 1 140 ? 50.236 3.967   13.142  1.00 17.65 ? 139 VAL B CB  1 
ATOM 2650 C CG1 . VAL B 1 140 ? 49.893 2.775   14.054  1.00 16.29 ? 139 VAL B CG1 1 
ATOM 2651 C CG2 . VAL B 1 140 ? 50.785 3.513   11.796  1.00 18.85 ? 139 VAL B CG2 1 
ATOM 2652 N N   . ASN B 1 141 ? 47.419 4.995   14.816  1.00 18.87 ? 140 ASN B N   1 
ATOM 2653 C CA  . ASN B 1 141 ? 46.963 5.230   16.207  1.00 19.09 ? 140 ASN B CA  1 
ATOM 2654 C C   . ASN B 1 141 ? 47.370 4.156   17.239  1.00 19.15 ? 140 ASN B C   1 
ATOM 2655 O O   . ASN B 1 141 ? 47.030 2.994   17.091  1.00 18.44 ? 140 ASN B O   1 
ATOM 2656 C CB  . ASN B 1 141 ? 45.445 5.295   16.226  1.00 19.46 ? 140 ASN B CB  1 
ATOM 2657 C CG  . ASN B 1 141 ? 44.909 5.834   17.531  1.00 18.64 ? 140 ASN B CG  1 
ATOM 2658 O OD1 . ASN B 1 141 ? 45.674 6.074   18.461  1.00 19.27 ? 140 ASN B OD1 1 
ATOM 2659 N ND2 . ASN B 1 141 ? 43.580 6.052   17.598  1.00 16.90 ? 140 ASN B ND2 1 
ATOM 2660 N N   . ILE B 1 142 ? 48.066 4.548   18.297  1.00 19.72 ? 141 ILE B N   1 
ATOM 2661 C CA  . ILE B 1 142 ? 48.618 3.560   19.209  1.00 20.53 ? 141 ILE B CA  1 
ATOM 2662 C C   . ILE B 1 142 ? 48.093 3.673   20.629  1.00 20.69 ? 141 ILE B C   1 
ATOM 2663 O O   . ILE B 1 142 ? 48.573 3.021   21.520  1.00 21.96 ? 141 ILE B O   1 
ATOM 2664 C CB  . ILE B 1 142 ? 50.181 3.610   19.171  1.00 21.00 ? 141 ILE B CB  1 
ATOM 2665 C CG1 . ILE B 1 142 ? 50.712 4.841   19.912  1.00 20.21 ? 141 ILE B CG1 1 
ATOM 2666 C CG2 . ILE B 1 142 ? 50.688 3.587   17.717  1.00 19.70 ? 141 ILE B CG2 1 
ATOM 2667 C CD1 . ILE B 1 142 ? 52.221 4.997   19.772  1.00 18.94 ? 141 ILE B CD1 1 
ATOM 2668 N N   . GLY B 1 143 ? 47.106 4.501   20.847  1.00 21.30 ? 142 GLY B N   1 
ATOM 2669 C CA  . GLY B 1 143 ? 46.453 4.572   22.143  1.00 21.98 ? 142 GLY B CA  1 
ATOM 2670 C C   . GLY B 1 143 ? 44.939 4.383   22.042  1.00 22.33 ? 142 GLY B C   1 
ATOM 2671 O O   . GLY B 1 143 ? 44.395 4.078   20.969  1.00 21.48 ? 142 GLY B O   1 
ATOM 2672 N N   . ASP B 1 144 ? 44.274 4.588   23.182  1.00 23.22 ? 143 ASP B N   1 
ATOM 2673 C CA  . ASP B 1 144 ? 42.858 4.229   23.387  1.00 23.56 ? 143 ASP B CA  1 
ATOM 2674 C C   . ASP B 1 144 ? 41.879 5.320   23.010  1.00 23.23 ? 143 ASP B C   1 
ATOM 2675 O O   . ASP B 1 144 ? 40.704 5.061   23.015  1.00 23.42 ? 143 ASP B O   1 
ATOM 2676 C CB  . ASP B 1 144 ? 42.606 3.890   24.851  1.00 23.93 ? 143 ASP B CB  1 
ATOM 2677 C CG  . ASP B 1 144 ? 43.514 2.786   25.357  1.00 27.65 ? 143 ASP B CG  1 
ATOM 2678 O OD1 . ASP B 1 144 ? 43.147 1.591   25.122  1.00 31.36 ? 143 ASP B OD1 1 
ATOM 2679 O OD2 . ASP B 1 144 ? 44.621 2.997   25.955  1.00 28.85 ? 143 ASP B OD2 1 
ATOM 2680 N N   . GLU B 1 145 ? 42.358 6.538   22.711  1.00 23.23 ? 144 GLU B N   1 
ATOM 2681 C CA  . GLU B 1 145 ? 41.518 7.669   22.233  1.00 22.31 ? 144 GLU B CA  1 
ATOM 2682 C C   . GLU B 1 145 ? 41.846 7.970   20.733  1.00 21.95 ? 144 GLU B C   1 
ATOM 2683 O O   . GLU B 1 145 ? 42.834 7.480   20.170  1.00 21.43 ? 144 GLU B O   1 
ATOM 2684 C CB  . GLU B 1 145 ? 41.741 8.937   23.120  1.00 21.97 ? 144 GLU B CB  1 
ATOM 2685 C CG  . GLU B 1 145 ? 41.127 8.893   24.554  1.00 24.44 ? 144 GLU B CG  1 
ATOM 2686 C CD  . GLU B 1 145 ? 39.587 8.604   24.620  1.00 26.66 ? 144 GLU B CD  1 
ATOM 2687 O OE1 . GLU B 1 145 ? 38.783 9.609   24.561  1.00 24.64 ? 144 GLU B OE1 1 
ATOM 2688 O OE2 . GLU B 1 145 ? 39.180 7.385   24.733  1.00 24.50 ? 144 GLU B OE2 1 
ATOM 2689 N N   . PRO B 1 146 ? 41.056 8.821   20.088  1.00 21.15 ? 145 PRO B N   1 
ATOM 2690 C CA  . PRO B 1 146 ? 41.327 9.177   18.696  1.00 20.70 ? 145 PRO B CA  1 
ATOM 2691 C C   . PRO B 1 146 ? 42.650 9.919   18.465  1.00 20.38 ? 145 PRO B C   1 
ATOM 2692 O O   . PRO B 1 146 ? 42.935 10.798  19.240  1.00 20.58 ? 145 PRO B O   1 
ATOM 2693 C CB  . PRO B 1 146 ? 40.154 10.092  18.364  1.00 20.41 ? 145 PRO B CB  1 
ATOM 2694 C CG  . PRO B 1 146 ? 39.128 9.728   19.329  1.00 20.40 ? 145 PRO B CG  1 
ATOM 2695 C CD  . PRO B 1 146 ? 39.845 9.502   20.581  1.00 20.60 ? 145 PRO B CD  1 
ATOM 2696 N N   . PHE B 1 147 ? 43.417 9.574   17.418  1.00 20.07 ? 146 PHE B N   1 
ATOM 2697 C CA  . PHE B 1 147 ? 44.606 10.349  16.978  1.00 18.89 ? 146 PHE B CA  1 
ATOM 2698 C C   . PHE B 1 147 ? 44.172 11.347  15.940  1.00 18.89 ? 146 PHE B C   1 
ATOM 2699 O O   . PHE B 1 147 ? 43.804 10.953  14.836  1.00 19.07 ? 146 PHE B O   1 
ATOM 2700 C CB  . PHE B 1 147 ? 45.670 9.411   16.330  1.00 18.33 ? 146 PHE B CB  1 
ATOM 2701 C CG  . PHE B 1 147 ? 46.990 10.096  16.004  1.00 16.87 ? 146 PHE B CG  1 
ATOM 2702 C CD1 . PHE B 1 147 ? 47.615 10.945  16.901  1.00 15.37 ? 146 PHE B CD1 1 
ATOM 2703 C CD2 . PHE B 1 147 ? 47.609 9.872   14.795  1.00 15.50 ? 146 PHE B CD2 1 
ATOM 2704 C CE1 . PHE B 1 147 ? 48.815 11.553  16.554  1.00 15.77 ? 146 PHE B CE1 1 
ATOM 2705 C CE2 . PHE B 1 147 ? 48.820 10.484  14.481  1.00 13.53 ? 146 PHE B CE2 1 
ATOM 2706 C CZ  . PHE B 1 147 ? 49.403 11.325  15.342  1.00 12.49 ? 146 PHE B CZ  1 
ATOM 2707 N N   . ILE B 1 148 ? 44.189 12.627  16.271  1.00 18.18 ? 147 ILE B N   1 
ATOM 2708 C CA  . ILE B 1 148 ? 43.685 13.639  15.368  1.00 17.52 ? 147 ILE B CA  1 
ATOM 2709 C C   . ILE B 1 148 ? 44.867 14.462  14.989  1.00 17.43 ? 147 ILE B C   1 
ATOM 2710 O O   . ILE B 1 148 ? 45.708 14.791  15.871  1.00 17.22 ? 147 ILE B O   1 
ATOM 2711 C CB  . ILE B 1 148 ? 42.631 14.552  16.061  1.00 17.30 ? 147 ILE B CB  1 
ATOM 2712 C CG1 . ILE B 1 148 ? 41.440 13.768  16.606  1.00 16.92 ? 147 ILE B CG1 1 
ATOM 2713 C CG2 . ILE B 1 148 ? 42.094 15.509  15.101  1.00 19.53 ? 147 ILE B CG2 1 
ATOM 2714 C CD1 . ILE B 1 148 ? 40.740 14.452  17.804  1.00 17.11 ? 147 ILE B CD1 1 
ATOM 2715 N N   . PHE B 1 149 ? 44.920 14.836  13.699  1.00 16.98 ? 148 PHE B N   1 
ATOM 2716 C CA  . PHE B 1 149 ? 46.027 15.626  13.137  1.00 15.85 ? 148 PHE B CA  1 
ATOM 2717 C C   . PHE B 1 149 ? 45.676 16.412  11.871  1.00 16.14 ? 148 PHE B C   1 
ATOM 2718 O O   . PHE B 1 149 ? 44.596 16.252  11.295  1.00 15.83 ? 148 PHE B O   1 
ATOM 2719 C CB  . PHE B 1 149 ? 47.207 14.738  12.863  1.00 15.27 ? 148 PHE B CB  1 
ATOM 2720 C CG  . PHE B 1 149 ? 46.924 13.631  11.922  1.00 13.98 ? 148 PHE B CG  1 
ATOM 2721 C CD1 . PHE B 1 149 ? 46.618 12.375  12.401  1.00 12.66 ? 148 PHE B CD1 1 
ATOM 2722 C CD2 . PHE B 1 149 ? 47.072 13.818  10.552  1.00 15.60 ? 148 PHE B CD2 1 
ATOM 2723 C CE1 . PHE B 1 149 ? 46.397 11.307  11.542  1.00 14.38 ? 148 PHE B CE1 1 
ATOM 2724 C CE2 . PHE B 1 149 ? 46.853 12.774  9.639   1.00 14.01 ? 148 PHE B CE2 1 
ATOM 2725 C CZ  . PHE B 1 149 ? 46.507 11.519  10.124  1.00 15.90 ? 148 PHE B CZ  1 
ATOM 2726 N N   . LEU B 1 150 ? 46.613 17.290  11.496  1.00 15.60 ? 149 LEU B N   1 
ATOM 2727 C CA  . LEU B 1 150 ? 46.506 18.214  10.385  1.00 14.38 ? 149 LEU B CA  1 
ATOM 2728 C C   . LEU B 1 150 ? 47.669 17.935  9.450   1.00 14.78 ? 149 LEU B C   1 
ATOM 2729 O O   . LEU B 1 150 ? 48.752 17.617  9.884   1.00 15.17 ? 149 LEU B O   1 
ATOM 2730 C CB  . LEU B 1 150 ? 46.614 19.625  10.921  1.00 13.20 ? 149 LEU B CB  1 
ATOM 2731 C CG  . LEU B 1 150 ? 46.865 20.734  9.943   1.00 12.76 ? 149 LEU B CG  1 
ATOM 2732 C CD1 . LEU B 1 150 ? 45.736 20.857  8.915   1.00 15.01 ? 149 LEU B CD1 1 
ATOM 2733 C CD2 . LEU B 1 150 ? 47.018 22.010  10.695  1.00 13.37 ? 149 LEU B CD2 1 
ATOM 2734 N N   . ALA B 1 151 ? 47.458 18.091  8.161   1.00 15.20 ? 150 ALA B N   1 
ATOM 2735 C CA  . ALA B 1 151 ? 48.459 17.792  7.148   1.00 14.57 ? 150 ALA B CA  1 
ATOM 2736 C C   . ALA B 1 151 ? 48.390 18.843  6.093   1.00 15.20 ? 150 ALA B C   1 
ATOM 2737 O O   . ALA B 1 151 ? 47.352 19.339  5.766   1.00 14.55 ? 150 ALA B O   1 
ATOM 2738 C CB  . ALA B 1 151 ? 48.182 16.498  6.522   1.00 14.83 ? 150 ALA B CB  1 
ATOM 2739 N N   . ILE B 1 152 ? 49.524 19.177  5.522   1.00 16.53 ? 151 ILE B N   1 
ATOM 2740 C CA  . ILE B 1 152 ? 49.548 20.216  4.529   1.00 16.99 ? 151 ILE B CA  1 
ATOM 2741 C C   . ILE B 1 152 ? 50.448 19.707  3.457   1.00 18.10 ? 151 ILE B C   1 
ATOM 2742 O O   . ILE B 1 152 ? 51.641 19.505  3.677   1.00 18.58 ? 151 ILE B O   1 
ATOM 2743 C CB  . ILE B 1 152 ? 50.058 21.508  5.099   1.00 16.16 ? 151 ILE B CB  1 
ATOM 2744 C CG1 . ILE B 1 152 ? 49.090 22.115  6.083   1.00 16.10 ? 151 ILE B CG1 1 
ATOM 2745 C CG2 . ILE B 1 152 ? 50.192 22.472  4.032   1.00 19.02 ? 151 ILE B CG2 1 
ATOM 2746 C CD1 . ILE B 1 152 ? 49.668 22.241  7.509   1.00 17.46 ? 151 ILE B CD1 1 
ATOM 2747 N N   . TYR B 1 153 ? 49.888 19.525  2.274   1.00 19.61 ? 152 TYR B N   1 
ATOM 2748 C CA  . TYR B 1 153 ? 50.629 18.946  1.154   1.00 20.81 ? 152 TYR B CA  1 
ATOM 2749 C C   . TYR B 1 153 ? 50.450 19.761  -0.096  1.00 21.53 ? 152 TYR B C   1 
ATOM 2750 O O   . TYR B 1 153 ? 49.374 20.369  -0.267  1.00 23.01 ? 152 TYR B O   1 
ATOM 2751 C CB  . TYR B 1 153 ? 50.151 17.513  0.893   1.00 20.94 ? 152 TYR B CB  1 
ATOM 2752 C CG  . TYR B 1 153 ? 48.668 17.300  1.046   1.00 22.55 ? 152 TYR B CG  1 
ATOM 2753 C CD1 . TYR B 1 153 ? 48.073 17.201  2.322   1.00 24.58 ? 152 TYR B CD1 1 
ATOM 2754 C CD2 . TYR B 1 153 ? 47.837 17.171  -0.075  1.00 24.03 ? 152 TYR B CD2 1 
ATOM 2755 C CE1 . TYR B 1 153 ? 46.694 17.001  2.480   1.00 21.89 ? 152 TYR B CE1 1 
ATOM 2756 C CE2 . TYR B 1 153 ? 46.455 16.969  0.079   1.00 24.09 ? 152 TYR B CE2 1 
ATOM 2757 C CZ  . TYR B 1 153 ? 45.913 16.899  1.369   1.00 23.14 ? 152 TYR B CZ  1 
ATOM 2758 O OH  . TYR B 1 153 ? 44.569 16.725  1.526   1.00 26.65 ? 152 TYR B OH  1 
ATOM 2759 N N   . PRO B 1 154 ? 51.443 19.764  -0.988  1.00 21.86 ? 153 PRO B N   1 
ATOM 2760 C CA  . PRO B 1 154 ? 51.281 20.343  -2.324  1.00 22.30 ? 153 PRO B CA  1 
ATOM 2761 C C   . PRO B 1 154 ? 50.075 19.806  -3.124  1.00 22.81 ? 153 PRO B C   1 
ATOM 2762 O O   . PRO B 1 154 ? 49.858 18.612  -3.220  1.00 22.18 ? 153 PRO B O   1 
ATOM 2763 C CB  . PRO B 1 154 ? 52.593 19.989  -3.007  1.00 22.45 ? 153 PRO B CB  1 
ATOM 2764 C CG  . PRO B 1 154 ? 53.541 19.829  -1.922  1.00 21.83 ? 153 PRO B CG  1 
ATOM 2765 C CD  . PRO B 1 154 ? 52.795 19.221  -0.809  1.00 21.96 ? 153 PRO B CD  1 
ATOM 2766 N N   . ALA B 1 155 ? 49.291 20.723  -3.675  1.00 24.22 ? 154 ALA B N   1 
ATOM 2767 C CA  . ALA B 1 155 ? 47.963 20.437  -4.214  1.00 25.39 ? 154 ALA B CA  1 
ATOM 2768 C C   . ALA B 1 155 ? 48.014 19.528  -5.398  1.00 26.74 ? 154 ALA B C   1 
ATOM 2769 O O   . ALA B 1 155 ? 47.021 18.886  -5.721  1.00 26.32 ? 154 ALA B O   1 
ATOM 2770 C CB  . ALA B 1 155 ? 47.303 21.709  -4.628  1.00 25.52 ? 154 ALA B CB  1 
ATOM 2771 N N   . ASP B 1 156 ? 49.169 19.484  -6.058  1.00 28.55 ? 155 ASP B N   1 
ATOM 2772 C CA  . ASP B 1 156 ? 49.335 18.609  -7.202  1.00 30.41 ? 155 ASP B CA  1 
ATOM 2773 C C   . ASP B 1 156 ? 50.159 17.328  -6.954  1.00 32.69 ? 155 ASP B C   1 
ATOM 2774 O O   . ASP B 1 156 ? 50.728 16.761  -7.907  1.00 33.02 ? 155 ASP B O   1 
ATOM 2775 C CB  . ASP B 1 156 ? 49.900 19.413  -8.354  1.00 29.99 ? 155 ASP B CB  1 
ATOM 2776 C CG  . ASP B 1 156 ? 51.368 19.685  -8.220  1.00 29.43 ? 155 ASP B CG  1 
ATOM 2777 O OD1 . ASP B 1 156 ? 51.921 19.457  -7.116  1.00 27.65 ? 155 ASP B OD1 1 
ATOM 2778 O OD2 . ASP B 1 156 ? 52.029 20.168  -9.180  1.00 28.17 ? 155 ASP B OD2 1 
ATOM 2779 N N   . ALA B 1 157 ? 50.188 16.853  -5.698  1.00 34.59 ? 156 ALA B N   1 
ATOM 2780 C CA  . ALA B 1 157 ? 51.042 15.717  -5.343  1.00 36.21 ? 156 ALA B CA  1 
ATOM 2781 C C   . ALA B 1 157 ? 50.454 14.434  -5.861  1.00 38.23 ? 156 ALA B C   1 
ATOM 2782 O O   . ALA B 1 157 ? 51.174 13.457  -6.066  1.00 37.62 ? 156 ALA B O   1 
ATOM 2783 C CB  . ALA B 1 157 ? 51.231 15.622  -3.868  1.00 36.39 ? 156 ALA B CB  1 
ATOM 2784 N N   . GLY B 1 158 ? 49.133 14.452  -6.064  1.00 41.09 ? 157 GLY B N   1 
ATOM 2785 C CA  . GLY B 1 158 ? 48.391 13.301  -6.529  1.00 43.07 ? 157 GLY B CA  1 
ATOM 2786 C C   . GLY B 1 158 ? 48.334 12.234  -5.451  1.00 45.24 ? 157 GLY B C   1 
ATOM 2787 O O   . GLY B 1 158 ? 48.664 12.493  -4.289  1.00 45.33 ? 157 GLY B O   1 
ATOM 2788 N N   . HIS B 1 159 ? 47.933 11.027  -5.845  1.00 47.92 ? 158 HIS B N   1 
ATOM 2789 C CA  . HIS B 1 159 ? 47.492 10.020  -4.892  1.00 50.08 ? 158 HIS B CA  1 
ATOM 2790 C C   . HIS B 1 159 ? 47.785 8.615   -5.425  1.00 51.70 ? 158 HIS B C   1 
ATOM 2791 O O   . HIS B 1 159 ? 47.034 8.082   -6.238  1.00 52.36 ? 158 HIS B O   1 
ATOM 2792 C CB  . HIS B 1 159 ? 45.970 10.204  -4.565  1.00 50.65 ? 158 HIS B CB  1 
ATOM 2793 C CG  . HIS B 1 159 ? 45.671 11.398  -3.696  1.00 51.67 ? 158 HIS B CG  1 
ATOM 2794 N ND1 . HIS B 1 159 ? 45.412 12.653  -4.217  1.00 52.67 ? 158 HIS B ND1 1 
ATOM 2795 C CD2 . HIS B 1 159 ? 45.623 11.534  -2.348  1.00 52.05 ? 158 HIS B CD2 1 
ATOM 2796 C CE1 . HIS B 1 159 ? 45.210 13.505  -3.228  1.00 52.92 ? 158 HIS B CE1 1 
ATOM 2797 N NE2 . HIS B 1 159 ? 45.318 12.849  -2.084  1.00 53.48 ? 158 HIS B NE2 1 
ATOM 2798 N N   . ASP B 1 160 ? 48.881 8.017   -4.943  1.00 53.78 ? 159 ASP B N   1 
ATOM 2799 C CA  . ASP B 1 160 ? 49.232 6.597   -5.202  1.00 55.10 ? 159 ASP B CA  1 
ATOM 2800 C C   . ASP B 1 160 ? 49.002 5.644   -3.976  1.00 56.20 ? 159 ASP B C   1 
ATOM 2801 O O   . ASP B 1 160 ? 49.921 5.372   -3.171  1.00 55.80 ? 159 ASP B O   1 
ATOM 2802 C CB  . ASP B 1 160 ? 50.684 6.493   -5.703  1.00 55.19 ? 159 ASP B CB  1 
ATOM 2803 C CG  . ASP B 1 160 ? 50.878 5.364   -6.734  1.00 55.90 ? 159 ASP B CG  1 
ATOM 2804 O OD1 . ASP B 1 160 ? 50.296 4.266   -6.491  1.00 54.05 ? 159 ASP B OD1 1 
ATOM 2805 O OD2 . ASP B 1 160 ? 51.601 5.501   -7.788  1.00 55.37 ? 159 ASP B OD2 1 
ATOM 2806 N N   . TYR B 1 161 ? 47.756 5.154   -3.870  1.00 57.58 ? 160 TYR B N   1 
ATOM 2807 C CA  . TYR B 1 161 ? 47.353 4.123   -2.887  1.00 58.68 ? 160 TYR B CA  1 
ATOM 2808 C C   . TYR B 1 161 ? 47.696 2.665   -3.358  1.00 59.08 ? 160 TYR B C   1 
ATOM 2809 O O   . TYR B 1 161 ? 47.827 1.758   -2.510  1.00 59.53 ? 160 TYR B O   1 
ATOM 2810 C CB  . TYR B 1 161 ? 45.832 4.219   -2.562  1.00 58.64 ? 160 TYR B CB  1 
ATOM 2811 C CG  . TYR B 1 161 ? 45.332 5.565   -1.998  1.00 59.66 ? 160 TYR B CG  1 
ATOM 2812 C CD1 . TYR B 1 161 ? 44.780 6.545   -2.850  1.00 59.55 ? 160 TYR B CD1 1 
ATOM 2813 C CD2 . TYR B 1 161 ? 45.368 5.842   -0.602  1.00 59.49 ? 160 TYR B CD2 1 
ATOM 2814 C CE1 . TYR B 1 161 ? 44.290 7.770   -2.330  1.00 60.21 ? 160 TYR B CE1 1 
ATOM 2815 C CE2 . TYR B 1 161 ? 44.879 7.071   -0.077  1.00 59.20 ? 160 TYR B CE2 1 
ATOM 2816 C CZ  . TYR B 1 161 ? 44.343 8.026   -0.944  1.00 59.61 ? 160 TYR B CZ  1 
ATOM 2817 O OH  . TYR B 1 161 ? 43.869 9.232   -0.450  1.00 59.67 ? 160 TYR B OH  1 
ATOM 2818 N N   . GLY B 1 162 ? 47.861 2.473   -4.681  1.00 59.09 ? 161 GLY B N   1 
ATOM 2819 C CA  . GLY B 1 162 ? 48.041 1.169   -5.320  1.00 58.75 ? 161 GLY B CA  1 
ATOM 2820 C C   . GLY B 1 162 ? 49.211 0.311   -4.849  1.00 58.89 ? 161 GLY B C   1 
ATOM 2821 O O   . GLY B 1 162 ? 49.018 -0.866  -4.605  1.00 59.18 ? 161 GLY B O   1 
ATOM 2822 N N   . THR B 1 163 ? 50.409 0.893   -4.696  1.00 59.31 ? 162 THR B N   1 
ATOM 2823 C CA  . THR B 1 163 ? 51.640 0.174   -4.272  1.00 58.82 ? 162 THR B CA  1 
ATOM 2824 C C   . THR B 1 163 ? 51.565 -0.372  -2.826  1.00 58.97 ? 162 THR B C   1 
ATOM 2825 O O   . THR B 1 163 ? 52.358 -1.225  -2.440  1.00 59.36 ? 162 THR B O   1 
ATOM 2826 C CB  . THR B 1 163 ? 52.895 1.113   -4.407  1.00 58.65 ? 162 THR B CB  1 
ATOM 2827 O OG1 . THR B 1 163 ? 52.772 1.969   -5.557  1.00 58.27 ? 162 THR B OG1 1 
ATOM 2828 C CG2 . THR B 1 163 ? 54.173 0.326   -4.678  1.00 58.53 ? 162 THR B CG2 1 
ATOM 2829 N N   . ILE B 1 164 ? 50.587 0.096   -2.046  1.00 59.12 ? 163 ILE B N   1 
ATOM 2830 C CA  . ILE B 1 164 ? 50.591 -0.037  -0.581  1.00 58.88 ? 163 ILE B CA  1 
ATOM 2831 C C   . ILE B 1 164 ? 49.711 -1.194  -0.052  1.00 59.10 ? 163 ILE B C   1 
ATOM 2832 O O   . ILE B 1 164 ? 49.980 -1.762  1.019   1.00 59.15 ? 163 ILE B O   1 
ATOM 2833 C CB  . ILE B 1 164 ? 50.176 1.341   0.033   1.00 58.53 ? 163 ILE B CB  1 
ATOM 2834 C CG1 . ILE B 1 164 ? 51.266 2.414   -0.227  1.00 57.96 ? 163 ILE B CG1 1 
ATOM 2835 C CG2 . ILE B 1 164 ? 49.818 1.217   1.517   1.00 58.62 ? 163 ILE B CG2 1 
ATOM 2836 C CD1 . ILE B 1 164 ? 52.698 2.058   0.194   1.00 57.66 ? 163 ILE B CD1 1 
ATOM 2837 N N   . ALA B 1 165 ? 48.649 -1.544  -0.776  1.00 59.08 ? 164 ALA B N   1 
ATOM 2838 C CA  . ALA B 1 165 ? 47.908 -2.768  -0.440  1.00 58.68 ? 164 ALA B CA  1 
ATOM 2839 C C   . ALA B 1 165 ? 48.543 -3.889  -1.249  1.00 58.10 ? 164 ALA B C   1 
ATOM 2840 O O   . ALA B 1 165 ? 48.836 -4.956  -0.706  1.00 58.15 ? 164 ALA B O   1 
ATOM 2841 C CB  . ALA B 1 165 ? 46.409 -2.637  -0.758  1.00 58.58 ? 164 ALA B CB  1 
ATOM 2842 N N   . GLU B 1 166 ? 48.766 -3.626  -2.546  1.00 57.15 ? 165 GLU B N   1 
ATOM 2843 C CA  . GLU B 1 166 ? 49.360 -4.625  -3.441  1.00 56.64 ? 165 GLU B CA  1 
ATOM 2844 C C   . GLU B 1 166 ? 50.687 -5.132  -2.816  1.00 55.76 ? 165 GLU B C   1 
ATOM 2845 O O   . GLU B 1 166 ? 50.852 -6.364  -2.656  1.00 56.13 ? 165 GLU B O   1 
ATOM 2846 C CB  . GLU B 1 166 ? 49.569 -4.102  -4.900  1.00 56.53 ? 165 GLU B CB  1 
ATOM 2847 C CG  . GLU B 1 166 ? 50.968 -3.500  -5.203  1.00 57.07 ? 165 GLU B CG  1 
ATOM 2848 C CD  . GLU B 1 166 ? 51.292 -3.391  -6.688  1.00 57.67 ? 165 GLU B CD  1 
ATOM 2849 O OE1 . GLU B 1 166 ? 50.763 -2.477  -7.367  1.00 59.37 ? 165 GLU B OE1 1 
ATOM 2850 O OE2 . GLU B 1 166 ? 52.092 -4.214  -7.179  1.00 57.28 ? 165 GLU B OE2 1 
ATOM 2851 N N   . LYS B 1 167 ? 51.601 -4.198  -2.462  1.00 53.79 ? 166 LYS B N   1 
ATOM 2852 C CA  . LYS B 1 167 ? 52.911 -4.572  -1.892  1.00 52.35 ? 166 LYS B CA  1 
ATOM 2853 C C   . LYS B 1 167 ? 52.970 -4.449  -0.364  1.00 49.94 ? 166 LYS B C   1 
ATOM 2854 O O   . LYS B 1 167 ? 53.497 -5.319  0.309   1.00 49.77 ? 166 LYS B O   1 
ATOM 2855 C CB  . LYS B 1 167 ? 54.057 -3.808  -2.563  1.00 52.50 ? 166 LYS B CB  1 
ATOM 2856 C CG  . LYS B 1 167 ? 55.028 -4.749  -3.331  1.00 53.83 ? 166 LYS B CG  1 
ATOM 2857 C CD  . LYS B 1 167 ? 56.229 -3.973  -3.975  1.00 55.06 ? 166 LYS B CD  1 
ATOM 2858 C CE  . LYS B 1 167 ? 55.945 -3.486  -5.451  1.00 53.98 ? 166 LYS B CE  1 
ATOM 2859 N NZ  . LYS B 1 167 ? 56.631 -2.188  -5.758  1.00 52.45 ? 166 LYS B NZ  1 
ATOM 2860 N N   . GLY B 1 168 ? 52.393 -3.386  0.171   1.00 47.47 ? 167 GLY B N   1 
ATOM 2861 C CA  . GLY B 1 168 ? 52.399 -3.166  1.607   1.00 44.96 ? 167 GLY B CA  1 
ATOM 2862 C C   . GLY B 1 168 ? 53.352 -2.058  2.010   1.00 42.08 ? 167 GLY B C   1 
ATOM 2863 O O   . GLY B 1 168 ? 53.834 -1.287  1.190   1.00 41.40 ? 167 GLY B O   1 
ATOM 2864 N N   . PHE B 1 169 ? 53.548 -1.973  3.310   1.00 39.10 ? 168 PHE B N   1 
ATOM 2865 C CA  . PHE B 1 169 ? 54.690 -1.325  3.907   1.00 37.54 ? 168 PHE B CA  1 
ATOM 2866 C C   . PHE B 1 169 ? 55.615 -2.416  4.491   1.00 36.52 ? 168 PHE B C   1 
ATOM 2867 O O   . PHE B 1 169 ? 55.153 -3.449  4.967   1.00 37.09 ? 168 PHE B O   1 
ATOM 2868 C CB  . PHE B 1 169 ? 54.223 -0.420  5.043   1.00 37.73 ? 168 PHE B CB  1 
ATOM 2869 C CG  . PHE B 1 169 ? 53.765 0.973   4.592   1.00 36.24 ? 168 PHE B CG  1 
ATOM 2870 C CD1 . PHE B 1 169 ? 52.468 1.181   4.119   1.00 31.73 ? 168 PHE B CD1 1 
ATOM 2871 C CD2 . PHE B 1 169 ? 54.638 2.071   4.686   1.00 32.69 ? 168 PHE B CD2 1 
ATOM 2872 C CE1 . PHE B 1 169 ? 52.076 2.401   3.727   1.00 29.71 ? 168 PHE B CE1 1 
ATOM 2873 C CE2 . PHE B 1 169 ? 54.230 3.288   4.300   1.00 30.99 ? 168 PHE B CE2 1 
ATOM 2874 C CZ  . PHE B 1 169 ? 52.932 3.461   3.806   1.00 30.21 ? 168 PHE B CZ  1 
ATOM 2875 N N   . SER B 1 170 ? 56.923 -2.191  4.492   1.00 34.81 ? 169 SER B N   1 
ATOM 2876 C CA  . SER B 1 170 ? 57.874 -3.224  4.924   1.00 33.30 ? 169 SER B CA  1 
ATOM 2877 C C   . SER B 1 170 ? 57.696 -3.571  6.376   1.00 32.17 ? 169 SER B C   1 
ATOM 2878 O O   . SER B 1 170 ? 58.043 -4.640  6.805   1.00 31.42 ? 169 SER B O   1 
ATOM 2879 C CB  . SER B 1 170 ? 59.335 -2.818  4.674   1.00 32.95 ? 169 SER B CB  1 
ATOM 2880 O OG  . SER B 1 170 ? 59.799 -1.889  5.629   1.00 32.41 ? 169 SER B OG  1 
ATOM 2881 N N   . LYS B 1 171 ? 57.151 -2.642  7.125   1.00 31.35 ? 170 LYS B N   1 
ATOM 2882 C CA  . LYS B 1 171 ? 57.060 -2.796  8.531   1.00 30.47 ? 170 LYS B CA  1 
ATOM 2883 C C   . LYS B 1 171 ? 55.663 -2.513  8.928   1.00 29.31 ? 170 LYS B C   1 
ATOM 2884 O O   . LYS B 1 171 ? 55.051 -1.679  8.332   1.00 28.60 ? 170 LYS B O   1 
ATOM 2885 C CB  . LYS B 1 171 ? 58.050 -1.834  9.194   1.00 30.91 ? 170 LYS B CB  1 
ATOM 2886 C CG  . LYS B 1 171 ? 59.522 -2.270  9.002   1.00 31.00 ? 170 LYS B CG  1 
ATOM 2887 C CD  . LYS B 1 171 ? 60.387 -1.886  10.198  1.00 33.32 ? 170 LYS B CD  1 
ATOM 2888 C CE  . LYS B 1 171 ? 61.769 -2.613  10.216  1.00 35.08 ? 170 LYS B CE  1 
ATOM 2889 N NZ  . LYS B 1 171 ? 62.054 -3.140  11.639  1.00 36.52 ? 170 LYS B NZ  1 
ATOM 2890 N N   . ILE B 1 172 ? 55.144 -3.312  9.867   1.00 29.30 ? 171 ILE B N   1 
ATOM 2891 C CA  . ILE B 1 172 ? 53.838 -3.101  10.507  1.00 28.77 ? 171 ILE B CA  1 
ATOM 2892 C C   . ILE B 1 172 ? 54.019 -2.725  11.961  1.00 27.92 ? 171 ILE B C   1 
ATOM 2893 O O   . ILE B 1 172 ? 55.110 -2.826  12.480  1.00 27.13 ? 171 ILE B O   1 
ATOM 2894 C CB  . ILE B 1 172 ? 52.974 -4.336  10.398  1.00 28.63 ? 171 ILE B CB  1 
ATOM 2895 C CG1 . ILE B 1 172 ? 53.562 -5.485  11.234  1.00 29.03 ? 171 ILE B CG1 1 
ATOM 2896 C CG2 . ILE B 1 172 ? 52.850 -4.730  8.955   1.00 29.24 ? 171 ILE B CG2 1 
ATOM 2897 C CD1 . ILE B 1 172 ? 52.721 -6.771  11.140  1.00 28.76 ? 171 ILE B CD1 1 
ATOM 2898 N N   . VAL B 1 173 ? 52.931 -2.281  12.590  1.00 27.84 ? 172 VAL B N   1 
ATOM 2899 C CA  . VAL B 1 173 ? 52.965 -1.714  13.927  1.00 27.92 ? 172 VAL B CA  1 
ATOM 2900 C C   . VAL B 1 173 ? 51.929 -2.377  14.773  1.00 28.13 ? 172 VAL B C   1 
ATOM 2901 O O   . VAL B 1 173 ? 50.749 -2.214  14.520  1.00 27.83 ? 172 VAL B O   1 
ATOM 2902 C CB  . VAL B 1 173 ? 52.680 -0.182  13.930  1.00 27.86 ? 172 VAL B CB  1 
ATOM 2903 C CG1 . VAL B 1 173 ? 52.915 0.406   15.350  1.00 28.13 ? 172 VAL B CG1 1 
ATOM 2904 C CG2 . VAL B 1 173 ? 53.538 0.556   12.919  1.00 27.04 ? 172 VAL B CG2 1 
ATOM 2905 N N   . ILE B 1 174 ? 52.370 -3.101  15.789  1.00 28.94 ? 173 ILE B N   1 
ATOM 2906 C CA  . ILE B 1 174 ? 51.459 -3.883  16.593  1.00 30.12 ? 173 ILE B CA  1 
ATOM 2907 C C   . ILE B 1 174 ? 51.698 -3.668  18.061  1.00 31.33 ? 173 ILE B C   1 
ATOM 2908 O O   . ILE B 1 174 ? 52.727 -3.127  18.462  1.00 31.85 ? 173 ILE B O   1 
ATOM 2909 C CB  . ILE B 1 174 ? 51.633 -5.365  16.312  1.00 30.06 ? 173 ILE B CB  1 
ATOM 2910 C CG1 . ILE B 1 174 ? 53.011 -5.806  16.800  1.00 31.22 ? 173 ILE B CG1 1 
ATOM 2911 C CG2 . ILE B 1 174 ? 51.465 -5.684  14.837  1.00 30.16 ? 173 ILE B CG2 1 
ATOM 2912 C CD1 . ILE B 1 174 ? 53.258 -7.316  16.636  1.00 33.27 ? 173 ILE B CD1 1 
ATOM 2913 N N   . GLU B 1 175 ? 50.718 -4.116  18.846  1.00 32.61 ? 174 GLU B N   1 
ATOM 2914 C CA  . GLU B 1 175 ? 50.849 -4.305  20.276  1.00 34.05 ? 174 GLU B CA  1 
ATOM 2915 C C   . GLU B 1 175 ? 51.254 -5.741  20.564  1.00 34.72 ? 174 GLU B C   1 
ATOM 2916 O O   . GLU B 1 175 ? 50.587 -6.645  20.106  1.00 34.27 ? 174 GLU B O   1 
ATOM 2917 C CB  . GLU B 1 175 ? 49.507 -4.046  20.957  1.00 34.65 ? 174 GLU B CB  1 
ATOM 2918 C CG  . GLU B 1 175 ? 49.584 -3.860  22.469  1.00 35.58 ? 174 GLU B CG  1 
ATOM 2919 C CD  . GLU B 1 175 ? 48.431 -3.028  22.976  1.00 37.61 ? 174 GLU B CD  1 
ATOM 2920 O OE1 . GLU B 1 175 ? 47.292 -3.518  22.831  1.00 39.18 ? 174 GLU B OE1 1 
ATOM 2921 O OE2 . GLU B 1 175 ? 48.651 -1.879  23.479  1.00 38.89 ? 174 GLU B OE2 1 
ATOM 2922 N N   . GLU B 1 176 ? 52.344 -5.935  21.315  1.00 36.00 ? 175 GLU B N   1 
ATOM 2923 C CA  . GLU B 1 176 ? 52.825 -7.265  21.707  1.00 36.99 ? 175 GLU B CA  1 
ATOM 2924 C C   . GLU B 1 176 ? 53.280 -7.233  23.178  1.00 38.16 ? 175 GLU B C   1 
ATOM 2925 O O   . GLU B 1 176 ? 54.352 -6.691  23.527  1.00 38.50 ? 175 GLU B O   1 
ATOM 2926 C CB  . GLU B 1 176 ? 53.965 -7.725  20.780  1.00 37.03 ? 175 GLU B CB  1 
ATOM 2927 C CG  . GLU B 1 176 ? 54.476 -9.160  20.951  1.00 35.61 ? 175 GLU B CG  1 
ATOM 2928 C CD  . GLU B 1 176 ? 55.506 -9.537  19.866  1.00 35.21 ? 175 GLU B CD  1 
ATOM 2929 O OE1 . GLU B 1 176 ? 56.637 -8.991  19.899  1.00 32.40 ? 175 GLU B OE1 1 
ATOM 2930 O OE2 . GLU B 1 176 ? 55.193 -10.372 18.977  1.00 34.62 ? 175 GLU B OE2 1 
ATOM 2931 N N   . ASN B 1 177 ? 52.449 -7.830  24.030  1.00 39.11 ? 176 ASN B N   1 
ATOM 2932 C CA  . ASN B 1 177 ? 52.687 -7.914  25.474  1.00 39.83 ? 176 ASN B CA  1 
ATOM 2933 C C   . ASN B 1 177 ? 52.568 -6.561  26.118  1.00 39.91 ? 176 ASN B C   1 
ATOM 2934 O O   . ASN B 1 177 ? 53.294 -6.238  27.073  1.00 40.92 ? 176 ASN B O   1 
ATOM 2935 C CB  . ASN B 1 177 ? 54.031 -8.599  25.807  1.00 39.82 ? 176 ASN B CB  1 
ATOM 2936 C CG  . ASN B 1 177 ? 53.988 -10.093 25.526  1.00 41.87 ? 176 ASN B CG  1 
ATOM 2937 O OD1 . ASN B 1 177 ? 54.637 -10.601 24.586  1.00 43.47 ? 176 ASN B OD1 1 
ATOM 2938 N ND2 . ASN B 1 177 ? 53.200 -10.814 26.336  1.00 43.80 ? 176 ASN B ND2 1 
ATOM 2939 N N   . GLY B 1 178 ? 51.652 -5.761  25.598  1.00 39.41 ? 177 GLY B N   1 
ATOM 2940 C CA  . GLY B 1 178 ? 51.389 -4.472  26.197  1.00 39.37 ? 177 GLY B CA  1 
ATOM 2941 C C   . GLY B 1 178 ? 52.193 -3.310  25.665  1.00 38.97 ? 177 GLY B C   1 
ATOM 2942 O O   . GLY B 1 178 ? 51.652 -2.208  25.725  1.00 39.57 ? 177 GLY B O   1 
ATOM 2943 N N   . GLU B 1 179 ? 53.436 -3.539  25.174  1.00 38.57 ? 178 GLU B N   1 
ATOM 2944 C CA  . GLU B 1 179 ? 54.331 -2.472  24.638  1.00 38.07 ? 178 GLU B CA  1 
ATOM 2945 C C   . GLU B 1 179 ? 54.322 -2.350  23.074  1.00 37.91 ? 178 GLU B C   1 
ATOM 2946 O O   . GLU B 1 179 ? 54.246 -3.336  22.360  1.00 38.14 ? 178 GLU B O   1 
ATOM 2947 C CB  . GLU B 1 179 ? 55.760 -2.585  25.233  1.00 37.89 ? 178 GLU B CB  1 
ATOM 2948 C CG  . GLU B 1 179 ? 56.712 -3.636  24.663  1.00 37.35 ? 178 GLU B CG  1 
ATOM 2949 C CD  . GLU B 1 179 ? 58.193 -3.259  24.821  1.00 37.90 ? 178 GLU B CD  1 
ATOM 2950 O OE1 . GLU B 1 179 ? 59.057 -3.644  23.995  1.00 38.37 ? 178 GLU B OE1 1 
ATOM 2951 O OE2 . GLU B 1 179 ? 58.525 -2.556  25.775  1.00 40.80 ? 178 GLU B OE2 1 
ATOM 2952 N N   . VAL B 1 180 ? 54.347 -1.123  22.556  1.00 37.54 ? 179 VAL B N   1 
ATOM 2953 C CA  . VAL B 1 180 ? 54.210 -0.874  21.104  1.00 36.67 ? 179 VAL B CA  1 
ATOM 2954 C C   . VAL B 1 180 ? 55.475 -1.262  20.382  1.00 35.41 ? 179 VAL B C   1 
ATOM 2955 O O   . VAL B 1 180 ? 56.524 -0.804  20.763  1.00 35.31 ? 179 VAL B O   1 
ATOM 2956 C CB  . VAL B 1 180 ? 53.928 0.620   20.843  1.00 36.49 ? 179 VAL B CB  1 
ATOM 2957 C CG1 . VAL B 1 180 ? 54.159 0.997   19.382  1.00 36.84 ? 179 VAL B CG1 1 
ATOM 2958 C CG2 . VAL B 1 180 ? 52.506 0.937   21.270  1.00 35.97 ? 179 VAL B CG2 1 
ATOM 2959 N N   . LYS B 1 181 ? 55.359 -2.088  19.346  1.00 34.68 ? 180 LYS B N   1 
ATOM 2960 C CA  . LYS B 1 181 ? 56.528 -2.646  18.652  1.00 34.87 ? 180 LYS B CA  1 
ATOM 2961 C C   . LYS B 1 181 ? 56.476 -2.488  17.121  1.00 34.98 ? 180 LYS B C   1 
ATOM 2962 O O   . LYS B 1 181 ? 55.428 -2.566  16.518  1.00 35.48 ? 180 LYS B O   1 
ATOM 2963 C CB  . LYS B 1 181 ? 56.718 -4.111  19.032  1.00 34.50 ? 180 LYS B CB  1 
ATOM 2964 C CG  . LYS B 1 181 ? 57.121 -4.312  20.491  1.00 35.05 ? 180 LYS B CG  1 
ATOM 2965 C CD  . LYS B 1 181 ? 57.603 -5.749  20.778  1.00 36.88 ? 180 LYS B CD  1 
ATOM 2966 C CE  . LYS B 1 181 ? 57.712 -6.065  22.307  1.00 36.90 ? 180 LYS B CE  1 
ATOM 2967 N NZ  . LYS B 1 181 ? 57.984 -7.486  22.677  1.00 35.18 ? 180 LYS B NZ  1 
ATOM 2968 N N   . VAL B 1 182 ? 57.611 -2.216  16.496  1.00 35.04 ? 181 VAL B N   1 
ATOM 2969 C CA  . VAL B 1 182 ? 57.622 -1.976  15.073  1.00 35.06 ? 181 VAL B CA  1 
ATOM 2970 C C   . VAL B 1 182 ? 58.458 -3.075  14.424  1.00 34.84 ? 181 VAL B C   1 
ATOM 2971 O O   . VAL B 1 182 ? 59.670 -3.164  14.602  1.00 34.54 ? 181 VAL B O   1 
ATOM 2972 C CB  . VAL B 1 182 ? 58.145 -0.529  14.726  1.00 35.41 ? 181 VAL B CB  1 
ATOM 2973 C CG1 . VAL B 1 182 ? 57.783 -0.143  13.296  1.00 34.86 ? 181 VAL B CG1 1 
ATOM 2974 C CG2 . VAL B 1 182 ? 57.544 0.516   15.675  1.00 35.01 ? 181 VAL B CG2 1 
ATOM 2975 N N   . VAL B 1 183 ? 57.775 -3.884  13.631  1.00 34.77 ? 182 VAL B N   1 
ATOM 2976 C CA  . VAL B 1 183 ? 58.263 -5.181  13.167  1.00 34.30 ? 182 VAL B CA  1 
ATOM 2977 C C   . VAL B 1 183 ? 58.033 -5.385  11.670  1.00 34.08 ? 182 VAL B C   1 
ATOM 2978 O O   . VAL B 1 183 ? 57.283 -4.653  11.054  1.00 33.30 ? 182 VAL B O   1 
ATOM 2979 C CB  . VAL B 1 183 ? 57.511 -6.322  13.918  1.00 34.01 ? 182 VAL B CB  1 
ATOM 2980 C CG1 . VAL B 1 183 ? 57.543 -6.077  15.398  1.00 34.72 ? 182 VAL B CG1 1 
ATOM 2981 C CG2 . VAL B 1 183 ? 56.054 -6.447  13.475  1.00 32.65 ? 182 VAL B CG2 1 
ATOM 2982 N N   . ASP B 1 184 ? 58.633 -6.437  11.129  1.00 33.91 ? 183 ASP B N   1 
ATOM 2983 C CA  . ASP B 1 184 ? 58.583 -6.688  9.718   1.00 34.39 ? 183 ASP B CA  1 
ATOM 2984 C C   . ASP B 1 184 ? 57.227 -7.293  9.292   1.00 34.49 ? 183 ASP B C   1 
ATOM 2985 O O   . ASP B 1 184 ? 56.617 -8.060  9.988   1.00 33.99 ? 183 ASP B O   1 
ATOM 2986 C CB  . ASP B 1 184 ? 59.808 -7.502  9.270   1.00 34.52 ? 183 ASP B CB  1 
ATOM 2987 C CG  . ASP B 1 184 ? 61.060 -7.135  10.059  1.00 36.91 ? 183 ASP B CG  1 
ATOM 2988 O OD1 . ASP B 1 184 ? 61.687 -6.076  9.757   1.00 38.13 ? 183 ASP B OD1 1 
ATOM 2989 O OD2 . ASP B 1 184 ? 61.457 -7.814  11.058  1.00 37.54 ? 183 ASP B OD2 1 
ATOM 2990 N N   . ASN B 1 185 ? 56.768 -6.884  8.123   1.00 35.55 ? 184 ASN B N   1 
ATOM 2991 C CA  . ASN B 1 185 ? 55.487 -7.245  7.565   1.00 36.23 ? 184 ASN B CA  1 
ATOM 2992 C C   . ASN B 1 185 ? 55.670 -8.590  6.905   1.00 37.32 ? 184 ASN B C   1 
ATOM 2993 O O   . ASN B 1 185 ? 56.425 -8.712  5.957   1.00 37.32 ? 184 ASN B O   1 
ATOM 2994 C CB  . ASN B 1 185 ? 55.115 -6.181  6.528   1.00 36.10 ? 184 ASN B CB  1 
ATOM 2995 C CG  . ASN B 1 185 ? 53.754 -6.355  5.963   1.00 34.85 ? 184 ASN B CG  1 
ATOM 2996 O OD1 . ASN B 1 185 ? 53.177 -7.421  5.991   1.00 35.51 ? 184 ASN B OD1 1 
ATOM 2997 N ND2 . ASN B 1 185 ? 53.229 -5.297  5.430   1.00 34.19 ? 184 ASN B ND2 1 
ATOM 2998 N N   . PRO B 1 186 ? 54.988 -9.606  7.392   1.00 38.61 ? 185 PRO B N   1 
ATOM 2999 C CA  . PRO B 1 186 ? 55.145 -10.948 6.833   1.00 39.56 ? 185 PRO B CA  1 
ATOM 3000 C C   . PRO B 1 186 ? 54.720 -10.987 5.377   1.00 41.04 ? 185 PRO B C   1 
ATOM 3001 O O   . PRO B 1 186 ? 55.249 -11.811 4.634   1.00 41.16 ? 185 PRO B O   1 
ATOM 3002 C CB  . PRO B 1 186 ? 54.215 -11.821 7.683   1.00 39.65 ? 185 PRO B CB  1 
ATOM 3003 C CG  . PRO B 1 186 ? 53.736 -10.974 8.786   1.00 39.86 ? 185 PRO B CG  1 
ATOM 3004 C CD  . PRO B 1 186 ? 54.005 -9.541  8.475   1.00 38.63 ? 185 PRO B CD  1 
ATOM 3005 N N   . ARG B 1 187 ? 53.758 -10.128 4.998   1.00 42.57 ? 186 ARG B N   1 
ATOM 3006 C CA  . ARG B 1 187 ? 53.352 -9.952  3.598   1.00 43.53 ? 186 ARG B CA  1 
ATOM 3007 C C   . ARG B 1 187 ? 54.465 -9.419  2.738   1.00 44.30 ? 186 ARG B C   1 
ATOM 3008 O O   . ARG B 1 187 ? 54.459 -9.658  1.518   1.00 45.64 ? 186 ARG B O   1 
ATOM 3009 C CB  . ARG B 1 187 ? 52.175 -8.998  3.443   1.00 43.63 ? 186 ARG B CB  1 
ATOM 3010 C CG  . ARG B 1 187 ? 50.854 -9.662  3.147   1.00 45.28 ? 186 ARG B CG  1 
ATOM 3011 C CD  . ARG B 1 187 ? 49.671 -9.083  3.937   1.00 47.66 ? 186 ARG B CD  1 
ATOM 3012 N NE  . ARG B 1 187 ? 48.570 -10.043 4.040   1.00 50.61 ? 186 ARG B NE  1 
ATOM 3013 C CZ  . ARG B 1 187 ? 48.588 -11.187 4.764   1.00 51.31 ? 186 ARG B CZ  1 
ATOM 3014 N NH1 . ARG B 1 187 ? 49.652 -11.545 5.486   1.00 51.40 ? 186 ARG B NH1 1 
ATOM 3015 N NH2 . ARG B 1 187 ? 47.508 -11.975 4.770   1.00 51.81 ? 186 ARG B NH2 1 
ATOM 3016 N N   . TRP B 1 188 ? 55.401 -8.675  3.341   1.00 44.53 ? 187 TRP B N   1 
ATOM 3017 C CA  . TRP B 1 188 ? 56.432 -7.948  2.553   1.00 44.24 ? 187 TRP B CA  1 
ATOM 3018 C C   . TRP B 1 188 ? 57.373 -8.858  1.743   1.00 43.50 ? 187 TRP B C   1 
ATOM 3019 O O   . TRP B 1 188 ? 57.776 -9.918  2.220   1.00 43.03 ? 187 TRP B O   1 
ATOM 3020 C CB  . TRP B 1 188 ? 57.253 -6.998  3.439   1.00 44.22 ? 187 TRP B CB  1 
ATOM 3021 C CG  . TRP B 1 188 ? 58.097 -6.056  2.649   1.00 43.37 ? 187 TRP B CG  1 
ATOM 3022 C CD1 . TRP B 1 188 ? 59.446 -6.038  2.577   1.00 42.92 ? 187 TRP B CD1 1 
ATOM 3023 C CD2 . TRP B 1 188 ? 57.636 -5.002  1.819   1.00 42.75 ? 187 TRP B CD2 1 
ATOM 3024 N NE1 . TRP B 1 188 ? 59.869 -5.034  1.741   1.00 43.50 ? 187 TRP B NE1 1 
ATOM 3025 C CE2 . TRP B 1 188 ? 58.770 -4.377  1.269   1.00 43.20 ? 187 TRP B CE2 1 
ATOM 3026 C CE3 . TRP B 1 188 ? 56.379 -4.522  1.484   1.00 44.38 ? 187 TRP B CE3 1 
ATOM 3027 C CZ2 . TRP B 1 188 ? 58.688 -3.313  0.402   1.00 44.24 ? 187 TRP B CZ2 1 
ATOM 3028 C CZ3 . TRP B 1 188 ? 56.285 -3.460  0.616   1.00 46.09 ? 187 TRP B CZ3 1 
ATOM 3029 C CH2 . TRP B 1 188 ? 57.439 -2.863  0.080   1.00 46.24 ? 187 TRP B CH2 1 
ATOM 3030 N N   . LYS B 1 189 ? 57.697 -8.401  0.528   0.50 43.09 ? 188 LYS B N   1 
ATOM 3031 C CA  . LYS B 1 189 ? 58.526 -9.125  -0.444  0.50 42.60 ? 188 LYS B CA  1 
ATOM 3032 C C   . LYS B 1 189 ? 59.614 -8.207  -1.001  0.50 41.96 ? 188 LYS B C   1 
ATOM 3033 O O   . LYS B 1 189 ? 59.341 -7.073  -1.382  0.50 40.84 ? 188 LYS B O   1 
ATOM 3034 C CB  . LYS B 1 189 ? 57.647 -9.663  -1.588  0.50 42.50 ? 188 LYS B CB  1 
ATOM 3035 C CG  . LYS B 1 189 ? 56.187 -9.973  -1.174  0.50 42.23 ? 188 LYS B CG  1 
ATOM 3036 C CD  . LYS B 1 189 ? 55.356 -10.580 -2.313  0.50 41.93 ? 188 LYS B CD  1 
ATOM 3037 C CE  . LYS B 1 189 ? 55.147 -9.594  -3.487  0.50 41.76 ? 188 LYS B CE  1 
ATOM 3038 N NZ  . LYS B 1 189 ? 54.769 -8.193  -3.103  0.50 40.49 ? 188 LYS B NZ  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   0   1   MET MET A . n 
A 1 2   MET 2   1   1   MET MET A . n 
A 1 3   TYR 3   2   2   TYR TYR A . n 
A 1 4   LYS 4   3   3   LYS LYS A . n 
A 1 5   GLU 5   4   4   GLU GLU A . n 
A 1 6   PRO 6   5   5   PRO PRO A . n 
A 1 7   PHE 7   6   6   PHE PHE A . n 
A 1 8   GLY 8   7   7   GLY GLY A . n 
A 1 9   VAL 9   8   8   VAL VAL A . n 
A 1 10  LYS 10  9   9   LYS LYS A . n 
A 1 11  VAL 11  10  10  VAL VAL A . n 
A 1 12  ASP 12  11  11  ASP ASP A . n 
A 1 13  PHE 13  12  12  PHE PHE A . n 
A 1 14  GLU 14  13  13  GLU GLU A . n 
A 1 15  THR 15  14  14  THR THR A . n 
A 1 16  GLY 16  15  15  GLY GLY A . n 
A 1 17  ILE 17  16  16  ILE ILE A . n 
A 1 18  ILE 18  17  17  ILE ILE A . n 
A 1 19  GLU 19  18  18  GLU GLU A . n 
A 1 20  GLY 20  19  19  GLY GLY A . n 
A 1 21  ALA 21  20  20  ALA ALA A . n 
A 1 22  LYS 22  21  21  LYS LYS A . n 
A 1 23  LYS 23  22  22  LYS LYS A . n 
A 1 24  SER 24  23  23  SER SER A . n 
A 1 25  VAL 25  24  24  VAL VAL A . n 
A 1 26  ARG 26  25  25  ARG ARG A . n 
A 1 27  ARG 27  26  26  ARG ARG A . n 
A 1 28  LEU 28  27  27  LEU LEU A . n 
A 1 29  SER 29  28  28  SER SER A . n 
A 1 30  ASP 30  29  29  ASP ASP A . n 
A 1 31  MET 31  30  30  MET MET A . n 
A 1 32  GLU 32  31  31  GLU GLU A . n 
A 1 33  GLY 33  32  32  GLY GLY A . n 
A 1 34  TYR 34  33  33  TYR TYR A . n 
A 1 35  PHE 35  34  34  PHE PHE A . n 
A 1 36  VAL 36  35  35  VAL VAL A . n 
A 1 37  ASP 37  36  36  ASP ASP A . n 
A 1 38  GLU 38  37  37  GLU GLU A . n 
A 1 39  ARG 39  38  38  ARG ARG A . n 
A 1 40  ALA 40  39  39  ALA ALA A . n 
A 1 41  TRP 41  40  40  TRP TRP A . n 
A 1 42  LYS 42  41  41  LYS LYS A . n 
A 1 43  GLU 43  42  42  GLU GLU A . n 
A 1 44  LEU 44  43  43  LEU LEU A . n 
A 1 45  VAL 45  44  44  VAL VAL A . n 
A 1 46  GLU 46  45  45  GLU GLU A . n 
A 1 47  LYS 47  46  46  LYS LYS A . n 
A 1 48  GLU 48  47  47  GLU GLU A . n 
A 1 49  ASP 49  48  48  ASP ASP A . n 
A 1 50  PRO 50  49  49  PRO PRO A . n 
A 1 51  VAL 51  50  50  VAL VAL A . n 
A 1 52  VAL 52  51  51  VAL VAL A . n 
A 1 53  TYR 53  52  52  TYR TYR A . n 
A 1 54  GLU 54  53  53  GLU GLU A . n 
A 1 55  VAL 55  54  54  VAL VAL A . n 
A 1 56  TYR 56  55  55  TYR TYR A . n 
A 1 57  ALA 57  56  56  ALA ALA A . n 
A 1 58  VAL 58  57  57  VAL VAL A . n 
A 1 59  GLU 59  58  58  GLU GLU A . n 
A 1 60  GLN 60  59  59  GLN GLN A . n 
A 1 61  GLU 61  60  60  GLU GLU A . n 
A 1 62  GLU 62  61  61  GLU GLU A . n 
A 1 63  LYS 63  62  62  LYS LYS A . n 
A 1 64  GLU 64  63  63  GLU GLU A . n 
A 1 65  GLY 65  64  64  GLY GLY A . n 
A 1 66  ASP 66  65  65  ASP ASP A . n 
A 1 67  LEU 67  66  66  LEU LEU A . n 
A 1 68  ASN 68  67  67  ASN ASN A . n 
A 1 69  PHE 69  68  68  PHE PHE A . n 
A 1 70  ALA 70  69  69  ALA ALA A . n 
A 1 71  THR 71  70  70  THR THR A . n 
A 1 72  THR 72  71  71  THR THR A . n 
A 1 73  VAL 73  72  72  VAL VAL A . n 
A 1 74  LEU 74  73  73  LEU LEU A . n 
A 1 75  TYR 75  74  74  TYR TYR A . n 
A 1 76  PRO 76  75  75  PRO PRO A . n 
A 1 77  GLY 77  76  76  GLY GLY A . n 
A 1 78  LYS 78  77  77  LYS LYS A . n 
A 1 79  VAL 79  78  78  VAL VAL A . n 
A 1 80  GLY 80  79  79  GLY GLY A . n 
A 1 81  LYS 81  80  80  LYS LYS A . n 
A 1 82  GLU 82  81  81  GLU GLU A . n 
A 1 83  PHE 83  82  82  PHE PHE A . n 
A 1 84  PHE 84  83  83  PHE PHE A . n 
A 1 85  PHE 85  84  84  PHE PHE A . n 
A 1 86  THR 86  85  85  THR THR A . n 
A 1 87  LYS 87  86  86  LYS LYS A . n 
A 1 88  GLY 88  87  87  GLY GLY A . n 
A 1 89  HIS 89  88  88  HIS HIS A . n 
A 1 90  PHE 90  89  89  PHE PHE A . n 
A 1 91  HIS 91  90  90  HIS HIS A . n 
A 1 92  ALA 92  91  91  ALA ALA A . n 
A 1 93  LYS 93  92  92  LYS LYS A . n 
A 1 94  LEU 94  93  93  LEU LEU A . n 
A 1 95  ASP 95  94  94  ASP ASP A . n 
A 1 96  ARG 96  95  95  ARG ARG A . n 
A 1 97  ALA 97  96  96  ALA ALA A . n 
A 1 98  GLU 98  97  97  GLU GLU A . n 
A 1 99  VAL 99  98  98  VAL VAL A . n 
A 1 100 TYR 100 99  99  TYR TYR A . n 
A 1 101 VAL 101 100 100 VAL VAL A . n 
A 1 102 ALA 102 101 101 ALA ALA A . n 
A 1 103 LEU 103 102 102 LEU LEU A . n 
A 1 104 LYS 104 103 103 LYS LYS A . n 
A 1 105 GLY 105 104 104 GLY GLY A . n 
A 1 106 LYS 106 105 105 LYS LYS A . n 
A 1 107 GLY 107 106 106 GLY GLY A . n 
A 1 108 GLY 108 107 107 GLY GLY A . n 
A 1 109 MET 109 108 108 MET MET A . n 
A 1 110 LEU 110 109 109 LEU LEU A . n 
A 1 111 LEU 111 110 110 LEU LEU A . n 
A 1 112 GLN 112 111 111 GLN GLN A . n 
A 1 113 THR 113 112 112 THR THR A . n 
A 1 114 PRO 114 113 113 PRO PRO A . n 
A 1 115 GLU 115 114 114 GLU GLU A . n 
A 1 116 GLY 116 115 115 GLY GLY A . n 
A 1 117 ASP 117 116 116 ASP ASP A . n 
A 1 118 ALA 118 117 117 ALA ALA A . n 
A 1 119 LYS 119 118 118 LYS LYS A . n 
A 1 120 TRP 120 119 119 TRP TRP A . n 
A 1 121 ILE 121 120 120 ILE ILE A . n 
A 1 122 SER 122 121 121 SER SER A . n 
A 1 123 MET 123 122 122 MET MET A . n 
A 1 124 GLU 124 123 123 GLU GLU A . n 
A 1 125 PRO 125 124 124 PRO PRO A . n 
A 1 126 GLY 126 125 125 GLY GLY A . n 
A 1 127 THR 127 126 126 THR THR A . n 
A 1 128 VAL 128 127 127 VAL VAL A . n 
A 1 129 VAL 129 128 128 VAL VAL A . n 
A 1 130 TYR 130 129 129 TYR TYR A . n 
A 1 131 VAL 131 130 130 VAL VAL A . n 
A 1 132 PRO 132 131 131 PRO PRO A . n 
A 1 133 PRO 133 132 132 PRO PRO A . n 
A 1 134 TYR 134 133 133 TYR TYR A . n 
A 1 135 TRP 135 134 134 TRP TRP A . n 
A 1 136 ALA 136 135 135 ALA ALA A . n 
A 1 137 HIS 137 136 136 HIS HIS A . n 
A 1 138 ARG 138 137 137 ARG ARG A . n 
A 1 139 THR 139 138 138 THR THR A . n 
A 1 140 VAL 140 139 139 VAL VAL A . n 
A 1 141 ASN 141 140 140 ASN ASN A . n 
A 1 142 ILE 142 141 141 ILE ILE A . n 
A 1 143 GLY 143 142 142 GLY GLY A . n 
A 1 144 ASP 144 143 143 ASP ASP A . n 
A 1 145 GLU 145 144 144 GLU GLU A . n 
A 1 146 PRO 146 145 145 PRO PRO A . n 
A 1 147 PHE 147 146 146 PHE PHE A . n 
A 1 148 ILE 148 147 147 ILE ILE A . n 
A 1 149 PHE 149 148 148 PHE PHE A . n 
A 1 150 LEU 150 149 149 LEU LEU A . n 
A 1 151 ALA 151 150 150 ALA ALA A . n 
A 1 152 ILE 152 151 151 ILE ILE A . n 
A 1 153 TYR 153 152 152 TYR TYR A . n 
A 1 154 PRO 154 153 153 PRO PRO A . n 
A 1 155 ALA 155 154 154 ALA ALA A . n 
A 1 156 ASP 156 155 155 ASP ASP A . n 
A 1 157 ALA 157 156 156 ALA ALA A . n 
A 1 158 GLY 158 157 157 GLY GLY A . n 
A 1 159 HIS 159 158 158 HIS HIS A . n 
A 1 160 ASP 160 159 159 ASP ASP A . n 
A 1 161 TYR 161 160 160 TYR TYR A . n 
A 1 162 GLY 162 161 161 GLY GLY A . n 
A 1 163 THR 163 162 162 THR THR A . n 
A 1 164 ILE 164 163 163 ILE ILE A . n 
A 1 165 ALA 165 164 164 ALA ALA A . n 
A 1 166 GLU 166 165 165 GLU GLU A . n 
A 1 167 LYS 167 166 166 LYS LYS A . n 
A 1 168 GLY 168 167 167 GLY GLY A . n 
A 1 169 PHE 169 168 168 PHE PHE A . n 
A 1 170 SER 170 169 169 SER SER A . n 
A 1 171 LYS 171 170 170 LYS LYS A . n 
A 1 172 ILE 172 171 171 ILE ILE A . n 
A 1 173 VAL 173 172 172 VAL VAL A . n 
A 1 174 ILE 174 173 173 ILE ILE A . n 
A 1 175 GLU 175 174 174 GLU GLU A . n 
A 1 176 GLU 176 175 175 GLU GLU A . n 
A 1 177 ASN 177 176 176 ASN ASN A . n 
A 1 178 GLY 178 177 177 GLY GLY A . n 
A 1 179 GLU 179 178 178 GLU GLU A . n 
A 1 180 VAL 180 179 179 VAL VAL A . n 
A 1 181 LYS 181 180 180 LYS LYS A . n 
A 1 182 VAL 182 181 181 VAL VAL A . n 
A 1 183 VAL 183 182 182 VAL VAL A . n 
A 1 184 ASP 184 183 183 ASP ASP A . n 
A 1 185 ASN 185 184 184 ASN ASN A . n 
A 1 186 PRO 186 185 185 PRO PRO A . n 
A 1 187 ARG 187 186 186 ARG ARG A . n 
A 1 188 TRP 188 187 187 TRP TRP A . n 
A 1 189 LYS 189 188 188 LYS LYS A . n 
A 1 190 LYS 190 189 ?   ?   ?   A . n 
B 1 1   MET 1   0   1   MET MET B . n 
B 1 2   MET 2   1   1   MET MET B . n 
B 1 3   TYR 3   2   2   TYR TYR B . n 
B 1 4   LYS 4   3   3   LYS LYS B . n 
B 1 5   GLU 5   4   4   GLU GLU B . n 
B 1 6   PRO 6   5   5   PRO PRO B . n 
B 1 7   PHE 7   6   6   PHE PHE B . n 
B 1 8   GLY 8   7   7   GLY GLY B . n 
B 1 9   VAL 9   8   8   VAL VAL B . n 
B 1 10  LYS 10  9   9   LYS LYS B . n 
B 1 11  VAL 11  10  10  VAL VAL B . n 
B 1 12  ASP 12  11  11  ASP ASP B . n 
B 1 13  PHE 13  12  12  PHE PHE B . n 
B 1 14  GLU 14  13  13  GLU GLU B . n 
B 1 15  THR 15  14  14  THR THR B . n 
B 1 16  GLY 16  15  15  GLY GLY B . n 
B 1 17  ILE 17  16  16  ILE ILE B . n 
B 1 18  ILE 18  17  17  ILE ILE B . n 
B 1 19  GLU 19  18  18  GLU GLU B . n 
B 1 20  GLY 20  19  19  GLY GLY B . n 
B 1 21  ALA 21  20  20  ALA ALA B . n 
B 1 22  LYS 22  21  21  LYS LYS B . n 
B 1 23  LYS 23  22  22  LYS LYS B . n 
B 1 24  SER 24  23  23  SER SER B . n 
B 1 25  VAL 25  24  24  VAL VAL B . n 
B 1 26  ARG 26  25  25  ARG ARG B . n 
B 1 27  ARG 27  26  26  ARG ARG B . n 
B 1 28  LEU 28  27  27  LEU LEU B . n 
B 1 29  SER 29  28  28  SER SER B . n 
B 1 30  ASP 30  29  29  ASP ASP B . n 
B 1 31  MET 31  30  30  MET MET B . n 
B 1 32  GLU 32  31  31  GLU GLU B . n 
B 1 33  GLY 33  32  32  GLY GLY B . n 
B 1 34  TYR 34  33  33  TYR TYR B . n 
B 1 35  PHE 35  34  34  PHE PHE B . n 
B 1 36  VAL 36  35  35  VAL VAL B . n 
B 1 37  ASP 37  36  36  ASP ASP B . n 
B 1 38  GLU 38  37  37  GLU GLU B . n 
B 1 39  ARG 39  38  38  ARG ARG B . n 
B 1 40  ALA 40  39  39  ALA ALA B . n 
B 1 41  TRP 41  40  40  TRP TRP B . n 
B 1 42  LYS 42  41  41  LYS LYS B . n 
B 1 43  GLU 43  42  42  GLU GLU B . n 
B 1 44  LEU 44  43  43  LEU LEU B . n 
B 1 45  VAL 45  44  44  VAL VAL B . n 
B 1 46  GLU 46  45  45  GLU GLU B . n 
B 1 47  LYS 47  46  46  LYS LYS B . n 
B 1 48  GLU 48  47  47  GLU GLU B . n 
B 1 49  ASP 49  48  48  ASP ASP B . n 
B 1 50  PRO 50  49  49  PRO PRO B . n 
B 1 51  VAL 51  50  50  VAL VAL B . n 
B 1 52  VAL 52  51  51  VAL VAL B . n 
B 1 53  TYR 53  52  52  TYR TYR B . n 
B 1 54  GLU 54  53  53  GLU GLU B . n 
B 1 55  VAL 55  54  54  VAL VAL B . n 
B 1 56  TYR 56  55  55  TYR TYR B . n 
B 1 57  ALA 57  56  56  ALA ALA B . n 
B 1 58  VAL 58  57  57  VAL VAL B . n 
B 1 59  GLU 59  58  58  GLU GLU B . n 
B 1 60  GLN 60  59  59  GLN GLN B . n 
B 1 61  GLU 61  60  60  GLU GLU B . n 
B 1 62  GLU 62  61  61  GLU GLU B . n 
B 1 63  LYS 63  62  62  LYS LYS B . n 
B 1 64  GLU 64  63  63  GLU GLU B . n 
B 1 65  GLY 65  64  64  GLY GLY B . n 
B 1 66  ASP 66  65  65  ASP ASP B . n 
B 1 67  LEU 67  66  66  LEU LEU B . n 
B 1 68  ASN 68  67  67  ASN ASN B . n 
B 1 69  PHE 69  68  68  PHE PHE B . n 
B 1 70  ALA 70  69  69  ALA ALA B . n 
B 1 71  THR 71  70  70  THR THR B . n 
B 1 72  THR 72  71  71  THR THR B . n 
B 1 73  VAL 73  72  72  VAL VAL B . n 
B 1 74  LEU 74  73  73  LEU LEU B . n 
B 1 75  TYR 75  74  74  TYR TYR B . n 
B 1 76  PRO 76  75  75  PRO PRO B . n 
B 1 77  GLY 77  76  76  GLY GLY B . n 
B 1 78  LYS 78  77  77  LYS LYS B . n 
B 1 79  VAL 79  78  78  VAL VAL B . n 
B 1 80  GLY 80  79  79  GLY GLY B . n 
B 1 81  LYS 81  80  80  LYS LYS B . n 
B 1 82  GLU 82  81  81  GLU GLU B . n 
B 1 83  PHE 83  82  82  PHE PHE B . n 
B 1 84  PHE 84  83  83  PHE PHE B . n 
B 1 85  PHE 85  84  84  PHE PHE B . n 
B 1 86  THR 86  85  85  THR THR B . n 
B 1 87  LYS 87  86  86  LYS LYS B . n 
B 1 88  GLY 88  87  87  GLY GLY B . n 
B 1 89  HIS 89  88  88  HIS HIS B . n 
B 1 90  PHE 90  89  89  PHE PHE B . n 
B 1 91  HIS 91  90  90  HIS HIS B . n 
B 1 92  ALA 92  91  91  ALA ALA B . n 
B 1 93  LYS 93  92  92  LYS LYS B . n 
B 1 94  LEU 94  93  93  LEU LEU B . n 
B 1 95  ASP 95  94  94  ASP ASP B . n 
B 1 96  ARG 96  95  95  ARG ARG B . n 
B 1 97  ALA 97  96  96  ALA ALA B . n 
B 1 98  GLU 98  97  97  GLU GLU B . n 
B 1 99  VAL 99  98  98  VAL VAL B . n 
B 1 100 TYR 100 99  99  TYR TYR B . n 
B 1 101 VAL 101 100 100 VAL VAL B . n 
B 1 102 ALA 102 101 101 ALA ALA B . n 
B 1 103 LEU 103 102 102 LEU LEU B . n 
B 1 104 LYS 104 103 103 LYS LYS B . n 
B 1 105 GLY 105 104 104 GLY GLY B . n 
B 1 106 LYS 106 105 105 LYS LYS B . n 
B 1 107 GLY 107 106 106 GLY GLY B . n 
B 1 108 GLY 108 107 107 GLY GLY B . n 
B 1 109 MET 109 108 108 MET MET B . n 
B 1 110 LEU 110 109 109 LEU LEU B . n 
B 1 111 LEU 111 110 110 LEU LEU B . n 
B 1 112 GLN 112 111 111 GLN GLN B . n 
B 1 113 THR 113 112 112 THR THR B . n 
B 1 114 PRO 114 113 113 PRO PRO B . n 
B 1 115 GLU 115 114 114 GLU GLU B . n 
B 1 116 GLY 116 115 115 GLY GLY B . n 
B 1 117 ASP 117 116 116 ASP ASP B . n 
B 1 118 ALA 118 117 117 ALA ALA B . n 
B 1 119 LYS 119 118 118 LYS LYS B . n 
B 1 120 TRP 120 119 119 TRP TRP B . n 
B 1 121 ILE 121 120 120 ILE ILE B . n 
B 1 122 SER 122 121 121 SER SER B . n 
B 1 123 MET 123 122 122 MET MET B . n 
B 1 124 GLU 124 123 123 GLU GLU B . n 
B 1 125 PRO 125 124 124 PRO PRO B . n 
B 1 126 GLY 126 125 125 GLY GLY B . n 
B 1 127 THR 127 126 126 THR THR B . n 
B 1 128 VAL 128 127 127 VAL VAL B . n 
B 1 129 VAL 129 128 128 VAL VAL B . n 
B 1 130 TYR 130 129 129 TYR TYR B . n 
B 1 131 VAL 131 130 130 VAL VAL B . n 
B 1 132 PRO 132 131 131 PRO PRO B . n 
B 1 133 PRO 133 132 132 PRO PRO B . n 
B 1 134 TYR 134 133 133 TYR TYR B . n 
B 1 135 TRP 135 134 134 TRP TRP B . n 
B 1 136 ALA 136 135 135 ALA ALA B . n 
B 1 137 HIS 137 136 136 HIS HIS B . n 
B 1 138 ARG 138 137 137 ARG ARG B . n 
B 1 139 THR 139 138 138 THR THR B . n 
B 1 140 VAL 140 139 139 VAL VAL B . n 
B 1 141 ASN 141 140 140 ASN ASN B . n 
B 1 142 ILE 142 141 141 ILE ILE B . n 
B 1 143 GLY 143 142 142 GLY GLY B . n 
B 1 144 ASP 144 143 143 ASP ASP B . n 
B 1 145 GLU 145 144 144 GLU GLU B . n 
B 1 146 PRO 146 145 145 PRO PRO B . n 
B 1 147 PHE 147 146 146 PHE PHE B . n 
B 1 148 ILE 148 147 147 ILE ILE B . n 
B 1 149 PHE 149 148 148 PHE PHE B . n 
B 1 150 LEU 150 149 149 LEU LEU B . n 
B 1 151 ALA 151 150 150 ALA ALA B . n 
B 1 152 ILE 152 151 151 ILE ILE B . n 
B 1 153 TYR 153 152 152 TYR TYR B . n 
B 1 154 PRO 154 153 153 PRO PRO B . n 
B 1 155 ALA 155 154 154 ALA ALA B . n 
B 1 156 ASP 156 155 155 ASP ASP B . n 
B 1 157 ALA 157 156 156 ALA ALA B . n 
B 1 158 GLY 158 157 157 GLY GLY B . n 
B 1 159 HIS 159 158 158 HIS HIS B . n 
B 1 160 ASP 160 159 159 ASP ASP B . n 
B 1 161 TYR 161 160 160 TYR TYR B . n 
B 1 162 GLY 162 161 161 GLY GLY B . n 
B 1 163 THR 163 162 162 THR THR B . n 
B 1 164 ILE 164 163 163 ILE ILE B . n 
B 1 165 ALA 165 164 164 ALA ALA B . n 
B 1 166 GLU 166 165 165 GLU GLU B . n 
B 1 167 LYS 167 166 166 LYS LYS B . n 
B 1 168 GLY 168 167 167 GLY GLY B . n 
B 1 169 PHE 169 168 168 PHE PHE B . n 
B 1 170 SER 170 169 169 SER SER B . n 
B 1 171 LYS 171 170 170 LYS LYS B . n 
B 1 172 ILE 172 171 171 ILE ILE B . n 
B 1 173 VAL 173 172 172 VAL VAL B . n 
B 1 174 ILE 174 173 173 ILE ILE B . n 
B 1 175 GLU 175 174 174 GLU GLU B . n 
B 1 176 GLU 176 175 175 GLU GLU B . n 
B 1 177 ASN 177 176 176 ASN ASN B . n 
B 1 178 GLY 178 177 177 GLY GLY B . n 
B 1 179 GLU 179 178 178 GLU GLU B . n 
B 1 180 VAL 180 179 179 VAL VAL B . n 
B 1 181 LYS 181 180 180 LYS LYS B . n 
B 1 182 VAL 182 181 181 VAL VAL B . n 
B 1 183 VAL 183 182 182 VAL VAL B . n 
B 1 184 ASP 184 183 183 ASP ASP B . n 
B 1 185 ASN 185 184 184 ASN ASN B . n 
B 1 186 PRO 186 185 185 PRO PRO B . n 
B 1 187 ARG 187 186 186 ARG ARG B . n 
B 1 188 TRP 188 187 187 TRP TRP B . n 
B 1 189 LYS 189 188 188 LYS LYS B . n 
B 1 190 LYS 190 189 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3820  ? 
1 MORE         -29   ? 
1 'SSA (A^2)'  17190 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-10-12 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2014-09-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.1.24 ? 1 
DENZO     'data reduction' .      ? 2 
SCALEPACK 'data scaling'   .      ? 3 
MOLREP    phasing          .      ? 4 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            B 
_pdbx_validate_rmsd_bond.auth_comp_id_1            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_1             4 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OE2 
_pdbx_validate_rmsd_bond.auth_asym_id_2            B 
_pdbx_validate_rmsd_bond.auth_comp_id_2            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_2             4 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.324 
_pdbx_validate_rmsd_bond.bond_target_value         1.252 
_pdbx_validate_rmsd_bond.bond_deviation            0.072 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.011 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 48  ? ? CG A ASP 48  ? ? OD2 A ASP 48  ? ? 124.82 118.30 6.52 0.90 N 
2 1 CB A ASP 143 ? ? CG A ASP 143 ? ? OD2 A ASP 143 ? ? 123.97 118.30 5.67 0.90 N 
3 1 CB A ASP 159 ? ? CG A ASP 159 ? ? OD2 A ASP 159 ? ? 123.73 118.30 5.43 0.90 N 
4 1 CB B ASP 29  ? ? CG B ASP 29  ? ? OD2 B ASP 29  ? ? 123.93 118.30 5.63 0.90 N 
5 1 CB B ASP 65  ? ? CG B ASP 65  ? ? OD2 B ASP 65  ? ? 124.18 118.30 5.88 0.90 N 
6 1 CB B ASP 143 ? ? CG B ASP 143 ? ? OD2 B ASP 143 ? ? 123.75 118.30 5.45 0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 47  ? ? -156.59 -50.81  
2  1 GLU A 61  ? ? -52.46  59.92   
3  1 PRO A 132 ? ? -48.93  150.94  
4  1 ASP A 159 ? ? -168.09 -139.08 
5  1 LYS A 166 ? ? -86.73  -78.27  
6  1 LYS B 21  ? ? 74.37   108.98  
7  1 GLU B 47  ? ? -146.42 -44.76  
8  1 ASP B 48  ? ? 50.73   74.38   
9  1 LYS B 62  ? ? -164.92 80.40   
10 1 GLU B 63  ? ? 4.60    112.91  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 ASP A 159 ? ? TYR A 160 ? ? -143.39 
2 1 TYR A 160 ? ? GLY A 161 ? ? -142.27 
3 1 HIS B 88  ? ? PHE B 89  ? ? 148.76  
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             GLU 
_pdbx_validate_main_chain_plane.auth_asym_id             A 
_pdbx_validate_main_chain_plane.auth_seq_id              60 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   13.25 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A LYS 189 ? A LYS 190 
2 1 Y 1 B LYS 189 ? B LYS 190 
#