data_1X9L
# 
_entry.id   1X9L 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1X9L         
RCSB  RCSB030111   
WWPDB D_1000030111 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          CIRMMP12 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1X9L 
_pdbx_database_status.recvd_initial_deposition_date   2004-08-23 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Banci, L.'                               1 
'Bertini, I.'                             2 
'Ciofi-Baffoni, S.'                       3 
'Katsari, E.'                             4 
'Katsaros, N.'                            5 
'Kubicek, K.'                             6 
'Structural Proteomics in Europe (SPINE)' 7 
# 
_citation.id                        primary 
_citation.title                     
'A copper(I) protein possibly involved in the assembly of CuA center of bacterial cytochrome c oxidase.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            102 
_citation.page_first                3994 
_citation.page_last                 3999 
_citation.year                      2005 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15753304 
_citation.pdbx_database_id_DOI      10.1073/pnas.0406150102 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Banci, L.'         1 
primary 'Bertini, I.'       2 
primary 'Ciofi-Baffoni, S.' 3 
primary 'Katsari, E.'       4 
primary 'Katsaros, N.'      5 
primary 'Kubicek, K.'       6 
# 
_cell.entry_id           1X9L 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1X9L 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat CuI-DR1885       15492.146 1 ? ? ? ? 
2 non-polymer syn 'COPPER (I) ION' 63.546    1 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHS
GGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHS
GGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         CIRMMP12 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   HIS n 
1 4   THR n 
1 5   MET n 
1 6   PRO n 
1 7   ALA n 
1 8   HIS n 
1 9   THR n 
1 10  PRO n 
1 11  PRO n 
1 12  ALA n 
1 13  GLN n 
1 14  THR n 
1 15  ALA n 
1 16  PRO n 
1 17  ALA n 
1 18  ALA n 
1 19  GLN n 
1 20  LYS n 
1 21  ALA n 
1 22  GLY n 
1 23  ALA n 
1 24  GLN n 
1 25  ALA n 
1 26  LEU n 
1 27  PRO n 
1 28  VAL n 
1 29  THR n 
1 30  VAL n 
1 31  GLN n 
1 32  GLY n 
1 33  ALA n 
1 34  THR n 
1 35  VAL n 
1 36  ALA n 
1 37  ALA n 
1 38  VAL n 
1 39  PRO n 
1 40  PRO n 
1 41  SER n 
1 42  ILE n 
1 43  ARG n 
1 44  ASP n 
1 45  THR n 
1 46  ALA n 
1 47  ALA n 
1 48  TYR n 
1 49  MET n 
1 50  THR n 
1 51  LEU n 
1 52  THR n 
1 53  ASN n 
1 54  LYS n 
1 55  SER n 
1 56  ASP n 
1 57  GLN n 
1 58  PRO n 
1 59  ILE n 
1 60  LYS n 
1 61  LEU n 
1 62  VAL n 
1 63  GLY n 
1 64  ALA n 
1 65  ALA n 
1 66  THR n 
1 67  PRO n 
1 68  LEU n 
1 69  ALA n 
1 70  THR n 
1 71  SER n 
1 72  PRO n 
1 73  MET n 
1 74  LEU n 
1 75  MET n 
1 76  THR n 
1 77  THR n 
1 78  THR n 
1 79  HIS n 
1 80  SER n 
1 81  GLY n 
1 82  GLY n 
1 83  MET n 
1 84  ALA n 
1 85  GLY n 
1 86  MET n 
1 87  LYS n 
1 88  MET n 
1 89  VAL n 
1 90  PRO n 
1 91  TRP n 
1 92  LEU n 
1 93  THR n 
1 94  ILE n 
1 95  PRO n 
1 96  ALA n 
1 97  ARG n 
1 98  GLY n 
1 99  THR n 
1 100 LEU n 
1 101 THR n 
1 102 LEU n 
1 103 GLN n 
1 104 ARG n 
1 105 ASP n 
1 106 GLY n 
1 107 ASP n 
1 108 HIS n 
1 109 VAL n 
1 110 MET n 
1 111 LEU n 
1 112 MET n 
1 113 GLY n 
1 114 LEU n 
1 115 LYS n 
1 116 ARG n 
1 117 PRO n 
1 118 LEU n 
1 119 LYS n 
1 120 VAL n 
1 121 GLY n 
1 122 GLU n 
1 123 THR n 
1 124 VAL n 
1 125 ASN n 
1 126 ILE n 
1 127 THR n 
1 128 LEU n 
1 129 LYS n 
1 130 ALA n 
1 131 THR n 
1 132 ASP n 
1 133 GLY n 
1 134 ARG n 
1 135 THR n 
1 136 LEU n 
1 137 ASN n 
1 138 VAL n 
1 139 ALA n 
1 140 ALA n 
1 141 THR n 
1 142 VAL n 
1 143 LYS n 
1 144 LYS n 
1 145 ASN n 
1 146 ILE n 
1 147 GLU n 
1 148 GLY n 
1 149 ARG n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Deinococcus radiodurans' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      243230 
_entity_src_nat.genus                      Deinococcus 
_entity_src_nat.species                    'Deinococcus radiodurans' 
_entity_src_nat.strain                     R1 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q9RT80_DEIRA 
_struct_ref.pdbx_db_accession          Q9RT80 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHSG
GMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKN
;
_struct_ref.pdbx_align_begin           35 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1X9L 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 145 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9RT80 
_struct_ref_seq.db_align_beg                  35 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  178 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       145 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1X9L MET A 1   ? UNP Q9RT80 ? ? 'INITIATING METHIONINE' 1   1 
1 1X9L ILE A 146 ? UNP Q9RT80 ? ? 'CLONING ARTIFACT'      146 2 
1 1X9L GLU A 147 ? UNP Q9RT80 ? ? 'CLONING ARTIFACT'      147 3 
1 1X9L GLY A 148 ? UNP Q9RT80 ? ? 'CLONING ARTIFACT'      148 4 
1 1X9L ARG A 149 ? UNP Q9RT80 ? ? 'CLONING ARTIFACT'      149 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
CU1 non-polymer         . 'COPPER (I) ION' ? 'Cu 1'           63.546  
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ? 'C5 H11 N O2 S'  149.211 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_15N-separated_NOESY 
2 1 1 3D_13C-separated_NOESY 
3 1 1 '2D NOESY'             
4 1 1 '2D TOCSY'             
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            101.325 
_pdbx_nmr_exptl_sample_conditions.pH                  7 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      atm 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '1mM CuI-DR1885, 100mM phosphate buffer K, 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.field_strength    800 
# 
_pdbx_nmr_refine.entry_id           1X9L 
_pdbx_nmr_refine.method             'simulated annealing, torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1X9L 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1X9L 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'minimized average structure' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XWINNMR 3.5   collection      Bruker         1 
NMRPipe 2.2   processing      'Delaglio, F.' 2 
DYANA   1.5   refinement      'Guentert, P.' 3 
Sparky  3.106 'data analysis' Sparky         4 
# 
_exptl.entry_id          1X9L 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1X9L 
_struct.title                     'Solution structure of CuI-DR1885 from Deinococcus Radiodurans' 
_struct.pdbx_descriptor           CuI-DR1885 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   'minimized average' 
# 
_struct_keywords.entry_id        1X9L 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            
;copper binding protein, deinococcus radiodurans, solution structure, holo-form, Structural Proteomics in Europe, SPINE, Structural Genomics, METAL BINDING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B CU1 . CU ? ? ? 1_555 A HIS 108 NE2 ? ? A CU1 150 A HIS 108 1_555 ? ? ? ? ? ? ? 2.146 ? 
metalc2 metalc ? ? B CU1 . CU ? ? ? 1_555 A MET 86  SD  ? ? A CU1 150 A MET 86  1_555 ? ? ? ? ? ? ? 2.503 ? 
metalc3 metalc ? ? B CU1 . CU ? ? ? 1_555 A MET 110 SD  ? ? A CU1 150 A MET 110 1_555 ? ? ? ? ? ? ? 2.406 ? 
metalc4 metalc ? ? B CU1 . CU ? ? ? 1_555 A MET 75  SD  ? ? A CU1 150 A MET 75  1_555 ? ? ? ? ? ? ? 2.443 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLY 2  A . ? GLY 2  A HIS 3  A ? HIS 3  A 1 -1.49  
2  MET 5  A . ? MET 5  A PRO 6  A ? PRO 6  A 1 6.46   
3  HIS 8  A . ? HIS 8  A THR 9  A ? THR 9  A 1 -12.25 
4  PRO 16 A . ? PRO 16 A ALA 17 A ? ALA 17 A 1 -7.32  
5  ALA 18 A . ? ALA 18 A GLN 19 A ? GLN 19 A 1 -14.49 
6  GLY 2  A . ? GLY 2  A HIS 3  A ? HIS 3  A 9 1.25   
7  HIS 3  A . ? HIS 3  A THR 4  A ? THR 4  A 9 9.97   
8  THR 14 A . ? THR 14 A ALA 15 A ? ALA 15 A 9 13.55  
9  PRO 16 A . ? PRO 16 A ALA 17 A ? ALA 17 A 9 -4.50  
10 GLN 19 A . ? GLN 19 A LYS 20 A ? LYS 20 A 9 9.88   
11 GLY 22 A . ? GLY 22 A ALA 23 A ? ALA 23 A 9 -2.24  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 101 ? LEU A 102 ? THR A 101 LEU A 102 
A 2 ALA A 47  ? THR A 50  ? ALA A 47  THR A 50  
A 3 THR A 34  ? VAL A 35  ? THR A 34  VAL A 35  
A 4 LEU A 136 ? VAL A 142 ? LEU A 136 VAL A 142 
A 5 GLU A 122 ? LEU A 128 ? GLU A 122 LEU A 128 
B 1 PRO A 58  ? LEU A 61  ? PRO A 58  LEU A 61  
B 2 LEU A 92  ? PRO A 95  ? LEU A 92  PRO A 95  
C 1 ALA A 84  ? GLY A 85  ? ALA A 84  GLY A 85  
C 2 ALA A 69  ? THR A 77  ? ALA A 69  THR A 77  
C 3 HIS A 108 ? LEU A 114 ? HIS A 108 LEU A 114 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 102 ? O LEU A 102 N MET A 49  ? N MET A 49  
A 2 3 O TYR A 48  ? O TYR A 48  N THR A 34  ? N THR A 34  
A 3 4 N VAL A 35  ? N VAL A 35  O THR A 141 ? O THR A 141 
A 4 5 O ALA A 140 ? O ALA A 140 N VAL A 124 ? N VAL A 124 
B 1 2 N ILE A 59  ? N ILE A 59  O ILE A 94  ? O ILE A 94  
C 1 2 O GLY A 85  ? O GLY A 85  N THR A 76  ? N THR A 76  
C 2 3 N SER A 71  ? N SER A 71  O MET A 112 ? O MET A 112 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE CU1 A 150' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 MET A 75  ? MET A 75  . ? 1_555 ? 
2 AC1 4 MET A 86  ? MET A 86  . ? 1_555 ? 
3 AC1 4 HIS A 108 ? HIS A 108 . ? 1_555 ? 
4 AC1 4 MET A 110 ? MET A 110 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1X9L 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1X9L 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CU 
H  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . MET A 1 1   ? -50.128 -2.749  16.226  1.00 10.00 ? 1   MET A N    1  
ATOM   2     C  CA   . MET A 1 1   ? -51.285 -2.225  15.470  1.00 10.00 ? 1   MET A CA   1  
ATOM   3     C  C    . MET A 1 1   ? -51.945 -3.268  14.555  1.00 10.00 ? 1   MET A C    1  
ATOM   4     O  O    . MET A 1 1   ? -53.135 -3.136  14.288  1.00 10.00 ? 1   MET A O    1  
ATOM   5     C  CB   . MET A 1 1   ? -50.958 -0.946  14.682  1.00 10.00 ? 1   MET A CB   1  
ATOM   6     C  CG   . MET A 1 1   ? -50.454 0.198   15.571  1.00 10.00 ? 1   MET A CG   1  
ATOM   7     S  SD   . MET A 1 1   ? -48.823 -0.053  16.309  1.00 10.00 ? 1   MET A SD   1  
ATOM   8     C  CE   . MET A 1 1   ? -48.776 1.323   17.476  1.00 10.00 ? 1   MET A CE   1  
ATOM   9     H  H1   . MET A 1 1   ? -49.780 -2.018  16.837  1.00 10.00 ? 1   MET A H1   1  
ATOM   10    H  H2   . MET A 1 1   ? -50.395 -3.554  16.771  1.00 10.00 ? 1   MET A H2   1  
ATOM   11    H  H3   . MET A 1 1   ? -49.332 -2.987  15.636  1.00 10.00 ? 1   MET A H3   1  
ATOM   12    H  HA   . MET A 1 1   ? -52.039 -1.955  16.211  1.00 10.00 ? 1   MET A HA   1  
ATOM   13    H  HB2  . MET A 1 1   ? -50.230 -1.159  13.902  1.00 10.00 ? 1   MET A HB2  1  
ATOM   14    H  HB3  . MET A 1 1   ? -51.875 -0.609  14.195  1.00 10.00 ? 1   MET A HB3  1  
ATOM   15    H  HG2  . MET A 1 1   ? -50.406 1.108   14.973  1.00 10.00 ? 1   MET A HG2  1  
ATOM   16    H  HG3  . MET A 1 1   ? -51.177 0.357   16.371  1.00 10.00 ? 1   MET A HG3  1  
ATOM   17    H  HE1  . MET A 1 1   ? -47.823 1.305   18.004  1.00 10.00 ? 1   MET A HE1  1  
ATOM   18    H  HE2  . MET A 1 1   ? -48.871 2.262   16.931  1.00 10.00 ? 1   MET A HE2  1  
ATOM   19    H  HE3  . MET A 1 1   ? -49.591 1.226   18.191  1.00 10.00 ? 1   MET A HE3  1  
ATOM   20    N  N    . GLY A 1 2   ? -51.214 -4.285  14.076  1.00 10.00 ? 2   GLY A N    1  
ATOM   21    C  CA   . GLY A 1 2   ? -51.763 -5.303  13.186  1.00 10.00 ? 2   GLY A CA   1  
ATOM   22    C  C    . GLY A 1 2   ? -51.380 -5.016  11.734  1.00 10.00 ? 2   GLY A C    1  
ATOM   23    O  O    . GLY A 1 2   ? -52.206 -4.467  11.013  1.00 10.00 ? 2   GLY A O    1  
ATOM   24    H  H    . GLY A 1 2   ? -50.247 -4.427  14.344  1.00 10.00 ? 2   GLY A H    1  
ATOM   25    H  HA2  . GLY A 1 2   ? -51.457 -6.294  13.495  1.00 10.00 ? 2   GLY A HA2  1  
ATOM   26    H  HA3  . GLY A 1 2   ? -52.853 -5.306  13.243  1.00 10.00 ? 2   GLY A HA3  1  
ATOM   27    N  N    . HIS A 1 3   ? -50.176 -5.320  11.224  1.00 10.00 ? 3   HIS A N    1  
ATOM   28    C  CA   . HIS A 1 3   ? -48.944 -5.916  11.761  1.00 10.00 ? 3   HIS A CA   1  
ATOM   29    C  C    . HIS A 1 3   ? -47.907 -4.883  12.207  1.00 10.00 ? 3   HIS A C    1  
ATOM   30    O  O    . HIS A 1 3   ? -46.710 -5.167  12.221  1.00 10.00 ? 3   HIS A O    1  
ATOM   31    C  CB   . HIS A 1 3   ? -49.123 -7.107  12.722  1.00 10.00 ? 3   HIS A CB   1  
ATOM   32    C  CG   . HIS A 1 3   ? -49.070 -6.862  14.218  1.00 10.00 ? 3   HIS A CG   1  
ATOM   33    N  ND1  . HIS A 1 3   ? -48.935 -5.633  14.876  1.00 10.00 ? 3   HIS A ND1  1  
ATOM   34    C  CD2  . HIS A 1 3   ? -49.123 -7.859  15.148  1.00 10.00 ? 3   HIS A CD2  1  
ATOM   35    C  CE1  . HIS A 1 3   ? -48.885 -5.933  16.185  1.00 10.00 ? 3   HIS A CE1  1  
ATOM   36    N  NE2  . HIS A 1 3   ? -49.001 -7.256  16.378  1.00 10.00 ? 3   HIS A NE2  1  
ATOM   37    H  H    . HIS A 1 3   ? -50.110 -5.067  10.249  1.00 10.00 ? 3   HIS A H    1  
ATOM   38    H  HA   . HIS A 1 3   ? -48.498 -6.365  10.873  1.00 10.00 ? 3   HIS A HA   1  
ATOM   39    H  HB2  . HIS A 1 3   ? -50.025 -7.661  12.463  1.00 10.00 ? 3   HIS A HB2  1  
ATOM   40    H  HB3  . HIS A 1 3   ? -48.284 -7.777  12.527  1.00 10.00 ? 3   HIS A HB3  1  
ATOM   41    H  HD2  . HIS A 1 3   ? -49.210 -8.919  14.955  1.00 10.00 ? 3   HIS A HD2  1  
ATOM   42    H  HE1  . HIS A 1 3   ? -48.745 -5.214  16.979  1.00 10.00 ? 3   HIS A HE1  1  
ATOM   43    H  HE2  . HIS A 1 3   ? -48.948 -7.725  17.272  1.00 10.00 ? 3   HIS A HE2  1  
ATOM   44    N  N    . THR A 1 4   ? -48.364 -3.676  12.548  1.00 10.00 ? 4   THR A N    1  
ATOM   45    C  CA   . THR A 1 4   ? -47.556 -2.645  13.180  1.00 10.00 ? 4   THR A CA   1  
ATOM   46    C  C    . THR A 1 4   ? -46.983 -3.157  14.503  1.00 10.00 ? 4   THR A C    1  
ATOM   47    O  O    . THR A 1 4   ? -47.591 -2.909  15.548  1.00 10.00 ? 4   THR A O    1  
ATOM   48    C  CB   . THR A 1 4   ? -46.492 -2.052  12.233  1.00 10.00 ? 4   THR A CB   1  
ATOM   49    O  OG1  . THR A 1 4   ? -45.937 -0.890  12.820  1.00 10.00 ? 4   THR A OG1  1  
ATOM   50    C  CG2  . THR A 1 4   ? -47.121 -1.624  10.902  1.00 10.00 ? 4   THR A CG2  1  
ATOM   51    H  H    . THR A 1 4   ? -49.347 -3.489  12.425  1.00 10.00 ? 4   THR A H    1  
ATOM   52    H  HA   . THR A 1 4   ? -48.223 -1.821  13.422  1.00 10.00 ? 4   THR A HA   1  
ATOM   53    H  HB   . THR A 1 4   ? -45.691 -2.763  12.021  1.00 10.00 ? 4   THR A HB   1  
ATOM   54    H  HG1  . THR A 1 4   ? -45.480 -1.119  13.643  1.00 10.00 ? 4   THR A HG1  1  
ATOM   55    H  HG21 . THR A 1 4   ? -47.940 -0.926  11.085  1.00 10.00 ? 4   THR A HG21 1  
ATOM   56    H  HG22 . THR A 1 4   ? -46.365 -1.129  10.291  1.00 10.00 ? 4   THR A HG22 1  
ATOM   57    H  HG23 . THR A 1 4   ? -47.496 -2.490  10.356  1.00 10.00 ? 4   THR A HG23 1  
ATOM   58    N  N    . MET A 1 5   ? -45.844 -3.850  14.442  1.00 10.00 ? 5   MET A N    1  
ATOM   59    C  CA   . MET A 1 5   ? -44.810 -3.907  15.466  1.00 10.00 ? 5   MET A CA   1  
ATOM   60    C  C    . MET A 1 5   ? -44.213 -2.496  15.696  1.00 10.00 ? 5   MET A C    1  
ATOM   61    O  O    . MET A 1 5   ? -44.881 -1.519  15.347  1.00 10.00 ? 5   MET A O    1  
ATOM   62    C  CB   . MET A 1 5   ? -45.271 -4.663  16.720  1.00 10.00 ? 5   MET A CB   1  
ATOM   63    C  CG   . MET A 1 5   ? -45.492 -6.135  16.336  1.00 10.00 ? 5   MET A CG   1  
ATOM   64    S  SD   . MET A 1 5   ? -45.920 -7.265  17.681  1.00 10.00 ? 5   MET A SD   1  
ATOM   65    C  CE   . MET A 1 5   ? -45.840 -8.825  16.770  1.00 10.00 ? 5   MET A CE   1  
ATOM   66    H  H    . MET A 1 5   ? -45.583 -4.188  13.521  1.00 10.00 ? 5   MET A H    1  
ATOM   67    H  HA   . MET A 1 5   ? -44.082 -4.551  15.006  1.00 10.00 ? 5   MET A HA   1  
ATOM   68    H  HB2  . MET A 1 5   ? -44.488 -4.626  17.476  1.00 10.00 ? 5   MET A HB2  1  
ATOM   69    H  HB3  . MET A 1 5   ? -46.178 -4.233  17.142  1.00 10.00 ? 5   MET A HB3  1  
ATOM   70    H  HG2  . MET A 1 5   ? -46.265 -6.204  15.572  1.00 10.00 ? 5   MET A HG2  1  
ATOM   71    H  HG3  . MET A 1 5   ? -44.570 -6.519  15.907  1.00 10.00 ? 5   MET A HG3  1  
ATOM   72    H  HE1  . MET A 1 5   ? -44.831 -8.968  16.384  1.00 10.00 ? 5   MET A HE1  1  
ATOM   73    H  HE2  . MET A 1 5   ? -46.543 -8.803  15.940  1.00 10.00 ? 5   MET A HE2  1  
ATOM   74    H  HE3  . MET A 1 5   ? -46.089 -9.645  17.442  1.00 10.00 ? 5   MET A HE3  1  
ATOM   75    N  N    . PRO A 1 6   ? -42.992 -2.305  16.243  1.00 10.00 ? 6   PRO A N    1  
ATOM   76    C  CA   . PRO A 1 6   ? -41.952 -3.273  16.603  1.00 10.00 ? 6   PRO A CA   1  
ATOM   77    C  C    . PRO A 1 6   ? -41.581 -4.238  15.476  1.00 10.00 ? 6   PRO A C    1  
ATOM   78    O  O    . PRO A 1 6   ? -42.011 -4.061  14.350  1.00 10.00 ? 6   PRO A O    1  
ATOM   79    C  CB   . PRO A 1 6   ? -40.727 -2.439  16.995  1.00 10.00 ? 6   PRO A CB   1  
ATOM   80    C  CG   . PRO A 1 6   ? -41.337 -1.134  17.497  1.00 10.00 ? 6   PRO A CG   1  
ATOM   81    C  CD   . PRO A 1 6   ? -42.523 -0.960  16.549  1.00 10.00 ? 6   PRO A CD   1  
ATOM   82    H  HA   . PRO A 1 6   ? -42.288 -3.834  17.473  1.00 10.00 ? 6   PRO A HA   1  
ATOM   83    H  HB2  . PRO A 1 6   ? -40.109 -2.925  17.751  1.00 10.00 ? 6   PRO A HB2  1  
ATOM   84    H  HB3  . PRO A 1 6   ? -40.126 -2.221  16.108  1.00 10.00 ? 6   PRO A HB3  1  
ATOM   85    H  HG2  . PRO A 1 6   ? -41.698 -1.266  18.518  1.00 10.00 ? 6   PRO A HG2  1  
ATOM   86    H  HG3  . PRO A 1 6   ? -40.638 -0.296  17.444  1.00 10.00 ? 6   PRO A HG3  1  
ATOM   87    H  HD2  . PRO A 1 6   ? -43.297 -0.354  17.025  1.00 10.00 ? 6   PRO A HD2  1  
ATOM   88    H  HD3  . PRO A 1 6   ? -42.195 -0.479  15.625  1.00 10.00 ? 6   PRO A HD3  1  
ATOM   89    N  N    . ALA A 1 7   ? -40.832 -5.296  15.795  1.00 10.00 ? 7   ALA A N    1  
ATOM   90    C  CA   . ALA A 1 7   ? -40.691 -6.479  14.954  1.00 10.00 ? 7   ALA A CA   1  
ATOM   91    C  C    . ALA A 1 7   ? -40.066 -6.243  13.567  1.00 10.00 ? 7   ALA A C    1  
ATOM   92    O  O    . ALA A 1 7   ? -38.879 -6.513  13.398  1.00 10.00 ? 7   ALA A O    1  
ATOM   93    C  CB   . ALA A 1 7   ? -42.034 -7.218  14.876  1.00 10.00 ? 7   ALA A CB   1  
ATOM   94    H  H    . ALA A 1 7   ? -40.440 -5.340  16.722  1.00 10.00 ? 7   ALA A H    1  
ATOM   95    H  HA   . ALA A 1 7   ? -40.013 -7.145  15.491  1.00 10.00 ? 7   ALA A HA   1  
ATOM   96    H  HB1  . ALA A 1 7   ? -42.415 -7.388  15.885  1.00 10.00 ? 7   ALA A HB1  1  
ATOM   97    H  HB2  . ALA A 1 7   ? -42.764 -6.638  14.308  1.00 10.00 ? 7   ALA A HB2  1  
ATOM   98    H  HB3  . ALA A 1 7   ? -41.887 -8.185  14.395  1.00 10.00 ? 7   ALA A HB3  1  
ATOM   99    N  N    . HIS A 1 8   ? -40.875 -6.041  12.520  1.00 10.00 ? 8   HIS A N    1  
ATOM   100   C  CA   . HIS A 1 8   ? -41.015 -4.861  11.644  1.00 10.00 ? 8   HIS A CA   1  
ATOM   101   C  C    . HIS A 1 8   ? -42.520 -4.579  11.391  1.00 10.00 ? 8   HIS A C    1  
ATOM   102   O  O    . HIS A 1 8   ? -42.996 -3.490  11.704  1.00 10.00 ? 8   HIS A O    1  
ATOM   103   C  CB   . HIS A 1 8   ? -40.257 -3.561  12.053  1.00 10.00 ? 8   HIS A CB   1  
ATOM   104   C  CG   . HIS A 1 8   ? -38.880 -3.687  12.657  1.00 10.00 ? 8   HIS A CG   1  
ATOM   105   N  ND1  . HIS A 1 8   ? -38.551 -3.331  13.968  1.00 10.00 ? 8   HIS A ND1  1  
ATOM   106   C  CD2  . HIS A 1 8   ? -37.784 -4.216  12.040  1.00 10.00 ? 8   HIS A CD2  1  
ATOM   107   C  CE1  . HIS A 1 8   ? -37.265 -3.677  14.116  1.00 10.00 ? 8   HIS A CE1  1  
ATOM   108   N  NE2  . HIS A 1 8   ? -36.778 -4.211  12.981  1.00 10.00 ? 8   HIS A NE2  1  
ATOM   109   H  H    . HIS A 1 8   ? -40.875 -6.869  11.942  1.00 10.00 ? 8   HIS A H    1  
ATOM   110   H  HA   . HIS A 1 8   ? -40.538 -5.108  10.704  1.00 10.00 ? 8   HIS A HA   1  
ATOM   111   H  HB2  . HIS A 1 8   ? -40.139 -2.969  11.142  1.00 10.00 ? 8   HIS A HB2  1  
ATOM   112   H  HB3  . HIS A 1 8   ? -40.834 -2.929  12.724  1.00 10.00 ? 8   HIS A HB3  1  
ATOM   113   H  HD2  . HIS A 1 8   ? -37.751 -4.636  11.047  1.00 10.00 ? 8   HIS A HD2  1  
ATOM   114   H  HE1  . HIS A 1 8   ? -36.703 -3.555  15.030  1.00 10.00 ? 8   HIS A HE1  1  
ATOM   115   H  HE2  . HIS A 1 8   ? -35.848 -4.584  12.858  1.00 10.00 ? 8   HIS A HE2  1  
ATOM   116   N  N    . THR A 1 9   ? -43.366 -5.469  10.836  1.00 10.00 ? 9   THR A N    1  
ATOM   117   C  CA   . THR A 1 9   ? -43.205 -6.745  10.129  1.00 10.00 ? 9   THR A CA   1  
ATOM   118   C  C    . THR A 1 9   ? -41.774 -7.038  9.675   1.00 10.00 ? 9   THR A C    1  
ATOM   119   O  O    . THR A 1 9   ? -41.098 -7.809  10.355  1.00 10.00 ? 9   THR A O    1  
ATOM   120   C  CB   . THR A 1 9   ? -43.832 -7.893  10.948  1.00 10.00 ? 9   THR A CB   1  
ATOM   121   O  OG1  . THR A 1 9   ? -43.077 -8.170  12.105  1.00 10.00 ? 9   THR A OG1  1  
ATOM   122   C  CG2  . THR A 1 9   ? -43.961 -9.185  10.129  1.00 10.00 ? 9   THR A CG2  1  
ATOM   123   H  H    . THR A 1 9   ? -44.323 -5.148  10.872  1.00 10.00 ? 9   THR A H    1  
ATOM   124   H  HA   . THR A 1 9   ? -43.834 -6.676  9.244   1.00 10.00 ? 9   THR A HA   1  
ATOM   125   H  HB   . THR A 1 9   ? -44.834 -7.597  11.260  1.00 10.00 ? 9   THR A HB   1  
ATOM   126   H  HG1  . THR A 1 9   ? -42.191 -8.412  11.814  1.00 10.00 ? 9   THR A HG1  1  
ATOM   127   H  HG21 . THR A 1 9   ? -44.570 -9.008  9.242   1.00 10.00 ? 9   THR A HG21 1  
ATOM   128   H  HG22 . THR A 1 9   ? -44.442 -9.951  10.737  1.00 10.00 ? 9   THR A HG22 1  
ATOM   129   H  HG23 . THR A 1 9   ? -42.982 -9.556  9.820   1.00 10.00 ? 9   THR A HG23 1  
ATOM   130   N  N    . PRO A 1 10  ? -41.273 -6.403  8.600   1.00 10.00 ? 10  PRO A N    1  
ATOM   131   C  CA   . PRO A 1 10  ? -39.873 -6.505  8.206   1.00 10.00 ? 10  PRO A CA   1  
ATOM   132   C  C    . PRO A 1 10  ? -39.533 -7.965  7.875   1.00 10.00 ? 10  PRO A C    1  
ATOM   133   O  O    . PRO A 1 10  ? -40.021 -8.438  6.854   1.00 10.00 ? 10  PRO A O    1  
ATOM   134   C  CB   . PRO A 1 10  ? -39.711 -5.575  6.997   1.00 10.00 ? 10  PRO A CB   1  
ATOM   135   C  CG   . PRO A 1 10  ? -41.129 -5.414  6.451   1.00 10.00 ? 10  PRO A CG   1  
ATOM   136   C  CD   . PRO A 1 10  ? -41.999 -5.518  7.702   1.00 10.00 ? 10  PRO A CD   1  
ATOM   137   H  HA   . PRO A 1 10  ? -39.237 -6.109  8.994   1.00 10.00 ? 10  PRO A HA   1  
ATOM   138   H  HB2  . PRO A 1 10  ? -39.351 -4.602  7.334   1.00 10.00 ? 10  PRO A HB2  1  
ATOM   139   H  HB3  . PRO A 1 10  ? -39.030 -5.976  6.244   1.00 10.00 ? 10  PRO A HB3  1  
ATOM   140   H  HG2  . PRO A 1 10  ? -41.269 -4.469  5.924   1.00 10.00 ? 10  PRO A HG2  1  
ATOM   141   H  HG3  . PRO A 1 10  ? -41.354 -6.251  5.786   1.00 10.00 ? 10  PRO A HG3  1  
ATOM   142   H  HD2  . PRO A 1 10  ? -42.102 -4.536  8.167   1.00 10.00 ? 10  PRO A HD2  1  
ATOM   143   H  HD3  . PRO A 1 10  ? -42.977 -5.902  7.415   1.00 10.00 ? 10  PRO A HD3  1  
ATOM   144   N  N    . PRO A 1 11  ? -38.737 -8.660  8.716   1.00 10.00 ? 11  PRO A N    1  
ATOM   145   C  CA   . PRO A 1 11  ? -38.302 -10.050 8.610   1.00 10.00 ? 11  PRO A CA   1  
ATOM   146   C  C    . PRO A 1 11  ? -39.109 -11.072 7.794   1.00 10.00 ? 11  PRO A C    1  
ATOM   147   O  O    . PRO A 1 11  ? -39.498 -12.116 8.310   1.00 10.00 ? 11  PRO A O    1  
ATOM   148   C  CB   . PRO A 1 11  ? -38.058 -10.488 10.050  1.00 10.00 ? 11  PRO A CB   1  
ATOM   149   C  CG   . PRO A 1 11  ? -37.360 -9.249  10.605  1.00 10.00 ? 11  PRO A CG   1  
ATOM   150   C  CD   . PRO A 1 11  ? -38.063 -8.095  9.883   1.00 10.00 ? 11  PRO A CD   1  
ATOM   151   H  HA   . PRO A 1 11  ? -37.321 -10.013 8.147   1.00 10.00 ? 11  PRO A HA   1  
ATOM   152   H  HB2  . PRO A 1 11  ? -39.013 -10.641 10.557  1.00 10.00 ? 11  PRO A HB2  1  
ATOM   153   H  HB3  . PRO A 1 11  ? -37.439 -11.383 10.118  1.00 10.00 ? 11  PRO A HB3  1  
ATOM   154   H  HG2  . PRO A 1 11  ? -37.458 -9.174  11.689  1.00 10.00 ? 11  PRO A HG2  1  
ATOM   155   H  HG3  . PRO A 1 11  ? -36.304 -9.267  10.325  1.00 10.00 ? 11  PRO A HG3  1  
ATOM   156   H  HD2  . PRO A 1 11  ? -38.748 -7.622  10.583  1.00 10.00 ? 11  PRO A HD2  1  
ATOM   157   H  HD3  . PRO A 1 11  ? -37.320 -7.372  9.555   1.00 10.00 ? 11  PRO A HD3  1  
ATOM   158   N  N    . ALA A 1 12  ? -39.150 -10.867 6.478   1.00 10.00 ? 12  ALA A N    1  
ATOM   159   C  CA   . ALA A 1 12  ? -38.917 -11.899 5.480   1.00 10.00 ? 12  ALA A CA   1  
ATOM   160   C  C    . ALA A 1 12  ? -37.501 -11.620 4.971   1.00 10.00 ? 12  ALA A C    1  
ATOM   161   O  O    . ALA A 1 12  ? -37.273 -11.376 3.789   1.00 10.00 ? 12  ALA A O    1  
ATOM   162   C  CB   . ALA A 1 12  ? -39.969 -11.796 4.372   1.00 10.00 ? 12  ALA A CB   1  
ATOM   163   H  H    . ALA A 1 12  ? -38.920 -9.916  6.190   1.00 10.00 ? 12  ALA A H    1  
ATOM   164   H  HA   . ALA A 1 12  ? -38.956 -12.897 5.920   1.00 10.00 ? 12  ALA A HA   1  
ATOM   165   H  HB1  . ALA A 1 12  ? -39.941 -10.804 3.918   1.00 10.00 ? 12  ALA A HB1  1  
ATOM   166   H  HB2  . ALA A 1 12  ? -39.771 -12.546 3.606   1.00 10.00 ? 12  ALA A HB2  1  
ATOM   167   H  HB3  . ALA A 1 12  ? -40.961 -11.969 4.791   1.00 10.00 ? 12  ALA A HB3  1  
ATOM   168   N  N    . GLN A 1 13  ? -36.568 -11.513 5.923   1.00 10.00 ? 13  GLN A N    1  
ATOM   169   C  CA   . GLN A 1 13  ? -35.444 -10.601 5.783   1.00 10.00 ? 13  GLN A CA   1  
ATOM   170   C  C    . GLN A 1 13  ? -35.973 -9.163  5.627   1.00 10.00 ? 13  GLN A C    1  
ATOM   171   O  O    . GLN A 1 13  ? -37.129 -8.874  5.931   1.00 10.00 ? 13  GLN A O    1  
ATOM   172   C  CB   . GLN A 1 13  ? -34.546 -10.683 7.022   1.00 10.00 ? 13  GLN A CB   1  
ATOM   173   C  CG   . GLN A 1 13  ? -34.050 -12.087 7.375   1.00 10.00 ? 13  GLN A CG   1  
ATOM   174   C  CD   . GLN A 1 13  ? -33.217 -12.037 8.654   1.00 10.00 ? 13  GLN A CD   1  
ATOM   175   O  OE1  . GLN A 1 13  ? -31.993 -11.971 8.605   1.00 10.00 ? 13  GLN A OE1  1  
ATOM   176   N  NE2  . GLN A 1 13  ? -33.872 -12.054 9.812   1.00 10.00 ? 13  GLN A NE2  1  
ATOM   177   H  H    . GLN A 1 13  ? -36.843 -11.760 6.859   1.00 10.00 ? 13  GLN A H    1  
ATOM   178   H  HA   . GLN A 1 13  ? -34.868 -10.880 4.899   1.00 10.00 ? 13  GLN A HA   1  
ATOM   179   H  HB2  . GLN A 1 13  ? -33.670 -10.060 6.845   1.00 10.00 ? 13  GLN A HB2  1  
ATOM   180   H  HB3  . GLN A 1 13  ? -35.091 -10.287 7.878   1.00 10.00 ? 13  GLN A HB3  1  
ATOM   181   H  HG2  . GLN A 1 13  ? -34.887 -12.769 7.526   1.00 10.00 ? 13  GLN A HG2  1  
ATOM   182   H  HG3  . GLN A 1 13  ? -33.432 -12.468 6.561   1.00 10.00 ? 13  GLN A HG3  1  
ATOM   183   H  HE21 . GLN A 1 13  ? -34.879 -12.082 9.835   1.00 10.00 ? 13  GLN A HE21 1  
ATOM   184   H  HE22 . GLN A 1 13  ? -33.338 -12.009 10.666  1.00 10.00 ? 13  GLN A HE22 1  
ATOM   185   N  N    . THR A 1 14  ? -35.119 -8.249  5.166   1.00 10.00 ? 14  THR A N    1  
ATOM   186   C  CA   . THR A 1 14  ? -35.495 -6.884  4.805   1.00 10.00 ? 14  THR A CA   1  
ATOM   187   C  C    . THR A 1 14  ? -35.835 -5.972  5.999   1.00 10.00 ? 14  THR A C    1  
ATOM   188   O  O    . THR A 1 14  ? -36.491 -4.948  5.815   1.00 10.00 ? 14  THR A O    1  
ATOM   189   C  CB   . THR A 1 14  ? -36.579 -6.866  3.708   1.00 10.00 ? 14  THR A CB   1  
ATOM   190   O  OG1  . THR A 1 14  ? -36.712 -5.553  3.204   1.00 10.00 ? 14  THR A OG1  1  
ATOM   191   C  CG2  . THR A 1 14  ? -36.202 -7.769  2.528   1.00 10.00 ? 14  THR A CG2  1  
ATOM   192   H  H    . THR A 1 14  ? -34.186 -8.551  4.930   1.00 10.00 ? 14  THR A H    1  
ATOM   193   H  HA   . THR A 1 14  ? -34.602 -6.450  4.354   1.00 10.00 ? 14  THR A HA   1  
ATOM   194   H  HB   . THR A 1 14  ? -37.543 -7.179  4.114   1.00 10.00 ? 14  THR A HB   1  
ATOM   195   H  HG1  . THR A 1 14  ? -36.875 -4.965  3.955   1.00 10.00 ? 14  THR A HG1  1  
ATOM   196   H  HG21 . THR A 1 14  ? -35.210 -7.504  2.159   1.00 10.00 ? 14  THR A HG21 1  
ATOM   197   H  HG22 . THR A 1 14  ? -36.212 -8.819  2.821   1.00 10.00 ? 14  THR A HG22 1  
ATOM   198   H  HG23 . THR A 1 14  ? -36.925 -7.630  1.724   1.00 10.00 ? 14  THR A HG23 1  
ATOM   199   N  N    . ALA A 1 15  ? -35.282 -6.249  7.183   1.00 10.00 ? 15  ALA A N    1  
ATOM   200   C  CA   . ALA A 1 15  ? -34.818 -5.192  8.085   1.00 10.00 ? 15  ALA A CA   1  
ATOM   201   C  C    . ALA A 1 15  ? -33.441 -5.614  8.605   1.00 10.00 ? 15  ALA A C    1  
ATOM   202   O  O    . ALA A 1 15  ? -33.227 -5.740  9.811   1.00 10.00 ? 15  ALA A O    1  
ATOM   203   C  CB   . ALA A 1 15  ? -35.815 -4.969  9.223   1.00 10.00 ? 15  ALA A CB   1  
ATOM   204   H  H    . ALA A 1 15  ? -34.876 -7.164  7.317   1.00 10.00 ? 15  ALA A H    1  
ATOM   205   H  HA   . ALA A 1 15  ? -34.709 -4.249  7.546   1.00 10.00 ? 15  ALA A HA   1  
ATOM   206   H  HB1  . ALA A 1 15  ? -35.518 -4.088  9.793   1.00 10.00 ? 15  ALA A HB1  1  
ATOM   207   H  HB2  . ALA A 1 15  ? -35.819 -5.827  9.894   1.00 10.00 ? 15  ALA A HB2  1  
ATOM   208   H  HB3  . ALA A 1 15  ? -36.813 -4.810  8.815   1.00 10.00 ? 15  ALA A HB3  1  
ATOM   209   N  N    . PRO A 1 16  ? -32.532 -5.980  7.688   1.00 10.00 ? 16  PRO A N    1  
ATOM   210   C  CA   . PRO A 1 16  ? -32.202 -7.378  7.526   1.00 10.00 ? 16  PRO A CA   1  
ATOM   211   C  C    . PRO A 1 16  ? -32.357 -8.240  8.792   1.00 10.00 ? 16  PRO A C    1  
ATOM   212   O  O    . PRO A 1 16  ? -33.481 -8.684  9.005   1.00 10.00 ? 16  PRO A O    1  
ATOM   213   C  CB   . PRO A 1 16  ? -30.993 -7.420  6.604   1.00 10.00 ? 16  PRO A CB   1  
ATOM   214   C  CG   . PRO A 1 16  ? -31.383 -6.305  5.615   1.00 10.00 ? 16  PRO A CG   1  
ATOM   215   C  CD   . PRO A 1 16  ? -32.275 -5.333  6.408   1.00 10.00 ? 16  PRO A CD   1  
ATOM   216   H  HA   . PRO A 1 16  ? -32.989 -7.766  6.881   1.00 10.00 ? 16  PRO A HA   1  
ATOM   217   H  HB2  . PRO A 1 16  ? -30.090 -7.137  7.125   1.00 10.00 ? 16  PRO A HB2  1  
ATOM   218   H  HB3  . PRO A 1 16  ? -30.875 -8.384  6.107   1.00 10.00 ? 16  PRO A HB3  1  
ATOM   219   H  HG2  . PRO A 1 16  ? -30.509 -5.800  5.204   1.00 10.00 ? 16  PRO A HG2  1  
ATOM   220   H  HG3  . PRO A 1 16  ? -31.965 -6.733  4.797   1.00 10.00 ? 16  PRO A HG3  1  
ATOM   221   H  HD2  . PRO A 1 16  ? -31.760 -4.386  6.554   1.00 10.00 ? 16  PRO A HD2  1  
ATOM   222   H  HD3  . PRO A 1 16  ? -33.190 -5.135  5.852   1.00 10.00 ? 16  PRO A HD3  1  
ATOM   223   N  N    . ALA A 1 17  ? -31.401 -8.493  9.693   1.00 10.00 ? 17  ALA A N    1  
ATOM   224   C  CA   . ALA A 1 17  ? -29.973 -8.218  9.761   1.00 10.00 ? 17  ALA A CA   1  
ATOM   225   C  C    . ALA A 1 17  ? -29.550 -6.753  9.613   1.00 10.00 ? 17  ALA A C    1  
ATOM   226   O  O    . ALA A 1 17  ? -28.462 -6.499  9.098   1.00 10.00 ? 17  ALA A O    1  
ATOM   227   C  CB   . ALA A 1 17  ? -29.181 -9.210  8.894   1.00 10.00 ? 17  ALA A CB   1  
ATOM   228   H  H    . ALA A 1 17  ? -31.746 -9.051  10.460  1.00 10.00 ? 17  ALA A H    1  
ATOM   229   H  HA   . ALA A 1 17  ? -29.697 -8.466  10.786  1.00 10.00 ? 17  ALA A HA   1  
ATOM   230   H  HB1  . ALA A 1 17  ? -29.373 -9.075  7.834   1.00 10.00 ? 17  ALA A HB1  1  
ATOM   231   H  HB2  . ALA A 1 17  ? -28.112 -9.086  9.073   1.00 10.00 ? 17  ALA A HB2  1  
ATOM   232   H  HB3  . ALA A 1 17  ? -29.460 -10.228 9.165   1.00 10.00 ? 17  ALA A HB3  1  
ATOM   233   N  N    . ALA A 1 18  ? -30.344 -5.793  10.107  1.00 10.00 ? 18  ALA A N    1  
ATOM   234   C  CA   . ALA A 1 18  ? -29.924 -4.395  10.196  1.00 10.00 ? 18  ALA A CA   1  
ATOM   235   C  C    . ALA A 1 18  ? -30.172 -3.802  11.587  1.00 10.00 ? 18  ALA A C    1  
ATOM   236   O  O    . ALA A 1 18  ? -31.320 -3.506  11.898  1.00 10.00 ? 18  ALA A O    1  
ATOM   237   C  CB   . ALA A 1 18  ? -30.636 -3.557  9.137   1.00 10.00 ? 18  ALA A CB   1  
ATOM   238   H  H    . ALA A 1 18  ? -31.280 -6.022  10.433  1.00 10.00 ? 18  ALA A H    1  
ATOM   239   H  HA   . ALA A 1 18  ? -28.881 -4.320  9.944   1.00 10.00 ? 18  ALA A HA   1  
ATOM   240   H  HB1  . ALA A 1 18  ? -30.298 -2.523  9.204   1.00 10.00 ? 18  ALA A HB1  1  
ATOM   241   H  HB2  . ALA A 1 18  ? -31.715 -3.580  9.279   1.00 10.00 ? 18  ALA A HB2  1  
ATOM   242   H  HB3  . ALA A 1 18  ? -30.378 -3.947  8.157   1.00 10.00 ? 18  ALA A HB3  1  
ATOM   243   N  N    . GLN A 1 19  ? -29.174 -3.559  12.452  1.00 10.00 ? 19  GLN A N    1  
ATOM   244   C  CA   . GLN A 1 19  ? -27.771 -3.981  12.506  1.00 10.00 ? 19  GLN A CA   1  
ATOM   245   C  C    . GLN A 1 19  ? -26.756 -3.023  11.861  1.00 10.00 ? 19  GLN A C    1  
ATOM   246   O  O    . GLN A 1 19  ? -25.838 -2.575  12.542  1.00 10.00 ? 19  GLN A O    1  
ATOM   247   C  CB   . GLN A 1 19  ? -27.549 -5.428  12.044  1.00 10.00 ? 19  GLN A CB   1  
ATOM   248   C  CG   . GLN A 1 19  ? -26.276 -6.042  12.637  1.00 10.00 ? 19  GLN A CG   1  
ATOM   249   C  CD   . GLN A 1 19  ? -25.772 -7.174  11.748  1.00 10.00 ? 19  GLN A CD   1  
ATOM   250   O  OE1  . GLN A 1 19  ? -24.848 -6.979  10.957  1.00 10.00 ? 19  GLN A OE1  1  
ATOM   251   N  NE2  . GLN A 1 19  ? -26.377 -8.352  11.848  1.00 10.00 ? 19  GLN A NE2  1  
ATOM   252   H  H    . GLN A 1 19  ? -29.491 -3.083  13.284  1.00 10.00 ? 19  GLN A H    1  
ATOM   253   H  HA   . GLN A 1 19  ? -27.545 -3.980  13.574  1.00 10.00 ? 19  GLN A HA   1  
ATOM   254   H  HB2  . GLN A 1 19  ? -28.400 -6.059  12.305  1.00 10.00 ? 19  GLN A HB2  1  
ATOM   255   H  HB3  . GLN A 1 19  ? -27.404 -5.429  10.970  1.00 10.00 ? 19  GLN A HB3  1  
ATOM   256   H  HG2  . GLN A 1 19  ? -25.488 -5.292  12.692  1.00 10.00 ? 19  GLN A HG2  1  
ATOM   257   H  HG3  . GLN A 1 19  ? -26.471 -6.407  13.646  1.00 10.00 ? 19  GLN A HG3  1  
ATOM   258   H  HE21 . GLN A 1 19  ? -27.131 -8.484  12.505  1.00 10.00 ? 19  GLN A HE21 1  
ATOM   259   H  HE22 . GLN A 1 19  ? -26.073 -9.114  11.261  1.00 10.00 ? 19  GLN A HE22 1  
ATOM   260   N  N    . LYS A 1 20  ? -26.834 -2.819  10.541  1.00 10.00 ? 20  LYS A N    1  
ATOM   261   C  CA   . LYS A 1 20  ? -25.710 -2.473  9.673   1.00 10.00 ? 20  LYS A CA   1  
ATOM   262   C  C    . LYS A 1 20  ? -26.116 -2.690  8.211   1.00 10.00 ? 20  LYS A C    1  
ATOM   263   O  O    . LYS A 1 20  ? -25.810 -1.860  7.356   1.00 10.00 ? 20  LYS A O    1  
ATOM   264   C  CB   . LYS A 1 20  ? -24.464 -3.310  10.038  1.00 10.00 ? 20  LYS A CB   1  
ATOM   265   C  CG   . LYS A 1 20  ? -23.415 -3.382  8.919   1.00 10.00 ? 20  LYS A CG   1  
ATOM   266   C  CD   . LYS A 1 20  ? -22.023 -3.774  9.440   1.00 10.00 ? 20  LYS A CD   1  
ATOM   267   C  CE   . LYS A 1 20  ? -21.972 -4.978  10.397  1.00 10.00 ? 20  LYS A CE   1  
ATOM   268   N  NZ   . LYS A 1 20  ? -22.599 -6.200  9.853   1.00 10.00 ? 20  LYS A NZ   1  
ATOM   269   H  H    . LYS A 1 20  ? -27.703 -3.000  10.074  1.00 10.00 ? 20  LYS A H    1  
ATOM   270   H  HA   . LYS A 1 20  ? -25.474 -1.416  9.807   1.00 10.00 ? 20  LYS A HA   1  
ATOM   271   H  HB2  . LYS A 1 20  ? -23.995 -2.857  10.912  1.00 10.00 ? 20  LYS A HB2  1  
ATOM   272   H  HB3  . LYS A 1 20  ? -24.772 -4.325  10.285  1.00 10.00 ? 20  LYS A HB3  1  
ATOM   273   H  HG2  . LYS A 1 20  ? -23.741 -4.085  8.151   1.00 10.00 ? 20  LYS A HG2  1  
ATOM   274   H  HG3  . LYS A 1 20  ? -23.322 -2.396  8.455   1.00 10.00 ? 20  LYS A HG3  1  
ATOM   275   H  HD2  . LYS A 1 20  ? -21.372 -3.954  8.582   1.00 10.00 ? 20  LYS A HD2  1  
ATOM   276   H  HD3  . LYS A 1 20  ? -21.614 -2.914  9.977   1.00 10.00 ? 20  LYS A HD3  1  
ATOM   277   H  HE2  . LYS A 1 20  ? -20.920 -5.190  10.602  1.00 10.00 ? 20  LYS A HE2  1  
ATOM   278   H  HE3  . LYS A 1 20  ? -22.450 -4.725  11.346  1.00 10.00 ? 20  LYS A HE3  1  
ATOM   279   H  HZ1  . LYS A 1 20  ? -22.382 -6.329  8.876   1.00 10.00 ? 20  LYS A HZ1  1  
ATOM   280   H  HZ2  . LYS A 1 20  ? -22.278 -7.004  10.374  1.00 10.00 ? 20  LYS A HZ2  1  
ATOM   281   H  HZ3  . LYS A 1 20  ? -23.609 -6.183  9.990   1.00 10.00 ? 20  LYS A HZ3  1  
ATOM   282   N  N    . ALA A 1 21  ? -26.774 -3.814  7.893   1.00 10.00 ? 21  ALA A N    1  
ATOM   283   C  CA   . ALA A 1 21  ? -27.256 -4.028  6.532   1.00 10.00 ? 21  ALA A CA   1  
ATOM   284   C  C    . ALA A 1 21  ? -28.260 -2.934  6.155   1.00 10.00 ? 21  ALA A C    1  
ATOM   285   O  O    . ALA A 1 21  ? -28.796 -2.247  7.020   1.00 10.00 ? 21  ALA A O    1  
ATOM   286   C  CB   . ALA A 1 21  ? -27.860 -5.416  6.370   1.00 10.00 ? 21  ALA A CB   1  
ATOM   287   H  H    . ALA A 1 21  ? -27.012 -4.496  8.600   1.00 10.00 ? 21  ALA A H    1  
ATOM   288   H  HA   . ALA A 1 21  ? -26.395 -3.966  5.863   1.00 10.00 ? 21  ALA A HA   1  
ATOM   289   H  HB1  . ALA A 1 21  ? -27.183 -6.175  6.764   1.00 10.00 ? 21  ALA A HB1  1  
ATOM   290   H  HB2  . ALA A 1 21  ? -28.045 -5.617  5.315   1.00 10.00 ? 21  ALA A HB2  1  
ATOM   291   H  HB3  . ALA A 1 21  ? -28.802 -5.429  6.907   1.00 10.00 ? 21  ALA A HB3  1  
ATOM   292   N  N    . GLY A 1 22  ? -28.408 -2.698  4.851   1.00 10.00 ? 22  GLY A N    1  
ATOM   293   C  CA   . GLY A 1 22  ? -28.657 -1.349  4.359   1.00 10.00 ? 22  GLY A CA   1  
ATOM   294   C  C    . GLY A 1 22  ? -27.310 -0.684  4.056   1.00 10.00 ? 22  GLY A C    1  
ATOM   295   O  O    . GLY A 1 22  ? -27.237 0.236   3.244   1.00 10.00 ? 22  GLY A O    1  
ATOM   296   H  H    . GLY A 1 22  ? -27.978 -3.335  4.198   1.00 10.00 ? 22  GLY A H    1  
ATOM   297   H  HA2  . GLY A 1 22  ? -29.240 -1.410  3.439   1.00 10.00 ? 22  GLY A HA2  1  
ATOM   298   H  HA3  . GLY A 1 22  ? -29.208 -0.744  5.080   1.00 10.00 ? 22  GLY A HA3  1  
ATOM   299   N  N    . ALA A 1 23  ? -26.233 -1.169  4.688   1.00 10.00 ? 23  ALA A N    1  
ATOM   300   C  CA   . ALA A 1 23  ? -24.839 -0.874  4.410   1.00 10.00 ? 23  ALA A CA   1  
ATOM   301   C  C    . ALA A 1 23  ? -24.444 0.447   5.046   1.00 10.00 ? 23  ALA A C    1  
ATOM   302   O  O    . ALA A 1 23  ? -23.466 0.500   5.791   1.00 10.00 ? 23  ALA A O    1  
ATOM   303   C  CB   . ALA A 1 23  ? -24.507 -0.930  2.913   1.00 10.00 ? 23  ALA A CB   1  
ATOM   304   H  H    . ALA A 1 23  ? -26.372 -1.720  5.525   1.00 10.00 ? 23  ALA A H    1  
ATOM   305   H  HA   . ALA A 1 23  ? -24.255 -1.659  4.895   1.00 10.00 ? 23  ALA A HA   1  
ATOM   306   H  HB1  . ALA A 1 23  ? -24.943 -0.090  2.374   1.00 10.00 ? 23  ALA A HB1  1  
ATOM   307   H  HB2  . ALA A 1 23  ? -23.424 -0.887  2.788   1.00 10.00 ? 23  ALA A HB2  1  
ATOM   308   H  HB3  . ALA A 1 23  ? -24.873 -1.864  2.485   1.00 10.00 ? 23  ALA A HB3  1  
ATOM   309   N  N    . GLN A 1 24  ? -25.184 1.515   4.731   1.00 10.00 ? 24  GLN A N    1  
ATOM   310   C  CA   . GLN A 1 24  ? -24.814 2.902   4.998   1.00 10.00 ? 24  GLN A CA   1  
ATOM   311   C  C    . GLN A 1 24  ? -23.741 3.290   3.994   1.00 10.00 ? 24  GLN A C    1  
ATOM   312   O  O    . GLN A 1 24  ? -23.946 4.102   3.099   1.00 10.00 ? 24  GLN A O    1  
ATOM   313   C  CB   . GLN A 1 24  ? -24.428 3.159   6.474   1.00 10.00 ? 24  GLN A CB   1  
ATOM   314   C  CG   . GLN A 1 24  ? -25.425 2.563   7.489   1.00 10.00 ? 24  GLN A CG   1  
ATOM   315   C  CD   . GLN A 1 24  ? -24.726 2.004   8.727   1.00 10.00 ? 24  GLN A CD   1  
ATOM   316   O  OE1  . GLN A 1 24  ? -24.969 2.448   9.844   1.00 10.00 ? 24  GLN A OE1  1  
ATOM   317   N  NE2  . GLN A 1 24  ? -23.855 1.014   8.545   1.00 10.00 ? 24  GLN A NE2  1  
ATOM   318   H  H    . GLN A 1 24  ? -25.963 1.357   4.098   1.00 10.00 ? 24  GLN A H    1  
ATOM   319   H  HA   . GLN A 1 24  ? -25.640 3.532   4.755   1.00 10.00 ? 24  GLN A HA   1  
ATOM   320   H  HB2  . GLN A 1 24  ? -23.428 2.784   6.684   1.00 10.00 ? 24  GLN A HB2  1  
ATOM   321   H  HB3  . GLN A 1 24  ? -24.383 4.237   6.633   1.00 10.00 ? 24  GLN A HB3  1  
ATOM   322   H  HG2  . GLN A 1 24  ? -26.126 3.340   7.794   1.00 10.00 ? 24  GLN A HG2  1  
ATOM   323   H  HG3  . GLN A 1 24  ? -26.005 1.747   7.063   1.00 10.00 ? 24  GLN A HG3  1  
ATOM   324   H  HE21 . GLN A 1 24  ? -23.648 0.695   7.601   1.00 10.00 ? 24  GLN A HE21 1  
ATOM   325   H  HE22 . GLN A 1 24  ? -23.368 0.643   9.344   1.00 10.00 ? 24  GLN A HE22 1  
ATOM   326   N  N    . ALA A 1 25  ? -22.630 2.598   4.166   1.00 10.00 ? 25  ALA A N    1  
ATOM   327   C  CA   . ALA A 1 25  ? -21.420 2.510   3.385   1.00 10.00 ? 25  ALA A CA   1  
ATOM   328   C  C    . ALA A 1 25  ? -20.378 1.911   4.321   1.00 10.00 ? 25  ALA A C    1  
ATOM   329   O  O    . ALA A 1 25  ? -20.309 2.312   5.483   1.00 10.00 ? 25  ALA A O    1  
ATOM   330   C  CB   . ALA A 1 25  ? -20.981 3.894   2.933   1.00 10.00 ? 25  ALA A CB   1  
ATOM   331   H  H    . ALA A 1 25  ? -22.681 2.038   4.999   1.00 10.00 ? 25  ALA A H    1  
ATOM   332   H  HA   . ALA A 1 25  ? -21.579 1.862   2.521   1.00 10.00 ? 25  ALA A HA   1  
ATOM   333   H  HB1  . ALA A 1 25  ? -21.023 4.558   3.796   1.00 10.00 ? 25  ALA A HB1  1  
ATOM   334   H  HB2  . ALA A 1 25  ? -21.651 4.257   2.156   1.00 10.00 ? 25  ALA A HB2  1  
ATOM   335   H  HB3  . ALA A 1 25  ? -19.965 3.831   2.545   1.00 10.00 ? 25  ALA A HB3  1  
ATOM   336   N  N    . LEU A 1 26  ? -19.577 0.962   3.840   1.00 10.00 ? 26  LEU A N    1  
ATOM   337   C  CA   . LEU A 1 26  ? -18.403 0.506   4.572   1.00 10.00 ? 26  LEU A CA   1  
ATOM   338   C  C    . LEU A 1 26  ? -17.210 1.188   3.905   1.00 10.00 ? 26  LEU A C    1  
ATOM   339   O  O    . LEU A 1 26  ? -17.054 1.040   2.690   1.00 10.00 ? 26  LEU A O    1  
ATOM   340   C  CB   . LEU A 1 26  ? -18.328 -1.030  4.576   1.00 10.00 ? 26  LEU A CB   1  
ATOM   341   C  CG   . LEU A 1 26  ? -16.999 -1.571  5.144   1.00 10.00 ? 26  LEU A CG   1  
ATOM   342   C  CD1  . LEU A 1 26  ? -17.232 -2.835  5.978   1.00 10.00 ? 26  LEU A CD1  1  
ATOM   343   C  CD2  . LEU A 1 26  ? -15.980 -1.899  4.044   1.00 10.00 ? 26  LEU A CD2  1  
ATOM   344   H  H    . LEU A 1 26  ? -19.630 0.754   2.845   1.00 10.00 ? 26  LEU A H    1  
ATOM   345   H  HA   . LEU A 1 26  ? -18.483 0.798   5.617   1.00 10.00 ? 26  LEU A HA   1  
ATOM   346   H  HB2  . LEU A 1 26  ? -19.152 -1.386  5.196   1.00 10.00 ? 26  LEU A HB2  1  
ATOM   347   H  HB3  . LEU A 1 26  ? -18.489 -1.406  3.572   1.00 10.00 ? 26  LEU A HB3  1  
ATOM   348   H  HG   . LEU A 1 26  ? -16.564 -0.826  5.808   1.00 10.00 ? 26  LEU A HG   1  
ATOM   349   H  HD11 . LEU A 1 26  ? -16.276 -3.204  6.350   1.00 10.00 ? 26  LEU A HD11 1  
ATOM   350   H  HD12 . LEU A 1 26  ? -17.875 -2.607  6.828   1.00 10.00 ? 26  LEU A HD12 1  
ATOM   351   H  HD13 . LEU A 1 26  ? -17.700 -3.608  5.368   1.00 10.00 ? 26  LEU A HD13 1  
ATOM   352   H  HD21 . LEU A 1 26  ? -14.976 -1.851  4.457   1.00 10.00 ? 26  LEU A HD21 1  
ATOM   353   H  HD22 . LEU A 1 26  ? -16.142 -2.906  3.663   1.00 10.00 ? 26  LEU A HD22 1  
ATOM   354   H  HD23 . LEU A 1 26  ? -16.038 -1.194  3.219   1.00 10.00 ? 26  LEU A HD23 1  
ATOM   355   N  N    . PRO A 1 27  ? -16.398 1.969   4.643   1.00 10.00 ? 27  PRO A N    1  
ATOM   356   C  CA   . PRO A 1 27  ? -15.249 2.638   4.060   1.00 10.00 ? 27  PRO A CA   1  
ATOM   357   C  C    . PRO A 1 27  ? -14.339 1.568   3.466   1.00 10.00 ? 27  PRO A C    1  
ATOM   358   O  O    . PRO A 1 27  ? -14.069 0.556   4.110   1.00 10.00 ? 27  PRO A O    1  
ATOM   359   C  CB   . PRO A 1 27  ? -14.593 3.434   5.191   1.00 10.00 ? 27  PRO A CB   1  
ATOM   360   C  CG   . PRO A 1 27  ? -15.040 2.695   6.451   1.00 10.00 ? 27  PRO A CG   1  
ATOM   361   C  CD   . PRO A 1 27  ? -16.433 2.185   6.082   1.00 10.00 ? 27  PRO A CD   1  
ATOM   362   H  HA   . PRO A 1 27  ? -15.584 3.324   3.279   1.00 10.00 ? 27  PRO A HA   1  
ATOM   363   H  HB2  . PRO A 1 27  ? -13.507 3.477   5.099   1.00 10.00 ? 27  PRO A HB2  1  
ATOM   364   H  HB3  . PRO A 1 27  ? -15.009 4.442   5.206   1.00 10.00 ? 27  PRO A HB3  1  
ATOM   365   H  HG2  . PRO A 1 27  ? -14.378 1.844   6.620   1.00 10.00 ? 27  PRO A HG2  1  
ATOM   366   H  HG3  . PRO A 1 27  ? -15.054 3.341   7.330   1.00 10.00 ? 27  PRO A HG3  1  
ATOM   367   H  HD2  . PRO A 1 27  ? -16.629 1.278   6.653   1.00 10.00 ? 27  PRO A HD2  1  
ATOM   368   H  HD3  . PRO A 1 27  ? -17.185 2.941   6.312   1.00 10.00 ? 27  PRO A HD3  1  
ATOM   369   N  N    . VAL A 1 28  ? -13.947 1.756   2.206   1.00 10.00 ? 28  VAL A N    1  
ATOM   370   C  CA   . VAL A 1 28  ? -13.692 0.660   1.279   1.00 10.00 ? 28  VAL A CA   1  
ATOM   371   C  C    . VAL A 1 28  ? -12.274 0.092   1.430   1.00 10.00 ? 28  VAL A C    1  
ATOM   372   O  O    . VAL A 1 28  ? -11.532 -0.057  0.461   1.00 10.00 ? 28  VAL A O    1  
ATOM   373   C  CB   . VAL A 1 28  ? -13.976 1.198   -0.140  1.00 10.00 ? 28  VAL A CB   1  
ATOM   374   C  CG1  . VAL A 1 28  ? -15.468 1.527   -0.289  1.00 10.00 ? 28  VAL A CG1  1  
ATOM   375   C  CG2  . VAL A 1 28  ? -13.176 2.462   -0.490  1.00 10.00 ? 28  VAL A CG2  1  
ATOM   376   H  H    . VAL A 1 28  ? -14.181 2.642   1.789   1.00 10.00 ? 28  VAL A H    1  
ATOM   377   H  HA   . VAL A 1 28  ? -14.389 -0.156  1.481   1.00 10.00 ? 28  VAL A HA   1  
ATOM   378   H  HB   . VAL A 1 28  ? -13.709 0.438   -0.871  1.00 10.00 ? 28  VAL A HB   1  
ATOM   379   H  HG11 . VAL A 1 28  ? -15.667 1.890   -1.296  1.00 10.00 ? 28  VAL A HG11 1  
ATOM   380   H  HG12 . VAL A 1 28  ? -16.066 0.637   -0.106  1.00 10.00 ? 28  VAL A HG12 1  
ATOM   381   H  HG13 . VAL A 1 28  ? -15.772 2.303   0.414   1.00 10.00 ? 28  VAL A HG13 1  
ATOM   382   H  HG21 . VAL A 1 28  ? -13.464 3.309   0.129   1.00 10.00 ? 28  VAL A HG21 1  
ATOM   383   H  HG22 . VAL A 1 28  ? -13.378 2.722   -1.528  1.00 10.00 ? 28  VAL A HG22 1  
ATOM   384   H  HG23 . VAL A 1 28  ? -12.108 2.285   -0.370  1.00 10.00 ? 28  VAL A HG23 1  
ATOM   385   N  N    . THR A 1 29  ? -11.910 -0.267  2.660   1.00 10.00 ? 29  THR A N    1  
ATOM   386   C  CA   . THR A 1 29  ? -10.609 -0.791  3.017   1.00 10.00 ? 29  THR A CA   1  
ATOM   387   C  C    . THR A 1 29  ? -10.710 -1.498  4.369   1.00 10.00 ? 29  THR A C    1  
ATOM   388   O  O    . THR A 1 29  ? -9.955  -1.192  5.292   1.00 10.00 ? 29  THR A O    1  
ATOM   389   C  CB   . THR A 1 29  ? -9.576  0.351   2.976   1.00 10.00 ? 29  THR A CB   1  
ATOM   390   O  OG1  . THR A 1 29  ? -8.328  -0.068  3.484   1.00 10.00 ? 29  THR A OG1  1  
ATOM   391   C  CG2  . THR A 1 29  ? -10.041 1.604   3.733   1.00 10.00 ? 29  THR A CG2  1  
ATOM   392   H  H    . THR A 1 29  ? -12.582 -0.138  3.407   1.00 10.00 ? 29  THR A H    1  
ATOM   393   H  HA   . THR A 1 29  ? -10.317 -1.547  2.288   1.00 10.00 ? 29  THR A HA   1  
ATOM   394   H  HB   . THR A 1 29  ? -9.433  0.623   1.931   1.00 10.00 ? 29  THR A HB   1  
ATOM   395   H  HG1  . THR A 1 29  ? -8.472  -0.376  4.389   1.00 10.00 ? 29  THR A HG1  1  
ATOM   396   H  HG21 . THR A 1 29  ? -9.254  2.357   3.698   1.00 10.00 ? 29  THR A HG21 1  
ATOM   397   H  HG22 . THR A 1 29  ? -10.935 2.023   3.271   1.00 10.00 ? 29  THR A HG22 1  
ATOM   398   H  HG23 . THR A 1 29  ? -10.257 1.366   4.775   1.00 10.00 ? 29  THR A HG23 1  
ATOM   399   N  N    . VAL A 1 30  ? -11.590 -2.495  4.472   1.00 10.00 ? 30  VAL A N    1  
ATOM   400   C  CA   . VAL A 1 30  ? -11.733 -3.289  5.692   1.00 10.00 ? 30  VAL A CA   1  
ATOM   401   C  C    . VAL A 1 30  ? -10.634 -4.355  5.699   1.00 10.00 ? 30  VAL A C    1  
ATOM   402   O  O    . VAL A 1 30  ? -10.886 -5.552  5.588   1.00 10.00 ? 30  VAL A O    1  
ATOM   403   C  CB   . VAL A 1 30  ? -13.177 -3.817  5.846   1.00 10.00 ? 30  VAL A CB   1  
ATOM   404   C  CG1  . VAL A 1 30  ? -13.703 -4.614  4.641   1.00 10.00 ? 30  VAL A CG1  1  
ATOM   405   C  CG2  . VAL A 1 30  ? -13.367 -4.623  7.139   1.00 10.00 ? 30  VAL A CG2  1  
ATOM   406   H  H    . VAL A 1 30  ? -12.165 -2.701  3.671   1.00 10.00 ? 30  VAL A H    1  
ATOM   407   H  HA   . VAL A 1 30  ? -11.559 -2.644  6.556   1.00 10.00 ? 30  VAL A HA   1  
ATOM   408   H  HB   . VAL A 1 30  ? -13.807 -2.936  5.957   1.00 10.00 ? 30  VAL A HB   1  
ATOM   409   H  HG11 . VAL A 1 30  ? -14.730 -4.923  4.837   1.00 10.00 ? 30  VAL A HG11 1  
ATOM   410   H  HG12 . VAL A 1 30  ? -13.701 -4.000  3.741   1.00 10.00 ? 30  VAL A HG12 1  
ATOM   411   H  HG13 . VAL A 1 30  ? -13.104 -5.506  4.467   1.00 10.00 ? 30  VAL A HG13 1  
ATOM   412   H  HG21 . VAL A 1 30  ? -12.977 -4.061  7.988   1.00 10.00 ? 30  VAL A HG21 1  
ATOM   413   H  HG22 . VAL A 1 30  ? -14.430 -4.803  7.301   1.00 10.00 ? 30  VAL A HG22 1  
ATOM   414   H  HG23 . VAL A 1 30  ? -12.862 -5.586  7.085   1.00 10.00 ? 30  VAL A HG23 1  
ATOM   415   N  N    . GLN A 1 31  ? -9.388  -3.881  5.775   1.00 10.00 ? 31  GLN A N    1  
ATOM   416   C  CA   . GLN A 1 31  ? -8.189  -4.671  5.592   1.00 10.00 ? 31  GLN A CA   1  
ATOM   417   C  C    . GLN A 1 31  ? -7.205  -4.471  6.748   1.00 10.00 ? 31  GLN A C    1  
ATOM   418   O  O    . GLN A 1 31  ? -7.087  -3.373  7.287   1.00 10.00 ? 31  GLN A O    1  
ATOM   419   C  CB   . GLN A 1 31  ? -7.588  -4.228  4.256   1.00 10.00 ? 31  GLN A CB   1  
ATOM   420   C  CG   . GLN A 1 31  ? -6.314  -4.985  3.895   1.00 10.00 ? 31  GLN A CG   1  
ATOM   421   C  CD   . GLN A 1 31  ? -6.505  -6.498  3.973   1.00 10.00 ? 31  GLN A CD   1  
ATOM   422   O  OE1  . GLN A 1 31  ? -5.981  -7.148  4.868   1.00 10.00 ? 31  GLN A OE1  1  
ATOM   423   N  NE2  . GLN A 1 31  ? -7.293  -7.066  3.071   1.00 10.00 ? 31  GLN A NE2  1  
ATOM   424   H  H    . GLN A 1 31  ? -9.269  -2.873  5.775   1.00 10.00 ? 31  GLN A H    1  
ATOM   425   H  HA   . GLN A 1 31  ? -8.459  -5.727  5.544   1.00 10.00 ? 31  GLN A HA   1  
ATOM   426   H  HB2  . GLN A 1 31  ? -8.333  -4.388  3.476   1.00 10.00 ? 31  GLN A HB2  1  
ATOM   427   H  HB3  . GLN A 1 31  ? -7.356  -3.162  4.293   1.00 10.00 ? 31  GLN A HB3  1  
ATOM   428   H  HG2  . GLN A 1 31  ? -6.038  -4.682  2.887   1.00 10.00 ? 31  GLN A HG2  1  
ATOM   429   H  HG3  . GLN A 1 31  ? -5.513  -4.688  4.573   1.00 10.00 ? 31  GLN A HG3  1  
ATOM   430   H  HE21 . GLN A 1 31  ? -7.785  -6.484  2.399   1.00 10.00 ? 31  GLN A HE21 1  
ATOM   431   H  HE22 . GLN A 1 31  ? -7.480  -8.055  3.141   1.00 10.00 ? 31  GLN A HE22 1  
ATOM   432   N  N    . GLY A 1 32  ? -6.470  -5.534  7.087   1.00 10.00 ? 32  GLY A N    1  
ATOM   433   C  CA   . GLY A 1 32  ? -5.367  -5.524  8.031   1.00 10.00 ? 32  GLY A CA   1  
ATOM   434   C  C    . GLY A 1 32  ? -4.063  -5.536  7.242   1.00 10.00 ? 32  GLY A C    1  
ATOM   435   O  O    . GLY A 1 32  ? -3.562  -6.601  6.889   1.00 10.00 ? 32  GLY A O    1  
ATOM   436   H  H    . GLY A 1 32  ? -6.556  -6.376  6.527   1.00 10.00 ? 32  GLY A H    1  
ATOM   437   H  HA2  . GLY A 1 32  ? -5.407  -4.665  8.702   1.00 10.00 ? 32  GLY A HA2  1  
ATOM   438   H  HA3  . GLY A 1 32  ? -5.422  -6.437  8.621   1.00 10.00 ? 32  GLY A HA3  1  
ATOM   439   N  N    . ALA A 1 33  ? -3.538  -4.350  6.925   1.00 10.00 ? 33  ALA A N    1  
ATOM   440   C  CA   . ALA A 1 33  ? -2.322  -4.205  6.136   1.00 10.00 ? 33  ALA A CA   1  
ATOM   441   C  C    . ALA A 1 33  ? -1.170  -5.029  6.710   1.00 10.00 ? 33  ALA A C    1  
ATOM   442   O  O    . ALA A 1 33  ? -0.999  -5.106  7.928   1.00 10.00 ? 33  ALA A O    1  
ATOM   443   C  CB   . ALA A 1 33  ? -1.937  -2.725  6.059   1.00 10.00 ? 33  ALA A CB   1  
ATOM   444   H  H    . ALA A 1 33  ? -4.001  -3.517  7.256   1.00 10.00 ? 33  ALA A H    1  
ATOM   445   H  HA   . ALA A 1 33  ? -2.514  -4.575  5.130   1.00 10.00 ? 33  ALA A HA   1  
ATOM   446   H  HB1  . ALA A 1 33  ? -2.766  -2.142  5.656   1.00 10.00 ? 33  ALA A HB1  1  
ATOM   447   H  HB2  . ALA A 1 33  ? -1.696  -2.350  7.054   1.00 10.00 ? 33  ALA A HB2  1  
ATOM   448   H  HB3  . ALA A 1 33  ? -1.068  -2.603  5.411   1.00 10.00 ? 33  ALA A HB3  1  
ATOM   449   N  N    . THR A 1 34  ? -0.352  -5.611  5.829   1.00 10.00 ? 34  THR A N    1  
ATOM   450   C  CA   . THR A 1 34  ? 0.914   -6.201  6.219   1.00 10.00 ? 34  THR A CA   1  
ATOM   451   C  C    . THR A 1 34  ? 2.012   -5.572  5.370   1.00 10.00 ? 34  THR A C    1  
ATOM   452   O  O    . THR A 1 34  ? 1.746   -5.201  4.226   1.00 10.00 ? 34  THR A O    1  
ATOM   453   C  CB   . THR A 1 34  ? 0.876   -7.734  6.140   1.00 10.00 ? 34  THR A CB   1  
ATOM   454   O  OG1  . THR A 1 34  ? 1.001   -8.230  4.827   1.00 10.00 ? 34  THR A OG1  1  
ATOM   455   C  CG2  . THR A 1 34  ? -0.418  -8.291  6.736   1.00 10.00 ? 34  THR A CG2  1  
ATOM   456   H  H    . THR A 1 34  ? -0.518  -5.524  4.835   1.00 10.00 ? 34  THR A H    1  
ATOM   457   H  HA   . THR A 1 34  ? 1.105   -5.931  7.252   1.00 10.00 ? 34  THR A HA   1  
ATOM   458   H  HB   . THR A 1 34  ? 1.727   -8.105  6.707   1.00 10.00 ? 34  THR A HB   1  
ATOM   459   H  HG1  . THR A 1 34  ? 0.291   -7.866  4.281   1.00 10.00 ? 34  THR A HG1  1  
ATOM   460   H  HG21 . THR A 1 34  ? -0.577  -7.881  7.733   1.00 10.00 ? 34  THR A HG21 1  
ATOM   461   H  HG22 . THR A 1 34  ? -1.264  -8.017  6.102   1.00 10.00 ? 34  THR A HG22 1  
ATOM   462   H  HG23 . THR A 1 34  ? -0.360  -9.377  6.792   1.00 10.00 ? 34  THR A HG23 1  
ATOM   463   N  N    . VAL A 1 35  ? 3.208   -5.399  5.938   1.00 10.00 ? 35  VAL A N    1  
ATOM   464   C  CA   . VAL A 1 35  ? 4.358   -4.804  5.269   1.00 10.00 ? 35  VAL A CA   1  
ATOM   465   C  C    . VAL A 1 35  ? 5.516   -5.783  5.370   1.00 10.00 ? 35  VAL A C    1  
ATOM   466   O  O    . VAL A 1 35  ? 5.714   -6.404  6.417   1.00 10.00 ? 35  VAL A O    1  
ATOM   467   C  CB   . VAL A 1 35  ? 4.707   -3.448  5.901   1.00 10.00 ? 35  VAL A CB   1  
ATOM   468   C  CG1  . VAL A 1 35  ? 5.963   -2.840  5.258   1.00 10.00 ? 35  VAL A CG1  1  
ATOM   469   C  CG2  . VAL A 1 35  ? 3.528   -2.481  5.741   1.00 10.00 ? 35  VAL A CG2  1  
ATOM   470   H  H    . VAL A 1 35  ? 3.350   -5.749  6.882   1.00 10.00 ? 35  VAL A H    1  
ATOM   471   H  HA   . VAL A 1 35  ? 4.141   -4.648  4.213   1.00 10.00 ? 35  VAL A HA   1  
ATOM   472   H  HB   . VAL A 1 35  ? 4.907   -3.587  6.963   1.00 10.00 ? 35  VAL A HB   1  
ATOM   473   H  HG11 . VAL A 1 35  ? 6.845   -3.426  5.519   1.00 10.00 ? 35  VAL A HG11 1  
ATOM   474   H  HG12 . VAL A 1 35  ? 5.859   -2.819  4.173   1.00 10.00 ? 35  VAL A HG12 1  
ATOM   475   H  HG13 . VAL A 1 35  ? 6.111   -1.824  5.623   1.00 10.00 ? 35  VAL A HG13 1  
ATOM   476   H  HG21 . VAL A 1 35  ? 3.280   -2.367  4.687   1.00 10.00 ? 35  VAL A HG21 1  
ATOM   477   H  HG22 . VAL A 1 35  ? 2.655   -2.869  6.260   1.00 10.00 ? 35  VAL A HG22 1  
ATOM   478   H  HG23 . VAL A 1 35  ? 3.781   -1.509  6.165   1.00 10.00 ? 35  VAL A HG23 1  
ATOM   479   N  N    . ALA A 1 36  ? 6.272   -5.933  4.280   1.00 10.00 ? 36  ALA A N    1  
ATOM   480   C  CA   . ALA A 1 36  ? 7.316   -6.930  4.226   1.00 10.00 ? 36  ALA A CA   1  
ATOM   481   C  C    . ALA A 1 36  ? 8.598   -6.434  4.891   1.00 10.00 ? 36  ALA A C    1  
ATOM   482   O  O    . ALA A 1 36  ? 9.283   -5.553  4.373   1.00 10.00 ? 36  ALA A O    1  
ATOM   483   C  CB   . ALA A 1 36  ? 7.535   -7.411  2.789   1.00 10.00 ? 36  ALA A CB   1  
ATOM   484   H  H    . ALA A 1 36  ? 6.079   -5.394  3.446   1.00 10.00 ? 36  ALA A H    1  
ATOM   485   H  HA   . ALA A 1 36  ? 6.937   -7.770  4.794   1.00 10.00 ? 36  ALA A HA   1  
ATOM   486   H  HB1  . ALA A 1 36  ? 6.643   -7.935  2.444   1.00 10.00 ? 36  ALA A HB1  1  
ATOM   487   H  HB2  . ALA A 1 36  ? 7.735   -6.578  2.120   1.00 10.00 ? 36  ALA A HB2  1  
ATOM   488   H  HB3  . ALA A 1 36  ? 8.379   -8.101  2.756   1.00 10.00 ? 36  ALA A HB3  1  
ATOM   489   N  N    . ALA A 1 37  ? 8.942   -7.018  6.038   1.00 10.00 ? 37  ALA A N    1  
ATOM   490   C  CA   . ALA A 1 37  ? 10.262  -6.859  6.639   1.00 10.00 ? 37  ALA A CA   1  
ATOM   491   C  C    . ALA A 1 37  ? 11.334  -7.199  5.596   1.00 10.00 ? 37  ALA A C    1  
ATOM   492   O  O    . ALA A 1 37  ? 11.168  -8.190  4.889   1.00 10.00 ? 37  ALA A O    1  
ATOM   493   C  CB   . ALA A 1 37  ? 10.390  -7.785  7.849   1.00 10.00 ? 37  ALA A CB   1  
ATOM   494   H  H    . ALA A 1 37  ? 8.284   -7.671  6.431   1.00 10.00 ? 37  ALA A H    1  
ATOM   495   H  HA   . ALA A 1 37  ? 10.367  -5.827  6.968   1.00 10.00 ? 37  ALA A HA   1  
ATOM   496   H  HB1  . ALA A 1 37  ? 9.589   -7.590  8.562   1.00 10.00 ? 37  ALA A HB1  1  
ATOM   497   H  HB2  . ALA A 1 37  ? 10.331  -8.818  7.510   1.00 10.00 ? 37  ALA A HB2  1  
ATOM   498   H  HB3  . ALA A 1 37  ? 11.352  -7.622  8.338   1.00 10.00 ? 37  ALA A HB3  1  
ATOM   499   N  N    . VAL A 1 38  ? 12.401  -6.388  5.508   1.00 10.00 ? 38  VAL A N    1  
ATOM   500   C  CA   . VAL A 1 38  ? 13.357  -6.303  4.388   1.00 10.00 ? 38  VAL A CA   1  
ATOM   501   C  C    . VAL A 1 38  ? 13.339  -7.511  3.427   1.00 10.00 ? 38  VAL A C    1  
ATOM   502   O  O    . VAL A 1 38  ? 13.777  -8.610  3.789   1.00 10.00 ? 38  VAL A O    1  
ATOM   503   C  CB   . VAL A 1 38  ? 14.780  -5.993  4.901   1.00 10.00 ? 38  VAL A CB   1  
ATOM   504   C  CG1  . VAL A 1 38  ? 15.846  -6.114  3.801   1.00 10.00 ? 38  VAL A CG1  1  
ATOM   505   C  CG2  . VAL A 1 38  ? 14.848  -4.553  5.425   1.00 10.00 ? 38  VAL A CG2  1  
ATOM   506   H  H    . VAL A 1 38  ? 12.477  -5.680  6.223   1.00 10.00 ? 38  VAL A H    1  
ATOM   507   H  HA   . VAL A 1 38  ? 13.072  -5.417  3.825   1.00 10.00 ? 38  VAL A HA   1  
ATOM   508   H  HB   . VAL A 1 38  ? 15.046  -6.680  5.702   1.00 10.00 ? 38  VAL A HB   1  
ATOM   509   H  HG11 . VAL A 1 38  ? 15.548  -5.541  2.921   1.00 10.00 ? 38  VAL A HG11 1  
ATOM   510   H  HG12 . VAL A 1 38  ? 16.800  -5.731  4.164   1.00 10.00 ? 38  VAL A HG12 1  
ATOM   511   H  HG13 . VAL A 1 38  ? 15.993  -7.157  3.525   1.00 10.00 ? 38  VAL A HG13 1  
ATOM   512   H  HG21 . VAL A 1 38  ? 14.122  -4.397  6.222   1.00 10.00 ? 38  VAL A HG21 1  
ATOM   513   H  HG22 . VAL A 1 38  ? 15.845  -4.346  5.815   1.00 10.00 ? 38  VAL A HG22 1  
ATOM   514   H  HG23 . VAL A 1 38  ? 14.647  -3.864  4.604   1.00 10.00 ? 38  VAL A HG23 1  
ATOM   515   N  N    . PRO A 1 39  ? 12.820  -7.350  2.200   1.00 10.00 ? 39  PRO A N    1  
ATOM   516   C  CA   . PRO A 1 39  ? 12.986  -8.331  1.139   1.00 10.00 ? 39  PRO A CA   1  
ATOM   517   C  C    . PRO A 1 39  ? 14.468  -8.534  0.822   1.00 10.00 ? 39  PRO A C    1  
ATOM   518   O  O    . PRO A 1 39  ? 15.271  -7.635  1.067   1.00 10.00 ? 39  PRO A O    1  
ATOM   519   C  CB   . PRO A 1 39  ? 12.237  -7.760  -0.071  1.00 10.00 ? 39  PRO A CB   1  
ATOM   520   C  CG   . PRO A 1 39  ? 11.251  -6.767  0.542   1.00 10.00 ? 39  PRO A CG   1  
ATOM   521   C  CD   . PRO A 1 39  ? 12.034  -6.224  1.731   1.00 10.00 ? 39  PRO A CD   1  
ATOM   522   H  HA   . PRO A 1 39  ? 12.542  -9.269  1.449   1.00 10.00 ? 39  PRO A HA   1  
ATOM   523   H  HB2  . PRO A 1 39  ? 12.928  -7.203  -0.705  1.00 10.00 ? 39  PRO A HB2  1  
ATOM   524   H  HB3  . PRO A 1 39  ? 11.729  -8.530  -0.652  1.00 10.00 ? 39  PRO A HB3  1  
ATOM   525   H  HG2  . PRO A 1 39  ? 10.959  -5.983  -0.156  1.00 10.00 ? 39  PRO A HG2  1  
ATOM   526   H  HG3  . PRO A 1 39  ? 10.369  -7.295  0.910   1.00 10.00 ? 39  PRO A HG3  1  
ATOM   527   H  HD2  . PRO A 1 39  ? 12.703  -5.423  1.404   1.00 10.00 ? 39  PRO A HD2  1  
ATOM   528   H  HD3  . PRO A 1 39  ? 11.335  -5.866  2.489   1.00 10.00 ? 39  PRO A HD3  1  
ATOM   529   N  N    . PRO A 1 40  ? 14.855  -9.670  0.222   1.00 10.00 ? 40  PRO A N    1  
ATOM   530   C  CA   . PRO A 1 40  ? 16.192  -9.850  -0.323  1.00 10.00 ? 40  PRO A CA   1  
ATOM   531   C  C    . PRO A 1 40  ? 16.314  -9.043  -1.625  1.00 10.00 ? 40  PRO A C    1  
ATOM   532   O  O    . PRO A 1 40  ? 16.559  -9.597  -2.694  1.00 10.00 ? 40  PRO A O    1  
ATOM   533   C  CB   . PRO A 1 40  ? 16.318  -11.363 -0.534  1.00 10.00 ? 40  PRO A CB   1  
ATOM   534   C  CG   . PRO A 1 40  ? 14.888  -11.776 -0.886  1.00 10.00 ? 40  PRO A CG   1  
ATOM   535   C  CD   . PRO A 1 40  ? 14.031  -10.842 -0.029  1.00 10.00 ? 40  PRO A CD   1  
ATOM   536   H  HA   . PRO A 1 40  ? 16.959  -9.517  0.378   1.00 10.00 ? 40  PRO A HA   1  
ATOM   537   H  HB2  . PRO A 1 40  ? 17.039  -11.635 -1.306  1.00 10.00 ? 40  PRO A HB2  1  
ATOM   538   H  HB3  . PRO A 1 40  ? 16.601  -11.830 0.411   1.00 10.00 ? 40  PRO A HB3  1  
ATOM   539   H  HG2  . PRO A 1 40  ? 14.707  -11.574 -1.944  1.00 10.00 ? 40  PRO A HG2  1  
ATOM   540   H  HG3  . PRO A 1 40  ? 14.702  -12.828 -0.668  1.00 10.00 ? 40  PRO A HG3  1  
ATOM   541   H  HD2  . PRO A 1 40  ? 13.109  -10.591 -0.554  1.00 10.00 ? 40  PRO A HD2  1  
ATOM   542   H  HD3  . PRO A 1 40  ? 13.802  -11.329 0.920   1.00 10.00 ? 40  PRO A HD3  1  
ATOM   543   N  N    . SER A 1 41  ? 16.100  -7.727  -1.538  1.00 10.00 ? 41  SER A N    1  
ATOM   544   C  CA   . SER A 1 41  ? 16.074  -6.806  -2.660  1.00 10.00 ? 41  SER A CA   1  
ATOM   545   C  C    . SER A 1 41  ? 16.167  -5.376  -2.120  1.00 10.00 ? 41  SER A C    1  
ATOM   546   O  O    . SER A 1 41  ? 15.455  -4.499  -2.597  1.00 10.00 ? 41  SER A O    1  
ATOM   547   C  CB   . SER A 1 41  ? 14.794  -7.030  -3.482  1.00 10.00 ? 41  SER A CB   1  
ATOM   548   O  OG   . SER A 1 41  ? 14.741  -6.158  -4.593  1.00 10.00 ? 41  SER A OG   1  
ATOM   549   H  H    . SER A 1 41  ? 15.887  -7.336  -0.625  1.00 10.00 ? 41  SER A H    1  
ATOM   550   H  HA   . SER A 1 41  ? 16.940  -6.989  -3.298  1.00 10.00 ? 41  SER A HA   1  
ATOM   551   H  HB2  . SER A 1 41  ? 14.761  -8.058  -3.847  1.00 10.00 ? 41  SER A HB2  1  
ATOM   552   H  HB3  . SER A 1 41  ? 13.923  -6.842  -2.854  1.00 10.00 ? 41  SER A HB3  1  
ATOM   553   H  HG   . SER A 1 41  ? 14.802  -5.253  -4.250  1.00 10.00 ? 41  SER A HG   1  
ATOM   554   N  N    . ILE A 1 42  ? 17.071  -5.158  -1.156  1.00 10.00 ? 42  ILE A N    1  
ATOM   555   C  CA   . ILE A 1 42  ? 17.407  -3.874  -0.571  1.00 10.00 ? 42  ILE A CA   1  
ATOM   556   C  C    . ILE A 1 42  ? 16.276  -3.420  0.371   1.00 10.00 ? 42  ILE A C    1  
ATOM   557   O  O    . ILE A 1 42  ? 15.242  -4.074  0.484   1.00 10.00 ? 42  ILE A O    1  
ATOM   558   C  CB   . ILE A 1 42  ? 17.871  -2.885  -1.668  1.00 10.00 ? 42  ILE A CB   1  
ATOM   559   C  CG1  . ILE A 1 42  ? 18.903  -3.574  -2.595  1.00 10.00 ? 42  ILE A CG1  1  
ATOM   560   C  CG2  . ILE A 1 42  ? 18.504  -1.625  -1.066  1.00 10.00 ? 42  ILE A CG2  1  
ATOM   561   C  CD1  . ILE A 1 42  ? 19.469  -2.679  -3.701  1.00 10.00 ? 42  ILE A CD1  1  
ATOM   562   H  H    . ILE A 1 42  ? 17.582  -5.931  -0.786  1.00 10.00 ? 42  ILE A H    1  
ATOM   563   H  HA   . ILE A 1 42  ? 18.276  -4.062  0.059   1.00 10.00 ? 42  ILE A HA   1  
ATOM   564   H  HB   . ILE A 1 42  ? 17.004  -2.587  -2.249  1.00 10.00 ? 42  ILE A HB   1  
ATOM   565   H  HG12 . ILE A 1 42  ? 19.732  -3.960  -2.001  1.00 10.00 ? 42  ILE A HG12 1  
ATOM   566   H  HG13 . ILE A 1 42  ? 18.437  -4.410  -3.116  1.00 10.00 ? 42  ILE A HG13 1  
ATOM   567   H  HG21 . ILE A 1 42  ? 18.940  -0.995  -1.836  1.00 10.00 ? 42  ILE A HG21 1  
ATOM   568   H  HG22 . ILE A 1 42  ? 17.742  -1.021  -0.588  1.00 10.00 ? 42  ILE A HG22 1  
ATOM   569   H  HG23 . ILE A 1 42  ? 19.273  -1.909  -0.347  1.00 10.00 ? 42  ILE A HG23 1  
ATOM   570   H  HD11 . ILE A 1 42  ? 18.660  -2.134  -4.188  1.00 10.00 ? 42  ILE A HD11 1  
ATOM   571   H  HD12 . ILE A 1 42  ? 20.201  -1.980  -3.296  1.00 10.00 ? 42  ILE A HD12 1  
ATOM   572   H  HD13 . ILE A 1 42  ? 19.972  -3.304  -4.439  1.00 10.00 ? 42  ILE A HD13 1  
ATOM   573   N  N    . ARG A 1 43  ? 16.534  -2.370  1.156   1.00 10.00 ? 43  ARG A N    1  
ATOM   574   C  CA   . ARG A 1 43  ? 15.647  -1.828  2.178   1.00 10.00 ? 43  ARG A CA   1  
ATOM   575   C  C    . ARG A 1 43  ? 14.201  -1.646  1.710   1.00 10.00 ? 43  ARG A C    1  
ATOM   576   O  O    . ARG A 1 43  ? 13.266  -1.831  2.486   1.00 10.00 ? 43  ARG A O    1  
ATOM   577   C  CB   . ARG A 1 43  ? 16.232  -0.501  2.685   1.00 10.00 ? 43  ARG A CB   1  
ATOM   578   C  CG   . ARG A 1 43  ? 16.163  0.622   1.641   1.00 10.00 ? 43  ARG A CG   1  
ATOM   579   C  CD   . ARG A 1 43  ? 17.196  1.716   1.915   1.00 10.00 ? 43  ARG A CD   1  
ATOM   580   N  NE   . ARG A 1 43  ? 16.934  2.439   3.175   1.00 10.00 ? 43  ARG A NE   1  
ATOM   581   C  CZ   . ARG A 1 43  ? 17.715  3.419   3.660   1.00 10.00 ? 43  ARG A CZ   1  
ATOM   582   N  NH1  . ARG A 1 43  ? 18.812  3.789   2.989   1.00 10.00 ? 43  ARG A NH1  1  
ATOM   583   N  NH2  . ARG A 1 43  ? 17.395  4.026   4.805   1.00 10.00 ? 43  ARG A NH2  1  
ATOM   584   H  H    . ARG A 1 43  ? 17.448  -1.959  1.083   1.00 10.00 ? 43  ARG A H    1  
ATOM   585   H  HA   . ARG A 1 43  ? 15.648  -2.524  3.011   1.00 10.00 ? 43  ARG A HA   1  
ATOM   586   H  HB2  . ARG A 1 43  ? 15.678  -0.186  3.562   1.00 10.00 ? 43  ARG A HB2  1  
ATOM   587   H  HB3  . ARG A 1 43  ? 17.269  -0.673  2.975   1.00 10.00 ? 43  ARG A HB3  1  
ATOM   588   H  HG2  . ARG A 1 43  ? 16.374  0.213   0.654   1.00 10.00 ? 43  ARG A HG2  1  
ATOM   589   H  HG3  . ARG A 1 43  ? 15.159  1.045   1.618   1.00 10.00 ? 43  ARG A HG3  1  
ATOM   590   H  HD2  . ARG A 1 43  ? 18.179  1.239   1.936   1.00 10.00 ? 43  ARG A HD2  1  
ATOM   591   H  HD3  . ARG A 1 43  ? 17.162  2.413   1.075   1.00 10.00 ? 43  ARG A HD3  1  
ATOM   592   H  HE   . ARG A 1 43  ? 16.111  2.178   3.707   1.00 10.00 ? 43  ARG A HE   1  
ATOM   593   H  HH11 . ARG A 1 43  ? 19.040  3.326   2.121   1.00 10.00 ? 43  ARG A HH11 1  
ATOM   594   H  HH12 . ARG A 1 43  ? 19.418  4.522   3.322   1.00 10.00 ? 43  ARG A HH12 1  
ATOM   595   H  HH21 . ARG A 1 43  ? 16.533  3.759   5.285   1.00 10.00 ? 43  ARG A HH21 1  
ATOM   596   H  HH22 . ARG A 1 43  ? 17.963  4.753   5.211   1.00 10.00 ? 43  ARG A HH22 1  
ATOM   597   N  N    . ASP A 1 44  ? 14.028  -1.196  0.470   1.00 10.00 ? 44  ASP A N    1  
ATOM   598   C  CA   . ASP A 1 44  ? 12.743  -0.910  -0.132  1.00 10.00 ? 44  ASP A CA   1  
ATOM   599   C  C    . ASP A 1 44  ? 11.847  -2.146  -0.147  1.00 10.00 ? 44  ASP A C    1  
ATOM   600   O  O    . ASP A 1 44  ? 12.309  -3.284  -0.121  1.00 10.00 ? 44  ASP A O    1  
ATOM   601   C  CB   . ASP A 1 44  ? 12.947  -0.313  -1.527  1.00 10.00 ? 44  ASP A CB   1  
ATOM   602   C  CG   . ASP A 1 44  ? 14.000  -1.017  -2.367  1.00 10.00 ? 44  ASP A CG   1  
ATOM   603   O  OD1  . ASP A 1 44  ? 15.164  -0.986  -1.904  1.00 10.00 ? 44  ASP A OD1  1  
ATOM   604   O  OD2  . ASP A 1 44  ? 13.631  -1.496  -3.459  1.00 10.00 ? 44  ASP A OD2  1  
ATOM   605   H  H    . ASP A 1 44  ? 14.821  -1.162  -0.172  1.00 10.00 ? 44  ASP A H    1  
ATOM   606   H  HA   . ASP A 1 44  ? 12.252  -0.157  0.486   1.00 10.00 ? 44  ASP A HA   1  
ATOM   607   H  HB2  . ASP A 1 44  ? 12.005  -0.346  -2.068  1.00 10.00 ? 44  ASP A HB2  1  
ATOM   608   H  HB3  . ASP A 1 44  ? 13.298  0.708   -1.414  1.00 10.00 ? 44  ASP A HB3  1  
ATOM   609   N  N    . THR A 1 45  ? 10.536  -1.911  -0.111  1.00 10.00 ? 45  THR A N    1  
ATOM   610   C  CA   . THR A 1 45  ? 9.569   -2.944  0.202   1.00 10.00 ? 45  THR A CA   1  
ATOM   611   C  C    . THR A 1 45  ? 8.181   -2.465  -0.220  1.00 10.00 ? 45  THR A C    1  
ATOM   612   O  O    . THR A 1 45  ? 8.052   -1.422  -0.863  1.00 10.00 ? 45  THR A O    1  
ATOM   613   C  CB   . THR A 1 45  ? 9.672   -3.301  1.696   1.00 10.00 ? 45  THR A CB   1  
ATOM   614   O  OG1  . THR A 1 45  ? 8.744   -4.316  2.004   1.00 10.00 ? 45  THR A OG1  1  
ATOM   615   C  CG2  . THR A 1 45  ? 9.436   -2.109  2.629   1.00 10.00 ? 45  THR A CG2  1  
ATOM   616   H  H    . THR A 1 45  ? 10.171  -0.974  -0.219  1.00 10.00 ? 45  THR A H    1  
ATOM   617   H  HA   . THR A 1 45  ? 9.805   -3.836  -0.383  1.00 10.00 ? 45  THR A HA   1  
ATOM   618   H  HB   . THR A 1 45  ? 10.673  -3.685  1.895   1.00 10.00 ? 45  THR A HB   1  
ATOM   619   H  HG1  . THR A 1 45  ? 8.965   -4.672  2.873   1.00 10.00 ? 45  THR A HG1  1  
ATOM   620   H  HG21 . THR A 1 45  ? 10.191  -1.341  2.458   1.00 10.00 ? 45  THR A HG21 1  
ATOM   621   H  HG22 . THR A 1 45  ? 8.447   -1.685  2.464   1.00 10.00 ? 45  THR A HG22 1  
ATOM   622   H  HG23 . THR A 1 45  ? 9.511   -2.440  3.666   1.00 10.00 ? 45  THR A HG23 1  
ATOM   623   N  N    . ALA A 1 46  ? 7.146   -3.229  0.131   1.00 10.00 ? 46  ALA A N    1  
ATOM   624   C  CA   . ALA A 1 46  ? 5.776   -2.991  -0.267  1.00 10.00 ? 46  ALA A CA   1  
ATOM   625   C  C    . ALA A 1 46  ? 4.822   -3.504  0.804   1.00 10.00 ? 46  ALA A C    1  
ATOM   626   O  O    . ALA A 1 46  ? 5.210   -4.313  1.653   1.00 10.00 ? 46  ALA A O    1  
ATOM   627   C  CB   . ALA A 1 46  ? 5.504   -3.662  -1.619  1.00 10.00 ? 46  ALA A CB   1  
ATOM   628   H  H    . ALA A 1 46  ? 7.311   -3.977  0.801   1.00 10.00 ? 46  ALA A H    1  
ATOM   629   H  HA   . ALA A 1 46  ? 5.634   -1.923  -0.351  1.00 10.00 ? 46  ALA A HA   1  
ATOM   630   H  HB1  . ALA A 1 46  ? 4.475   -3.478  -1.927  1.00 10.00 ? 46  ALA A HB1  1  
ATOM   631   H  HB2  . ALA A 1 46  ? 6.176   -3.257  -2.376  1.00 10.00 ? 46  ALA A HB2  1  
ATOM   632   H  HB3  . ALA A 1 46  ? 5.662   -4.738  -1.538  1.00 10.00 ? 46  ALA A HB3  1  
ATOM   633   N  N    . ALA A 1 47  ? 3.572   -3.037  0.740   1.00 10.00 ? 47  ALA A N    1  
ATOM   634   C  CA   . ALA A 1 47  ? 2.490   -3.629  1.511   1.00 10.00 ? 47  ALA A CA   1  
ATOM   635   C  C    . ALA A 1 47  ? 1.928   -4.833  0.756   1.00 10.00 ? 47  ALA A C    1  
ATOM   636   O  O    . ALA A 1 47  ? 1.947   -4.857  -0.475  1.00 10.00 ? 47  ALA A O    1  
ATOM   637   C  CB   . ALA A 1 47  ? 1.389   -2.611  1.813   1.00 10.00 ? 47  ALA A CB   1  
ATOM   638   H  H    . ALA A 1 47  ? 3.349   -2.371  0.005   1.00 10.00 ? 47  ALA A H    1  
ATOM   639   H  HA   . ALA A 1 47  ? 2.893   -3.959  2.465   1.00 10.00 ? 47  ALA A HA   1  
ATOM   640   H  HB1  . ALA A 1 47  ? 0.928   -2.269  0.887   1.00 10.00 ? 47  ALA A HB1  1  
ATOM   641   H  HB2  . ALA A 1 47  ? 0.631   -3.088  2.441   1.00 10.00 ? 47  ALA A HB2  1  
ATOM   642   H  HB3  . ALA A 1 47  ? 1.808   -1.762  2.352   1.00 10.00 ? 47  ALA A HB3  1  
ATOM   643   N  N    . TYR A 1 48  ? 1.434   -5.820  1.504   1.00 10.00 ? 48  TYR A N    1  
ATOM   644   C  CA   . TYR A 1 48  ? 0.798   -7.026  1.003   1.00 10.00 ? 48  TYR A CA   1  
ATOM   645   C  C    . TYR A 1 48  ? -0.575  -7.049  1.673   1.00 10.00 ? 48  TYR A C    1  
ATOM   646   O  O    . TYR A 1 48  ? -0.664  -7.288  2.878   1.00 10.00 ? 48  TYR A O    1  
ATOM   647   C  CB   . TYR A 1 48  ? 1.617   -8.268  1.380   1.00 10.00 ? 48  TYR A CB   1  
ATOM   648   C  CG   . TYR A 1 48  ? 2.884   -8.545  0.577   1.00 10.00 ? 48  TYR A CG   1  
ATOM   649   C  CD1  . TYR A 1 48  ? 3.979   -7.656  0.617   1.00 10.00 ? 48  TYR A CD1  1  
ATOM   650   C  CD2  . TYR A 1 48  ? 3.029   -9.780  -0.084  1.00 10.00 ? 48  TYR A CD2  1  
ATOM   651   C  CE1  . TYR A 1 48  ? 5.199   -8.006  0.005   1.00 10.00 ? 48  TYR A CE1  1  
ATOM   652   C  CE2  . TYR A 1 48  ? 4.265   -10.150 -0.642  1.00 10.00 ? 48  TYR A CE2  1  
ATOM   653   C  CZ   . TYR A 1 48  ? 5.371   -9.291  -0.537  1.00 10.00 ? 48  TYR A CZ   1  
ATOM   654   O  OH   . TYR A 1 48  ? 6.563   -9.665  -1.091  1.00 10.00 ? 48  TYR A OH   1  
ATOM   655   H  H    . TYR A 1 48  ? 1.390   -5.682  2.510   1.00 10.00 ? 48  TYR A H    1  
ATOM   656   H  HA   . TYR A 1 48  ? 0.702   -7.003  -0.078  1.00 10.00 ? 48  TYR A HA   1  
ATOM   657   H  HB2  . TYR A 1 48  ? 1.876   -8.180  2.428   1.00 10.00 ? 48  TYR A HB2  1  
ATOM   658   H  HB3  . TYR A 1 48  ? 0.957   -9.130  1.281   1.00 10.00 ? 48  TYR A HB3  1  
ATOM   659   H  HD1  . TYR A 1 48  ? 3.908   -6.714  1.135   1.00 10.00 ? 48  TYR A HD1  1  
ATOM   660   H  HD2  . TYR A 1 48  ? 2.208   -10.481 -0.119  1.00 10.00 ? 48  TYR A HD2  1  
ATOM   661   H  HE1  . TYR A 1 48  ? 6.002   -7.284  -0.032  1.00 10.00 ? 48  TYR A HE1  1  
ATOM   662   H  HE2  . TYR A 1 48  ? 4.390   -11.129 -1.080  1.00 10.00 ? 48  TYR A HE2  1  
ATOM   663   H  HH   . TYR A 1 48  ? 7.334   -9.403  -0.553  1.00 10.00 ? 48  TYR A HH   1  
ATOM   664   N  N    . MET A 1 49  ? -1.627  -6.694  0.935   1.00 10.00 ? 49  MET A N    1  
ATOM   665   C  CA   . MET A 1 49  ? -2.974  -6.523  1.467   1.00 10.00 ? 49  MET A CA   1  
ATOM   666   C  C    . MET A 1 49  ? -4.033  -6.622  0.363   1.00 10.00 ? 49  MET A C    1  
ATOM   667   O  O    . MET A 1 49  ? -3.722  -7.024  -0.754  1.00 10.00 ? 49  MET A O    1  
ATOM   668   C  CB   . MET A 1 49  ? -3.063  -5.276  2.358   1.00 10.00 ? 49  MET A CB   1  
ATOM   669   C  CG   . MET A 1 49  ? -3.130  -3.912  1.663   1.00 10.00 ? 49  MET A CG   1  
ATOM   670   S  SD   . MET A 1 49  ? -3.493  -2.585  2.845   1.00 10.00 ? 49  MET A SD   1  
ATOM   671   C  CE   . MET A 1 49  ? -3.446  -1.117  1.797   1.00 10.00 ? 49  MET A CE   1  
ATOM   672   H  H    . MET A 1 49  ? -1.484  -6.595  -0.064  1.00 10.00 ? 49  MET A H    1  
ATOM   673   H  HA   . MET A 1 49  ? -3.158  -7.378  2.120   1.00 10.00 ? 49  MET A HA   1  
ATOM   674   H  HB2  . MET A 1 49  ? -3.940  -5.390  2.985   1.00 10.00 ? 49  MET A HB2  1  
ATOM   675   H  HB3  . MET A 1 49  ? -2.203  -5.255  3.024   1.00 10.00 ? 49  MET A HB3  1  
ATOM   676   H  HG2  . MET A 1 49  ? -2.174  -3.708  1.181   1.00 10.00 ? 49  MET A HG2  1  
ATOM   677   H  HG3  . MET A 1 49  ? -3.919  -3.907  0.915   1.00 10.00 ? 49  MET A HG3  1  
ATOM   678   H  HE1  . MET A 1 49  ? -2.442  -0.989  1.397   1.00 10.00 ? 49  MET A HE1  1  
ATOM   679   H  HE2  . MET A 1 49  ? -3.705  -0.248  2.401   1.00 10.00 ? 49  MET A HE2  1  
ATOM   680   H  HE3  . MET A 1 49  ? -4.167  -1.222  0.989   1.00 10.00 ? 49  MET A HE3  1  
ATOM   681   N  N    . THR A 1 50  ? -5.306  -6.341  0.657   1.00 10.00 ? 50  THR A N    1  
ATOM   682   C  CA   . THR A 1 50  ? -6.375  -6.310  -0.334  1.00 10.00 ? 50  THR A CA   1  
ATOM   683   C  C    . THR A 1 50  ? -7.400  -5.226  0.024   1.00 10.00 ? 50  THR A C    1  
ATOM   684   O  O    . THR A 1 50  ? -7.958  -5.237  1.121   1.00 10.00 ? 50  THR A O    1  
ATOM   685   C  CB   . THR A 1 50  ? -6.970  -7.725  -0.442  1.00 10.00 ? 50  THR A CB   1  
ATOM   686   O  OG1  . THR A 1 50  ? -6.079  -8.546  -1.173  1.00 10.00 ? 50  THR A OG1  1  
ATOM   687   C  CG2  . THR A 1 50  ? -8.339  -7.776  -1.114  1.00 10.00 ? 50  THR A CG2  1  
ATOM   688   H  H    . THR A 1 50  ? -5.568  -6.125  1.604   1.00 10.00 ? 50  THR A H    1  
ATOM   689   H  HA   . THR A 1 50  ? -5.954  -6.023  -1.295  1.00 10.00 ? 50  THR A HA   1  
ATOM   690   H  HB   . THR A 1 50  ? -7.085  -8.142  0.559   1.00 10.00 ? 50  THR A HB   1  
ATOM   691   H  HG1  . THR A 1 50  ? -5.175  -8.274  -0.961  1.00 10.00 ? 50  THR A HG1  1  
ATOM   692   H  HG21 . THR A 1 50  ? -8.664  -8.813  -1.188  1.00 10.00 ? 50  THR A HG21 1  
ATOM   693   H  HG22 . THR A 1 50  ? -9.060  -7.227  -0.511  1.00 10.00 ? 50  THR A HG22 1  
ATOM   694   H  HG23 . THR A 1 50  ? -8.292  -7.345  -2.111  1.00 10.00 ? 50  THR A HG23 1  
ATOM   695   N  N    . LEU A 1 51  ? -7.681  -4.304  -0.901  1.00 10.00 ? 51  LEU A N    1  
ATOM   696   C  CA   . LEU A 1 51  ? -8.707  -3.291  -0.732  1.00 10.00 ? 51  LEU A CA   1  
ATOM   697   C  C    . LEU A 1 51  ? -9.993  -4.012  -1.081  1.00 10.00 ? 51  LEU A C    1  
ATOM   698   O  O    . LEU A 1 51  ? -10.020 -4.751  -2.064  1.00 10.00 ? 51  LEU A O    1  
ATOM   699   C  CB   . LEU A 1 51  ? -8.474  -2.142  -1.730  1.00 10.00 ? 51  LEU A CB   1  
ATOM   700   C  CG   . LEU A 1 51  ? -8.073  -0.812  -1.079  1.00 10.00 ? 51  LEU A CG   1  
ATOM   701   C  CD1  . LEU A 1 51  ? -6.940  -0.950  -0.053  1.00 10.00 ? 51  LEU A CD1  1  
ATOM   702   C  CD2  . LEU A 1 51  ? -7.610  0.154   -2.175  1.00 10.00 ? 51  LEU A CD2  1  
ATOM   703   H  H    . LEU A 1 51  ? -7.424  -4.493  -1.863  1.00 10.00 ? 51  LEU A H    1  
ATOM   704   H  HA   . LEU A 1 51  ? -8.759  -2.945  0.309   1.00 10.00 ? 51  LEU A HA   1  
ATOM   705   H  HB2  . LEU A 1 51  ? -7.729  -2.438  -2.468  1.00 10.00 ? 51  LEU A HB2  1  
ATOM   706   H  HB3  . LEU A 1 51  ? -9.398  -1.950  -2.279  1.00 10.00 ? 51  LEU A HB3  1  
ATOM   707   H  HG   . LEU A 1 51  ? -8.972  -0.407  -0.608  1.00 10.00 ? 51  LEU A HG   1  
ATOM   708   H  HD11 . LEU A 1 51  ? -6.592  0.040   0.243   1.00 10.00 ? 51  LEU A HD11 1  
ATOM   709   H  HD12 . LEU A 1 51  ? -7.273  -1.467  0.846   1.00 10.00 ? 51  LEU A HD12 1  
ATOM   710   H  HD13 . LEU A 1 51  ? -6.110  -1.500  -0.495  1.00 10.00 ? 51  LEU A HD13 1  
ATOM   711   H  HD21 . LEU A 1 51  ? -8.365  0.218   -2.955  1.00 10.00 ? 51  LEU A HD21 1  
ATOM   712   H  HD22 . LEU A 1 51  ? -7.450  1.146   -1.754  1.00 10.00 ? 51  LEU A HD22 1  
ATOM   713   H  HD23 . LEU A 1 51  ? -6.679  -0.200  -2.618  1.00 10.00 ? 51  LEU A HD23 1  
ATOM   714   N  N    . THR A 1 52  ? -10.999 -3.844  -0.223  1.00 10.00 ? 52  THR A N    1  
ATOM   715   C  CA   . THR A 1 52  ? -12.193 -4.662  -0.179  1.00 10.00 ? 52  THR A CA   1  
ATOM   716   C  C    . THR A 1 52  ? -13.398 -3.722  -0.188  1.00 10.00 ? 52  THR A C    1  
ATOM   717   O  O    . THR A 1 52  ? -13.879 -3.310  0.868   1.00 10.00 ? 52  THR A O    1  
ATOM   718   C  CB   . THR A 1 52  ? -12.122 -5.537  1.084   1.00 10.00 ? 52  THR A CB   1  
ATOM   719   O  OG1  . THR A 1 52  ? -10.893 -6.240  1.115   1.00 10.00 ? 52  THR A OG1  1  
ATOM   720   C  CG2  . THR A 1 52  ? -13.261 -6.558  1.131   1.00 10.00 ? 52  THR A CG2  1  
ATOM   721   H  H    . THR A 1 52  ? -10.892 -3.156  0.508   1.00 10.00 ? 52  THR A H    1  
ATOM   722   H  HA   . THR A 1 52  ? -12.243 -5.317  -1.050  1.00 10.00 ? 52  THR A HA   1  
ATOM   723   H  HB   . THR A 1 52  ? -12.177 -4.906  1.973   1.00 10.00 ? 52  THR A HB   1  
ATOM   724   H  HG1  . THR A 1 52  ? -10.158 -5.617  1.155   1.00 10.00 ? 52  THR A HG1  1  
ATOM   725   H  HG21 . THR A 1 52  ? -14.226 -6.052  1.158   1.00 10.00 ? 52  THR A HG21 1  
ATOM   726   H  HG22 . THR A 1 52  ? -13.216 -7.207  0.255   1.00 10.00 ? 52  THR A HG22 1  
ATOM   727   H  HG23 . THR A 1 52  ? -13.159 -7.168  2.029   1.00 10.00 ? 52  THR A HG23 1  
ATOM   728   N  N    . ASN A 1 53  ? -13.868 -3.360  -1.385  1.00 10.00 ? 53  ASN A N    1  
ATOM   729   C  CA   . ASN A 1 53  ? -14.874 -2.317  -1.530  1.00 10.00 ? 53  ASN A CA   1  
ATOM   730   C  C    . ASN A 1 53  ? -16.259 -2.868  -1.215  1.00 10.00 ? 53  ASN A C    1  
ATOM   731   O  O    . ASN A 1 53  ? -16.652 -3.907  -1.741  1.00 10.00 ? 53  ASN A O    1  
ATOM   732   C  CB   . ASN A 1 53  ? -14.838 -1.753  -2.953  1.00 10.00 ? 53  ASN A CB   1  
ATOM   733   C  CG   . ASN A 1 53  ? -15.527 -0.400  -3.058  1.00 10.00 ? 53  ASN A CG   1  
ATOM   734   O  OD1  . ASN A 1 53  ? -16.680 -0.235  -2.665  1.00 10.00 ? 53  ASN A OD1  1  
ATOM   735   N  ND2  . ASN A 1 53  ? -14.786 0.594   -3.549  1.00 10.00 ? 53  ASN A ND2  1  
ATOM   736   H  H    . ASN A 1 53  ? -13.344 -3.640  -2.209  1.00 10.00 ? 53  ASN A H    1  
ATOM   737   H  HA   . ASN A 1 53  ? -14.635 -1.519  -0.830  1.00 10.00 ? 53  ASN A HA   1  
ATOM   738   H  HB2  . ASN A 1 53  ? -13.798 -1.597  -3.214  1.00 10.00 ? 53  ASN A HB2  1  
ATOM   739   H  HB3  . ASN A 1 53  ? -15.284 -2.456  -3.658  1.00 10.00 ? 53  ASN A HB3  1  
ATOM   740   H  HD21 . ASN A 1 53  ? -13.833 0.416   -3.825  1.00 10.00 ? 53  ASN A HD21 1  
ATOM   741   H  HD22 . ASN A 1 53  ? -15.122 1.542   -3.531  1.00 10.00 ? 53  ASN A HD22 1  
ATOM   742   N  N    . LYS A 1 54  ? -16.978 -2.178  -0.329  1.00 10.00 ? 54  LYS A N    1  
ATOM   743   C  CA   . LYS A 1 54  ? -18.322 -2.526  0.096   1.00 10.00 ? 54  LYS A CA   1  
ATOM   744   C  C    . LYS A 1 54  ? -19.088 -1.211  0.252   1.00 10.00 ? 54  LYS A C    1  
ATOM   745   O  O    . LYS A 1 54  ? -19.622 -0.896  1.314   1.00 10.00 ? 54  LYS A O    1  
ATOM   746   C  CB   . LYS A 1 54  ? -18.244 -3.305  1.415   1.00 10.00 ? 54  LYS A CB   1  
ATOM   747   C  CG   . LYS A 1 54  ? -17.544 -4.671  1.345   1.00 10.00 ? 54  LYS A CG   1  
ATOM   748   C  CD   . LYS A 1 54  ? -18.279 -5.725  0.504   1.00 10.00 ? 54  LYS A CD   1  
ATOM   749   C  CE   . LYS A 1 54  ? -19.655 -6.075  1.094   1.00 10.00 ? 54  LYS A CE   1  
ATOM   750   N  NZ   . LYS A 1 54  ? -20.297 -7.194  0.375   1.00 10.00 ? 54  LYS A NZ   1  
ATOM   751   H  H    . LYS A 1 54  ? -16.605 -1.307  0.025   1.00 10.00 ? 54  LYS A H    1  
ATOM   752   H  HA   . LYS A 1 54  ? -18.835 -3.120  -0.661  1.00 10.00 ? 54  LYS A HA   1  
ATOM   753   H  HB2  . LYS A 1 54  ? -17.659 -2.693  2.091   1.00 10.00 ? 54  LYS A HB2  1  
ATOM   754   H  HB3  . LYS A 1 54  ? -19.239 -3.410  1.839   1.00 10.00 ? 54  LYS A HB3  1  
ATOM   755   H  HG2  . LYS A 1 54  ? -16.538 -4.536  0.945   1.00 10.00 ? 54  LYS A HG2  1  
ATOM   756   H  HG3  . LYS A 1 54  ? -17.433 -5.045  2.364   1.00 10.00 ? 54  LYS A HG3  1  
ATOM   757   H  HD2  . LYS A 1 54  ? -18.381 -5.366  -0.522  1.00 10.00 ? 54  LYS A HD2  1  
ATOM   758   H  HD3  . LYS A 1 54  ? -17.649 -6.617  0.486   1.00 10.00 ? 54  LYS A HD3  1  
ATOM   759   H  HE2  . LYS A 1 54  ? -19.537 -6.349  2.145   1.00 10.00 ? 54  LYS A HE2  1  
ATOM   760   H  HE3  . LYS A 1 54  ? -20.313 -5.206  1.034   1.00 10.00 ? 54  LYS A HE3  1  
ATOM   761   H  HZ1  . LYS A 1 54  ? -20.435 -6.950  -0.596  1.00 10.00 ? 54  LYS A HZ1  1  
ATOM   762   H  HZ2  . LYS A 1 54  ? -19.721 -8.023  0.430   1.00 10.00 ? 54  LYS A HZ2  1  
ATOM   763   H  HZ3  . LYS A 1 54  ? -21.197 -7.395  0.791   1.00 10.00 ? 54  LYS A HZ3  1  
ATOM   764   N  N    . SER A 1 55  ? -19.118 -0.458  -0.846  1.00 10.00 ? 55  SER A N    1  
ATOM   765   C  CA   . SER A 1 55  ? -19.860 0.788   -0.993  1.00 10.00 ? 55  SER A CA   1  
ATOM   766   C  C    . SER A 1 55  ? -20.164 1.078   -2.468  1.00 10.00 ? 55  SER A C    1  
ATOM   767   O  O    . SER A 1 55  ? -21.268 1.526   -2.766  1.00 10.00 ? 55  SER A O    1  
ATOM   768   C  CB   . SER A 1 55  ? -19.114 1.967   -0.354  1.00 10.00 ? 55  SER A CB   1  
ATOM   769   O  OG   . SER A 1 55  ? -19.029 1.833   1.055   1.00 10.00 ? 55  SER A OG   1  
ATOM   770   H  H    . SER A 1 55  ? -18.619 -0.822  -1.646  1.00 10.00 ? 55  SER A H    1  
ATOM   771   H  HA   . SER A 1 55  ? -20.819 0.685   -0.480  1.00 10.00 ? 55  SER A HA   1  
ATOM   772   H  HB2  . SER A 1 55  ? -18.124 2.073   -0.795  1.00 10.00 ? 55  SER A HB2  1  
ATOM   773   H  HB3  . SER A 1 55  ? -19.680 2.875   -0.560  1.00 10.00 ? 55  SER A HB3  1  
ATOM   774   H  HG   . SER A 1 55  ? -18.288 1.262   1.294   1.00 10.00 ? 55  SER A HG   1  
ATOM   775   N  N    . ASP A 1 56  ? -19.206 0.829   -3.376  1.00 10.00 ? 56  ASP A N    1  
ATOM   776   C  CA   . ASP A 1 56  ? -19.308 1.049   -4.807  1.00 10.00 ? 56  ASP A CA   1  
ATOM   777   C  C    . ASP A 1 56  ? -19.430 2.525   -5.167  1.00 10.00 ? 56  ASP A C    1  
ATOM   778   O  O    . ASP A 1 56  ? -20.404 2.971   -5.772  1.00 10.00 ? 56  ASP A O    1  
ATOM   779   C  CB   . ASP A 1 56  ? -20.354 0.126   -5.450  1.00 10.00 ? 56  ASP A CB   1  
ATOM   780   C  CG   . ASP A 1 56  ? -19.886 -1.317  -5.427  1.00 10.00 ? 56  ASP A CG   1  
ATOM   781   O  OD1  . ASP A 1 56  ? -18.665 -1.541  -5.583  1.00 10.00 ? 56  ASP A OD1  1  
ATOM   782   O  OD2  . ASP A 1 56  ? -20.749 -2.217  -5.301  1.00 10.00 ? 56  ASP A OD2  1  
ATOM   783   H  H    . ASP A 1 56  ? -18.326 0.404   -3.116  1.00 10.00 ? 56  ASP A H    1  
ATOM   784   H  HA   . ASP A 1 56  ? -18.332 0.764   -5.187  1.00 10.00 ? 56  ASP A HA   1  
ATOM   785   H  HB2  . ASP A 1 56  ? -21.313 0.213   -4.939  1.00 10.00 ? 56  ASP A HB2  1  
ATOM   786   H  HB3  . ASP A 1 56  ? -20.508 0.409   -6.490  1.00 10.00 ? 56  ASP A HB3  1  
ATOM   787   N  N    . GLN A 1 57  ? -18.383 3.278   -4.817  1.00 10.00 ? 57  GLN A N    1  
ATOM   788   C  CA   . GLN A 1 57  ? -18.210 4.685   -5.121  1.00 10.00 ? 57  GLN A CA   1  
ATOM   789   C  C    . GLN A 1 57  ? -16.786 4.883   -5.667  1.00 10.00 ? 57  GLN A C    1  
ATOM   790   O  O    . GLN A 1 57  ? -15.905 4.077   -5.360  1.00 10.00 ? 57  GLN A O    1  
ATOM   791   C  CB   . GLN A 1 57  ? -18.408 5.501   -3.835  1.00 10.00 ? 57  GLN A CB   1  
ATOM   792   C  CG   . GLN A 1 57  ? -19.852 5.970   -3.595  1.00 10.00 ? 57  GLN A CG   1  
ATOM   793   C  CD   . GLN A 1 57  ? -20.680 4.946   -2.830  1.00 10.00 ? 57  GLN A CD   1  
ATOM   794   O  OE1  . GLN A 1 57  ? -20.642 4.910   -1.606  1.00 10.00 ? 57  GLN A OE1  1  
ATOM   795   N  NE2  . GLN A 1 57  ? -21.414 4.097   -3.533  1.00 10.00 ? 57  GLN A NE2  1  
ATOM   796   H  H    . GLN A 1 57  ? -17.574 2.826   -4.418  1.00 10.00 ? 57  GLN A H    1  
ATOM   797   H  HA   . GLN A 1 57  ? -18.931 4.988   -5.879  1.00 10.00 ? 57  GLN A HA   1  
ATOM   798   H  HB2  . GLN A 1 57  ? -18.050 4.926   -2.973  1.00 10.00 ? 57  GLN A HB2  1  
ATOM   799   H  HB3  . GLN A 1 57  ? -17.800 6.398   -3.930  1.00 10.00 ? 57  GLN A HB3  1  
ATOM   800   H  HG2  . GLN A 1 57  ? -19.813 6.866   -2.975  1.00 10.00 ? 57  GLN A HG2  1  
ATOM   801   H  HG3  . GLN A 1 57  ? -20.340 6.236   -4.533  1.00 10.00 ? 57  GLN A HG3  1  
ATOM   802   H  HE21 . GLN A 1 57  ? -21.324 4.048   -4.544  1.00 10.00 ? 57  GLN A HE21 1  
ATOM   803   H  HE22 . GLN A 1 57  ? -21.812 3.292   -3.055  1.00 10.00 ? 57  GLN A HE22 1  
ATOM   804   N  N    . PRO A 1 58  ? -16.544 5.939   -6.464  1.00 10.00 ? 58  PRO A N    1  
ATOM   805   C  CA   . PRO A 1 58  ? -15.247 6.225   -7.062  1.00 10.00 ? 58  PRO A CA   1  
ATOM   806   C  C    . PRO A 1 58  ? -14.287 6.865   -6.045  1.00 10.00 ? 58  PRO A C    1  
ATOM   807   O  O    . PRO A 1 58  ? -14.027 8.072   -6.088  1.00 10.00 ? 58  PRO A O    1  
ATOM   808   C  CB   . PRO A 1 58  ? -15.563 7.140   -8.248  1.00 10.00 ? 58  PRO A CB   1  
ATOM   809   C  CG   . PRO A 1 58  ? -16.788 7.919   -7.766  1.00 10.00 ? 58  PRO A CG   1  
ATOM   810   C  CD   . PRO A 1 58  ? -17.551 6.866   -6.962  1.00 10.00 ? 58  PRO A CD   1  
ATOM   811   H  HA   . PRO A 1 58  ? -14.801 5.312   -7.440  1.00 10.00 ? 58  PRO A HA   1  
ATOM   812   H  HB2  . PRO A 1 58  ? -14.727 7.786   -8.509  1.00 10.00 ? 58  PRO A HB2  1  
ATOM   813   H  HB3  . PRO A 1 58  ? -15.847 6.530   -9.108  1.00 10.00 ? 58  PRO A HB3  1  
ATOM   814   H  HG2  . PRO A 1 58  ? -16.474 8.729   -7.104  1.00 10.00 ? 58  PRO A HG2  1  
ATOM   815   H  HG3  . PRO A 1 58  ? -17.378 8.317   -8.594  1.00 10.00 ? 58  PRO A HG3  1  
ATOM   816   H  HD2  . PRO A 1 58  ? -18.117 7.342   -6.159  1.00 10.00 ? 58  PRO A HD2  1  
ATOM   817   H  HD3  . PRO A 1 58  ? -18.234 6.339   -7.632  1.00 10.00 ? 58  PRO A HD3  1  
ATOM   818   N  N    . ILE A 1 59  ? -13.745 6.050   -5.138  1.00 10.00 ? 59  ILE A N    1  
ATOM   819   C  CA   . ILE A 1 59  ? -12.819 6.511   -4.104  1.00 10.00 ? 59  ILE A CA   1  
ATOM   820   C  C    . ILE A 1 59  ? -11.406 6.579   -4.693  1.00 10.00 ? 59  ILE A C    1  
ATOM   821   O  O    . ILE A 1 59  ? -11.060 5.787   -5.567  1.00 10.00 ? 59  ILE A O    1  
ATOM   822   C  CB   . ILE A 1 59  ? -12.904 5.612   -2.846  1.00 10.00 ? 59  ILE A CB   1  
ATOM   823   C  CG1  . ILE A 1 59  ? -14.030 6.057   -1.894  1.00 10.00 ? 59  ILE A CG1  1  
ATOM   824   C  CG2  . ILE A 1 59  ? -11.610 5.606   -2.011  1.00 10.00 ? 59  ILE A CG2  1  
ATOM   825   C  CD1  . ILE A 1 59  ? -15.424 5.920   -2.499  1.00 10.00 ? 59  ILE A CD1  1  
ATOM   826   H  H    . ILE A 1 59  ? -13.951 5.059   -5.221  1.00 10.00 ? 59  ILE A H    1  
ATOM   827   H  HA   . ILE A 1 59  ? -13.107 7.518   -3.809  1.00 10.00 ? 59  ILE A HA   1  
ATOM   828   H  HB   . ILE A 1 59  ? -13.094 4.583   -3.152  1.00 10.00 ? 59  ILE A HB   1  
ATOM   829   H  HG12 . ILE A 1 59  ? -14.005 5.435   -0.998  1.00 10.00 ? 59  ILE A HG12 1  
ATOM   830   H  HG13 . ILE A 1 59  ? -13.873 7.094   -1.593  1.00 10.00 ? 59  ILE A HG13 1  
ATOM   831   H  HG21 . ILE A 1 59  ? -11.367 6.616   -1.679  1.00 10.00 ? 59  ILE A HG21 1  
ATOM   832   H  HG22 . ILE A 1 59  ? -11.741 4.979   -1.128  1.00 10.00 ? 59  ILE A HG22 1  
ATOM   833   H  HG23 . ILE A 1 59  ? -10.774 5.200   -2.581  1.00 10.00 ? 59  ILE A HG23 1  
ATOM   834   H  HD11 . ILE A 1 59  ? -15.568 4.900   -2.854  1.00 10.00 ? 59  ILE A HD11 1  
ATOM   835   H  HD12 . ILE A 1 59  ? -16.168 6.141   -1.734  1.00 10.00 ? 59  ILE A HD12 1  
ATOM   836   H  HD13 . ILE A 1 59  ? -15.546 6.626   -3.319  1.00 10.00 ? 59  ILE A HD13 1  
ATOM   837   N  N    . LYS A 1 60  ? -10.589 7.525   -4.221  1.00 10.00 ? 60  LYS A N    1  
ATOM   838   C  CA   . LYS A 1 60  ? -9.204  7.707   -4.601  1.00 10.00 ? 60  LYS A CA   1  
ATOM   839   C  C    . LYS A 1 60  ? -8.308  7.830   -3.367  1.00 10.00 ? 60  LYS A C    1  
ATOM   840   O  O    . LYS A 1 60  ? -8.184  8.893   -2.752  1.00 10.00 ? 60  LYS A O    1  
ATOM   841   C  CB   . LYS A 1 60  ? -9.043  8.813   -5.651  1.00 10.00 ? 60  LYS A CB   1  
ATOM   842   C  CG   . LYS A 1 60  ? -9.439  10.268  -5.355  1.00 10.00 ? 60  LYS A CG   1  
ATOM   843   C  CD   . LYS A 1 60  ? -10.754 10.730  -6.017  1.00 10.00 ? 60  LYS A CD   1  
ATOM   844   C  CE   . LYS A 1 60  ? -11.851 10.581  -4.959  1.00 10.00 ? 60  LYS A CE   1  
ATOM   845   N  NZ   . LYS A 1 60  ? -13.246 10.526  -5.425  1.00 10.00 ? 60  LYS A NZ   1  
ATOM   846   H  H    . LYS A 1 60  ? -10.949 8.164   -3.520  1.00 10.00 ? 60  LYS A H    1  
ATOM   847   H  HA   . LYS A 1 60  ? -8.875  6.799   -5.102  1.00 10.00 ? 60  LYS A HA   1  
ATOM   848   H  HB2  . LYS A 1 60  ? -7.985  8.828   -5.885  1.00 10.00 ? 60  LYS A HB2  1  
ATOM   849   H  HB3  . LYS A 1 60  ? -9.593  8.475   -6.517  1.00 10.00 ? 60  LYS A HB3  1  
ATOM   850   H  HG2  . LYS A 1 60  ? -9.471  10.432  -4.280  1.00 10.00 ? 60  LYS A HG2  1  
ATOM   851   H  HG3  . LYS A 1 60  ? -8.645  10.892  -5.773  1.00 10.00 ? 60  LYS A HG3  1  
ATOM   852   H  HD2  . LYS A 1 60  ? -10.654 11.782  -6.295  1.00 10.00 ? 60  LYS A HD2  1  
ATOM   853   H  HD3  . LYS A 1 60  ? -10.952 10.151  -6.920  1.00 10.00 ? 60  LYS A HD3  1  
ATOM   854   H  HE2  . LYS A 1 60  ? -11.714 9.610   -4.526  1.00 10.00 ? 60  LYS A HE2  1  
ATOM   855   H  HE3  . LYS A 1 60  ? -11.730 11.339  -4.183  1.00 10.00 ? 60  LYS A HE3  1  
ATOM   856   H  HZ1  . LYS A 1 60  ? -13.770 10.408  -4.551  1.00 10.00 ? 60  LYS A HZ1  1  
ATOM   857   H  HZ2  . LYS A 1 60  ? -13.448 9.682   -5.960  1.00 10.00 ? 60  LYS A HZ2  1  
ATOM   858   H  HZ3  . LYS A 1 60  ? -13.549 11.367  -5.887  1.00 10.00 ? 60  LYS A HZ3  1  
ATOM   859   N  N    . LEU A 1 61  ? -7.664  6.707   -3.037  1.00 10.00 ? 61  LEU A N    1  
ATOM   860   C  CA   . LEU A 1 61  ? -6.743  6.533   -1.936  1.00 10.00 ? 61  LEU A CA   1  
ATOM   861   C  C    . LEU A 1 61  ? -5.402  7.044   -2.440  1.00 10.00 ? 61  LEU A C    1  
ATOM   862   O  O    . LEU A 1 61  ? -4.916  6.545   -3.451  1.00 10.00 ? 61  LEU A O    1  
ATOM   863   C  CB   . LEU A 1 61  ? -6.759  5.037   -1.585  1.00 10.00 ? 61  LEU A CB   1  
ATOM   864   C  CG   . LEU A 1 61  ? -5.628  4.467   -0.722  1.00 10.00 ? 61  LEU A CG   1  
ATOM   865   C  CD1  . LEU A 1 61  ? -4.323  4.330   -1.505  1.00 10.00 ? 61  LEU A CD1  1  
ATOM   866   C  CD2  . LEU A 1 61  ? -5.413  5.247   0.570   1.00 10.00 ? 61  LEU A CD2  1  
ATOM   867   H  H    . LEU A 1 61  ? -7.707  5.913   -3.661  1.00 10.00 ? 61  LEU A H    1  
ATOM   868   H  HA   . LEU A 1 61  ? -7.066  7.077   -1.057  1.00 10.00 ? 61  LEU A HA   1  
ATOM   869   H  HB2  . LEU A 1 61  ? -7.695  4.857   -1.058  1.00 10.00 ? 61  LEU A HB2  1  
ATOM   870   H  HB3  . LEU A 1 61  ? -6.778  4.459   -2.509  1.00 10.00 ? 61  LEU A HB3  1  
ATOM   871   H  HG   . LEU A 1 61  ? -5.936  3.456   -0.451  1.00 10.00 ? 61  LEU A HG   1  
ATOM   872   H  HD11 . LEU A 1 61  ? -3.764  5.262   -1.493  1.00 10.00 ? 61  LEU A HD11 1  
ATOM   873   H  HD12 . LEU A 1 61  ? -3.708  3.551   -1.056  1.00 10.00 ? 61  LEU A HD12 1  
ATOM   874   H  HD13 . LEU A 1 61  ? -4.560  4.060   -2.534  1.00 10.00 ? 61  LEU A HD13 1  
ATOM   875   H  HD21 . LEU A 1 61  ? -5.108  6.272   0.371   1.00 10.00 ? 61  LEU A HD21 1  
ATOM   876   H  HD22 . LEU A 1 61  ? -6.334  5.249   1.152   1.00 10.00 ? 61  LEU A HD22 1  
ATOM   877   H  HD23 . LEU A 1 61  ? -4.628  4.739   1.125   1.00 10.00 ? 61  LEU A HD23 1  
ATOM   878   N  N    . VAL A 1 62  ? -4.821  8.042   -1.765  1.00 10.00 ? 62  VAL A N    1  
ATOM   879   C  CA   . VAL A 1 62  ? -3.524  8.595   -2.129  1.00 10.00 ? 62  VAL A CA   1  
ATOM   880   C  C    . VAL A 1 62  ? -2.773  8.962   -0.847  1.00 10.00 ? 62  VAL A C    1  
ATOM   881   O  O    . VAL A 1 62  ? -2.289  10.077  -0.668  1.00 10.00 ? 62  VAL A O    1  
ATOM   882   C  CB   . VAL A 1 62  ? -3.719  9.758   -3.130  1.00 10.00 ? 62  VAL A CB   1  
ATOM   883   C  CG1  . VAL A 1 62  ? -4.651  10.867  -2.626  1.00 10.00 ? 62  VAL A CG1  1  
ATOM   884   C  CG2  . VAL A 1 62  ? -2.394  10.373  -3.608  1.00 10.00 ? 62  VAL A CG2  1  
ATOM   885   H  H    . VAL A 1 62  ? -5.261  8.418   -0.932  1.00 10.00 ? 62  VAL A H    1  
ATOM   886   H  HA   . VAL A 1 62  ? -2.932  7.828   -2.627  1.00 10.00 ? 62  VAL A HA   1  
ATOM   887   H  HB   . VAL A 1 62  ? -4.205  9.331   -4.006  1.00 10.00 ? 62  VAL A HB   1  
ATOM   888   H  HG11 . VAL A 1 62  ? -4.757  11.619  -3.410  1.00 10.00 ? 62  VAL A HG11 1  
ATOM   889   H  HG12 . VAL A 1 62  ? -5.636  10.460  -2.399  1.00 10.00 ? 62  VAL A HG12 1  
ATOM   890   H  HG13 . VAL A 1 62  ? -4.244  11.343  -1.735  1.00 10.00 ? 62  VAL A HG13 1  
ATOM   891   H  HG21 . VAL A 1 62  ? -2.570  10.938  -4.522  1.00 10.00 ? 62  VAL A HG21 1  
ATOM   892   H  HG22 . VAL A 1 62  ? -1.661  9.592   -3.811  1.00 10.00 ? 62  VAL A HG22 1  
ATOM   893   H  HG23 . VAL A 1 62  ? -1.983  11.057  -2.868  1.00 10.00 ? 62  VAL A HG23 1  
ATOM   894   N  N    . GLY A 1 63  ? -2.638  7.989   0.055   1.00 10.00 ? 63  GLY A N    1  
ATOM   895   C  CA   . GLY A 1 63  ? -1.721  8.116   1.168   1.00 10.00 ? 63  GLY A CA   1  
ATOM   896   C  C    . GLY A 1 63  ? -1.431  6.755   1.775   1.00 10.00 ? 63  GLY A C    1  
ATOM   897   O  O    . GLY A 1 63  ? -2.302  5.887   1.779   1.00 10.00 ? 63  GLY A O    1  
ATOM   898   H  H    . GLY A 1 63  ? -3.066  7.086   -0.103  1.00 10.00 ? 63  GLY A H    1  
ATOM   899   H  HA2  . GLY A 1 63  ? -0.782  8.528   0.787   1.00 10.00 ? 63  GLY A HA2  1  
ATOM   900   H  HA3  . GLY A 1 63  ? -2.131  8.779   1.928   1.00 10.00 ? 63  GLY A HA3  1  
ATOM   901   N  N    . ALA A 1 64  ? -0.223  6.602   2.311   1.00 10.00 ? 64  ALA A N    1  
ATOM   902   C  CA   . ALA A 1 64  ? 0.231   5.458   3.086   1.00 10.00 ? 64  ALA A CA   1  
ATOM   903   C  C    . ALA A 1 64  ? 1.388   5.926   3.977   1.00 10.00 ? 64  ALA A C    1  
ATOM   904   O  O    . ALA A 1 64  ? 2.517   5.462   3.841   1.00 10.00 ? 64  ALA A O    1  
ATOM   905   C  CB   . ALA A 1 64  ? 0.651   4.344   2.123   1.00 10.00 ? 64  ALA A CB   1  
ATOM   906   H  H    . ALA A 1 64  ? 0.425   7.364   2.201   1.00 10.00 ? 64  ALA A H    1  
ATOM   907   H  HA   . ALA A 1 64  ? -0.574  5.092   3.725   1.00 10.00 ? 64  ALA A HA   1  
ATOM   908   H  HB1  . ALA A 1 64  ? 1.093   3.516   2.674   1.00 10.00 ? 64  ALA A HB1  1  
ATOM   909   H  HB2  . ALA A 1 64  ? -0.219  3.980   1.574   1.00 10.00 ? 64  ALA A HB2  1  
ATOM   910   H  HB3  . ALA A 1 64  ? 1.384   4.726   1.413   1.00 10.00 ? 64  ALA A HB3  1  
ATOM   911   N  N    . ALA A 1 65  ? 1.121   6.900   4.851   1.00 10.00 ? 65  ALA A N    1  
ATOM   912   C  CA   . ALA A 1 65  ? 2.154   7.557   5.647   1.00 10.00 ? 65  ALA A CA   1  
ATOM   913   C  C    . ALA A 1 65  ? 2.415   6.737   6.908   1.00 10.00 ? 65  ALA A C    1  
ATOM   914   O  O    . ALA A 1 65  ? 1.477   6.182   7.472   1.00 10.00 ? 65  ALA A O    1  
ATOM   915   C  CB   . ALA A 1 65  ? 1.703   8.976   6.000   1.00 10.00 ? 65  ALA A CB   1  
ATOM   916   H  H    . ALA A 1 65  ? 0.149   7.127   5.048   1.00 10.00 ? 65  ALA A H    1  
ATOM   917   H  HA   . ALA A 1 65  ? 3.074   7.630   5.064   1.00 10.00 ? 65  ALA A HA   1  
ATOM   918   H  HB1  . ALA A 1 65  ? 1.530   9.545   5.086   1.00 10.00 ? 65  ALA A HB1  1  
ATOM   919   H  HB2  . ALA A 1 65  ? 0.781   8.942   6.581   1.00 10.00 ? 65  ALA A HB2  1  
ATOM   920   H  HB3  . ALA A 1 65  ? 2.476   9.472   6.587   1.00 10.00 ? 65  ALA A HB3  1  
ATOM   921   N  N    . THR A 1 66  ? 3.669   6.628   7.357   1.00 10.00 ? 66  THR A N    1  
ATOM   922   C  CA   . THR A 1 66  ? 4.011   5.730   8.453   1.00 10.00 ? 66  THR A CA   1  
ATOM   923   C  C    . THR A 1 66  ? 5.447   5.995   8.927   1.00 10.00 ? 66  THR A C    1  
ATOM   924   O  O    . THR A 1 66  ? 6.310   6.347   8.111   1.00 10.00 ? 66  THR A O    1  
ATOM   925   C  CB   . THR A 1 66  ? 3.828   4.274   7.975   1.00 10.00 ? 66  THR A CB   1  
ATOM   926   O  OG1  . THR A 1 66  ? 4.267   3.363   8.955   1.00 10.00 ? 66  THR A OG1  1  
ATOM   927   C  CG2  . THR A 1 66  ? 4.536   3.984   6.646   1.00 10.00 ? 66  THR A CG2  1  
ATOM   928   H  H    . THR A 1 66  ? 4.431   7.076   6.869   1.00 10.00 ? 66  THR A H    1  
ATOM   929   H  HA   . THR A 1 66  ? 3.319   5.920   9.274   1.00 10.00 ? 66  THR A HA   1  
ATOM   930   H  HB   . THR A 1 66  ? 2.775   4.070   7.807   1.00 10.00 ? 66  THR A HB   1  
ATOM   931   H  HG1  . THR A 1 66  ? 3.564   3.263   9.615   1.00 10.00 ? 66  THR A HG1  1  
ATOM   932   H  HG21 . THR A 1 66  ? 5.582   4.270   6.697   1.00 10.00 ? 66  THR A HG21 1  
ATOM   933   H  HG22 . THR A 1 66  ? 4.457   2.919   6.423   1.00 10.00 ? 66  THR A HG22 1  
ATOM   934   H  HG23 . THR A 1 66  ? 4.061   4.532   5.833   1.00 10.00 ? 66  THR A HG23 1  
ATOM   935   N  N    . PRO A 1 67  ? 5.776   5.792   10.214  1.00 10.00 ? 67  PRO A N    1  
ATOM   936   C  CA   . PRO A 1 67  ? 7.154   5.783   10.685  1.00 10.00 ? 67  PRO A CA   1  
ATOM   937   C  C    . PRO A 1 67  ? 7.848   4.464   10.293  1.00 10.00 ? 67  PRO A C    1  
ATOM   938   O  O    . PRO A 1 67  ? 8.491   3.826   11.121  1.00 10.00 ? 67  PRO A O    1  
ATOM   939   C  CB   . PRO A 1 67  ? 7.046   5.990   12.200  1.00 10.00 ? 67  PRO A CB   1  
ATOM   940   C  CG   . PRO A 1 67  ? 5.735   5.285   12.542  1.00 10.00 ? 67  PRO A CG   1  
ATOM   941   C  CD   . PRO A 1 67  ? 4.857   5.568   11.321  1.00 10.00 ? 67  PRO A CD   1  
ATOM   942   H  HA   . PRO A 1 67  ? 7.720   6.616   10.271  1.00 10.00 ? 67  PRO A HA   1  
ATOM   943   H  HB2  . PRO A 1 67  ? 7.893   5.594   12.762  1.00 10.00 ? 67  PRO A HB2  1  
ATOM   944   H  HB3  . PRO A 1 67  ? 6.935   7.055   12.409  1.00 10.00 ? 67  PRO A HB3  1  
ATOM   945   H  HG2  . PRO A 1 67  ? 5.925   4.215   12.618  1.00 10.00 ? 67  PRO A HG2  1  
ATOM   946   H  HG3  . PRO A 1 67  ? 5.292   5.654   13.468  1.00 10.00 ? 67  PRO A HG3  1  
ATOM   947   H  HD2  . PRO A 1 67  ? 4.190   4.726   11.150  1.00 10.00 ? 67  PRO A HD2  1  
ATOM   948   H  HD3  . PRO A 1 67  ? 4.275   6.475   11.494  1.00 10.00 ? 67  PRO A HD3  1  
ATOM   949   N  N    . LEU A 1 68  ? 7.743   4.075   9.016   1.00 10.00 ? 68  LEU A N    1  
ATOM   950   C  CA   . LEU A 1 68  ? 8.293   2.846   8.455   1.00 10.00 ? 68  LEU A CA   1  
ATOM   951   C  C    . LEU A 1 68  ? 9.165   3.244   7.260   1.00 10.00 ? 68  LEU A C    1  
ATOM   952   O  O    . LEU A 1 68  ? 10.391  3.196   7.332   1.00 10.00 ? 68  LEU A O    1  
ATOM   953   C  CB   . LEU A 1 68  ? 7.122   1.914   8.075   1.00 10.00 ? 68  LEU A CB   1  
ATOM   954   C  CG   . LEU A 1 68  ? 7.443   0.436   7.805   1.00 10.00 ? 68  LEU A CG   1  
ATOM   955   C  CD1  . LEU A 1 68  ? 8.660   0.217   6.901   1.00 10.00 ? 68  LEU A CD1  1  
ATOM   956   C  CD2  . LEU A 1 68  ? 7.583   -0.334  9.119   1.00 10.00 ? 68  LEU A CD2  1  
ATOM   957   H  H    . LEU A 1 68  ? 7.215   4.660   8.384   1.00 10.00 ? 68  LEU A H    1  
ATOM   958   H  HA   . LEU A 1 68  ? 8.921   2.343   9.191   1.00 10.00 ? 68  LEU A HA   1  
ATOM   959   H  HB2  . LEU A 1 68  ? 6.399   1.933   8.890   1.00 10.00 ? 68  LEU A HB2  1  
ATOM   960   H  HB3  . LEU A 1 68  ? 6.617   2.294   7.192   1.00 10.00 ? 68  LEU A HB3  1  
ATOM   961   H  HG   . LEU A 1 68  ? 6.580   0.013   7.288   1.00 10.00 ? 68  LEU A HG   1  
ATOM   962   H  HD11 . LEU A 1 68  ? 9.577   0.500   7.417   1.00 10.00 ? 68  LEU A HD11 1  
ATOM   963   H  HD12 . LEU A 1 68  ? 8.718   -0.837  6.631   1.00 10.00 ? 68  LEU A HD12 1  
ATOM   964   H  HD13 . LEU A 1 68  ? 8.554   0.797   5.984   1.00 10.00 ? 68  LEU A HD13 1  
ATOM   965   H  HD21 . LEU A 1 68  ? 6.630   -0.322  9.646   1.00 10.00 ? 68  LEU A HD21 1  
ATOM   966   H  HD22 . LEU A 1 68  ? 7.848   -1.371  8.913   1.00 10.00 ? 68  LEU A HD22 1  
ATOM   967   H  HD23 . LEU A 1 68  ? 8.340   0.125   9.753   1.00 10.00 ? 68  LEU A HD23 1  
ATOM   968   N  N    . ALA A 1 69  ? 8.533   3.694   6.172   1.00 10.00 ? 69  ALA A N    1  
ATOM   969   C  CA   . ALA A 1 69  ? 9.173   4.020   4.906   1.00 10.00 ? 69  ALA A CA   1  
ATOM   970   C  C    . ALA A 1 69  ? 9.164   5.527   4.683   1.00 10.00 ? 69  ALA A C    1  
ATOM   971   O  O    . ALA A 1 69  ? 8.264   6.217   5.162   1.00 10.00 ? 69  ALA A O    1  
ATOM   972   C  CB   . ALA A 1 69  ? 8.414   3.312   3.792   1.00 10.00 ? 69  ALA A CB   1  
ATOM   973   H  H    . ALA A 1 69  ? 7.528   3.764   6.193   1.00 10.00 ? 69  ALA A H    1  
ATOM   974   H  HA   . ALA A 1 69  ? 10.204  3.669   4.891   1.00 10.00 ? 69  ALA A HA   1  
ATOM   975   H  HB1  . ALA A 1 69  ? 8.791   3.631   2.826   1.00 10.00 ? 69  ALA A HB1  1  
ATOM   976   H  HB2  . ALA A 1 69  ? 8.567   2.239   3.901   1.00 10.00 ? 69  ALA A HB2  1  
ATOM   977   H  HB3  . ALA A 1 69  ? 7.351   3.548   3.849   1.00 10.00 ? 69  ALA A HB3  1  
ATOM   978   N  N    . THR A 1 70  ? 10.193  6.055   4.022   1.00 10.00 ? 70  THR A N    1  
ATOM   979   C  CA   . THR A 1 70  ? 10.343  7.480   3.753   1.00 10.00 ? 70  THR A CA   1  
ATOM   980   C  C    . THR A 1 70  ? 9.527   7.866   2.522   1.00 10.00 ? 70  THR A C    1  
ATOM   981   O  O    . THR A 1 70  ? 8.966   8.957   2.462   1.00 10.00 ? 70  THR A O    1  
ATOM   982   C  CB   . THR A 1 70  ? 11.830  7.819   3.562   1.00 10.00 ? 70  THR A CB   1  
ATOM   983   O  OG1  . THR A 1 70  ? 12.583  7.294   4.636   1.00 10.00 ? 70  THR A OG1  1  
ATOM   984   C  CG2  . THR A 1 70  ? 12.069  9.331   3.522   1.00 10.00 ? 70  THR A CG2  1  
ATOM   985   H  H    . THR A 1 70  ? 10.921  5.434   3.686   1.00 10.00 ? 70  THR A H    1  
ATOM   986   H  HA   . THR A 1 70  ? 9.970   8.050   4.603   1.00 10.00 ? 70  THR A HA   1  
ATOM   987   H  HB   . THR A 1 70  ? 12.193  7.381   2.630   1.00 10.00 ? 70  THR A HB   1  
ATOM   988   H  HG1  . THR A 1 70  ? 12.684  6.344   4.499   1.00 10.00 ? 70  THR A HG1  1  
ATOM   989   H  HG21 . THR A 1 70  ? 13.138  9.523   3.424   1.00 10.00 ? 70  THR A HG21 1  
ATOM   990   H  HG22 . THR A 1 70  ? 11.557  9.777   2.670   1.00 10.00 ? 70  THR A HG22 1  
ATOM   991   H  HG23 . THR A 1 70  ? 11.710  9.794   4.441   1.00 10.00 ? 70  THR A HG23 1  
ATOM   992   N  N    . SER A 1 71  ? 9.480   6.963   1.538   1.00 10.00 ? 71  SER A N    1  
ATOM   993   C  CA   . SER A 1 71  ? 8.953   7.217   0.212   1.00 10.00 ? 71  SER A CA   1  
ATOM   994   C  C    . SER A 1 71  ? 7.787   6.278   -0.102  1.00 10.00 ? 71  SER A C    1  
ATOM   995   O  O    . SER A 1 71  ? 7.967   5.340   -0.872  1.00 10.00 ? 71  SER A O    1  
ATOM   996   C  CB   . SER A 1 71  ? 10.124  7.074   -0.768  1.00 10.00 ? 71  SER A CB   1  
ATOM   997   O  OG   . SER A 1 71  ? 9.722   7.327   -2.095  1.00 10.00 ? 71  SER A OG   1  
ATOM   998   H  H    . SER A 1 71  ? 9.893   6.045   1.674   1.00 10.00 ? 71  SER A H    1  
ATOM   999   H  HA   . SER A 1 71  ? 8.581   8.229   0.103   1.00 10.00 ? 71  SER A HA   1  
ATOM   1000  H  HB2  . SER A 1 71  ? 10.917  7.778   -0.502  1.00 10.00 ? 71  SER A HB2  1  
ATOM   1001  H  HB3  . SER A 1 71  ? 10.539  6.071   -0.714  1.00 10.00 ? 71  SER A HB3  1  
ATOM   1002  H  HG   . SER A 1 71  ? 9.210   6.570   -2.407  1.00 10.00 ? 71  SER A HG   1  
ATOM   1003  N  N    . PRO A 1 72  ? 6.589   6.498   0.464   1.00 10.00 ? 72  PRO A N    1  
ATOM   1004  C  CA   . PRO A 1 72  ? 5.427   5.663   0.190   1.00 10.00 ? 72  PRO A CA   1  
ATOM   1005  C  C    . PRO A 1 72  ? 4.853   5.988   -1.171  1.00 10.00 ? 72  PRO A C    1  
ATOM   1006  O  O    . PRO A 1 72  ? 4.180   7.007   -1.283  1.00 10.00 ? 72  PRO A O    1  
ATOM   1007  C  CB   . PRO A 1 72  ? 4.443   6.001   1.311   1.00 10.00 ? 72  PRO A CB   1  
ATOM   1008  C  CG   . PRO A 1 72  ? 4.794   7.427   1.725   1.00 10.00 ? 72  PRO A CG   1  
ATOM   1009  C  CD   . PRO A 1 72  ? 6.308   7.461   1.519   1.00 10.00 ? 72  PRO A CD   1  
ATOM   1010  H  HA   . PRO A 1 72  ? 5.663   4.600   0.183   1.00 10.00 ? 72  PRO A HA   1  
ATOM   1011  H  HB2  . PRO A 1 72  ? 3.403   5.866   1.035   1.00 10.00 ? 72  PRO A HB2  1  
ATOM   1012  H  HB3  . PRO A 1 72  ? 4.636   5.355   2.150   1.00 10.00 ? 72  PRO A HB3  1  
ATOM   1013  H  HG2  . PRO A 1 72  ? 4.313   8.086   0.995   1.00 10.00 ? 72  PRO A HG2  1  
ATOM   1014  H  HG3  . PRO A 1 72  ? 4.515   7.643   2.766   1.00 10.00 ? 72  PRO A HG3  1  
ATOM   1015  H  HD2  . PRO A 1 72  ? 6.613   8.453   1.192   1.00 10.00 ? 72  PRO A HD2  1  
ATOM   1016  H  HD3  . PRO A 1 72  ? 6.800   7.176   2.455   1.00 10.00 ? 72  PRO A HD3  1  
ATOM   1017  N  N    . MET A 1 73  ? 5.156   5.150   -2.173  1.00 10.00 ? 73  MET A N    1  
ATOM   1018  C  CA   . MET A 1 73  ? 4.816   5.333   -3.576  1.00 10.00 ? 73  MET A CA   1  
ATOM   1019  C  C    . MET A 1 73  ? 3.751   4.323   -3.958  1.00 10.00 ? 73  MET A C    1  
ATOM   1020  O  O    . MET A 1 73  ? 3.900   3.138   -3.685  1.00 10.00 ? 73  MET A O    1  
ATOM   1021  C  CB   . MET A 1 73  ? 6.064   5.172   -4.436  1.00 10.00 ? 73  MET A CB   1  
ATOM   1022  C  CG   . MET A 1 73  ? 6.910   6.452   -4.385  1.00 10.00 ? 73  MET A CG   1  
ATOM   1023  S  SD   . MET A 1 73  ? 8.594   6.222   -4.994  1.00 10.00 ? 73  MET A SD   1  
ATOM   1024  C  CE   . MET A 1 73  ? 9.084   7.952   -5.177  1.00 10.00 ? 73  MET A CE   1  
ATOM   1025  H  H    . MET A 1 73  ? 5.766   4.356   -1.968  1.00 10.00 ? 73  MET A H    1  
ATOM   1026  H  HA   . MET A 1 73  ? 4.422   6.325   -3.730  1.00 10.00 ? 73  MET A HA   1  
ATOM   1027  H  HB2  . MET A 1 73  ? 6.613   4.339   -3.986  1.00 10.00 ? 73  MET A HB2  1  
ATOM   1028  H  HB3  . MET A 1 73  ? 5.762   4.964   -5.476  1.00 10.00 ? 73  MET A HB3  1  
ATOM   1029  H  HG2  . MET A 1 73  ? 6.416   7.200   -5.008  1.00 10.00 ? 73  MET A HG2  1  
ATOM   1030  H  HG3  . MET A 1 73  ? 6.979   6.834   -3.362  1.00 10.00 ? 73  MET A HG3  1  
ATOM   1031  H  HE1  . MET A 1 73  ? 8.956   8.481   -4.235  1.00 10.00 ? 73  MET A HE1  1  
ATOM   1032  H  HE2  . MET A 1 73  ? 8.463   8.421   -5.939  1.00 10.00 ? 73  MET A HE2  1  
ATOM   1033  H  HE3  . MET A 1 73  ? 10.128  7.995   -5.481  1.00 10.00 ? 73  MET A HE3  1  
ATOM   1034  N  N    . LEU A 1 74  ? 2.660   4.792   -4.561  1.00 10.00 ? 74  LEU A N    1  
ATOM   1035  C  CA   . LEU A 1 74  ? 1.546   3.963   -5.005  1.00 10.00 ? 74  LEU A CA   1  
ATOM   1036  C  C    . LEU A 1 74  ? 1.891   3.362   -6.372  1.00 10.00 ? 74  LEU A C    1  
ATOM   1037  O  O    . LEU A 1 74  ? 2.550   4.012   -7.185  1.00 10.00 ? 74  LEU A O    1  
ATOM   1038  C  CB   . LEU A 1 74  ? 0.313   4.876   -5.076  1.00 10.00 ? 74  LEU A CB   1  
ATOM   1039  C  CG   . LEU A 1 74  ? -0.128  5.239   -3.641  1.00 10.00 ? 74  LEU A CG   1  
ATOM   1040  C  CD1  . LEU A 1 74  ? -0.380  6.741   -3.491  1.00 10.00 ? 74  LEU A CD1  1  
ATOM   1041  C  CD2  . LEU A 1 74  ? -1.378  4.446   -3.257  1.00 10.00 ? 74  LEU A CD2  1  
ATOM   1042  H  H    . LEU A 1 74  ? 2.592   5.782   -4.741  1.00 10.00 ? 74  LEU A H    1  
ATOM   1043  H  HA   . LEU A 1 74  ? 1.371   3.150   -4.291  1.00 10.00 ? 74  LEU A HA   1  
ATOM   1044  H  HB2  . LEU A 1 74  ? 0.600   5.777   -5.619  1.00 10.00 ? 74  LEU A HB2  1  
ATOM   1045  H  HB3  . LEU A 1 74  ? -0.503  4.421   -5.643  1.00 10.00 ? 74  LEU A HB3  1  
ATOM   1046  H  HG   . LEU A 1 74  ? 0.651   4.990   -2.914  1.00 10.00 ? 74  LEU A HG   1  
ATOM   1047  H  HD11 . LEU A 1 74  ? -0.657  6.957   -2.459  1.00 10.00 ? 74  LEU A HD11 1  
ATOM   1048  H  HD12 . LEU A 1 74  ? 0.532   7.290   -3.731  1.00 10.00 ? 74  LEU A HD12 1  
ATOM   1049  H  HD13 . LEU A 1 74  ? -1.179  7.058   -4.158  1.00 10.00 ? 74  LEU A HD13 1  
ATOM   1050  H  HD21 . LEU A 1 74  ? -1.544  4.541   -2.184  1.00 10.00 ? 74  LEU A HD21 1  
ATOM   1051  H  HD22 . LEU A 1 74  ? -2.242  4.830   -3.797  1.00 10.00 ? 74  LEU A HD22 1  
ATOM   1052  H  HD23 . LEU A 1 74  ? -1.239  3.393   -3.503  1.00 10.00 ? 74  LEU A HD23 1  
ATOM   1053  N  N    . MET A 1 75  ? 1.499   2.106   -6.613  1.00 10.00 ? 75  MET A N    1  
ATOM   1054  C  CA   . MET A 1 75  ? 1.879   1.355   -7.804  1.00 10.00 ? 75  MET A CA   1  
ATOM   1055  C  C    . MET A 1 75  ? 0.770   0.377   -8.209  1.00 10.00 ? 75  MET A C    1  
ATOM   1056  O  O    . MET A 1 75  ? -0.039  -0.012  -7.376  1.00 10.00 ? 75  MET A O    1  
ATOM   1057  C  CB   . MET A 1 75  ? 3.216   0.652   -7.531  1.00 10.00 ? 75  MET A CB   1  
ATOM   1058  C  CG   . MET A 1 75  ? 3.956   0.370   -8.840  1.00 10.00 ? 75  MET A CG   1  
ATOM   1059  S  SD   . MET A 1 75  ? 5.764   0.470   -8.848  1.00 10.00 ? 75  MET A SD   1  
ATOM   1060  C  CE   . MET A 1 75  ? 6.102   2.013   -7.958  1.00 10.00 ? 75  MET A CE   1  
ATOM   1061  H  H    . MET A 1 75  ? 0.977   1.592   -5.908  1.00 10.00 ? 75  MET A H    1  
ATOM   1062  H  HA   . MET A 1 75  ? 1.991   2.069   -8.619  1.00 10.00 ? 75  MET A HA   1  
ATOM   1063  H  HB2  . MET A 1 75  ? 3.813   1.319   -6.918  1.00 10.00 ? 75  MET A HB2  1  
ATOM   1064  H  HB3  . MET A 1 75  ? 3.051   -0.267  -6.971  1.00 10.00 ? 75  MET A HB3  1  
ATOM   1065  H  HG2  . MET A 1 75  ? 3.665   -0.611  -9.202  1.00 10.00 ? 75  MET A HG2  1  
ATOM   1066  H  HG3  . MET A 1 75  ? 3.637   1.089   -9.583  1.00 10.00 ? 75  MET A HG3  1  
ATOM   1067  H  HE1  . MET A 1 75  ? 5.881   1.925   -6.896  1.00 10.00 ? 75  MET A HE1  1  
ATOM   1068  H  HE2  . MET A 1 75  ? 7.157   2.257   -8.074  1.00 10.00 ? 75  MET A HE2  1  
ATOM   1069  H  HE3  . MET A 1 75  ? 5.502   2.812   -8.386  1.00 10.00 ? 75  MET A HE3  1  
ATOM   1070  N  N    . THR A 1 76  ? 0.665   0.017   -9.494  1.00 10.00 ? 76  THR A N    1  
ATOM   1071  C  CA   . THR A 1 76  ? -0.573  -0.557  -9.999  1.00 10.00 ? 76  THR A CA   1  
ATOM   1072  C  C    . THR A 1 76  ? -0.340  -1.352  -11.288 1.00 10.00 ? 76  THR A C    1  
ATOM   1073  O  O    . THR A 1 76  ? -0.231  -0.779  -12.365 1.00 10.00 ? 76  THR A O    1  
ATOM   1074  C  CB   . THR A 1 76  ? -1.649  0.528   -10.062 1.00 10.00 ? 76  THR A CB   1  
ATOM   1075  O  OG1  . THR A 1 76  ? -2.850  -0.059  -10.474 1.00 10.00 ? 76  THR A OG1  1  
ATOM   1076  C  CG2  . THR A 1 76  ? -1.272  1.704   -10.958 1.00 10.00 ? 76  THR A CG2  1  
ATOM   1077  H  H    . THR A 1 76  ? 1.361   0.270   -10.177 1.00 10.00 ? 76  THR A H    1  
ATOM   1078  H  HA   . THR A 1 76  ? -0.991  -1.241  -9.283  1.00 10.00 ? 76  THR A HA   1  
ATOM   1079  H  HB   . THR A 1 76  ? -1.818  0.921   -9.056  1.00 10.00 ? 76  THR A HB   1  
ATOM   1080  H  HG1  . THR A 1 76  ? -3.162  -0.637  -9.754  1.00 10.00 ? 76  THR A HG1  1  
ATOM   1081  H  HG21 . THR A 1 76  ? -1.201  1.392   -11.997 1.00 10.00 ? 76  THR A HG21 1  
ATOM   1082  H  HG22 . THR A 1 76  ? -2.034  2.477   -10.868 1.00 10.00 ? 76  THR A HG22 1  
ATOM   1083  H  HG23 . THR A 1 76  ? -0.308  2.099   -10.639 1.00 10.00 ? 76  THR A HG23 1  
ATOM   1084  N  N    . THR A 1 77  ? -0.227  -2.681  -11.191 1.00 10.00 ? 77  THR A N    1  
ATOM   1085  C  CA   . THR A 1 77  ? 0.022   -3.536  -12.345 1.00 10.00 ? 77  THR A CA   1  
ATOM   1086  C  C    . THR A 1 77  ? -0.824  -4.801  -12.255 1.00 10.00 ? 77  THR A C    1  
ATOM   1087  O  O    . THR A 1 77  ? -0.316  -5.922  -12.252 1.00 10.00 ? 77  THR A O    1  
ATOM   1088  C  CB   . THR A 1 77  ? 1.523   -3.796  -12.528 1.00 10.00 ? 77  THR A CB   1  
ATOM   1089  O  OG1  . THR A 1 77  ? 1.729   -4.667  -13.617 1.00 10.00 ? 77  THR A OG1  1  
ATOM   1090  C  CG2  . THR A 1 77  ? 2.211   -4.365  -11.287 1.00 10.00 ? 77  THR A CG2  1  
ATOM   1091  H  H    . THR A 1 77  ? -0.399  -3.123  -10.300 1.00 10.00 ? 77  THR A H    1  
ATOM   1092  H  HA   . THR A 1 77  ? -0.314  -3.032  -13.252 1.00 10.00 ? 77  THR A HA   1  
ATOM   1093  H  HB   . THR A 1 77  ? 1.990   -2.848  -12.771 1.00 10.00 ? 77  THR A HB   1  
ATOM   1094  H  HG1  . THR A 1 77  ? 1.337   -5.520  -13.387 1.00 10.00 ? 77  THR A HG1  1  
ATOM   1095  H  HG21 . THR A 1 77  ? 2.203   -3.638  -10.478 1.00 10.00 ? 77  THR A HG21 1  
ATOM   1096  H  HG22 . THR A 1 77  ? 3.238   -4.629  -11.530 1.00 10.00 ? 77  THR A HG22 1  
ATOM   1097  H  HG23 . THR A 1 77  ? 1.727   -5.277  -10.967 1.00 10.00 ? 77  THR A HG23 1  
ATOM   1098  N  N    . THR A 1 78  ? -2.137  -4.623  -12.208 1.00 10.00 ? 78  THR A N    1  
ATOM   1099  C  CA   . THR A 1 78  ? -3.103  -5.710  -12.284 1.00 10.00 ? 78  THR A CA   1  
ATOM   1100  C  C    . THR A 1 78  ? -4.369  -5.217  -12.982 1.00 10.00 ? 78  THR A C    1  
ATOM   1101  O  O    . THR A 1 78  ? -4.960  -4.218  -12.573 1.00 10.00 ? 78  THR A O    1  
ATOM   1102  C  CB   . THR A 1 78  ? -3.354  -6.268  -10.876 1.00 10.00 ? 78  THR A CB   1  
ATOM   1103  O  OG1  . THR A 1 78  ? -2.197  -6.965  -10.462 1.00 10.00 ? 78  THR A OG1  1  
ATOM   1104  C  CG2  . THR A 1 78  ? -4.528  -7.247  -10.835 1.00 10.00 ? 78  THR A CG2  1  
ATOM   1105  H  H    . THR A 1 78  ? -2.472  -3.666  -12.209 1.00 10.00 ? 78  THR A H    1  
ATOM   1106  H  HA   . THR A 1 78  ? -2.687  -6.514  -12.893 1.00 10.00 ? 78  THR A HA   1  
ATOM   1107  H  HB   . THR A 1 78  ? -3.560  -5.450  -10.182 1.00 10.00 ? 78  THR A HB   1  
ATOM   1108  H  HG1  . THR A 1 78  ? -1.474  -6.768  -11.071 1.00 10.00 ? 78  THR A HG1  1  
ATOM   1109  H  HG21 . THR A 1 78  ? -5.461  -6.729  -11.055 1.00 10.00 ? 78  THR A HG21 1  
ATOM   1110  H  HG22 . THR A 1 78  ? -4.371  -8.047  -11.560 1.00 10.00 ? 78  THR A HG22 1  
ATOM   1111  H  HG23 . THR A 1 78  ? -4.596  -7.678  -9.835  1.00 10.00 ? 78  THR A HG23 1  
ATOM   1112  N  N    . HIS A 1 79  ? -4.775  -5.918  -14.047 1.00 10.00 ? 79  HIS A N    1  
ATOM   1113  C  CA   . HIS A 1 79  ? -5.827  -5.510  -14.973 1.00 10.00 ? 79  HIS A CA   1  
ATOM   1114  C  C    . HIS A 1 79  ? -7.201  -5.761  -14.337 1.00 10.00 ? 79  HIS A C    1  
ATOM   1115  O  O    . HIS A 1 79  ? -7.971  -6.588  -14.812 1.00 10.00 ? 79  HIS A O    1  
ATOM   1116  C  CB   . HIS A 1 79  ? -5.684  -6.279  -16.299 1.00 10.00 ? 79  HIS A CB   1  
ATOM   1117  C  CG   . HIS A 1 79  ? -4.374  -6.147  -17.044 1.00 10.00 ? 79  HIS A CG   1  
ATOM   1118  N  ND1  . HIS A 1 79  ? -4.109  -6.783  -18.257 1.00 10.00 ? 79  HIS A ND1  1  
ATOM   1119  C  CD2  . HIS A 1 79  ? -3.253  -5.472  -16.642 1.00 10.00 ? 79  HIS A CD2  1  
ATOM   1120  C  CE1  . HIS A 1 79  ? -2.840  -6.480  -18.561 1.00 10.00 ? 79  HIS A CE1  1  
ATOM   1121  N  NE2  . HIS A 1 79  ? -2.300  -5.701  -17.608 1.00 10.00 ? 79  HIS A NE2  1  
ATOM   1122  H  H    . HIS A 1 79  ? -4.269  -6.763  -14.266 1.00 10.00 ? 79  HIS A H    1  
ATOM   1123  H  HA   . HIS A 1 79  ? -5.729  -4.444  -15.184 1.00 10.00 ? 79  HIS A HA   1  
ATOM   1124  H  HB2  . HIS A 1 79  ? -5.836  -7.342  -16.106 1.00 10.00 ? 79  HIS A HB2  1  
ATOM   1125  H  HB3  . HIS A 1 79  ? -6.474  -5.945  -16.972 1.00 10.00 ? 79  HIS A HB3  1  
ATOM   1126  H  HD2  . HIS A 1 79  ? -3.122  -4.883  -15.747 1.00 10.00 ? 79  HIS A HD2  1  
ATOM   1127  H  HE1  . HIS A 1 79  ? -2.322  -6.819  -19.445 1.00 10.00 ? 79  HIS A HE1  1  
ATOM   1128  H  HE2  . HIS A 1 79  ? -1.353  -5.353  -17.604 1.00 10.00 ? 79  HIS A HE2  1  
ATOM   1129  N  N    . SER A 1 80  ? -7.472  -5.046  -13.242 1.00 10.00 ? 80  SER A N    1  
ATOM   1130  C  CA   . SER A 1 80  ? -8.630  -5.143  -12.356 1.00 10.00 ? 80  SER A CA   1  
ATOM   1131  C  C    . SER A 1 80  ? -8.346  -4.379  -11.058 1.00 10.00 ? 80  SER A C    1  
ATOM   1132  O  O    . SER A 1 80  ? -9.288  -4.051  -10.341 1.00 10.00 ? 80  SER A O    1  
ATOM   1133  C  CB   . SER A 1 80  ? -9.016  -6.594  -12.017 1.00 10.00 ? 80  SER A CB   1  
ATOM   1134  O  OG   . SER A 1 80  ? -10.178 -6.610  -11.204 1.00 10.00 ? 80  SER A OG   1  
ATOM   1135  H  H    . SER A 1 80  ? -6.776  -4.343  -13.020 1.00 10.00 ? 80  SER A H    1  
ATOM   1136  H  HA   . SER A 1 80  ? -9.475  -4.669  -12.858 1.00 10.00 ? 80  SER A HA   1  
ATOM   1137  H  HB2  . SER A 1 80  ? -9.253  -7.170  -12.911 1.00 10.00 ? 80  SER A HB2  1  
ATOM   1138  H  HB3  . SER A 1 80  ? -8.197  -7.080  -11.486 1.00 10.00 ? 80  SER A HB3  1  
ATOM   1139  H  HG   . SER A 1 80  ? -10.155 -5.859  -10.595 1.00 10.00 ? 80  SER A HG   1  
ATOM   1140  N  N    . GLY A 1 81  ? -7.070  -4.137  -10.735 1.00 10.00 ? 81  GLY A N    1  
ATOM   1141  C  CA   . GLY A 1 81  ? -6.683  -3.127  -9.774  1.00 10.00 ? 81  GLY A CA   1  
ATOM   1142  C  C    . GLY A 1 81  ? -6.701  -1.768  -10.461 1.00 10.00 ? 81  GLY A C    1  
ATOM   1143  O  O    . GLY A 1 81  ? -7.485  -1.545  -11.382 1.00 10.00 ? 81  GLY A O    1  
ATOM   1144  H  H    . GLY A 1 81  ? -6.329  -4.449  -11.345 1.00 10.00 ? 81  GLY A H    1  
ATOM   1145  H  HA2  . GLY A 1 81  ? -7.381  -3.093  -8.945  1.00 10.00 ? 81  GLY A HA2  1  
ATOM   1146  H  HA3  . GLY A 1 81  ? -5.684  -3.352  -9.404  1.00 10.00 ? 81  GLY A HA3  1  
ATOM   1147  N  N    . GLY A 1 82  ? -5.839  -0.856  -10.021 1.00 10.00 ? 82  GLY A N    1  
ATOM   1148  C  CA   . GLY A 1 82  ? -5.812  0.495   -10.574 1.00 10.00 ? 82  GLY A CA   1  
ATOM   1149  C  C    . GLY A 1 82  ? -5.555  0.525   -12.088 1.00 10.00 ? 82  GLY A C    1  
ATOM   1150  O  O    . GLY A 1 82  ? -6.279  1.190   -12.828 1.00 10.00 ? 82  GLY A O    1  
ATOM   1151  H  H    . GLY A 1 82  ? -5.185  -1.122  -9.277  1.00 10.00 ? 82  GLY A H    1  
ATOM   1152  H  HA2  . GLY A 1 82  ? -6.769  0.978   -10.369 1.00 10.00 ? 82  GLY A HA2  1  
ATOM   1153  H  HA3  . GLY A 1 82  ? -5.032  1.072   -10.081 1.00 10.00 ? 82  GLY A HA3  1  
ATOM   1154  N  N    . MET A 1 83  ? -4.488  -0.139  -12.543 1.00 10.00 ? 83  MET A N    1  
ATOM   1155  C  CA   . MET A 1 83  ? -3.919  0.003   -13.874 1.00 10.00 ? 83  MET A CA   1  
ATOM   1156  C  C    . MET A 1 83  ? -2.936  -1.145  -14.161 1.00 10.00 ? 83  MET A C    1  
ATOM   1157  O  O    . MET A 1 83  ? -2.900  -2.147  -13.443 1.00 10.00 ? 83  MET A O    1  
ATOM   1158  C  CB   . MET A 1 83  ? -3.271  1.402   -14.003 1.00 10.00 ? 83  MET A CB   1  
ATOM   1159  C  CG   . MET A 1 83  ? -3.952  2.261   -15.076 1.00 10.00 ? 83  MET A CG   1  
ATOM   1160  S  SD   . MET A 1 83  ? -3.789  1.669   -16.781 1.00 10.00 ? 83  MET A SD   1  
ATOM   1161  C  CE   . MET A 1 83  ? -4.653  2.990   -17.658 1.00 10.00 ? 83  MET A CE   1  
ATOM   1162  H  H    . MET A 1 83  ? -3.913  -0.621  -11.860 1.00 10.00 ? 83  MET A H    1  
ATOM   1163  H  HA   . MET A 1 83  ? -4.734  -0.090  -14.594 1.00 10.00 ? 83  MET A HA   1  
ATOM   1164  H  HB2  . MET A 1 83  ? -3.363  1.942   -13.060 1.00 10.00 ? 83  MET A HB2  1  
ATOM   1165  H  HB3  . MET A 1 83  ? -2.206  1.339   -14.227 1.00 10.00 ? 83  MET A HB3  1  
ATOM   1166  H  HG2  . MET A 1 83  ? -5.014  2.345   -14.844 1.00 10.00 ? 83  MET A HG2  1  
ATOM   1167  H  HG3  . MET A 1 83  ? -3.515  3.259   -15.034 1.00 10.00 ? 83  MET A HG3  1  
ATOM   1168  H  HE1  . MET A 1 83  ? -4.641  2.773   -18.725 1.00 10.00 ? 83  MET A HE1  1  
ATOM   1169  H  HE2  . MET A 1 83  ? -5.684  3.042   -17.308 1.00 10.00 ? 83  MET A HE2  1  
ATOM   1170  H  HE3  . MET A 1 83  ? -4.152  3.938   -17.472 1.00 10.00 ? 83  MET A HE3  1  
ATOM   1171  N  N    . ALA A 1 84  ? -2.161  -1.004  -15.243 1.00 10.00 ? 84  ALA A N    1  
ATOM   1172  C  CA   . ALA A 1 84  ? -1.355  -2.035  -15.871 1.00 10.00 ? 84  ALA A CA   1  
ATOM   1173  C  C    . ALA A 1 84  ? 0.064   -1.493  -16.039 1.00 10.00 ? 84  ALA A C    1  
ATOM   1174  O  O    . ALA A 1 84  ? 0.663   -1.627  -17.103 1.00 10.00 ? 84  ALA A O    1  
ATOM   1175  C  CB   . ALA A 1 84  ? -1.985  -2.357  -17.230 1.00 10.00 ? 84  ALA A CB   1  
ATOM   1176  H  H    . ALA A 1 84  ? -2.098  -0.097  -15.678 1.00 10.00 ? 84  ALA A H    1  
ATOM   1177  H  HA   . ALA A 1 84  ? -1.328  -2.945  -15.272 1.00 10.00 ? 84  ALA A HA   1  
ATOM   1178  H  HB1  . ALA A 1 84  ? -1.403  -3.124  -17.739 1.00 10.00 ? 84  ALA A HB1  1  
ATOM   1179  H  HB2  . ALA A 1 84  ? -3.007  -2.709  -17.093 1.00 10.00 ? 84  ALA A HB2  1  
ATOM   1180  H  HB3  . ALA A 1 84  ? -2.004  -1.462  -17.853 1.00 10.00 ? 84  ALA A HB3  1  
ATOM   1181  N  N    . GLY A 1 85  ? 0.574   -0.819  -15.008 1.00 10.00 ? 85  GLY A N    1  
ATOM   1182  C  CA   . GLY A 1 85  ? 1.821   -0.085  -15.063 1.00 10.00 ? 85  GLY A CA   1  
ATOM   1183  C  C    . GLY A 1 85  ? 2.491   -0.079  -13.691 1.00 10.00 ? 85  GLY A C    1  
ATOM   1184  O  O    . GLY A 1 85  ? 2.090   0.685   -12.814 1.00 10.00 ? 85  GLY A O    1  
ATOM   1185  H  H    . GLY A 1 85  ? 0.042   -0.757  -14.146 1.00 10.00 ? 85  GLY A H    1  
ATOM   1186  H  HA2  . GLY A 1 85  ? 2.469   -0.526  -15.813 1.00 10.00 ? 85  GLY A HA2  1  
ATOM   1187  H  HA3  . GLY A 1 85  ? 1.605   0.943   -15.353 1.00 10.00 ? 85  GLY A HA3  1  
ATOM   1188  N  N    . MET A 1 86  ? 3.527   -0.902  -13.493 1.00 10.00 ? 86  MET A N    1  
ATOM   1189  C  CA   . MET A 1 86  ? 4.247   -0.988  -12.224 1.00 10.00 ? 86  MET A CA   1  
ATOM   1190  C  C    . MET A 1 86  ? 5.194   0.217   -12.110 1.00 10.00 ? 86  MET A C    1  
ATOM   1191  O  O    . MET A 1 86  ? 6.414   0.081   -12.093 1.00 10.00 ? 86  MET A O    1  
ATOM   1192  C  CB   . MET A 1 86  ? 4.988   -2.330  -12.154 1.00 10.00 ? 86  MET A CB   1  
ATOM   1193  C  CG   . MET A 1 86  ? 5.267   -2.904  -10.756 1.00 10.00 ? 86  MET A CG   1  
ATOM   1194  S  SD   . MET A 1 86  ? 6.806   -2.461  -9.891  1.00 10.00 ? 86  MET A SD   1  
ATOM   1195  C  CE   . MET A 1 86  ? 7.261   -4.065  -9.190  1.00 10.00 ? 86  MET A CE   1  
ATOM   1196  H  H    . MET A 1 86  ? 3.823   -1.507  -14.246 1.00 10.00 ? 86  MET A H    1  
ATOM   1197  H  HA   . MET A 1 86  ? 3.484   -0.982  -11.442 1.00 10.00 ? 86  MET A HA   1  
ATOM   1198  H  HB2  . MET A 1 86  ? 4.369   -3.053  -12.678 1.00 10.00 ? 86  MET A HB2  1  
ATOM   1199  H  HB3  . MET A 1 86  ? 5.925   -2.270  -12.688 1.00 10.00 ? 86  MET A HB3  1  
ATOM   1200  H  HG2  . MET A 1 86  ? 4.410   -2.736  -10.114 1.00 10.00 ? 86  MET A HG2  1  
ATOM   1201  H  HG3  . MET A 1 86  ? 5.359   -3.973  -10.919 1.00 10.00 ? 86  MET A HG3  1  
ATOM   1202  H  HE1  . MET A 1 86  ? 7.424   -4.774  -10.002 1.00 10.00 ? 86  MET A HE1  1  
ATOM   1203  H  HE2  . MET A 1 86  ? 8.181   -3.965  -8.616  1.00 10.00 ? 86  MET A HE2  1  
ATOM   1204  H  HE3  . MET A 1 86  ? 6.469   -4.442  -8.547  1.00 10.00 ? 86  MET A HE3  1  
ATOM   1205  N  N    . LYS A 1 87  ? 4.600   1.406   -12.076 1.00 10.00 ? 87  LYS A N    1  
ATOM   1206  C  CA   . LYS A 1 87  ? 5.253   2.704   -12.127 1.00 10.00 ? 87  LYS A CA   1  
ATOM   1207  C  C    . LYS A 1 87  ? 4.710   3.598   -11.012 1.00 10.00 ? 87  LYS A C    1  
ATOM   1208  O  O    . LYS A 1 87  ? 3.667   3.311   -10.426 1.00 10.00 ? 87  LYS A O    1  
ATOM   1209  C  CB   . LYS A 1 87  ? 5.027   3.326   -13.518 1.00 10.00 ? 87  LYS A CB   1  
ATOM   1210  C  CG   . LYS A 1 87  ? 3.563   3.737   -13.754 1.00 10.00 ? 87  LYS A CG   1  
ATOM   1211  C  CD   . LYS A 1 87  ? 3.217   3.905   -15.240 1.00 10.00 ? 87  LYS A CD   1  
ATOM   1212  C  CE   . LYS A 1 87  ? 3.991   5.061   -15.890 1.00 10.00 ? 87  LYS A CE   1  
ATOM   1213  N  NZ   . LYS A 1 87  ? 3.585   5.276   -17.296 1.00 10.00 ? 87  LYS A NZ   1  
ATOM   1214  H  H    . LYS A 1 87  ? 3.590   1.383   -12.049 1.00 10.00 ? 87  LYS A H    1  
ATOM   1215  H  HA   . LYS A 1 87  ? 6.326   2.579   -11.973 1.00 10.00 ? 87  LYS A HA   1  
ATOM   1216  H  HB2  . LYS A 1 87  ? 5.665   4.205   -13.621 1.00 10.00 ? 87  LYS A HB2  1  
ATOM   1217  H  HB3  . LYS A 1 87  ? 5.328   2.594   -14.268 1.00 10.00 ? 87  LYS A HB3  1  
ATOM   1218  H  HG2  . LYS A 1 87  ? 2.901   2.968   -13.359 1.00 10.00 ? 87  LYS A HG2  1  
ATOM   1219  H  HG3  . LYS A 1 87  ? 3.351   4.664   -13.217 1.00 10.00 ? 87  LYS A HG3  1  
ATOM   1220  H  HD2  . LYS A 1 87  ? 3.429   2.966   -15.757 1.00 10.00 ? 87  LYS A HD2  1  
ATOM   1221  H  HD3  . LYS A 1 87  ? 2.143   4.098   -15.305 1.00 10.00 ? 87  LYS A HD3  1  
ATOM   1222  H  HE2  . LYS A 1 87  ? 3.809   5.978   -15.324 1.00 10.00 ? 87  LYS A HE2  1  
ATOM   1223  H  HE3  . LYS A 1 87  ? 5.060   4.844   -15.863 1.00 10.00 ? 87  LYS A HE3  1  
ATOM   1224  H  HZ1  . LYS A 1 87  ? 2.601   5.503   -17.347 1.00 10.00 ? 87  LYS A HZ1  1  
ATOM   1225  H  HZ2  . LYS A 1 87  ? 4.114   6.042   -17.691 1.00 10.00 ? 87  LYS A HZ2  1  
ATOM   1226  H  HZ3  . LYS A 1 87  ? 3.762   4.445   -17.843 1.00 10.00 ? 87  LYS A HZ3  1  
ATOM   1227  N  N    . MET A 1 88  ? 5.387   4.716   -10.757 1.00 10.00 ? 88  MET A N    1  
ATOM   1228  C  CA   . MET A 1 88  ? 5.049   5.630   -9.676  1.00 10.00 ? 88  MET A CA   1  
ATOM   1229  C  C    . MET A 1 88  ? 3.877   6.497   -10.138 1.00 10.00 ? 88  MET A C    1  
ATOM   1230  O  O    . MET A 1 88  ? 4.046   7.647   -10.537 1.00 10.00 ? 88  MET A O    1  
ATOM   1231  C  CB   . MET A 1 88  ? 6.283   6.477   -9.335  1.00 10.00 ? 88  MET A CB   1  
ATOM   1232  C  CG   . MET A 1 88  ? 7.424   5.607   -8.795  1.00 10.00 ? 88  MET A CG   1  
ATOM   1233  S  SD   . MET A 1 88  ? 8.980   6.466   -8.436  1.00 10.00 ? 88  MET A SD   1  
ATOM   1234  C  CE   . MET A 1 88  ? 9.457   7.055   -10.075 1.00 10.00 ? 88  MET A CE   1  
ATOM   1235  H  H    . MET A 1 88  ? 6.214   4.909   -11.297 1.00 10.00 ? 88  MET A H    1  
ATOM   1236  H  HA   . MET A 1 88  ? 4.747   5.080   -8.782  1.00 10.00 ? 88  MET A HA   1  
ATOM   1237  H  HB2  . MET A 1 88  ? 6.611   7.000   -10.232 1.00 10.00 ? 88  MET A HB2  1  
ATOM   1238  H  HB3  . MET A 1 88  ? 6.018   7.214   -8.576  1.00 10.00 ? 88  MET A HB3  1  
ATOM   1239  H  HG2  . MET A 1 88  ? 7.085   5.150   -7.866  1.00 10.00 ? 88  MET A HG2  1  
ATOM   1240  H  HG3  . MET A 1 88  ? 7.650   4.813   -9.502  1.00 10.00 ? 88  MET A HG3  1  
ATOM   1241  H  HE1  . MET A 1 88  ? 10.432  7.533   -10.001 1.00 10.00 ? 88  MET A HE1  1  
ATOM   1242  H  HE2  . MET A 1 88  ? 8.731   7.782   -10.434 1.00 10.00 ? 88  MET A HE2  1  
ATOM   1243  H  HE3  . MET A 1 88  ? 9.516   6.213   -10.762 1.00 10.00 ? 88  MET A HE3  1  
ATOM   1244  N  N    . VAL A 1 89  ? 2.687   5.897   -10.144 1.00 10.00 ? 89  VAL A N    1  
ATOM   1245  C  CA   . VAL A 1 89  ? 1.472   6.557   -10.591 1.00 10.00 ? 89  VAL A CA   1  
ATOM   1246  C  C    . VAL A 1 89  ? 1.071   7.699   -9.645  1.00 10.00 ? 89  VAL A C    1  
ATOM   1247  O  O    . VAL A 1 89  ? 1.517   7.722   -8.499  1.00 10.00 ? 89  VAL A O    1  
ATOM   1248  C  CB   . VAL A 1 89  ? 0.325   5.532   -10.723 1.00 10.00 ? 89  VAL A CB   1  
ATOM   1249  C  CG1  . VAL A 1 89  ? 0.566   4.594   -11.910 1.00 10.00 ? 89  VAL A CG1  1  
ATOM   1250  C  CG2  . VAL A 1 89  ? 0.106   4.723   -9.437  1.00 10.00 ? 89  VAL A CG2  1  
ATOM   1251  H  H    . VAL A 1 89  ? 2.652   4.927   -9.847  1.00 10.00 ? 89  VAL A H    1  
ATOM   1252  H  HA   . VAL A 1 89  ? 1.713   6.976   -11.567 1.00 10.00 ? 89  VAL A HA   1  
ATOM   1253  H  HB   . VAL A 1 89  ? -0.606  6.063   -10.919 1.00 10.00 ? 89  VAL A HB   1  
ATOM   1254  H  HG11 . VAL A 1 89  ? -0.332  4.009   -12.100 1.00 10.00 ? 89  VAL A HG11 1  
ATOM   1255  H  HG12 . VAL A 1 89  ? 0.791   5.174   -12.805 1.00 10.00 ? 89  VAL A HG12 1  
ATOM   1256  H  HG13 . VAL A 1 89  ? 1.394   3.920   -11.698 1.00 10.00 ? 89  VAL A HG13 1  
ATOM   1257  H  HG21 . VAL A 1 89  ? -0.823  4.160   -9.517  1.00 10.00 ? 89  VAL A HG21 1  
ATOM   1258  H  HG22 . VAL A 1 89  ? 0.923   4.024   -9.282  1.00 10.00 ? 89  VAL A HG22 1  
ATOM   1259  H  HG23 . VAL A 1 89  ? 0.032   5.384   -8.574  1.00 10.00 ? 89  VAL A HG23 1  
ATOM   1260  N  N    . PRO A 1 90  ? 0.179   8.606   -10.093 1.00 10.00 ? 90  PRO A N    1  
ATOM   1261  C  CA   . PRO A 1 90  ? -0.589  9.498   -9.227  1.00 10.00 ? 90  PRO A CA   1  
ATOM   1262  C  C    . PRO A 1 90  ? -1.022  8.824   -7.923  1.00 10.00 ? 90  PRO A C    1  
ATOM   1263  O  O    . PRO A 1 90  ? -0.735  9.332   -6.842  1.00 10.00 ? 90  PRO A O    1  
ATOM   1264  C  CB   . PRO A 1 90  ? -1.781  9.980   -10.072 1.00 10.00 ? 90  PRO A CB   1  
ATOM   1265  C  CG   . PRO A 1 90  ? -1.742  9.153   -11.356 1.00 10.00 ? 90  PRO A CG   1  
ATOM   1266  C  CD   . PRO A 1 90  ? -0.276  8.762   -11.468 1.00 10.00 ? 90  PRO A CD   1  
ATOM   1267  H  HA   . PRO A 1 90  ? -0.013  10.382  -8.960  1.00 10.00 ? 90  PRO A HA   1  
ATOM   1268  H  HB2  . PRO A 1 90  ? -2.738  9.827   -9.581  1.00 10.00 ? 90  PRO A HB2  1  
ATOM   1269  H  HB3  . PRO A 1 90  ? -1.652  11.036  -10.312 1.00 10.00 ? 90  PRO A HB3  1  
ATOM   1270  H  HG2  . PRO A 1 90  ? -2.347  8.254   -11.225 1.00 10.00 ? 90  PRO A HG2  1  
ATOM   1271  H  HG3  . PRO A 1 90  ? -2.090  9.717   -12.223 1.00 10.00 ? 90  PRO A HG3  1  
ATOM   1272  H  HD2  . PRO A 1 90  ? -0.191  7.882   -12.103 1.00 10.00 ? 90  PRO A HD2  1  
ATOM   1273  H  HD3  . PRO A 1 90  ? 0.283   9.582   -11.921 1.00 10.00 ? 90  PRO A HD3  1  
ATOM   1274  N  N    . TRP A 1 91  ? -1.722  7.694   -8.043  1.00 10.00 ? 91  TRP A N    1  
ATOM   1275  C  CA   . TRP A 1 91  ? -2.357  6.915   -6.997  1.00 10.00 ? 91  TRP A CA   1  
ATOM   1276  C  C    . TRP A 1 91  ? -3.162  5.843   -7.743  1.00 10.00 ? 91  TRP A C    1  
ATOM   1277  O  O    . TRP A 1 91  ? -2.966  5.685   -8.950  1.00 10.00 ? 91  TRP A O    1  
ATOM   1278  C  CB   . TRP A 1 91  ? -3.236  7.801   -6.096  1.00 10.00 ? 91  TRP A CB   1  
ATOM   1279  C  CG   . TRP A 1 91  ? -4.407  8.444   -6.756  1.00 10.00 ? 91  TRP A CG   1  
ATOM   1280  C  CD1  . TRP A 1 91  ? -5.620  7.874   -6.883  1.00 10.00 ? 91  TRP A CD1  1  
ATOM   1281  C  CD2  . TRP A 1 91  ? -4.524  9.750   -7.389  1.00 10.00 ? 91  TRP A CD2  1  
ATOM   1282  N  NE1  . TRP A 1 91  ? -6.381  8.616   -7.749  1.00 10.00 ? 91  TRP A NE1  1  
ATOM   1283  C  CE2  . TRP A 1 91  ? -5.765  9.798   -8.075  1.00 10.00 ? 91  TRP A CE2  1  
ATOM   1284  C  CE3  . TRP A 1 91  ? -3.719  10.901  -7.457  1.00 10.00 ? 91  TRP A CE3  1  
ATOM   1285  C  CZ2  . TRP A 1 91  ? -6.143  10.886  -8.861  1.00 10.00 ? 91  TRP A CZ2  1  
ATOM   1286  C  CZ3  . TRP A 1 91  ? -4.103  12.025  -8.212  1.00 10.00 ? 91  TRP A CZ3  1  
ATOM   1287  C  CH2  . TRP A 1 91  ? -5.311  12.010  -8.932  1.00 10.00 ? 91  TRP A CH2  1  
ATOM   1288  H  H    . TRP A 1 91  ? -1.847  7.279   -8.957  1.00 10.00 ? 91  TRP A H    1  
ATOM   1289  H  HA   . TRP A 1 91  ? -1.588  6.433   -6.398  1.00 10.00 ? 91  TRP A HA   1  
ATOM   1290  H  HB2  . TRP A 1 91  ? -3.635  7.179   -5.311  1.00 10.00 ? 91  TRP A HB2  1  
ATOM   1291  H  HB3  . TRP A 1 91  ? -2.636  8.567   -5.618  1.00 10.00 ? 91  TRP A HB3  1  
ATOM   1292  H  HD1  . TRP A 1 91  ? -5.907  6.934   -6.453  1.00 10.00 ? 91  TRP A HD1  1  
ATOM   1293  H  HE1  . TRP A 1 91  ? -7.292  8.308   -8.070  1.00 10.00 ? 91  TRP A HE1  1  
ATOM   1294  H  HE3  . TRP A 1 91  ? -2.798  10.892  -6.912  1.00 10.00 ? 91  TRP A HE3  1  
ATOM   1295  H  HZ2  . TRP A 1 91  ? -7.059  10.838  -9.409  1.00 10.00 ? 91  TRP A HZ2  1  
ATOM   1296  H  HZ3  . TRP A 1 91  ? -3.464  12.896  -8.247  1.00 10.00 ? 91  TRP A HZ3  1  
ATOM   1297  H  HH2  . TRP A 1 91  ? -5.617  12.855  -9.529  1.00 10.00 ? 91  TRP A HH2  1  
ATOM   1298  N  N    . LEU A 1 92  ? -4.091  5.155   -7.072  1.00 10.00 ? 92  LEU A N    1  
ATOM   1299  C  CA   . LEU A 1 92  ? -5.066  4.289   -7.726  1.00 10.00 ? 92  LEU A CA   1  
ATOM   1300  C  C    . LEU A 1 92  ? -6.490  4.643   -7.292  1.00 10.00 ? 92  LEU A C    1  
ATOM   1301  O  O    . LEU A 1 92  ? -6.869  4.446   -6.138  1.00 10.00 ? 92  LEU A O    1  
ATOM   1302  C  CB   . LEU A 1 92  ? -4.720  2.800   -7.554  1.00 10.00 ? 92  LEU A CB   1  
ATOM   1303  C  CG   . LEU A 1 92  ? -4.827  2.169   -6.154  1.00 10.00 ? 92  LEU A CG   1  
ATOM   1304  C  CD1  . LEU A 1 92  ? -4.429  0.696   -6.272  1.00 10.00 ? 92  LEU A CD1  1  
ATOM   1305  C  CD2  . LEU A 1 92  ? -3.919  2.834   -5.116  1.00 10.00 ? 92  LEU A CD2  1  
ATOM   1306  H  H    . LEU A 1 92  ? -4.226  5.346   -6.090  1.00 10.00 ? 92  LEU A H    1  
ATOM   1307  H  HA   . LEU A 1 92  ? -5.023  4.460   -8.803  1.00 10.00 ? 92  LEU A HA   1  
ATOM   1308  H  HB2  . LEU A 1 92  ? -5.409  2.250   -8.195  1.00 10.00 ? 92  LEU A HB2  1  
ATOM   1309  H  HB3  . LEU A 1 92  ? -3.710  2.642   -7.935  1.00 10.00 ? 92  LEU A HB3  1  
ATOM   1310  H  HG   . LEU A 1 92  ? -5.858  2.201   -5.801  1.00 10.00 ? 92  LEU A HG   1  
ATOM   1311  H  HD11 . LEU A 1 92  ? -4.519  0.204   -5.304  1.00 10.00 ? 92  LEU A HD11 1  
ATOM   1312  H  HD12 . LEU A 1 92  ? -3.396  0.620   -6.614  1.00 10.00 ? 92  LEU A HD12 1  
ATOM   1313  H  HD13 . LEU A 1 92  ? -5.078  0.186   -6.985  1.00 10.00 ? 92  LEU A HD13 1  
ATOM   1314  H  HD21 . LEU A 1 92  ? -3.886  2.226   -4.211  1.00 10.00 ? 92  LEU A HD21 1  
ATOM   1315  H  HD22 . LEU A 1 92  ? -4.315  3.811   -4.849  1.00 10.00 ? 92  LEU A HD22 1  
ATOM   1316  H  HD23 . LEU A 1 92  ? -2.909  2.936   -5.513  1.00 10.00 ? 92  LEU A HD23 1  
ATOM   1317  N  N    . THR A 1 93  ? -7.285  5.186   -8.218  1.00 10.00 ? 93  THR A N    1  
ATOM   1318  C  CA   . THR A 1 93  ? -8.710  5.387   -7.993  1.00 10.00 ? 93  THR A CA   1  
ATOM   1319  C  C    . THR A 1 93  ? -9.384  4.024   -8.143  1.00 10.00 ? 93  THR A C    1  
ATOM   1320  O  O    . THR A 1 93  ? -9.113  3.309   -9.104  1.00 10.00 ? 93  THR A O    1  
ATOM   1321  C  CB   . THR A 1 93  ? -9.279  6.360   -9.039  1.00 10.00 ? 93  THR A CB   1  
ATOM   1322  O  OG1  . THR A 1 93  ? -8.496  7.530   -9.119  1.00 10.00 ? 93  THR A OG1  1  
ATOM   1323  C  CG2  . THR A 1 93  ? -10.732 6.765   -8.777  1.00 10.00 ? 93  THR A CG2  1  
ATOM   1324  H  H    . THR A 1 93  ? -6.881  5.522   -9.080  1.00 10.00 ? 93  THR A H    1  
ATOM   1325  H  HA   . THR A 1 93  ? -8.872  5.794   -7.000  1.00 10.00 ? 93  THR A HA   1  
ATOM   1326  H  HB   . THR A 1 93  ? -9.248  5.869   -10.005 1.00 10.00 ? 93  THR A HB   1  
ATOM   1327  H  HG1  . THR A 1 93  ? -8.763  8.020   -9.903  1.00 10.00 ? 93  THR A HG1  1  
ATOM   1328  H  HG21 . THR A 1 93  ? -10.836 7.200   -7.787  1.00 10.00 ? 93  THR A HG21 1  
ATOM   1329  H  HG22 . THR A 1 93  ? -11.038 7.505   -9.517  1.00 10.00 ? 93  THR A HG22 1  
ATOM   1330  H  HG23 . THR A 1 93  ? -11.386 5.897   -8.854  1.00 10.00 ? 93  THR A HG23 1  
ATOM   1331  N  N    . ILE A 1 94  ? -10.249 3.670   -7.193  1.00 10.00 ? 94  ILE A N    1  
ATOM   1332  C  CA   . ILE A 1 94  ? -11.054 2.460   -7.205  1.00 10.00 ? 94  ILE A CA   1  
ATOM   1333  C  C    . ILE A 1 94  ? -12.468 2.854   -7.656  1.00 10.00 ? 94  ILE A C    1  
ATOM   1334  O  O    . ILE A 1 94  ? -13.222 3.440   -6.877  1.00 10.00 ? 94  ILE A O    1  
ATOM   1335  C  CB   . ILE A 1 94  ? -11.003 1.763   -5.832  1.00 10.00 ? 94  ILE A CB   1  
ATOM   1336  C  CG1  . ILE A 1 94  ? -11.063 2.740   -4.644  1.00 10.00 ? 94  ILE A CG1  1  
ATOM   1337  C  CG2  . ILE A 1 94  ? -9.713  0.934   -5.761  1.00 10.00 ? 94  ILE A CG2  1  
ATOM   1338  C  CD1  . ILE A 1 94  ? -11.177 2.035   -3.292  1.00 10.00 ? 94  ILE A CD1  1  
ATOM   1339  H  H    . ILE A 1 94  ? -10.454 4.347   -6.466  1.00 10.00 ? 94  ILE A H    1  
ATOM   1340  H  HA   . ILE A 1 94  ? -10.634 1.744   -7.909  1.00 10.00 ? 94  ILE A HA   1  
ATOM   1341  H  HB   . ILE A 1 94  ? -11.854 1.085   -5.779  1.00 10.00 ? 94  ILE A HB   1  
ATOM   1342  H  HG12 . ILE A 1 94  ? -10.165 3.359   -4.617  1.00 10.00 ? 94  ILE A HG12 1  
ATOM   1343  H  HG13 . ILE A 1 94  ? -11.932 3.384   -4.754  1.00 10.00 ? 94  ILE A HG13 1  
ATOM   1344  H  HG21 . ILE A 1 94  ? -9.632  0.289   -6.635  1.00 10.00 ? 94  ILE A HG21 1  
ATOM   1345  H  HG22 . ILE A 1 94  ? -8.844  1.593   -5.727  1.00 10.00 ? 94  ILE A HG22 1  
ATOM   1346  H  HG23 . ILE A 1 94  ? -9.719  0.295   -4.881  1.00 10.00 ? 94  ILE A HG23 1  
ATOM   1347  H  HD11 . ILE A 1 94  ? -12.056 1.394   -3.271  1.00 10.00 ? 94  ILE A HD11 1  
ATOM   1348  H  HD12 . ILE A 1 94  ? -10.291 1.442   -3.083  1.00 10.00 ? 94  ILE A HD12 1  
ATOM   1349  H  HD13 . ILE A 1 94  ? -11.259 2.792   -2.516  1.00 10.00 ? 94  ILE A HD13 1  
ATOM   1350  N  N    . PRO A 1 95  ? -12.820 2.615   -8.929  1.00 10.00 ? 95  PRO A N    1  
ATOM   1351  C  CA   . PRO A 1 95  ? -14.008 3.181   -9.547  1.00 10.00 ? 95  PRO A CA   1  
ATOM   1352  C  C    . PRO A 1 95  ? -15.244 2.374   -9.152  1.00 10.00 ? 95  PRO A C    1  
ATOM   1353  O  O    . PRO A 1 95  ? -15.809 1.671   -9.987  1.00 10.00 ? 95  PRO A O    1  
ATOM   1354  C  CB   . PRO A 1 95  ? -13.737 3.080   -11.045 1.00 10.00 ? 95  PRO A CB   1  
ATOM   1355  C  CG   . PRO A 1 95  ? -12.904 1.806   -11.172 1.00 10.00 ? 95  PRO A CG   1  
ATOM   1356  C  CD   . PRO A 1 95  ? -12.063 1.831   -9.898  1.00 10.00 ? 95  PRO A CD   1  
ATOM   1357  H  HA   . PRO A 1 95  ? -14.144 4.229   -9.283  1.00 10.00 ? 95  PRO A HA   1  
ATOM   1358  H  HB2  . PRO A 1 95  ? -14.670 3.005   -11.594 1.00 10.00 ? 95  PRO A HB2  1  
ATOM   1359  H  HB3  . PRO A 1 95  ? -13.155 3.940   -11.380 1.00 10.00 ? 95  PRO A HB3  1  
ATOM   1360  H  HG2  . PRO A 1 95  ? -13.560 0.934   -11.157 1.00 10.00 ? 95  PRO A HG2  1  
ATOM   1361  H  HG3  . PRO A 1 95  ? -12.291 1.797   -12.074 1.00 10.00 ? 95  PRO A HG3  1  
ATOM   1362  H  HD2  . PRO A 1 95  ? -11.889 0.811   -9.545  1.00 10.00 ? 95  PRO A HD2  1  
ATOM   1363  H  HD3  . PRO A 1 95  ? -11.117 2.320   -10.121 1.00 10.00 ? 95  PRO A HD3  1  
ATOM   1364  N  N    . ALA A 1 96  ? -15.632 2.421   -7.874  1.00 10.00 ? 96  ALA A N    1  
ATOM   1365  C  CA   . ALA A 1 96  ? -16.424 1.363   -7.268  1.00 10.00 ? 96  ALA A CA   1  
ATOM   1366  C  C    . ALA A 1 96  ? -15.669 0.029   -7.377  1.00 10.00 ? 96  ALA A C    1  
ATOM   1367  O  O    . ALA A 1 96  ? -14.552 -0.007  -7.893  1.00 10.00 ? 96  ALA A O    1  
ATOM   1368  C  CB   . ALA A 1 96  ? -17.824 1.327   -7.889  1.00 10.00 ? 96  ALA A CB   1  
ATOM   1369  H  H    . ALA A 1 96  ? -15.130 3.020   -7.231  1.00 10.00 ? 96  ALA A H    1  
ATOM   1370  H  HA   . ALA A 1 96  ? -16.517 1.622   -6.213  1.00 10.00 ? 96  ALA A HA   1  
ATOM   1371  H  HB1  . ALA A 1 96  ? -17.803 1.044   -8.937  1.00 10.00 ? 96  ALA A HB1  1  
ATOM   1372  H  HB2  . ALA A 1 96  ? -18.442 0.597   -7.380  1.00 10.00 ? 96  ALA A HB2  1  
ATOM   1373  H  HB3  . ALA A 1 96  ? -18.257 2.322   -7.795  1.00 10.00 ? 96  ALA A HB3  1  
ATOM   1374  N  N    . ARG A 1 97  ? -16.220 -1.063  -6.836  1.00 10.00 ? 97  ARG A N    1  
ATOM   1375  C  CA   . ARG A 1 97  ? -15.658 -2.414  -6.922  1.00 10.00 ? 97  ARG A CA   1  
ATOM   1376  C  C    . ARG A 1 97  ? -14.136 -2.538  -6.808  1.00 10.00 ? 97  ARG A C    1  
ATOM   1377  O  O    . ARG A 1 97  ? -13.526 -3.451  -7.361  1.00 10.00 ? 97  ARG A O    1  
ATOM   1378  C  CB   . ARG A 1 97  ? -16.216 -3.148  -8.151  1.00 10.00 ? 97  ARG A CB   1  
ATOM   1379  C  CG   . ARG A 1 97  ? -17.733 -3.314  -8.037  1.00 10.00 ? 97  ARG A CG   1  
ATOM   1380  C  CD   . ARG A 1 97  ? -18.106 -4.376  -6.993  1.00 10.00 ? 97  ARG A CD   1  
ATOM   1381  N  NE   . ARG A 1 97  ? -19.498 -4.191  -6.576  1.00 10.00 ? 97  ARG A NE   1  
ATOM   1382  C  CZ   . ARG A 1 97  ? -20.605 -4.573  -7.223  1.00 10.00 ? 97  ARG A CZ   1  
ATOM   1383  N  NH1  . ARG A 1 97  ? -20.535 -5.434  -8.244  1.00 10.00 ? 97  ARG A NH1  1  
ATOM   1384  N  NH2  . ARG A 1 97  ? -21.773 -4.058  -6.835  1.00 10.00 ? 97  ARG A NH2  1  
ATOM   1385  H  H    . ARG A 1 97  ? -17.143 -1.005  -6.394  1.00 10.00 ? 97  ARG A H    1  
ATOM   1386  H  HA   . ARG A 1 97  ? -15.988 -2.904  -6.013  1.00 10.00 ? 97  ARG A HA   1  
ATOM   1387  H  HB2  . ARG A 1 97  ? -15.976 -2.570  -9.045  1.00 10.00 ? 97  ARG A HB2  1  
ATOM   1388  H  HB3  . ARG A 1 97  ? -15.766 -4.137  -8.247  1.00 10.00 ? 97  ARG A HB3  1  
ATOM   1389  H  HG2  . ARG A 1 97  ? -18.185 -2.355  -7.795  1.00 10.00 ? 97  ARG A HG2  1  
ATOM   1390  H  HG3  . ARG A 1 97  ? -18.145 -3.597  -8.996  1.00 10.00 ? 97  ARG A HG3  1  
ATOM   1391  H  HD2  . ARG A 1 97  ? -17.892 -5.378  -7.361  1.00 10.00 ? 97  ARG A HD2  1  
ATOM   1392  H  HD3  . ARG A 1 97  ? -17.511 -4.234  -6.089  1.00 10.00 ? 97  ARG A HD3  1  
ATOM   1393  H  HE   . ARG A 1 97  ? -19.637 -3.479  -5.854  1.00 10.00 ? 97  ARG A HE   1  
ATOM   1394  H  HH11 . ARG A 1 97  ? -19.631 -5.773  -8.532  1.00 10.00 ? 97  ARG A HH11 1  
ATOM   1395  H  HH12 . ARG A 1 97  ? -21.358 -5.724  -8.750  1.00 10.00 ? 97  ARG A HH12 1  
ATOM   1396  H  HH21 . ARG A 1 97  ? -21.699 -3.306  -6.134  1.00 10.00 ? 97  ARG A HH21 1  
ATOM   1397  H  HH22 . ARG A 1 97  ? -22.658 -4.264  -7.267  1.00 10.00 ? 97  ARG A HH22 1  
ATOM   1398  N  N    . GLY A 1 98  ? -13.538 -1.668  -6.000  1.00 10.00 ? 98  GLY A N    1  
ATOM   1399  C  CA   . GLY A 1 98  ? -12.191 -1.803  -5.486  1.00 10.00 ? 98  GLY A CA   1  
ATOM   1400  C  C    . GLY A 1 98  ? -11.991 -3.069  -4.651  1.00 10.00 ? 98  GLY A C    1  
ATOM   1401  O  O    . GLY A 1 98  ? -11.847 -2.990  -3.432  1.00 10.00 ? 98  GLY A O    1  
ATOM   1402  H  H    . GLY A 1 98  ? -14.029 -0.794  -5.869  1.00 10.00 ? 98  GLY A H    1  
ATOM   1403  H  HA2  . GLY A 1 98  ? -11.458 -1.752  -6.293  1.00 10.00 ? 98  GLY A HA2  1  
ATOM   1404  H  HA3  . GLY A 1 98  ? -12.072 -0.964  -4.815  1.00 10.00 ? 98  GLY A HA3  1  
ATOM   1405  N  N    . THR A 1 99  ? -11.985 -4.232  -5.295  1.00 10.00 ? 99  THR A N    1  
ATOM   1406  C  CA   . THR A 1 99  ? -11.668 -5.511  -4.682  1.00 10.00 ? 99  THR A CA   1  
ATOM   1407  C  C    . THR A 1 99  ? -10.340 -5.977  -5.265  1.00 10.00 ? 99  THR A C    1  
ATOM   1408  O  O    . THR A 1 99  ? -10.259 -7.047  -5.863  1.00 10.00 ? 99  THR A O    1  
ATOM   1409  C  CB   . THR A 1 99  ? -12.814 -6.499  -4.926  1.00 10.00 ? 99  THR A CB   1  
ATOM   1410  O  OG1  . THR A 1 99  ? -14.065 -5.852  -4.766  1.00 10.00 ? 99  THR A OG1  1  
ATOM   1411  C  CG2  . THR A 1 99  ? -12.759 -7.690  -3.964  1.00 10.00 ? 99  THR A CG2  1  
ATOM   1412  H  H    . THR A 1 99  ? -12.195 -4.219  -6.287  1.00 10.00 ? 99  THR A H    1  
ATOM   1413  H  HA   . THR A 1 99  ? -11.547 -5.424  -3.614  1.00 10.00 ? 99  THR A HA   1  
ATOM   1414  H  HB   . THR A 1 99  ? -12.725 -6.857  -5.948  1.00 10.00 ? 99  THR A HB   1  
ATOM   1415  H  HG1  . THR A 1 99  ? -14.090 -5.440  -3.900  1.00 10.00 ? 99  THR A HG1  1  
ATOM   1416  H  HG21 . THR A 1 99  ? -12.847 -7.350  -2.932  1.00 10.00 ? 99  THR A HG21 1  
ATOM   1417  H  HG22 . THR A 1 99  ? -13.581 -8.371  -4.185  1.00 10.00 ? 99  THR A HG22 1  
ATOM   1418  H  HG23 . THR A 1 99  ? -11.818 -8.227  -4.083  1.00 10.00 ? 99  THR A HG23 1  
ATOM   1419  N  N    . LEU A 1 100 ? -9.304  -5.146  -5.118  1.00 10.00 ? 100 LEU A N    1  
ATOM   1420  C  CA   . LEU A 1 100 ? -8.002  -5.420  -5.702  1.00 10.00 ? 100 LEU A CA   1  
ATOM   1421  C  C    . LEU A 1 100 ? -7.032  -5.868  -4.614  1.00 10.00 ? 100 LEU A C    1  
ATOM   1422  O  O    . LEU A 1 100 ? -7.225  -5.559  -3.440  1.00 10.00 ? 100 LEU A O    1  
ATOM   1423  C  CB   . LEU A 1 100 ? -7.530  -4.205  -6.499  1.00 10.00 ? 100 LEU A CB   1  
ATOM   1424  C  CG   . LEU A 1 100 ? -7.025  -3.044  -5.627  1.00 10.00 ? 100 LEU A CG   1  
ATOM   1425  C  CD1  . LEU A 1 100 ? -5.504  -2.955  -5.746  1.00 10.00 ? 100 LEU A CD1  1  
ATOM   1426  C  CD2  . LEU A 1 100 ? -7.649  -1.723  -6.079  1.00 10.00 ? 100 LEU A CD2  1  
ATOM   1427  H  H    . LEU A 1 100 ? -9.409  -4.310  -4.555  1.00 10.00 ? 100 LEU A H    1  
ATOM   1428  H  HA   . LEU A 1 100 ? -8.084  -6.236  -6.423  1.00 10.00 ? 100 LEU A HA   1  
ATOM   1429  H  HB2  . LEU A 1 100 ? -6.737  -4.528  -7.174  1.00 10.00 ? 100 LEU A HB2  1  
ATOM   1430  H  HB3  . LEU A 1 100 ? -8.375  -3.875  -7.105  1.00 10.00 ? 100 LEU A HB3  1  
ATOM   1431  H  HG   . LEU A 1 100 ? -7.299  -3.197  -4.585  1.00 10.00 ? 100 LEU A HG   1  
ATOM   1432  H  HD11 . LEU A 1 100 ? -5.253  -2.745  -6.784  1.00 10.00 ? 100 LEU A HD11 1  
ATOM   1433  H  HD12 . LEU A 1 100 ? -5.035  -3.894  -5.455  1.00 10.00 ? 100 LEU A HD12 1  
ATOM   1434  H  HD13 . LEU A 1 100 ? -5.120  -2.153  -5.117  1.00 10.00 ? 100 LEU A HD13 1  
ATOM   1435  H  HD21 . LEU A 1 100 ? -8.732  -1.792  -5.986  1.00 10.00 ? 100 LEU A HD21 1  
ATOM   1436  H  HD22 . LEU A 1 100 ? -7.287  -0.911  -5.448  1.00 10.00 ? 100 LEU A HD22 1  
ATOM   1437  H  HD23 . LEU A 1 100 ? -7.386  -1.512  -7.116  1.00 10.00 ? 100 LEU A HD23 1  
ATOM   1438  N  N    . THR A 1 101 ? -5.994  -6.597  -5.008  1.00 10.00 ? 101 THR A N    1  
ATOM   1439  C  CA   . THR A 1 101 ? -5.072  -7.261  -4.111  1.00 10.00 ? 101 THR A CA   1  
ATOM   1440  C  C    . THR A 1 101 ? -3.722  -6.610  -4.316  1.00 10.00 ? 101 THR A C    1  
ATOM   1441  O  O    . THR A 1 101 ? -3.154  -6.676  -5.401  1.00 10.00 ? 101 THR A O    1  
ATOM   1442  C  CB   . THR A 1 101 ? -5.079  -8.775  -4.356  1.00 10.00 ? 101 THR A CB   1  
ATOM   1443  O  OG1  . THR A 1 101 ? -6.312  -9.286  -3.887  1.00 10.00 ? 101 THR A OG1  1  
ATOM   1444  C  CG2  . THR A 1 101 ? -3.947  -9.502  -3.621  1.00 10.00 ? 101 THR A CG2  1  
ATOM   1445  H  H    . THR A 1 101 ? -5.746  -6.585  -5.982  1.00 10.00 ? 101 THR A H    1  
ATOM   1446  H  HA   . THR A 1 101 ? -5.373  -7.106  -3.082  1.00 10.00 ? 101 THR A HA   1  
ATOM   1447  H  HB   . THR A 1 101 ? -4.984  -8.976  -5.424  1.00 10.00 ? 101 THR A HB   1  
ATOM   1448  H  HG1  . THR A 1 101 ? -6.384  -9.089  -2.941  1.00 10.00 ? 101 THR A HG1  1  
ATOM   1449  H  HG21 . THR A 1 101 ? -3.967  -9.275  -2.556  1.00 10.00 ? 101 THR A HG21 1  
ATOM   1450  H  HG22 . THR A 1 101 ? -2.980  -9.205  -4.026  1.00 10.00 ? 101 THR A HG22 1  
ATOM   1451  H  HG23 . THR A 1 101 ? -4.062  -10.578 -3.757  1.00 10.00 ? 101 THR A HG23 1  
ATOM   1452  N  N    . LEU A 1 102 ? -3.247  -5.956  -3.264  1.00 10.00 ? 102 LEU A N    1  
ATOM   1453  C  CA   . LEU A 1 102 ? -2.001  -5.243  -3.256  1.00 10.00 ? 102 LEU A CA   1  
ATOM   1454  C  C    . LEU A 1 102 ? -0.916  -6.282  -2.995  1.00 10.00 ? 102 LEU A C    1  
ATOM   1455  O  O    . LEU A 1 102 ? -0.823  -6.784  -1.878  1.00 10.00 ? 102 LEU A O    1  
ATOM   1456  C  CB   . LEU A 1 102 ? -2.036  -4.162  -2.169  1.00 10.00 ? 102 LEU A CB   1  
ATOM   1457  C  CG   . LEU A 1 102 ? -2.911  -2.957  -2.568  1.00 10.00 ? 102 LEU A CG   1  
ATOM   1458  C  CD1  . LEU A 1 102 ? -4.412  -3.205  -2.357  1.00 10.00 ? 102 LEU A CD1  1  
ATOM   1459  C  CD2  . LEU A 1 102 ? -2.489  -1.751  -1.729  1.00 10.00 ? 102 LEU A CD2  1  
ATOM   1460  H  H    . LEU A 1 102 ? -3.745  -6.021  -2.389  1.00 10.00 ? 102 LEU A H    1  
ATOM   1461  H  HA   . LEU A 1 102 ? -1.881  -4.756  -4.215  1.00 10.00 ? 102 LEU A HA   1  
ATOM   1462  H  HB2  . LEU A 1 102 ? -2.385  -4.582  -1.226  1.00 10.00 ? 102 LEU A HB2  1  
ATOM   1463  H  HB3  . LEU A 1 102 ? -1.012  -3.822  -2.015  1.00 10.00 ? 102 LEU A HB3  1  
ATOM   1464  H  HG   . LEU A 1 102 ? -2.743  -2.704  -3.616  1.00 10.00 ? 102 LEU A HG   1  
ATOM   1465  H  HD11 . LEU A 1 102 ? -4.962  -2.286  -2.555  1.00 10.00 ? 102 LEU A HD11 1  
ATOM   1466  H  HD12 . LEU A 1 102 ? -4.783  -3.966  -3.040  1.00 10.00 ? 102 LEU A HD12 1  
ATOM   1467  H  HD13 . LEU A 1 102 ? -4.607  -3.520  -1.332  1.00 10.00 ? 102 LEU A HD13 1  
ATOM   1468  H  HD21 . LEU A 1 102 ? -3.094  -0.881  -1.987  1.00 10.00 ? 102 LEU A HD21 1  
ATOM   1469  H  HD22 . LEU A 1 102 ? -2.617  -1.986  -0.676  1.00 10.00 ? 102 LEU A HD22 1  
ATOM   1470  H  HD23 . LEU A 1 102 ? -1.442  -1.520  -1.918  1.00 10.00 ? 102 LEU A HD23 1  
ATOM   1471  N  N    . GLN A 1 103 ? -0.135  -6.641  -4.015  1.00 10.00 ? 103 GLN A N    1  
ATOM   1472  C  CA   . GLN A 1 103 ? 0.952   -7.602  -3.924  1.00 10.00 ? 103 GLN A CA   1  
ATOM   1473  C  C    . GLN A 1 103 ? 2.174   -7.094  -4.692  1.00 10.00 ? 103 GLN A C    1  
ATOM   1474  O  O    . GLN A 1 103 ? 2.068   -6.280  -5.612  1.00 10.00 ? 103 GLN A O    1  
ATOM   1475  C  CB   . GLN A 1 103 ? 0.485   -8.973  -4.424  1.00 10.00 ? 103 GLN A CB   1  
ATOM   1476  C  CG   . GLN A 1 103 ? 0.299   -8.990  -5.946  1.00 10.00 ? 103 GLN A CG   1  
ATOM   1477  C  CD   . GLN A 1 103 ? -0.981  -9.703  -6.346  1.00 10.00 ? 103 GLN A CD   1  
ATOM   1478  O  OE1  . GLN A 1 103 ? -1.029  -10.928 -6.388  1.00 10.00 ? 103 GLN A OE1  1  
ATOM   1479  N  NE2  . GLN A 1 103 ? -2.034  -8.949  -6.632  1.00 10.00 ? 103 GLN A NE2  1  
ATOM   1480  H  H    . GLN A 1 103 ? -0.250  -6.155  -4.900  1.00 10.00 ? 103 GLN A H    1  
ATOM   1481  H  HA   . GLN A 1 103 ? 1.241   -7.707  -2.876  1.00 10.00 ? 103 GLN A HA   1  
ATOM   1482  H  HB2  . GLN A 1 103 ? 1.218   -9.734  -4.152  1.00 10.00 ? 103 GLN A HB2  1  
ATOM   1483  H  HB3  . GLN A 1 103 ? -0.455  -9.216  -3.925  1.00 10.00 ? 103 GLN A HB3  1  
ATOM   1484  H  HG2  . GLN A 1 103 ? 0.245   -7.976  -6.326  1.00 10.00 ? 103 GLN A HG2  1  
ATOM   1485  H  HG3  . GLN A 1 103 ? 1.149   -9.486  -6.416  1.00 10.00 ? 103 GLN A HG3  1  
ATOM   1486  H  HE21 . GLN A 1 103 ? -1.989  -7.924  -6.611  1.00 10.00 ? 103 GLN A HE21 1  
ATOM   1487  H  HE22 . GLN A 1 103 ? -2.882  -9.408  -6.895  1.00 10.00 ? 103 GLN A HE22 1  
ATOM   1488  N  N    . ARG A 1 104 ? 3.340   -7.605  -4.299  1.00 10.00 ? 104 ARG A N    1  
ATOM   1489  C  CA   . ARG A 1 104 ? 4.646   -7.026  -4.597  1.00 10.00 ? 104 ARG A CA   1  
ATOM   1490  C  C    . ARG A 1 104 ? 4.830   -6.633  -6.062  1.00 10.00 ? 104 ARG A C    1  
ATOM   1491  O  O    . ARG A 1 104 ? 5.425   -5.593  -6.338  1.00 10.00 ? 104 ARG A O    1  
ATOM   1492  C  CB   . ARG A 1 104 ? 5.748   -7.983  -4.132  1.00 10.00 ? 104 ARG A CB   1  
ATOM   1493  C  CG   . ARG A 1 104 ? 7.137   -7.377  -4.369  1.00 10.00 ? 104 ARG A CG   1  
ATOM   1494  C  CD   . ARG A 1 104 ? 8.195   -8.055  -3.497  1.00 10.00 ? 104 ARG A CD   1  
ATOM   1495  N  NE   . ARG A 1 104 ? 8.295   -9.516  -3.738  1.00 10.00 ? 104 ARG A NE   1  
ATOM   1496  C  CZ   . ARG A 1 104 ? 9.351   -10.193 -4.238  1.00 10.00 ? 104 ARG A CZ   1  
ATOM   1497  N  NH1  . ARG A 1 104 ? 10.461  -9.536  -4.623  1.00 10.00 ? 104 ARG A NH1  1  
ATOM   1498  N  NH2  . ARG A 1 104 ? 9.299   -11.532 -4.351  1.00 10.00 ? 104 ARG A NH2  1  
ATOM   1499  H  H    . ARG A 1 104 ? 3.285   -8.339  -3.609  1.00 10.00 ? 104 ARG A H    1  
ATOM   1500  H  HA   . ARG A 1 104 ? 4.723   -6.112  -4.006  1.00 10.00 ? 104 ARG A HA   1  
ATOM   1501  H  HB2  . ARG A 1 104 ? 5.606   -8.150  -3.065  1.00 10.00 ? 104 ARG A HB2  1  
ATOM   1502  H  HB3  . ARG A 1 104 ? 5.666   -8.935  -4.657  1.00 10.00 ? 104 ARG A HB3  1  
ATOM   1503  H  HG2  . ARG A 1 104 ? 7.410   -7.455  -5.422  1.00 10.00 ? 104 ARG A HG2  1  
ATOM   1504  H  HG3  . ARG A 1 104 ? 7.114   -6.320  -4.094  1.00 10.00 ? 104 ARG A HG3  1  
ATOM   1505  H  HD2  . ARG A 1 104 ? 9.127   -7.514  -3.637  1.00 10.00 ? 104 ARG A HD2  1  
ATOM   1506  H  HD3  . ARG A 1 104 ? 7.893   -7.908  -2.460  1.00 10.00 ? 104 ARG A HD3  1  
ATOM   1507  H  HE   . ARG A 1 104 ? 7.507   -10.051 -3.390  1.00 10.00 ? 104 ARG A HE   1  
ATOM   1508  H  HH11 . ARG A 1 104 ? 10.509  -8.530  -4.552  1.00 10.00 ? 104 ARG A HH11 1  
ATOM   1509  H  HH12 . ARG A 1 104 ? 11.259  -10.023 -5.000  1.00 10.00 ? 104 ARG A HH12 1  
ATOM   1510  H  HH21 . ARG A 1 104 ? 8.490   -12.073 -4.067  1.00 10.00 ? 104 ARG A HH21 1  
ATOM   1511  H  HH22 . ARG A 1 104 ? 10.064  -12.096 -4.703  1.00 10.00 ? 104 ARG A HH22 1  
ATOM   1512  N  N    . ASP A 1 105 ? 4.343   -7.464  -6.988  1.00 10.00 ? 105 ASP A N    1  
ATOM   1513  C  CA   . ASP A 1 105 ? 4.359   -7.165  -8.412  1.00 10.00 ? 105 ASP A CA   1  
ATOM   1514  C  C    . ASP A 1 105 ? 2.985   -7.452  -9.020  1.00 10.00 ? 105 ASP A C    1  
ATOM   1515  O  O    . ASP A 1 105 ? 2.849   -8.185  -9.995  1.00 10.00 ? 105 ASP A O    1  
ATOM   1516  C  CB   . ASP A 1 105 ? 5.496   -7.942  -9.088  1.00 10.00 ? 105 ASP A CB   1  
ATOM   1517  C  CG   . ASP A 1 105 ? 5.724   -7.486  -10.523 1.00 10.00 ? 105 ASP A CG   1  
ATOM   1518  O  OD1  . ASP A 1 105 ? 5.313   -6.347  -10.833 1.00 10.00 ? 105 ASP A OD1  1  
ATOM   1519  O  OD2  . ASP A 1 105 ? 6.361   -8.261  -11.266 1.00 10.00 ? 105 ASP A OD2  1  
ATOM   1520  H  H    . ASP A 1 105 ? 3.863   -8.298  -6.686  1.00 10.00 ? 105 ASP A H    1  
ATOM   1521  H  HA   . ASP A 1 105 ? 4.538   -6.099  -8.549  1.00 10.00 ? 105 ASP A HA   1  
ATOM   1522  H  HB2  . ASP A 1 105 ? 6.425   -7.778  -8.543  1.00 10.00 ? 105 ASP A HB2  1  
ATOM   1523  H  HB3  . ASP A 1 105 ? 5.268   -9.009  -9.088  1.00 10.00 ? 105 ASP A HB3  1  
ATOM   1524  N  N    . GLY A 1 106 ? 1.940   -6.886  -8.410  1.00 10.00 ? 106 GLY A N    1  
ATOM   1525  C  CA   . GLY A 1 106 ? 0.585   -7.011  -8.930  1.00 10.00 ? 106 GLY A CA   1  
ATOM   1526  C  C    . GLY A 1 106 ? -0.335  -6.010  -8.262  1.00 10.00 ? 106 GLY A C    1  
ATOM   1527  O  O    . GLY A 1 106 ? -1.262  -6.401  -7.558  1.00 10.00 ? 106 GLY A O    1  
ATOM   1528  H  H    . GLY A 1 106 ? 2.087   -6.406  -7.526  1.00 10.00 ? 106 GLY A H    1  
ATOM   1529  H  HA2  . GLY A 1 106 ? 0.577   -6.759  -9.985  1.00 10.00 ? 106 GLY A HA2  1  
ATOM   1530  H  HA3  . GLY A 1 106 ? 0.214   -8.027  -8.796  1.00 10.00 ? 106 GLY A HA3  1  
ATOM   1531  N  N    . ASP A 1 107 ? -0.028  -4.726  -8.502  1.00 10.00 ? 107 ASP A N    1  
ATOM   1532  C  CA   . ASP A 1 107 ? -0.646  -3.559  -7.878  1.00 10.00 ? 107 ASP A CA   1  
ATOM   1533  C  C    . ASP A 1 107 ? -0.327  -3.538  -6.387  1.00 10.00 ? 107 ASP A C    1  
ATOM   1534  O  O    . ASP A 1 107 ? -0.236  -4.598  -5.789  1.00 10.00 ? 107 ASP A O    1  
ATOM   1535  C  CB   . ASP A 1 107 ? -2.147  -3.501  -8.231  1.00 10.00 ? 107 ASP A CB   1  
ATOM   1536  C  CG   . ASP A 1 107 ? -2.866  -2.244  -7.763  1.00 10.00 ? 107 ASP A CG   1  
ATOM   1537  O  OD1  . ASP A 1 107 ? -2.638  -1.852  -6.603  1.00 10.00 ? 107 ASP A OD1  1  
ATOM   1538  O  OD2  . ASP A 1 107 ? -3.648  -1.701  -8.580  1.00 10.00 ? 107 ASP A OD2  1  
ATOM   1539  H  H    . ASP A 1 107 ? 0.773   -4.573  -9.091  1.00 10.00 ? 107 ASP A H    1  
ATOM   1540  H  HA   . ASP A 1 107 ? -0.100  -2.716  -8.277  1.00 10.00 ? 107 ASP A HA   1  
ATOM   1541  H  HB2  . ASP A 1 107 ? -2.273  -3.584  -9.309  1.00 10.00 ? 107 ASP A HB2  1  
ATOM   1542  H  HB3  . ASP A 1 107 ? -2.661  -4.338  -7.760  1.00 10.00 ? 107 ASP A HB3  1  
ATOM   1543  N  N    . HIS A 1 108 ? 0.028   -2.387  -5.809  1.00 10.00 ? 108 HIS A N    1  
ATOM   1544  C  CA   . HIS A 1 108 ? 0.522   -2.322  -4.437  1.00 10.00 ? 108 HIS A CA   1  
ATOM   1545  C  C    . HIS A 1 108 ? 0.864   -0.887  -4.014  1.00 10.00 ? 108 HIS A C    1  
ATOM   1546  O  O    . HIS A 1 108 ? 0.783   0.052   -4.802  1.00 10.00 ? 108 HIS A O    1  
ATOM   1547  C  CB   . HIS A 1 108 ? 1.780   -3.204  -4.273  1.00 10.00 ? 108 HIS A CB   1  
ATOM   1548  C  CG   . HIS A 1 108 ? 2.818   -3.001  -5.354  1.00 10.00 ? 108 HIS A CG   1  
ATOM   1549  N  ND1  . HIS A 1 108 ? 2.822   -3.571  -6.605  1.00 10.00 ? 108 HIS A ND1  1  
ATOM   1550  C  CD2  . HIS A 1 108 ? 3.975   -2.284  -5.235  1.00 10.00 ? 108 HIS A CD2  1  
ATOM   1551  C  CE1  . HIS A 1 108 ? 3.976   -3.238  -7.196  1.00 10.00 ? 108 HIS A CE1  1  
ATOM   1552  N  NE2  . HIS A 1 108 ? 4.714   -2.419  -6.424  1.00 10.00 ? 108 HIS A NE2  1  
ATOM   1553  H  H    . HIS A 1 108 ? -0.129  -1.516  -6.310  1.00 10.00 ? 108 HIS A H    1  
ATOM   1554  H  HA   . HIS A 1 108 ? -0.293  -2.716  -3.824  1.00 10.00 ? 108 HIS A HA   1  
ATOM   1555  H  HB2  . HIS A 1 108 ? 2.253   -3.023  -3.309  1.00 10.00 ? 108 HIS A HB2  1  
ATOM   1556  H  HB3  . HIS A 1 108 ? 1.504   -4.253  -4.243  1.00 10.00 ? 108 HIS A HB3  1  
ATOM   1557  H  HD1  . HIS A 1 108 ? 2.103   -4.147  -7.015  1.00 10.00 ? 108 HIS A HD1  1  
ATOM   1558  H  HD2  . HIS A 1 108 ? 4.263   -1.749  -4.346  1.00 10.00 ? 108 HIS A HD2  1  
ATOM   1559  H  HE1  . HIS A 1 108 ? 4.284   -3.640  -8.141  1.00 10.00 ? 108 HIS A HE1  1  
ATOM   1560  N  N    . VAL A 1 109 ? 1.341   -0.728  -2.776  1.00 10.00 ? 109 VAL A N    1  
ATOM   1561  C  CA   . VAL A 1 109 ? 2.071   0.453   -2.340  1.00 10.00 ? 109 VAL A CA   1  
ATOM   1562  C  C    . VAL A 1 109 ? 3.510   0.004   -2.115  1.00 10.00 ? 109 VAL A C    1  
ATOM   1563  O  O    . VAL A 1 109 ? 3.727   -0.908  -1.315  1.00 10.00 ? 109 VAL A O    1  
ATOM   1564  C  CB   . VAL A 1 109 ? 1.461   1.015   -1.045  1.00 10.00 ? 109 VAL A CB   1  
ATOM   1565  C  CG1  . VAL A 1 109 ? 2.266   2.223   -0.547  1.00 10.00 ? 109 VAL A CG1  1  
ATOM   1566  C  CG2  . VAL A 1 109 ? 0.014   1.459   -1.277  1.00 10.00 ? 109 VAL A CG2  1  
ATOM   1567  H  H    . VAL A 1 109 ? 1.431   -1.540  -2.181  1.00 10.00 ? 109 VAL A H    1  
ATOM   1568  H  HA   . VAL A 1 109 ? 2.054   1.234   -3.099  1.00 10.00 ? 109 VAL A HA   1  
ATOM   1569  H  HB   . VAL A 1 109 ? 1.472   0.244   -0.273  1.00 10.00 ? 109 VAL A HB   1  
ATOM   1570  H  HG11 . VAL A 1 109 ? 1.818   2.594   0.373   1.00 10.00 ? 109 VAL A HG11 1  
ATOM   1571  H  HG12 . VAL A 1 109 ? 3.297   1.946   -0.334  1.00 10.00 ? 109 VAL A HG12 1  
ATOM   1572  H  HG13 . VAL A 1 109 ? 2.258   3.017   -1.294  1.00 10.00 ? 109 VAL A HG13 1  
ATOM   1573  H  HG21 . VAL A 1 109 ? -0.003  2.234   -2.039  1.00 10.00 ? 109 VAL A HG21 1  
ATOM   1574  H  HG22 . VAL A 1 109 ? -0.600  0.623   -1.608  1.00 10.00 ? 109 VAL A HG22 1  
ATOM   1575  H  HG23 . VAL A 1 109 ? -0.406  1.857   -0.352  1.00 10.00 ? 109 VAL A HG23 1  
ATOM   1576  N  N    . MET A 1 110 ? 4.471   0.638   -2.795  1.00 10.00 ? 110 MET A N    1  
ATOM   1577  C  CA   . MET A 1 110 ? 5.886   0.519   -2.491  1.00 10.00 ? 110 MET A CA   1  
ATOM   1578  C  C    . MET A 1 110 ? 6.213   1.497   -1.366  1.00 10.00 ? 110 MET A C    1  
ATOM   1579  O  O    . MET A 1 110 ? 6.425   2.690   -1.574  1.00 10.00 ? 110 MET A O    1  
ATOM   1580  C  CB   . MET A 1 110 ? 6.780   0.783   -3.711  1.00 10.00 ? 110 MET A CB   1  
ATOM   1581  C  CG   . MET A 1 110 ? 6.497   -0.214  -4.834  1.00 10.00 ? 110 MET A CG   1  
ATOM   1582  S  SD   . MET A 1 110 ? 7.726   -0.298  -6.160  1.00 10.00 ? 110 MET A SD   1  
ATOM   1583  C  CE   . MET A 1 110 ? 8.960   -1.369  -5.385  1.00 10.00 ? 110 MET A CE   1  
ATOM   1584  H  H    . MET A 1 110 ? 4.204   1.413   -3.392  1.00 10.00 ? 110 MET A H    1  
ATOM   1585  H  HA   . MET A 1 110 ? 6.098   -0.497  -2.162  1.00 10.00 ? 110 MET A HA   1  
ATOM   1586  H  HB2  . MET A 1 110 ? 6.640   1.799   -4.076  1.00 10.00 ? 110 MET A HB2  1  
ATOM   1587  H  HB3  . MET A 1 110 ? 7.818   0.673   -3.396  1.00 10.00 ? 110 MET A HB3  1  
ATOM   1588  H  HG2  . MET A 1 110 ? 6.421   -1.213  -4.407  1.00 10.00 ? 110 MET A HG2  1  
ATOM   1589  H  HG3  . MET A 1 110 ? 5.544   0.070   -5.279  1.00 10.00 ? 110 MET A HG3  1  
ATOM   1590  H  HE1  . MET A 1 110 ? 9.339   -0.904  -4.474  1.00 10.00 ? 110 MET A HE1  1  
ATOM   1591  H  HE2  . MET A 1 110 ? 8.518   -2.334  -5.139  1.00 10.00 ? 110 MET A HE2  1  
ATOM   1592  H  HE3  . MET A 1 110 ? 9.790   -1.516  -6.074  1.00 10.00 ? 110 MET A HE3  1  
ATOM   1593  N  N    . LEU A 1 111 ? 6.302   0.959   -0.160  1.00 10.00 ? 111 LEU A N    1  
ATOM   1594  C  CA   . LEU A 1 111 ? 6.776   1.656   1.018   1.00 10.00 ? 111 LEU A CA   1  
ATOM   1595  C  C    . LEU A 1 111 ? 8.306   1.688   0.916   1.00 10.00 ? 111 LEU A C    1  
ATOM   1596  O  O    . LEU A 1 111 ? 9.016   0.944   1.590   1.00 10.00 ? 111 LEU A O    1  
ATOM   1597  C  CB   . LEU A 1 111 ? 6.267   0.894   2.251   1.00 10.00 ? 111 LEU A CB   1  
ATOM   1598  C  CG   . LEU A 1 111 ? 4.733   0.906   2.374   1.00 10.00 ? 111 LEU A CG   1  
ATOM   1599  C  CD1  . LEU A 1 111 ? 4.320   -0.034  3.507   1.00 10.00 ? 111 LEU A CD1  1  
ATOM   1600  C  CD2  . LEU A 1 111 ? 4.188   2.309   2.664   1.00 10.00 ? 111 LEU A CD2  1  
ATOM   1601  H  H    . LEU A 1 111 ? 6.048   -0.010  -0.087  1.00 10.00 ? 111 LEU A H    1  
ATOM   1602  H  HA   . LEU A 1 111 ? 6.414   2.682   1.048   1.00 10.00 ? 111 LEU A HA   1  
ATOM   1603  H  HB2  . LEU A 1 111 ? 6.604   -0.141  2.184   1.00 10.00 ? 111 LEU A HB2  1  
ATOM   1604  H  HB3  . LEU A 1 111 ? 6.684   1.326   3.157   1.00 10.00 ? 111 LEU A HB3  1  
ATOM   1605  H  HG   . LEU A 1 111 ? 4.279   0.532   1.455   1.00 10.00 ? 111 LEU A HG   1  
ATOM   1606  H  HD11 . LEU A 1 111 ? 3.236   -0.023  3.623   1.00 10.00 ? 111 LEU A HD11 1  
ATOM   1607  H  HD12 . LEU A 1 111 ? 4.636   -1.046  3.259   1.00 10.00 ? 111 LEU A HD12 1  
ATOM   1608  H  HD13 . LEU A 1 111 ? 4.785   0.275   4.443   1.00 10.00 ? 111 LEU A HD13 1  
ATOM   1609  H  HD21 . LEU A 1 111 ? 4.693   2.742   3.528   1.00 10.00 ? 111 LEU A HD21 1  
ATOM   1610  H  HD22 . LEU A 1 111 ? 4.327   2.956   1.800   1.00 10.00 ? 111 LEU A HD22 1  
ATOM   1611  H  HD23 . LEU A 1 111 ? 3.121   2.249   2.874   1.00 10.00 ? 111 LEU A HD23 1  
ATOM   1612  N  N    . MET A 1 112 ? 8.804   2.546   0.021   1.00 10.00 ? 112 MET A N    1  
ATOM   1613  C  CA   . MET A 1 112 ? 10.203  2.600   -0.371  1.00 10.00 ? 112 MET A CA   1  
ATOM   1614  C  C    . MET A 1 112 ? 11.006  3.463   0.613   1.00 10.00 ? 112 MET A C    1  
ATOM   1615  O  O    . MET A 1 112 ? 10.474  4.375   1.247   1.00 10.00 ? 112 MET A O    1  
ATOM   1616  C  CB   . MET A 1 112 ? 10.268  3.133   -1.812  1.00 10.00 ? 112 MET A CB   1  
ATOM   1617  C  CG   . MET A 1 112 ? 11.592  2.840   -2.520  1.00 10.00 ? 112 MET A CG   1  
ATOM   1618  S  SD   . MET A 1 112 ? 11.701  3.505   -4.200  1.00 10.00 ? 112 MET A SD   1  
ATOM   1619  C  CE   . MET A 1 112 ? 13.268  2.767   -4.714  1.00 10.00 ? 112 MET A CE   1  
ATOM   1620  H  H    . MET A 1 112 ? 8.154   3.131   -0.500  1.00 10.00 ? 112 MET A H    1  
ATOM   1621  H  HA   . MET A 1 112 ? 10.596  1.583   -0.366  1.00 10.00 ? 112 MET A HA   1  
ATOM   1622  H  HB2  . MET A 1 112 ? 9.480   2.660   -2.401  1.00 10.00 ? 112 MET A HB2  1  
ATOM   1623  H  HB3  . MET A 1 112 ? 10.099  4.206   -1.826  1.00 10.00 ? 112 MET A HB3  1  
ATOM   1624  H  HG2  . MET A 1 112 ? 12.431  3.226   -1.944  1.00 10.00 ? 112 MET A HG2  1  
ATOM   1625  H  HG3  . MET A 1 112 ? 11.686  1.763   -2.610  1.00 10.00 ? 112 MET A HG3  1  
ATOM   1626  H  HE1  . MET A 1 112 ? 13.485  3.073   -5.736  1.00 10.00 ? 112 MET A HE1  1  
ATOM   1627  H  HE2  . MET A 1 112 ? 14.066  3.102   -4.054  1.00 10.00 ? 112 MET A HE2  1  
ATOM   1628  H  HE3  . MET A 1 112 ? 13.188  1.680   -4.670  1.00 10.00 ? 112 MET A HE3  1  
ATOM   1629  N  N    . GLY A 1 113 ? 12.310  3.203   0.734   1.00 10.00 ? 113 GLY A N    1  
ATOM   1630  C  CA   . GLY A 1 113 ? 13.190  4.028   1.549   1.00 10.00 ? 113 GLY A CA   1  
ATOM   1631  C  C    . GLY A 1 113 ? 12.946  3.788   3.038   1.00 10.00 ? 113 GLY A C    1  
ATOM   1632  O  O    . GLY A 1 113 ? 12.587  4.706   3.770   1.00 10.00 ? 113 GLY A O    1  
ATOM   1633  H  H    . GLY A 1 113 ? 12.708  2.446   0.198   1.00 10.00 ? 113 GLY A H    1  
ATOM   1634  H  HA2  . GLY A 1 113 ? 14.225  3.799   1.302   1.00 10.00 ? 113 GLY A HA2  1  
ATOM   1635  H  HA3  . GLY A 1 113 ? 13.018  5.081   1.319   1.00 10.00 ? 113 GLY A HA3  1  
ATOM   1636  N  N    . LEU A 1 114 ? 13.138  2.548   3.488   1.00 10.00 ? 114 LEU A N    1  
ATOM   1637  C  CA   . LEU A 1 114 ? 12.968  2.130   4.878   1.00 10.00 ? 114 LEU A CA   1  
ATOM   1638  C  C    . LEU A 1 114 ? 13.777  3.031   5.828   1.00 10.00 ? 114 LEU A C    1  
ATOM   1639  O  O    . LEU A 1 114 ? 14.975  3.212   5.598   1.00 10.00 ? 114 LEU A O    1  
ATOM   1640  C  CB   . LEU A 1 114 ? 13.441  0.673   4.978   1.00 10.00 ? 114 LEU A CB   1  
ATOM   1641  C  CG   . LEU A 1 114 ? 12.660  -0.201  5.962   1.00 10.00 ? 114 LEU A CG   1  
ATOM   1642  C  CD1  . LEU A 1 114 ? 13.319  -1.583  5.985   1.00 10.00 ? 114 LEU A CD1  1  
ATOM   1643  C  CD2  . LEU A 1 114 ? 12.666  0.381   7.370   1.00 10.00 ? 114 LEU A CD2  1  
ATOM   1644  H  H    . LEU A 1 114 ? 13.373  1.840   2.809   1.00 10.00 ? 114 LEU A H    1  
ATOM   1645  H  HA   . LEU A 1 114 ? 11.908  2.175   5.124   1.00 10.00 ? 114 LEU A HA   1  
ATOM   1646  H  HB2  . LEU A 1 114 ? 13.330  0.196   4.005   1.00 10.00 ? 114 LEU A HB2  1  
ATOM   1647  H  HB3  . LEU A 1 114 ? 14.496  0.659   5.250   1.00 10.00 ? 114 LEU A HB3  1  
ATOM   1648  H  HG   . LEU A 1 114 ? 11.628  -0.304  5.624   1.00 10.00 ? 114 LEU A HG   1  
ATOM   1649  H  HD11 . LEU A 1 114 ? 14.379  -1.496  6.228   1.00 10.00 ? 114 LEU A HD11 1  
ATOM   1650  H  HD12 . LEU A 1 114 ? 12.846  -2.218  6.728   1.00 10.00 ? 114 LEU A HD12 1  
ATOM   1651  H  HD13 . LEU A 1 114 ? 13.209  -2.052  5.010   1.00 10.00 ? 114 LEU A HD13 1  
ATOM   1652  H  HD21 . LEU A 1 114 ? 12.208  -0.336  8.045   1.00 10.00 ? 114 LEU A HD21 1  
ATOM   1653  H  HD22 . LEU A 1 114 ? 12.074  1.289   7.412   1.00 10.00 ? 114 LEU A HD22 1  
ATOM   1654  H  HD23 . LEU A 1 114 ? 13.689  0.585   7.685   1.00 10.00 ? 114 LEU A HD23 1  
ATOM   1655  N  N    . LYS A 1 115 ? 13.153  3.581   6.880   1.00 10.00 ? 115 LYS A N    1  
ATOM   1656  C  CA   . LYS A 1 115 ? 13.840  4.339   7.923   1.00 10.00 ? 115 LYS A CA   1  
ATOM   1657  C  C    . LYS A 1 115 ? 14.589  3.415   8.896   1.00 10.00 ? 115 LYS A C    1  
ATOM   1658  O  O    . LYS A 1 115 ? 15.818  3.410   8.908   1.00 10.00 ? 115 LYS A O    1  
ATOM   1659  C  CB   . LYS A 1 115 ? 12.860  5.251   8.696   1.00 10.00 ? 115 LYS A CB   1  
ATOM   1660  C  CG   . LYS A 1 115 ? 12.567  6.602   8.016   1.00 10.00 ? 115 LYS A CG   1  
ATOM   1661  C  CD   . LYS A 1 115 ? 11.212  6.698   7.301   1.00 10.00 ? 115 LYS A CD   1  
ATOM   1662  C  CE   . LYS A 1 115 ? 10.005  6.725   8.254   1.00 10.00 ? 115 LYS A CE   1  
ATOM   1663  N  NZ   . LYS A 1 115 ? 8.780   7.233   7.589   1.00 10.00 ? 115 LYS A NZ   1  
ATOM   1664  H  H    . LYS A 1 115 ? 12.163  3.400   7.005   1.00 10.00 ? 115 LYS A H    1  
ATOM   1665  H  HA   . LYS A 1 115 ? 14.597  4.972   7.458   1.00 10.00 ? 115 LYS A HA   1  
ATOM   1666  H  HB2  . LYS A 1 115 ? 11.940  4.718   8.933   1.00 10.00 ? 115 LYS A HB2  1  
ATOM   1667  H  HB3  . LYS A 1 115 ? 13.344  5.500   9.643   1.00 10.00 ? 115 LYS A HB3  1  
ATOM   1668  H  HG2  . LYS A 1 115 ? 12.611  7.389   8.771   1.00 10.00 ? 115 LYS A HG2  1  
ATOM   1669  H  HG3  . LYS A 1 115 ? 13.352  6.819   7.288   1.00 10.00 ? 115 LYS A HG3  1  
ATOM   1670  H  HD2  . LYS A 1 115 ? 11.231  7.629   6.732   1.00 10.00 ? 115 LYS A HD2  1  
ATOM   1671  H  HD3  . LYS A 1 115 ? 11.137  5.862   6.606   1.00 10.00 ? 115 LYS A HD3  1  
ATOM   1672  H  HE2  . LYS A 1 115 ? 9.836   5.714   8.622   1.00 10.00 ? 115 LYS A HE2  1  
ATOM   1673  H  HE3  . LYS A 1 115 ? 10.221  7.368   9.109   1.00 10.00 ? 115 LYS A HE3  1  
ATOM   1674  H  HZ1  . LYS A 1 115 ? 8.636   6.783   6.693   1.00 10.00 ? 115 LYS A HZ1  1  
ATOM   1675  H  HZ2  . LYS A 1 115 ? 8.842   8.227   7.425   1.00 10.00 ? 115 LYS A HZ2  1  
ATOM   1676  H  HZ3  . LYS A 1 115 ? 7.932   7.039   8.116   1.00 10.00 ? 115 LYS A HZ3  1  
ATOM   1677  N  N    . ARG A 1 116 ? 13.858  2.703   9.764   1.00 10.00 ? 116 ARG A N    1  
ATOM   1678  C  CA   . ARG A 1 116 ? 14.394  2.055   10.968  1.00 10.00 ? 116 ARG A CA   1  
ATOM   1679  C  C    . ARG A 1 116 ? 14.256  0.527   10.906  1.00 10.00 ? 116 ARG A C    1  
ATOM   1680  O  O    . ARG A 1 116 ? 13.404  0.029   10.177  1.00 10.00 ? 116 ARG A O    1  
ATOM   1681  C  CB   . ARG A 1 116 ? 13.673  2.621   12.205  1.00 10.00 ? 116 ARG A CB   1  
ATOM   1682  C  CG   . ARG A 1 116 ? 14.419  3.840   12.765  1.00 10.00 ? 116 ARG A CG   1  
ATOM   1683  C  CD   . ARG A 1 116 ? 13.789  4.309   14.083  1.00 10.00 ? 116 ARG A CD   1  
ATOM   1684  N  NE   . ARG A 1 116 ? 14.654  5.289   14.763  1.00 10.00 ? 116 ARG A NE   1  
ATOM   1685  C  CZ   . ARG A 1 116 ? 14.475  5.734   16.018  1.00 10.00 ? 116 ARG A CZ   1  
ATOM   1686  N  NH1  . ARG A 1 116 ? 13.386  5.368   16.704  1.00 10.00 ? 116 ARG A NH1  1  
ATOM   1687  N  NH2  . ARG A 1 116 ? 15.384  6.538   16.581  1.00 10.00 ? 116 ARG A NH2  1  
ATOM   1688  H  H    . ARG A 1 116 ? 12.861  2.652   9.615   1.00 10.00 ? 116 ARG A H    1  
ATOM   1689  H  HA   . ARG A 1 116 ? 15.459  2.272   11.048  1.00 10.00 ? 116 ARG A HA   1  
ATOM   1690  H  HB2  . ARG A 1 116 ? 12.646  2.891   11.953  1.00 10.00 ? 116 ARG A HB2  1  
ATOM   1691  H  HB3  . ARG A 1 116 ? 13.625  1.856   12.982  1.00 10.00 ? 116 ARG A HB3  1  
ATOM   1692  H  HG2  . ARG A 1 116 ? 15.455  3.557   12.957  1.00 10.00 ? 116 ARG A HG2  1  
ATOM   1693  H  HG3  . ARG A 1 116 ? 14.405  4.648   12.031  1.00 10.00 ? 116 ARG A HG3  1  
ATOM   1694  H  HD2  . ARG A 1 116 ? 12.812  4.749   13.870  1.00 10.00 ? 116 ARG A HD2  1  
ATOM   1695  H  HD3  . ARG A 1 116 ? 13.660  3.438   14.729  1.00 10.00 ? 116 ARG A HD3  1  
ATOM   1696  H  HE   . ARG A 1 116 ? 15.464  5.601   14.245  1.00 10.00 ? 116 ARG A HE   1  
ATOM   1697  H  HH11 . ARG A 1 116 ? 12.701  4.772   16.263  1.00 10.00 ? 116 ARG A HH11 1  
ATOM   1698  H  HH12 . ARG A 1 116 ? 13.222  5.676   17.651  1.00 10.00 ? 116 ARG A HH12 1  
ATOM   1699  H  HH21 . ARG A 1 116 ? 16.217  6.808   16.076  1.00 10.00 ? 116 ARG A HH21 1  
ATOM   1700  H  HH22 . ARG A 1 116 ? 15.271  6.878   17.525  1.00 10.00 ? 116 ARG A HH22 1  
ATOM   1701  N  N    . PRO A 1 117 ? 15.079  -0.229  11.657  1.00 10.00 ? 117 PRO A N    1  
ATOM   1702  C  CA   . PRO A 1 117 ? 15.079  -1.686  11.617  1.00 10.00 ? 117 PRO A CA   1  
ATOM   1703  C  C    . PRO A 1 117 ? 13.724  -2.265  12.031  1.00 10.00 ? 117 PRO A C    1  
ATOM   1704  O  O    . PRO A 1 117 ? 13.052  -1.727  12.909  1.00 10.00 ? 117 PRO A O    1  
ATOM   1705  C  CB   . PRO A 1 117 ? 16.203  -2.134  12.559  1.00 10.00 ? 117 PRO A CB   1  
ATOM   1706  C  CG   . PRO A 1 117 ? 16.354  -0.952  13.516  1.00 10.00 ? 117 PRO A CG   1  
ATOM   1707  C  CD   . PRO A 1 117 ? 16.070  0.245   12.611  1.00 10.00 ? 117 PRO A CD   1  
ATOM   1708  H  HA   . PRO A 1 117 ? 15.313  -2.012  10.602  1.00 10.00 ? 117 PRO A HA   1  
ATOM   1709  H  HB2  . PRO A 1 117 ? 15.970  -3.061  13.084  1.00 10.00 ? 117 PRO A HB2  1  
ATOM   1710  H  HB3  . PRO A 1 117 ? 17.126  -2.250  11.990  1.00 10.00 ? 117 PRO A HB3  1  
ATOM   1711  H  HG2  . PRO A 1 117 ? 15.585  -1.014  14.288  1.00 10.00 ? 117 PRO A HG2  1  
ATOM   1712  H  HG3  . PRO A 1 117 ? 17.344  -0.907  13.972  1.00 10.00 ? 117 PRO A HG3  1  
ATOM   1713  H  HD2  . PRO A 1 117 ? 15.727  1.081   13.217  1.00 10.00 ? 117 PRO A HD2  1  
ATOM   1714  H  HD3  . PRO A 1 117 ? 16.979  0.523   12.075  1.00 10.00 ? 117 PRO A HD3  1  
ATOM   1715  N  N    . LEU A 1 118 ? 13.341  -3.369  11.383  1.00 10.00 ? 118 LEU A N    1  
ATOM   1716  C  CA   . LEU A 1 118 ? 12.029  -3.991  11.467  1.00 10.00 ? 118 LEU A CA   1  
ATOM   1717  C  C    . LEU A 1 118 ? 12.169  -5.398  12.030  1.00 10.00 ? 118 LEU A C    1  
ATOM   1718  O  O    . LEU A 1 118 ? 13.127  -6.088  11.686  1.00 10.00 ? 118 LEU A O    1  
ATOM   1719  C  CB   . LEU A 1 118 ? 11.463  -4.110  10.048  1.00 10.00 ? 118 LEU A CB   1  
ATOM   1720  C  CG   . LEU A 1 118 ? 11.310  -2.770  9.320   1.00 10.00 ? 118 LEU A CG   1  
ATOM   1721  C  CD1  . LEU A 1 118 ? 10.604  -3.013  7.982   1.00 10.00 ? 118 LEU A CD1  1  
ATOM   1722  C  CD2  . LEU A 1 118 ? 10.523  -1.742  10.137  1.00 10.00 ? 118 LEU A CD2  1  
ATOM   1723  H  H    . LEU A 1 118 ? 13.985  -3.799  10.737  1.00 10.00 ? 118 LEU A H    1  
ATOM   1724  H  HA   . LEU A 1 118 ? 11.353  -3.416  12.101  1.00 10.00 ? 118 LEU A HA   1  
ATOM   1725  H  HB2  . LEU A 1 118 ? 12.129  -4.741  9.456   1.00 10.00 ? 118 LEU A HB2  1  
ATOM   1726  H  HB3  . LEU A 1 118 ? 10.505  -4.615  10.103  1.00 10.00 ? 118 LEU A HB3  1  
ATOM   1727  H  HG   . LEU A 1 118 ? 12.304  -2.368  9.121   1.00 10.00 ? 118 LEU A HG   1  
ATOM   1728  H  HD11 . LEU A 1 118 ? 9.601   -3.408  8.148   1.00 10.00 ? 118 LEU A HD11 1  
ATOM   1729  H  HD12 . LEU A 1 118 ? 10.529  -2.079  7.428   1.00 10.00 ? 118 LEU A HD12 1  
ATOM   1730  H  HD13 . LEU A 1 118 ? 11.176  -3.725  7.389   1.00 10.00 ? 118 LEU A HD13 1  
ATOM   1731  H  HD21 . LEU A 1 118 ? 11.076  -1.449  11.027  1.00 10.00 ? 118 LEU A HD21 1  
ATOM   1732  H  HD22 . LEU A 1 118 ? 10.375  -0.849  9.533   1.00 10.00 ? 118 LEU A HD22 1  
ATOM   1733  H  HD23 . LEU A 1 118 ? 9.558   -2.154  10.432  1.00 10.00 ? 118 LEU A HD23 1  
ATOM   1734  N  N    . LYS A 1 119 ? 11.220  -5.841  12.862  1.00 10.00 ? 119 LYS A N    1  
ATOM   1735  C  CA   . LYS A 1 119 ? 11.126  -7.240  13.262  1.00 10.00 ? 119 LYS A CA   1  
ATOM   1736  C  C    . LYS A 1 119 ? 9.925   -7.888  12.570  1.00 10.00 ? 119 LYS A C    1  
ATOM   1737  O  O    . LYS A 1 119 ? 8.805   -7.392  12.662  1.00 10.00 ? 119 LYS A O    1  
ATOM   1738  C  CB   . LYS A 1 119 ? 10.984  -7.374  14.788  1.00 10.00 ? 119 LYS A CB   1  
ATOM   1739  C  CG   . LYS A 1 119 ? 12.303  -7.350  15.582  1.00 10.00 ? 119 LYS A CG   1  
ATOM   1740  C  CD   . LYS A 1 119 ? 13.220  -6.118  15.434  1.00 10.00 ? 119 LYS A CD   1  
ATOM   1741  C  CE   . LYS A 1 119 ? 12.802  -4.863  16.220  1.00 10.00 ? 119 LYS A CE   1  
ATOM   1742  N  NZ   . LYS A 1 119 ? 11.383  -4.528  16.029  1.00 10.00 ? 119 LYS A NZ   1  
ATOM   1743  H  H    . LYS A 1 119 ? 10.459  -5.210  13.134  1.00 10.00 ? 119 LYS A H    1  
ATOM   1744  H  HA   . LYS A 1 119 ? 12.018  -7.783  12.944  1.00 10.00 ? 119 LYS A HA   1  
ATOM   1745  H  HB2  . LYS A 1 119 ? 10.274  -6.642  15.158  1.00 10.00 ? 119 LYS A HB2  1  
ATOM   1746  H  HB3  . LYS A 1 119 ? 10.544  -8.354  14.987  1.00 10.00 ? 119 LYS A HB3  1  
ATOM   1747  H  HG2  . LYS A 1 119 ? 12.070  -7.515  16.635  1.00 10.00 ? 119 LYS A HG2  1  
ATOM   1748  H  HG3  . LYS A 1 119 ? 12.868  -8.221  15.243  1.00 10.00 ? 119 LYS A HG3  1  
ATOM   1749  H  HD2  . LYS A 1 119 ? 14.209  -6.402  15.802  1.00 10.00 ? 119 LYS A HD2  1  
ATOM   1750  H  HD3  . LYS A 1 119 ? 13.348  -5.874  14.381  1.00 10.00 ? 119 LYS A HD3  1  
ATOM   1751  H  HE2  . LYS A 1 119 ? 12.979  -5.024  17.285  1.00 10.00 ? 119 LYS A HE2  1  
ATOM   1752  H  HE3  . LYS A 1 119 ? 13.413  -4.020  15.891  1.00 10.00 ? 119 LYS A HE3  1  
ATOM   1753  H  HZ1  . LYS A 1 119 ? 10.786  -5.224  16.442  1.00 10.00 ? 119 LYS A HZ1  1  
ATOM   1754  H  HZ2  . LYS A 1 119 ? 11.104  -4.453  15.048  1.00 10.00 ? 119 LYS A HZ2  1  
ATOM   1755  H  HZ3  . LYS A 1 119 ? 11.060  -3.632  16.401  1.00 10.00 ? 119 LYS A HZ3  1  
ATOM   1756  N  N    . VAL A 1 120 ? 10.157  -9.034  11.925  1.00 10.00 ? 120 VAL A N    1  
ATOM   1757  C  CA   . VAL A 1 120 ? 9.107   -9.952  11.506  1.00 10.00 ? 120 VAL A CA   1  
ATOM   1758  C  C    . VAL A 1 120 ? 8.258   -10.290 12.737  1.00 10.00 ? 120 VAL A C    1  
ATOM   1759  O  O    . VAL A 1 120 ? 8.735   -11.010 13.611  1.00 10.00 ? 120 VAL A O    1  
ATOM   1760  C  CB   . VAL A 1 120 ? 9.748   -11.221 10.906  1.00 10.00 ? 120 VAL A CB   1  
ATOM   1761  C  CG1  . VAL A 1 120 ? 8.699   -12.282 10.545  1.00 10.00 ? 120 VAL A CG1  1  
ATOM   1762  C  CG2  . VAL A 1 120 ? 10.540  -10.897 9.634   1.00 10.00 ? 120 VAL A CG2  1  
ATOM   1763  H  H    . VAL A 1 120 ? 11.105  -9.368  11.883  1.00 10.00 ? 120 VAL A H    1  
ATOM   1764  H  HA   . VAL A 1 120 ? 8.497   -9.474  10.743  1.00 10.00 ? 120 VAL A HA   1  
ATOM   1765  H  HB   . VAL A 1 120 ? 10.433  -11.654 11.637  1.00 10.00 ? 120 VAL A HB   1  
ATOM   1766  H  HG11 . VAL A 1 120 ? 8.156   -12.611 11.432  1.00 10.00 ? 120 VAL A HG11 1  
ATOM   1767  H  HG12 . VAL A 1 120 ? 9.193   -13.151 10.109  1.00 10.00 ? 120 VAL A HG12 1  
ATOM   1768  H  HG13 . VAL A 1 120 ? 7.994   -11.877 9.822   1.00 10.00 ? 120 VAL A HG13 1  
ATOM   1769  H  HG21 . VAL A 1 120 ? 11.039  -11.797 9.274   1.00 10.00 ? 120 VAL A HG21 1  
ATOM   1770  H  HG22 . VAL A 1 120 ? 9.855   -10.542 8.866   1.00 10.00 ? 120 VAL A HG22 1  
ATOM   1771  H  HG23 . VAL A 1 120 ? 11.298  -10.137 9.827   1.00 10.00 ? 120 VAL A HG23 1  
ATOM   1772  N  N    . GLY A 1 121 ? 7.031   -9.767  12.826  1.00 10.00 ? 121 GLY A N    1  
ATOM   1773  C  CA   . GLY A 1 121 ? 6.164   -9.975  13.978  1.00 10.00 ? 121 GLY A CA   1  
ATOM   1774  C  C    . GLY A 1 121 ? 5.786   -8.656  14.644  1.00 10.00 ? 121 GLY A C    1  
ATOM   1775  O  O    . GLY A 1 121 ? 4.871   -8.626  15.463  1.00 10.00 ? 121 GLY A O    1  
ATOM   1776  H  H    . GLY A 1 121 ? 6.712   -9.098  12.125  1.00 10.00 ? 121 GLY A H    1  
ATOM   1777  H  HA2  . GLY A 1 121 ? 5.257   -10.464 13.636  1.00 10.00 ? 121 GLY A HA2  1  
ATOM   1778  H  HA3  . GLY A 1 121 ? 6.626   -10.611 14.734  1.00 10.00 ? 121 GLY A HA3  1  
ATOM   1779  N  N    . GLU A 1 122 ? 6.475   -7.565  14.297  1.00 10.00 ? 122 GLU A N    1  
ATOM   1780  C  CA   . GLU A 1 122 ? 6.160   -6.247  14.783  1.00 10.00 ? 122 GLU A CA   1  
ATOM   1781  C  C    . GLU A 1 122 ? 4.888   -5.774  14.104  1.00 10.00 ? 122 GLU A C    1  
ATOM   1782  O  O    . GLU A 1 122 ? 4.251   -6.456  13.296  1.00 10.00 ? 122 GLU A O    1  
ATOM   1783  C  CB   . GLU A 1 122 ? 7.371   -5.354  14.489  1.00 10.00 ? 122 GLU A CB   1  
ATOM   1784  C  CG   . GLU A 1 122 ? 7.477   -3.938  15.064  1.00 10.00 ? 122 GLU A CG   1  
ATOM   1785  C  CD   . GLU A 1 122 ? 8.944   -3.524  15.042  1.00 10.00 ? 122 GLU A CD   1  
ATOM   1786  O  OE1  . GLU A 1 122 ? 9.688   -4.003  14.150  1.00 10.00 ? 122 GLU A OE1  1  
ATOM   1787  O  OE2  . GLU A 1 122 ? 9.405   -2.923  16.036  1.00 10.00 ? 122 GLU A OE2  1  
ATOM   1788  H  H    . GLU A 1 122 ? 7.180   -7.592  13.574  1.00 10.00 ? 122 GLU A H    1  
ATOM   1789  H  HA   . GLU A 1 122 ? 6.001   -6.286  15.863  1.00 10.00 ? 122 GLU A HA   1  
ATOM   1790  H  HB2  . GLU A 1 122 ? 8.189   -5.896  14.939  1.00 10.00 ? 122 GLU A HB2  1  
ATOM   1791  H  HB3  . GLU A 1 122 ? 7.546   -5.281  13.419  1.00 10.00 ? 122 GLU A HB3  1  
ATOM   1792  H  HG2  . GLU A 1 122 ? 6.911   -3.225  14.465  1.00 10.00 ? 122 GLU A HG2  1  
ATOM   1793  H  HG3  . GLU A 1 122 ? 7.125   -3.921  16.096  1.00 10.00 ? 122 GLU A HG3  1  
ATOM   1794  N  N    . THR A 1 123 ? 4.514   -4.569  14.472  1.00 10.00 ? 123 THR A N    1  
ATOM   1795  C  CA   . THR A 1 123 ? 3.346   -3.878  13.968  1.00 10.00 ? 123 THR A CA   1  
ATOM   1796  C  C    . THR A 1 123 ? 3.617   -2.390  14.111  1.00 10.00 ? 123 THR A C    1  
ATOM   1797  O  O    . THR A 1 123 ? 4.044   -1.946  15.174  1.00 10.00 ? 123 THR A O    1  
ATOM   1798  C  CB   . THR A 1 123 ? 2.085   -4.341  14.715  1.00 10.00 ? 123 THR A CB   1  
ATOM   1799  O  OG1  . THR A 1 123 ? 1.784   -5.678  14.360  1.00 10.00 ? 123 THR A OG1  1  
ATOM   1800  C  CG2  . THR A 1 123 ? 0.853   -3.499  14.374  1.00 10.00 ? 123 THR A CG2  1  
ATOM   1801  H  H    . THR A 1 123 ? 5.184   -4.093  15.062  1.00 10.00 ? 123 THR A H    1  
ATOM   1802  H  HA   . THR A 1 123 ? 3.242   -4.121  12.915  1.00 10.00 ? 123 THR A HA   1  
ATOM   1803  H  HB   . THR A 1 123 ? 2.263   -4.281  15.791  1.00 10.00 ? 123 THR A HB   1  
ATOM   1804  H  HG1  . THR A 1 123 ? 2.606   -6.148  14.172  1.00 10.00 ? 123 THR A HG1  1  
ATOM   1805  H  HG21 . THR A 1 123 ? 0.676   -3.515  13.298  1.00 10.00 ? 123 THR A HG21 1  
ATOM   1806  H  HG22 . THR A 1 123 ? -0.014  -3.921  14.883  1.00 10.00 ? 123 THR A HG22 1  
ATOM   1807  H  HG23 . THR A 1 123 ? 0.982   -2.468  14.705  1.00 10.00 ? 123 THR A HG23 1  
ATOM   1808  N  N    . VAL A 1 124 ? 3.410   -1.642  13.028  1.00 10.00 ? 124 VAL A N    1  
ATOM   1809  C  CA   . VAL A 1 124 ? 3.629   -0.205  12.979  1.00 10.00 ? 124 VAL A CA   1  
ATOM   1810  C  C    . VAL A 1 124 ? 2.344   0.433   12.454  1.00 10.00 ? 124 VAL A C    1  
ATOM   1811  O  O    . VAL A 1 124 ? 1.644   -0.166  11.639  1.00 10.00 ? 124 VAL A O    1  
ATOM   1812  C  CB   . VAL A 1 124 ? 4.853   0.101   12.098  1.00 10.00 ? 124 VAL A CB   1  
ATOM   1813  C  CG1  . VAL A 1 124 ? 5.114   1.608   12.003  1.00 10.00 ? 124 VAL A CG1  1  
ATOM   1814  C  CG2  . VAL A 1 124 ? 6.110   -0.555  12.690  1.00 10.00 ? 124 VAL A CG2  1  
ATOM   1815  H  H    . VAL A 1 124 ? 3.020   -2.088  12.200  1.00 10.00 ? 124 VAL A H    1  
ATOM   1816  H  HA   . VAL A 1 124 ? 3.824   0.174   13.982  1.00 10.00 ? 124 VAL A HA   1  
ATOM   1817  H  HB   . VAL A 1 124 ? 4.678   -0.288  11.092  1.00 10.00 ? 124 VAL A HB   1  
ATOM   1818  H  HG11 . VAL A 1 124 ? 6.036   1.792   11.451  1.00 10.00 ? 124 VAL A HG11 1  
ATOM   1819  H  HG12 . VAL A 1 124 ? 4.300   2.102   11.478  1.00 10.00 ? 124 VAL A HG12 1  
ATOM   1820  H  HG13 . VAL A 1 124 ? 5.208   2.026   13.005  1.00 10.00 ? 124 VAL A HG13 1  
ATOM   1821  H  HG21 . VAL A 1 124 ? 6.003   -1.637  12.714  1.00 10.00 ? 124 VAL A HG21 1  
ATOM   1822  H  HG22 . VAL A 1 124 ? 6.983   -0.309  12.086  1.00 10.00 ? 124 VAL A HG22 1  
ATOM   1823  H  HG23 . VAL A 1 124 ? 6.274   -0.196  13.707  1.00 10.00 ? 124 VAL A HG23 1  
ATOM   1824  N  N    . ASN A 1 125 ? 2.001   1.631   12.929  1.00 10.00 ? 125 ASN A N    1  
ATOM   1825  C  CA   . ASN A 1 125 ? 0.798   2.304   12.458  1.00 10.00 ? 125 ASN A CA   1  
ATOM   1826  C  C    . ASN A 1 125 ? 1.027   2.842   11.047  1.00 10.00 ? 125 ASN A C    1  
ATOM   1827  O  O    . ASN A 1 125 ? 2.115   3.324   10.727  1.00 10.00 ? 125 ASN A O    1  
ATOM   1828  C  CB   . ASN A 1 125 ? 0.374   3.433   13.407  1.00 10.00 ? 125 ASN A CB   1  
ATOM   1829  C  CG   . ASN A 1 125 ? -0.281  2.924   14.691  1.00 10.00 ? 125 ASN A CG   1  
ATOM   1830  O  OD1  . ASN A 1 125 ? -0.323  1.728   14.959  1.00 10.00 ? 125 ASN A OD1  1  
ATOM   1831  N  ND2  . ASN A 1 125 ? -0.807  3.835   15.504  1.00 10.00 ? 125 ASN A ND2  1  
ATOM   1832  H  H    . ASN A 1 125 ? 2.601   2.096   13.592  1.00 10.00 ? 125 ASN A H    1  
ATOM   1833  H  HA   . ASN A 1 125 ? -0.013  1.576   12.419  1.00 10.00 ? 125 ASN A HA   1  
ATOM   1834  H  HB2  . ASN A 1 125 ? 1.236   4.054   13.652  1.00 10.00 ? 125 ASN A HB2  1  
ATOM   1835  H  HB3  . ASN A 1 125 ? -0.364  4.052   12.893  1.00 10.00 ? 125 ASN A HB3  1  
ATOM   1836  H  HD21 . ASN A 1 125 ? -0.764  4.816   15.279  1.00 10.00 ? 125 ASN A HD21 1  
ATOM   1837  H  HD22 . ASN A 1 125 ? -1.238  3.516   16.359  1.00 10.00 ? 125 ASN A HD22 1  
ATOM   1838  N  N    . ILE A 1 126 ? -0.012  2.788   10.217  1.00 10.00 ? 126 ILE A N    1  
ATOM   1839  C  CA   . ILE A 1 126 ? -0.079  3.451   8.926   1.00 10.00 ? 126 ILE A CA   1  
ATOM   1840  C  C    . ILE A 1 126 ? -1.237  4.437   8.994   1.00 10.00 ? 126 ILE A C    1  
ATOM   1841  O  O    . ILE A 1 126 ? -2.272  4.111   9.567   1.00 10.00 ? 126 ILE A O    1  
ATOM   1842  C  CB   . ILE A 1 126 ? -0.250  2.412   7.802   1.00 10.00 ? 126 ILE A CB   1  
ATOM   1843  C  CG1  . ILE A 1 126 ? 0.001   3.030   6.416   1.00 10.00 ? 126 ILE A CG1  1  
ATOM   1844  C  CG2  . ILE A 1 126 ? -1.626  1.744   7.827   1.00 10.00 ? 126 ILE A CG2  1  
ATOM   1845  C  CD1  . ILE A 1 126 ? -0.305  2.033   5.294   1.00 10.00 ? 126 ILE A CD1  1  
ATOM   1846  H  H    . ILE A 1 126 ? -0.881  2.387   10.558  1.00 10.00 ? 126 ILE A H    1  
ATOM   1847  H  HA   . ILE A 1 126 ? 0.836   4.009   8.758   1.00 10.00 ? 126 ILE A HA   1  
ATOM   1848  H  HB   . ILE A 1 126 ? 0.484   1.630   7.981   1.00 10.00 ? 126 ILE A HB   1  
ATOM   1849  H  HG12 . ILE A 1 126 ? -0.627  3.909   6.272   1.00 10.00 ? 126 ILE A HG12 1  
ATOM   1850  H  HG13 . ILE A 1 126 ? 1.046   3.331   6.342   1.00 10.00 ? 126 ILE A HG13 1  
ATOM   1851  H  HG21 . ILE A 1 126 ? -1.623  0.839   7.221   1.00 10.00 ? 126 ILE A HG21 1  
ATOM   1852  H  HG22 . ILE A 1 126 ? -1.875  1.455   8.841   1.00 10.00 ? 126 ILE A HG22 1  
ATOM   1853  H  HG23 . ILE A 1 126 ? -2.371  2.439   7.437   1.00 10.00 ? 126 ILE A HG23 1  
ATOM   1854  H  HD11 . ILE A 1 126 ? 0.033   2.441   4.345   1.00 10.00 ? 126 ILE A HD11 1  
ATOM   1855  H  HD12 . ILE A 1 126 ? 0.215   1.092   5.482   1.00 10.00 ? 126 ILE A HD12 1  
ATOM   1856  H  HD13 . ILE A 1 126 ? -1.380  1.854   5.226   1.00 10.00 ? 126 ILE A HD13 1  
ATOM   1857  N  N    . THR A 1 127 ? -1.061  5.632   8.435   1.00 10.00 ? 127 THR A N    1  
ATOM   1858  C  CA   . THR A 1 127 ? -2.128  6.585   8.202   1.00 10.00 ? 127 THR A CA   1  
ATOM   1859  C  C    . THR A 1 127 ? -2.320  6.678   6.692   1.00 10.00 ? 127 THR A C    1  
ATOM   1860  O  O    . THR A 1 127 ? -1.458  7.221   5.997   1.00 10.00 ? 127 THR A O    1  
ATOM   1861  C  CB   . THR A 1 127 ? -1.794  7.941   8.833   1.00 10.00 ? 127 THR A CB   1  
ATOM   1862  O  OG1  . THR A 1 127 ? -1.448  7.750   10.189  1.00 10.00 ? 127 THR A OG1  1  
ATOM   1863  C  CG2  . THR A 1 127 ? -3.009  8.875   8.768   1.00 10.00 ? 127 THR A CG2  1  
ATOM   1864  H  H    . THR A 1 127 ? -0.177  5.825   7.981   1.00 10.00 ? 127 THR A H    1  
ATOM   1865  H  HA   . THR A 1 127 ? -3.038  6.236   8.675   1.00 10.00 ? 127 THR A HA   1  
ATOM   1866  H  HB   . THR A 1 127 ? -0.951  8.398   8.312   1.00 10.00 ? 127 THR A HB   1  
ATOM   1867  H  HG1  . THR A 1 127 ? -0.767  7.074   10.234  1.00 10.00 ? 127 THR A HG1  1  
ATOM   1868  H  HG21 . THR A 1 127 ? -3.860  8.416   9.275   1.00 10.00 ? 127 THR A HG21 1  
ATOM   1869  H  HG22 . THR A 1 127 ? -2.768  9.817   9.260   1.00 10.00 ? 127 THR A HG22 1  
ATOM   1870  H  HG23 . THR A 1 127 ? -3.281  9.075   7.732   1.00 10.00 ? 127 THR A HG23 1  
ATOM   1871  N  N    . LEU A 1 128 ? -3.423  6.130   6.179   1.00 10.00 ? 128 LEU A N    1  
ATOM   1872  C  CA   . LEU A 1 128 ? -3.792  6.333   4.787   1.00 10.00 ? 128 LEU A CA   1  
ATOM   1873  C  C    . LEU A 1 128 ? -4.566  7.636   4.643   1.00 10.00 ? 128 LEU A C    1  
ATOM   1874  O  O    . LEU A 1 128 ? -5.075  8.165   5.633   1.00 10.00 ? 128 LEU A O    1  
ATOM   1875  C  CB   . LEU A 1 128 ? -4.528  5.127   4.197   1.00 10.00 ? 128 LEU A CB   1  
ATOM   1876  C  CG   . LEU A 1 128 ? -5.853  4.697   4.840   1.00 10.00 ? 128 LEU A CG   1  
ATOM   1877  C  CD1  . LEU A 1 128 ? -7.000  5.634   4.429   1.00 10.00 ? 128 LEU A CD1  1  
ATOM   1878  C  CD2  . LEU A 1 128 ? -6.191  3.280   4.362   1.00 10.00 ? 128 LEU A CD2  1  
ATOM   1879  H  H    . LEU A 1 128 ? -4.120  5.761   6.820   1.00 10.00 ? 128 LEU A H    1  
ATOM   1880  H  HA   . LEU A 1 128 ? -2.881  6.439   4.202   1.00 10.00 ? 128 LEU A HA   1  
ATOM   1881  H  HB2  . LEU A 1 128 ? -4.759  5.395   3.174   1.00 10.00 ? 128 LEU A HB2  1  
ATOM   1882  H  HB3  . LEU A 1 128 ? -3.834  4.285   4.198   1.00 10.00 ? 128 LEU A HB3  1  
ATOM   1883  H  HG   . LEU A 1 128 ? -5.744  4.663   5.922   1.00 10.00 ? 128 LEU A HG   1  
ATOM   1884  H  HD11 . LEU A 1 128 ? -6.964  5.832   3.359   1.00 10.00 ? 128 LEU A HD11 1  
ATOM   1885  H  HD12 . LEU A 1 128 ? -7.960  5.174   4.663   1.00 10.00 ? 128 LEU A HD12 1  
ATOM   1886  H  HD13 . LEU A 1 128 ? -6.937  6.578   4.963   1.00 10.00 ? 128 LEU A HD13 1  
ATOM   1887  H  HD21 . LEU A 1 128 ? -5.394  2.591   4.641   1.00 10.00 ? 128 LEU A HD21 1  
ATOM   1888  H  HD22 . LEU A 1 128 ? -6.312  3.267   3.278   1.00 10.00 ? 128 LEU A HD22 1  
ATOM   1889  H  HD23 . LEU A 1 128 ? -7.116  2.942   4.830   1.00 10.00 ? 128 LEU A HD23 1  
ATOM   1890  N  N    . LYS A 1 129 ? -4.655  8.153   3.414   1.00 10.00 ? 129 LYS A N    1  
ATOM   1891  C  CA   . LYS A 1 129 ? -5.240  9.447   3.134   1.00 10.00 ? 129 LYS A CA   1  
ATOM   1892  C  C    . LYS A 1 129 ? -5.855  9.415   1.733   1.00 10.00 ? 129 LYS A C    1  
ATOM   1893  O  O    . LYS A 1 129 ? -5.174  9.593   0.726   1.00 10.00 ? 129 LYS A O    1  
ATOM   1894  C  CB   . LYS A 1 129 ? -4.186  10.551  3.324   1.00 10.00 ? 129 LYS A CB   1  
ATOM   1895  C  CG   . LYS A 1 129 ? -4.841  11.911  3.596   1.00 10.00 ? 129 LYS A CG   1  
ATOM   1896  C  CD   . LYS A 1 129 ? -3.763  12.973  3.850   1.00 10.00 ? 129 LYS A CD   1  
ATOM   1897  C  CE   . LYS A 1 129 ? -4.416  14.311  4.225   1.00 10.00 ? 129 LYS A CE   1  
ATOM   1898  N  NZ   . LYS A 1 129 ? -3.412  15.357  4.515   1.00 10.00 ? 129 LYS A NZ   1  
ATOM   1899  H  H    . LYS A 1 129 ? -4.316  7.628   2.622   1.00 10.00 ? 129 LYS A H    1  
ATOM   1900  H  HA   . LYS A 1 129 ? -6.033  9.608   3.859   1.00 10.00 ? 129 LYS A HA   1  
ATOM   1901  H  HB2  . LYS A 1 129 ? -3.569  10.303  4.189   1.00 10.00 ? 129 LYS A HB2  1  
ATOM   1902  H  HB3  . LYS A 1 129 ? -3.541  10.617  2.447   1.00 10.00 ? 129 LYS A HB3  1  
ATOM   1903  H  HG2  . LYS A 1 129 ? -5.463  12.197  2.746   1.00 10.00 ? 129 LYS A HG2  1  
ATOM   1904  H  HG3  . LYS A 1 129 ? -5.473  11.828  4.482   1.00 10.00 ? 129 LYS A HG3  1  
ATOM   1905  H  HD2  . LYS A 1 129 ? -3.124  12.629  4.667   1.00 10.00 ? 129 LYS A HD2  1  
ATOM   1906  H  HD3  . LYS A 1 129 ? -3.158  13.080  2.946   1.00 10.00 ? 129 LYS A HD3  1  
ATOM   1907  H  HE2  . LYS A 1 129 ? -5.051  14.644  3.402   1.00 10.00 ? 129 LYS A HE2  1  
ATOM   1908  H  HE3  . LYS A 1 129 ? -5.044  14.168  5.108   1.00 10.00 ? 129 LYS A HE3  1  
ATOM   1909  H  HZ1  . LYS A 1 129 ? -2.829  15.517  3.705   1.00 10.00 ? 129 LYS A HZ1  1  
ATOM   1910  H  HZ2  . LYS A 1 129 ? -3.879  16.221  4.755   1.00 10.00 ? 129 LYS A HZ2  1  
ATOM   1911  H  HZ3  . LYS A 1 129 ? -2.830  15.077  5.292   1.00 10.00 ? 129 LYS A HZ3  1  
ATOM   1912  N  N    . ALA A 1 130 ? -7.154  9.141   1.664   1.00 10.00 ? 130 ALA A N    1  
ATOM   1913  C  CA   . ALA A 1 130 ? -7.916  9.265   0.429   1.00 10.00 ? 130 ALA A CA   1  
ATOM   1914  C  C    . ALA A 1 130 ? -8.376  10.705  0.262   1.00 10.00 ? 130 ALA A C    1  
ATOM   1915  O  O    . ALA A 1 130 ? -8.902  11.294  1.208   1.00 10.00 ? 130 ALA A O    1  
ATOM   1916  C  CB   . ALA A 1 130 ? -9.103  8.299   0.424   1.00 10.00 ? 130 ALA A CB   1  
ATOM   1917  H  H    . ALA A 1 130 ? -7.630  8.971   2.533   1.00 10.00 ? 130 ALA A H    1  
ATOM   1918  H  HA   . ALA A 1 130 ? -7.268  9.041   -0.412  1.00 10.00 ? 130 ALA A HA   1  
ATOM   1919  H  HB1  . ALA A 1 130 ? -9.599  8.333   -0.547  1.00 10.00 ? 130 ALA A HB1  1  
ATOM   1920  H  HB2  . ALA A 1 130 ? -8.764  7.281   0.615   1.00 10.00 ? 130 ALA A HB2  1  
ATOM   1921  H  HB3  . ALA A 1 130 ? -9.822  8.587   1.186   1.00 10.00 ? 130 ALA A HB3  1  
ATOM   1922  N  N    . THR A 1 131 ? -8.206  11.274  -0.935  1.00 10.00 ? 131 THR A N    1  
ATOM   1923  C  CA   . THR A 1 131 ? -8.559  12.673  -1.167  1.00 10.00 ? 131 THR A CA   1  
ATOM   1924  C  C    . THR A 1 131 ? -10.073 12.867  -1.324  1.00 10.00 ? 131 THR A C    1  
ATOM   1925  O  O    . THR A 1 131 ? -10.520 13.997  -1.510  1.00 10.00 ? 131 THR A O    1  
ATOM   1926  C  CB   . THR A 1 131 ? -7.715  13.309  -2.285  1.00 10.00 ? 131 THR A CB   1  
ATOM   1927  O  OG1  . THR A 1 131 ? -7.988  14.693  -2.365  1.00 10.00 ? 131 THR A OG1  1  
ATOM   1928  C  CG2  . THR A 1 131 ? -7.938  12.678  -3.658  1.00 10.00 ? 131 THR A CG2  1  
ATOM   1929  H  H    . THR A 1 131 ? -7.880  10.699  -1.706  1.00 10.00 ? 131 THR A H    1  
ATOM   1930  H  HA   . THR A 1 131 ? -8.286  13.229  -0.267  1.00 10.00 ? 131 THR A HA   1  
ATOM   1931  H  HB   . THR A 1 131 ? -6.660  13.198  -2.031  1.00 10.00 ? 131 THR A HB   1  
ATOM   1932  H  HG1  . THR A 1 131 ? -8.942  14.827  -2.276  1.00 10.00 ? 131 THR A HG1  1  
ATOM   1933  H  HG21 . THR A 1 131 ? -7.622  11.637  -3.637  1.00 10.00 ? 131 THR A HG21 1  
ATOM   1934  H  HG22 . THR A 1 131 ? -8.988  12.754  -3.940  1.00 10.00 ? 131 THR A HG22 1  
ATOM   1935  H  HG23 . THR A 1 131 ? -7.336  13.208  -4.396  1.00 10.00 ? 131 THR A HG23 1  
ATOM   1936  N  N    . ASP A 1 132 ? -10.866 11.800  -1.158  1.00 10.00 ? 132 ASP A N    1  
ATOM   1937  C  CA   . ASP A 1 132 ? -12.273 11.896  -0.780  1.00 10.00 ? 132 ASP A CA   1  
ATOM   1938  C  C    . ASP A 1 132 ? -12.431 12.570  0.592   1.00 10.00 ? 132 ASP A C    1  
ATOM   1939  O  O    . ASP A 1 132 ? -13.543 12.937  0.976   1.00 10.00 ? 132 ASP A O    1  
ATOM   1940  C  CB   . ASP A 1 132 ? -12.895 10.493  -0.735  1.00 10.00 ? 132 ASP A CB   1  
ATOM   1941  C  CG   . ASP A 1 132 ? -12.785 9.781   -2.070  1.00 10.00 ? 132 ASP A CG   1  
ATOM   1942  O  OD1  . ASP A 1 132 ? -13.691 9.980   -2.913  1.00 10.00 ? 132 ASP A OD1  1  
ATOM   1943  O  OD2  . ASP A 1 132 ? -11.755 9.094   -2.260  1.00 10.00 ? 132 ASP A OD2  1  
ATOM   1944  H  H    . ASP A 1 132 ? -10.463 10.873  -1.157  1.00 10.00 ? 132 ASP A H    1  
ATOM   1945  H  HA   . ASP A 1 132 ? -12.803 12.493  -1.525  1.00 10.00 ? 132 ASP A HA   1  
ATOM   1946  H  HB2  . ASP A 1 132 ? -12.405 9.892   0.033   1.00 10.00 ? 132 ASP A HB2  1  
ATOM   1947  H  HB3  . ASP A 1 132 ? -13.953 10.586  -0.496  1.00 10.00 ? 132 ASP A HB3  1  
ATOM   1948  N  N    . GLY A 1 133 ? -11.340 12.669  1.362   1.00 10.00 ? 133 GLY A N    1  
ATOM   1949  C  CA   . GLY A 1 133 ? -11.260 13.331  2.653   1.00 10.00 ? 133 GLY A CA   1  
ATOM   1950  C  C    . GLY A 1 133 ? -11.241 12.293  3.769   1.00 10.00 ? 133 GLY A C    1  
ATOM   1951  O  O    . GLY A 1 133 ? -12.026 12.392  4.716   1.00 10.00 ? 133 GLY A O    1  
ATOM   1952  H  H    . GLY A 1 133 ? -10.482 12.241  1.034   1.00 10.00 ? 133 GLY A H    1  
ATOM   1953  H  HA2  . GLY A 1 133 ? -10.332 13.902  2.693   1.00 10.00 ? 133 GLY A HA2  1  
ATOM   1954  H  HA3  . GLY A 1 133 ? -12.095 14.018  2.794   1.00 10.00 ? 133 GLY A HA3  1  
ATOM   1955  N  N    . ARG A 1 134 ? -10.403 11.262  3.627   1.00 10.00 ? 134 ARG A N    1  
ATOM   1956  C  CA   . ARG A 1 134 ? -10.128 10.283  4.671   1.00 10.00 ? 134 ARG A CA   1  
ATOM   1957  C  C    . ARG A 1 134 ? -8.694  10.518  5.148   1.00 10.00 ? 134 ARG A C    1  
ATOM   1958  O  O    . ARG A 1 134 ? -7.877  11.035  4.389   1.00 10.00 ? 134 ARG A O    1  
ATOM   1959  C  CB   . ARG A 1 134 ? -10.284 8.843   4.153   1.00 10.00 ? 134 ARG A CB   1  
ATOM   1960  C  CG   . ARG A 1 134 ? -11.601 8.506   3.433   1.00 10.00 ? 134 ARG A CG   1  
ATOM   1961  C  CD   . ARG A 1 134 ? -12.859 8.668   4.301   1.00 10.00 ? 134 ARG A CD   1  
ATOM   1962  N  NE   . ARG A 1 134 ? -13.358 10.051  4.275   1.00 10.00 ? 134 ARG A NE   1  
ATOM   1963  C  CZ   . ARG A 1 134 ? -14.043 10.627  3.273   1.00 10.00 ? 134 ARG A CZ   1  
ATOM   1964  N  NH1  . ARG A 1 134 ? -14.465 9.911   2.228   1.00 10.00 ? 134 ARG A NH1  1  
ATOM   1965  N  NH2  . ARG A 1 134 ? -14.250 11.944  3.308   1.00 10.00 ? 134 ARG A NH2  1  
ATOM   1966  H  H    . ARG A 1 134 ? -9.755  11.278  2.844   1.00 10.00 ? 134 ARG A H    1  
ATOM   1967  H  HA   . ARG A 1 134 ? -10.801 10.422  5.517   1.00 10.00 ? 134 ARG A HA   1  
ATOM   1968  H  HB2  . ARG A 1 134 ? -9.468  8.640   3.462   1.00 10.00 ? 134 ARG A HB2  1  
ATOM   1969  H  HB3  . ARG A 1 134 ? -10.169 8.162   4.998   1.00 10.00 ? 134 ARG A HB3  1  
ATOM   1970  H  HG2  . ARG A 1 134 ? -11.689 9.101   2.524   1.00 10.00 ? 134 ARG A HG2  1  
ATOM   1971  H  HG3  . ARG A 1 134 ? -11.535 7.457   3.136   1.00 10.00 ? 134 ARG A HG3  1  
ATOM   1972  H  HD2  . ARG A 1 134 ? -13.637 7.985   3.955   1.00 10.00 ? 134 ARG A HD2  1  
ATOM   1973  H  HD3  . ARG A 1 134 ? -12.627 8.388   5.330   1.00 10.00 ? 134 ARG A HD3  1  
ATOM   1974  H  HE   . ARG A 1 134 ? -12.975 10.682  4.975   1.00 10.00 ? 134 ARG A HE   1  
ATOM   1975  H  HH11 . ARG A 1 134 ? -14.262 8.925   2.178   1.00 10.00 ? 134 ARG A HH11 1  
ATOM   1976  H  HH12 . ARG A 1 134 ? -14.957 10.351  1.463   1.00 10.00 ? 134 ARG A HH12 1  
ATOM   1977  H  HH21 . ARG A 1 134 ? -13.796 12.457  4.061   1.00 10.00 ? 134 ARG A HH21 1  
ATOM   1978  H  HH22 . ARG A 1 134 ? -14.413 12.449  2.434   1.00 10.00 ? 134 ARG A HH22 1  
ATOM   1979  N  N    . THR A 1 135 ? -8.411  10.112  6.386   1.00 10.00 ? 135 THR A N    1  
ATOM   1980  C  CA   . THR A 1 135 ? -7.151  10.248  7.097   1.00 10.00 ? 135 THR A CA   1  
ATOM   1981  C  C    . THR A 1 135 ? -7.198  9.134   8.146   1.00 10.00 ? 135 THR A C    1  
ATOM   1982  O  O    . THR A 1 135 ? -7.511  9.392   9.305   1.00 10.00 ? 135 THR A O    1  
ATOM   1983  C  CB   . THR A 1 135 ? -7.058  11.644  7.741   1.00 10.00 ? 135 THR A CB   1  
ATOM   1984  O  OG1  . THR A 1 135 ? -7.169  12.659  6.761   1.00 10.00 ? 135 THR A OG1  1  
ATOM   1985  C  CG2  . THR A 1 135 ? -5.717  11.829  8.452   1.00 10.00 ? 135 THR A CG2  1  
ATOM   1986  H  H    . THR A 1 135 ? -9.109  9.585   6.880   1.00 10.00 ? 135 THR A H    1  
ATOM   1987  H  HA   . THR A 1 135 ? -6.312  10.112  6.419   1.00 10.00 ? 135 THR A HA   1  
ATOM   1988  H  HB   . THR A 1 135 ? -7.869  11.767  8.463   1.00 10.00 ? 135 THR A HB   1  
ATOM   1989  H  HG1  . THR A 1 135 ? -7.394  13.483  7.200   1.00 10.00 ? 135 THR A HG1  1  
ATOM   1990  H  HG21 . THR A 1 135 ? -5.619  11.104  9.259   1.00 10.00 ? 135 THR A HG21 1  
ATOM   1991  H  HG22 . THR A 1 135 ? -4.904  11.688  7.741   1.00 10.00 ? 135 THR A HG22 1  
ATOM   1992  H  HG23 . THR A 1 135 ? -5.662  12.831  8.876   1.00 10.00 ? 135 THR A HG23 1  
ATOM   1993  N  N    . LEU A 1 136 ? -7.035  7.882   7.714   1.00 10.00 ? 136 LEU A N    1  
ATOM   1994  C  CA   . LEU A 1 136 ? -7.430  6.720   8.508   1.00 10.00 ? 136 LEU A CA   1  
ATOM   1995  C  C    . LEU A 1 136 ? -6.183  6.020   9.032   1.00 10.00 ? 136 LEU A C    1  
ATOM   1996  O  O    . LEU A 1 136 ? -5.286  5.705   8.253   1.00 10.00 ? 136 LEU A O    1  
ATOM   1997  C  CB   . LEU A 1 136 ? -8.285  5.774   7.658   1.00 10.00 ? 136 LEU A CB   1  
ATOM   1998  C  CG   . LEU A 1 136 ? -9.015  4.692   8.472   1.00 10.00 ? 136 LEU A CG   1  
ATOM   1999  C  CD1  . LEU A 1 136 ? -10.224 5.268   9.220   1.00 10.00 ? 136 LEU A CD1  1  
ATOM   2000  C  CD2  . LEU A 1 136 ? -9.494  3.586   7.524   1.00 10.00 ? 136 LEU A CD2  1  
ATOM   2001  H  H    . LEU A 1 136 ? -6.605  7.738   6.805   1.00 10.00 ? 136 LEU A H    1  
ATOM   2002  H  HA   . LEU A 1 136 ? -8.035  7.045   9.353   1.00 10.00 ? 136 LEU A HA   1  
ATOM   2003  H  HB2  . LEU A 1 136 ? -9.017  6.350   7.091   1.00 10.00 ? 136 LEU A HB2  1  
ATOM   2004  H  HB3  . LEU A 1 136 ? -7.619  5.278   6.960   1.00 10.00 ? 136 LEU A HB3  1  
ATOM   2005  H  HG   . LEU A 1 136 ? -8.331  4.242   9.193   1.00 10.00 ? 136 LEU A HG   1  
ATOM   2006  H  HD11 . LEU A 1 136 ? -9.909  6.004   9.959   1.00 10.00 ? 136 LEU A HD11 1  
ATOM   2007  H  HD12 . LEU A 1 136 ? -10.911 5.739   8.516   1.00 10.00 ? 136 LEU A HD12 1  
ATOM   2008  H  HD13 . LEU A 1 136 ? -10.748 4.466   9.741   1.00 10.00 ? 136 LEU A HD13 1  
ATOM   2009  H  HD21 . LEU A 1 136 ? -8.639  3.125   7.029   1.00 10.00 ? 136 LEU A HD21 1  
ATOM   2010  H  HD22 . LEU A 1 136 ? -10.163 4.001   6.770   1.00 10.00 ? 136 LEU A HD22 1  
ATOM   2011  H  HD23 . LEU A 1 136 ? -10.023 2.818   8.088   1.00 10.00 ? 136 LEU A HD23 1  
ATOM   2012  N  N    . ASN A 1 137 ? -6.138  5.784   10.343  1.00 10.00 ? 137 ASN A N    1  
ATOM   2013  C  CA   . ASN A 1 137 ? -5.054  5.137   11.053  1.00 10.00 ? 137 ASN A CA   1  
ATOM   2014  C  C    . ASN A 1 137 ? -5.377  3.653   11.125  1.00 10.00 ? 137 ASN A C    1  
ATOM   2015  O  O    . ASN A 1 137 ? -6.506  3.279   11.434  1.00 10.00 ? 137 ASN A O    1  
ATOM   2016  C  CB   . ASN A 1 137 ? -4.901  5.728   12.460  1.00 10.00 ? 137 ASN A CB   1  
ATOM   2017  C  CG   . ASN A 1 137 ? -6.154  5.528   13.312  1.00 10.00 ? 137 ASN A CG   1  
ATOM   2018  O  OD1  . ASN A 1 137 ? -7.234  5.972   12.934  1.00 10.00 ? 137 ASN A OD1  1  
ATOM   2019  N  ND2  . ASN A 1 137 ? -6.027  4.865   14.458  1.00 10.00 ? 137 ASN A ND2  1  
ATOM   2020  H  H    . ASN A 1 137 ? -6.981  5.890   10.884  1.00 10.00 ? 137 ASN A H    1  
ATOM   2021  H  HA   . ASN A 1 137 ? -4.124  5.312   10.522  1.00 10.00 ? 137 ASN A HA   1  
ATOM   2022  H  HB2  . ASN A 1 137 ? -4.043  5.257   12.943  1.00 10.00 ? 137 ASN A HB2  1  
ATOM   2023  H  HB3  . ASN A 1 137 ? -4.702  6.795   12.374  1.00 10.00 ? 137 ASN A HB3  1  
ATOM   2024  H  HD21 . ASN A 1 137 ? -5.136  4.497   14.751  1.00 10.00 ? 137 ASN A HD21 1  
ATOM   2025  H  HD22 . ASN A 1 137 ? -6.856  4.717   15.013  1.00 10.00 ? 137 ASN A HD22 1  
ATOM   2026  N  N    . VAL A 1 138 ? -4.401  2.814   10.804  1.00 10.00 ? 138 VAL A N    1  
ATOM   2027  C  CA   . VAL A 1 138 ? -4.554  1.382   10.677  1.00 10.00 ? 138 VAL A CA   1  
ATOM   2028  C  C    . VAL A 1 138 ? -3.279  0.773   11.269  1.00 10.00 ? 138 VAL A C    1  
ATOM   2029  O  O    . VAL A 1 138 ? -2.236  1.427   11.281  1.00 10.00 ? 138 VAL A O    1  
ATOM   2030  C  CB   . VAL A 1 138 ? -4.755  1.087   9.177   1.00 10.00 ? 138 VAL A CB   1  
ATOM   2031  C  CG1  . VAL A 1 138 ? -4.363  -0.341  8.764   1.00 10.00 ? 138 VAL A CG1  1  
ATOM   2032  C  CG2  . VAL A 1 138 ? -6.189  1.352   8.715   1.00 10.00 ? 138 VAL A CG2  1  
ATOM   2033  H  H    . VAL A 1 138 ? -3.490  3.175   10.526  1.00 10.00 ? 138 VAL A H    1  
ATOM   2034  H  HA   . VAL A 1 138 ? -5.411  1.028   11.251  1.00 10.00 ? 138 VAL A HA   1  
ATOM   2035  H  HB   . VAL A 1 138 ? -4.169  1.825   8.632   1.00 10.00 ? 138 VAL A HB   1  
ATOM   2036  H  HG11 . VAL A 1 138 ? -3.303  -0.524  8.939   1.00 10.00 ? 138 VAL A HG11 1  
ATOM   2037  H  HG12 . VAL A 1 138 ? -4.951  -1.066  9.327   1.00 10.00 ? 138 VAL A HG12 1  
ATOM   2038  H  HG13 . VAL A 1 138 ? -4.556  -0.482  7.700   1.00 10.00 ? 138 VAL A HG13 1  
ATOM   2039  H  HG21 . VAL A 1 138 ? -6.885  0.690   9.229   1.00 10.00 ? 138 VAL A HG21 1  
ATOM   2040  H  HG22 . VAL A 1 138 ? -6.457  2.390   8.906   1.00 10.00 ? 138 VAL A HG22 1  
ATOM   2041  H  HG23 . VAL A 1 138 ? -6.246  1.181   7.638   1.00 10.00 ? 138 VAL A HG23 1  
ATOM   2042  N  N    . ALA A 1 139 ? -3.359  -0.454  11.787  1.00 10.00 ? 139 ALA A N    1  
ATOM   2043  C  CA   . ALA A 1 139 ? -2.208  -1.177  12.308  1.00 10.00 ? 139 ALA A CA   1  
ATOM   2044  C  C    . ALA A 1 139 ? -1.663  -2.070  11.198  1.00 10.00 ? 139 ALA A C    1  
ATOM   2045  O  O    . ALA A 1 139 ? -2.374  -2.956  10.729  1.00 10.00 ? 139 ALA A O    1  
ATOM   2046  C  CB   . ALA A 1 139 ? -2.640  -1.998  13.526  1.00 10.00 ? 139 ALA A CB   1  
ATOM   2047  H  H    . ALA A 1 139 ? -4.231  -0.956  11.722  1.00 10.00 ? 139 ALA A H    1  
ATOM   2048  H  HA   . ALA A 1 139 ? -1.423  -0.489  12.625  1.00 10.00 ? 139 ALA A HA   1  
ATOM   2049  H  HB1  . ALA A 1 139 ? -3.426  -2.702  13.249  1.00 10.00 ? 139 ALA A HB1  1  
ATOM   2050  H  HB2  . ALA A 1 139 ? -1.787  -2.554  13.913  1.00 10.00 ? 139 ALA A HB2  1  
ATOM   2051  H  HB3  . ALA A 1 139 ? -3.011  -1.332  14.306  1.00 10.00 ? 139 ALA A HB3  1  
ATOM   2052  N  N    . ALA A 1 140 ? -0.426  -1.823  10.761  1.00 10.00 ? 140 ALA A N    1  
ATOM   2053  C  CA   . ALA A 1 140 ? 0.216   -2.580  9.702   1.00 10.00 ? 140 ALA A CA   1  
ATOM   2054  C  C    . ALA A 1 140 ? 1.166   -3.606  10.309  1.00 10.00 ? 140 ALA A C    1  
ATOM   2055  O  O    . ALA A 1 140 ? 2.107   -3.227  11.007  1.00 10.00 ? 140 ALA A O    1  
ATOM   2056  C  CB   . ALA A 1 140 ? 0.980   -1.631  8.785   1.00 10.00 ? 140 ALA A CB   1  
ATOM   2057  H  H    . ALA A 1 140 ? 0.133   -1.098  11.200  1.00 10.00 ? 140 ALA A H    1  
ATOM   2058  H  HA   . ALA A 1 140 ? -0.542  -3.069  9.097   1.00 10.00 ? 140 ALA A HA   1  
ATOM   2059  H  HB1  . ALA A 1 140 ? 0.307   -0.860  8.411   1.00 10.00 ? 140 ALA A HB1  1  
ATOM   2060  H  HB2  . ALA A 1 140 ? 1.807   -1.170  9.323   1.00 10.00 ? 140 ALA A HB2  1  
ATOM   2061  H  HB3  . ALA A 1 140 ? 1.377   -2.211  7.956   1.00 10.00 ? 140 ALA A HB3  1  
ATOM   2062  N  N    . THR A 1 141 ? 0.939   -4.895  10.047  1.00 10.00 ? 141 THR A N    1  
ATOM   2063  C  CA   . THR A 1 141 ? 1.736   -5.965  10.636  1.00 10.00 ? 141 THR A CA   1  
ATOM   2064  C  C    . THR A 1 141 ? 3.017   -6.161  9.821   1.00 10.00 ? 141 THR A C    1  
ATOM   2065  O  O    . THR A 1 141 ? 2.966   -6.326  8.603   1.00 10.00 ? 141 THR A O    1  
ATOM   2066  C  CB   . THR A 1 141 ? 0.906   -7.253  10.703  1.00 10.00 ? 141 THR A CB   1  
ATOM   2067  O  OG1  . THR A 1 141 ? -0.418  -6.954  11.089  1.00 10.00 ? 141 THR A OG1  1  
ATOM   2068  C  CG2  . THR A 1 141 ? 1.496   -8.238  11.717  1.00 10.00 ? 141 THR A CG2  1  
ATOM   2069  H  H    . THR A 1 141 ? 0.155   -5.143  9.447   1.00 10.00 ? 141 THR A H    1  
ATOM   2070  H  HA   . THR A 1 141 ? 1.991   -5.681  11.658  1.00 10.00 ? 141 THR A HA   1  
ATOM   2071  H  HB   . THR A 1 141 ? 0.876   -7.720  9.717   1.00 10.00 ? 141 THR A HB   1  
ATOM   2072  H  HG1  . THR A 1 141 ? -0.393  -6.355  11.841  1.00 10.00 ? 141 THR A HG1  1  
ATOM   2073  H  HG21 . THR A 1 141 ? 1.517   -7.786  12.709  1.00 10.00 ? 141 THR A HG21 1  
ATOM   2074  H  HG22 . THR A 1 141 ? 0.873   -9.131  11.758  1.00 10.00 ? 141 THR A HG22 1  
ATOM   2075  H  HG23 . THR A 1 141 ? 2.511   -8.516  11.434  1.00 10.00 ? 141 THR A HG23 1  
ATOM   2076  N  N    . VAL A 1 142 ? 4.181   -6.136  10.469  1.00 10.00 ? 142 VAL A N    1  
ATOM   2077  C  CA   . VAL A 1 142 ? 5.451   -6.137  9.772   1.00 10.00 ? 142 VAL A CA   1  
ATOM   2078  C  C    . VAL A 1 142 ? 5.924   -7.582  9.689   1.00 10.00 ? 142 VAL A C    1  
ATOM   2079  O  O    . VAL A 1 142 ? 6.448   -8.107  10.665  1.00 10.00 ? 142 VAL A O    1  
ATOM   2080  C  CB   . VAL A 1 142 ? 6.438   -5.250  10.538  1.00 10.00 ? 142 VAL A CB   1  
ATOM   2081  C  CG1  . VAL A 1 142 ? 7.800   -5.215  9.847   1.00 10.00 ? 142 VAL A CG1  1  
ATOM   2082  C  CG2  . VAL A 1 142 ? 5.931   -3.808  10.652  1.00 10.00 ? 142 VAL A CG2  1  
ATOM   2083  H  H    . VAL A 1 142 ? 4.211   -6.166  11.483  1.00 10.00 ? 142 VAL A H    1  
ATOM   2084  H  HA   . VAL A 1 142 ? 5.345   -5.716  8.774   1.00 10.00 ? 142 VAL A HA   1  
ATOM   2085  H  HB   . VAL A 1 142 ? 6.563   -5.652  11.540  1.00 10.00 ? 142 VAL A HB   1  
ATOM   2086  H  HG11 . VAL A 1 142 ? 8.287   -6.186  9.918   1.00 10.00 ? 142 VAL A HG11 1  
ATOM   2087  H  HG12 . VAL A 1 142 ? 7.690   -4.933  8.799   1.00 10.00 ? 142 VAL A HG12 1  
ATOM   2088  H  HG13 . VAL A 1 142 ? 8.410   -4.476  10.358  1.00 10.00 ? 142 VAL A HG13 1  
ATOM   2089  H  HG21 . VAL A 1 142 ? 5.756   -3.393  9.659   1.00 10.00 ? 142 VAL A HG21 1  
ATOM   2090  H  HG22 . VAL A 1 142 ? 5.009   -3.769  11.230  1.00 10.00 ? 142 VAL A HG22 1  
ATOM   2091  H  HG23 . VAL A 1 142 ? 6.686   -3.208  11.161  1.00 10.00 ? 142 VAL A HG23 1  
ATOM   2092  N  N    . LYS A 1 143 ? 5.707   -8.255  8.559   1.00 10.00 ? 143 LYS A N    1  
ATOM   2093  C  CA   . LYS A 1 143 ? 6.258   -9.580  8.319   1.00 10.00 ? 143 LYS A CA   1  
ATOM   2094  C  C    . LYS A 1 143 ? 6.283   -9.860  6.817   1.00 10.00 ? 143 LYS A C    1  
ATOM   2095  O  O    . LYS A 1 143 ? 5.353   -9.478  6.108   1.00 10.00 ? 143 LYS A O    1  
ATOM   2096  C  CB   . LYS A 1 143 ? 5.520   -10.667 9.114   1.00 10.00 ? 143 LYS A CB   1  
ATOM   2097  C  CG   . LYS A 1 143 ? 3.995   -10.566 9.023   1.00 10.00 ? 143 LYS A CG   1  
ATOM   2098  C  CD   . LYS A 1 143 ? 3.378   -11.792 9.708   1.00 10.00 ? 143 LYS A CD   1  
ATOM   2099  C  CE   . LYS A 1 143 ? 1.846   -11.746 9.647   1.00 10.00 ? 143 LYS A CE   1  
ATOM   2100  N  NZ   . LYS A 1 143 ? 1.233   -12.929 10.288  1.00 10.00 ? 143 LYS A NZ   1  
ATOM   2101  H  H    . LYS A 1 143 ? 5.324   -7.757  7.755   1.00 10.00 ? 143 LYS A H    1  
ATOM   2102  H  HA   . LYS A 1 143 ? 7.296   -9.571  8.658   1.00 10.00 ? 143 LYS A HA   1  
ATOM   2103  H  HB2  . LYS A 1 143 ? 5.839   -11.640 8.736   1.00 10.00 ? 143 LYS A HB2  1  
ATOM   2104  H  HB3  . LYS A 1 143 ? 5.808   -10.598 10.162  1.00 10.00 ? 143 LYS A HB3  1  
ATOM   2105  H  HG2  . LYS A 1 143 ? 3.662   -9.651  9.515   1.00 10.00 ? 143 LYS A HG2  1  
ATOM   2106  H  HG3  . LYS A 1 143 ? 3.702   -10.531 7.975   1.00 10.00 ? 143 LYS A HG3  1  
ATOM   2107  H  HD2  . LYS A 1 143 ? 3.739   -12.688 9.198   1.00 10.00 ? 143 LYS A HD2  1  
ATOM   2108  H  HD3  . LYS A 1 143 ? 3.714   -11.816 10.748  1.00 10.00 ? 143 LYS A HD3  1  
ATOM   2109  H  HE2  . LYS A 1 143 ? 1.492   -10.844 10.151  1.00 10.00 ? 143 LYS A HE2  1  
ATOM   2110  H  HE3  . LYS A 1 143 ? 1.530   -11.707 8.602   1.00 10.00 ? 143 LYS A HE3  1  
ATOM   2111  H  HZ1  . LYS A 1 143 ? 0.225   -12.858 10.244  1.00 10.00 ? 143 LYS A HZ1  1  
ATOM   2112  H  HZ2  . LYS A 1 143 ? 1.513   -12.988 11.258  1.00 10.00 ? 143 LYS A HZ2  1  
ATOM   2113  H  HZ3  . LYS A 1 143 ? 1.521   -13.771 9.807   1.00 10.00 ? 143 LYS A HZ3  1  
ATOM   2114  N  N    . LYS A 1 144 ? 7.361   -10.487 6.338   1.00 10.00 ? 144 LYS A N    1  
ATOM   2115  C  CA   . LYS A 1 144 ? 7.616   -10.636 4.918   1.00 10.00 ? 144 LYS A CA   1  
ATOM   2116  C  C    . LYS A 1 144 ? 6.549   -11.424 4.158   1.00 10.00 ? 144 LYS A C    1  
ATOM   2117  O  O    . LYS A 1 144 ? 6.019   -10.907 3.179   1.00 10.00 ? 144 LYS A O    1  
ATOM   2118  C  CB   . LYS A 1 144 ? 9.069   -11.017 4.661   1.00 10.00 ? 144 LYS A CB   1  
ATOM   2119  C  CG   . LYS A 1 144 ? 9.618   -12.298 5.282   1.00 10.00 ? 144 LYS A CG   1  
ATOM   2120  C  CD   . LYS A 1 144 ? 11.127  -12.160 5.567   1.00 10.00 ? 144 LYS A CD   1  
ATOM   2121  C  CE   . LYS A 1 144 ? 12.030  -11.850 4.352   1.00 10.00 ? 144 LYS A CE   1  
ATOM   2122  N  NZ   . LYS A 1 144 ? 11.874  -10.479 3.809   1.00 10.00 ? 144 LYS A NZ   1  
ATOM   2123  H  H    . LYS A 1 144 ? 8.094   -10.741 6.977   1.00 10.00 ? 144 LYS A H    1  
ATOM   2124  H  HA   . LYS A 1 144 ? 7.562   -9.654  4.469   1.00 10.00 ? 144 LYS A HA   1  
ATOM   2125  H  HB2  . LYS A 1 144 ? 9.209   -11.066 3.584   1.00 10.00 ? 144 LYS A HB2  1  
ATOM   2126  H  HB3  . LYS A 1 144 ? 9.635   -10.180 5.061   1.00 10.00 ? 144 LYS A HB3  1  
ATOM   2127  H  HG2  . LYS A 1 144 ? 9.120   -12.508 6.229   1.00 10.00 ? 144 LYS A HG2  1  
ATOM   2128  H  HG3  . LYS A 1 144 ? 9.437   -13.143 4.608   1.00 10.00 ? 144 LYS A HG3  1  
ATOM   2129  H  HD2  . LYS A 1 144 ? 11.281  -11.395 6.334   1.00 10.00 ? 144 LYS A HD2  1  
ATOM   2130  H  HD3  . LYS A 1 144 ? 11.466  -13.111 5.991   1.00 10.00 ? 144 LYS A HD3  1  
ATOM   2131  H  HE2  . LYS A 1 144 ? 13.065  -11.944 4.691   1.00 10.00 ? 144 LYS A HE2  1  
ATOM   2132  H  HE3  . LYS A 1 144 ? 11.865  -12.581 3.557   1.00 10.00 ? 144 LYS A HE3  1  
ATOM   2133  H  HZ1  . LYS A 1 144 ? 11.551  -9.809  4.503   1.00 10.00 ? 144 LYS A HZ1  1  
ATOM   2134  H  HZ2  . LYS A 1 144 ? 12.760  -10.089 3.491   1.00 10.00 ? 144 LYS A HZ2  1  
ATOM   2135  H  HZ3  . LYS A 1 144 ? 11.202  -10.425 3.040   1.00 10.00 ? 144 LYS A HZ3  1  
ATOM   2136  N  N    . ASN A 1 145 ? 6.197   -12.627 4.643   1.00 10.00 ? 145 ASN A N    1  
ATOM   2137  C  CA   . ASN A 1 145 ? 5.125   -13.455 4.102   1.00 10.00 ? 145 ASN A CA   1  
ATOM   2138  C  C    . ASN A 1 145 ? 5.444   -13.934 2.681   1.00 10.00 ? 145 ASN A C    1  
ATOM   2139  O  O    . ASN A 1 145 ? 5.414   -13.145 1.741   1.00 10.00 ? 145 ASN A O    1  
ATOM   2140  C  CB   . ASN A 1 145 ? 3.762   -12.734 4.111   1.00 10.00 ? 145 ASN A CB   1  
ATOM   2141  C  CG   . ASN A 1 145 ? 3.335   -12.202 5.476   1.00 10.00 ? 145 ASN A CG   1  
ATOM   2142  O  OD1  . ASN A 1 145 ? 3.690   -12.752 6.516   1.00 10.00 ? 145 ASN A OD1  1  
ATOM   2143  N  ND2  . ASN A 1 145 ? 2.541   -11.134 5.489   1.00 10.00 ? 145 ASN A ND2  1  
ATOM   2144  H  H    . ASN A 1 145 ? 6.666   -12.939 5.474   1.00 10.00 ? 145 ASN A H    1  
ATOM   2145  H  HA   . ASN A 1 145 ? 5.037   -14.326 4.752   1.00 10.00 ? 145 ASN A HA   1  
ATOM   2146  H  HB2  . ASN A 1 145 ? 3.769   -11.912 3.396   1.00 10.00 ? 145 ASN A HB2  1  
ATOM   2147  H  HB3  . ASN A 1 145 ? 3.002   -13.445 3.784   1.00 10.00 ? 145 ASN A HB3  1  
ATOM   2148  H  HD21 . ASN A 1 145 ? 2.299   -10.661 4.628   1.00 10.00 ? 145 ASN A HD21 1  
ATOM   2149  H  HD22 . ASN A 1 145 ? 2.254   -10.731 6.362   1.00 10.00 ? 145 ASN A HD22 1  
ATOM   2150  N  N    . ILE A 1 146 ? 5.698   -15.239 2.504   1.00 10.00 ? 146 ILE A N    1  
ATOM   2151  C  CA   . ILE A 1 146 ? 5.928   -15.867 1.199   1.00 10.00 ? 146 ILE A CA   1  
ATOM   2152  C  C    . ILE A 1 146 ? 6.859   -15.026 0.307   1.00 10.00 ? 146 ILE A C    1  
ATOM   2153  O  O    . ILE A 1 146 ? 6.532   -14.718 -0.835  1.00 10.00 ? 146 ILE A O    1  
ATOM   2154  C  CB   . ILE A 1 146 ? 4.592   -16.264 0.521   1.00 10.00 ? 146 ILE A CB   1  
ATOM   2155  C  CG1  . ILE A 1 146 ? 3.621   -15.082 0.314   1.00 10.00 ? 146 ILE A CG1  1  
ATOM   2156  C  CG2  . ILE A 1 146 ? 3.920   -17.375 1.341   1.00 10.00 ? 146 ILE A CG2  1  
ATOM   2157  C  CD1  . ILE A 1 146 ? 2.433   -15.432 -0.585  1.00 10.00 ? 146 ILE A CD1  1  
ATOM   2158  H  H    . ILE A 1 146 ? 5.689   -15.843 3.312   1.00 10.00 ? 146 ILE A H    1  
ATOM   2159  H  HA   . ILE A 1 146 ? 6.475   -16.791 1.389   1.00 10.00 ? 146 ILE A HA   1  
ATOM   2160  H  HB   . ILE A 1 146 ? 4.836   -16.682 -0.457  1.00 10.00 ? 146 ILE A HB   1  
ATOM   2161  H  HG12 . ILE A 1 146 ? 3.235   -14.740 1.273   1.00 10.00 ? 146 ILE A HG12 1  
ATOM   2162  H  HG13 . ILE A 1 146 ? 4.145   -14.256 -0.167  1.00 10.00 ? 146 ILE A HG13 1  
ATOM   2163  H  HG21 . ILE A 1 146 ? 4.624   -18.190 1.509   1.00 10.00 ? 146 ILE A HG21 1  
ATOM   2164  H  HG22 . ILE A 1 146 ? 3.584   -16.988 2.301   1.00 10.00 ? 146 ILE A HG22 1  
ATOM   2165  H  HG23 . ILE A 1 146 ? 3.066   -17.777 0.799   1.00 10.00 ? 146 ILE A HG23 1  
ATOM   2166  H  HD11 . ILE A 1 146 ? 1.853   -14.528 -0.770  1.00 10.00 ? 146 ILE A HD11 1  
ATOM   2167  H  HD12 . ILE A 1 146 ? 1.786   -16.164 -0.105  1.00 10.00 ? 146 ILE A HD12 1  
ATOM   2168  H  HD13 . ILE A 1 146 ? 2.788   -15.824 -1.537  1.00 10.00 ? 146 ILE A HD13 1  
ATOM   2169  N  N    . GLU A 1 147 ? 8.035   -14.689 0.848   1.00 10.00 ? 147 GLU A N    1  
ATOM   2170  C  CA   . GLU A 1 147 ? 9.034   -13.857 0.206   1.00 10.00 ? 147 GLU A CA   1  
ATOM   2171  C  C    . GLU A 1 147 ? 10.381  -14.569 0.300   1.00 10.00 ? 147 GLU A C    1  
ATOM   2172  O  O    . GLU A 1 147 ? 10.526  -15.538 1.045   1.00 10.00 ? 147 GLU A O    1  
ATOM   2173  C  CB   . GLU A 1 147 ? 9.029   -12.488 0.886   1.00 10.00 ? 147 GLU A CB   1  
ATOM   2174  C  CG   . GLU A 1 147 ? 9.807   -11.420 0.107   1.00 10.00 ? 147 GLU A CG   1  
ATOM   2175  C  CD   . GLU A 1 147 ? 9.612   -10.066 0.767   1.00 10.00 ? 147 GLU A CD   1  
ATOM   2176  O  OE1  . GLU A 1 147 ? 10.277  -9.875  1.809   1.00 10.00 ? 147 GLU A OE1  1  
ATOM   2177  O  OE2  . GLU A 1 147 ? 8.797   -9.280  0.222   1.00 10.00 ? 147 GLU A OE2  1  
ATOM   2178  H  H    . GLU A 1 147 ? 8.275   -15.069 1.750   1.00 10.00 ? 147 GLU A H    1  
ATOM   2179  H  HA   . GLU A 1 147 ? 8.788   -13.726 -0.848  1.00 10.00 ? 147 GLU A HA   1  
ATOM   2180  H  HB2  . GLU A 1 147 ? 7.996   -12.140 0.965   1.00 10.00 ? 147 GLU A HB2  1  
ATOM   2181  H  HB3  . GLU A 1 147 ? 9.442   -12.579 1.889   1.00 10.00 ? 147 GLU A HB3  1  
ATOM   2182  H  HG2  . GLU A 1 147 ? 10.876  -11.638 0.110   1.00 10.00 ? 147 GLU A HG2  1  
ATOM   2183  H  HG3  . GLU A 1 147 ? 9.445   -11.370 -0.922  1.00 10.00 ? 147 GLU A HG3  1  
ATOM   2184  N  N    . GLY A 1 148 ? 11.348  -14.145 -0.518  1.00 10.00 ? 148 GLY A N    1  
ATOM   2185  C  CA   . GLY A 1 148 ? 12.402  -15.047 -0.970  1.00 10.00 ? 148 GLY A CA   1  
ATOM   2186  C  C    . GLY A 1 148 ? 11.764  -16.184 -1.780  1.00 10.00 ? 148 GLY A C    1  
ATOM   2187  O  O    . GLY A 1 148 ? 12.273  -17.310 -1.817  1.00 10.00 ? 148 GLY A O    1  
ATOM   2188  H  H    . GLY A 1 148 ? 11.165  -13.327 -1.078  1.00 10.00 ? 148 GLY A H    1  
ATOM   2189  H  HA2  . GLY A 1 148 ? 13.093  -14.504 -1.619  1.00 10.00 ? 148 GLY A HA2  1  
ATOM   2190  H  HA3  . GLY A 1 148 ? 12.953  -15.456 -0.120  1.00 10.00 ? 148 GLY A HA3  1  
ATOM   2191  N  N    . ARG A 1 149 ? 10.624  -15.869 -2.401  1.00 10.00 ? 149 ARG A N    1  
ATOM   2192  C  CA   . ARG A 1 149 ? 9.804   -16.650 -3.295  1.00 10.00 ? 149 ARG A CA   1  
ATOM   2193  C  C    . ARG A 1 149 ? 9.485   -15.646 -4.410  1.00 10.00 ? 149 ARG A C    1  
ATOM   2194  O  O    . ARG A 1 149 ? 9.601   -14.423 -4.125  1.00 10.00 ? 149 ARG A O    1  
ATOM   2195  C  CB   . ARG A 1 149 ? 8.499   -17.093 -2.601  1.00 10.00 ? 149 ARG A CB   1  
ATOM   2196  C  CG   . ARG A 1 149 ? 8.601   -17.856 -1.267  1.00 10.00 ? 149 ARG A CG   1  
ATOM   2197  C  CD   . ARG A 1 149 ? 9.092   -19.302 -1.411  1.00 10.00 ? 149 ARG A CD   1  
ATOM   2198  N  NE   . ARG A 1 149 ? 10.513  -19.310 -1.766  1.00 10.00 ? 149 ARG A NE   1  
ATOM   2199  C  CZ   . ARG A 1 149 ? 11.129  -20.072 -2.680  1.00 10.00 ? 149 ARG A CZ   1  
ATOM   2200  N  NH1  . ARG A 1 149 ? 10.547  -21.175 -3.162  1.00 10.00 ? 149 ARG A NH1  1  
ATOM   2201  N  NH2  . ARG A 1 149 ? 12.340  -19.688 -3.094  1.00 10.00 ? 149 ARG A NH2  1  
ATOM   2202  O  OXT  . ARG A 1 149 ? 9.141   -16.116 -5.512  1.00 10.00 ? 149 ARG A OXT  1  
ATOM   2203  H  H    . ARG A 1 149 ? 10.373  -14.886 -2.495  1.00 10.00 ? 149 ARG A H    1  
ATOM   2204  H  HA   . ARG A 1 149 ? 10.350  -17.495 -3.710  1.00 10.00 ? 149 ARG A HA   1  
ATOM   2205  H  HB2  . ARG A 1 149 ? 7.927   -16.187 -2.404  1.00 10.00 ? 149 ARG A HB2  1  
ATOM   2206  H  HB3  . ARG A 1 149 ? 7.924   -17.689 -3.309  1.00 10.00 ? 149 ARG A HB3  1  
ATOM   2207  H  HG2  . ARG A 1 149 ? 9.232   -17.311 -0.565  1.00 10.00 ? 149 ARG A HG2  1  
ATOM   2208  H  HG3  . ARG A 1 149 ? 7.598   -17.898 -0.842  1.00 10.00 ? 149 ARG A HG3  1  
ATOM   2209  H  HD2  . ARG A 1 149 ? 8.974   -19.811 -0.452  1.00 10.00 ? 149 ARG A HD2  1  
ATOM   2210  H  HD3  . ARG A 1 149 ? 8.475   -19.803 -2.157  1.00 10.00 ? 149 ARG A HD3  1  
ATOM   2211  H  HE   . ARG A 1 149 ? 11.052  -18.518 -1.423  1.00 10.00 ? 149 ARG A HE   1  
ATOM   2212  H  HH11 . ARG A 1 149 ? 9.646   -21.453 -2.800  1.00 10.00 ? 149 ARG A HH11 1  
ATOM   2213  H  HH12 . ARG A 1 149 ? 10.984  -21.738 -3.877  1.00 10.00 ? 149 ARG A HH12 1  
ATOM   2214  H  HH21 . ARG A 1 149 ? 12.677  -18.790 -2.735  1.00 10.00 ? 149 ARG A HH21 1  
ATOM   2215  H  HH22 . ARG A 1 149 ? 12.871  -20.186 -3.792  1.00 10.00 ? 149 ARG A HH22 1  
HETATM 2216  CU CU   . CU1 B 2 .   ? 6.288   -1.570  -7.610  1.00 10.00 ? 150 CU1 A CU   1  
ATOM   2217  N  N    . MET A 1 1   ? -88.724 -32.661 13.936  1.00 10.00 ? 1   MET A N    2  
ATOM   2218  C  CA   . MET A 1 1   ? -87.710 -31.756 14.504  1.00 10.00 ? 1   MET A CA   2  
ATOM   2219  C  C    . MET A 1 1   ? -86.662 -31.554 13.414  1.00 10.00 ? 1   MET A C    2  
ATOM   2220  O  O    . MET A 1 1   ? -86.970 -31.889 12.272  1.00 10.00 ? 1   MET A O    2  
ATOM   2221  C  CB   . MET A 1 1   ? -87.129 -32.305 15.816  1.00 10.00 ? 1   MET A CB   2  
ATOM   2222  C  CG   . MET A 1 1   ? -88.192 -32.461 16.912  1.00 10.00 ? 1   MET A CG   2  
ATOM   2223  S  SD   . MET A 1 1   ? -87.522 -32.983 18.511  1.00 10.00 ? 1   MET A SD   2  
ATOM   2224  C  CE   . MET A 1 1   ? -89.038 -33.025 19.493  1.00 10.00 ? 1   MET A CE   2  
ATOM   2225  H  H1   . MET A 1 1   ? -88.415 -33.617 14.032  1.00 10.00 ? 1   MET A H1   2  
ATOM   2226  H  H2   . MET A 1 1   ? -89.633 -32.526 14.350  1.00 10.00 ? 1   MET A H2   2  
ATOM   2227  H  H3   . MET A 1 1   ? -88.729 -32.442 12.942  1.00 10.00 ? 1   MET A H3   2  
ATOM   2228  H  HA   . MET A 1 1   ? -88.172 -30.785 14.692  1.00 10.00 ? 1   MET A HA   2  
ATOM   2229  H  HB2  . MET A 1 1   ? -86.654 -33.271 15.637  1.00 10.00 ? 1   MET A HB2  2  
ATOM   2230  H  HB3  . MET A 1 1   ? -86.376 -31.614 16.196  1.00 10.00 ? 1   MET A HB3  2  
ATOM   2231  H  HG2  . MET A 1 1   ? -88.691 -31.504 17.064  1.00 10.00 ? 1   MET A HG2  2  
ATOM   2232  H  HG3  . MET A 1 1   ? -88.930 -33.204 16.614  1.00 10.00 ? 1   MET A HG3  2  
ATOM   2233  H  HE1  . MET A 1 1   ? -89.732 -33.745 19.061  1.00 10.00 ? 1   MET A HE1  2  
ATOM   2234  H  HE2  . MET A 1 1   ? -88.790 -33.326 20.510  1.00 10.00 ? 1   MET A HE2  2  
ATOM   2235  H  HE3  . MET A 1 1   ? -89.491 -32.035 19.507  1.00 10.00 ? 1   MET A HE3  2  
ATOM   2236  N  N    . GLY A 1 2   ? -85.476 -31.037 13.735  1.00 10.00 ? 2   GLY A N    2  
ATOM   2237  C  CA   . GLY A 1 2   ? -84.393 -30.841 12.786  1.00 10.00 ? 2   GLY A CA   2  
ATOM   2238  C  C    . GLY A 1 2   ? -83.100 -30.666 13.575  1.00 10.00 ? 2   GLY A C    2  
ATOM   2239  O  O    . GLY A 1 2   ? -83.146 -30.562 14.800  1.00 10.00 ? 2   GLY A O    2  
ATOM   2240  H  H    . GLY A 1 2   ? -85.238 -30.813 14.694  1.00 10.00 ? 2   GLY A H    2  
ATOM   2241  H  HA2  . GLY A 1 2   ? -84.303 -31.709 12.132  1.00 10.00 ? 2   GLY A HA2  2  
ATOM   2242  H  HA3  . GLY A 1 2   ? -84.584 -29.949 12.188  1.00 10.00 ? 2   GLY A HA3  2  
ATOM   2243  N  N    . HIS A 1 3   ? -81.962 -30.652 12.881  1.00 10.00 ? 3   HIS A N    2  
ATOM   2244  C  CA   . HIS A 1 3   ? -80.631 -30.561 13.459  1.00 10.00 ? 3   HIS A CA   2  
ATOM   2245  C  C    . HIS A 1 3   ? -79.680 -30.170 12.324  1.00 10.00 ? 3   HIS A C    2  
ATOM   2246  O  O    . HIS A 1 3   ? -80.054 -30.293 11.158  1.00 10.00 ? 3   HIS A O    2  
ATOM   2247  C  CB   . HIS A 1 3   ? -80.251 -31.916 14.077  1.00 10.00 ? 3   HIS A CB   2  
ATOM   2248  C  CG   . HIS A 1 3   ? -78.839 -31.969 14.594  1.00 10.00 ? 3   HIS A CG   2  
ATOM   2249  N  ND1  . HIS A 1 3   ? -77.771 -32.567 13.926  1.00 10.00 ? 3   HIS A ND1  2  
ATOM   2250  C  CD2  . HIS A 1 3   ? -78.378 -31.324 15.706  1.00 10.00 ? 3   HIS A CD2  2  
ATOM   2251  C  CE1  . HIS A 1 3   ? -76.687 -32.287 14.664  1.00 10.00 ? 3   HIS A CE1  2  
ATOM   2252  N  NE2  . HIS A 1 3   ? -77.019 -31.542 15.734  1.00 10.00 ? 3   HIS A NE2  2  
ATOM   2253  H  H    . HIS A 1 3   ? -81.976 -30.707 11.869  1.00 10.00 ? 3   HIS A H    2  
ATOM   2254  H  HA   . HIS A 1 3   ? -80.614 -29.785 14.226  1.00 10.00 ? 3   HIS A HA   2  
ATOM   2255  H  HB2  . HIS A 1 3   ? -80.926 -32.141 14.902  1.00 10.00 ? 3   HIS A HB2  2  
ATOM   2256  H  HB3  . HIS A 1 3   ? -80.363 -32.694 13.320  1.00 10.00 ? 3   HIS A HB3  2  
ATOM   2257  H  HD2  . HIS A 1 3   ? -78.957 -30.733 16.400  1.00 10.00 ? 3   HIS A HD2  2  
ATOM   2258  H  HE1  . HIS A 1 3   ? -75.682 -32.597 14.419  1.00 10.00 ? 3   HIS A HE1  2  
ATOM   2259  H  HE2  . HIS A 1 3   ? -76.369 -31.174 16.413  1.00 10.00 ? 3   HIS A HE2  2  
ATOM   2260  N  N    . THR A 1 4   ? -78.480 -29.687 12.649  1.00 10.00 ? 4   THR A N    2  
ATOM   2261  C  CA   . THR A 1 4   ? -77.419 -29.434 11.690  1.00 10.00 ? 4   THR A CA   2  
ATOM   2262  C  C    . THR A 1 4   ? -76.098 -29.366 12.458  1.00 10.00 ? 4   THR A C    2  
ATOM   2263  O  O    . THR A 1 4   ? -76.094 -29.421 13.688  1.00 10.00 ? 4   THR A O    2  
ATOM   2264  C  CB   . THR A 1 4   ? -77.701 -28.167 10.862  1.00 10.00 ? 4   THR A CB   2  
ATOM   2265  O  OG1  . THR A 1 4   ? -76.669 -27.981 9.910   1.00 10.00 ? 4   THR A OG1  2  
ATOM   2266  C  CG2  . THR A 1 4   ? -77.821 -26.909 11.730  1.00 10.00 ? 4   THR A CG2  2  
ATOM   2267  H  H    . THR A 1 4   ? -78.189 -29.646 13.619  1.00 10.00 ? 4   THR A H    2  
ATOM   2268  H  HA   . THR A 1 4   ? -77.361 -30.285 11.009  1.00 10.00 ? 4   THR A HA   2  
ATOM   2269  H  HB   . THR A 1 4   ? -78.638 -28.303 10.318  1.00 10.00 ? 4   THR A HB   2  
ATOM   2270  H  HG1  . THR A 1 4   ? -76.932 -27.285 9.301   1.00 10.00 ? 4   THR A HG1  2  
ATOM   2271  H  HG21 . THR A 1 4   ? -78.630 -27.025 12.451  1.00 10.00 ? 4   THR A HG21 2  
ATOM   2272  H  HG22 . THR A 1 4   ? -76.890 -26.724 12.266  1.00 10.00 ? 4   THR A HG22 2  
ATOM   2273  H  HG23 . THR A 1 4   ? -78.040 -26.048 11.099  1.00 10.00 ? 4   THR A HG23 2  
ATOM   2274  N  N    . MET A 1 5   ? -74.992 -29.248 11.723  1.00 10.00 ? 5   MET A N    2  
ATOM   2275  C  CA   . MET A 1 5   ? -73.636 -29.248 12.245  1.00 10.00 ? 5   MET A CA   2  
ATOM   2276  C  C    . MET A 1 5   ? -72.723 -28.560 11.221  1.00 10.00 ? 5   MET A C    2  
ATOM   2277  O  O    . MET A 1 5   ? -72.191 -29.232 10.339  1.00 10.00 ? 5   MET A O    2  
ATOM   2278  C  CB   . MET A 1 5   ? -73.206 -30.697 12.532  1.00 10.00 ? 5   MET A CB   2  
ATOM   2279  C  CG   . MET A 1 5   ? -71.807 -30.772 13.154  1.00 10.00 ? 5   MET A CG   2  
ATOM   2280  S  SD   . MET A 1 5   ? -71.297 -32.443 13.629  1.00 10.00 ? 5   MET A SD   2  
ATOM   2281  C  CE   . MET A 1 5   ? -69.649 -32.092 14.279  1.00 10.00 ? 5   MET A CE   2  
ATOM   2282  H  H    . MET A 1 5   ? -75.131 -29.098 10.729  1.00 10.00 ? 5   MET A H    2  
ATOM   2283  H  HA   . MET A 1 5   ? -73.614 -28.717 13.196  1.00 10.00 ? 5   MET A HA   2  
ATOM   2284  H  HB2  . MET A 1 5   ? -73.909 -31.143 13.236  1.00 10.00 ? 5   MET A HB2  2  
ATOM   2285  H  HB3  . MET A 1 5   ? -73.222 -31.283 11.612  1.00 10.00 ? 5   MET A HB3  2  
ATOM   2286  H  HG2  . MET A 1 5   ? -71.069 -30.394 12.446  1.00 10.00 ? 5   MET A HG2  2  
ATOM   2287  H  HG3  . MET A 1 5   ? -71.783 -30.152 14.050  1.00 10.00 ? 5   MET A HG3  2  
ATOM   2288  H  HE1  . MET A 1 5   ? -69.196 -33.023 14.615  1.00 10.00 ? 5   MET A HE1  2  
ATOM   2289  H  HE2  . MET A 1 5   ? -69.037 -31.650 13.494  1.00 10.00 ? 5   MET A HE2  2  
ATOM   2290  H  HE3  . MET A 1 5   ? -69.730 -31.401 15.118  1.00 10.00 ? 5   MET A HE3  2  
ATOM   2291  N  N    . PRO A 1 6   ? -72.550 -27.230 11.285  1.00 10.00 ? 6   PRO A N    2  
ATOM   2292  C  CA   . PRO A 1 6   ? -71.669 -26.525 10.370  1.00 10.00 ? 6   PRO A CA   2  
ATOM   2293  C  C    . PRO A 1 6   ? -70.207 -26.853 10.693  1.00 10.00 ? 6   PRO A C    2  
ATOM   2294  O  O    . PRO A 1 6   ? -69.887 -27.254 11.811  1.00 10.00 ? 6   PRO A O    2  
ATOM   2295  C  CB   . PRO A 1 6   ? -71.986 -25.041 10.571  1.00 10.00 ? 6   PRO A CB   2  
ATOM   2296  C  CG   . PRO A 1 6   ? -72.429 -24.977 12.033  1.00 10.00 ? 6   PRO A CG   2  
ATOM   2297  C  CD   . PRO A 1 6   ? -73.147 -26.312 12.243  1.00 10.00 ? 6   PRO A CD   2  
ATOM   2298  H  HA   . PRO A 1 6   ? -71.886 -26.809 9.338   1.00 10.00 ? 6   PRO A HA   2  
ATOM   2299  H  HB2  . PRO A 1 6   ? -71.131 -24.394 10.368  1.00 10.00 ? 6   PRO A HB2  2  
ATOM   2300  H  HB3  . PRO A 1 6   ? -72.825 -24.763 9.932   1.00 10.00 ? 6   PRO A HB3  2  
ATOM   2301  H  HG2  . PRO A 1 6   ? -71.545 -24.940 12.673  1.00 10.00 ? 6   PRO A HG2  2  
ATOM   2302  H  HG3  . PRO A 1 6   ? -73.074 -24.121 12.236  1.00 10.00 ? 6   PRO A HG3  2  
ATOM   2303  H  HD2  . PRO A 1 6   ? -73.003 -26.629 13.276  1.00 10.00 ? 6   PRO A HD2  2  
ATOM   2304  H  HD3  . PRO A 1 6   ? -74.210 -26.205 12.025  1.00 10.00 ? 6   PRO A HD3  2  
ATOM   2305  N  N    . ALA A 1 7   ? -69.318 -26.671 9.713   1.00 10.00 ? 7   ALA A N    2  
ATOM   2306  C  CA   . ALA A 1 7   ? -67.888 -26.900 9.849   1.00 10.00 ? 7   ALA A CA   2  
ATOM   2307  C  C    . ALA A 1 7   ? -67.181 -26.146 8.724   1.00 10.00 ? 7   ALA A C    2  
ATOM   2308  O  O    . ALA A 1 7   ? -67.828 -25.744 7.757   1.00 10.00 ? 7   ALA A O    2  
ATOM   2309  C  CB   . ALA A 1 7   ? -67.589 -28.401 9.775   1.00 10.00 ? 7   ALA A CB   2  
ATOM   2310  H  H    . ALA A 1 7   ? -69.609 -26.309 8.814   1.00 10.00 ? 7   ALA A H    2  
ATOM   2311  H  HA   . ALA A 1 7   ? -67.547 -26.509 10.809  1.00 10.00 ? 7   ALA A HA   2  
ATOM   2312  H  HB1  . ALA A 1 7   ? -68.098 -28.925 10.584  1.00 10.00 ? 7   ALA A HB1  2  
ATOM   2313  H  HB2  . ALA A 1 7   ? -67.932 -28.801 8.820   1.00 10.00 ? 7   ALA A HB2  2  
ATOM   2314  H  HB3  . ALA A 1 7   ? -66.516 -28.571 9.867   1.00 10.00 ? 7   ALA A HB3  2  
ATOM   2315  N  N    . HIS A 1 8   ? -65.867 -25.954 8.855   1.00 10.00 ? 8   HIS A N    2  
ATOM   2316  C  CA   . HIS A 1 8   ? -65.002 -25.306 7.879   1.00 10.00 ? 8   HIS A CA   2  
ATOM   2317  C  C    . HIS A 1 8   ? -63.563 -25.641 8.279   1.00 10.00 ? 8   HIS A C    2  
ATOM   2318  O  O    . HIS A 1 8   ? -63.344 -26.157 9.376   1.00 10.00 ? 8   HIS A O    2  
ATOM   2319  C  CB   . HIS A 1 8   ? -65.250 -23.787 7.878   1.00 10.00 ? 8   HIS A CB   2  
ATOM   2320  C  CG   . HIS A 1 8   ? -64.382 -23.024 6.909   1.00 10.00 ? 8   HIS A CG   2  
ATOM   2321  N  ND1  . HIS A 1 8   ? -63.884 -23.534 5.709   1.00 10.00 ? 8   HIS A ND1  2  
ATOM   2322  C  CD2  . HIS A 1 8   ? -63.877 -21.772 7.112   1.00 10.00 ? 8   HIS A CD2  2  
ATOM   2323  C  CE1  . HIS A 1 8   ? -63.105 -22.566 5.202   1.00 10.00 ? 8   HIS A CE1  2  
ATOM   2324  N  NE2  . HIS A 1 8   ? -63.080 -21.500 6.023   1.00 10.00 ? 8   HIS A NE2  2  
ATOM   2325  H  H    . HIS A 1 8   ? -65.380 -26.327 9.662   1.00 10.00 ? 8   HIS A H    2  
ATOM   2326  H  HA   . HIS A 1 8   ? -65.207 -25.715 6.888   1.00 10.00 ? 8   HIS A HA   2  
ATOM   2327  H  HB2  . HIS A 1 8   ? -66.289 -23.591 7.612   1.00 10.00 ? 8   HIS A HB2  2  
ATOM   2328  H  HB3  . HIS A 1 8   ? -65.075 -23.403 8.884   1.00 10.00 ? 8   HIS A HB3  2  
ATOM   2329  H  HD2  . HIS A 1 8   ? -64.055 -21.131 7.963   1.00 10.00 ? 8   HIS A HD2  2  
ATOM   2330  H  HE1  . HIS A 1 8   ? -62.562 -22.639 4.271   1.00 10.00 ? 8   HIS A HE1  2  
ATOM   2331  H  HE2  . HIS A 1 8   ? -62.563 -20.648 5.862   1.00 10.00 ? 8   HIS A HE2  2  
ATOM   2332  N  N    . THR A 1 9   ? -62.588 -25.353 7.417   1.00 10.00 ? 9   THR A N    2  
ATOM   2333  C  CA   . THR A 1 9   ? -61.171 -25.470 7.722   1.00 10.00 ? 9   THR A CA   2  
ATOM   2334  C  C    . THR A 1 9   ? -60.407 -24.471 6.838   1.00 10.00 ? 9   THR A C    2  
ATOM   2335  O  O    . THR A 1 9   ? -60.581 -24.490 5.619   1.00 10.00 ? 9   THR A O    2  
ATOM   2336  C  CB   . THR A 1 9   ? -60.712 -26.931 7.556   1.00 10.00 ? 9   THR A CB   2  
ATOM   2337  O  OG1  . THR A 1 9   ? -59.357 -27.065 7.931   1.00 10.00 ? 9   THR A OG1  2  
ATOM   2338  C  CG2  . THR A 1 9   ? -60.888 -27.487 6.138   1.00 10.00 ? 9   THR A CG2  2  
ATOM   2339  H  H    . THR A 1 9   ? -62.838 -24.905 6.537   1.00 10.00 ? 9   THR A H    2  
ATOM   2340  H  HA   . THR A 1 9   ? -61.044 -25.216 8.772   1.00 10.00 ? 9   THR A HA   2  
ATOM   2341  H  HB   . THR A 1 9   ? -61.305 -27.554 8.228   1.00 10.00 ? 9   THR A HB   2  
ATOM   2342  H  HG1  . THR A 1 9   ? -59.278 -26.941 8.880   1.00 10.00 ? 9   THR A HG1  2  
ATOM   2343  H  HG21 . THR A 1 9   ? -60.219 -26.982 5.441   1.00 10.00 ? 9   THR A HG21 2  
ATOM   2344  H  HG22 . THR A 1 9   ? -60.643 -28.549 6.139   1.00 10.00 ? 9   THR A HG22 2  
ATOM   2345  H  HG23 . THR A 1 9   ? -61.918 -27.366 5.804   1.00 10.00 ? 9   THR A HG23 2  
ATOM   2346  N  N    . PRO A 1 10  ? -59.624 -23.542 7.411   1.00 10.00 ? 10  PRO A N    2  
ATOM   2347  C  CA   . PRO A 1 10  ? -58.880 -22.565 6.633   1.00 10.00 ? 10  PRO A CA   2  
ATOM   2348  C  C    . PRO A 1 10  ? -57.579 -23.194 6.110   1.00 10.00 ? 10  PRO A C    2  
ATOM   2349  O  O    . PRO A 1 10  ? -56.937 -23.950 6.839   1.00 10.00 ? 10  PRO A O    2  
ATOM   2350  C  CB   . PRO A 1 10  ? -58.588 -21.425 7.611   1.00 10.00 ? 10  PRO A CB   2  
ATOM   2351  C  CG   . PRO A 1 10  ? -58.452 -22.148 8.952   1.00 10.00 ? 10  PRO A CG   2  
ATOM   2352  C  CD   . PRO A 1 10  ? -59.452 -23.301 8.836   1.00 10.00 ? 10  PRO A CD   2  
ATOM   2353  H  HA   . PRO A 1 10  ? -59.502 -22.190 5.821   1.00 10.00 ? 10  PRO A HA   2  
ATOM   2354  H  HB2  . PRO A 1 10  ? -57.687 -20.867 7.348   1.00 10.00 ? 10  PRO A HB2  2  
ATOM   2355  H  HB3  . PRO A 1 10  ? -59.447 -20.754 7.651   1.00 10.00 ? 10  PRO A HB3  2  
ATOM   2356  H  HG2  . PRO A 1 10  ? -57.442 -22.551 9.045   1.00 10.00 ? 10  PRO A HG2  2  
ATOM   2357  H  HG3  . PRO A 1 10  ? -58.670 -21.494 9.798   1.00 10.00 ? 10  PRO A HG3  2  
ATOM   2358  H  HD2  . PRO A 1 10  ? -59.062 -24.181 9.351   1.00 10.00 ? 10  PRO A HD2  2  
ATOM   2359  H  HD3  . PRO A 1 10  ? -60.406 -22.998 9.271   1.00 10.00 ? 10  PRO A HD3  2  
ATOM   2360  N  N    . PRO A 1 11  ? -57.154 -22.887 4.874   1.00 10.00 ? 11  PRO A N    2  
ATOM   2361  C  CA   . PRO A 1 11  ? -55.851 -23.296 4.376   1.00 10.00 ? 11  PRO A CA   2  
ATOM   2362  C  C    . PRO A 1 11  ? -54.754 -22.436 5.016   1.00 10.00 ? 11  PRO A C    2  
ATOM   2363  O  O    . PRO A 1 11  ? -55.034 -21.380 5.583   1.00 10.00 ? 11  PRO A O    2  
ATOM   2364  C  CB   . PRO A 1 11  ? -55.926 -23.073 2.864   1.00 10.00 ? 11  PRO A CB   2  
ATOM   2365  C  CG   . PRO A 1 11  ? -56.852 -21.861 2.748   1.00 10.00 ? 11  PRO A CG   2  
ATOM   2366  C  CD   . PRO A 1 11  ? -57.848 -22.071 3.891   1.00 10.00 ? 11  PRO A CD   2  
ATOM   2367  H  HA   . PRO A 1 11  ? -55.663 -24.350 4.589   1.00 10.00 ? 11  PRO A HA   2  
ATOM   2368  H  HB2  . PRO A 1 11  ? -54.950 -22.896 2.409   1.00 10.00 ? 11  PRO A HB2  2  
ATOM   2369  H  HB3  . PRO A 1 11  ? -56.404 -23.936 2.397   1.00 10.00 ? 11  PRO A HB3  2  
ATOM   2370  H  HG2  . PRO A 1 11  ? -56.277 -20.951 2.931   1.00 10.00 ? 11  PRO A HG2  2  
ATOM   2371  H  HG3  . PRO A 1 11  ? -57.342 -21.805 1.775   1.00 10.00 ? 11  PRO A HG3  2  
ATOM   2372  H  HD2  . PRO A 1 11  ? -58.146 -21.104 4.300   1.00 10.00 ? 11  PRO A HD2  2  
ATOM   2373  H  HD3  . PRO A 1 11  ? -58.720 -22.615 3.525   1.00 10.00 ? 11  PRO A HD3  2  
ATOM   2374  N  N    . ALA A 1 12  ? -53.495 -22.869 4.899   1.00 10.00 ? 12  ALA A N    2  
ATOM   2375  C  CA   . ALA A 1 12  ? -52.332 -22.125 5.356   1.00 10.00 ? 12  ALA A CA   2  
ATOM   2376  C  C    . ALA A 1 12  ? -51.122 -22.598 4.553   1.00 10.00 ? 12  ALA A C    2  
ATOM   2377  O  O    . ALA A 1 12  ? -51.108 -23.738 4.093   1.00 10.00 ? 12  ALA A O    2  
ATOM   2378  C  CB   . ALA A 1 12  ? -52.119 -22.352 6.855   1.00 10.00 ? 12  ALA A CB   2  
ATOM   2379  H  H    . ALA A 1 12  ? -53.294 -23.731 4.407   1.00 10.00 ? 12  ALA A H    2  
ATOM   2380  H  HA   . ALA A 1 12  ? -52.486 -21.060 5.172   1.00 10.00 ? 12  ALA A HA   2  
ATOM   2381  H  HB1  . ALA A 1 12  ? -51.970 -23.415 7.053   1.00 10.00 ? 12  ALA A HB1  2  
ATOM   2382  H  HB2  . ALA A 1 12  ? -51.241 -21.800 7.191   1.00 10.00 ? 12  ALA A HB2  2  
ATOM   2383  H  HB3  . ALA A 1 12  ? -52.989 -22.003 7.412   1.00 10.00 ? 12  ALA A HB3  2  
ATOM   2384  N  N    . GLN A 1 13  ? -50.128 -21.724 4.374   1.00 10.00 ? 13  GLN A N    2  
ATOM   2385  C  CA   . GLN A 1 13  ? -48.897 -21.982 3.641   1.00 10.00 ? 13  GLN A CA   2  
ATOM   2386  C  C    . GLN A 1 13  ? -47.962 -20.795 3.882   1.00 10.00 ? 13  GLN A C    2  
ATOM   2387  O  O    . GLN A 1 13  ? -48.382 -19.801 4.473   1.00 10.00 ? 13  GLN A O    2  
ATOM   2388  C  CB   . GLN A 1 13  ? -49.180 -22.177 2.140   1.00 10.00 ? 13  GLN A CB   2  
ATOM   2389  C  CG   . GLN A 1 13  ? -49.916 -20.985 1.510   1.00 10.00 ? 13  GLN A CG   2  
ATOM   2390  C  CD   . GLN A 1 13  ? -50.195 -21.219 0.030   1.00 10.00 ? 13  GLN A CD   2  
ATOM   2391  O  OE1  . GLN A 1 13  ? -51.343 -21.336 -0.383  1.00 10.00 ? 13  GLN A OE1  2  
ATOM   2392  N  NE2  . GLN A 1 13  ? -49.148 -21.287 -0.788  1.00 10.00 ? 13  GLN A NE2  2  
ATOM   2393  H  H    . GLN A 1 13  ? -50.184 -20.801 4.788   1.00 10.00 ? 13  GLN A H    2  
ATOM   2394  H  HA   . GLN A 1 13  ? -48.428 -22.884 4.038   1.00 10.00 ? 13  GLN A HA   2  
ATOM   2395  H  HB2  . GLN A 1 13  ? -48.235 -22.333 1.620   1.00 10.00 ? 13  GLN A HB2  2  
ATOM   2396  H  HB3  . GLN A 1 13  ? -49.786 -23.073 1.998   1.00 10.00 ? 13  GLN A HB3  2  
ATOM   2397  H  HG2  . GLN A 1 13  ? -50.871 -20.833 2.013   1.00 10.00 ? 13  GLN A HG2  2  
ATOM   2398  H  HG3  . GLN A 1 13  ? -49.323 -20.075 1.612   1.00 10.00 ? 13  GLN A HG3  2  
ATOM   2399  H  HE21 . GLN A 1 13  ? -48.209 -21.191 -0.434  1.00 10.00 ? 13  GLN A HE21 2  
ATOM   2400  H  HE22 . GLN A 1 13  ? -49.320 -21.443 -1.769  1.00 10.00 ? 13  GLN A HE22 2  
ATOM   2401  N  N    . THR A 1 14  ? -46.718 -20.882 3.407   1.00 10.00 ? 14  THR A N    2  
ATOM   2402  C  CA   . THR A 1 14  ? -45.765 -19.783 3.379   1.00 10.00 ? 14  THR A CA   2  
ATOM   2403  C  C    . THR A 1 14  ? -44.638 -20.177 2.422   1.00 10.00 ? 14  THR A C    2  
ATOM   2404  O  O    . THR A 1 14  ? -44.681 -21.266 1.848   1.00 10.00 ? 14  THR A O    2  
ATOM   2405  C  CB   . THR A 1 14  ? -45.267 -19.431 4.795   1.00 10.00 ? 14  THR A CB   2  
ATOM   2406  O  OG1  . THR A 1 14  ? -44.375 -18.333 4.728   1.00 10.00 ? 14  THR A OG1  2  
ATOM   2407  C  CG2  . THR A 1 14  ? -44.573 -20.610 5.487   1.00 10.00 ? 14  THR A CG2  2  
ATOM   2408  H  H    . THR A 1 14  ? -46.418 -21.710 2.905   1.00 10.00 ? 14  THR A H    2  
ATOM   2409  H  HA   . THR A 1 14  ? -46.263 -18.905 2.963   1.00 10.00 ? 14  THR A HA   2  
ATOM   2410  H  HB   . THR A 1 14  ? -46.119 -19.127 5.405   1.00 10.00 ? 14  THR A HB   2  
ATOM   2411  H  HG1  . THR A 1 14  ? -44.231 -18.000 5.619   1.00 10.00 ? 14  THR A HG1  2  
ATOM   2412  H  HG21 . THR A 1 14  ? -43.705 -20.937 4.914   1.00 10.00 ? 14  THR A HG21 2  
ATOM   2413  H  HG22 . THR A 1 14  ? -44.244 -20.308 6.482   1.00 10.00 ? 14  THR A HG22 2  
ATOM   2414  H  HG23 . THR A 1 14  ? -45.266 -21.445 5.591   1.00 10.00 ? 14  THR A HG23 2  
ATOM   2415  N  N    . ALA A 1 15  ? -43.651 -19.295 2.255   1.00 10.00 ? 15  ALA A N    2  
ATOM   2416  C  CA   . ALA A 1 15  ? -42.503 -19.474 1.372   1.00 10.00 ? 15  ALA A CA   2  
ATOM   2417  C  C    . ALA A 1 15  ? -41.450 -18.392 1.656   1.00 10.00 ? 15  ALA A C    2  
ATOM   2418  O  O    . ALA A 1 15  ? -41.247 -17.506 0.828   1.00 10.00 ? 15  ALA A O    2  
ATOM   2419  C  CB   . ALA A 1 15  ? -42.961 -19.429 -0.093  1.00 10.00 ? 15  ALA A CB   2  
ATOM   2420  H  H    . ALA A 1 15  ? -43.681 -18.481 2.862   1.00 10.00 ? 15  ALA A H    2  
ATOM   2421  H  HA   . ALA A 1 15  ? -42.058 -20.455 1.544   1.00 10.00 ? 15  ALA A HA   2  
ATOM   2422  H  HB1  . ALA A 1 15  ? -42.096 -19.527 -0.750  1.00 10.00 ? 15  ALA A HB1  2  
ATOM   2423  H  HB2  . ALA A 1 15  ? -43.648 -20.248 -0.306  1.00 10.00 ? 15  ALA A HB2  2  
ATOM   2424  H  HB3  . ALA A 1 15  ? -43.461 -18.482 -0.302  1.00 10.00 ? 15  ALA A HB3  2  
ATOM   2425  N  N    . PRO A 1 16  ? -40.787 -18.422 2.823   1.00 10.00 ? 16  PRO A N    2  
ATOM   2426  C  CA   . PRO A 1 16  ? -39.770 -17.440 3.163   1.00 10.00 ? 16  PRO A CA   2  
ATOM   2427  C  C    . PRO A 1 16  ? -38.509 -17.670 2.324   1.00 10.00 ? 16  PRO A C    2  
ATOM   2428  O  O    . PRO A 1 16  ? -38.168 -18.810 2.014   1.00 10.00 ? 16  PRO A O    2  
ATOM   2429  C  CB   . PRO A 1 16  ? -39.500 -17.649 4.656   1.00 10.00 ? 16  PRO A CB   2  
ATOM   2430  C  CG   . PRO A 1 16  ? -39.781 -19.140 4.851   1.00 10.00 ? 16  PRO A CG   2  
ATOM   2431  C  CD   . PRO A 1 16  ? -40.939 -19.401 3.887   1.00 10.00 ? 16  PRO A CD   2  
ATOM   2432  H  HA   . PRO A 1 16  ? -40.146 -16.429 2.997   1.00 10.00 ? 16  PRO A HA   2  
ATOM   2433  H  HB2  . PRO A 1 16  ? -38.482 -17.377 4.942   1.00 10.00 ? 16  PRO A HB2  2  
ATOM   2434  H  HB3  . PRO A 1 16  ? -40.219 -17.070 5.236   1.00 10.00 ? 16  PRO A HB3  2  
ATOM   2435  H  HG2  . PRO A 1 16  ? -38.909 -19.716 4.535   1.00 10.00 ? 16  PRO A HG2  2  
ATOM   2436  H  HG3  . PRO A 1 16  ? -40.036 -19.383 5.883   1.00 10.00 ? 16  PRO A HG3  2  
ATOM   2437  H  HD2  . PRO A 1 16  ? -40.892 -20.427 3.520   1.00 10.00 ? 16  PRO A HD2  2  
ATOM   2438  H  HD3  . PRO A 1 16  ? -41.883 -19.230 4.404   1.00 10.00 ? 16  PRO A HD3  2  
ATOM   2439  N  N    . ALA A 1 17  ? -37.804 -16.590 1.976   1.00 10.00 ? 17  ALA A N    2  
ATOM   2440  C  CA   . ALA A 1 17  ? -36.538 -16.630 1.260   1.00 10.00 ? 17  ALA A CA   2  
ATOM   2441  C  C    . ALA A 1 17  ? -35.842 -15.286 1.466   1.00 10.00 ? 17  ALA A C    2  
ATOM   2442  O  O    . ALA A 1 17  ? -36.510 -14.293 1.750   1.00 10.00 ? 17  ALA A O    2  
ATOM   2443  C  CB   . ALA A 1 17  ? -36.783 -16.894 -0.230  1.00 10.00 ? 17  ALA A CB   2  
ATOM   2444  H  H    . ALA A 1 17  ? -38.112 -15.666 2.250   1.00 10.00 ? 17  ALA A H    2  
ATOM   2445  H  HA   . ALA A 1 17  ? -35.915 -17.426 1.672   1.00 10.00 ? 17  ALA A HA   2  
ATOM   2446  H  HB1  . ALA A 1 17  ? -37.418 -16.111 -0.646  1.00 10.00 ? 17  ALA A HB1  2  
ATOM   2447  H  HB2  . ALA A 1 17  ? -35.832 -16.903 -0.763  1.00 10.00 ? 17  ALA A HB2  2  
ATOM   2448  H  HB3  . ALA A 1 17  ? -37.271 -17.860 -0.365  1.00 10.00 ? 17  ALA A HB3  2  
ATOM   2449  N  N    . ALA A 1 18  ? -34.514 -15.255 1.334   1.00 10.00 ? 18  ALA A N    2  
ATOM   2450  C  CA   . ALA A 1 18  ? -33.695 -14.057 1.438   1.00 10.00 ? 18  ALA A CA   2  
ATOM   2451  C  C    . ALA A 1 18  ? -32.309 -14.397 0.892   1.00 10.00 ? 18  ALA A C    2  
ATOM   2452  O  O    . ALA A 1 18  ? -31.975 -15.576 0.781   1.00 10.00 ? 18  ALA A O    2  
ATOM   2453  C  CB   . ALA A 1 18  ? -33.603 -13.597 2.898   1.00 10.00 ? 18  ALA A CB   2  
ATOM   2454  H  H    . ALA A 1 18  ? -34.006 -16.100 1.100   1.00 10.00 ? 18  ALA A H    2  
ATOM   2455  H  HA   . ALA A 1 18  ? -34.138 -13.265 0.832   1.00 10.00 ? 18  ALA A HA   2  
ATOM   2456  H  HB1  . ALA A 1 18  ? -32.962 -12.718 2.968   1.00 10.00 ? 18  ALA A HB1  2  
ATOM   2457  H  HB2  . ALA A 1 18  ? -34.591 -13.338 3.277   1.00 10.00 ? 18  ALA A HB2  2  
ATOM   2458  H  HB3  . ALA A 1 18  ? -33.182 -14.394 3.512   1.00 10.00 ? 18  ALA A HB3  2  
ATOM   2459  N  N    . GLN A 1 19  ? -31.515 -13.379 0.551   1.00 10.00 ? 19  GLN A N    2  
ATOM   2460  C  CA   . GLN A 1 19  ? -30.133 -13.514 0.110   1.00 10.00 ? 19  GLN A CA   2  
ATOM   2461  C  C    . GLN A 1 19  ? -29.360 -12.279 0.577   1.00 10.00 ? 19  GLN A C    2  
ATOM   2462  O  O    . GLN A 1 19  ? -29.961 -11.292 1.014   1.00 10.00 ? 19  GLN A O    2  
ATOM   2463  C  CB   . GLN A 1 19  ? -30.058 -13.638 -1.421  1.00 10.00 ? 19  GLN A CB   2  
ATOM   2464  C  CG   . GLN A 1 19  ? -30.719 -14.917 -1.953  1.00 10.00 ? 19  GLN A CG   2  
ATOM   2465  C  CD   . GLN A 1 19  ? -30.471 -15.116 -3.446  1.00 10.00 ? 19  GLN A CD   2  
ATOM   2466  O  OE1  . GLN A 1 19  ? -30.032 -14.208 -4.143  1.00 10.00 ? 19  GLN A OE1  2  
ATOM   2467  N  NE2  . GLN A 1 19  ? -30.750 -16.312 -3.955  1.00 10.00 ? 19  GLN A NE2  2  
ATOM   2468  H  H    . GLN A 1 19  ? -31.835 -12.431 0.694   1.00 10.00 ? 19  GLN A H    2  
ATOM   2469  H  HA   . GLN A 1 19  ? -29.681 -14.395 0.569   1.00 10.00 ? 19  GLN A HA   2  
ATOM   2470  H  HB2  . GLN A 1 19  ? -30.530 -12.768 -1.881  1.00 10.00 ? 19  GLN A HB2  2  
ATOM   2471  H  HB3  . GLN A 1 19  ? -29.007 -13.656 -1.714  1.00 10.00 ? 19  GLN A HB3  2  
ATOM   2472  H  HG2  . GLN A 1 19  ? -30.315 -15.775 -1.414  1.00 10.00 ? 19  GLN A HG2  2  
ATOM   2473  H  HG3  . GLN A 1 19  ? -31.796 -14.870 -1.797  1.00 10.00 ? 19  GLN A HG3  2  
ATOM   2474  H  HE21 . GLN A 1 19  ? -31.109 -17.051 -3.370  1.00 10.00 ? 19  GLN A HE21 2  
ATOM   2475  H  HE22 . GLN A 1 19  ? -30.589 -16.462 -4.939  1.00 10.00 ? 19  GLN A HE22 2  
ATOM   2476  N  N    . LYS A 1 20  ? -28.031 -12.319 0.484   1.00 10.00 ? 20  LYS A N    2  
ATOM   2477  C  CA   . LYS A 1 20  ? -27.151 -11.185 0.709   1.00 10.00 ? 20  LYS A CA   2  
ATOM   2478  C  C    . LYS A 1 20  ? -25.791 -11.546 0.107   1.00 10.00 ? 20  LYS A C    2  
ATOM   2479  O  O    . LYS A 1 20  ? -25.604 -12.683 -0.326  1.00 10.00 ? 20  LYS A O    2  
ATOM   2480  C  CB   . LYS A 1 20  ? -27.058 -10.867 2.214   1.00 10.00 ? 20  LYS A CB   2  
ATOM   2481  C  CG   . LYS A 1 20  ? -26.667 -9.402  2.480   1.00 10.00 ? 20  LYS A CG   2  
ATOM   2482  C  CD   . LYS A 1 20  ? -27.546 -8.721  3.542   1.00 10.00 ? 20  LYS A CD   2  
ATOM   2483  C  CE   . LYS A 1 20  ? -28.900 -8.217  3.005   1.00 10.00 ? 20  LYS A CE   2  
ATOM   2484  N  NZ   . LYS A 1 20  ? -29.882 -9.291  2.742   1.00 10.00 ? 20  LYS A NZ   2  
ATOM   2485  H  H    . LYS A 1 20  ? -27.568 -13.139 0.105   1.00 10.00 ? 20  LYS A H    2  
ATOM   2486  H  HA   . LYS A 1 20  ? -27.565 -10.336 0.163   1.00 10.00 ? 20  LYS A HA   2  
ATOM   2487  H  HB2  . LYS A 1 20  ? -28.005 -11.084 2.702   1.00 10.00 ? 20  LYS A HB2  2  
ATOM   2488  H  HB3  . LYS A 1 20  ? -26.319 -11.526 2.673   1.00 10.00 ? 20  LYS A HB3  2  
ATOM   2489  H  HG2  . LYS A 1 20  ? -25.633 -9.396  2.836   1.00 10.00 ? 20  LYS A HG2  2  
ATOM   2490  H  HG3  . LYS A 1 20  ? -26.698 -8.804  1.568   1.00 10.00 ? 20  LYS A HG3  2  
ATOM   2491  H  HD2  . LYS A 1 20  ? -27.675 -9.374  4.407   1.00 10.00 ? 20  LYS A HD2  2  
ATOM   2492  H  HD3  . LYS A 1 20  ? -26.996 -7.840  3.883   1.00 10.00 ? 20  LYS A HD3  2  
ATOM   2493  H  HE2  . LYS A 1 20  ? -29.329 -7.550  3.756   1.00 10.00 ? 20  LYS A HE2  2  
ATOM   2494  H  HE3  . LYS A 1 20  ? -28.742 -7.635  2.095   1.00 10.00 ? 20  LYS A HE3  2  
ATOM   2495  H  HZ1  . LYS A 1 20  ? -30.763 -8.891  2.453   1.00 10.00 ? 20  LYS A HZ1  2  
ATOM   2496  H  HZ2  . LYS A 1 20  ? -29.585 -9.921  1.997   1.00 10.00 ? 20  LYS A HZ2  2  
ATOM   2497  H  HZ3  . LYS A 1 20  ? -30.036 -9.844  3.572   1.00 10.00 ? 20  LYS A HZ3  2  
ATOM   2498  N  N    . ALA A 1 21  ? -24.856 -10.595 0.082   1.00 10.00 ? 21  ALA A N    2  
ATOM   2499  C  CA   . ALA A 1 21  ? -23.497 -10.771 -0.400  1.00 10.00 ? 21  ALA A CA   2  
ATOM   2500  C  C    . ALA A 1 21  ? -22.663 -9.635  0.192   1.00 10.00 ? 21  ALA A C    2  
ATOM   2501  O  O    . ALA A 1 21  ? -23.212 -8.781  0.891   1.00 10.00 ? 21  ALA A O    2  
ATOM   2502  C  CB   . ALA A 1 21  ? -23.477 -10.743 -1.934  1.00 10.00 ? 21  ALA A CB   2  
ATOM   2503  H  H    . ALA A 1 21  ? -25.031 -9.690  0.497   1.00 10.00 ? 21  ALA A H    2  
ATOM   2504  H  HA   . ALA A 1 21  ? -23.100 -11.725 -0.047  1.00 10.00 ? 21  ALA A HA   2  
ATOM   2505  H  HB1  . ALA A 1 21  ? -22.459 -10.881 -2.299  1.00 10.00 ? 21  ALA A HB1  2  
ATOM   2506  H  HB2  . ALA A 1 21  ? -24.099 -11.546 -2.329  1.00 10.00 ? 21  ALA A HB2  2  
ATOM   2507  H  HB3  . ALA A 1 21  ? -23.858 -9.786  -2.293  1.00 10.00 ? 21  ALA A HB3  2  
ATOM   2508  N  N    . GLY A 1 22  ? -21.359 -9.616  -0.088  1.00 10.00 ? 22  GLY A N    2  
ATOM   2509  C  CA   . GLY A 1 22  ? -20.439 -8.586  0.359   1.00 10.00 ? 22  GLY A CA   2  
ATOM   2510  C  C    . GLY A 1 22  ? -19.117 -8.780  -0.376  1.00 10.00 ? 22  GLY A C    2  
ATOM   2511  O  O    . GLY A 1 22  ? -18.984 -9.732  -1.146  1.00 10.00 ? 22  GLY A O    2  
ATOM   2512  H  H    . GLY A 1 22  ? -20.949 -10.321 -0.689  1.00 10.00 ? 22  GLY A H    2  
ATOM   2513  H  HA2  . GLY A 1 22  ? -20.843 -7.599  0.128   1.00 10.00 ? 22  GLY A HA2  2  
ATOM   2514  H  HA3  . GLY A 1 22  ? -20.280 -8.675  1.434   1.00 10.00 ? 22  GLY A HA3  2  
ATOM   2515  N  N    . ALA A 1 23  ? -18.151 -7.889  -0.147  1.00 10.00 ? 23  ALA A N    2  
ATOM   2516  C  CA   . ALA A 1 23  ? -16.825 -7.928  -0.745  1.00 10.00 ? 23  ALA A CA   2  
ATOM   2517  C  C    . ALA A 1 23  ? -15.908 -7.054  0.110   1.00 10.00 ? 23  ALA A C    2  
ATOM   2518  O  O    . ALA A 1 23  ? -16.388 -6.389  1.029   1.00 10.00 ? 23  ALA A O    2  
ATOM   2519  C  CB   . ALA A 1 23  ? -16.887 -7.421  -2.191  1.00 10.00 ? 23  ALA A CB   2  
ATOM   2520  H  H    . ALA A 1 23  ? -18.286 -7.152  0.536   1.00 10.00 ? 23  ALA A H    2  
ATOM   2521  H  HA   . ALA A 1 23  ? -16.448 -8.953  -0.734  1.00 10.00 ? 23  ALA A HA   2  
ATOM   2522  H  HB1  . ALA A 1 23  ? -17.256 -6.395  -2.210  1.00 10.00 ? 23  ALA A HB1  2  
ATOM   2523  H  HB2  . ALA A 1 23  ? -15.894 -7.451  -2.640  1.00 10.00 ? 23  ALA A HB2  2  
ATOM   2524  H  HB3  . ALA A 1 23  ? -17.553 -8.052  -2.780  1.00 10.00 ? 23  ALA A HB3  2  
ATOM   2525  N  N    . GLN A 1 24  ? -14.607 -7.054  -0.187  1.00 10.00 ? 24  GLN A N    2  
ATOM   2526  C  CA   . GLN A 1 24  ? -13.611 -6.207  0.453   1.00 10.00 ? 24  GLN A CA   2  
ATOM   2527  C  C    . GLN A 1 24  ? -12.610 -5.776  -0.619  1.00 10.00 ? 24  GLN A C    2  
ATOM   2528  O  O    . GLN A 1 24  ? -12.589 -6.354  -1.705  1.00 10.00 ? 24  GLN A O    2  
ATOM   2529  C  CB   . GLN A 1 24  ? -12.899 -6.968  1.582   1.00 10.00 ? 24  GLN A CB   2  
ATOM   2530  C  CG   . GLN A 1 24  ? -13.857 -7.387  2.704   1.00 10.00 ? 24  GLN A CG   2  
ATOM   2531  C  CD   . GLN A 1 24  ? -13.106 -8.020  3.870   1.00 10.00 ? 24  GLN A CD   2  
ATOM   2532  O  OE1  . GLN A 1 24  ? -13.181 -9.224  4.086   1.00 10.00 ? 24  GLN A OE1  2  
ATOM   2533  N  NE2  . GLN A 1 24  ? -12.370 -7.217  4.632   1.00 10.00 ? 24  GLN A NE2  2  
ATOM   2534  H  H    . GLN A 1 24  ? -14.280 -7.556  -1.003  1.00 10.00 ? 24  GLN A H    2  
ATOM   2535  H  HA   . GLN A 1 24  ? -14.084 -5.311  0.859   1.00 10.00 ? 24  GLN A HA   2  
ATOM   2536  H  HB2  . GLN A 1 24  ? -12.416 -7.858  1.175   1.00 10.00 ? 24  GLN A HB2  2  
ATOM   2537  H  HB3  . GLN A 1 24  ? -12.129 -6.321  2.004   1.00 10.00 ? 24  GLN A HB3  2  
ATOM   2538  H  HG2  . GLN A 1 24  ? -14.409 -6.518  3.065   1.00 10.00 ? 24  GLN A HG2  2  
ATOM   2539  H  HG3  . GLN A 1 24  ? -14.570 -8.119  2.325   1.00 10.00 ? 24  GLN A HG3  2  
ATOM   2540  H  HE21 . GLN A 1 24  ? -12.321 -6.228  4.441   1.00 10.00 ? 24  GLN A HE21 2  
ATOM   2541  H  HE22 . GLN A 1 24  ? -11.868 -7.622  5.408   1.00 10.00 ? 24  GLN A HE22 2  
ATOM   2542  N  N    . ALA A 1 25  ? -11.788 -4.774  -0.307  1.00 10.00 ? 25  ALA A N    2  
ATOM   2543  C  CA   . ALA A 1 25  ? -10.745 -4.240  -1.168  1.00 10.00 ? 25  ALA A CA   2  
ATOM   2544  C  C    . ALA A 1 25  ? -9.721  -3.567  -0.254  1.00 10.00 ? 25  ALA A C    2  
ATOM   2545  O  O    . ALA A 1 25  ? -10.021 -3.340  0.919   1.00 10.00 ? 25  ALA A O    2  
ATOM   2546  C  CB   . ALA A 1 25  ? -11.360 -3.244  -2.156  1.00 10.00 ? 25  ALA A CB   2  
ATOM   2547  H  H    . ALA A 1 25  ? -11.812 -4.369  0.621   1.00 10.00 ? 25  ALA A H    2  
ATOM   2548  H  HA   . ALA A 1 25  ? -10.263 -5.052  -1.715  1.00 10.00 ? 25  ALA A HA   2  
ATOM   2549  H  HB1  . ALA A 1 25  ? -11.843 -2.429  -1.615  1.00 10.00 ? 25  ALA A HB1  2  
ATOM   2550  H  HB2  . ALA A 1 25  ? -10.586 -2.833  -2.801  1.00 10.00 ? 25  ALA A HB2  2  
ATOM   2551  H  HB3  . ALA A 1 25  ? -12.100 -3.748  -2.779  1.00 10.00 ? 25  ALA A HB3  2  
ATOM   2552  N  N    . LEU A 1 26  ? -8.523  -3.265  -0.763  1.00 10.00 ? 26  LEU A N    2  
ATOM   2553  C  CA   . LEU A 1 26  ? -7.435  -2.692  0.021   1.00 10.00 ? 26  LEU A CA   2  
ATOM   2554  C  C    . LEU A 1 26  ? -6.569  -1.813  -0.892  1.00 10.00 ? 26  LEU A C    2  
ATOM   2555  O  O    . LEU A 1 26  ? -6.339  -2.185  -2.045  1.00 10.00 ? 26  LEU A O    2  
ATOM   2556  C  CB   . LEU A 1 26  ? -6.681  -3.832  0.736   1.00 10.00 ? 26  LEU A CB   2  
ATOM   2557  C  CG   . LEU A 1 26  ? -5.230  -3.551  1.159   1.00 10.00 ? 26  LEU A CG   2  
ATOM   2558  C  CD1  . LEU A 1 26  ? -4.911  -4.338  2.432   1.00 10.00 ? 26  LEU A CD1  2  
ATOM   2559  C  CD2  . LEU A 1 26  ? -4.238  -3.947  0.061   1.00 10.00 ? 26  LEU A CD2  2  
ATOM   2560  H  H    . LEU A 1 26  ? -8.337  -3.470  -1.741  1.00 10.00 ? 26  LEU A H    2  
ATOM   2561  H  HA   . LEU A 1 26  ? -7.876  -2.064  0.793   1.00 10.00 ? 26  LEU A HA   2  
ATOM   2562  H  HB2  . LEU A 1 26  ? -7.264  -4.064  1.627   1.00 10.00 ? 26  LEU A HB2  2  
ATOM   2563  H  HB3  . LEU A 1 26  ? -6.677  -4.730  0.125   1.00 10.00 ? 26  LEU A HB3  2  
ATOM   2564  H  HG   . LEU A 1 26  ? -5.085  -2.503  1.390   1.00 10.00 ? 26  LEU A HG   2  
ATOM   2565  H  HD11 . LEU A 1 26  ? -3.892  -4.126  2.747   1.00 10.00 ? 26  LEU A HD11 2  
ATOM   2566  H  HD12 . LEU A 1 26  ? -5.586  -4.036  3.233   1.00 10.00 ? 26  LEU A HD12 2  
ATOM   2567  H  HD13 . LEU A 1 26  ? -5.019  -5.408  2.252   1.00 10.00 ? 26  LEU A HD13 2  
ATOM   2568  H  HD21 . LEU A 1 26  ? -4.199  -5.030  -0.036  1.00 10.00 ? 26  LEU A HD21 2  
ATOM   2569  H  HD22 . LEU A 1 26  ? -4.506  -3.517  -0.900  1.00 10.00 ? 26  LEU A HD22 2  
ATOM   2570  H  HD23 . LEU A 1 26  ? -3.255  -3.569  0.327   1.00 10.00 ? 26  LEU A HD23 2  
ATOM   2571  N  N    . PRO A 1 27  ? -6.133  -0.628  -0.424  1.00 10.00 ? 27  PRO A N    2  
ATOM   2572  C  CA   . PRO A 1 27  ? -5.345  0.292   -1.224  1.00 10.00 ? 27  PRO A CA   2  
ATOM   2573  C  C    . PRO A 1 27  ? -3.882  -0.153  -1.264  1.00 10.00 ? 27  PRO A C    2  
ATOM   2574  O  O    . PRO A 1 27  ? -3.467  -1.064  -0.550  1.00 10.00 ? 27  PRO A O    2  
ATOM   2575  C  CB   . PRO A 1 27  ? -5.503  1.650   -0.534  1.00 10.00 ? 27  PRO A CB   2  
ATOM   2576  C  CG   . PRO A 1 27  ? -5.609  1.258   0.938   1.00 10.00 ? 27  PRO A CG   2  
ATOM   2577  C  CD   . PRO A 1 27  ? -6.398  -0.050  0.889   1.00 10.00 ? 27  PRO A CD   2  
ATOM   2578  H  HA   . PRO A 1 27  ? -5.732  0.346   -2.243  1.00 10.00 ? 27  PRO A HA   2  
ATOM   2579  H  HB2  . PRO A 1 27  ? -4.672  2.332   -0.724  1.00 10.00 ? 27  PRO A HB2  2  
ATOM   2580  H  HB3  . PRO A 1 27  ? -6.440  2.103   -0.858  1.00 10.00 ? 27  PRO A HB3  2  
ATOM   2581  H  HG2  . PRO A 1 27  ? -4.614  1.057   1.335   1.00 10.00 ? 27  PRO A HG2  2  
ATOM   2582  H  HG3  . PRO A 1 27  ? -6.105  2.014   1.545   1.00 10.00 ? 27  PRO A HG3  2  
ATOM   2583  H  HD2  . PRO A 1 27  ? -6.068  -0.689  1.709   1.00 10.00 ? 27  PRO A HD2  2  
ATOM   2584  H  HD3  . PRO A 1 27  ? -7.462  0.170   0.985   1.00 10.00 ? 27  PRO A HD3  2  
ATOM   2585  N  N    . VAL A 1 28  ? -3.079  0.526   -2.082  1.00 10.00 ? 28  VAL A N    2  
ATOM   2586  C  CA   . VAL A 1 28  ? -1.745  0.076   -2.450  1.00 10.00 ? 28  VAL A CA   2  
ATOM   2587  C  C    . VAL A 1 28  ? -0.716  0.435   -1.368  1.00 10.00 ? 28  VAL A C    2  
ATOM   2588  O  O    . VAL A 1 28  ? 0.227   1.185   -1.594  1.00 10.00 ? 28  VAL A O    2  
ATOM   2589  C  CB   . VAL A 1 28  ? -1.421  0.638   -3.849  1.00 10.00 ? 28  VAL A CB   2  
ATOM   2590  C  CG1  . VAL A 1 28  ? -1.164  2.153   -3.869  1.00 10.00 ? 28  VAL A CG1  2  
ATOM   2591  C  CG2  . VAL A 1 28  ? -0.269  -0.124  -4.505  1.00 10.00 ? 28  VAL A CG2  2  
ATOM   2592  H  H    . VAL A 1 28  ? -3.477  1.282   -2.616  1.00 10.00 ? 28  VAL A H    2  
ATOM   2593  H  HA   . VAL A 1 28  ? -1.775  -1.011  -2.512  1.00 10.00 ? 28  VAL A HA   2  
ATOM   2594  H  HB   . VAL A 1 28  ? -2.297  0.479   -4.474  1.00 10.00 ? 28  VAL A HB   2  
ATOM   2595  H  HG11 . VAL A 1 28  ? -0.115  2.383   -3.691  1.00 10.00 ? 28  VAL A HG11 2  
ATOM   2596  H  HG12 . VAL A 1 28  ? -1.434  2.557   -4.844  1.00 10.00 ? 28  VAL A HG12 2  
ATOM   2597  H  HG13 . VAL A 1 28  ? -1.763  2.641   -3.103  1.00 10.00 ? 28  VAL A HG13 2  
ATOM   2598  H  HG21 . VAL A 1 28  ? -0.636  -1.011  -5.004  1.00 10.00 ? 28  VAL A HG21 2  
ATOM   2599  H  HG22 . VAL A 1 28  ? 0.219   0.502   -5.248  1.00 10.00 ? 28  VAL A HG22 2  
ATOM   2600  H  HG23 . VAL A 1 28  ? 0.441   -0.443  -3.749  1.00 10.00 ? 28  VAL A HG23 2  
ATOM   2601  N  N    . THR A 1 29  ? -0.890  -0.110  -0.167  1.00 10.00 ? 29  THR A N    2  
ATOM   2602  C  CA   . THR A 1 29  ? -0.006  0.175   0.954   1.00 10.00 ? 29  THR A CA   2  
ATOM   2603  C  C    . THR A 1 29  ? -0.076  -0.968  1.962   1.00 10.00 ? 29  THR A C    2  
ATOM   2604  O  O    . THR A 1 29  ? -0.403  -0.753  3.129   1.00 10.00 ? 29  THR A O    2  
ATOM   2605  C  CB   . THR A 1 29  ? -0.319  1.569   1.540   1.00 10.00 ? 29  THR A CB   2  
ATOM   2606  O  OG1  . THR A 1 29  ? 0.386   1.790   2.744   1.00 10.00 ? 29  THR A OG1  2  
ATOM   2607  C  CG2  . THR A 1 29  ? -1.813  1.802   1.793   1.00 10.00 ? 29  THR A CG2  2  
ATOM   2608  H  H    . THR A 1 29  ? -1.693  -0.720  -0.031  1.00 10.00 ? 29  THR A H    2  
ATOM   2609  H  HA   . THR A 1 29  ? 1.027   0.201   0.601   1.00 10.00 ? 29  THR A HA   2  
ATOM   2610  H  HB   . THR A 1 29  ? 0.019   2.315   0.821   1.00 10.00 ? 29  THR A HB   2  
ATOM   2611  H  HG1  . THR A 1 29  ? 0.165   1.066   3.346   1.00 10.00 ? 29  THR A HG1  2  
ATOM   2612  H  HG21 . THR A 1 29  ? -1.948  2.774   2.270   1.00 10.00 ? 29  THR A HG21 2  
ATOM   2613  H  HG22 . THR A 1 29  ? -2.358  1.802   0.849   1.00 10.00 ? 29  THR A HG22 2  
ATOM   2614  H  HG23 . THR A 1 29  ? -2.217  1.028   2.445   1.00 10.00 ? 29  THR A HG23 2  
ATOM   2615  N  N    . VAL A 1 30  ? 0.265   -2.178  1.510   1.00 10.00 ? 30  VAL A N    2  
ATOM   2616  C  CA   . VAL A 1 30  ? 0.320   -3.361  2.359   1.00 10.00 ? 30  VAL A CA   2  
ATOM   2617  C  C    . VAL A 1 30  ? 1.678   -4.048  2.225   1.00 10.00 ? 30  VAL A C    2  
ATOM   2618  O  O    . VAL A 1 30  ? 1.806   -5.221  1.878   1.00 10.00 ? 30  VAL A O    2  
ATOM   2619  C  CB   . VAL A 1 30  ? -0.927  -4.236  2.115   1.00 10.00 ? 30  VAL A CB   2  
ATOM   2620  C  CG1  . VAL A 1 30  ? -0.967  -4.880  0.721   1.00 10.00 ? 30  VAL A CG1  2  
ATOM   2621  C  CG2  . VAL A 1 30  ? -1.083  -5.314  3.195   1.00 10.00 ? 30  VAL A CG2  2  
ATOM   2622  H  H    . VAL A 1 30  ? 0.521   -2.270  0.538   1.00 10.00 ? 30  VAL A H    2  
ATOM   2623  H  HA   . VAL A 1 30  ? 0.314   -3.041  3.397   1.00 10.00 ? 30  VAL A HA   2  
ATOM   2624  H  HB   . VAL A 1 30  ? -1.795  -3.571  2.192   1.00 10.00 ? 30  VAL A HB   2  
ATOM   2625  H  HG11 . VAL A 1 30  ? -0.158  -5.591  0.572   1.00 10.00 ? 30  VAL A HG11 2  
ATOM   2626  H  HG12 . VAL A 1 30  ? -1.902  -5.425  0.599   1.00 10.00 ? 30  VAL A HG12 2  
ATOM   2627  H  HG13 . VAL A 1 30  ? -0.906  -4.104  -0.040  1.00 10.00 ? 30  VAL A HG13 2  
ATOM   2628  H  HG21 . VAL A 1 30  ? -0.262  -6.029  3.153   1.00 10.00 ? 30  VAL A HG21 2  
ATOM   2629  H  HG22 . VAL A 1 30  ? -1.102  -4.850  4.182   1.00 10.00 ? 30  VAL A HG22 2  
ATOM   2630  H  HG23 . VAL A 1 30  ? -2.020  -5.851  3.044   1.00 10.00 ? 30  VAL A HG23 2  
ATOM   2631  N  N    . GLN A 1 31  ? 2.729   -3.293  2.532   1.00 10.00 ? 31  GLN A N    2  
ATOM   2632  C  CA   . GLN A 1 31  ? 4.081   -3.803  2.524   1.00 10.00 ? 31  GLN A CA   2  
ATOM   2633  C  C    . GLN A 1 31  ? 4.945   -2.979  3.483   1.00 10.00 ? 31  GLN A C    2  
ATOM   2634  O  O    . GLN A 1 31  ? 4.817   -1.757  3.525   1.00 10.00 ? 31  GLN A O    2  
ATOM   2635  C  CB   . GLN A 1 31  ? 4.575   -3.696  1.082   1.00 10.00 ? 31  GLN A CB   2  
ATOM   2636  C  CG   . GLN A 1 31  ? 5.739   -4.646  0.786   1.00 10.00 ? 31  GLN A CG   2  
ATOM   2637  C  CD   . GLN A 1 31  ? 5.302   -6.054  0.376   1.00 10.00 ? 31  GLN A CD   2  
ATOM   2638  O  OE1  . GLN A 1 31  ? 6.082   -6.775  -0.236  1.00 10.00 ? 31  GLN A OE1  2  
ATOM   2639  N  NE2  . GLN A 1 31  ? 4.079   -6.481  0.688   1.00 10.00 ? 31  GLN A NE2  2  
ATOM   2640  H  H    . GLN A 1 31  ? 2.609   -2.298  2.659   1.00 10.00 ? 31  GLN A H    2  
ATOM   2641  H  HA   . GLN A 1 31  ? 4.080   -4.842  2.857   1.00 10.00 ? 31  GLN A HA   2  
ATOM   2642  H  HB2  . GLN A 1 31  ? 3.772   -3.905  0.373   1.00 10.00 ? 31  GLN A HB2  2  
ATOM   2643  H  HB3  . GLN A 1 31  ? 4.861   -2.657  0.934   1.00 10.00 ? 31  GLN A HB3  2  
ATOM   2644  H  HG2  . GLN A 1 31  ? 6.314   -4.235  -0.041  1.00 10.00 ? 31  GLN A HG2  2  
ATOM   2645  H  HG3  . GLN A 1 31  ? 6.399   -4.710  1.647   1.00 10.00 ? 31  GLN A HG3  2  
ATOM   2646  H  HE21 . GLN A 1 31  ? 3.387   -5.892  1.146   1.00 10.00 ? 31  GLN A HE21 2  
ATOM   2647  H  HE22 . GLN A 1 31  ? 3.816   -7.405  0.385   1.00 10.00 ? 31  GLN A HE22 2  
ATOM   2648  N  N    . GLY A 1 32  ? 5.818   -3.645  4.247   1.00 10.00 ? 32  GLY A N    2  
ATOM   2649  C  CA   . GLY A 1 32  ? 6.869   -2.978  5.004   1.00 10.00 ? 32  GLY A CA   2  
ATOM   2650  C  C    . GLY A 1 32  ? 7.978   -2.531  4.050   1.00 10.00 ? 32  GLY A C    2  
ATOM   2651  O  O    . GLY A 1 32  ? 8.013   -2.979  2.904   1.00 10.00 ? 32  GLY A O    2  
ATOM   2652  H  H    . GLY A 1 32  ? 5.878   -4.646  4.153   1.00 10.00 ? 32  GLY A H    2  
ATOM   2653  H  HA2  . GLY A 1 32  ? 6.462   -2.117  5.536   1.00 10.00 ? 32  GLY A HA2  2  
ATOM   2654  H  HA3  . GLY A 1 32  ? 7.286   -3.676  5.730   1.00 10.00 ? 32  GLY A HA3  2  
ATOM   2655  N  N    . ALA A 1 33  ? 8.885   -1.661  4.505   1.00 10.00 ? 33  ALA A N    2  
ATOM   2656  C  CA   . ALA A 1 33  ? 9.965   -1.138  3.681   1.00 10.00 ? 33  ALA A CA   2  
ATOM   2657  C  C    . ALA A 1 33  ? 11.316  -1.657  4.165   1.00 10.00 ? 33  ALA A C    2  
ATOM   2658  O  O    . ALA A 1 33  ? 11.497  -2.013  5.333   1.00 10.00 ? 33  ALA A O    2  
ATOM   2659  C  CB   . ALA A 1 33  ? 9.922   0.394   3.692   1.00 10.00 ? 33  ALA A CB   2  
ATOM   2660  H  H    . ALA A 1 33  ? 8.883   -1.377  5.483   1.00 10.00 ? 33  ALA A H    2  
ATOM   2661  H  HA   . ALA A 1 33  ? 9.854   -1.458  2.644   1.00 10.00 ? 33  ALA A HA   2  
ATOM   2662  H  HB1  . ALA A 1 33  ? 10.739  0.793   3.091   1.00 10.00 ? 33  ALA A HB1  2  
ATOM   2663  H  HB2  . ALA A 1 33  ? 8.976   0.741   3.276   1.00 10.00 ? 33  ALA A HB2  2  
ATOM   2664  H  HB3  . ALA A 1 33  ? 10.012  0.769   4.711   1.00 10.00 ? 33  ALA A HB3  2  
ATOM   2665  N  N    . THR A 1 34  ? 12.290  -1.670  3.257   1.00 10.00 ? 34  THR A N    2  
ATOM   2666  C  CA   . THR A 1 34  ? 13.687  -1.873  3.586   1.00 10.00 ? 34  THR A CA   2  
ATOM   2667  C  C    . THR A 1 34  ? 14.451  -0.670  3.038   1.00 10.00 ? 34  THR A C    2  
ATOM   2668  O  O    . THR A 1 34  ? 13.940  0.000   2.144   1.00 10.00 ? 34  THR A O    2  
ATOM   2669  C  CB   . THR A 1 34  ? 14.166  -3.218  3.025   1.00 10.00 ? 34  THR A CB   2  
ATOM   2670  O  OG1  . THR A 1 34  ? 14.223  -3.199  1.620   1.00 10.00 ? 34  THR A OG1  2  
ATOM   2671  C  CG2  . THR A 1 34  ? 13.223  -4.355  3.426   1.00 10.00 ? 34  THR A CG2  2  
ATOM   2672  H  H    . THR A 1 34  ? 12.100  -1.387  2.298   1.00 10.00 ? 34  THR A H    2  
ATOM   2673  H  HA   . THR A 1 34  ? 13.814  -1.889  4.664   1.00 10.00 ? 34  THR A HA   2  
ATOM   2674  H  HB   . THR A 1 34  ? 15.165  -3.418  3.414   1.00 10.00 ? 34  THR A HB   2  
ATOM   2675  H  HG1  . THR A 1 34  ? 13.392  -2.844  1.275   1.00 10.00 ? 34  THR A HG1  2  
ATOM   2676  H  HG21 . THR A 1 34  ? 13.065  -4.357  4.503   1.00 10.00 ? 34  THR A HG21 2  
ATOM   2677  H  HG22 . THR A 1 34  ? 12.259  -4.231  2.928   1.00 10.00 ? 34  THR A HG22 2  
ATOM   2678  H  HG23 . THR A 1 34  ? 13.650  -5.308  3.118   1.00 10.00 ? 34  THR A HG23 2  
ATOM   2679  N  N    . VAL A 1 35  ? 15.628  -0.360  3.583   1.00 10.00 ? 35  VAL A N    2  
ATOM   2680  C  CA   . VAL A 1 35  ? 16.471  0.741   3.136   1.00 10.00 ? 35  VAL A CA   2  
ATOM   2681  C  C    . VAL A 1 35  ? 17.887  0.208   2.984   1.00 10.00 ? 35  VAL A C    2  
ATOM   2682  O  O    . VAL A 1 35  ? 18.346  -0.583  3.812   1.00 10.00 ? 35  VAL A O    2  
ATOM   2683  C  CB   . VAL A 1 35  ? 16.382  1.922   4.120   1.00 10.00 ? 35  VAL A CB   2  
ATOM   2684  C  CG1  . VAL A 1 35  ? 17.446  2.992   3.839   1.00 10.00 ? 35  VAL A CG1  2  
ATOM   2685  C  CG2  . VAL A 1 35  ? 14.998  2.575   4.032   1.00 10.00 ? 35  VAL A CG2  2  
ATOM   2686  H  H    . VAL A 1 35  ? 15.994  -0.947  4.326   1.00 10.00 ? 35  VAL A H    2  
ATOM   2687  H  HA   . VAL A 1 35  ? 16.156  1.080   2.153   1.00 10.00 ? 35  VAL A HA   2  
ATOM   2688  H  HB   . VAL A 1 35  ? 16.525  1.558   5.136   1.00 10.00 ? 35  VAL A HB   2  
ATOM   2689  H  HG11 . VAL A 1 35  ? 17.383  3.315   2.800   1.00 10.00 ? 35  VAL A HG11 2  
ATOM   2690  H  HG12 . VAL A 1 35  ? 17.285  3.852   4.490   1.00 10.00 ? 35  VAL A HG12 2  
ATOM   2691  H  HG13 . VAL A 1 35  ? 18.446  2.605   4.034   1.00 10.00 ? 35  VAL A HG13 2  
ATOM   2692  H  HG21 . VAL A 1 35  ? 14.220  1.841   4.229   1.00 10.00 ? 35  VAL A HG21 2  
ATOM   2693  H  HG22 . VAL A 1 35  ? 14.921  3.376   4.767   1.00 10.00 ? 35  VAL A HG22 2  
ATOM   2694  H  HG23 . VAL A 1 35  ? 14.846  2.989   3.036   1.00 10.00 ? 35  VAL A HG23 2  
ATOM   2695  N  N    . ALA A 1 36  ? 18.591  0.639   1.933   1.00 10.00 ? 36  ALA A N    2  
ATOM   2696  C  CA   . ALA A 1 36  ? 19.865  0.045   1.547   1.00 10.00 ? 36  ALA A CA   2  
ATOM   2697  C  C    . ALA A 1 36  ? 21.046  0.523   2.402   1.00 10.00 ? 36  ALA A C    2  
ATOM   2698  O  O    . ALA A 1 36  ? 22.150  0.697   1.889   1.00 10.00 ? 36  ALA A O    2  
ATOM   2699  C  CB   . ALA A 1 36  ? 20.105  0.312   0.063   1.00 10.00 ? 36  ALA A CB   2  
ATOM   2700  H  H    . ALA A 1 36  ? 18.168  1.321   1.309   1.00 10.00 ? 36  ALA A H    2  
ATOM   2701  H  HA   . ALA A 1 36  ? 19.770  -1.030  1.671   1.00 10.00 ? 36  ALA A HA   2  
ATOM   2702  H  HB1  . ALA A 1 36  ? 21.008  -0.204  -0.265  1.00 10.00 ? 36  ALA A HB1  2  
ATOM   2703  H  HB2  . ALA A 1 36  ? 19.256  -0.059  -0.507  1.00 10.00 ? 36  ALA A HB2  2  
ATOM   2704  H  HB3  . ALA A 1 36  ? 20.218  1.383   -0.102  1.00 10.00 ? 36  ALA A HB3  2  
ATOM   2705  N  N    . ALA A 1 37  ? 20.833  0.698   3.710   1.00 10.00 ? 37  ALA A N    2  
ATOM   2706  C  CA   . ALA A 1 37  ? 21.791  1.310   4.626   1.00 10.00 ? 37  ALA A CA   2  
ATOM   2707  C  C    . ALA A 1 37  ? 22.346  2.604   4.015   1.00 10.00 ? 37  ALA A C    2  
ATOM   2708  O  O    . ALA A 1 37  ? 21.622  3.289   3.293   1.00 10.00 ? 37  ALA A O    2  
ATOM   2709  C  CB   . ALA A 1 37  ? 22.865  0.282   5.007   1.00 10.00 ? 37  ALA A CB   2  
ATOM   2710  H  H    . ALA A 1 37  ? 19.909  0.472   4.051   1.00 10.00 ? 37  ALA A H    2  
ATOM   2711  H  HA   . ALA A 1 37  ? 21.266  1.596   5.532   1.00 10.00 ? 37  ALA A HA   2  
ATOM   2712  H  HB1  . ALA A 1 37  ? 22.385  -0.618  5.392   1.00 10.00 ? 37  ALA A HB1  2  
ATOM   2713  H  HB2  . ALA A 1 37  ? 23.472  0.025   4.139   1.00 10.00 ? 37  ALA A HB2  2  
ATOM   2714  H  HB3  . ALA A 1 37  ? 23.508  0.676   5.791   1.00 10.00 ? 37  ALA A HB3  2  
ATOM   2715  N  N    . VAL A 1 38  ? 23.620  2.920   4.264   1.00 10.00 ? 38  VAL A N    2  
ATOM   2716  C  CA   . VAL A 1 38  ? 24.389  3.768   3.365   1.00 10.00 ? 38  VAL A CA   2  
ATOM   2717  C  C    . VAL A 1 38  ? 25.088  2.804   2.402   1.00 10.00 ? 38  VAL A C    2  
ATOM   2718  O  O    . VAL A 1 38  ? 25.991  2.088   2.839   1.00 10.00 ? 38  VAL A O    2  
ATOM   2719  C  CB   . VAL A 1 38  ? 25.400  4.632   4.144   1.00 10.00 ? 38  VAL A CB   2  
ATOM   2720  C  CG1  . VAL A 1 38  ? 26.334  5.386   3.194   1.00 10.00 ? 38  VAL A CG1  2  
ATOM   2721  C  CG2  . VAL A 1 38  ? 24.666  5.672   4.999   1.00 10.00 ? 38  VAL A CG2  2  
ATOM   2722  H  H    . VAL A 1 38  ? 24.155  2.328   4.882   1.00 10.00 ? 38  VAL A H    2  
ATOM   2723  H  HA   . VAL A 1 38  ? 23.733  4.457   2.837   1.00 10.00 ? 38  VAL A HA   2  
ATOM   2724  H  HB   . VAL A 1 38  ? 26.030  4.007   4.772   1.00 10.00 ? 38  VAL A HB   2  
ATOM   2725  H  HG11 . VAL A 1 38  ? 25.734  5.917   2.460   1.00 10.00 ? 38  VAL A HG11 2  
ATOM   2726  H  HG12 . VAL A 1 38  ? 26.941  6.100   3.751   1.00 10.00 ? 38  VAL A HG12 2  
ATOM   2727  H  HG13 . VAL A 1 38  ? 27.003  4.695   2.684   1.00 10.00 ? 38  VAL A HG13 2  
ATOM   2728  H  HG21 . VAL A 1 38  ? 24.119  6.355   4.351   1.00 10.00 ? 38  VAL A HG21 2  
ATOM   2729  H  HG22 . VAL A 1 38  ? 23.959  5.191   5.670   1.00 10.00 ? 38  VAL A HG22 2  
ATOM   2730  H  HG23 . VAL A 1 38  ? 25.384  6.243   5.588   1.00 10.00 ? 38  VAL A HG23 2  
ATOM   2731  N  N    . PRO A 1 39  ? 24.683  2.724   1.126   1.00 10.00 ? 39  PRO A N    2  
ATOM   2732  C  CA   . PRO A 1 39  ? 25.420  1.951   0.143   1.00 10.00 ? 39  PRO A CA   2  
ATOM   2733  C  C    . PRO A 1 39  ? 26.737  2.684   -0.147  1.00 10.00 ? 39  PRO A C    2  
ATOM   2734  O  O    . PRO A 1 39  ? 26.883  3.846   0.233   1.00 10.00 ? 39  PRO A O    2  
ATOM   2735  C  CB   . PRO A 1 39  ? 24.492  1.880   -1.074  1.00 10.00 ? 39  PRO A CB   2  
ATOM   2736  C  CG   . PRO A 1 39  ? 23.678  3.170   -0.989  1.00 10.00 ? 39  PRO A CG   2  
ATOM   2737  C  CD   . PRO A 1 39  ? 23.595  3.462   0.507   1.00 10.00 ? 39  PRO A CD   2  
ATOM   2738  H  HA   . PRO A 1 39  ? 25.622  0.947   0.518   1.00 10.00 ? 39  PRO A HA   2  
ATOM   2739  H  HB2  . PRO A 1 39  ? 25.023  1.804   -2.023  1.00 10.00 ? 39  PRO A HB2  2  
ATOM   2740  H  HB3  . PRO A 1 39  ? 23.817  1.031   -0.953  1.00 10.00 ? 39  PRO A HB3  2  
ATOM   2741  H  HG2  . PRO A 1 39  ? 24.220  3.980   -1.480  1.00 10.00 ? 39  PRO A HG2  2  
ATOM   2742  H  HG3  . PRO A 1 39  ? 22.685  3.054   -1.426  1.00 10.00 ? 39  PRO A HG3  2  
ATOM   2743  H  HD2  . PRO A 1 39  ? 23.687  4.538   0.660   1.00 10.00 ? 39  PRO A HD2  2  
ATOM   2744  H  HD3  . PRO A 1 39  ? 22.646  3.099   0.896   1.00 10.00 ? 39  PRO A HD3  2  
ATOM   2745  N  N    . PRO A 1 40  ? 27.713  2.047   -0.813  1.00 10.00 ? 40  PRO A N    2  
ATOM   2746  C  CA   . PRO A 1 40  ? 28.982  2.682   -1.142  1.00 10.00 ? 40  PRO A CA   2  
ATOM   2747  C  C    . PRO A 1 40  ? 28.797  3.689   -2.287  1.00 10.00 ? 40  PRO A C    2  
ATOM   2748  O  O    . PRO A 1 40  ? 29.336  3.511   -3.377  1.00 10.00 ? 40  PRO A O    2  
ATOM   2749  C  CB   . PRO A 1 40  ? 29.916  1.519   -1.502  1.00 10.00 ? 40  PRO A CB   2  
ATOM   2750  C  CG   . PRO A 1 40  ? 28.959  0.478   -2.085  1.00 10.00 ? 40  PRO A CG   2  
ATOM   2751  C  CD   . PRO A 1 40  ? 27.707  0.652   -1.223  1.00 10.00 ? 40  PRO A CD   2  
ATOM   2752  H  HA   . PRO A 1 40  ? 29.391  3.207   -0.277  1.00 10.00 ? 40  PRO A HA   2  
ATOM   2753  H  HB2  . PRO A 1 40  ? 30.711  1.795   -2.196  1.00 10.00 ? 40  PRO A HB2  2  
ATOM   2754  H  HB3  . PRO A 1 40  ? 30.354  1.122   -0.585  1.00 10.00 ? 40  PRO A HB3  2  
ATOM   2755  H  HG2  . PRO A 1 40  ? 28.731  0.740   -3.120  1.00 10.00 ? 40  PRO A HG2  2  
ATOM   2756  H  HG3  . PRO A 1 40  ? 29.364  -0.533  -2.033  1.00 10.00 ? 40  PRO A HG3  2  
ATOM   2757  H  HD2  . PRO A 1 40  ? 26.820  0.381   -1.794  1.00 10.00 ? 40  PRO A HD2  2  
ATOM   2758  H  HD3  . PRO A 1 40  ? 27.787  0.021   -0.337  1.00 10.00 ? 40  PRO A HD3  2  
ATOM   2759  N  N    . SER A 1 41  ? 28.017  4.748   -2.045  1.00 10.00 ? 41  SER A N    2  
ATOM   2760  C  CA   . SER A 1 41  ? 27.701  5.789   -3.008  1.00 10.00 ? 41  SER A CA   2  
ATOM   2761  C  C    . SER A 1 41  ? 27.063  6.970   -2.266  1.00 10.00 ? 41  SER A C    2  
ATOM   2762  O  O    . SER A 1 41  ? 25.941  7.368   -2.568  1.00 10.00 ? 41  SER A O    2  
ATOM   2763  C  CB   . SER A 1 41  ? 26.798  5.227   -4.120  1.00 10.00 ? 41  SER A CB   2  
ATOM   2764  O  OG   . SER A 1 41  ? 26.793  6.086   -5.245  1.00 10.00 ? 41  SER A OG   2  
ATOM   2765  H  H    . SER A 1 41  ? 27.584  4.817   -1.129  1.00 10.00 ? 41  SER A H    2  
ATOM   2766  H  HA   . SER A 1 41  ? 28.632  6.132   -3.463  1.00 10.00 ? 41  SER A HA   2  
ATOM   2767  H  HB2  . SER A 1 41  ? 27.176  4.259   -4.451  1.00 10.00 ? 41  SER A HB2  2  
ATOM   2768  H  HB3  . SER A 1 41  ? 25.783  5.095   -3.740  1.00 10.00 ? 41  SER A HB3  2  
ATOM   2769  H  HG   . SER A 1 41  ? 26.359  5.644   -5.977  1.00 10.00 ? 41  SER A HG   2  
ATOM   2770  N  N    . ILE A 1 42  ? 27.806  7.530   -1.302  1.00 10.00 ? 42  ILE A N    2  
ATOM   2771  C  CA   . ILE A 1 42  ? 27.460  8.727   -0.546  1.00 10.00 ? 42  ILE A CA   2  
ATOM   2772  C  C    . ILE A 1 42  ? 26.398  8.401   0.511   1.00 10.00 ? 42  ILE A C    2  
ATOM   2773  O  O    . ILE A 1 42  ? 25.800  7.331   0.490   1.00 10.00 ? 42  ILE A O    2  
ATOM   2774  C  CB   . ILE A 1 42  ? 27.094  9.910   -1.475  1.00 10.00 ? 42  ILE A CB   2  
ATOM   2775  C  CG1  . ILE A 1 42  ? 28.048  10.066  -2.680  1.00 10.00 ? 42  ILE A CG1  2  
ATOM   2776  C  CG2  . ILE A 1 42  ? 27.078  11.232  -0.700  1.00 10.00 ? 42  ILE A CG2  2  
ATOM   2777  C  CD1  . ILE A 1 42  ? 29.521  10.244  -2.293  1.00 10.00 ? 42  ILE A CD1  2  
ATOM   2778  H  H    . ILE A 1 42  ? 28.658  7.073   -1.025  1.00 10.00 ? 42  ILE A H    2  
ATOM   2779  H  HA   . ILE A 1 42  ? 28.364  8.997   -0.001  1.00 10.00 ? 42  ILE A HA   2  
ATOM   2780  H  HB   . ILE A 1 42  ? 26.085  9.758   -1.862  1.00 10.00 ? 42  ILE A HB   2  
ATOM   2781  H  HG12 . ILE A 1 42  ? 27.968  9.207   -3.344  1.00 10.00 ? 42  ILE A HG12 2  
ATOM   2782  H  HG13 . ILE A 1 42  ? 27.741  10.938  -3.259  1.00 10.00 ? 42  ILE A HG13 2  
ATOM   2783  H  HG21 . ILE A 1 42  ? 27.083  12.075  -1.390  1.00 10.00 ? 42  ILE A HG21 2  
ATOM   2784  H  HG22 . ILE A 1 42  ? 26.173  11.305  -0.100  1.00 10.00 ? 42  ILE A HG22 2  
ATOM   2785  H  HG23 . ILE A 1 42  ? 27.956  11.287  -0.056  1.00 10.00 ? 42  ILE A HG23 2  
ATOM   2786  H  HD11 . ILE A 1 42  ? 30.112  10.372  -3.201  1.00 10.00 ? 42  ILE A HD11 2  
ATOM   2787  H  HD12 . ILE A 1 42  ? 29.651  11.127  -1.669  1.00 10.00 ? 42  ILE A HD12 2  
ATOM   2788  H  HD13 . ILE A 1 42  ? 29.889  9.366   -1.763  1.00 10.00 ? 42  ILE A HD13 2  
ATOM   2789  N  N    . ARG A 1 43  ? 26.219  9.300   1.486   1.00 10.00 ? 43  ARG A N    2  
ATOM   2790  C  CA   . ARG A 1 43  ? 25.304  9.140   2.608   1.00 10.00 ? 43  ARG A CA   2  
ATOM   2791  C  C    . ARG A 1 43  ? 23.879  8.825   2.139   1.00 10.00 ? 43  ARG A C    2  
ATOM   2792  O  O    . ARG A 1 43  ? 23.154  8.080   2.795   1.00 10.00 ? 43  ARG A O    2  
ATOM   2793  C  CB   . ARG A 1 43  ? 25.321  10.428  3.449   1.00 10.00 ? 43  ARG A CB   2  
ATOM   2794  C  CG   . ARG A 1 43  ? 24.918  10.153  4.906   1.00 10.00 ? 43  ARG A CG   2  
ATOM   2795  C  CD   . ARG A 1 43  ? 26.023  10.543  5.902   1.00 10.00 ? 43  ARG A CD   2  
ATOM   2796  N  NE   . ARG A 1 43  ? 25.955  9.775   7.158   1.00 10.00 ? 43  ARG A NE   2  
ATOM   2797  C  CZ   . ARG A 1 43  ? 25.363  10.152  8.304   1.00 10.00 ? 43  ARG A CZ   2  
ATOM   2798  N  NH1  . ARG A 1 43  ? 24.533  11.191  8.346   1.00 10.00 ? 43  ARG A NH1  2  
ATOM   2799  N  NH2  . ARG A 1 43  ? 25.601  9.480   9.433   1.00 10.00 ? 43  ARG A NH2  2  
ATOM   2800  H  H    . ARG A 1 43  ? 26.776  10.138  1.467   1.00 10.00 ? 43  ARG A H    2  
ATOM   2801  H  HA   . ARG A 1 43  ? 25.679  8.307   3.202   1.00 10.00 ? 43  ARG A HA   2  
ATOM   2802  H  HB2  . ARG A 1 43  ? 26.317  10.870  3.424   1.00 10.00 ? 43  ARG A HB2  2  
ATOM   2803  H  HB3  . ARG A 1 43  ? 24.630  11.150  3.004   1.00 10.00 ? 43  ARG A HB3  2  
ATOM   2804  H  HG2  . ARG A 1 43  ? 24.021  10.728  5.118   1.00 10.00 ? 43  ARG A HG2  2  
ATOM   2805  H  HG3  . ARG A 1 43  ? 24.679  9.096   5.020   1.00 10.00 ? 43  ARG A HG3  2  
ATOM   2806  H  HD2  . ARG A 1 43  ? 26.994  10.307  5.462   1.00 10.00 ? 43  ARG A HD2  2  
ATOM   2807  H  HD3  . ARG A 1 43  ? 25.998  11.620  6.085   1.00 10.00 ? 43  ARG A HD3  2  
ATOM   2808  H  HE   . ARG A 1 43  ? 26.504  8.926   7.165   1.00 10.00 ? 43  ARG A HE   2  
ATOM   2809  H  HH11 . ARG A 1 43  ? 24.118  11.559  7.488   1.00 10.00 ? 43  ARG A HH11 2  
ATOM   2810  H  HH12 . ARG A 1 43  ? 24.065  11.424  9.220   1.00 10.00 ? 43  ARG A HH12 2  
ATOM   2811  H  HH21 . ARG A 1 43  ? 26.252  8.711   9.455   1.00 10.00 ? 43  ARG A HH21 2  
ATOM   2812  H  HH22 . ARG A 1 43  ? 25.081  9.713   10.268  1.00 10.00 ? 43  ARG A HH22 2  
ATOM   2813  N  N    . ASP A 1 44  ? 23.480  9.450   1.030   1.00 10.00 ? 44  ASP A N    2  
ATOM   2814  C  CA   . ASP A 1 44  ? 22.212  9.260   0.349   1.00 10.00 ? 44  ASP A CA   2  
ATOM   2815  C  C    . ASP A 1 44  ? 21.889  7.779   0.170   1.00 10.00 ? 44  ASP A C    2  
ATOM   2816  O  O    . ASP A 1 44  ? 22.784  6.955   -0.004  1.00 10.00 ? 44  ASP A O    2  
ATOM   2817  C  CB   . ASP A 1 44  ? 22.295  9.927   -1.030  1.00 10.00 ? 44  ASP A CB   2  
ATOM   2818  C  CG   . ASP A 1 44  ? 22.568  11.424  -0.970  1.00 10.00 ? 44  ASP A CG   2  
ATOM   2819  O  OD1  . ASP A 1 44  ? 22.411  11.993  0.132   1.00 10.00 ? 44  ASP A OD1  2  
ATOM   2820  O  OD2  . ASP A 1 44  ? 22.908  11.973  -2.036  1.00 10.00 ? 44  ASP A OD2  2  
ATOM   2821  H  H    . ASP A 1 44  ? 24.101  10.124  0.611   1.00 10.00 ? 44  ASP A H    2  
ATOM   2822  H  HA   . ASP A 1 44  ? 21.424  9.725   0.940   1.00 10.00 ? 44  ASP A HA   2  
ATOM   2823  H  HB2  . ASP A 1 44  ? 23.097  9.458   -1.602  1.00 10.00 ? 44  ASP A HB2  2  
ATOM   2824  H  HB3  . ASP A 1 44  ? 21.360  9.758   -1.561  1.00 10.00 ? 44  ASP A HB3  2  
ATOM   2825  N  N    . THR A 1 45  ? 20.603  7.430   0.173   1.00 10.00 ? 45  THR A N    2  
ATOM   2826  C  CA   . THR A 1 45  ? 20.196  6.053   -0.039  1.00 10.00 ? 45  THR A CA   2  
ATOM   2827  C  C    . THR A 1 45  ? 18.786  6.032   -0.617  1.00 10.00 ? 45  THR A C    2  
ATOM   2828  O  O    . THR A 1 45  ? 18.280  7.062   -1.065  1.00 10.00 ? 45  THR A O    2  
ATOM   2829  C  CB   . THR A 1 45  ? 20.372  5.248   1.263   1.00 10.00 ? 45  THR A CB   2  
ATOM   2830  O  OG1  . THR A 1 45  ? 20.135  3.869   1.062   1.00 10.00 ? 45  THR A OG1  2  
ATOM   2831  C  CG2  . THR A 1 45  ? 19.459  5.731   2.390   1.00 10.00 ? 45  THR A CG2  2  
ATOM   2832  H  H    . THR A 1 45  ? 19.868  8.128   0.285   1.00 10.00 ? 45  THR A H    2  
ATOM   2833  H  HA   . THR A 1 45  ? 20.849  5.626   -0.798  1.00 10.00 ? 45  THR A HA   2  
ATOM   2834  H  HB   . THR A 1 45  ? 21.405  5.366   1.595   1.00 10.00 ? 45  THR A HB   2  
ATOM   2835  H  HG1  . THR A 1 45  ? 20.538  3.413   1.816   1.00 10.00 ? 45  THR A HG1  2  
ATOM   2836  H  HG21 . THR A 1 45  ? 19.760  5.266   3.329   1.00 10.00 ? 45  THR A HG21 2  
ATOM   2837  H  HG22 . THR A 1 45  ? 19.540  6.811   2.488   1.00 10.00 ? 45  THR A HG22 2  
ATOM   2838  H  HG23 . THR A 1 45  ? 18.428  5.456   2.178   1.00 10.00 ? 45  THR A HG23 2  
ATOM   2839  N  N    . ALA A 1 46  ? 18.153  4.861   -0.629  1.00 10.00 ? 46  ALA A N    2  
ATOM   2840  C  CA   . ALA A 1 46  ? 16.819  4.671   -1.145  1.00 10.00 ? 46  ALA A CA   2  
ATOM   2841  C  C    . ALA A 1 46  ? 16.172  3.509   -0.411  1.00 10.00 ? 46  ALA A C    2  
ATOM   2842  O  O    . ALA A 1 46  ? 16.870  2.654   0.147   1.00 10.00 ? 46  ALA A O    2  
ATOM   2843  C  CB   . ALA A 1 46  ? 16.879  4.406   -2.653  1.00 10.00 ? 46  ALA A CB   2  
ATOM   2844  H  H    . ALA A 1 46  ? 18.577  4.062   -0.170  1.00 10.00 ? 46  ALA A H    2  
ATOM   2845  H  HA   . ALA A 1 46  ? 16.240  5.565   -0.928  1.00 10.00 ? 46  ALA A HA   2  
ATOM   2846  H  HB1  . ALA A 1 46  ? 15.876  4.227   -3.041  1.00 10.00 ? 46  ALA A HB1  2  
ATOM   2847  H  HB2  . ALA A 1 46  ? 17.311  5.266   -3.165  1.00 10.00 ? 46  ALA A HB2  2  
ATOM   2848  H  HB3  . ALA A 1 46  ? 17.491  3.525   -2.848  1.00 10.00 ? 46  ALA A HB3  2  
ATOM   2849  N  N    . ALA A 1 47  ? 14.839  3.487   -0.432  1.00 10.00 ? 47  ALA A N    2  
ATOM   2850  C  CA   . ALA A 1 47  ? 14.084  2.352   0.054   1.00 10.00 ? 47  ALA A CA   2  
ATOM   2851  C  C    . ALA A 1 47  ? 13.998  1.301   -1.045  1.00 10.00 ? 47  ALA A C    2  
ATOM   2852  O  O    . ALA A 1 47  ? 14.060  1.625   -2.231  1.00 10.00 ? 47  ALA A O    2  
ATOM   2853  C  CB   . ALA A 1 47  ? 12.688  2.762   0.527   1.00 10.00 ? 47  ALA A CB   2  
ATOM   2854  H  H    . ALA A 1 47  ? 14.355  4.213   -0.952  1.00 10.00 ? 47  ALA A H    2  
ATOM   2855  H  HA   . ALA A 1 47  ? 14.609  1.944   0.909   1.00 10.00 ? 47  ALA A HA   2  
ATOM   2856  H  HB1  . ALA A 1 47  ? 12.763  3.553   1.273   1.00 10.00 ? 47  ALA A HB1  2  
ATOM   2857  H  HB2  . ALA A 1 47  ? 12.092  3.104   -0.318  1.00 10.00 ? 47  ALA A HB2  2  
ATOM   2858  H  HB3  . ALA A 1 47  ? 12.199  1.894   0.978   1.00 10.00 ? 47  ALA A HB3  2  
ATOM   2859  N  N    . TYR A 1 48  ? 13.834  0.048   -0.630  1.00 10.00 ? 48  TYR A N    2  
ATOM   2860  C  CA   . TYR A 1 48  ? 13.454  -1.064  -1.467  1.00 10.00 ? 48  TYR A CA   2  
ATOM   2861  C  C    . TYR A 1 48  ? 12.176  -1.584  -0.818  1.00 10.00 ? 48  TYR A C    2  
ATOM   2862  O  O    . TYR A 1 48  ? 12.155  -1.829  0.393   1.00 10.00 ? 48  TYR A O    2  
ATOM   2863  C  CB   . TYR A 1 48  ? 14.563  -2.120  -1.529  1.00 10.00 ? 48  TYR A CB   2  
ATOM   2864  C  CG   . TYR A 1 48  ? 15.712  -1.802  -2.466  1.00 10.00 ? 48  TYR A CG   2  
ATOM   2865  C  CD1  . TYR A 1 48  ? 16.630  -0.782  -2.150  1.00 10.00 ? 48  TYR A CD1  2  
ATOM   2866  C  CD2  . TYR A 1 48  ? 15.929  -2.605  -3.602  1.00 10.00 ? 48  TYR A CD2  2  
ATOM   2867  C  CE1  . TYR A 1 48  ? 17.772  -0.594  -2.946  1.00 10.00 ? 48  TYR A CE1  2  
ATOM   2868  C  CE2  . TYR A 1 48  ? 17.084  -2.430  -4.381  1.00 10.00 ? 48  TYR A CE2  2  
ATOM   2869  C  CZ   . TYR A 1 48  ? 18.036  -1.468  -4.012  1.00 10.00 ? 48  TYR A CZ   2  
ATOM   2870  O  OH   . TYR A 1 48  ? 19.201  -1.350  -4.708  1.00 10.00 ? 48  TYR A OH   2  
ATOM   2871  H  H    . TYR A 1 48  ? 13.695  -0.111  0.363   1.00 10.00 ? 48  TYR A H    2  
ATOM   2872  H  HA   . TYR A 1 48  ? 13.253  -0.707  -2.471  1.00 10.00 ? 48  TYR A HA   2  
ATOM   2873  H  HB2  . TYR A 1 48  ? 14.974  -2.280  -0.534  1.00 10.00 ? 48  TYR A HB2  2  
ATOM   2874  H  HB3  . TYR A 1 48  ? 14.110  -3.053  -1.863  1.00 10.00 ? 48  TYR A HB3  2  
ATOM   2875  H  HD1  . TYR A 1 48  ? 16.483  -0.164  -1.276  1.00 10.00 ? 48  TYR A HD1  2  
ATOM   2876  H  HD2  . TYR A 1 48  ? 15.232  -3.390  -3.859  1.00 10.00 ? 48  TYR A HD2  2  
ATOM   2877  H  HE1  . TYR A 1 48  ? 18.460  0.208   -2.725  1.00 10.00 ? 48  TYR A HE1  2  
ATOM   2878  H  HE2  . TYR A 1 48  ? 17.272  -3.098  -5.209  1.00 10.00 ? 48  TYR A HE2  2  
ATOM   2879  H  HH   . TYR A 1 48  ? 19.350  -2.090  -5.302  1.00 10.00 ? 48  TYR A HH   2  
ATOM   2880  N  N    . MET A 1 49  ? 11.094  -1.638  -1.590  1.00 10.00 ? 49  MET A N    2  
ATOM   2881  C  CA   . MET A 1 49  ? 9.751   -1.906  -1.098  1.00 10.00 ? 49  MET A CA   2  
ATOM   2882  C  C    . MET A 1 49  ? 8.943   -2.446  -2.276  1.00 10.00 ? 49  MET A C    2  
ATOM   2883  O  O    . MET A 1 49  ? 9.480   -2.663  -3.361  1.00 10.00 ? 49  MET A O    2  
ATOM   2884  C  CB   . MET A 1 49  ? 9.160   -0.626  -0.467  1.00 10.00 ? 49  MET A CB   2  
ATOM   2885  C  CG   . MET A 1 49  ? 7.912   -0.854  0.407   1.00 10.00 ? 49  MET A CG   2  
ATOM   2886  S  SD   . MET A 1 49  ? 6.344   -0.203  -0.233  1.00 10.00 ? 49  MET A SD   2  
ATOM   2887  C  CE   . MET A 1 49  ? 6.640   1.574   -0.086  1.00 10.00 ? 49  MET A CE   2  
ATOM   2888  H  H    . MET A 1 49  ? 11.202  -1.525  -2.598  1.00 10.00 ? 49  MET A H    2  
ATOM   2889  H  HA   . MET A 1 49  ? 9.809   -2.688  -0.338  1.00 10.00 ? 49  MET A HA   2  
ATOM   2890  H  HB2  . MET A 1 49  ? 9.916   -0.185  0.183   1.00 10.00 ? 49  MET A HB2  2  
ATOM   2891  H  HB3  . MET A 1 49  ? 8.931   0.095   -1.250  1.00 10.00 ? 49  MET A HB3  2  
ATOM   2892  H  HG2  . MET A 1 49  ? 7.786   -1.916  0.602   1.00 10.00 ? 49  MET A HG2  2  
ATOM   2893  H  HG3  . MET A 1 49  ? 8.065   -0.373  1.370   1.00 10.00 ? 49  MET A HG3  2  
ATOM   2894  H  HE1  . MET A 1 49  ? 5.766   2.110   -0.453  1.00 10.00 ? 49  MET A HE1  2  
ATOM   2895  H  HE2  . MET A 1 49  ? 6.804   1.824   0.962   1.00 10.00 ? 49  MET A HE2  2  
ATOM   2896  H  HE3  . MET A 1 49  ? 7.511   1.857   -0.670  1.00 10.00 ? 49  MET A HE3  2  
ATOM   2897  N  N    . THR A 1 50  ? 7.658   -2.709  -2.084  1.00 10.00 ? 50  THR A N    2  
ATOM   2898  C  CA   . THR A 1 50  ? 6.762   -3.141  -3.136  1.00 10.00 ? 50  THR A CA   2  
ATOM   2899  C  C    . THR A 1 50  ? 5.368   -2.615  -2.800  1.00 10.00 ? 50  THR A C    2  
ATOM   2900  O  O    . THR A 1 50  ? 4.869   -2.842  -1.703  1.00 10.00 ? 50  THR A O    2  
ATOM   2901  C  CB   . THR A 1 50  ? 6.864   -4.669  -3.261  1.00 10.00 ? 50  THR A CB   2  
ATOM   2902  O  OG1  . THR A 1 50  ? 8.044   -4.985  -3.975  1.00 10.00 ? 50  THR A OG1  2  
ATOM   2903  C  CG2  . THR A 1 50  ? 5.674   -5.308  -3.971  1.00 10.00 ? 50  THR A CG2  2  
ATOM   2904  H  H    . THR A 1 50  ? 7.248   -2.561  -1.179  1.00 10.00 ? 50  THR A H    2  
ATOM   2905  H  HA   . THR A 1 50  ? 7.068   -2.687  -4.077  1.00 10.00 ? 50  THR A HA   2  
ATOM   2906  H  HB   . THR A 1 50  ? 6.924   -5.112  -2.265  1.00 10.00 ? 50  THR A HB   2  
ATOM   2907  H  HG1  . THR A 1 50  ? 8.729   -4.346  -3.740  1.00 10.00 ? 50  THR A HG1  2  
ATOM   2908  H  HG21 . THR A 1 50  ? 5.545   -4.883  -4.964  1.00 10.00 ? 50  THR A HG21 2  
ATOM   2909  H  HG22 . THR A 1 50  ? 5.842   -6.381  -4.058  1.00 10.00 ? 50  THR A HG22 2  
ATOM   2910  H  HG23 . THR A 1 50  ? 4.778   -5.141  -3.378  1.00 10.00 ? 50  THR A HG23 2  
ATOM   2911  N  N    . LEU A 1 51  ? 4.754   -1.891  -3.733  1.00 10.00 ? 51  LEU A N    2  
ATOM   2912  C  CA   . LEU A 1 51  ? 3.371   -1.465  -3.659  1.00 10.00 ? 51  LEU A CA   2  
ATOM   2913  C  C    . LEU A 1 51  ? 2.539   -2.633  -4.167  1.00 10.00 ? 51  LEU A C    2  
ATOM   2914  O  O    . LEU A 1 51  ? 2.881   -3.229  -5.186  1.00 10.00 ? 51  LEU A O    2  
ATOM   2915  C  CB   . LEU A 1 51  ? 3.180   -0.238  -4.565  1.00 10.00 ? 51  LEU A CB   2  
ATOM   2916  C  CG   . LEU A 1 51  ? 2.915   1.084   -3.824  1.00 10.00 ? 51  LEU A CG   2  
ATOM   2917  C  CD1  . LEU A 1 51  ? 3.858   1.352   -2.643  1.00 10.00 ? 51  LEU A CD1  2  
ATOM   2918  C  CD2  . LEU A 1 51  ? 3.041   2.231   -4.828  1.00 10.00 ? 51  LEU A CD2  2  
ATOM   2919  H  H    . LEU A 1 51  ? 5.191   -1.822  -4.642  1.00 10.00 ? 51  LEU A H    2  
ATOM   2920  H  HA   . LEU A 1 51  ? 3.085   -1.248  -2.630  1.00 10.00 ? 51  LEU A HA   2  
ATOM   2921  H  HB2  . LEU A 1 51  ? 4.056   -0.133  -5.198  1.00 10.00 ? 51  LEU A HB2  2  
ATOM   2922  H  HB3  . LEU A 1 51  ? 2.346   -0.413  -5.243  1.00 10.00 ? 51  LEU A HB3  2  
ATOM   2923  H  HG   . LEU A 1 51  ? 1.889   1.074   -3.462  1.00 10.00 ? 51  LEU A HG   2  
ATOM   2924  H  HD11 . LEU A 1 51  ? 4.895   1.237   -2.952  1.00 10.00 ? 51  LEU A HD11 2  
ATOM   2925  H  HD12 . LEU A 1 51  ? 3.709   2.370   -2.283  1.00 10.00 ? 51  LEU A HD12 2  
ATOM   2926  H  HD13 . LEU A 1 51  ? 3.654   0.675   -1.816  1.00 10.00 ? 51  LEU A HD13 2  
ATOM   2927  H  HD21 . LEU A 1 51  ? 4.058   2.257   -5.216  1.00 10.00 ? 51  LEU A HD21 2  
ATOM   2928  H  HD22 . LEU A 1 51  ? 2.349   2.076   -5.652  1.00 10.00 ? 51  LEU A HD22 2  
ATOM   2929  H  HD23 . LEU A 1 51  ? 2.810   3.182   -4.347  1.00 10.00 ? 51  LEU A HD23 2  
ATOM   2930  N  N    . THR A 1 52  ? 1.459   -2.950  -3.454  1.00 10.00 ? 52  THR A N    2  
ATOM   2931  C  CA   . THR A 1 52  ? 0.602   -4.099  -3.702  1.00 10.00 ? 52  THR A CA   2  
ATOM   2932  C  C    . THR A 1 52  ? -0.855  -3.652  -3.600  1.00 10.00 ? 52  THR A C    2  
ATOM   2933  O  O    . THR A 1 52  ? -1.374  -3.547  -2.491  1.00 10.00 ? 52  THR A O    2  
ATOM   2934  C  CB   . THR A 1 52  ? 0.955   -5.167  -2.654  1.00 10.00 ? 52  THR A CB   2  
ATOM   2935  O  OG1  . THR A 1 52  ? 2.314   -5.517  -2.803  1.00 10.00 ? 52  THR A OG1  2  
ATOM   2936  C  CG2  . THR A 1 52  ? 0.114   -6.439  -2.810  1.00 10.00 ? 52  THR A CG2  2  
ATOM   2937  H  H    . THR A 1 52  ? 1.295   -2.430  -2.606  1.00 10.00 ? 52  THR A H    2  
ATOM   2938  H  HA   . THR A 1 52  ? 0.767   -4.507  -4.698  1.00 10.00 ? 52  THR A HA   2  
ATOM   2939  H  HB   . THR A 1 52  ? 0.824   -4.753  -1.646  1.00 10.00 ? 52  THR A HB   2  
ATOM   2940  H  HG1  . THR A 1 52  ? 2.469   -5.797  -3.711  1.00 10.00 ? 52  THR A HG1  2  
ATOM   2941  H  HG21 . THR A 1 52  ? -0.938  -6.227  -2.617  1.00 10.00 ? 52  THR A HG21 2  
ATOM   2942  H  HG22 . THR A 1 52  ? 0.223   -6.840  -3.818  1.00 10.00 ? 52  THR A HG22 2  
ATOM   2943  H  HG23 . THR A 1 52  ? 0.456   -7.184  -2.090  1.00 10.00 ? 52  THR A HG23 2  
ATOM   2944  N  N    . ASN A 1 53  ? -1.518  -3.357  -4.726  1.00 10.00 ? 53  ASN A N    2  
ATOM   2945  C  CA   . ASN A 1 53  ? -2.898  -2.885  -4.683  1.00 10.00 ? 53  ASN A CA   2  
ATOM   2946  C  C    . ASN A 1 53  ? -3.850  -4.069  -4.601  1.00 10.00 ? 53  ASN A C    2  
ATOM   2947  O  O    . ASN A 1 53  ? -3.532  -5.153  -5.089  1.00 10.00 ? 53  ASN A O    2  
ATOM   2948  C  CB   . ASN A 1 53  ? -3.234  -2.033  -5.915  1.00 10.00 ? 53  ASN A CB   2  
ATOM   2949  C  CG   . ASN A 1 53  ? -4.247  -0.938  -5.595  1.00 10.00 ? 53  ASN A CG   2  
ATOM   2950  O  OD1  . ASN A 1 53  ? -4.938  -0.981  -4.580  1.00 10.00 ? 53  ASN A OD1  2  
ATOM   2951  N  ND2  . ASN A 1 53  ? -4.260  0.110   -6.409  1.00 10.00 ? 53  ASN A ND2  2  
ATOM   2952  H  H    . ASN A 1 53  ? -1.077  -3.442  -5.639  1.00 10.00 ? 53  ASN A H    2  
ATOM   2953  H  HA   . ASN A 1 53  ? -3.025  -2.278  -3.788  1.00 10.00 ? 53  ASN A HA   2  
ATOM   2954  H  HB2  . ASN A 1 53  ? -2.341  -1.526  -6.270  1.00 10.00 ? 53  ASN A HB2  2  
ATOM   2955  H  HB3  . ASN A 1 53  ? -3.598  -2.673  -6.713  1.00 10.00 ? 53  ASN A HB3  2  
ATOM   2956  H  HD21 . ASN A 1 53  ? -3.867  0.052   -7.347  1.00 10.00 ? 53  ASN A HD21 2  
ATOM   2957  H  HD22 . ASN A 1 53  ? -4.701  0.960   -6.115  1.00 10.00 ? 53  ASN A HD22 2  
ATOM   2958  N  N    . LYS A 1 54  ? -5.027  -3.866  -4.012  1.00 10.00 ? 54  LYS A N    2  
ATOM   2959  C  CA   . LYS A 1 54  ? -6.102  -4.841  -4.037  1.00 10.00 ? 54  LYS A CA   2  
ATOM   2960  C  C    . LYS A 1 54  ? -7.388  -4.053  -4.252  1.00 10.00 ? 54  LYS A C    2  
ATOM   2961  O  O    . LYS A 1 54  ? -8.325  -4.132  -3.459  1.00 10.00 ? 54  LYS A O    2  
ATOM   2962  C  CB   . LYS A 1 54  ? -6.128  -5.613  -2.713  1.00 10.00 ? 54  LYS A CB   2  
ATOM   2963  C  CG   . LYS A 1 54  ? -4.904  -6.504  -2.447  1.00 10.00 ? 54  LYS A CG   2  
ATOM   2964  C  CD   . LYS A 1 54  ? -4.772  -7.713  -3.386  1.00 10.00 ? 54  LYS A CD   2  
ATOM   2965  C  CE   . LYS A 1 54  ? -5.971  -8.667  -3.261  1.00 10.00 ? 54  LYS A CE   2  
ATOM   2966  N  NZ   . LYS A 1 54  ? -5.738  -9.949  -3.957  1.00 10.00 ? 54  LYS A NZ   2  
ATOM   2967  H  H    . LYS A 1 54  ? -5.261  -2.945  -3.637  1.00 10.00 ? 54  LYS A H    2  
ATOM   2968  H  HA   . LYS A 1 54  ? -6.000  -5.533  -4.872  1.00 10.00 ? 54  LYS A HA   2  
ATOM   2969  H  HB2  . LYS A 1 54  ? -6.172  -4.868  -1.927  1.00 10.00 ? 54  LYS A HB2  2  
ATOM   2970  H  HB3  . LYS A 1 54  ? -7.038  -6.203  -2.655  1.00 10.00 ? 54  LYS A HB3  2  
ATOM   2971  H  HG2  . LYS A 1 54  ? -3.998  -5.899  -2.515  1.00 10.00 ? 54  LYS A HG2  2  
ATOM   2972  H  HG3  . LYS A 1 54  ? -4.972  -6.868  -1.420  1.00 10.00 ? 54  LYS A HG3  2  
ATOM   2973  H  HD2  . LYS A 1 54  ? -4.661  -7.366  -4.415  1.00 10.00 ? 54  LYS A HD2  2  
ATOM   2974  H  HD3  . LYS A 1 54  ? -3.853  -8.232  -3.105  1.00 10.00 ? 54  LYS A HD3  2  
ATOM   2975  H  HE2  . LYS A 1 54  ? -6.161  -8.872  -2.205  1.00 10.00 ? 54  LYS A HE2  2  
ATOM   2976  H  HE3  . LYS A 1 54  ? -6.858  -8.197  -3.689  1.00 10.00 ? 54  LYS A HE3  2  
ATOM   2977  H  HZ1  . LYS A 1 54  ? -6.553  -10.540 -3.859  1.00 10.00 ? 54  LYS A HZ1  2  
ATOM   2978  H  HZ2  . LYS A 1 54  ? -5.568  -9.787  -4.940  1.00 10.00 ? 54  LYS A HZ2  2  
ATOM   2979  H  HZ3  . LYS A 1 54  ? -4.943  -10.426 -3.555  1.00 10.00 ? 54  LYS A HZ3  2  
ATOM   2980  N  N    . SER A 1 55  ? -7.416  -3.290  -5.343  1.00 10.00 ? 55  SER A N    2  
ATOM   2981  C  CA   . SER A 1 55  ? -8.537  -2.495  -5.786  1.00 10.00 ? 55  SER A CA   2  
ATOM   2982  C  C    . SER A 1 55  ? -8.088  -1.932  -7.123  1.00 10.00 ? 55  SER A C    2  
ATOM   2983  O  O    . SER A 1 55  ? -6.894  -1.971  -7.425  1.00 10.00 ? 55  SER A O    2  
ATOM   2984  C  CB   . SER A 1 55  ? -8.858  -1.356  -4.812  1.00 10.00 ? 55  SER A CB   2  
ATOM   2985  O  OG   . SER A 1 55  ? -10.166 -0.883  -5.074  1.00 10.00 ? 55  SER A OG   2  
ATOM   2986  H  H    . SER A 1 55  ? -6.620  -3.234  -5.977  1.00 10.00 ? 55  SER A H    2  
ATOM   2987  H  HA   . SER A 1 55  ? -9.405  -3.144  -5.914  1.00 10.00 ? 55  SER A HA   2  
ATOM   2988  H  HB2  . SER A 1 55  ? -8.824  -1.702  -3.784  1.00 10.00 ? 55  SER A HB2  2  
ATOM   2989  H  HB3  . SER A 1 55  ? -8.127  -0.553  -4.930  1.00 10.00 ? 55  SER A HB3  2  
ATOM   2990  H  HG   . SER A 1 55  ? -10.250 0.005   -4.697  1.00 10.00 ? 55  SER A HG   2  
ATOM   2991  N  N    . ASP A 1 56  ? -9.034  -1.427  -7.904  1.00 10.00 ? 56  ASP A N    2  
ATOM   2992  C  CA   . ASP A 1 56  ? -8.777  -0.918  -9.234  1.00 10.00 ? 56  ASP A CA   2  
ATOM   2993  C  C    . ASP A 1 56  ? -9.096  0.571   -9.264  1.00 10.00 ? 56  ASP A C    2  
ATOM   2994  O  O    . ASP A 1 56  ? -10.203 0.983   -9.611  1.00 10.00 ? 56  ASP A O    2  
ATOM   2995  C  CB   . ASP A 1 56  ? -9.538  -1.757  -10.266 1.00 10.00 ? 56  ASP A CB   2  
ATOM   2996  C  CG   . ASP A 1 56  ? -8.712  -1.837  -11.533 1.00 10.00 ? 56  ASP A CG   2  
ATOM   2997  O  OD1  . ASP A 1 56  ? -7.679  -2.540  -11.462 1.00 10.00 ? 56  ASP A OD1  2  
ATOM   2998  O  OD2  . ASP A 1 56  ? -9.075  -1.155  -12.512 1.00 10.00 ? 56  ASP A OD2  2  
ATOM   2999  H  H    . ASP A 1 56  ? -9.969  -1.379  -7.537  1.00 10.00 ? 56  ASP A H    2  
ATOM   3000  H  HA   . ASP A 1 56  ? -7.716  -1.018  -9.451  1.00 10.00 ? 56  ASP A HA   2  
ATOM   3001  H  HB2  . ASP A 1 56  ? -9.658  -2.778  -9.903  1.00 10.00 ? 56  ASP A HB2  2  
ATOM   3002  H  HB3  . ASP A 1 56  ? -10.525 -1.344  -10.479 1.00 10.00 ? 56  ASP A HB3  2  
ATOM   3003  N  N    . GLN A 1 57  ? -8.142  1.378   -8.793  1.00 10.00 ? 57  GLN A N    2  
ATOM   3004  C  CA   . GLN A 1 57  ? -8.233  2.827   -8.749  1.00 10.00 ? 57  GLN A CA   2  
ATOM   3005  C  C    . GLN A 1 57  ? -6.834  3.407   -8.975  1.00 10.00 ? 57  GLN A C    2  
ATOM   3006  O  O    . GLN A 1 57  ? -5.856  2.786   -8.558  1.00 10.00 ? 57  GLN A O    2  
ATOM   3007  C  CB   . GLN A 1 57  ? -8.735  3.282   -7.372  1.00 10.00 ? 57  GLN A CB   2  
ATOM   3008  C  CG   . GLN A 1 57  ? -10.246 3.128   -7.151  1.00 10.00 ? 57  GLN A CG   2  
ATOM   3009  C  CD   . GLN A 1 57  ? -10.577 1.873   -6.355  1.00 10.00 ? 57  GLN A CD   2  
ATOM   3010  O  OE1  . GLN A 1 57  ? -10.345 1.820   -5.148  1.00 10.00 ? 57  GLN A OE1  2  
ATOM   3011  N  NE2  . GLN A 1 57  ? -11.103 0.841   -7.001  1.00 10.00 ? 57  GLN A NE2  2  
ATOM   3012  H  H    . GLN A 1 57  ? -7.263  0.974   -8.492  1.00 10.00 ? 57  GLN A H    2  
ATOM   3013  H  HA   . GLN A 1 57  ? -8.909  3.170   -9.532  1.00 10.00 ? 57  GLN A HA   2  
ATOM   3014  H  HB2  . GLN A 1 57  ? -8.186  2.746   -6.593  1.00 10.00 ? 57  GLN A HB2  2  
ATOM   3015  H  HB3  . GLN A 1 57  ? -8.505  4.343   -7.288  1.00 10.00 ? 57  GLN A HB3  2  
ATOM   3016  H  HG2  . GLN A 1 57  ? -10.590 3.974   -6.556  1.00 10.00 ? 57  GLN A HG2  2  
ATOM   3017  H  HG3  . GLN A 1 57  ? -10.784 3.146   -8.099  1.00 10.00 ? 57  GLN A HG3  2  
ATOM   3018  H  HE21 . GLN A 1 57  ? -11.206 0.878   -8.014  1.00 10.00 ? 57  GLN A HE21 2  
ATOM   3019  H  HE22 . GLN A 1 57  ? -11.250 -0.014  -6.476  1.00 10.00 ? 57  GLN A HE22 2  
ATOM   3020  N  N    . PRO A 1 58  ? -6.716  4.597   -9.587  1.00 10.00 ? 58  PRO A N    2  
ATOM   3021  C  CA   . PRO A 1 58  ? -5.450  5.297   -9.740  1.00 10.00 ? 58  PRO A CA   2  
ATOM   3022  C  C    . PRO A 1 58  ? -5.010  5.874   -8.389  1.00 10.00 ? 58  PRO A C    2  
ATOM   3023  O  O    . PRO A 1 58  ? -5.080  7.081   -8.154  1.00 10.00 ? 58  PRO A O    2  
ATOM   3024  C  CB   . PRO A 1 58  ? -5.718  6.374   -10.796 1.00 10.00 ? 58  PRO A CB   2  
ATOM   3025  C  CG   . PRO A 1 58  ? -7.190  6.719   -10.564 1.00 10.00 ? 58  PRO A CG   2  
ATOM   3026  C  CD   . PRO A 1 58  ? -7.800  5.372   -10.175 1.00 10.00 ? 58  PRO A CD   2  
ATOM   3027  H  HA   . PRO A 1 58  ? -4.677  4.624   -10.103 1.00 10.00 ? 58  PRO A HA   2  
ATOM   3028  H  HB2  . PRO A 1 58  ? -5.063  7.242   -10.704 1.00 10.00 ? 58  PRO A HB2  2  
ATOM   3029  H  HB3  . PRO A 1 58  ? -5.610  5.936   -11.790 1.00 10.00 ? 58  PRO A HB3  2  
ATOM   3030  H  HG2  . PRO A 1 58  ? -7.272  7.414   -9.726  1.00 10.00 ? 58  PRO A HG2  2  
ATOM   3031  H  HG3  . PRO A 1 58  ? -7.660  7.147   -11.451 1.00 10.00 ? 58  PRO A HG3  2  
ATOM   3032  H  HD2  . PRO A 1 58  ? -8.626  5.526   -9.479  1.00 10.00 ? 58  PRO A HD2  2  
ATOM   3033  H  HD3  . PRO A 1 58  ? -8.158  4.865   -11.072 1.00 10.00 ? 58  PRO A HD3  2  
ATOM   3034  N  N    . ILE A 1 59  ? -4.567  5.000   -7.487  1.00 10.00 ? 59  ILE A N    2  
ATOM   3035  C  CA   . ILE A 1 59  ? -4.134  5.382   -6.150  1.00 10.00 ? 59  ILE A CA   2  
ATOM   3036  C  C    . ILE A 1 59  ? -2.676  5.853   -6.221  1.00 10.00 ? 59  ILE A C    2  
ATOM   3037  O  O    . ILE A 1 59  ? -1.949  5.551   -7.168  1.00 10.00 ? 59  ILE A O    2  
ATOM   3038  C  CB   . ILE A 1 59  ? -4.396  4.222   -5.165  1.00 10.00 ? 59  ILE A CB   2  
ATOM   3039  C  CG1  . ILE A 1 59  ? -5.919  4.056   -4.998  1.00 10.00 ? 59  ILE A CG1  2  
ATOM   3040  C  CG2  . ILE A 1 59  ? -3.784  4.491   -3.781  1.00 10.00 ? 59  ILE A CG2  2  
ATOM   3041  C  CD1  . ILE A 1 59  ? -6.325  2.676   -4.476  1.00 10.00 ? 59  ILE A CD1  2  
ATOM   3042  H  H    . ILE A 1 59  ? -4.526  4.022   -7.761  1.00 10.00 ? 59  ILE A H    2  
ATOM   3043  H  HA   . ILE A 1 59  ? -4.738  6.224   -5.810  1.00 10.00 ? 59  ILE A HA   2  
ATOM   3044  H  HB   . ILE A 1 59  ? -3.965  3.307   -5.574  1.00 10.00 ? 59  ILE A HB   2  
ATOM   3045  H  HG12 . ILE A 1 59  ? -6.294  4.821   -4.318  1.00 10.00 ? 59  ILE A HG12 2  
ATOM   3046  H  HG13 . ILE A 1 59  ? -6.417  4.191   -5.956  1.00 10.00 ? 59  ILE A HG13 2  
ATOM   3047  H  HG21 . ILE A 1 59  ? -4.164  5.429   -3.380  1.00 10.00 ? 59  ILE A HG21 2  
ATOM   3048  H  HG22 . ILE A 1 59  ? -4.033  3.690   -3.087  1.00 10.00 ? 59  ILE A HG22 2  
ATOM   3049  H  HG23 . ILE A 1 59  ? -2.700  4.551   -3.845  1.00 10.00 ? 59  ILE A HG23 2  
ATOM   3050  H  HD11 . ILE A 1 59  ? -5.797  2.430   -3.557  1.00 10.00 ? 59  ILE A HD11 2  
ATOM   3051  H  HD12 . ILE A 1 59  ? -7.397  2.668   -4.278  1.00 10.00 ? 59  ILE A HD12 2  
ATOM   3052  H  HD13 . ILE A 1 59  ? -6.109  1.927   -5.234  1.00 10.00 ? 59  ILE A HD13 2  
ATOM   3053  N  N    . LYS A 1 60  ? -2.261  6.663   -5.245  1.00 10.00 ? 60  LYS A N    2  
ATOM   3054  C  CA   . LYS A 1 60  ? -0.950  7.273   -5.218  1.00 10.00 ? 60  LYS A CA   2  
ATOM   3055  C  C    . LYS A 1 60  ? -0.457  7.394   -3.787  1.00 10.00 ? 60  LYS A C    2  
ATOM   3056  O  O    . LYS A 1 60  ? -1.246  7.279   -2.852  1.00 10.00 ? 60  LYS A O    2  
ATOM   3057  C  CB   . LYS A 1 60  ? -1.032  8.638   -5.903  1.00 10.00 ? 60  LYS A CB   2  
ATOM   3058  C  CG   . LYS A 1 60  ? -1.824  9.720   -5.148  1.00 10.00 ? 60  LYS A CG   2  
ATOM   3059  C  CD   . LYS A 1 60  ? -2.933  10.321  -6.028  1.00 10.00 ? 60  LYS A CD   2  
ATOM   3060  C  CE   . LYS A 1 60  ? -4.209  9.465   -6.044  1.00 10.00 ? 60  LYS A CE   2  
ATOM   3061  N  NZ   . LYS A 1 60  ? -4.941  9.511   -4.758  1.00 10.00 ? 60  LYS A NZ   2  
ATOM   3062  H  H    . LYS A 1 60  ? -2.851  6.854   -4.452  1.00 10.00 ? 60  LYS A H    2  
ATOM   3063  H  HA   . LYS A 1 60  ? -0.238  6.639   -5.748  1.00 10.00 ? 60  LYS A HA   2  
ATOM   3064  H  HB2  . LYS A 1 60  ? -0.014  8.983   -6.049  1.00 10.00 ? 60  LYS A HB2  2  
ATOM   3065  H  HB3  . LYS A 1 60  ? -1.483  8.483   -6.877  1.00 10.00 ? 60  LYS A HB3  2  
ATOM   3066  H  HG2  . LYS A 1 60  ? -2.244  9.344   -4.215  1.00 10.00 ? 60  LYS A HG2  2  
ATOM   3067  H  HG3  . LYS A 1 60  ? -1.126  10.521  -4.895  1.00 10.00 ? 60  LYS A HG3  2  
ATOM   3068  H  HD2  . LYS A 1 60  ? -3.175  11.322  -5.668  1.00 10.00 ? 60  LYS A HD2  2  
ATOM   3069  H  HD3  . LYS A 1 60  ? -2.561  10.436  -7.048  1.00 10.00 ? 60  LYS A HD3  2  
ATOM   3070  H  HE2  . LYS A 1 60  ? -4.868  9.866   -6.817  1.00 10.00 ? 60  LYS A HE2  2  
ATOM   3071  H  HE3  . LYS A 1 60  ? -3.973  8.438   -6.313  1.00 10.00 ? 60  LYS A HE3  2  
ATOM   3072  H  HZ1  . LYS A 1 60  ? -4.921  10.459  -4.394  1.00 10.00 ? 60  LYS A HZ1  2  
ATOM   3073  H  HZ2  . LYS A 1 60  ? -5.894  9.198   -4.857  1.00 10.00 ? 60  LYS A HZ2  2  
ATOM   3074  H  HZ3  . LYS A 1 60  ? -4.527  8.976   -3.989  1.00 10.00 ? 60  LYS A HZ3  2  
ATOM   3075  N  N    . LEU A 1 61  ? 0.838   7.655   -3.629  1.00 10.00 ? 61  LEU A N    2  
ATOM   3076  C  CA   . LEU A 1 61  ? 1.504   7.828   -2.362  1.00 10.00 ? 61  LEU A CA   2  
ATOM   3077  C  C    . LEU A 1 61  ? 2.457   8.995   -2.596  1.00 10.00 ? 61  LEU A C    2  
ATOM   3078  O  O    . LEU A 1 61  ? 3.186   8.966   -3.585  1.00 10.00 ? 61  LEU A O    2  
ATOM   3079  C  CB   . LEU A 1 61  ? 2.183   6.486   -2.056  1.00 10.00 ? 61  LEU A CB   2  
ATOM   3080  C  CG   . LEU A 1 61  ? 3.280   6.468   -0.989  1.00 10.00 ? 61  LEU A CG   2  
ATOM   3081  C  CD1  . LEU A 1 61  ? 4.593   7.061   -1.512  1.00 10.00 ? 61  LEU A CD1  2  
ATOM   3082  C  CD2  . LEU A 1 61  ? 2.827   7.112   0.321   1.00 10.00 ? 61  LEU A CD2  2  
ATOM   3083  H  H    . LEU A 1 61  ? 1.464   7.712   -4.427  1.00 10.00 ? 61  LEU A H    2  
ATOM   3084  H  HA   . LEU A 1 61  ? 0.800   8.068   -1.567  1.00 10.00 ? 61  LEU A HA   2  
ATOM   3085  H  HB2  . LEU A 1 61  ? 1.397   5.800   -1.736  1.00 10.00 ? 61  LEU A HB2  2  
ATOM   3086  H  HB3  . LEU A 1 61  ? 2.610   6.083   -2.976  1.00 10.00 ? 61  LEU A HB3  2  
ATOM   3087  H  HG   . LEU A 1 61  ? 3.471   5.415   -0.783  1.00 10.00 ? 61  LEU A HG   2  
ATOM   3088  H  HD11 . LEU A 1 61  ? 4.731   6.767   -2.553  1.00 10.00 ? 61  LEU A HD11 2  
ATOM   3089  H  HD12 . LEU A 1 61  ? 4.592   8.145   -1.458  1.00 10.00 ? 61  LEU A HD12 2  
ATOM   3090  H  HD13 . LEU A 1 61  ? 5.425   6.688   -0.915  1.00 10.00 ? 61  LEU A HD13 2  
ATOM   3091  H  HD21 . LEU A 1 61  ? 1.911   6.633   0.669   1.00 10.00 ? 61  LEU A HD21 2  
ATOM   3092  H  HD22 . LEU A 1 61  ? 3.613   6.963   1.058   1.00 10.00 ? 61  LEU A HD22 2  
ATOM   3093  H  HD23 . LEU A 1 61  ? 2.650   8.178   0.201   1.00 10.00 ? 61  LEU A HD23 2  
ATOM   3094  N  N    . VAL A 1 62  ? 2.426   10.025  -1.742  1.00 10.00 ? 62  VAL A N    2  
ATOM   3095  C  CA   . VAL A 1 62  ? 3.315   11.179  -1.833  1.00 10.00 ? 62  VAL A CA   2  
ATOM   3096  C  C    . VAL A 1 62  ? 3.814   11.530  -0.429  1.00 10.00 ? 62  VAL A C    2  
ATOM   3097  O  O    . VAL A 1 62  ? 3.773   12.674  0.018   1.00 10.00 ? 62  VAL A O    2  
ATOM   3098  C  CB   . VAL A 1 62  ? 2.577   12.331  -2.552  1.00 10.00 ? 62  VAL A CB   2  
ATOM   3099  C  CG1  . VAL A 1 62  ? 1.229   12.704  -1.921  1.00 10.00 ? 62  VAL A CG1  2  
ATOM   3100  C  CG2  . VAL A 1 62  ? 3.432   13.598  -2.711  1.00 10.00 ? 62  VAL A CG2  2  
ATOM   3101  H  H    . VAL A 1 62  ? 1.812   10.005  -0.933  1.00 10.00 ? 62  VAL A H    2  
ATOM   3102  H  HA   . VAL A 1 62  ? 4.195   10.928  -2.424  1.00 10.00 ? 62  VAL A HA   2  
ATOM   3103  H  HB   . VAL A 1 62  ? 2.351   11.969  -3.553  1.00 10.00 ? 62  VAL A HB   2  
ATOM   3104  H  HG11 . VAL A 1 62  ? 0.777   13.505  -2.505  1.00 10.00 ? 62  VAL A HG11 2  
ATOM   3105  H  HG12 . VAL A 1 62  ? 0.557   11.847  -1.927  1.00 10.00 ? 62  VAL A HG12 2  
ATOM   3106  H  HG13 . VAL A 1 62  ? 1.364   13.049  -0.896  1.00 10.00 ? 62  VAL A HG13 2  
ATOM   3107  H  HG21 . VAL A 1 62  ? 4.468   13.337  -2.928  1.00 10.00 ? 62  VAL A HG21 2  
ATOM   3108  H  HG22 . VAL A 1 62  ? 3.035   14.197  -3.527  1.00 10.00 ? 62  VAL A HG22 2  
ATOM   3109  H  HG23 . VAL A 1 62  ? 3.406   14.210  -1.811  1.00 10.00 ? 62  VAL A HG23 2  
ATOM   3110  N  N    . GLY A 1 63  ? 4.352   10.531  0.270   1.00 10.00 ? 63  GLY A N    2  
ATOM   3111  C  CA   . GLY A 1 63  ? 5.130   10.772  1.466   1.00 10.00 ? 63  GLY A CA   2  
ATOM   3112  C  C    . GLY A 1 63  ? 5.992   9.569   1.815   1.00 10.00 ? 63  GLY A C    2  
ATOM   3113  O  O    . GLY A 1 63  ? 5.624   8.430   1.541   1.00 10.00 ? 63  GLY A O    2  
ATOM   3114  H  H    . GLY A 1 63  ? 4.309   9.591   -0.093  1.00 10.00 ? 63  GLY A H    2  
ATOM   3115  H  HA2  . GLY A 1 63  ? 5.797   11.615  1.260   1.00 10.00 ? 63  GLY A HA2  2  
ATOM   3116  H  HA3  . GLY A 1 63  ? 4.479   11.018  2.303   1.00 10.00 ? 63  GLY A HA3  2  
ATOM   3117  N  N    . ALA A 1 64  ? 7.121   9.857   2.454   1.00 10.00 ? 64  ALA A N    2  
ATOM   3118  C  CA   . ALA A 1 64  ? 8.041   8.935   3.094   1.00 10.00 ? 64  ALA A CA   2  
ATOM   3119  C  C    . ALA A 1 64  ? 8.800   9.749   4.144   1.00 10.00 ? 64  ALA A C    2  
ATOM   3120  O  O    . ALA A 1 64  ? 10.010  9.949   4.058   1.00 10.00 ? 64  ALA A O    2  
ATOM   3121  C  CB   . ALA A 1 64  ? 8.974   8.314   2.053   1.00 10.00 ? 64  ALA A CB   2  
ATOM   3122  H  H    . ALA A 1 64  ? 7.286   10.833  2.615   1.00 10.00 ? 64  ALA A H    2  
ATOM   3123  H  HA   . ALA A 1 64  ? 7.484   8.140   3.593   1.00 10.00 ? 64  ALA A HA   2  
ATOM   3124  H  HB1  . ALA A 1 64  ? 8.392   7.737   1.334   1.00 10.00 ? 64  ALA A HB1  2  
ATOM   3125  H  HB2  . ALA A 1 64  ? 9.523   9.097   1.527   1.00 10.00 ? 64  ALA A HB2  2  
ATOM   3126  H  HB3  . ALA A 1 64  ? 9.680   7.652   2.554   1.00 10.00 ? 64  ALA A HB3  2  
ATOM   3127  N  N    . ALA A 1 65  ? 8.058   10.279  5.114   1.00 10.00 ? 65  ALA A N    2  
ATOM   3128  C  CA   . ALA A 1 65  ? 8.563   11.207  6.107   1.00 10.00 ? 65  ALA A CA   2  
ATOM   3129  C  C    . ALA A 1 65  ? 9.231   10.382  7.199   1.00 10.00 ? 65  ALA A C    2  
ATOM   3130  O  O    . ALA A 1 65  ? 8.582   9.916   8.135   1.00 10.00 ? 65  ALA A O    2  
ATOM   3131  C  CB   . ALA A 1 65  ? 7.422   12.074  6.648   1.00 10.00 ? 65  ALA A CB   2  
ATOM   3132  H  H    . ALA A 1 65  ? 7.097   9.975   5.205   1.00 10.00 ? 65  ALA A H    2  
ATOM   3133  H  HA   . ALA A 1 65  ? 9.293   11.879  5.651   1.00 10.00 ? 65  ALA A HA   2  
ATOM   3134  H  HB1  . ALA A 1 65  ? 6.972   12.641  5.833   1.00 10.00 ? 65  ALA A HB1  2  
ATOM   3135  H  HB2  . ALA A 1 65  ? 6.659   11.454  7.115   1.00 10.00 ? 65  ALA A HB2  2  
ATOM   3136  H  HB3  . ALA A 1 65  ? 7.814   12.770  7.391   1.00 10.00 ? 65  ALA A HB3  2  
ATOM   3137  N  N    . THR A 1 66  ? 10.532  10.162  7.020   1.00 10.00 ? 66  THR A N    2  
ATOM   3138  C  CA   . THR A 1 66  ? 11.367  9.375   7.905   1.00 10.00 ? 66  THR A CA   2  
ATOM   3139  C  C    . THR A 1 66  ? 12.252  10.312  8.741   1.00 10.00 ? 66  THR A C    2  
ATOM   3140  O  O    . THR A 1 66  ? 12.864  11.224  8.180   1.00 10.00 ? 66  THR A O    2  
ATOM   3141  C  CB   . THR A 1 66  ? 12.178  8.384   7.057   1.00 10.00 ? 66  THR A CB   2  
ATOM   3142  O  OG1  . THR A 1 66  ? 13.069  7.659   7.873   1.00 10.00 ? 66  THR A OG1  2  
ATOM   3143  C  CG2  . THR A 1 66  ? 12.960  9.009   5.900   1.00 10.00 ? 66  THR A CG2  2  
ATOM   3144  H  H    . THR A 1 66  ? 10.963  10.545  6.189   1.00 10.00 ? 66  THR A H    2  
ATOM   3145  H  HA   . THR A 1 66  ? 10.726  8.783   8.554   1.00 10.00 ? 66  THR A HA   2  
ATOM   3146  H  HB   . THR A 1 66  ? 11.481  7.692   6.591   1.00 10.00 ? 66  THR A HB   2  
ATOM   3147  H  HG1  . THR A 1 66  ? 12.575  7.086   8.463   1.00 10.00 ? 66  THR A HG1  2  
ATOM   3148  H  HG21 . THR A 1 66  ? 13.675  8.276   5.528   1.00 10.00 ? 66  THR A HG21 2  
ATOM   3149  H  HG22 . THR A 1 66  ? 12.285  9.280   5.089   1.00 10.00 ? 66  THR A HG22 2  
ATOM   3150  H  HG23 . THR A 1 66  ? 13.497  9.894   6.218   1.00 10.00 ? 66  THR A HG23 2  
ATOM   3151  N  N    . PRO A 1 67  ? 12.364  10.114  10.067  1.00 10.00 ? 67  PRO A N    2  
ATOM   3152  C  CA   . PRO A 1 67  ? 13.254  10.893  10.921  1.00 10.00 ? 67  PRO A CA   2  
ATOM   3153  C  C    . PRO A 1 67  ? 14.697  10.414  10.708  1.00 10.00 ? 67  PRO A C    2  
ATOM   3154  O  O    . PRO A 1 67  ? 15.334  9.878   11.617  1.00 10.00 ? 67  PRO A O    2  
ATOM   3155  C  CB   . PRO A 1 67  ? 12.742  10.637  12.343  1.00 10.00 ? 67  PRO A CB   2  
ATOM   3156  C  CG   . PRO A 1 67  ? 12.232  9.198   12.264  1.00 10.00 ? 67  PRO A CG   2  
ATOM   3157  C  CD   . PRO A 1 67  ? 11.646  9.121   10.853  1.00 10.00 ? 67  PRO A CD   2  
ATOM   3158  H  HA   . PRO A 1 67  ? 13.188  11.959  10.698  1.00 10.00 ? 67  PRO A HA   2  
ATOM   3159  H  HB2  . PRO A 1 67  ? 13.504  10.774  13.110  1.00 10.00 ? 67  PRO A HB2  2  
ATOM   3160  H  HB3  . PRO A 1 67  ? 11.898  11.300  12.541  1.00 10.00 ? 67  PRO A HB3  2  
ATOM   3161  H  HG2  . PRO A 1 67  ? 13.073  8.508   12.347  1.00 10.00 ? 67  PRO A HG2  2  
ATOM   3162  H  HG3  . PRO A 1 67  ? 11.488  8.975   13.030  1.00 10.00 ? 67  PRO A HG3  2  
ATOM   3163  H  HD2  . PRO A 1 67  ? 11.779  8.114   10.457  1.00 10.00 ? 67  PRO A HD2  2  
ATOM   3164  H  HD3  . PRO A 1 67  ? 10.585  9.375   10.883  1.00 10.00 ? 67  PRO A HD3  2  
ATOM   3165  N  N    . LEU A 1 68  ? 15.191  10.571  9.476   1.00 10.00 ? 68  LEU A N    2  
ATOM   3166  C  CA   . LEU A 1 68  ? 16.349  9.840   8.981   1.00 10.00 ? 68  LEU A CA   2  
ATOM   3167  C  C    . LEU A 1 68  ? 16.927  10.505  7.739   1.00 10.00 ? 68  LEU A C    2  
ATOM   3168  O  O    . LEU A 1 68  ? 18.133  10.715  7.671   1.00 10.00 ? 68  LEU A O    2  
ATOM   3169  C  CB   . LEU A 1 68  ? 15.928  8.408   8.638   1.00 10.00 ? 68  LEU A CB   2  
ATOM   3170  C  CG   . LEU A 1 68  ? 17.111  7.441   8.504   1.00 10.00 ? 68  LEU A CG   2  
ATOM   3171  C  CD1  . LEU A 1 68  ? 17.669  7.075   9.880   1.00 10.00 ? 68  LEU A CD1  2  
ATOM   3172  C  CD2  . LEU A 1 68  ? 16.658  6.181   7.756   1.00 10.00 ? 68  LEU A CD2  2  
ATOM   3173  H  H    . LEU A 1 68  ? 14.604  11.055  8.805   1.00 10.00 ? 68  LEU A H    2  
ATOM   3174  H  HA   . LEU A 1 68  ? 17.110  9.837   9.760   1.00 10.00 ? 68  LEU A HA   2  
ATOM   3175  H  HB2  . LEU A 1 68  ? 15.256  8.041   9.410   1.00 10.00 ? 68  LEU A HB2  2  
ATOM   3176  H  HB3  . LEU A 1 68  ? 15.386  8.429   7.694   1.00 10.00 ? 68  LEU A HB3  2  
ATOM   3177  H  HG   . LEU A 1 68  ? 17.908  7.913   7.934   1.00 10.00 ? 68  LEU A HG   2  
ATOM   3178  H  HD11 . LEU A 1 68  ? 18.139  7.949   10.321  1.00 10.00 ? 68  LEU A HD11 2  
ATOM   3179  H  HD12 . LEU A 1 68  ? 16.867  6.738   10.535  1.00 10.00 ? 68  LEU A HD12 2  
ATOM   3180  H  HD13 . LEU A 1 68  ? 18.416  6.287   9.785   1.00 10.00 ? 68  LEU A HD13 2  
ATOM   3181  H  HD21 . LEU A 1 68  ? 16.382  6.441   6.734   1.00 10.00 ? 68  LEU A HD21 2  
ATOM   3182  H  HD22 . LEU A 1 68  ? 17.467  5.451   7.727   1.00 10.00 ? 68  LEU A HD22 2  
ATOM   3183  H  HD23 . LEU A 1 68  ? 15.792  5.740   8.248   1.00 10.00 ? 68  LEU A HD23 2  
ATOM   3184  N  N    . ALA A 1 69  ? 16.081  10.837  6.763   1.00 10.00 ? 69  ALA A N    2  
ATOM   3185  C  CA   . ALA A 1 69  ? 16.481  11.510  5.539   1.00 10.00 ? 69  ALA A CA   2  
ATOM   3186  C  C    . ALA A 1 69  ? 16.236  13.001  5.708   1.00 10.00 ? 69  ALA A C    2  
ATOM   3187  O  O    . ALA A 1 69  ? 15.137  13.399  6.086   1.00 10.00 ? 69  ALA A O    2  
ATOM   3188  C  CB   . ALA A 1 69  ? 15.659  10.976  4.365   1.00 10.00 ? 69  ALA A CB   2  
ATOM   3189  H  H    . ALA A 1 69  ? 15.094  10.692  6.907   1.00 10.00 ? 69  ALA A H    2  
ATOM   3190  H  HA   . ALA A 1 69  ? 17.533  11.323  5.320   1.00 10.00 ? 69  ALA A HA   2  
ATOM   3191  H  HB1  . ALA A 1 69  ? 16.021  11.412  3.433   1.00 10.00 ? 69  ALA A HB1  2  
ATOM   3192  H  HB2  . ALA A 1 69  ? 15.761  9.895   4.322   1.00 10.00 ? 69  ALA A HB2  2  
ATOM   3193  H  HB3  . ALA A 1 69  ? 14.606  11.230  4.489   1.00 10.00 ? 69  ALA A HB3  2  
ATOM   3194  N  N    . THR A 1 70  ? 17.235  13.832  5.420   1.00 10.00 ? 70  THR A N    2  
ATOM   3195  C  CA   . THR A 1 70  ? 17.009  15.263  5.287   1.00 10.00 ? 70  THR A CA   2  
ATOM   3196  C  C    . THR A 1 70  ? 16.202  15.526  4.011   1.00 10.00 ? 70  THR A C    2  
ATOM   3197  O  O    . THR A 1 70  ? 15.396  16.451  3.971   1.00 10.00 ? 70  THR A O    2  
ATOM   3198  C  CB   . THR A 1 70  ? 18.350  16.014  5.285   1.00 10.00 ? 70  THR A CB   2  
ATOM   3199  O  OG1  . THR A 1 70  ? 19.140  15.573  6.372   1.00 10.00 ? 70  THR A OG1  2  
ATOM   3200  C  CG2  . THR A 1 70  ? 18.153  17.525  5.423   1.00 10.00 ? 70  THR A CG2  2  
ATOM   3201  H  H    . THR A 1 70  ? 18.139  13.457  5.152   1.00 10.00 ? 70  THR A H    2  
ATOM   3202  H  HA   . THR A 1 70  ? 16.426  15.613  6.140   1.00 10.00 ? 70  THR A HA   2  
ATOM   3203  H  HB   . THR A 1 70  ? 18.883  15.812  4.354   1.00 10.00 ? 70  THR A HB   2  
ATOM   3204  H  HG1  . THR A 1 70  ? 19.533  14.726  6.122   1.00 10.00 ? 70  THR A HG1  2  
ATOM   3205  H  HG21 . THR A 1 70  ? 19.126  18.016  5.455   1.00 10.00 ? 70  THR A HG21 2  
ATOM   3206  H  HG22 . THR A 1 70  ? 17.594  17.915  4.571   1.00 10.00 ? 70  THR A HG22 2  
ATOM   3207  H  HG23 . THR A 1 70  ? 17.610  17.752  6.340   1.00 10.00 ? 70  THR A HG23 2  
ATOM   3208  N  N    . SER A 1 71  ? 16.433  14.717  2.970   1.00 10.00 ? 71  SER A N    2  
ATOM   3209  C  CA   . SER A 1 71  ? 15.904  14.934  1.634   1.00 10.00 ? 71  SER A CA   2  
ATOM   3210  C  C    . SER A 1 71  ? 15.208  13.663  1.116   1.00 10.00 ? 71  SER A C    2  
ATOM   3211  O  O    . SER A 1 71  ? 15.742  12.984  0.238   1.00 10.00 ? 71  SER A O    2  
ATOM   3212  C  CB   . SER A 1 71  ? 17.085  15.376  0.759   1.00 10.00 ? 71  SER A CB   2  
ATOM   3213  O  OG   . SER A 1 71  ? 16.658  15.757  -0.529  1.00 10.00 ? 71  SER A OG   2  
ATOM   3214  H  H    . SER A 1 71  ? 17.100  13.958  3.067   1.00 10.00 ? 71  SER A H    2  
ATOM   3215  H  HA   . SER A 1 71  ? 15.181  15.750  1.622   1.00 10.00 ? 71  SER A HA   2  
ATOM   3216  H  HB2  . SER A 1 71  ? 17.587  16.226  1.224   1.00 10.00 ? 71  SER A HB2  2  
ATOM   3217  H  HB3  . SER A 1 71  ? 17.814  14.575  0.681   1.00 10.00 ? 71  SER A HB3  2  
ATOM   3218  H  HG   . SER A 1 71  ? 16.449  14.965  -1.038  1.00 10.00 ? 71  SER A HG   2  
ATOM   3219  N  N    . PRO A 1 72  ? 14.017  13.315  1.630   1.00 10.00 ? 72  PRO A N    2  
ATOM   3220  C  CA   . PRO A 1 72  ? 13.204  12.255  1.054   1.00 10.00 ? 72  PRO A CA   2  
ATOM   3221  C  C    . PRO A 1 72  ? 12.639  12.732  -0.290  1.00 10.00 ? 72  PRO A C    2  
ATOM   3222  O  O    . PRO A 1 72  ? 11.984  13.771  -0.345  1.00 10.00 ? 72  PRO A O    2  
ATOM   3223  C  CB   . PRO A 1 72  ? 12.108  11.983  2.088   1.00 10.00 ? 72  PRO A CB   2  
ATOM   3224  C  CG   . PRO A 1 72  ? 11.933  13.334  2.784   1.00 10.00 ? 72  PRO A CG   2  
ATOM   3225  C  CD   . PRO A 1 72  ? 13.338  13.941  2.754   1.00 10.00 ? 72  PRO A CD   2  
ATOM   3226  H  HA   . PRO A 1 72  ? 13.800  11.357  0.910   1.00 10.00 ? 72  PRO A HA   2  
ATOM   3227  H  HB2  . PRO A 1 72  ? 11.182  11.625  1.635   1.00 10.00 ? 72  PRO A HB2  2  
ATOM   3228  H  HB3  . PRO A 1 72  ? 12.471  11.253  2.813   1.00 10.00 ? 72  PRO A HB3  2  
ATOM   3229  H  HG2  . PRO A 1 72  ? 11.257  13.958  2.196   1.00 10.00 ? 72  PRO A HG2  2  
ATOM   3230  H  HG3  . PRO A 1 72  ? 11.550  13.228  3.800   1.00 10.00 ? 72  PRO A HG3  2  
ATOM   3231  H  HD2  . PRO A 1 72  ? 13.270  15.024  2.651   1.00 10.00 ? 72  PRO A HD2  2  
ATOM   3232  H  HD3  . PRO A 1 72  ? 13.860  13.688  3.676   1.00 10.00 ? 72  PRO A HD3  2  
ATOM   3233  N  N    . MET A 1 73  ? 12.914  12.004  -1.378  1.00 10.00 ? 73  MET A N    2  
ATOM   3234  C  CA   . MET A 1 73  ? 12.578  12.403  -2.739  1.00 10.00 ? 73  MET A CA   2  
ATOM   3235  C  C    . MET A 1 73  ? 12.208  11.174  -3.568  1.00 10.00 ? 73  MET A C    2  
ATOM   3236  O  O    . MET A 1 73  ? 12.992  10.238  -3.693  1.00 10.00 ? 73  MET A O    2  
ATOM   3237  C  CB   . MET A 1 73  ? 13.779  13.103  -3.379  1.00 10.00 ? 73  MET A CB   2  
ATOM   3238  C  CG   . MET A 1 73  ? 13.957  14.539  -2.879  1.00 10.00 ? 73  MET A CG   2  
ATOM   3239  S  SD   . MET A 1 73  ? 15.421  15.368  -3.540  1.00 10.00 ? 73  MET A SD   2  
ATOM   3240  C  CE   . MET A 1 73  ? 15.082  17.058  -2.996  1.00 10.00 ? 73  MET A CE   2  
ATOM   3241  H  H    . MET A 1 73  ? 13.427  11.134  -1.266  1.00 10.00 ? 73  MET A H    2  
ATOM   3242  H  HA   . MET A 1 73  ? 11.730  13.090  -2.736  1.00 10.00 ? 73  MET A HA   2  
ATOM   3243  H  HB2  . MET A 1 73  ? 14.668  12.516  -3.161  1.00 10.00 ? 73  MET A HB2  2  
ATOM   3244  H  HB3  . MET A 1 73  ? 13.642  13.142  -4.461  1.00 10.00 ? 73  MET A HB3  2  
ATOM   3245  H  HG2  . MET A 1 73  ? 13.080  15.115  -3.170  1.00 10.00 ? 73  MET A HG2  2  
ATOM   3246  H  HG3  . MET A 1 73  ? 14.043  14.553  -1.794  1.00 10.00 ? 73  MET A HG3  2  
ATOM   3247  H  HE1  . MET A 1 73  ? 14.958  17.082  -1.915  1.00 10.00 ? 73  MET A HE1  2  
ATOM   3248  H  HE2  . MET A 1 73  ? 15.918  17.695  -3.283  1.00 10.00 ? 73  MET A HE2  2  
ATOM   3249  H  HE3  . MET A 1 73  ? 14.171  17.415  -3.474  1.00 10.00 ? 73  MET A HE3  2  
ATOM   3250  N  N    . LEU A 1 74  ? 11.019  11.187  -4.163  1.00 10.00 ? 74  LEU A N    2  
ATOM   3251  C  CA   . LEU A 1 74  ? 10.493  10.088  -4.957  1.00 10.00 ? 74  LEU A CA   2  
ATOM   3252  C  C    . LEU A 1 74  ? 11.045  10.166  -6.391  1.00 10.00 ? 74  LEU A C    2  
ATOM   3253  O  O    . LEU A 1 74  ? 11.184  11.261  -6.944  1.00 10.00 ? 74  LEU A O    2  
ATOM   3254  C  CB   . LEU A 1 74  ? 8.950   10.217  -4.946  1.00 10.00 ? 74  LEU A CB   2  
ATOM   3255  C  CG   . LEU A 1 74  ? 8.339   9.858   -3.573  1.00 10.00 ? 74  LEU A CG   2  
ATOM   3256  C  CD1  . LEU A 1 74  ? 6.878   10.303  -3.475  1.00 10.00 ? 74  LEU A CD1  2  
ATOM   3257  C  CD2  . LEU A 1 74  ? 8.386   8.350   -3.320  1.00 10.00 ? 74  LEU A CD2  2  
ATOM   3258  H  H    . LEU A 1 74  ? 10.435  11.996  -4.031  1.00 10.00 ? 74  LEU A H    2  
ATOM   3259  H  HA   . LEU A 1 74  ? 10.862  9.163   -4.490  1.00 10.00 ? 74  LEU A HA   2  
ATOM   3260  H  HB2  . LEU A 1 74  ? 8.717   11.262  -5.156  1.00 10.00 ? 74  LEU A HB2  2  
ATOM   3261  H  HB3  . LEU A 1 74  ? 8.468   9.646   -5.748  1.00 10.00 ? 74  LEU A HB3  2  
ATOM   3262  H  HG   . LEU A 1 74  ? 8.882   10.364  -2.771  1.00 10.00 ? 74  LEU A HG   2  
ATOM   3263  H  HD11 . LEU A 1 74  ? 6.510   10.116  -2.466  1.00 10.00 ? 74  LEU A HD11 2  
ATOM   3264  H  HD12 . LEU A 1 74  ? 6.794   11.370  -3.685  1.00 10.00 ? 74  LEU A HD12 2  
ATOM   3265  H  HD13 . LEU A 1 74  ? 6.271   9.736   -4.179  1.00 10.00 ? 74  LEU A HD13 2  
ATOM   3266  H  HD21 . LEU A 1 74  ? 7.892   8.116   -2.376  1.00 10.00 ? 74  LEU A HD21 2  
ATOM   3267  H  HD22 . LEU A 1 74  ? 7.893   7.811   -4.126  1.00 10.00 ? 74  LEU A HD22 2  
ATOM   3268  H  HD23 . LEU A 1 74  ? 9.416   8.021   -3.263  1.00 10.00 ? 74  LEU A HD23 2  
ATOM   3269  N  N    . MET A 1 75  ? 11.375  9.011   -6.986  1.00 10.00 ? 75  MET A N    2  
ATOM   3270  C  CA   . MET A 1 75  ? 11.953  8.902   -8.327  1.00 10.00 ? 75  MET A CA   2  
ATOM   3271  C  C    . MET A 1 75  ? 11.369  7.700   -9.066  1.00 10.00 ? 75  MET A C    2  
ATOM   3272  O  O    . MET A 1 75  ? 10.986  6.729   -8.424  1.00 10.00 ? 75  MET A O    2  
ATOM   3273  C  CB   . MET A 1 75  ? 13.472  8.766   -8.209  1.00 10.00 ? 75  MET A CB   2  
ATOM   3274  C  CG   . MET A 1 75  ? 14.185  8.762   -9.564  1.00 10.00 ? 75  MET A CG   2  
ATOM   3275  S  SD   . MET A 1 75  ? 15.954  9.134   -9.494  1.00 10.00 ? 75  MET A SD   2  
ATOM   3276  C  CE   . MET A 1 75  ? 15.927  10.914  -9.176  1.00 10.00 ? 75  MET A CE   2  
ATOM   3277  H  H    . MET A 1 75  ? 11.202  8.138   -6.488  1.00 10.00 ? 75  MET A H    2  
ATOM   3278  H  HA   . MET A 1 75  ? 11.720  9.803   -8.896  1.00 10.00 ? 75  MET A HA   2  
ATOM   3279  H  HB2  . MET A 1 75  ? 13.820  9.611   -7.638  1.00 10.00 ? 75  MET A HB2  2  
ATOM   3280  H  HB3  . MET A 1 75  ? 13.710  7.852   -7.670  1.00 10.00 ? 75  MET A HB3  2  
ATOM   3281  H  HG2  . MET A 1 75  ? 14.058  7.774   -10.004 1.00 10.00 ? 75  MET A HG2  2  
ATOM   3282  H  HG3  . MET A 1 75  ? 13.733  9.491   -10.229 1.00 10.00 ? 75  MET A HG3  2  
ATOM   3283  H  HE1  . MET A 1 75  ? 16.950  11.271  -9.071  1.00 10.00 ? 75  MET A HE1  2  
ATOM   3284  H  HE2  . MET A 1 75  ? 15.465  11.418  -10.022 1.00 10.00 ? 75  MET A HE2  2  
ATOM   3285  H  HE3  . MET A 1 75  ? 15.363  11.143  -8.276  1.00 10.00 ? 75  MET A HE3  2  
ATOM   3286  N  N    . THR A 1 76  ? 11.325  7.770   -10.400 1.00 10.00 ? 76  THR A N    2  
ATOM   3287  C  CA   . THR A 1 76  ? 10.488  6.934   -11.247 1.00 10.00 ? 76  THR A CA   2  
ATOM   3288  C  C    . THR A 1 76  ? 11.227  6.521   -12.526 1.00 10.00 ? 76  THR A C    2  
ATOM   3289  O  O    . THR A 1 76  ? 11.509  7.384   -13.361 1.00 10.00 ? 76  THR A O    2  
ATOM   3290  C  CB   . THR A 1 76  ? 9.296   7.799   -11.651 1.00 10.00 ? 76  THR A CB   2  
ATOM   3291  O  OG1  . THR A 1 76  ? 9.785   9.038   -12.124 1.00 10.00 ? 76  THR A OG1  2  
ATOM   3292  C  CG2  . THR A 1 76  ? 8.300   8.029   -10.516 1.00 10.00 ? 76  THR A CG2  2  
ATOM   3293  H  H    . THR A 1 76  ? 11.627  8.625   -10.844 1.00 10.00 ? 76  THR A H    2  
ATOM   3294  H  HA   . THR A 1 76  ? 10.101  6.058   -10.731 1.00 10.00 ? 76  THR A HA   2  
ATOM   3295  H  HB   . THR A 1 76  ? 8.779   7.286   -12.449 1.00 10.00 ? 76  THR A HB   2  
ATOM   3296  H  HG1  . THR A 1 76  ? 10.385  8.851   -12.858 1.00 10.00 ? 76  THR A HG1  2  
ATOM   3297  H  HG21 . THR A 1 76  ? 7.500   8.689   -10.847 1.00 10.00 ? 76  THR A HG21 2  
ATOM   3298  H  HG22 . THR A 1 76  ? 7.854   7.082   -10.231 1.00 10.00 ? 76  THR A HG22 2  
ATOM   3299  H  HG23 . THR A 1 76  ? 8.797   8.455   -9.648  1.00 10.00 ? 76  THR A HG23 2  
ATOM   3300  N  N    . THR A 1 77  ? 11.494  5.229   -12.736 1.00 10.00 ? 77  THR A N    2  
ATOM   3301  C  CA   . THR A 1 77  ? 11.893  4.734   -14.063 1.00 10.00 ? 77  THR A CA   2  
ATOM   3302  C  C    . THR A 1 77  ? 11.389  3.320   -14.388 1.00 10.00 ? 77  THR A C    2  
ATOM   3303  O  O    . THR A 1 77  ? 12.149  2.408   -14.688 1.00 10.00 ? 77  THR A O    2  
ATOM   3304  C  CB   . THR A 1 77  ? 13.385  5.014   -14.356 1.00 10.00 ? 77  THR A CB   2  
ATOM   3305  O  OG1  . THR A 1 77  ? 13.524  5.474   -15.685 1.00 10.00 ? 77  THR A OG1  2  
ATOM   3306  C  CG2  . THR A 1 77  ? 14.424  3.913   -14.118 1.00 10.00 ? 77  THR A CG2  2  
ATOM   3307  H  H    . THR A 1 77  ? 11.263  4.591   -11.992 1.00 10.00 ? 77  THR A H    2  
ATOM   3308  H  HA   . THR A 1 77  ? 11.348  5.357   -14.772 1.00 10.00 ? 77  THR A HA   2  
ATOM   3309  H  HB   . THR A 1 77  ? 13.667  5.824   -13.696 1.00 10.00 ? 77  THR A HB   2  
ATOM   3310  H  HG1  . THR A 1 77  ? 14.462  5.521   -15.890 1.00 10.00 ? 77  THR A HG1  2  
ATOM   3311  H  HG21 . THR A 1 77  ? 14.281  3.469   -13.139 1.00 10.00 ? 77  THR A HG21 2  
ATOM   3312  H  HG22 . THR A 1 77  ? 14.382  3.138   -14.882 1.00 10.00 ? 77  THR A HG22 2  
ATOM   3313  H  HG23 . THR A 1 77  ? 15.426  4.337   -14.159 1.00 10.00 ? 77  THR A HG23 2  
ATOM   3314  N  N    . THR A 1 78  ? 10.073  3.128   -14.390 1.00 10.00 ? 78  THR A N    2  
ATOM   3315  C  CA   . THR A 1 78  ? 9.477   1.885   -14.868 1.00 10.00 ? 78  THR A CA   2  
ATOM   3316  C  C    . THR A 1 78  ? 8.161   2.183   -15.587 1.00 10.00 ? 78  THR A C    2  
ATOM   3317  O  O    . THR A 1 78  ? 7.240   2.779   -15.028 1.00 10.00 ? 78  THR A O    2  
ATOM   3318  C  CB   . THR A 1 78  ? 9.371   0.848   -13.739 1.00 10.00 ? 78  THR A CB   2  
ATOM   3319  O  OG1  . THR A 1 78  ? 8.508   -0.212  -14.104 1.00 10.00 ? 78  THR A OG1  2  
ATOM   3320  C  CG2  . THR A 1 78  ? 8.883   1.461   -12.432 1.00 10.00 ? 78  THR A CG2  2  
ATOM   3321  H  H    . THR A 1 78  ? 9.465   3.862   -14.037 1.00 10.00 ? 78  THR A H    2  
ATOM   3322  H  HA   . THR A 1 78  ? 10.139  1.442   -15.615 1.00 10.00 ? 78  THR A HA   2  
ATOM   3323  H  HB   . THR A 1 78  ? 10.366  0.439   -13.549 1.00 10.00 ? 78  THR A HB   2  
ATOM   3324  H  HG1  . THR A 1 78  ? 9.007   -0.862  -14.607 1.00 10.00 ? 78  THR A HG1  2  
ATOM   3325  H  HG21 . THR A 1 78  ? 9.589   2.214   -12.098 1.00 10.00 ? 78  THR A HG21 2  
ATOM   3326  H  HG22 . THR A 1 78  ? 7.905   1.917   -12.571 1.00 10.00 ? 78  THR A HG22 2  
ATOM   3327  H  HG23 . THR A 1 78  ? 8.842   0.681   -11.672 1.00 10.00 ? 78  THR A HG23 2  
ATOM   3328  N  N    . HIS A 1 79  ? 8.097   1.792   -16.864 1.00 10.00 ? 79  HIS A N    2  
ATOM   3329  C  CA   . HIS A 1 79  ? 7.004   2.085   -17.777 1.00 10.00 ? 79  HIS A CA   2  
ATOM   3330  C  C    . HIS A 1 79  ? 5.824   1.154   -17.475 1.00 10.00 ? 79  HIS A C    2  
ATOM   3331  O  O    . HIS A 1 79  ? 5.427   0.350   -18.314 1.00 10.00 ? 79  HIS A O    2  
ATOM   3332  C  CB   . HIS A 1 79  ? 7.496   1.919   -19.228 1.00 10.00 ? 79  HIS A CB   2  
ATOM   3333  C  CG   . HIS A 1 79  ? 8.557   2.877   -19.734 1.00 10.00 ? 79  HIS A CG   2  
ATOM   3334  N  ND1  . HIS A 1 79  ? 8.668   3.254   -21.073 1.00 10.00 ? 79  HIS A ND1  2  
ATOM   3335  C  CD2  . HIS A 1 79  ? 9.586   3.446   -19.029 1.00 10.00 ? 79  HIS A CD2  2  
ATOM   3336  C  CE1  . HIS A 1 79  ? 9.749   4.043   -21.146 1.00 10.00 ? 79  HIS A CE1  2  
ATOM   3337  N  NE2  . HIS A 1 79  ? 10.320  4.174   -19.937 1.00 10.00 ? 79  HIS A NE2  2  
ATOM   3338  H  H    . HIS A 1 79  ? 8.874   1.269   -17.239 1.00 10.00 ? 79  HIS A H    2  
ATOM   3339  H  HA   . HIS A 1 79  ? 6.657   3.108   -17.642 1.00 10.00 ? 79  HIS A HA   2  
ATOM   3340  H  HB2  . HIS A 1 79  ? 7.873   0.904   -19.361 1.00 10.00 ? 79  HIS A HB2  2  
ATOM   3341  H  HB3  . HIS A 1 79  ? 6.634   2.040   -19.886 1.00 10.00 ? 79  HIS A HB3  2  
ATOM   3342  H  HD2  . HIS A 1 79  ? 9.796   3.396   -17.970 1.00 10.00 ? 79  HIS A HD2  2  
ATOM   3343  H  HE1  . HIS A 1 79  ? 10.111  4.507   -22.052 1.00 10.00 ? 79  HIS A HE1  2  
ATOM   3344  H  HE2  . HIS A 1 79  ? 11.140  4.726   -19.733 1.00 10.00 ? 79  HIS A HE2  2  
ATOM   3345  N  N    . SER A 1 80  ? 5.278   1.244   -16.260 1.00 10.00 ? 80  SER A N    2  
ATOM   3346  C  CA   . SER A 1 80  ? 4.144   0.454   -15.790 1.00 10.00 ? 80  SER A CA   2  
ATOM   3347  C  C    . SER A 1 80  ? 3.556   1.113   -14.541 1.00 10.00 ? 80  SER A C    2  
ATOM   3348  O  O    . SER A 1 80  ? 2.378   1.457   -14.514 1.00 10.00 ? 80  SER A O    2  
ATOM   3349  C  CB   . SER A 1 80  ? 4.574   -0.990  -15.485 1.00 10.00 ? 80  SER A CB   2  
ATOM   3350  O  OG   . SER A 1 80  ? 4.759   -1.737  -16.671 1.00 10.00 ? 80  SER A OG   2  
ATOM   3351  H  H    . SER A 1 80  ? 5.676   1.936   -15.632 1.00 10.00 ? 80  SER A H    2  
ATOM   3352  H  HA   . SER A 1 80  ? 3.367   0.439   -16.556 1.00 10.00 ? 80  SER A HA   2  
ATOM   3353  H  HB2  . SER A 1 80  ? 5.498   -0.995  -14.903 1.00 10.00 ? 80  SER A HB2  2  
ATOM   3354  H  HB3  . SER A 1 80  ? 3.793   -1.482  -14.902 1.00 10.00 ? 80  SER A HB3  2  
ATOM   3355  H  HG   . SER A 1 80  ? 5.057   -1.148  -17.377 1.00 10.00 ? 80  SER A HG   2  
ATOM   3356  N  N    . GLY A 1 81  ? 4.385   1.277   -13.507 1.00 10.00 ? 81  GLY A N    2  
ATOM   3357  C  CA   . GLY A 1 81  ? 4.006   1.975   -12.290 1.00 10.00 ? 81  GLY A CA   2  
ATOM   3358  C  C    . GLY A 1 81  ? 4.459   3.427   -12.399 1.00 10.00 ? 81  GLY A C    2  
ATOM   3359  O  O    . GLY A 1 81  ? 3.758   4.269   -12.953 1.00 10.00 ? 81  GLY A O    2  
ATOM   3360  H  H    . GLY A 1 81  ? 5.352   1.000   -13.609 1.00 10.00 ? 81  GLY A H    2  
ATOM   3361  H  HA2  . GLY A 1 81  ? 2.940   1.891   -12.067 1.00 10.00 ? 81  GLY A HA2  2  
ATOM   3362  H  HA3  . GLY A 1 81  ? 4.522   1.515   -11.457 1.00 10.00 ? 81  GLY A HA3  2  
ATOM   3363  N  N    . GLY A 1 82  ? 5.657   3.704   -11.881 1.00 10.00 ? 82  GLY A N    2  
ATOM   3364  C  CA   . GLY A 1 82  ? 6.243   5.029   -11.838 1.00 10.00 ? 82  GLY A CA   2  
ATOM   3365  C  C    . GLY A 1 82  ? 7.214   5.229   -12.997 1.00 10.00 ? 82  GLY A C    2  
ATOM   3366  O  O    . GLY A 1 82  ? 8.384   4.850   -12.910 1.00 10.00 ? 82  GLY A O    2  
ATOM   3367  H  H    . GLY A 1 82  ? 6.198   2.958   -11.472 1.00 10.00 ? 82  GLY A H    2  
ATOM   3368  H  HA2  . GLY A 1 82  ? 5.475   5.804   -11.845 1.00 10.00 ? 82  GLY A HA2  2  
ATOM   3369  H  HA3  . GLY A 1 82  ? 6.795   5.112   -10.906 1.00 10.00 ? 82  GLY A HA3  2  
ATOM   3370  N  N    . MET A 1 83  ? 6.752   5.871   -14.071 1.00 10.00 ? 83  MET A N    2  
ATOM   3371  C  CA   . MET A 1 83  ? 7.605   6.299   -15.170 1.00 10.00 ? 83  MET A CA   2  
ATOM   3372  C  C    . MET A 1 83  ? 8.030   7.743   -14.947 1.00 10.00 ? 83  MET A C    2  
ATOM   3373  O  O    . MET A 1 83  ? 7.203   8.560   -14.551 1.00 10.00 ? 83  MET A O    2  
ATOM   3374  C  CB   . MET A 1 83  ? 6.834   6.226   -16.495 1.00 10.00 ? 83  MET A CB   2  
ATOM   3375  C  CG   . MET A 1 83  ? 7.697   5.707   -17.648 1.00 10.00 ? 83  MET A CG   2  
ATOM   3376  S  SD   . MET A 1 83  ? 9.020   6.773   -18.281 1.00 10.00 ? 83  MET A SD   2  
ATOM   3377  C  CE   . MET A 1 83  ? 8.055   8.114   -19.013 1.00 10.00 ? 83  MET A CE   2  
ATOM   3378  H  H    . MET A 1 83  ? 5.788   6.172   -14.077 1.00 10.00 ? 83  MET A H    2  
ATOM   3379  H  HA   . MET A 1 83  ? 8.481   5.651   -15.225 1.00 10.00 ? 83  MET A HA   2  
ATOM   3380  H  HB2  . MET A 1 83  ? 5.995   5.544   -16.382 1.00 10.00 ? 83  MET A HB2  2  
ATOM   3381  H  HB3  . MET A 1 83  ? 6.461   7.219   -16.748 1.00 10.00 ? 83  MET A HB3  2  
ATOM   3382  H  HG2  . MET A 1 83  ? 8.157   4.791   -17.296 1.00 10.00 ? 83  MET A HG2  2  
ATOM   3383  H  HG3  . MET A 1 83  ? 7.049   5.465   -18.490 1.00 10.00 ? 83  MET A HG3  2  
ATOM   3384  H  HE1  . MET A 1 83  ? 7.390   7.706   -19.772 1.00 10.00 ? 83  MET A HE1  2  
ATOM   3385  H  HE2  . MET A 1 83  ? 7.471   8.620   -18.246 1.00 10.00 ? 83  MET A HE2  2  
ATOM   3386  H  HE3  . MET A 1 83  ? 8.737   8.826   -19.476 1.00 10.00 ? 83  MET A HE3  2  
ATOM   3387  N  N    . ALA A 1 84  ? 9.287   8.043   -15.278 1.00 10.00 ? 84  ALA A N    2  
ATOM   3388  C  CA   . ALA A 1 84  ? 9.731   9.311   -15.840 1.00 10.00 ? 84  ALA A CA   2  
ATOM   3389  C  C    . ALA A 1 84  ? 11.253  9.368   -15.847 1.00 10.00 ? 84  ALA A C    2  
ATOM   3390  O  O    . ALA A 1 84  ? 11.856  10.223  -15.208 1.00 10.00 ? 84  ALA A O    2  
ATOM   3391  C  CB   . ALA A 1 84  ? 9.089   10.540  -15.195 1.00 10.00 ? 84  ALA A CB   2  
ATOM   3392  H  H    . ALA A 1 84  ? 9.903   7.262   -15.449 1.00 10.00 ? 84  ALA A H    2  
ATOM   3393  H  HA   . ALA A 1 84  ? 9.425   9.317   -16.882 1.00 10.00 ? 84  ALA A HA   2  
ATOM   3394  H  HB1  . ALA A 1 84  ? 8.035   10.590  -15.461 1.00 10.00 ? 84  ALA A HB1  2  
ATOM   3395  H  HB2  . ALA A 1 84  ? 9.203   10.506  -14.115 1.00 10.00 ? 84  ALA A HB2  2  
ATOM   3396  H  HB3  . ALA A 1 84  ? 9.563   11.433  -15.595 1.00 10.00 ? 84  ALA A HB3  2  
ATOM   3397  N  N    . GLY A 1 85  ? 11.864  8.454   -16.602 1.00 10.00 ? 85  GLY A N    2  
ATOM   3398  C  CA   . GLY A 1 85  ? 13.284  8.446   -16.919 1.00 10.00 ? 85  GLY A CA   2  
ATOM   3399  C  C    . GLY A 1 85  ? 14.208  8.738   -15.729 1.00 10.00 ? 85  GLY A C    2  
ATOM   3400  O  O    . GLY A 1 85  ? 15.219  9.416   -15.888 1.00 10.00 ? 85  GLY A O    2  
ATOM   3401  H  H    . GLY A 1 85  ? 11.290  7.776   -17.078 1.00 10.00 ? 85  GLY A H    2  
ATOM   3402  H  HA2  . GLY A 1 85  ? 13.496  7.457   -17.319 1.00 10.00 ? 85  GLY A HA2  2  
ATOM   3403  H  HA3  . GLY A 1 85  ? 13.472  9.183   -17.701 1.00 10.00 ? 85  GLY A HA3  2  
ATOM   3404  N  N    . MET A 1 86  ? 13.862  8.230   -14.544 1.00 10.00 ? 86  MET A N    2  
ATOM   3405  C  CA   . MET A 1 86  ? 14.616  8.390   -13.308 1.00 10.00 ? 86  MET A CA   2  
ATOM   3406  C  C    . MET A 1 86  ? 14.786  9.873   -12.935 1.00 10.00 ? 86  MET A C    2  
ATOM   3407  O  O    . MET A 1 86  ? 15.814  10.279  -12.398 1.00 10.00 ? 86  MET A O    2  
ATOM   3408  C  CB   . MET A 1 86  ? 15.942  7.599   -13.384 1.00 10.00 ? 86  MET A CB   2  
ATOM   3409  C  CG   . MET A 1 86  ? 16.165  6.656   -12.194 1.00 10.00 ? 86  MET A CG   2  
ATOM   3410  S  SD   . MET A 1 86  ? 17.887  6.221   -11.834 1.00 10.00 ? 86  MET A SD   2  
ATOM   3411  C  CE   . MET A 1 86  ? 18.393  5.497   -13.409 1.00 10.00 ? 86  MET A CE   2  
ATOM   3412  H  H    . MET A 1 86  ? 12.979  7.734   -14.482 1.00 10.00 ? 86  MET A H    2  
ATOM   3413  H  HA   . MET A 1 86  ? 13.997  7.953   -12.526 1.00 10.00 ? 86  MET A HA   2  
ATOM   3414  H  HB2  . MET A 1 86  ? 15.975  7.006   -14.297 1.00 10.00 ? 86  MET A HB2  2  
ATOM   3415  H  HB3  . MET A 1 86  ? 16.775  8.294   -13.411 1.00 10.00 ? 86  MET A HB3  2  
ATOM   3416  H  HG2  . MET A 1 86  ? 15.794  7.131   -11.298 1.00 10.00 ? 86  MET A HG2  2  
ATOM   3417  H  HG3  . MET A 1 86  ? 15.602  5.736   -12.335 1.00 10.00 ? 86  MET A HG3  2  
ATOM   3418  H  HE1  . MET A 1 86  ? 18.342  6.251   -14.192 1.00 10.00 ? 86  MET A HE1  2  
ATOM   3419  H  HE2  . MET A 1 86  ? 19.415  5.132   -13.321 1.00 10.00 ? 86  MET A HE2  2  
ATOM   3420  H  HE3  . MET A 1 86  ? 17.735  4.667   -13.655 1.00 10.00 ? 86  MET A HE3  2  
ATOM   3421  N  N    . LYS A 1 87  ? 13.752  10.683  -13.172 1.00 10.00 ? 87  LYS A N    2  
ATOM   3422  C  CA   . LYS A 1 87  ? 13.717  12.083  -12.757 1.00 10.00 ? 87  LYS A CA   2  
ATOM   3423  C  C    . LYS A 1 87  ? 13.043  12.225  -11.389 1.00 10.00 ? 87  LYS A C    2  
ATOM   3424  O  O    . LYS A 1 87  ? 12.314  11.334  -10.956 1.00 10.00 ? 87  LYS A O    2  
ATOM   3425  C  CB   . LYS A 1 87  ? 13.067  12.941  -13.853 1.00 10.00 ? 87  LYS A CB   2  
ATOM   3426  C  CG   . LYS A 1 87  ? 11.536  12.826  -13.969 1.00 10.00 ? 87  LYS A CG   2  
ATOM   3427  C  CD   . LYS A 1 87  ? 10.795  13.927  -13.196 1.00 10.00 ? 87  LYS A CD   2  
ATOM   3428  C  CE   . LYS A 1 87  ? 9.455   14.296  -13.844 1.00 10.00 ? 87  LYS A CE   2  
ATOM   3429  N  NZ   . LYS A 1 87  ? 9.629   15.104  -15.070 1.00 10.00 ? 87  LYS A NZ   2  
ATOM   3430  H  H    . LYS A 1 87  ? 12.957  10.300  -13.670 1.00 10.00 ? 87  LYS A H    2  
ATOM   3431  H  HA   . LYS A 1 87  ? 14.743  12.445  -12.660 1.00 10.00 ? 87  LYS A HA   2  
ATOM   3432  H  HB2  . LYS A 1 87  ? 13.352  13.983  -13.704 1.00 10.00 ? 87  LYS A HB2  2  
ATOM   3433  H  HB3  . LYS A 1 87  ? 13.503  12.627  -14.803 1.00 10.00 ? 87  LYS A HB3  2  
ATOM   3434  H  HG2  . LYS A 1 87  ? 11.294  12.873  -15.030 1.00 10.00 ? 87  LYS A HG2  2  
ATOM   3435  H  HG3  . LYS A 1 87  ? 11.186  11.858  -13.599 1.00 10.00 ? 87  LYS A HG3  2  
ATOM   3436  H  HD2  . LYS A 1 87  ? 10.594  13.533  -12.203 1.00 10.00 ? 87  LYS A HD2  2  
ATOM   3437  H  HD3  . LYS A 1 87  ? 11.405  14.825  -13.076 1.00 10.00 ? 87  LYS A HD3  2  
ATOM   3438  H  HE2  . LYS A 1 87  ? 8.901   13.385  -14.080 1.00 10.00 ? 87  LYS A HE2  2  
ATOM   3439  H  HE3  . LYS A 1 87  ? 8.874   14.878  -13.125 1.00 10.00 ? 87  LYS A HE3  2  
ATOM   3440  H  HZ1  . LYS A 1 87  ? 10.112  15.964  -14.851 1.00 10.00 ? 87  LYS A HZ1  2  
ATOM   3441  H  HZ2  . LYS A 1 87  ? 10.164  14.592  -15.757 1.00 10.00 ? 87  LYS A HZ2  2  
ATOM   3442  H  HZ3  . LYS A 1 87  ? 8.725   15.330  -15.463 1.00 10.00 ? 87  LYS A HZ3  2  
ATOM   3443  N  N    . MET A 1 88  ? 13.264  13.358  -10.717 1.00 10.00 ? 88  MET A N    2  
ATOM   3444  C  CA   . MET A 1 88  ? 12.684  13.644  -9.411  1.00 10.00 ? 88  MET A CA   2  
ATOM   3445  C  C    . MET A 1 88  ? 11.254  14.124  -9.653  1.00 10.00 ? 88  MET A C    2  
ATOM   3446  O  O    . MET A 1 88  ? 11.056  15.142  -10.316 1.00 10.00 ? 88  MET A O    2  
ATOM   3447  C  CB   . MET A 1 88  ? 13.522  14.734  -8.730  1.00 10.00 ? 88  MET A CB   2  
ATOM   3448  C  CG   . MET A 1 88  ? 12.970  15.117  -7.350  1.00 10.00 ? 88  MET A CG   2  
ATOM   3449  S  SD   . MET A 1 88  ? 13.839  16.471  -6.516  1.00 10.00 ? 88  MET A SD   2  
ATOM   3450  C  CE   . MET A 1 88  ? 13.433  17.867  -7.590  1.00 10.00 ? 88  MET A CE   2  
ATOM   3451  H  H    . MET A 1 88  ? 13.842  14.070  -11.136 1.00 10.00 ? 88  MET A H    2  
ATOM   3452  H  HA   . MET A 1 88  ? 12.691  12.747  -8.788  1.00 10.00 ? 88  MET A HA   2  
ATOM   3453  H  HB2  . MET A 1 88  ? 14.546  14.378  -8.607  1.00 10.00 ? 88  MET A HB2  2  
ATOM   3454  H  HB3  . MET A 1 88  ? 13.537  15.616  -9.370  1.00 10.00 ? 88  MET A HB3  2  
ATOM   3455  H  HG2  . MET A 1 88  ? 11.924  15.412  -7.425  1.00 10.00 ? 88  MET A HG2  2  
ATOM   3456  H  HG3  . MET A 1 88  ? 13.032  14.243  -6.702  1.00 10.00 ? 88  MET A HG3  2  
ATOM   3457  H  HE1  . MET A 1 88  ? 12.350  17.962  -7.667  1.00 10.00 ? 88  MET A HE1  2  
ATOM   3458  H  HE2  . MET A 1 88  ? 13.847  18.775  -7.154  1.00 10.00 ? 88  MET A HE2  2  
ATOM   3459  H  HE3  . MET A 1 88  ? 13.864  17.717  -8.577  1.00 10.00 ? 88  MET A HE3  2  
ATOM   3460  N  N    . VAL A 1 89  ? 10.262  13.359  -9.193  1.00 10.00 ? 89  VAL A N    2  
ATOM   3461  C  CA   . VAL A 1 89  ? 8.872   13.551  -9.597  1.00 10.00 ? 89  VAL A CA   2  
ATOM   3462  C  C    . VAL A 1 89  ? 8.048   14.306  -8.553  1.00 10.00 ? 89  VAL A C    2  
ATOM   3463  O  O    . VAL A 1 89  ? 8.479   14.427  -7.408  1.00 10.00 ? 89  VAL A O    2  
ATOM   3464  C  CB   . VAL A 1 89  ? 8.211   12.189  -9.887  1.00 10.00 ? 89  VAL A CB   2  
ATOM   3465  C  CG1  . VAL A 1 89  ? 8.615   11.680  -11.269 1.00 10.00 ? 89  VAL A CG1  2  
ATOM   3466  C  CG2  . VAL A 1 89  ? 8.515   11.147  -8.805  1.00 10.00 ? 89  VAL A CG2  2  
ATOM   3467  H  H    . VAL A 1 89  ? 10.486  12.580  -8.582  1.00 10.00 ? 89  VAL A H    2  
ATOM   3468  H  HA   . VAL A 1 89  ? 8.869   14.143  -10.510 1.00 10.00 ? 89  VAL A HA   2  
ATOM   3469  H  HB   . VAL A 1 89  ? 7.129   12.305  -9.914  1.00 10.00 ? 89  VAL A HB   2  
ATOM   3470  H  HG11 . VAL A 1 89  ? 9.684   11.477  -11.299 1.00 10.00 ? 89  VAL A HG11 2  
ATOM   3471  H  HG12 . VAL A 1 89  ? 8.058   10.774  -11.494 1.00 10.00 ? 89  VAL A HG12 2  
ATOM   3472  H  HG13 . VAL A 1 89  ? 8.360   12.421  -12.023 1.00 10.00 ? 89  VAL A HG13 2  
ATOM   3473  H  HG21 . VAL A 1 89  ? 8.407   11.584  -7.812  1.00 10.00 ? 89  VAL A HG21 2  
ATOM   3474  H  HG22 . VAL A 1 89  ? 7.814   10.321  -8.894  1.00 10.00 ? 89  VAL A HG22 2  
ATOM   3475  H  HG23 . VAL A 1 89  ? 9.525   10.761  -8.927  1.00 10.00 ? 89  VAL A HG23 2  
ATOM   3476  N  N    . PRO A 1 90  ? 6.823   14.733  -8.926  1.00 10.00 ? 90  PRO A N    2  
ATOM   3477  C  CA   . PRO A 1 90  ? 5.714   14.896  -7.992  1.00 10.00 ? 90  PRO A CA   2  
ATOM   3478  C  C    . PRO A 1 90  ? 5.712   13.805  -6.916  1.00 10.00 ? 90  PRO A C    2  
ATOM   3479  O  O    . PRO A 1 90  ? 5.757   14.116  -5.730  1.00 10.00 ? 90  PRO A O    2  
ATOM   3480  C  CB   . PRO A 1 90  ? 4.437   14.880  -8.851  1.00 10.00 ? 90  PRO A CB   2  
ATOM   3481  C  CG   . PRO A 1 90  ? 4.872   14.421  -10.238 1.00 10.00 ? 90  PRO A CG   2  
ATOM   3482  C  CD   . PRO A 1 90  ? 6.327   14.857  -10.293 1.00 10.00 ? 90  PRO A CD   2  
ATOM   3483  H  HA   . PRO A 1 90  ? 5.745   15.860  -7.489  1.00 10.00 ? 90  PRO A HA   2  
ATOM   3484  H  HB2  . PRO A 1 90  ? 3.680   14.194  -8.483  1.00 10.00 ? 90  PRO A HB2  2  
ATOM   3485  H  HB3  . PRO A 1 90  ? 4.027   15.889  -8.912  1.00 10.00 ? 90  PRO A HB3  2  
ATOM   3486  H  HG2  . PRO A 1 90  ? 4.813   13.333  -10.295 1.00 10.00 ? 90  PRO A HG2  2  
ATOM   3487  H  HG3  . PRO A 1 90  ? 4.271   14.870  -11.030 1.00 10.00 ? 90  PRO A HG3  2  
ATOM   3488  H  HD2  . PRO A 1 90  ? 6.832   14.260  -11.049 1.00 10.00 ? 90  PRO A HD2  2  
ATOM   3489  H  HD3  . PRO A 1 90  ? 6.377   15.909  -10.579 1.00 10.00 ? 90  PRO A HD3  2  
ATOM   3490  N  N    . TRP A 1 91  ? 5.643   12.543  -7.348  1.00 10.00 ? 91  TRP A N    2  
ATOM   3491  C  CA   . TRP A 1 91  ? 5.410   11.336  -6.579  1.00 10.00 ? 91  TRP A CA   2  
ATOM   3492  C  C    . TRP A 1 91  ? 5.096   10.256  -7.620  1.00 10.00 ? 91  TRP A C    2  
ATOM   3493  O  O    . TRP A 1 91  ? 5.234   10.521  -8.817  1.00 10.00 ? 91  TRP A O    2  
ATOM   3494  C  CB   . TRP A 1 91  ? 4.261   11.508  -5.568  1.00 10.00 ? 91  TRP A CB   2  
ATOM   3495  C  CG   . TRP A 1 91  ? 2.895   11.682  -6.143  1.00 10.00 ? 91  TRP A CG   2  
ATOM   3496  C  CD1  . TRP A 1 91  ? 2.066   10.663  -6.444  1.00 10.00 ? 91  TRP A CD1  2  
ATOM   3497  C  CD2  . TRP A 1 91  ? 2.167   12.897  -6.485  1.00 10.00 ? 91  TRP A CD2  2  
ATOM   3498  N  NE1  . TRP A 1 91  ? 0.974   11.146  -7.121  1.00 10.00 ? 91  TRP A NE1  2  
ATOM   3499  C  CE2  . TRP A 1 91  ? 0.979   12.519  -7.166  1.00 10.00 ? 91  TRP A CE2  2  
ATOM   3500  C  CE3  . TRP A 1 91  ? 2.388   14.278  -6.316  1.00 10.00 ? 91  TRP A CE3  2  
ATOM   3501  C  CZ2  . TRP A 1 91  ? 0.106   13.455  -7.721  1.00 10.00 ? 91  TRP A CZ2  2  
ATOM   3502  C  CZ3  . TRP A 1 91  ? 1.492   15.234  -6.831  1.00 10.00 ? 91  TRP A CZ3  2  
ATOM   3503  C  CH2  . TRP A 1 91  ? 0.360   14.822  -7.555  1.00 10.00 ? 91  TRP A CH2  2  
ATOM   3504  H  H    . TRP A 1 91  ? 5.747   12.337  -8.332  1.00 10.00 ? 91  TRP A H    2  
ATOM   3505  H  HA   . TRP A 1 91  ? 6.332   11.079  -6.064  1.00 10.00 ? 91  TRP A HA   2  
ATOM   3506  H  HB2  . TRP A 1 91  ? 4.215   10.613  -4.966  1.00 10.00 ? 91  TRP A HB2  2  
ATOM   3507  H  HB3  . TRP A 1 91  ? 4.469   12.323  -4.887  1.00 10.00 ? 91  TRP A HB3  2  
ATOM   3508  H  HD1  . TRP A 1 91  ? 2.277   9.625   -6.259  1.00 10.00 ? 91  TRP A HD1  2  
ATOM   3509  H  HE1  . TRP A 1 91  ? 0.292   10.534  -7.561  1.00 10.00 ? 91  TRP A HE1  2  
ATOM   3510  H  HE3  . TRP A 1 91  ? 3.283   14.592  -5.813  1.00 10.00 ? 91  TRP A HE3  2  
ATOM   3511  H  HZ2  . TRP A 1 91  ? -0.734  13.115  -8.287  1.00 10.00 ? 91  TRP A HZ2  2  
ATOM   3512  H  HZ3  . TRP A 1 91  ? 1.689   16.287  -6.691  1.00 10.00 ? 91  TRP A HZ3  2  
ATOM   3513  H  HH2  . TRP A 1 91  ? -0.319  15.541  -7.988  1.00 10.00 ? 91  TRP A HH2  2  
ATOM   3514  N  N    . LEU A 1 92  ? 4.640   9.076   -7.190  1.00 10.00 ? 92  LEU A N    2  
ATOM   3515  C  CA   . LEU A 1 92  ? 4.219   8.000   -8.080  1.00 10.00 ? 92  LEU A CA   2  
ATOM   3516  C  C    . LEU A 1 92  ? 2.754   7.614   -7.833  1.00 10.00 ? 92  LEU A C    2  
ATOM   3517  O  O    . LEU A 1 92  ? 2.406   7.023   -6.814  1.00 10.00 ? 92  LEU A O    2  
ATOM   3518  C  CB   . LEU A 1 92  ? 5.237   6.842   -8.077  1.00 10.00 ? 92  LEU A CB   2  
ATOM   3519  C  CG   . LEU A 1 92  ? 5.503   6.009   -6.806  1.00 10.00 ? 92  LEU A CG   2  
ATOM   3520  C  CD1  . LEU A 1 92  ? 5.493   6.790   -5.490  1.00 10.00 ? 92  LEU A CD1  2  
ATOM   3521  C  CD2  . LEU A 1 92  ? 4.620   4.763   -6.695  1.00 10.00 ? 92  LEU A CD2  2  
ATOM   3522  H  H    . LEU A 1 92  ? 4.503   8.944   -6.198  1.00 10.00 ? 92  LEU A H    2  
ATOM   3523  H  HA   . LEU A 1 92  ? 4.257   8.361   -9.110  1.00 10.00 ? 92  LEU A HA   2  
ATOM   3524  H  HB2  . LEU A 1 92  ? 4.978   6.160   -8.888  1.00 10.00 ? 92  LEU A HB2  2  
ATOM   3525  H  HB3  . LEU A 1 92  ? 6.194   7.292   -8.347  1.00 10.00 ? 92  LEU A HB3  2  
ATOM   3526  H  HG   . LEU A 1 92  ? 6.517   5.625   -6.920  1.00 10.00 ? 92  LEU A HG   2  
ATOM   3527  H  HD11 . LEU A 1 92  ? 6.150   7.653   -5.576  1.00 10.00 ? 92  LEU A HD11 2  
ATOM   3528  H  HD12 . LEU A 1 92  ? 4.484   7.111   -5.236  1.00 10.00 ? 92  LEU A HD12 2  
ATOM   3529  H  HD13 . LEU A 1 92  ? 5.864   6.147   -4.691  1.00 10.00 ? 92  LEU A HD13 2  
ATOM   3530  H  HD21 . LEU A 1 92  ? 5.087   4.089   -5.978  1.00 10.00 ? 92  LEU A HD21 2  
ATOM   3531  H  HD22 . LEU A 1 92  ? 3.620   5.003   -6.345  1.00 10.00 ? 92  LEU A HD22 2  
ATOM   3532  H  HD23 . LEU A 1 92  ? 4.558   4.260   -7.658  1.00 10.00 ? 92  LEU A HD23 2  
ATOM   3533  N  N    . THR A 1 93  ? 1.874   7.998   -8.762  1.00 10.00 ? 93  THR A N    2  
ATOM   3534  C  CA   . THR A 1 93  ? 0.533   7.435   -8.881  1.00 10.00 ? 93  THR A CA   2  
ATOM   3535  C  C    . THR A 1 93  ? 0.657   6.119   -9.649  1.00 10.00 ? 93  THR A C    2  
ATOM   3536  O  O    . THR A 1 93  ? 1.293   6.101   -10.701 1.00 10.00 ? 93  THR A O    2  
ATOM   3537  C  CB   . THR A 1 93  ? -0.373  8.417   -9.644  1.00 10.00 ? 93  THR A CB   2  
ATOM   3538  O  OG1  . THR A 1 93  ? -0.387  9.679   -9.008  1.00 10.00 ? 93  THR A OG1  2  
ATOM   3539  C  CG2  . THR A 1 93  ? -1.821  7.938   -9.787  1.00 10.00 ? 93  THR A CG2  2  
ATOM   3540  H  H    . THR A 1 93  ? 2.182   8.643   -9.476  1.00 10.00 ? 93  THR A H    2  
ATOM   3541  H  HA   . THR A 1 93  ? 0.117   7.242   -7.897  1.00 10.00 ? 93  THR A HA   2  
ATOM   3542  H  HB   . THR A 1 93  ? 0.034   8.545   -10.646 1.00 10.00 ? 93  THR A HB   2  
ATOM   3543  H  HG1  . THR A 1 93  ? -0.790  10.311  -9.612  1.00 10.00 ? 93  THR A HG1  2  
ATOM   3544  H  HG21 . THR A 1 93  ? -1.863  7.027   -10.384 1.00 10.00 ? 93  THR A HG21 2  
ATOM   3545  H  HG22 . THR A 1 93  ? -2.264  7.740   -8.812  1.00 10.00 ? 93  THR A HG22 2  
ATOM   3546  H  HG23 . THR A 1 93  ? -2.408  8.711   -10.285 1.00 10.00 ? 93  THR A HG23 2  
ATOM   3547  N  N    . ILE A 1 94  ? 0.061   5.034   -9.143  1.00 10.00 ? 94  ILE A N    2  
ATOM   3548  C  CA   . ILE A 1 94  ? 0.021   3.748   -9.833  1.00 10.00 ? 94  ILE A CA   2  
ATOM   3549  C  C    . ILE A 1 94  ? -1.404  3.527   -10.339 1.00 10.00 ? 94  ILE A C    2  
ATOM   3550  O  O    . ILE A 1 94  ? -2.355  3.746   -9.589  1.00 10.00 ? 94  ILE A O    2  
ATOM   3551  C  CB   . ILE A 1 94  ? 0.513   2.596   -8.933  1.00 10.00 ? 94  ILE A CB   2  
ATOM   3552  C  CG1  . ILE A 1 94  ? -0.306  2.422   -7.640  1.00 10.00 ? 94  ILE A CG1  2  
ATOM   3553  C  CG2  . ILE A 1 94  ? 1.988   2.833   -8.585  1.00 10.00 ? 94  ILE A CG2  2  
ATOM   3554  C  CD1  . ILE A 1 94  ? -1.299  1.262   -7.728  1.00 10.00 ? 94  ILE A CD1  2  
ATOM   3555  H  H    . ILE A 1 94  ? -0.545  5.141   -8.333  1.00 10.00 ? 94  ILE A H    2  
ATOM   3556  H  HA   . ILE A 1 94  ? 0.704   3.781   -10.679 1.00 10.00 ? 94  ILE A HA   2  
ATOM   3557  H  HB   . ILE A 1 94  ? 0.462   1.664   -9.505  1.00 10.00 ? 94  ILE A HB   2  
ATOM   3558  H  HG12 . ILE A 1 94  ? 0.364   2.213   -6.809  1.00 10.00 ? 94  ILE A HG12 2  
ATOM   3559  H  HG13 . ILE A 1 94  ? -0.850  3.329   -7.397  1.00 10.00 ? 94  ILE A HG13 2  
ATOM   3560  H  HG21 . ILE A 1 94  ? 2.565   2.997   -9.495  1.00 10.00 ? 94  ILE A HG21 2  
ATOM   3561  H  HG22 . ILE A 1 94  ? 2.087   3.705   -7.939  1.00 10.00 ? 94  ILE A HG22 2  
ATOM   3562  H  HG23 . ILE A 1 94  ? 2.391   1.960   -8.072  1.00 10.00 ? 94  ILE A HG23 2  
ATOM   3563  H  HD11 . ILE A 1 94  ? -0.757  0.319   -7.735  1.00 10.00 ? 94  ILE A HD11 2  
ATOM   3564  H  HD12 . ILE A 1 94  ? -1.941  1.288   -6.851  1.00 10.00 ? 94  ILE A HD12 2  
ATOM   3565  H  HD13 . ILE A 1 94  ? -1.917  1.338   -8.622  1.00 10.00 ? 94  ILE A HD13 2  
ATOM   3566  N  N    . PRO A 1 95  ? -1.591  3.141   -11.608 1.00 10.00 ? 95  PRO A N    2  
ATOM   3567  C  CA   . PRO A 1 95  ? -2.918  2.926   -12.141 1.00 10.00 ? 95  PRO A CA   2  
ATOM   3568  C  C    . PRO A 1 95  ? -3.487  1.614   -11.602 1.00 10.00 ? 95  PRO A C    2  
ATOM   3569  O  O    . PRO A 1 95  ? -2.783  0.605   -11.554 1.00 10.00 ? 95  PRO A O    2  
ATOM   3570  C  CB   . PRO A 1 95  ? -2.735  2.883   -13.660 1.00 10.00 ? 95  PRO A CB   2  
ATOM   3571  C  CG   . PRO A 1 95  ? -1.320  2.325   -13.826 1.00 10.00 ? 95  PRO A CG   2  
ATOM   3572  C  CD   . PRO A 1 95  ? -0.574  2.902   -12.622 1.00 10.00 ? 95  PRO A CD   2  
ATOM   3573  H  HA   . PRO A 1 95  ? -3.579  3.753   -11.878 1.00 10.00 ? 95  PRO A HA   2  
ATOM   3574  H  HB2  . PRO A 1 95  ? -3.488  2.266   -14.152 1.00 10.00 ? 95  PRO A HB2  2  
ATOM   3575  H  HB3  . PRO A 1 95  ? -2.766  3.899   -14.055 1.00 10.00 ? 95  PRO A HB3  2  
ATOM   3576  H  HG2  . PRO A 1 95  ? -1.347  1.237   -13.748 1.00 10.00 ? 95  PRO A HG2  2  
ATOM   3577  H  HG3  . PRO A 1 95  ? -0.864  2.618   -14.773 1.00 10.00 ? 95  PRO A HG3  2  
ATOM   3578  H  HD2  . PRO A 1 95  ? 0.185   2.194   -12.287 1.00 10.00 ? 95  PRO A HD2  2  
ATOM   3579  H  HD3  . PRO A 1 95  ? -0.109  3.849   -12.903 1.00 10.00 ? 95  PRO A HD3  2  
ATOM   3580  N  N    . ALA A 1 96  ? -4.780  1.623   -11.265 1.00 10.00 ? 96  ALA A N    2  
ATOM   3581  C  CA   . ALA A 1 96  ? -5.584  0.415   -11.155 1.00 10.00 ? 96  ALA A CA   2  
ATOM   3582  C  C    . ALA A 1 96  ? -5.025  -0.565  -10.112 1.00 10.00 ? 96  ALA A C    2  
ATOM   3583  O  O    . ALA A 1 96  ? -4.351  -0.157  -9.162  1.00 10.00 ? 96  ALA A O    2  
ATOM   3584  C  CB   . ALA A 1 96  ? -5.649  -0.206  -12.557 1.00 10.00 ? 96  ALA A CB   2  
ATOM   3585  H  H    . ALA A 1 96  ? -5.269  2.503   -11.251 1.00 10.00 ? 96  ALA A H    2  
ATOM   3586  H  HA   . ALA A 1 96  ? -6.589  0.715   -10.857 1.00 10.00 ? 96  ALA A HA   2  
ATOM   3587  H  HB1  . ALA A 1 96  ? -4.686  -0.642  -12.821 1.00 10.00 ? 96  ALA A HB1  2  
ATOM   3588  H  HB2  . ALA A 1 96  ? -6.394  -0.987  -12.603 1.00 10.00 ? 96  ALA A HB2  2  
ATOM   3589  H  HB3  . ALA A 1 96  ? -5.920  0.555   -13.287 1.00 10.00 ? 96  ALA A HB3  2  
ATOM   3590  N  N    . ARG A 1 97  ? -5.271  -1.866  -10.303 1.00 10.00 ? 97  ARG A N    2  
ATOM   3591  C  CA   . ARG A 1 97  ? -4.643  -2.959  -9.566  1.00 10.00 ? 97  ARG A CA   2  
ATOM   3592  C  C    . ARG A 1 97  ? -3.121  -3.072  -9.803  1.00 10.00 ? 97  ARG A C    2  
ATOM   3593  O  O    . ARG A 1 97  ? -2.610  -4.153  -10.089 1.00 10.00 ? 97  ARG A O    2  
ATOM   3594  C  CB   . ARG A 1 97  ? -5.394  -4.269  -9.875  1.00 10.00 ? 97  ARG A CB   2  
ATOM   3595  C  CG   . ARG A 1 97  ? -5.470  -4.590  -11.381 1.00 10.00 ? 97  ARG A CG   2  
ATOM   3596  C  CD   . ARG A 1 97  ? -4.767  -5.896  -11.762 1.00 10.00 ? 97  ARG A CD   2  
ATOM   3597  N  NE   . ARG A 1 97  ? -5.502  -7.059  -11.245 1.00 10.00 ? 97  ARG A NE   2  
ATOM   3598  C  CZ   . ARG A 1 97  ? -5.144  -8.336  -11.445 1.00 10.00 ? 97  ARG A CZ   2  
ATOM   3599  N  NH1  . ARG A 1 97  ? -4.002  -8.611  -12.084 1.00 10.00 ? 97  ARG A NH1  2  
ATOM   3600  N  NH2  . ARG A 1 97  ? -5.930  -9.328  -11.011 1.00 10.00 ? 97  ARG A NH2  2  
ATOM   3601  H  H    . ARG A 1 97  ? -6.034  -2.121  -10.939 1.00 10.00 ? 97  ARG A H    2  
ATOM   3602  H  HA   . ARG A 1 97  ? -4.788  -2.762  -8.509  1.00 10.00 ? 97  ARG A HA   2  
ATOM   3603  H  HB2  . ARG A 1 97  ? -4.931  -5.090  -9.327  1.00 10.00 ? 97  ARG A HB2  2  
ATOM   3604  H  HB3  . ARG A 1 97  ? -6.415  -4.155  -9.505  1.00 10.00 ? 97  ARG A HB3  2  
ATOM   3605  H  HG2  . ARG A 1 97  ? -6.516  -4.671  -11.677 1.00 10.00 ? 97  ARG A HG2  2  
ATOM   3606  H  HG3  . ARG A 1 97  ? -5.038  -3.772  -11.956 1.00 10.00 ? 97  ARG A HG3  2  
ATOM   3607  H  HD2  . ARG A 1 97  ? -4.738  -5.944  -12.853 1.00 10.00 ? 97  ARG A HD2  2  
ATOM   3608  H  HD3  . ARG A 1 97  ? -3.745  -5.881  -11.381 1.00 10.00 ? 97  ARG A HD3  2  
ATOM   3609  H  HE   . ARG A 1 97  ? -6.357  -6.849  -10.748 1.00 10.00 ? 97  ARG A HE   2  
ATOM   3610  H  HH11 . ARG A 1 97  ? -3.423  -7.846  -12.398 1.00 10.00 ? 97  ARG A HH11 2  
ATOM   3611  H  HH12 . ARG A 1 97  ? -3.698  -9.556  -12.263 1.00 10.00 ? 97  ARG A HH12 2  
ATOM   3612  H  HH21 . ARG A 1 97  ? -6.807  -9.121  -10.556 1.00 10.00 ? 97  ARG A HH21 2  
ATOM   3613  H  HH22 . ARG A 1 97  ? -5.685  -10.296 -11.164 1.00 10.00 ? 97  ARG A HH22 2  
ATOM   3614  N  N    . GLY A 1 98  ? -2.377  -1.974  -9.652  1.00 10.00 ? 98  GLY A N    2  
ATOM   3615  C  CA   . GLY A 1 98  ? -0.929  -1.941  -9.739  1.00 10.00 ? 98  GLY A CA   2  
ATOM   3616  C  C    . GLY A 1 98  ? -0.276  -2.793  -8.656  1.00 10.00 ? 98  GLY A C    2  
ATOM   3617  O  O    . GLY A 1 98  ? -0.810  -2.977  -7.560  1.00 10.00 ? 98  GLY A O    2  
ATOM   3618  H  H    . GLY A 1 98  ? -2.838  -1.101  -9.440  1.00 10.00 ? 98  GLY A H    2  
ATOM   3619  H  HA2  . GLY A 1 98  ? -0.579  -2.265  -10.715 1.00 10.00 ? 98  GLY A HA2  2  
ATOM   3620  H  HA3  . GLY A 1 98  ? -0.603  -0.910  -9.615  1.00 10.00 ? 98  GLY A HA3  2  
ATOM   3621  N  N    . THR A 1 99  ? 0.934   -3.264  -8.950  1.00 10.00 ? 99  THR A N    2  
ATOM   3622  C  CA   . THR A 1 99  ? 1.839   -3.762  -7.939  1.00 10.00 ? 99  THR A CA   2  
ATOM   3623  C  C    . THR A 1 99  ? 3.269   -3.436  -8.368  1.00 10.00 ? 99  THR A C    2  
ATOM   3624  O  O    . THR A 1 99  ? 3.895   -4.160  -9.135  1.00 10.00 ? 99  THR A O    2  
ATOM   3625  C  CB   . THR A 1 99  ? 1.546   -5.225  -7.561  1.00 10.00 ? 99  THR A CB   2  
ATOM   3626  O  OG1  . THR A 1 99  ? 2.350   -5.630  -6.468  1.00 10.00 ? 99  THR A OG1  2  
ATOM   3627  C  CG2  . THR A 1 99  ? 1.691   -6.229  -8.708  1.00 10.00 ? 99  THR A CG2  2  
ATOM   3628  H  H    . THR A 1 99  ? 1.329   -3.066  -9.854  1.00 10.00 ? 99  THR A H    2  
ATOM   3629  H  HA   . THR A 1 99  ? 1.622   -3.155  -7.068  1.00 10.00 ? 99  THR A HA   2  
ATOM   3630  H  HB   . THR A 1 99  ? 0.507   -5.264  -7.233  1.00 10.00 ? 99  THR A HB   2  
ATOM   3631  H  HG1  . THR A 1 99  ? 2.642   -4.842  -5.988  1.00 10.00 ? 99  THR A HG1  2  
ATOM   3632  H  HG21 . THR A 1 99  ? 1.103   -5.908  -9.568  1.00 10.00 ? 99  THR A HG21 2  
ATOM   3633  H  HG22 . THR A 1 99  ? 2.735   -6.334  -9.001  1.00 10.00 ? 99  THR A HG22 2  
ATOM   3634  H  HG23 . THR A 1 99  ? 1.329   -7.203  -8.377  1.00 10.00 ? 99  THR A HG23 2  
ATOM   3635  N  N    . LEU A 1 100 ? 3.734   -2.265  -7.935  1.00 10.00 ? 100 LEU A N    2  
ATOM   3636  C  CA   . LEU A 1 100 ? 5.050   -1.744  -8.274  1.00 10.00 ? 100 LEU A CA   2  
ATOM   3637  C  C    . LEU A 1 100 ? 6.105   -2.306  -7.321  1.00 10.00 ? 100 LEU A C    2  
ATOM   3638  O  O    . LEU A 1 100 ? 5.772   -2.772  -6.235  1.00 10.00 ? 100 LEU A O    2  
ATOM   3639  C  CB   . LEU A 1 100 ? 4.990   -0.212  -8.245  1.00 10.00 ? 100 LEU A CB   2  
ATOM   3640  C  CG   . LEU A 1 100 ? 6.173   0.479   -8.934  1.00 10.00 ? 100 LEU A CG   2  
ATOM   3641  C  CD1  . LEU A 1 100 ? 6.343   -0.038  -10.368 1.00 10.00 ? 100 LEU A CD1  2  
ATOM   3642  C  CD2  . LEU A 1 100 ? 5.916   1.988   -8.910  1.00 10.00 ? 100 LEU A CD2  2  
ATOM   3643  H  H    . LEU A 1 100 ? 3.142   -1.739  -7.310  1.00 10.00 ? 100 LEU A H    2  
ATOM   3644  H  HA   . LEU A 1 100 ? 5.288   -2.085  -9.281  1.00 10.00 ? 100 LEU A HA   2  
ATOM   3645  H  HB2  . LEU A 1 100 ? 4.078   0.099   -8.756  1.00 10.00 ? 100 LEU A HB2  2  
ATOM   3646  H  HB3  . LEU A 1 100 ? 4.939   0.133   -7.214  1.00 10.00 ? 100 LEU A HB3  2  
ATOM   3647  H  HG   . LEU A 1 100 ? 7.098   0.311   -8.382  1.00 10.00 ? 100 LEU A HG   2  
ATOM   3648  H  HD11 . LEU A 1 100 ? 7.031   -0.884  -10.385 1.00 10.00 ? 100 LEU A HD11 2  
ATOM   3649  H  HD12 . LEU A 1 100 ? 5.389   -0.360  -10.784 1.00 10.00 ? 100 LEU A HD12 2  
ATOM   3650  H  HD13 . LEU A 1 100 ? 6.744   0.750   -10.995 1.00 10.00 ? 100 LEU A HD13 2  
ATOM   3651  H  HD21 . LEU A 1 100 ? 5.954   2.338   -7.878  1.00 10.00 ? 100 LEU A HD21 2  
ATOM   3652  H  HD22 . LEU A 1 100 ? 6.686   2.504   -9.477  1.00 10.00 ? 100 LEU A HD22 2  
ATOM   3653  H  HD23 . LEU A 1 100 ? 4.941   2.228   -9.329  1.00 10.00 ? 100 LEU A HD23 2  
ATOM   3654  N  N    . THR A 1 101 ? 7.376   -2.251  -7.716  1.00 10.00 ? 101 THR A N    2  
ATOM   3655  C  CA   . THR A 1 101 ? 8.491   -2.872  -7.022  1.00 10.00 ? 101 THR A CA   2  
ATOM   3656  C  C    . THR A 1 101 ? 9.555   -1.796  -6.896  1.00 10.00 ? 101 THR A C    2  
ATOM   3657  O  O    . THR A 1 101 ? 10.263  -1.507  -7.857  1.00 10.00 ? 101 THR A O    2  
ATOM   3658  C  CB   . THR A 1 101 ? 8.977   -4.092  -7.817  1.00 10.00 ? 101 THR A CB   2  
ATOM   3659  O  OG1  . THR A 1 101 ? 7.892   -4.977  -8.010  1.00 10.00 ? 101 THR A OG1  2  
ATOM   3660  C  CG2  . THR A 1 101 ? 10.097  -4.836  -7.083  1.00 10.00 ? 101 THR A CG2  2  
ATOM   3661  H  H    . THR A 1 101 ? 7.616   -1.688  -8.517  1.00 10.00 ? 101 THR A H    2  
ATOM   3662  H  HA   . THR A 1 101 ? 8.198   -3.210  -6.029  1.00 10.00 ? 101 THR A HA   2  
ATOM   3663  H  HB   . THR A 1 101 ? 9.343   -3.776  -8.795  1.00 10.00 ? 101 THR A HB   2  
ATOM   3664  H  HG1  . THR A 1 101 ? 7.452   -5.114  -7.166  1.00 10.00 ? 101 THR A HG1  2  
ATOM   3665  H  HG21 . THR A 1 101 ? 10.969  -4.190  -6.968  1.00 10.00 ? 101 THR A HG21 2  
ATOM   3666  H  HG22 . THR A 1 101 ? 9.756   -5.158  -6.099  1.00 10.00 ? 101 THR A HG22 2  
ATOM   3667  H  HG23 . THR A 1 101 ? 10.387  -5.713  -7.663  1.00 10.00 ? 101 THR A HG23 2  
ATOM   3668  N  N    . LEU A 1 102 ? 9.624   -1.178  -5.722  1.00 10.00 ? 102 LEU A N    2  
ATOM   3669  C  CA   . LEU A 1 102 ? 10.425  0.002   -5.502  1.00 10.00 ? 102 LEU A CA   2  
ATOM   3670  C  C    . LEU A 1 102 ? 11.852  -0.471  -5.261  1.00 10.00 ? 102 LEU A C    2  
ATOM   3671  O  O    . LEU A 1 102 ? 12.072  -1.309  -4.386  1.00 10.00 ? 102 LEU A O    2  
ATOM   3672  C  CB   . LEU A 1 102 ? 9.872   0.800   -4.314  1.00 10.00 ? 102 LEU A CB   2  
ATOM   3673  C  CG   . LEU A 1 102 ? 8.518   1.459   -4.639  1.00 10.00 ? 102 LEU A CG   2  
ATOM   3674  C  CD1  . LEU A 1 102 ? 7.319   0.532   -4.399  1.00 10.00 ? 102 LEU A CD1  2  
ATOM   3675  C  CD2  . LEU A 1 102 ? 8.342   2.729   -3.801  1.00 10.00 ? 102 LEU A CD2  2  
ATOM   3676  H  H    . LEU A 1 102 ? 9.128   -1.563  -4.931  1.00 10.00 ? 102 LEU A H    2  
ATOM   3677  H  HA   . LEU A 1 102 ? 10.374  0.626   -6.391  1.00 10.00 ? 102 LEU A HA   2  
ATOM   3678  H  HB2  . LEU A 1 102 ? 9.779   0.161   -3.438  1.00 10.00 ? 102 LEU A HB2  2  
ATOM   3679  H  HB3  . LEU A 1 102 ? 10.597  1.578   -4.079  1.00 10.00 ? 102 LEU A HB3  2  
ATOM   3680  H  HG   . LEU A 1 102 ? 8.509   1.754   -5.686  1.00 10.00 ? 102 LEU A HG   2  
ATOM   3681  H  HD11 . LEU A 1 102 ? 7.356   -0.341  -5.046  1.00 10.00 ? 102 LEU A HD11 2  
ATOM   3682  H  HD12 . LEU A 1 102 ? 7.288   0.212   -3.357  1.00 10.00 ? 102 LEU A HD12 2  
ATOM   3683  H  HD13 . LEU A 1 102 ? 6.406   1.075   -4.639  1.00 10.00 ? 102 LEU A HD13 2  
ATOM   3684  H  HD21 . LEU A 1 102 ? 7.369   3.178   -4.005  1.00 10.00 ? 102 LEU A HD21 2  
ATOM   3685  H  HD22 . LEU A 1 102 ? 8.414   2.491   -2.741  1.00 10.00 ? 102 LEU A HD22 2  
ATOM   3686  H  HD23 . LEU A 1 102 ? 9.114   3.452   -4.063  1.00 10.00 ? 102 LEU A HD23 2  
ATOM   3687  N  N    . GLN A 1 103 ? 12.795  0.011   -6.072  1.00 10.00 ? 103 GLN A N    2  
ATOM   3688  C  CA   . GLN A 1 103 ? 14.168  -0.463  -6.128  1.00 10.00 ? 103 GLN A CA   2  
ATOM   3689  C  C    . GLN A 1 103 ? 15.052  0.653   -6.671  1.00 10.00 ? 103 GLN A C    2  
ATOM   3690  O  O    . GLN A 1 103 ? 14.572  1.506   -7.412  1.00 10.00 ? 103 GLN A O    2  
ATOM   3691  C  CB   . GLN A 1 103 ? 14.236  -1.686  -7.047  1.00 10.00 ? 103 GLN A CB   2  
ATOM   3692  C  CG   . GLN A 1 103 ? 14.002  -1.283  -8.511  1.00 10.00 ? 103 GLN A CG   2  
ATOM   3693  C  CD   . GLN A 1 103 ? 13.573  -2.479  -9.334  1.00 10.00 ? 103 GLN A CD   2  
ATOM   3694  O  OE1  . GLN A 1 103 ? 14.398  -3.191  -9.896  1.00 10.00 ? 103 GLN A OE1  2  
ATOM   3695  N  NE2  . GLN A 1 103 ? 12.272  -2.722  -9.394  1.00 10.00 ? 103 GLN A NE2  2  
ATOM   3696  H  H    . GLN A 1 103 ? 12.537  0.725   -6.752  1.00 10.00 ? 103 GLN A H    2  
ATOM   3697  H  HA   . GLN A 1 103 ? 14.496  -0.731  -5.124  1.00 10.00 ? 103 GLN A HA   2  
ATOM   3698  H  HB2  . GLN A 1 103 ? 15.214  -2.162  -6.964  1.00 10.00 ? 103 GLN A HB2  2  
ATOM   3699  H  HB3  . GLN A 1 103 ? 13.476  -2.404  -6.732  1.00 10.00 ? 103 GLN A HB3  2  
ATOM   3700  H  HG2  . GLN A 1 103 ? 13.220  -0.527  -8.588  1.00 10.00 ? 103 GLN A HG2  2  
ATOM   3701  H  HG3  . GLN A 1 103 ? 14.920  -0.876  -8.938  1.00 10.00 ? 103 GLN A HG3  2  
ATOM   3702  H  HE21 . GLN A 1 103 ? 11.602  -2.107  -8.931  1.00 10.00 ? 103 GLN A HE21 2  
ATOM   3703  H  HE22 . GLN A 1 103 ? 11.971  -3.511  -9.930  1.00 10.00 ? 103 GLN A HE22 2  
ATOM   3704  N  N    . ARG A 1 104 ? 16.342  0.644   -6.335  1.00 10.00 ? 104 ARG A N    2  
ATOM   3705  C  CA   . ARG A 1 104 ? 17.259  1.739   -6.662  1.00 10.00 ? 104 ARG A CA   2  
ATOM   3706  C  C    . ARG A 1 104 ? 17.545  1.780   -8.171  1.00 10.00 ? 104 ARG A C    2  
ATOM   3707  O  O    . ARG A 1 104 ? 18.624  1.392   -8.614  1.00 10.00 ? 104 ARG A O    2  
ATOM   3708  C  CB   . ARG A 1 104 ? 18.526  1.643   -5.794  1.00 10.00 ? 104 ARG A CB   2  
ATOM   3709  C  CG   . ARG A 1 104 ? 19.340  2.943   -5.676  1.00 10.00 ? 104 ARG A CG   2  
ATOM   3710  C  CD   . ARG A 1 104 ? 20.022  3.349   -6.989  1.00 10.00 ? 104 ARG A CD   2  
ATOM   3711  N  NE   . ARG A 1 104 ? 21.007  4.423   -6.801  1.00 10.00 ? 104 ARG A NE   2  
ATOM   3712  C  CZ   . ARG A 1 104 ? 21.739  4.939   -7.804  1.00 10.00 ? 104 ARG A CZ   2  
ATOM   3713  N  NH1  . ARG A 1 104 ? 21.577  4.471   -9.048  1.00 10.00 ? 104 ARG A NH1  2  
ATOM   3714  N  NH2  . ARG A 1 104 ? 22.622  5.914   -7.559  1.00 10.00 ? 104 ARG A NH2  2  
ATOM   3715  H  H    . ARG A 1 104 ? 16.669  -0.158  -5.819  1.00 10.00 ? 104 ARG A H    2  
ATOM   3716  H  HA   . ARG A 1 104 ? 16.762  2.671   -6.386  1.00 10.00 ? 104 ARG A HA   2  
ATOM   3717  H  HB2  . ARG A 1 104 ? 18.206  1.403   -4.782  1.00 10.00 ? 104 ARG A HB2  2  
ATOM   3718  H  HB3  . ARG A 1 104 ? 19.164  0.834   -6.150  1.00 10.00 ? 104 ARG A HB3  2  
ATOM   3719  H  HG2  . ARG A 1 104 ? 18.691  3.749   -5.327  1.00 10.00 ? 104 ARG A HG2  2  
ATOM   3720  H  HG3  . ARG A 1 104 ? 20.110  2.769   -4.923  1.00 10.00 ? 104 ARG A HG3  2  
ATOM   3721  H  HD2  . ARG A 1 104 ? 20.529  2.470   -7.394  1.00 10.00 ? 104 ARG A HD2  2  
ATOM   3722  H  HD3  . ARG A 1 104 ? 19.264  3.699   -7.690  1.00 10.00 ? 104 ARG A HD3  2  
ATOM   3723  H  HE   . ARG A 1 104 ? 21.133  4.768   -5.859  1.00 10.00 ? 104 ARG A HE   2  
ATOM   3724  H  HH11 . ARG A 1 104 ? 20.912  3.727   -9.215  1.00 10.00 ? 104 ARG A HH11 2  
ATOM   3725  H  HH12 . ARG A 1 104 ? 22.104  4.827   -9.831  1.00 10.00 ? 104 ARG A HH12 2  
ATOM   3726  H  HH21 . ARG A 1 104 ? 22.750  6.273   -6.623  1.00 10.00 ? 104 ARG A HH21 2  
ATOM   3727  H  HH22 . ARG A 1 104 ? 23.177  6.315   -8.301  1.00 10.00 ? 104 ARG A HH22 2  
ATOM   3728  N  N    . ASP A 1 105 ? 16.567  2.295   -8.919  1.00 10.00 ? 105 ASP A N    2  
ATOM   3729  C  CA   . ASP A 1 105 ? 16.449  2.437   -10.362 1.00 10.00 ? 105 ASP A CA   2  
ATOM   3730  C  C    . ASP A 1 105 ? 14.944  2.501   -10.665 1.00 10.00 ? 105 ASP A C    2  
ATOM   3731  O  O    . ASP A 1 105 ? 14.351  3.577   -10.558 1.00 10.00 ? 105 ASP A O    2  
ATOM   3732  C  CB   . ASP A 1 105 ? 17.171  1.316   -11.126 1.00 10.00 ? 105 ASP A CB   2  
ATOM   3733  C  CG   . ASP A 1 105 ? 16.779  1.317   -12.592 1.00 10.00 ? 105 ASP A CG   2  
ATOM   3734  O  OD1  . ASP A 1 105 ? 17.162  2.284   -13.282 1.00 10.00 ? 105 ASP A OD1  2  
ATOM   3735  O  OD2  . ASP A 1 105 ? 16.045  0.377   -12.962 1.00 10.00 ? 105 ASP A OD2  2  
ATOM   3736  H  H    . ASP A 1 105 ? 15.713  2.491   -8.410  1.00 10.00 ? 105 ASP A H    2  
ATOM   3737  H  HA   . ASP A 1 105 ? 16.891  3.389   -10.660 1.00 10.00 ? 105 ASP A HA   2  
ATOM   3738  H  HB2  . ASP A 1 105 ? 18.248  1.471   -11.080 1.00 10.00 ? 105 ASP A HB2  2  
ATOM   3739  H  HB3  . ASP A 1 105 ? 16.942  0.341   -10.693 1.00 10.00 ? 105 ASP A HB3  2  
ATOM   3740  N  N    . GLY A 1 106 ? 14.328  1.360   -10.990 1.00 10.00 ? 106 GLY A N    2  
ATOM   3741  C  CA   . GLY A 1 106 ? 12.984  1.222   -11.534 1.00 10.00 ? 106 GLY A CA   2  
ATOM   3742  C  C    . GLY A 1 106 ? 11.881  1.588   -10.552 1.00 10.00 ? 106 GLY A C    2  
ATOM   3743  O  O    . GLY A 1 106 ? 11.152  0.720   -10.082 1.00 10.00 ? 106 GLY A O    2  
ATOM   3744  H  H    . GLY A 1 106 ? 14.935  0.570   -11.152 1.00 10.00 ? 106 GLY A H    2  
ATOM   3745  H  HA2  . GLY A 1 106 ? 12.891  1.877   -12.396 1.00 10.00 ? 106 GLY A HA2  2  
ATOM   3746  H  HA3  . GLY A 1 106 ? 12.847  0.192   -11.864 1.00 10.00 ? 106 GLY A HA3  2  
ATOM   3747  N  N    . ASP A 1 107 ? 11.760  2.897   -10.322 1.00 10.00 ? 107 ASP A N    2  
ATOM   3748  C  CA   . ASP A 1 107 ? 10.916  3.559   -9.343  1.00 10.00 ? 107 ASP A CA   2  
ATOM   3749  C  C    . ASP A 1 107 ? 11.377  3.257   -7.925  1.00 10.00 ? 107 ASP A C    2  
ATOM   3750  O  O    . ASP A 1 107 ? 11.747  2.130   -7.609  1.00 10.00 ? 107 ASP A O    2  
ATOM   3751  C  CB   . ASP A 1 107 ? 9.420   3.304   -9.540  1.00 10.00 ? 107 ASP A CB   2  
ATOM   3752  C  CG   . ASP A 1 107 ? 8.618   4.066   -8.497  1.00 10.00 ? 107 ASP A CG   2  
ATOM   3753  O  OD1  . ASP A 1 107 ? 8.468   3.531   -7.381  1.00 10.00 ? 107 ASP A OD1  2  
ATOM   3754  O  OD2  . ASP A 1 107 ? 8.164   5.174   -8.842  1.00 10.00 ? 107 ASP A OD2  2  
ATOM   3755  H  H    . ASP A 1 107 ? 12.524  3.444   -10.698 1.00 10.00 ? 107 ASP A H    2  
ATOM   3756  H  HA   . ASP A 1 107 ? 11.094  4.611   -9.513  1.00 10.00 ? 107 ASP A HA   2  
ATOM   3757  H  HB2  . ASP A 1 107 ? 9.108   3.654   -10.521 1.00 10.00 ? 107 ASP A HB2  2  
ATOM   3758  H  HB3  . ASP A 1 107 ? 9.200   2.242   -9.434  1.00 10.00 ? 107 ASP A HB3  2  
ATOM   3759  N  N    . HIS A 1 108 ? 11.444  4.292   -7.090  1.00 10.00 ? 108 HIS A N    2  
ATOM   3760  C  CA   . HIS A 1 108 ? 11.867  4.159   -5.713  1.00 10.00 ? 108 HIS A CA   2  
ATOM   3761  C  C    . HIS A 1 108 ? 11.625  5.436   -4.915  1.00 10.00 ? 108 HIS A C    2  
ATOM   3762  O  O    . HIS A 1 108 ? 11.356  6.505   -5.468  1.00 10.00 ? 108 HIS A O    2  
ATOM   3763  C  CB   . HIS A 1 108 ? 13.357  3.802   -5.646  1.00 10.00 ? 108 HIS A CB   2  
ATOM   3764  C  CG   . HIS A 1 108 ? 14.254  4.636   -6.540  1.00 10.00 ? 108 HIS A CG   2  
ATOM   3765  N  ND1  . HIS A 1 108 ? 14.328  4.628   -7.921  1.00 10.00 ? 108 HIS A ND1  2  
ATOM   3766  C  CD2  . HIS A 1 108 ? 15.176  5.541   -6.092  1.00 10.00 ? 108 HIS A CD2  2  
ATOM   3767  C  CE1  . HIS A 1 108 ? 15.291  5.490   -8.278  1.00 10.00 ? 108 HIS A CE1  2  
ATOM   3768  N  NE2  . HIS A 1 108 ? 15.823  6.103   -7.202  1.00 10.00 ? 108 HIS A NE2  2  
ATOM   3769  H  H    . HIS A 1 108 ? 11.140  5.205   -7.416  1.00 10.00 ? 108 HIS A H    2  
ATOM   3770  H  HA   . HIS A 1 108 ? 11.270  3.342   -5.293  1.00 10.00 ? 108 HIS A HA   2  
ATOM   3771  H  HB2  . HIS A 1 108 ? 13.717  3.891   -4.621  1.00 10.00 ? 108 HIS A HB2  2  
ATOM   3772  H  HB3  . HIS A 1 108 ? 13.444  2.754   -5.880  1.00 10.00 ? 108 HIS A HB3  2  
ATOM   3773  H  HD1  . HIS A 1 108 ? 13.772  4.104   -8.592  1.00 10.00 ? 108 HIS A HD1  2  
ATOM   3774  H  HD2  . HIS A 1 108 ? 15.365  5.771   -5.055  1.00 10.00 ? 108 HIS A HD2  2  
ATOM   3775  H  HE1  . HIS A 1 108 ? 15.579  5.677   -9.301  1.00 10.00 ? 108 HIS A HE1  2  
ATOM   3776  N  N    . VAL A 1 109 ? 11.823  5.317   -3.600  1.00 10.00 ? 109 VAL A N    2  
ATOM   3777  C  CA   . VAL A 1 109 ? 11.905  6.437   -2.690  1.00 10.00 ? 109 VAL A CA   2  
ATOM   3778  C  C    . VAL A 1 109 ? 13.393  6.649   -2.473  1.00 10.00 ? 109 VAL A C    2  
ATOM   3779  O  O    . VAL A 1 109 ? 14.038  5.747   -1.940  1.00 10.00 ? 109 VAL A O    2  
ATOM   3780  C  CB   . VAL A 1 109 ? 11.214  6.091   -1.357  1.00 10.00 ? 109 VAL A CB   2  
ATOM   3781  C  CG1  . VAL A 1 109 ? 11.069  7.352   -0.501  1.00 10.00 ? 109 VAL A CG1  2  
ATOM   3782  C  CG2  . VAL A 1 109 ? 9.849   5.414   -1.538  1.00 10.00 ? 109 VAL A CG2  2  
ATOM   3783  H  H    . VAL A 1 109 ? 12.202  4.449   -3.239  1.00 10.00 ? 109 VAL A H    2  
ATOM   3784  H  HA   . VAL A 1 109 ? 11.464  7.332   -3.121  1.00 10.00 ? 109 VAL A HA   2  
ATOM   3785  H  HB   . VAL A 1 109 ? 11.836  5.391   -0.798  1.00 10.00 ? 109 VAL A HB   2  
ATOM   3786  H  HG11 . VAL A 1 109 ? 10.706  7.064   0.483   1.00 10.00 ? 109 VAL A HG11 2  
ATOM   3787  H  HG12 . VAL A 1 109 ? 12.033  7.844   -0.380  1.00 10.00 ? 109 VAL A HG12 2  
ATOM   3788  H  HG13 . VAL A 1 109 ? 10.366  8.047   -0.960  1.00 10.00 ? 109 VAL A HG13 2  
ATOM   3789  H  HG21 . VAL A 1 109 ? 9.213   5.994   -2.202  1.00 10.00 ? 109 VAL A HG21 2  
ATOM   3790  H  HG22 . VAL A 1 109 ? 9.983   4.417   -1.955  1.00 10.00 ? 109 VAL A HG22 2  
ATOM   3791  H  HG23 . VAL A 1 109 ? 9.356   5.314   -0.570  1.00 10.00 ? 109 VAL A HG23 2  
ATOM   3792  N  N    . MET A 1 110 ? 13.945  7.798   -2.867  1.00 10.00 ? 110 MET A N    2  
ATOM   3793  C  CA   . MET A 1 110 ? 15.254  8.171   -2.373  1.00 10.00 ? 110 MET A CA   2  
ATOM   3794  C  C    . MET A 1 110 ? 15.075  8.810   -1.014  1.00 10.00 ? 110 MET A C    2  
ATOM   3795  O  O    . MET A 1 110 ? 14.119  9.533   -0.747  1.00 10.00 ? 110 MET A O    2  
ATOM   3796  C  CB   . MET A 1 110 ? 16.020  9.143   -3.262  1.00 10.00 ? 110 MET A CB   2  
ATOM   3797  C  CG   . MET A 1 110 ? 16.190  8.568   -4.657  1.00 10.00 ? 110 MET A CG   2  
ATOM   3798  S  SD   . MET A 1 110 ? 17.274  9.504   -5.750  1.00 10.00 ? 110 MET A SD   2  
ATOM   3799  C  CE   . MET A 1 110 ? 16.505  11.136  -5.660  1.00 10.00 ? 110 MET A CE   2  
ATOM   3800  H  H    . MET A 1 110 ? 13.369  8.535   -3.256  1.00 10.00 ? 110 MET A H    2  
ATOM   3801  H  HA   . MET A 1 110 ? 15.876  7.280   -2.300  1.00 10.00 ? 110 MET A HA   2  
ATOM   3802  H  HB2  . MET A 1 110 ? 15.520  10.106  -3.277  1.00 10.00 ? 110 MET A HB2  2  
ATOM   3803  H  HB3  . MET A 1 110 ? 17.013  9.289   -2.835  1.00 10.00 ? 110 MET A HB3  2  
ATOM   3804  H  HG2  . MET A 1 110 ? 16.626  7.575   -4.561  1.00 10.00 ? 110 MET A HG2  2  
ATOM   3805  H  HG3  . MET A 1 110 ? 15.203  8.493   -5.114  1.00 10.00 ? 110 MET A HG3  2  
ATOM   3806  H  HE1  . MET A 1 110 ? 15.443  11.072  -5.892  1.00 10.00 ? 110 MET A HE1  2  
ATOM   3807  H  HE2  . MET A 1 110 ? 16.634  11.528  -4.651  1.00 10.00 ? 110 MET A HE2  2  
ATOM   3808  H  HE3  . MET A 1 110 ? 17.005  11.807  -6.356  1.00 10.00 ? 110 MET A HE3  2  
ATOM   3809  N  N    . LEU A 1 111 ? 16.059  8.520   -0.190  1.00 10.00 ? 111 LEU A N    2  
ATOM   3810  C  CA   . LEU A 1 111 ? 16.293  9.037   1.133   1.00 10.00 ? 111 LEU A CA   2  
ATOM   3811  C  C    . LEU A 1 111 ? 17.662  9.711   1.062   1.00 10.00 ? 111 LEU A C    2  
ATOM   3812  O  O    . LEU A 1 111 ? 18.672  9.120   1.443   1.00 10.00 ? 111 LEU A O    2  
ATOM   3813  C  CB   . LEU A 1 111 ? 16.254  7.854   2.110   1.00 10.00 ? 111 LEU A CB   2  
ATOM   3814  C  CG   . LEU A 1 111 ? 14.910  7.101   2.111   1.00 10.00 ? 111 LEU A CG   2  
ATOM   3815  C  CD1  . LEU A 1 111 ? 14.975  5.977   3.148   1.00 10.00 ? 111 LEU A CD1  2  
ATOM   3816  C  CD2  . LEU A 1 111 ? 13.720  8.017   2.421   1.00 10.00 ? 111 LEU A CD2  2  
ATOM   3817  H  H    . LEU A 1 111 ? 16.767  7.937   -0.608  1.00 10.00 ? 111 LEU A H    2  
ATOM   3818  H  HA   . LEU A 1 111 ? 15.548  9.780   1.416   1.00 10.00 ? 111 LEU A HA   2  
ATOM   3819  H  HB2  . LEU A 1 111 ? 17.022  7.145   1.808   1.00 10.00 ? 111 LEU A HB2  2  
ATOM   3820  H  HB3  . LEU A 1 111 ? 16.489  8.198   3.115   1.00 10.00 ? 111 LEU A HB3  2  
ATOM   3821  H  HG   . LEU A 1 111 ? 14.746  6.640   1.135   1.00 10.00 ? 111 LEU A HG   2  
ATOM   3822  H  HD11 . LEU A 1 111 ? 14.048  5.403   3.128   1.00 10.00 ? 111 LEU A HD11 2  
ATOM   3823  H  HD12 . LEU A 1 111 ? 15.805  5.313   2.911   1.00 10.00 ? 111 LEU A HD12 2  
ATOM   3824  H  HD13 . LEU A 1 111 ? 15.119  6.390   4.146   1.00 10.00 ? 111 LEU A HD13 2  
ATOM   3825  H  HD21 . LEU A 1 111 ? 13.934  8.617   3.301   1.00 10.00 ? 111 LEU A HD21 2  
ATOM   3826  H  HD22 . LEU A 1 111 ? 13.520  8.682   1.584   1.00 10.00 ? 111 LEU A HD22 2  
ATOM   3827  H  HD23 . LEU A 1 111 ? 12.826  7.419   2.599   1.00 10.00 ? 111 LEU A HD23 2  
ATOM   3828  N  N    . MET A 1 112 ? 17.707  10.926  0.507   1.00 10.00 ? 112 MET A N    2  
ATOM   3829  C  CA   . MET A 1 112 ? 18.952  11.665  0.375   1.00 10.00 ? 112 MET A CA   2  
ATOM   3830  C  C    . MET A 1 112 ? 19.244  12.397  1.685   1.00 10.00 ? 112 MET A C    2  
ATOM   3831  O  O    . MET A 1 112 ? 18.336  12.717  2.461   1.00 10.00 ? 112 MET A O    2  
ATOM   3832  C  CB   . MET A 1 112 ? 18.886  12.626  -0.823  1.00 10.00 ? 112 MET A CB   2  
ATOM   3833  C  CG   . MET A 1 112 ? 19.244  11.934  -2.137  1.00 10.00 ? 112 MET A CG   2  
ATOM   3834  S  SD   . MET A 1 112 ? 19.033  12.957  -3.613  1.00 10.00 ? 112 MET A SD   2  
ATOM   3835  C  CE   . MET A 1 112 ? 20.039  12.004  -4.771  1.00 10.00 ? 112 MET A CE   2  
ATOM   3836  H  H    . MET A 1 112 ? 16.850  11.408  0.253   1.00 10.00 ? 112 MET A H    2  
ATOM   3837  H  HA   . MET A 1 112 ? 19.768  10.973  0.185   1.00 10.00 ? 112 MET A HA   2  
ATOM   3838  H  HB2  . MET A 1 112 ? 17.893  13.047  -0.928  1.00 10.00 ? 112 MET A HB2  2  
ATOM   3839  H  HB3  . MET A 1 112 ? 19.600  13.439  -0.681  1.00 10.00 ? 112 MET A HB3  2  
ATOM   3840  H  HG2  . MET A 1 112 ? 20.293  11.672  -2.091  1.00 10.00 ? 112 MET A HG2  2  
ATOM   3841  H  HG3  . MET A 1 112 ? 18.659  11.023  -2.255  1.00 10.00 ? 112 MET A HG3  2  
ATOM   3842  H  HE1  . MET A 1 112 ? 19.990  12.469  -5.754  1.00 10.00 ? 112 MET A HE1  2  
ATOM   3843  H  HE2  . MET A 1 112 ? 21.072  11.999  -4.423  1.00 10.00 ? 112 MET A HE2  2  
ATOM   3844  H  HE3  . MET A 1 112 ? 19.667  10.983  -4.823  1.00 10.00 ? 112 MET A HE3  2  
ATOM   3845  N  N    . GLY A 1 113 ? 20.523  12.670  1.931   1.00 10.00 ? 113 GLY A N    2  
ATOM   3846  C  CA   . GLY A 1 113 ? 20.969  13.413  3.094   1.00 10.00 ? 113 GLY A CA   2  
ATOM   3847  C  C    . GLY A 1 113 ? 20.627  12.655  4.372   1.00 10.00 ? 113 GLY A C    2  
ATOM   3848  O  O    . GLY A 1 113 ? 19.956  13.194  5.254   1.00 10.00 ? 113 GLY A O    2  
ATOM   3849  H  H    . GLY A 1 113 ? 21.224  12.361  1.250   1.00 10.00 ? 113 GLY A H    2  
ATOM   3850  H  HA2  . GLY A 1 113 ? 22.043  13.570  3.025   1.00 10.00 ? 113 GLY A HA2  2  
ATOM   3851  H  HA3  . GLY A 1 113 ? 20.484  14.387  3.107   1.00 10.00 ? 113 GLY A HA3  2  
ATOM   3852  N  N    . LEU A 1 114 ? 21.062  11.397  4.467   1.00 10.00 ? 114 LEU A N    2  
ATOM   3853  C  CA   . LEU A 1 114 ? 20.824  10.564  5.634   1.00 10.00 ? 114 LEU A CA   2  
ATOM   3854  C  C    . LEU A 1 114 ? 21.476  11.205  6.862   1.00 10.00 ? 114 LEU A C    2  
ATOM   3855  O  O    . LEU A 1 114 ? 22.554  11.793  6.763   1.00 10.00 ? 114 LEU A O    2  
ATOM   3856  C  CB   . LEU A 1 114 ? 21.345  9.143   5.378   1.00 10.00 ? 114 LEU A CB   2  
ATOM   3857  C  CG   . LEU A 1 114 ? 20.607  8.070   6.192   1.00 10.00 ? 114 LEU A CG   2  
ATOM   3858  C  CD1  . LEU A 1 114 ? 19.217  7.804   5.598   1.00 10.00 ? 114 LEU A CD1  2  
ATOM   3859  C  CD2  . LEU A 1 114 ? 21.418  6.770   6.163   1.00 10.00 ? 114 LEU A CD2  2  
ATOM   3860  H  H    . LEU A 1 114 ? 21.576  11.007  3.695   1.00 10.00 ? 114 LEU A H    2  
ATOM   3861  H  HA   . LEU A 1 114 ? 19.749  10.526  5.784   1.00 10.00 ? 114 LEU A HA   2  
ATOM   3862  H  HB2  . LEU A 1 114 ? 21.232  8.899   4.321   1.00 10.00 ? 114 LEU A HB2  2  
ATOM   3863  H  HB3  . LEU A 1 114 ? 22.405  9.108   5.623   1.00 10.00 ? 114 LEU A HB3  2  
ATOM   3864  H  HG   . LEU A 1 114 ? 20.508  8.384   7.232   1.00 10.00 ? 114 LEU A HG   2  
ATOM   3865  H  HD11 . LEU A 1 114 ? 19.294  7.644   4.526   1.00 10.00 ? 114 LEU A HD11 2  
ATOM   3866  H  HD12 . LEU A 1 114 ? 18.788  6.910   6.047   1.00 10.00 ? 114 LEU A HD12 2  
ATOM   3867  H  HD13 . LEU A 1 114 ? 18.549  8.646   5.774   1.00 10.00 ? 114 LEU A HD13 2  
ATOM   3868  H  HD21 . LEU A 1 114 ? 20.898  5.994   6.725   1.00 10.00 ? 114 LEU A HD21 2  
ATOM   3869  H  HD22 . LEU A 1 114 ? 21.554  6.437   5.133   1.00 10.00 ? 114 LEU A HD22 2  
ATOM   3870  H  HD23 . LEU A 1 114 ? 22.394  6.937   6.620   1.00 10.00 ? 114 LEU A HD23 2  
ATOM   3871  N  N    . LYS A 1 115 ? 20.805  11.125  8.010   1.00 10.00 ? 115 LYS A N    2  
ATOM   3872  C  CA   . LYS A 1 115 ? 21.126  11.869  9.216   1.00 10.00 ? 115 LYS A CA   2  
ATOM   3873  C  C    . LYS A 1 115 ? 21.799  10.938  10.225  1.00 10.00 ? 115 LYS A C    2  
ATOM   3874  O  O    . LYS A 1 115 ? 22.980  11.120  10.533  1.00 10.00 ? 115 LYS A O    2  
ATOM   3875  C  CB   . LYS A 1 115 ? 19.841  12.519  9.758   1.00 10.00 ? 115 LYS A CB   2  
ATOM   3876  C  CG   . LYS A 1 115 ? 19.295  13.543  8.746   1.00 10.00 ? 115 LYS A CG   2  
ATOM   3877  C  CD   . LYS A 1 115 ? 17.798  13.838  8.911   1.00 10.00 ? 115 LYS A CD   2  
ATOM   3878  C  CE   . LYS A 1 115 ? 17.402  14.420  10.270  1.00 10.00 ? 115 LYS A CE   2  
ATOM   3879  N  NZ   . LYS A 1 115 ? 17.999  15.753  10.491  1.00 10.00 ? 115 LYS A NZ   2  
ATOM   3880  H  H    . LYS A 1 115 ? 19.902  10.665  7.978   1.00 10.00 ? 115 LYS A H    2  
ATOM   3881  H  HA   . LYS A 1 115 ? 21.824  12.676  8.986   1.00 10.00 ? 115 LYS A HA   2  
ATOM   3882  H  HB2  . LYS A 1 115 ? 19.093  11.745  9.938   1.00 10.00 ? 115 LYS A HB2  2  
ATOM   3883  H  HB3  . LYS A 1 115 ? 20.057  13.021  10.702  1.00 10.00 ? 115 LYS A HB3  2  
ATOM   3884  H  HG2  . LYS A 1 115 ? 19.890  14.456  8.779   1.00 10.00 ? 115 LYS A HG2  2  
ATOM   3885  H  HG3  . LYS A 1 115 ? 19.390  13.139  7.739   1.00 10.00 ? 115 LYS A HG3  2  
ATOM   3886  H  HD2  . LYS A 1 115 ? 17.492  14.513  8.111   1.00 10.00 ? 115 LYS A HD2  2  
ATOM   3887  H  HD3  . LYS A 1 115 ? 17.250  12.910  8.767   1.00 10.00 ? 115 LYS A HD3  2  
ATOM   3888  H  HE2  . LYS A 1 115 ? 16.312  14.505  10.293  1.00 10.00 ? 115 LYS A HE2  2  
ATOM   3889  H  HE3  . LYS A 1 115 ? 17.698  13.729  11.062  1.00 10.00 ? 115 LYS A HE3  2  
ATOM   3890  H  HZ1  . LYS A 1 115 ? 19.006  15.682  10.505  1.00 10.00 ? 115 LYS A HZ1  2  
ATOM   3891  H  HZ2  . LYS A 1 115 ? 17.727  16.380  9.746   1.00 10.00 ? 115 LYS A HZ2  2  
ATOM   3892  H  HZ3  . LYS A 1 115 ? 17.682  16.134  11.372  1.00 10.00 ? 115 LYS A HZ3  2  
ATOM   3893  N  N    . ARG A 1 116 ? 21.069  9.931   10.718  1.00 10.00 ? 116 ARG A N    2  
ATOM   3894  C  CA   . ARG A 1 116 ? 21.586  9.026   11.743  1.00 10.00 ? 116 ARG A CA   2  
ATOM   3895  C  C    . ARG A 1 116 ? 22.847  8.303   11.250  1.00 10.00 ? 116 ARG A C    2  
ATOM   3896  O  O    . ARG A 1 116 ? 22.977  8.040   10.054  1.00 10.00 ? 116 ARG A O    2  
ATOM   3897  C  CB   . ARG A 1 116 ? 20.542  7.966   12.139  1.00 10.00 ? 116 ARG A CB   2  
ATOM   3898  C  CG   . ARG A 1 116 ? 19.315  8.532   12.865  1.00 10.00 ? 116 ARG A CG   2  
ATOM   3899  C  CD   . ARG A 1 116 ? 18.416  7.385   13.360  1.00 10.00 ? 116 ARG A CD   2  
ATOM   3900  N  NE   . ARG A 1 116 ? 17.156  7.898   13.922  1.00 10.00 ? 116 ARG A NE   2  
ATOM   3901  C  CZ   . ARG A 1 116 ? 16.248  7.167   14.593  1.00 10.00 ? 116 ARG A CZ   2  
ATOM   3902  N  NH1  . ARG A 1 116 ? 16.358  5.839   14.679  1.00 10.00 ? 116 ARG A NH1  2  
ATOM   3903  N  NH2  . ARG A 1 116 ? 15.222  7.781   15.192  1.00 10.00 ? 116 ARG A NH2  2  
ATOM   3904  H  H    . ARG A 1 116 ? 20.147  9.776   10.337  1.00 10.00 ? 116 ARG A H    2  
ATOM   3905  H  HA   . ARG A 1 116 ? 21.822  9.638   12.614  1.00 10.00 ? 116 ARG A HA   2  
ATOM   3906  H  HB2  . ARG A 1 116 ? 20.232  7.422   11.247  1.00 10.00 ? 116 ARG A HB2  2  
ATOM   3907  H  HB3  . ARG A 1 116 ? 21.020  7.250   12.810  1.00 10.00 ? 116 ARG A HB3  2  
ATOM   3908  H  HG2  . ARG A 1 116 ? 19.645  9.120   13.724  1.00 10.00 ? 116 ARG A HG2  2  
ATOM   3909  H  HG3  . ARG A 1 116 ? 18.757  9.183   12.191  1.00 10.00 ? 116 ARG A HG3  2  
ATOM   3910  H  HD2  . ARG A 1 116 ? 18.188  6.703   12.539  1.00 10.00 ? 116 ARG A HD2  2  
ATOM   3911  H  HD3  . ARG A 1 116 ? 18.952  6.815   14.124  1.00 10.00 ? 116 ARG A HD3  2  
ATOM   3912  H  HE   . ARG A 1 116 ? 16.973  8.881   13.775  1.00 10.00 ? 116 ARG A HE   2  
ATOM   3913  H  HH11 . ARG A 1 116 ? 17.085  5.328   14.164  1.00 10.00 ? 116 ARG A HH11 2  
ATOM   3914  H  HH12 . ARG A 1 116 ? 15.694  5.258   15.165  1.00 10.00 ? 116 ARG A HH12 2  
ATOM   3915  H  HH21 . ARG A 1 116 ? 15.125  8.785   15.141  1.00 10.00 ? 116 ARG A HH21 2  
ATOM   3916  H  HH22 . ARG A 1 116 ? 14.544  7.256   15.724  1.00 10.00 ? 116 ARG A HH22 2  
ATOM   3917  N  N    . PRO A 1 117 ? 23.773  7.938   12.151  1.00 10.00 ? 117 PRO A N    2  
ATOM   3918  C  CA   . PRO A 1 117 ? 24.745  6.900   11.864  1.00 10.00 ? 117 PRO A CA   2  
ATOM   3919  C  C    . PRO A 1 117 ? 23.975  5.582   11.732  1.00 10.00 ? 117 PRO A C    2  
ATOM   3920  O  O    . PRO A 1 117 ? 23.528  5.023   12.732  1.00 10.00 ? 117 PRO A O    2  
ATOM   3921  C  CB   . PRO A 1 117 ? 25.711  6.909   13.051  1.00 10.00 ? 117 PRO A CB   2  
ATOM   3922  C  CG   . PRO A 1 117 ? 24.847  7.397   14.216  1.00 10.00 ? 117 PRO A CG   2  
ATOM   3923  C  CD   . PRO A 1 117 ? 23.832  8.331   13.552  1.00 10.00 ? 117 PRO A CD   2  
ATOM   3924  H  HA   . PRO A 1 117 ? 25.298  7.103   10.947  1.00 10.00 ? 117 PRO A HA   2  
ATOM   3925  H  HB2  . PRO A 1 117 ? 26.150  5.929   13.241  1.00 10.00 ? 117 PRO A HB2  2  
ATOM   3926  H  HB3  . PRO A 1 117 ? 26.500  7.640   12.865  1.00 10.00 ? 117 PRO A HB3  2  
ATOM   3927  H  HG2  . PRO A 1 117 ? 24.322  6.550   14.659  1.00 10.00 ? 117 PRO A HG2  2  
ATOM   3928  H  HG3  . PRO A 1 117 ? 25.437  7.906   14.979  1.00 10.00 ? 117 PRO A HG3  2  
ATOM   3929  H  HD2  . PRO A 1 117 ? 22.871  8.231   14.059  1.00 10.00 ? 117 PRO A HD2  2  
ATOM   3930  H  HD3  . PRO A 1 117 ? 24.183  9.362   13.619  1.00 10.00 ? 117 PRO A HD3  2  
ATOM   3931  N  N    . LEU A 1 118 ? 23.769  5.128   10.493  1.00 10.00 ? 118 LEU A N    2  
ATOM   3932  C  CA   . LEU A 1 118 ? 22.963  3.958   10.188  1.00 10.00 ? 118 LEU A CA   2  
ATOM   3933  C  C    . LEU A 1 118 ? 23.413  2.709   10.943  1.00 10.00 ? 118 LEU A C    2  
ATOM   3934  O  O    . LEU A 1 118 ? 24.551  2.619   11.406  1.00 10.00 ? 118 LEU A O    2  
ATOM   3935  C  CB   . LEU A 1 118 ? 22.918  3.730   8.669   1.00 10.00 ? 118 LEU A CB   2  
ATOM   3936  C  CG   . LEU A 1 118 ? 24.204  3.249   7.964   1.00 10.00 ? 118 LEU A CG   2  
ATOM   3937  C  CD1  . LEU A 1 118 ? 25.433  4.137   8.194   1.00 10.00 ? 118 LEU A CD1  2  
ATOM   3938  C  CD2  . LEU A 1 118 ? 24.556  1.775   8.211   1.00 10.00 ? 118 LEU A CD2  2  
ATOM   3939  H  H    . LEU A 1 118 ? 24.122  5.652   9.707   1.00 10.00 ? 118 LEU A H    2  
ATOM   3940  H  HA   . LEU A 1 118 ? 21.946  4.192   10.512  1.00 10.00 ? 118 LEU A HA   2  
ATOM   3941  H  HB2  . LEU A 1 118 ? 22.135  3.002   8.457   1.00 10.00 ? 118 LEU A HB2  2  
ATOM   3942  H  HB3  . LEU A 1 118 ? 22.614  4.669   8.204   1.00 10.00 ? 118 LEU A HB3  2  
ATOM   3943  H  HG   . LEU A 1 118 ? 23.972  3.323   6.908   1.00 10.00 ? 118 LEU A HG   2  
ATOM   3944  H  HD11 . LEU A 1 118 ? 25.188  5.177   7.980   1.00 10.00 ? 118 LEU A HD11 2  
ATOM   3945  H  HD12 . LEU A 1 118 ? 25.789  4.043   9.220   1.00 10.00 ? 118 LEU A HD12 2  
ATOM   3946  H  HD13 . LEU A 1 118 ? 26.232  3.824   7.522   1.00 10.00 ? 118 LEU A HD13 2  
ATOM   3947  H  HD21 . LEU A 1 118 ? 23.657  1.160   8.184   1.00 10.00 ? 118 LEU A HD21 2  
ATOM   3948  H  HD22 . LEU A 1 118 ? 25.237  1.437   7.429   1.00 10.00 ? 118 LEU A HD22 2  
ATOM   3949  H  HD23 . LEU A 1 118 ? 25.061  1.639   9.164   1.00 10.00 ? 118 LEU A HD23 2  
ATOM   3950  N  N    . LYS A 1 119 ? 22.515  1.726   11.025  1.00 10.00 ? 119 LYS A N    2  
ATOM   3951  C  CA   . LYS A 1 119 ? 22.784  0.400   11.547  1.00 10.00 ? 119 LYS A CA   2  
ATOM   3952  C  C    . LYS A 1 119 ? 22.193  -0.601  10.560  1.00 10.00 ? 119 LYS A C    2  
ATOM   3953  O  O    . LYS A 1 119 ? 21.029  -0.483  10.188  1.00 10.00 ? 119 LYS A O    2  
ATOM   3954  C  CB   . LYS A 1 119 ? 22.143  0.243   12.939  1.00 10.00 ? 119 LYS A CB   2  
ATOM   3955  C  CG   . LYS A 1 119 ? 23.153  0.019   14.072  1.00 10.00 ? 119 LYS A CG   2  
ATOM   3956  C  CD   . LYS A 1 119 ? 24.100  1.214   14.240  1.00 10.00 ? 119 LYS A CD   2  
ATOM   3957  C  CE   . LYS A 1 119 ? 24.910  1.090   15.537  1.00 10.00 ? 119 LYS A CE   2  
ATOM   3958  N  NZ   . LYS A 1 119 ? 25.860  2.211   15.689  1.00 10.00 ? 119 LYS A NZ   2  
ATOM   3959  H  H    . LYS A 1 119 ? 21.602  1.856   10.609  1.00 10.00 ? 119 LYS A H    2  
ATOM   3960  H  HA   . LYS A 1 119 ? 23.860  0.230   11.587  1.00 10.00 ? 119 LYS A HA   2  
ATOM   3961  H  HB2  . LYS A 1 119 ? 21.543  1.123   13.177  1.00 10.00 ? 119 LYS A HB2  2  
ATOM   3962  H  HB3  . LYS A 1 119 ? 21.467  -0.615  12.934  1.00 10.00 ? 119 LYS A HB3  2  
ATOM   3963  H  HG2  . LYS A 1 119 ? 22.581  -0.122  14.991  1.00 10.00 ? 119 LYS A HG2  2  
ATOM   3964  H  HG3  . LYS A 1 119 ? 23.722  -0.892  13.878  1.00 10.00 ? 119 LYS A HG3  2  
ATOM   3965  H  HD2  . LYS A 1 119 ? 24.789  1.240   13.396  1.00 10.00 ? 119 LYS A HD2  2  
ATOM   3966  H  HD3  . LYS A 1 119 ? 23.514  2.137   14.246  1.00 10.00 ? 119 LYS A HD3  2  
ATOM   3967  H  HE2  . LYS A 1 119 ? 24.228  1.080   16.390  1.00 10.00 ? 119 LYS A HE2  2  
ATOM   3968  H  HE3  . LYS A 1 119 ? 25.465  0.150   15.525  1.00 10.00 ? 119 LYS A HE3  2  
ATOM   3969  H  HZ1  . LYS A 1 119 ? 26.506  2.225   14.911  1.00 10.00 ? 119 LYS A HZ1  2  
ATOM   3970  H  HZ2  . LYS A 1 119 ? 25.359  3.088   15.714  1.00 10.00 ? 119 LYS A HZ2  2  
ATOM   3971  H  HZ3  . LYS A 1 119 ? 26.382  2.104   16.548  1.00 10.00 ? 119 LYS A HZ3  2  
ATOM   3972  N  N    . VAL A 1 120 ? 22.995  -1.583  10.149  1.00 10.00 ? 120 VAL A N    2  
ATOM   3973  C  CA   . VAL A 1 120 ? 22.518  -2.753  9.433   1.00 10.00 ? 120 VAL A CA   2  
ATOM   3974  C  C    . VAL A 1 120 ? 21.628  -3.529  10.408  1.00 10.00 ? 120 VAL A C    2  
ATOM   3975  O  O    . VAL A 1 120 ? 22.133  -4.289  11.231  1.00 10.00 ? 120 VAL A O    2  
ATOM   3976  C  CB   . VAL A 1 120 ? 23.714  -3.581  8.924   1.00 10.00 ? 120 VAL A CB   2  
ATOM   3977  C  CG1  . VAL A 1 120 ? 23.243  -4.827  8.160   1.00 10.00 ? 120 VAL A CG1  2  
ATOM   3978  C  CG2  . VAL A 1 120 ? 24.596  -2.742  7.988   1.00 10.00 ? 120 VAL A CG2  2  
ATOM   3979  H  H    . VAL A 1 120 ? 23.940  -1.599  10.489  1.00 10.00 ? 120 VAL A H    2  
ATOM   3980  H  HA   . VAL A 1 120 ? 21.941  -2.434  8.568   1.00 10.00 ? 120 VAL A HA   2  
ATOM   3981  H  HB   . VAL A 1 120 ? 24.321  -3.905  9.772   1.00 10.00 ? 120 VAL A HB   2  
ATOM   3982  H  HG11 . VAL A 1 120 ? 24.108  -5.392  7.812   1.00 10.00 ? 120 VAL A HG11 2  
ATOM   3983  H  HG12 . VAL A 1 120 ? 22.650  -5.473  8.807   1.00 10.00 ? 120 VAL A HG12 2  
ATOM   3984  H  HG13 . VAL A 1 120 ? 22.643  -4.535  7.299   1.00 10.00 ? 120 VAL A HG13 2  
ATOM   3985  H  HG21 . VAL A 1 120 ? 25.413  -3.356  7.607   1.00 10.00 ? 120 VAL A HG21 2  
ATOM   3986  H  HG22 . VAL A 1 120 ? 24.006  -2.375  7.148   1.00 10.00 ? 120 VAL A HG22 2  
ATOM   3987  H  HG23 . VAL A 1 120 ? 25.026  -1.894  8.521   1.00 10.00 ? 120 VAL A HG23 2  
ATOM   3988  N  N    . GLY A 1 121 ? 20.318  -3.283  10.357  1.00 10.00 ? 121 GLY A N    2  
ATOM   3989  C  CA   . GLY A 1 121 ? 19.343  -3.808  11.296  1.00 10.00 ? 121 GLY A CA   2  
ATOM   3990  C  C    . GLY A 1 121 ? 18.706  -2.702  12.137  1.00 10.00 ? 121 GLY A C    2  
ATOM   3991  O  O    . GLY A 1 121 ? 18.063  -3.010  13.138  1.00 10.00 ? 121 GLY A O    2  
ATOM   3992  H  H    . GLY A 1 121 ? 19.980  -2.613  9.672   1.00 10.00 ? 121 GLY A H    2  
ATOM   3993  H  HA2  . GLY A 1 121 ? 18.552  -4.297  10.726  1.00 10.00 ? 121 GLY A HA2  2  
ATOM   3994  H  HA3  . GLY A 1 121 ? 19.786  -4.544  11.967  1.00 10.00 ? 121 GLY A HA3  2  
ATOM   3995  N  N    . GLU A 1 122 ? 18.836  -1.428  11.740  1.00 10.00 ? 122 GLU A N    2  
ATOM   3996  C  CA   . GLU A 1 122 ? 17.923  -0.411  12.211  1.00 10.00 ? 122 GLU A CA   2  
ATOM   3997  C  C    . GLU A 1 122 ? 16.561  -0.684  11.588  1.00 10.00 ? 122 GLU A C    2  
ATOM   3998  O  O    . GLU A 1 122 ? 16.405  -1.451  10.633  1.00 10.00 ? 122 GLU A O    2  
ATOM   3999  C  CB   . GLU A 1 122 ? 18.410  0.993   11.825  1.00 10.00 ? 122 GLU A CB   2  
ATOM   4000  C  CG   . GLU A 1 122 ? 18.767  1.918   12.995  1.00 10.00 ? 122 GLU A CG   2  
ATOM   4001  C  CD   . GLU A 1 122 ? 17.597  2.808   13.369  1.00 10.00 ? 122 GLU A CD   2  
ATOM   4002  O  OE1  . GLU A 1 122 ? 16.479  2.258   13.466  1.00 10.00 ? 122 GLU A OE1  2  
ATOM   4003  O  OE2  . GLU A 1 122 ? 17.830  4.031   13.511  1.00 10.00 ? 122 GLU A OE2  2  
ATOM   4004  H  H    . GLU A 1 122 ? 19.376  -1.169  10.927  1.00 10.00 ? 122 GLU A H    2  
ATOM   4005  H  HA   . GLU A 1 122 ? 17.831  -0.479  13.297  1.00 10.00 ? 122 GLU A HA   2  
ATOM   4006  H  HB2  . GLU A 1 122 ? 19.287  0.889   11.227  1.00 10.00 ? 122 GLU A HB2  2  
ATOM   4007  H  HB3  . GLU A 1 122 ? 17.679  1.482   11.187  1.00 10.00 ? 122 GLU A HB3  2  
ATOM   4008  H  HG2  . GLU A 1 122 ? 19.092  1.347   13.864  1.00 10.00 ? 122 GLU A HG2  2  
ATOM   4009  H  HG3  . GLU A 1 122 ? 19.584  2.571   12.684  1.00 10.00 ? 122 GLU A HG3  2  
ATOM   4010  N  N    . THR A 1 123 ? 15.606  0.029   12.147  1.00 10.00 ? 123 THR A N    2  
ATOM   4011  C  CA   . THR A 1 123 ? 14.176  -0.225  12.031  1.00 10.00 ? 123 THR A CA   2  
ATOM   4012  C  C    . THR A 1 123 ? 13.447  1.092   12.262  1.00 10.00 ? 123 THR A C    2  
ATOM   4013  O  O    . THR A 1 123 ? 12.910  1.349   13.340  1.00 10.00 ? 123 THR A O    2  
ATOM   4014  C  CB   . THR A 1 123 ? 13.746  -1.313  13.032  1.00 10.00 ? 123 THR A CB   2  
ATOM   4015  O  OG1  . THR A 1 123 ? 14.554  -2.462  12.871  1.00 10.00 ? 123 THR A OG1  2  
ATOM   4016  C  CG2  . THR A 1 123 ? 12.288  -1.737  12.811  1.00 10.00 ? 123 THR A CG2  2  
ATOM   4017  H  H    . THR A 1 123 ? 15.995  0.795   12.706  1.00 10.00 ? 123 THR A H    2  
ATOM   4018  H  HA   . THR A 1 123 ? 13.954  -0.585  11.026  1.00 10.00 ? 123 THR A HA   2  
ATOM   4019  H  HB   . THR A 1 123 ? 13.870  -0.935  14.049  1.00 10.00 ? 123 THR A HB   2  
ATOM   4020  H  HG1  . THR A 1 123 ? 14.501  -3.000  13.665  1.00 10.00 ? 123 THR A HG1  2  
ATOM   4021  H  HG21 . THR A 1 123 ? 11.613  -0.895  12.963  1.00 10.00 ? 123 THR A HG21 2  
ATOM   4022  H  HG22 . THR A 1 123 ? 12.162  -2.116  11.796  1.00 10.00 ? 123 THR A HG22 2  
ATOM   4023  H  HG23 . THR A 1 123 ? 12.025  -2.524  13.518  1.00 10.00 ? 123 THR A HG23 2  
ATOM   4024  N  N    . VAL A 1 124 ? 13.448  1.946   11.243  1.00 10.00 ? 124 VAL A N    2  
ATOM   4025  C  CA   . VAL A 1 124 ? 13.002  3.318   11.382  1.00 10.00 ? 124 VAL A CA   2  
ATOM   4026  C  C    . VAL A 1 124 ? 11.522  3.393   11.020  1.00 10.00 ? 124 VAL A C    2  
ATOM   4027  O  O    . VAL A 1 124 ? 11.128  2.960   9.941   1.00 10.00 ? 124 VAL A O    2  
ATOM   4028  C  CB   . VAL A 1 124 ? 13.878  4.219   10.504  1.00 10.00 ? 124 VAL A CB   2  
ATOM   4029  C  CG1  . VAL A 1 124 ? 13.442  5.680   10.642  1.00 10.00 ? 124 VAL A CG1  2  
ATOM   4030  C  CG2  . VAL A 1 124 ? 15.350  4.088   10.921  1.00 10.00 ? 124 VAL A CG2  2  
ATOM   4031  H  H    . VAL A 1 124 ? 13.805  1.632   10.345  1.00 10.00 ? 124 VAL A H    2  
ATOM   4032  H  HA   . VAL A 1 124 ? 13.138  3.642   12.416  1.00 10.00 ? 124 VAL A HA   2  
ATOM   4033  H  HB   . VAL A 1 124 ? 13.783  3.919   9.460   1.00 10.00 ? 124 VAL A HB   2  
ATOM   4034  H  HG11 . VAL A 1 124 ? 12.420  5.805   10.287  1.00 10.00 ? 124 VAL A HG11 2  
ATOM   4035  H  HG12 . VAL A 1 124 ? 13.505  5.998   11.682  1.00 10.00 ? 124 VAL A HG12 2  
ATOM   4036  H  HG13 . VAL A 1 124 ? 14.096  6.303   10.039  1.00 10.00 ? 124 VAL A HG13 2  
ATOM   4037  H  HG21 . VAL A 1 124 ? 15.691  3.057   10.836  1.00 10.00 ? 124 VAL A HG21 2  
ATOM   4038  H  HG22 . VAL A 1 124 ? 15.976  4.694   10.272  1.00 10.00 ? 124 VAL A HG22 2  
ATOM   4039  H  HG23 . VAL A 1 124 ? 15.477  4.420   11.951  1.00 10.00 ? 124 VAL A HG23 2  
ATOM   4040  N  N    . ASN A 1 125 ? 10.694  3.949   11.906  1.00 10.00 ? 125 ASN A N    2  
ATOM   4041  C  CA   . ASN A 1 125 ? 9.296   4.212   11.592  1.00 10.00 ? 125 ASN A CA   2  
ATOM   4042  C  C    . ASN A 1 125 ? 9.232   5.428   10.671  1.00 10.00 ? 125 ASN A C    2  
ATOM   4043  O  O    . ASN A 1 125 ? 9.750   6.486   11.026  1.00 10.00 ? 125 ASN A O    2  
ATOM   4044  C  CB   . ASN A 1 125 ? 8.484   4.450   12.870  1.00 10.00 ? 125 ASN A CB   2  
ATOM   4045  C  CG   . ASN A 1 125 ? 8.255   3.151   13.635  1.00 10.00 ? 125 ASN A CG   2  
ATOM   4046  O  OD1  . ASN A 1 125 ? 7.340   2.398   13.323  1.00 10.00 ? 125 ASN A OD1  2  
ATOM   4047  N  ND2  . ASN A 1 125 ? 9.078   2.868   14.642  1.00 10.00 ? 125 ASN A ND2  2  
ATOM   4048  H  H    . ASN A 1 125 ? 11.074  4.307   12.768  1.00 10.00 ? 125 ASN A H    2  
ATOM   4049  H  HA   . ASN A 1 125 ? 8.869   3.346   11.084  1.00 10.00 ? 125 ASN A HA   2  
ATOM   4050  H  HB2  . ASN A 1 125 ? 8.976   5.191   13.502  1.00 10.00 ? 125 ASN A HB2  2  
ATOM   4051  H  HB3  . ASN A 1 125 ? 7.505   4.840   12.588  1.00 10.00 ? 125 ASN A HB3  2  
ATOM   4052  H  HD21 . ASN A 1 125 ? 9.831   3.488   14.892  1.00 10.00 ? 125 ASN A HD21 2  
ATOM   4053  H  HD22 . ASN A 1 125 ? 8.937   2.002   15.140  1.00 10.00 ? 125 ASN A HD22 2  
ATOM   4054  N  N    . ILE A 1 126 ? 8.621   5.278   9.495   1.00 10.00 ? 126 ILE A N    2  
ATOM   4055  C  CA   . ILE A 1 126 ? 8.449   6.332   8.506   1.00 10.00 ? 126 ILE A CA   2  
ATOM   4056  C  C    . ILE A 1 126 ? 6.962   6.620   8.360   1.00 10.00 ? 126 ILE A C    2  
ATOM   4057  O  O    . ILE A 1 126 ? 6.179   5.678   8.256   1.00 10.00 ? 126 ILE A O    2  
ATOM   4058  C  CB   . ILE A 1 126 ? 9.111   5.943   7.171   1.00 10.00 ? 126 ILE A CB   2  
ATOM   4059  C  CG1  . ILE A 1 126 ? 8.369   4.918   6.301   1.00 10.00 ? 126 ILE A CG1  2  
ATOM   4060  C  CG2  . ILE A 1 126 ? 10.530  5.442   7.461   1.00 10.00 ? 126 ILE A CG2  2  
ATOM   4061  C  CD1  . ILE A 1 126 ? 9.074   4.743   4.954   1.00 10.00 ? 126 ILE A CD1  2  
ATOM   4062  H  H    . ILE A 1 126 ? 8.226   4.373   9.266   1.00 10.00 ? 126 ILE A H    2  
ATOM   4063  H  HA   . ILE A 1 126 ? 8.940   7.242   8.844   1.00 10.00 ? 126 ILE A HA   2  
ATOM   4064  H  HB   . ILE A 1 126 ? 9.144   6.853   6.579   1.00 10.00 ? 126 ILE A HB   2  
ATOM   4065  H  HG12 . ILE A 1 126 ? 8.318   3.957   6.806   1.00 10.00 ? 126 ILE A HG12 2  
ATOM   4066  H  HG13 . ILE A 1 126 ? 7.362   5.272   6.085   1.00 10.00 ? 126 ILE A HG13 2  
ATOM   4067  H  HG21 . ILE A 1 126 ? 10.974  6.060   8.236   1.00 10.00 ? 126 ILE A HG21 2  
ATOM   4068  H  HG22 . ILE A 1 126 ? 10.494  4.414   7.817   1.00 10.00 ? 126 ILE A HG22 2  
ATOM   4069  H  HG23 . ILE A 1 126 ? 11.150  5.486   6.567   1.00 10.00 ? 126 ILE A HG23 2  
ATOM   4070  H  HD11 . ILE A 1 126 ? 10.039  4.256   5.086   1.00 10.00 ? 126 ILE A HD11 2  
ATOM   4071  H  HD12 . ILE A 1 126 ? 8.457   4.127   4.301   1.00 10.00 ? 126 ILE A HD12 2  
ATOM   4072  H  HD13 . ILE A 1 126 ? 9.227   5.720   4.494   1.00 10.00 ? 126 ILE A HD13 2  
ATOM   4073  N  N    . THR A 1 127 ? 6.558   7.893   8.361   1.00 10.00 ? 127 THR A N    2  
ATOM   4074  C  CA   . THR A 1 127 ? 5.167   8.236   8.111   1.00 10.00 ? 127 THR A CA   2  
ATOM   4075  C  C    . THR A 1 127 ? 4.972   8.467   6.618   1.00 10.00 ? 127 THR A C    2  
ATOM   4076  O  O    . THR A 1 127 ? 5.659   9.288   6.015   1.00 10.00 ? 127 THR A O    2  
ATOM   4077  C  CB   . THR A 1 127 ? 4.721   9.445   8.940   1.00 10.00 ? 127 THR A CB   2  
ATOM   4078  O  OG1  . THR A 1 127 ? 5.241   9.356   10.250  1.00 10.00 ? 127 THR A OG1  2  
ATOM   4079  C  CG2  . THR A 1 127 ? 3.188   9.483   9.017   1.00 10.00 ? 127 THR A CG2  2  
ATOM   4080  H  H    . THR A 1 127 ? 7.234   8.649   8.436   1.00 10.00 ? 127 THR A H    2  
ATOM   4081  H  HA   . THR A 1 127 ? 4.542   7.406   8.425   1.00 10.00 ? 127 THR A HA   2  
ATOM   4082  H  HB   . THR A 1 127 ? 5.088   10.364  8.484   1.00 10.00 ? 127 THR A HB   2  
ATOM   4083  H  HG1  . THR A 1 127 ? 5.161   8.448   10.553  1.00 10.00 ? 127 THR A HG1  2  
ATOM   4084  H  HG21 . THR A 1 127 ? 2.867   10.370  9.562   1.00 10.00 ? 127 THR A HG21 2  
ATOM   4085  H  HG22 . THR A 1 127 ? 2.755   9.498   8.017   1.00 10.00 ? 127 THR A HG22 2  
ATOM   4086  H  HG23 . THR A 1 127 ? 2.811   8.596   9.529   1.00 10.00 ? 127 THR A HG23 2  
ATOM   4087  N  N    . LEU A 1 128 ? 4.019   7.769   6.014   1.00 10.00 ? 128 LEU A N    2  
ATOM   4088  C  CA   . LEU A 1 128 ? 3.641   8.006   4.637   1.00 10.00 ? 128 LEU A CA   2  
ATOM   4089  C  C    . LEU A 1 128 ? 2.685   9.193   4.589   1.00 10.00 ? 128 LEU A C    2  
ATOM   4090  O  O    . LEU A 1 128 ? 2.223   9.649   5.632   1.00 10.00 ? 128 LEU A O    2  
ATOM   4091  C  CB   . LEU A 1 128 ? 2.887   6.792   4.110   1.00 10.00 ? 128 LEU A CB   2  
ATOM   4092  C  CG   . LEU A 1 128 ? 3.598   5.442   4.225   1.00 10.00 ? 128 LEU A CG   2  
ATOM   4093  C  CD1  . LEU A 1 128 ? 2.752   4.486   3.384   1.00 10.00 ? 128 LEU A CD1  2  
ATOM   4094  C  CD2  . LEU A 1 128 ? 5.039   5.475   3.701   1.00 10.00 ? 128 LEU A CD2  2  
ATOM   4095  H  H    . LEU A 1 128 ? 3.435   7.163   6.579   1.00 10.00 ? 128 LEU A H    2  
ATOM   4096  H  HA   . LEU A 1 128 ? 4.518   8.203   4.019   1.00 10.00 ? 128 LEU A HA   2  
ATOM   4097  H  HB2  . LEU A 1 128 ? 1.943   6.726   4.646   1.00 10.00 ? 128 LEU A HB2  2  
ATOM   4098  H  HB3  . LEU A 1 128 ? 2.660   6.971   3.067   1.00 10.00 ? 128 LEU A HB3  2  
ATOM   4099  H  HG   . LEU A 1 128 ? 3.602   5.113   5.265   1.00 10.00 ? 128 LEU A HG   2  
ATOM   4100  H  HD11 . LEU A 1 128 ? 2.809   4.788   2.338   1.00 10.00 ? 128 LEU A HD11 2  
ATOM   4101  H  HD12 . LEU A 1 128 ? 3.114   3.467   3.482   1.00 10.00 ? 128 LEU A HD12 2  
ATOM   4102  H  HD13 . LEU A 1 128 ? 1.711   4.538   3.712   1.00 10.00 ? 128 LEU A HD13 2  
ATOM   4103  H  HD21 . LEU A 1 128 ? 5.655   6.114   4.334   1.00 10.00 ? 128 LEU A HD21 2  
ATOM   4104  H  HD22 . LEU A 1 128 ? 5.456   4.468   3.718   1.00 10.00 ? 128 LEU A HD22 2  
ATOM   4105  H  HD23 . LEU A 1 128 ? 5.064   5.853   2.679   1.00 10.00 ? 128 LEU A HD23 2  
ATOM   4106  N  N    . LYS A 1 129 ? 2.341   9.650   3.383   1.00 10.00 ? 129 LYS A N    2  
ATOM   4107  C  CA   . LYS A 1 129 ? 1.220   10.541  3.131   1.00 10.00 ? 129 LYS A CA   2  
ATOM   4108  C  C    . LYS A 1 129 ? 0.742   10.311  1.700   1.00 10.00 ? 129 LYS A C    2  
ATOM   4109  O  O    . LYS A 1 129 ? 1.346   10.793  0.749   1.00 10.00 ? 129 LYS A O    2  
ATOM   4110  C  CB   . LYS A 1 129 ? 1.575   12.020  3.378   1.00 10.00 ? 129 LYS A CB   2  
ATOM   4111  C  CG   . LYS A 1 129 ? 1.668   12.331  4.876   1.00 10.00 ? 129 LYS A CG   2  
ATOM   4112  C  CD   . LYS A 1 129 ? 1.622   13.826  5.208   1.00 10.00 ? 129 LYS A CD   2  
ATOM   4113  C  CE   . LYS A 1 129 ? 1.184   14.071  6.664   1.00 10.00 ? 129 LYS A CE   2  
ATOM   4114  N  NZ   . LYS A 1 129 ? 1.725   13.079  7.622   1.00 10.00 ? 129 LYS A NZ   2  
ATOM   4115  H  H    . LYS A 1 129 ? 2.751   9.217   2.568   1.00 10.00 ? 129 LYS A H    2  
ATOM   4116  H  HA   . LYS A 1 129 ? 0.391   10.274  3.785   1.00 10.00 ? 129 LYS A HA   2  
ATOM   4117  H  HB2  . LYS A 1 129 ? 2.508   12.283  2.880   1.00 10.00 ? 129 LYS A HB2  2  
ATOM   4118  H  HB3  . LYS A 1 129 ? 0.771   12.624  2.955   1.00 10.00 ? 129 LYS A HB3  2  
ATOM   4119  H  HG2  . LYS A 1 129 ? 0.831   11.833  5.363   1.00 10.00 ? 129 LYS A HG2  2  
ATOM   4120  H  HG3  . LYS A 1 129 ? 2.611   11.935  5.250   1.00 10.00 ? 129 LYS A HG3  2  
ATOM   4121  H  HD2  . LYS A 1 129 ? 2.609   14.257  5.026   1.00 10.00 ? 129 LYS A HD2  2  
ATOM   4122  H  HD3  . LYS A 1 129 ? 0.912   14.333  4.551   1.00 10.00 ? 129 LYS A HD3  2  
ATOM   4123  H  HE2  . LYS A 1 129 ? 1.502   15.075  6.956   1.00 10.00 ? 129 LYS A HE2  2  
ATOM   4124  H  HE3  . LYS A 1 129 ? 0.094   14.033  6.719   1.00 10.00 ? 129 LYS A HE3  2  
ATOM   4125  H  HZ1  . LYS A 1 129 ? 2.718   12.953  7.491   1.00 10.00 ? 129 LYS A HZ1  2  
ATOM   4126  H  HZ2  . LYS A 1 129 ? 1.550   13.386  8.568   1.00 10.00 ? 129 LYS A HZ2  2  
ATOM   4127  H  HZ3  . LYS A 1 129 ? 1.253   12.180  7.513   1.00 10.00 ? 129 LYS A HZ3  2  
ATOM   4128  N  N    . ALA A 1 130 ? -0.353  9.577   1.529   1.00 10.00 ? 130 ALA A N    2  
ATOM   4129  C  CA   . ALA A 1 130 ? -1.079  9.628   0.268   1.00 10.00 ? 130 ALA A CA   2  
ATOM   4130  C  C    . ALA A 1 130 ? -2.004  10.842  0.291   1.00 10.00 ? 130 ALA A C    2  
ATOM   4131  O  O    . ALA A 1 130 ? -2.529  11.194  1.349   1.00 10.00 ? 130 ALA A O    2  
ATOM   4132  C  CB   . ALA A 1 130 ? -1.894  8.353   0.075   1.00 10.00 ? 130 ALA A CB   2  
ATOM   4133  H  H    . ALA A 1 130 ? -0.776  9.128   2.331   1.00 10.00 ? 130 ALA A H    2  
ATOM   4134  H  HA   . ALA A 1 130 ? -0.392  9.715   -0.573  1.00 10.00 ? 130 ALA A HA   2  
ATOM   4135  H  HB1  . ALA A 1 130 ? -2.372  8.372   -0.903  1.00 10.00 ? 130 ALA A HB1  2  
ATOM   4136  H  HB2  . ALA A 1 130 ? -1.251  7.474   0.148   1.00 10.00 ? 130 ALA A HB2  2  
ATOM   4137  H  HB3  . ALA A 1 130 ? -2.673  8.318   0.830   1.00 10.00 ? 130 ALA A HB3  2  
ATOM   4138  N  N    . THR A 1 131 ? -2.253  11.431  -0.885  1.00 10.00 ? 131 THR A N    2  
ATOM   4139  C  CA   . THR A 1 131 ? -3.293  12.444  -1.097  1.00 10.00 ? 131 THR A CA   2  
ATOM   4140  C  C    . THR A 1 131 ? -4.585  12.079  -0.372  1.00 10.00 ? 131 THR A C    2  
ATOM   4141  O  O    . THR A 1 131 ? -5.302  12.928  0.147   1.00 10.00 ? 131 THR A O    2  
ATOM   4142  C  CB   . THR A 1 131 ? -3.576  12.583  -2.601  1.00 10.00 ? 131 THR A CB   2  
ATOM   4143  O  OG1  . THR A 1 131 ? -3.799  11.320  -3.214  1.00 10.00 ? 131 THR A OG1  2  
ATOM   4144  C  CG2  . THR A 1 131 ? -2.405  13.258  -3.321  1.00 10.00 ? 131 THR A CG2  2  
ATOM   4145  H  H    . THR A 1 131 ? -1.756  11.094  -1.697  1.00 10.00 ? 131 THR A H    2  
ATOM   4146  H  HA   . THR A 1 131 ? -2.970  13.399  -0.691  1.00 10.00 ? 131 THR A HA   2  
ATOM   4147  H  HB   . THR A 1 131 ? -4.463  13.208  -2.729  1.00 10.00 ? 131 THR A HB   2  
ATOM   4148  H  HG1  . THR A 1 131 ? -4.132  10.669  -2.571  1.00 10.00 ? 131 THR A HG1  2  
ATOM   4149  H  HG21 . THR A 1 131 ? -1.515  12.632  -3.276  1.00 10.00 ? 131 THR A HG21 2  
ATOM   4150  H  HG22 . THR A 1 131 ? -2.666  13.425  -4.366  1.00 10.00 ? 131 THR A HG22 2  
ATOM   4151  H  HG23 . THR A 1 131 ? -2.189  14.221  -2.858  1.00 10.00 ? 131 THR A HG23 2  
ATOM   4152  N  N    . ASP A 1 132 ? -4.845  10.777  -0.358  1.00 10.00 ? 132 ASP A N    2  
ATOM   4153  C  CA   . ASP A 1 132 ? -6.007  10.099  0.145   1.00 10.00 ? 132 ASP A CA   2  
ATOM   4154  C  C    . ASP A 1 132 ? -6.208  10.328  1.650   1.00 10.00 ? 132 ASP A C    2  
ATOM   4155  O  O    . ASP A 1 132 ? -7.232  9.923   2.194   1.00 10.00 ? 132 ASP A O    2  
ATOM   4156  C  CB   . ASP A 1 132 ? -5.815  8.594   -0.134  1.00 10.00 ? 132 ASP A CB   2  
ATOM   4157  C  CG   . ASP A 1 132 ? -5.323  8.190   -1.529  1.00 10.00 ? 132 ASP A CG   2  
ATOM   4158  O  OD1  . ASP A 1 132 ? -4.711  9.022   -2.250  1.00 10.00 ? 132 ASP A OD1  2  
ATOM   4159  O  OD2  . ASP A 1 132 ? -5.527  6.998   -1.841  1.00 10.00 ? 132 ASP A OD2  2  
ATOM   4160  H  H    . ASP A 1 132 ? -4.233  10.173  -0.895  1.00 10.00 ? 132 ASP A H    2  
ATOM   4161  H  HA   . ASP A 1 132 ? -6.861  10.491  -0.404  1.00 10.00 ? 132 ASP A HA   2  
ATOM   4162  H  HB2  . ASP A 1 132 ? -5.084  8.215   0.577   1.00 10.00 ? 132 ASP A HB2  2  
ATOM   4163  H  HB3  . ASP A 1 132 ? -6.765  8.095   0.060   1.00 10.00 ? 132 ASP A HB3  2  
ATOM   4164  N  N    . GLY A 1 133 ? -5.213  10.896  2.343   1.00 10.00 ? 133 GLY A N    2  
ATOM   4165  C  CA   . GLY A 1 133 ? -5.227  11.063  3.788   1.00 10.00 ? 133 GLY A CA   2  
ATOM   4166  C  C    . GLY A 1 133 ? -4.640  9.838   4.488   1.00 10.00 ? 133 GLY A C    2  
ATOM   4167  O  O    . GLY A 1 133 ? -4.654  9.752   5.715   1.00 10.00 ? 133 GLY A O    2  
ATOM   4168  H  H    . GLY A 1 133 ? -4.369  11.181  1.856   1.00 10.00 ? 133 GLY A H    2  
ATOM   4169  H  HA2  . GLY A 1 133 ? -4.617  11.931  4.039   1.00 10.00 ? 133 GLY A HA2  2  
ATOM   4170  H  HA3  . GLY A 1 133 ? -6.241  11.238  4.150   1.00 10.00 ? 133 GLY A HA3  2  
ATOM   4171  N  N    . ARG A 1 134 ? -4.068  8.900   3.726   1.00 10.00 ? 134 ARG A N    2  
ATOM   4172  C  CA   . ARG A 1 134 ? -3.491  7.685   4.276   1.00 10.00 ? 134 ARG A CA   2  
ATOM   4173  C  C    . ARG A 1 134 ? -2.087  8.023   4.767   1.00 10.00 ? 134 ARG A C    2  
ATOM   4174  O  O    . ARG A 1 134 ? -1.078  7.676   4.152   1.00 10.00 ? 134 ARG A O    2  
ATOM   4175  C  CB   . ARG A 1 134 ? -3.517  6.561   3.232   1.00 10.00 ? 134 ARG A CB   2  
ATOM   4176  C  CG   . ARG A 1 134 ? -4.972  6.178   2.909   1.00 10.00 ? 134 ARG A CG   2  
ATOM   4177  C  CD   . ARG A 1 134 ? -5.118  5.305   1.654   1.00 10.00 ? 134 ARG A CD   2  
ATOM   4178  N  NE   . ARG A 1 134 ? -6.497  4.793   1.564   1.00 10.00 ? 134 ARG A NE   2  
ATOM   4179  C  CZ   . ARG A 1 134 ? -7.285  4.671   0.479   1.00 10.00 ? 134 ARG A CZ   2  
ATOM   4180  N  NH1  . ARG A 1 134 ? -6.935  5.129   -0.727  1.00 10.00 ? 134 ARG A NH1  2  
ATOM   4181  N  NH2  . ARG A 1 134 ? -8.467  4.056   0.614   1.00 10.00 ? 134 ARG A NH2  2  
ATOM   4182  H  H    . ARG A 1 134 ? -4.029  9.042   2.729   1.00 10.00 ? 134 ARG A H    2  
ATOM   4183  H  HA   . ARG A 1 134 ? -4.078  7.344   5.131   1.00 10.00 ? 134 ARG A HA   2  
ATOM   4184  H  HB2  . ARG A 1 134 ? -2.997  6.869   2.332   1.00 10.00 ? 134 ARG A HB2  2  
ATOM   4185  H  HB3  . ARG A 1 134 ? -2.981  5.709   3.650   1.00 10.00 ? 134 ARG A HB3  2  
ATOM   4186  H  HG2  . ARG A 1 134 ? -5.374  5.649   3.775   1.00 10.00 ? 134 ARG A HG2  2  
ATOM   4187  H  HG3  . ARG A 1 134 ? -5.573  7.076   2.755   1.00 10.00 ? 134 ARG A HG3  2  
ATOM   4188  H  HD2  . ARG A 1 134 ? -4.840  5.883   0.773   1.00 10.00 ? 134 ARG A HD2  2  
ATOM   4189  H  HD3  . ARG A 1 134 ? -4.438  4.454   1.734   1.00 10.00 ? 134 ARG A HD3  2  
ATOM   4190  H  HE   . ARG A 1 134 ? -6.869  4.464   2.444   1.00 10.00 ? 134 ARG A HE   2  
ATOM   4191  H  HH11 . ARG A 1 134 ? -6.147  5.769   -0.888  1.00 10.00 ? 134 ARG A HH11 2  
ATOM   4192  H  HH12 . ARG A 1 134 ? -7.530  5.007   -1.530  1.00 10.00 ? 134 ARG A HH12 2  
ATOM   4193  H  HH21 . ARG A 1 134 ? -8.770  3.710   1.513   1.00 10.00 ? 134 ARG A HH21 2  
ATOM   4194  H  HH22 . ARG A 1 134 ? -9.096  3.958   -0.169  1.00 10.00 ? 134 ARG A HH22 2  
ATOM   4195  N  N    . THR A 1 135 ? -2.046  8.743   5.889   1.00 10.00 ? 135 THR A N    2  
ATOM   4196  C  CA   . THR A 1 135 ? -0.824  9.158   6.549   1.00 10.00 ? 135 THR A CA   2  
ATOM   4197  C  C    . THR A 1 135 ? -0.340  8.021   7.447   1.00 10.00 ? 135 THR A C    2  
ATOM   4198  O  O    . THR A 1 135 ? -0.324  8.137   8.671   1.00 10.00 ? 135 THR A O    2  
ATOM   4199  C  CB   . THR A 1 135 ? -0.999  10.522  7.253   1.00 10.00 ? 135 THR A CB   2  
ATOM   4200  O  OG1  . THR A 1 135 ? 0.198   10.883  7.922   1.00 10.00 ? 135 THR A OG1  2  
ATOM   4201  C  CG2  . THR A 1 135 ? -2.163  10.593  8.250   1.00 10.00 ? 135 THR A CG2  2  
ATOM   4202  H  H    . THR A 1 135 ? -2.937  8.999   6.291   1.00 10.00 ? 135 THR A H    2  
ATOM   4203  H  HA   . THR A 1 135 ? -0.093  9.285   5.763   1.00 10.00 ? 135 THR A HA   2  
ATOM   4204  H  HB   . THR A 1 135 ? -1.200  11.267  6.482   1.00 10.00 ? 135 THR A HB   2  
ATOM   4205  H  HG1  . THR A 1 135 ? 0.363   10.177  8.566   1.00 10.00 ? 135 THR A HG1  2  
ATOM   4206  H  HG21 . THR A 1 135 ? -2.183  11.583  8.705   1.00 10.00 ? 135 THR A HG21 2  
ATOM   4207  H  HG22 . THR A 1 135 ? -3.115  10.435  7.745   1.00 10.00 ? 135 THR A HG22 2  
ATOM   4208  H  HG23 . THR A 1 135 ? -2.057  9.853   9.043   1.00 10.00 ? 135 THR A HG23 2  
ATOM   4209  N  N    . LEU A 1 136 ? 0.058   6.920   6.813   1.00 10.00 ? 136 LEU A N    2  
ATOM   4210  C  CA   . LEU A 1 136 ? 0.295   5.643   7.469   1.00 10.00 ? 136 LEU A CA   2  
ATOM   4211  C  C    . LEU A 1 136 ? 1.663   5.673   8.141   1.00 10.00 ? 136 LEU A C    2  
ATOM   4212  O  O    . LEU A 1 136 ? 2.410   6.626   7.959   1.00 10.00 ? 136 LEU A O    2  
ATOM   4213  C  CB   . LEU A 1 136 ? 0.258   4.533   6.402   1.00 10.00 ? 136 LEU A CB   2  
ATOM   4214  C  CG   . LEU A 1 136 ? -0.778  3.420   6.635   1.00 10.00 ? 136 LEU A CG   2  
ATOM   4215  C  CD1  . LEU A 1 136 ? -0.498  2.609   7.905   1.00 10.00 ? 136 LEU A CD1  2  
ATOM   4216  C  CD2  . LEU A 1 136 ? -2.212  3.964   6.643   1.00 10.00 ? 136 LEU A CD2  2  
ATOM   4217  H  H    . LEU A 1 136 ? 0.118   6.965   5.805   1.00 10.00 ? 136 LEU A H    2  
ATOM   4218  H  HA   . LEU A 1 136 ? -0.464  5.486   8.235   1.00 10.00 ? 136 LEU A HA   2  
ATOM   4219  H  HB2  . LEU A 1 136 ? 0.045   4.981   5.432   1.00 10.00 ? 136 LEU A HB2  2  
ATOM   4220  H  HB3  . LEU A 1 136 ? 1.249   4.086   6.325   1.00 10.00 ? 136 LEU A HB3  2  
ATOM   4221  H  HG   . LEU A 1 136 ? -0.697  2.734   5.790   1.00 10.00 ? 136 LEU A HG   2  
ATOM   4222  H  HD11 . LEU A 1 136 ? -0.607  3.226   8.796   1.00 10.00 ? 136 LEU A HD11 2  
ATOM   4223  H  HD12 . LEU A 1 136 ? -1.205  1.781   7.967   1.00 10.00 ? 136 LEU A HD12 2  
ATOM   4224  H  HD13 . LEU A 1 136 ? 0.511   2.197   7.864   1.00 10.00 ? 136 LEU A HD13 2  
ATOM   4225  H  HD21 . LEU A 1 136 ? -2.389  4.594   7.514   1.00 10.00 ? 136 LEU A HD21 2  
ATOM   4226  H  HD22 . LEU A 1 136 ? -2.389  4.546   5.739   1.00 10.00 ? 136 LEU A HD22 2  
ATOM   4227  H  HD23 . LEU A 1 136 ? -2.914  3.131   6.668   1.00 10.00 ? 136 LEU A HD23 2  
ATOM   4228  N  N    . ASN A 1 137 ? 2.004   4.625   8.890   1.00 10.00 ? 137 ASN A N    2  
ATOM   4229  C  CA   . ASN A 1 137 ? 3.298   4.422   9.503   1.00 10.00 ? 137 ASN A CA   2  
ATOM   4230  C  C    . ASN A 1 137 ? 3.816   3.107   8.942   1.00 10.00 ? 137 ASN A C    2  
ATOM   4231  O  O    . ASN A 1 137 ? 3.077   2.126   8.923   1.00 10.00 ? 137 ASN A O    2  
ATOM   4232  C  CB   . ASN A 1 137 ? 3.180   4.377   11.029  1.00 10.00 ? 137 ASN A CB   2  
ATOM   4233  C  CG   . ASN A 1 137 ? 2.343   3.211   11.553  1.00 10.00 ? 137 ASN A CG   2  
ATOM   4234  O  OD1  . ASN A 1 137 ? 2.878   2.215   12.024  1.00 10.00 ? 137 ASN A OD1  2  
ATOM   4235  N  ND2  . ASN A 1 137 ? 1.019   3.336   11.501  1.00 10.00 ? 137 ASN A ND2  2  
ATOM   4236  H  H    . ASN A 1 137 ? 1.446   3.788   8.878   1.00 10.00 ? 137 ASN A H    2  
ATOM   4237  H  HA   . ASN A 1 137 ? 3.974   5.234   9.246   1.00 10.00 ? 137 ASN A HA   2  
ATOM   4238  H  HB2  . ASN A 1 137 ? 4.186   4.265   11.420  1.00 10.00 ? 137 ASN A HB2  2  
ATOM   4239  H  HB3  . ASN A 1 137 ? 2.771   5.319   11.393  1.00 10.00 ? 137 ASN A HB3  2  
ATOM   4240  H  HD21 . ASN A 1 137 ? 0.598   4.182   11.151  1.00 10.00 ? 137 ASN A HD21 2  
ATOM   4241  H  HD22 . ASN A 1 137 ? 0.457   2.575   11.851  1.00 10.00 ? 137 ASN A HD22 2  
ATOM   4242  N  N    . VAL A 1 138 ? 5.040   3.109   8.423   1.00 10.00 ? 138 VAL A N    2  
ATOM   4243  C  CA   . VAL A 1 138 ? 5.678   1.945   7.837   1.00 10.00 ? 138 VAL A CA   2  
ATOM   4244  C  C    . VAL A 1 138 ? 7.024   1.744   8.532   1.00 10.00 ? 138 VAL A C    2  
ATOM   4245  O  O    . VAL A 1 138 ? 7.692   2.717   8.869   1.00 10.00 ? 138 VAL A O    2  
ATOM   4246  C  CB   . VAL A 1 138 ? 5.808   2.194   6.324   1.00 10.00 ? 138 VAL A CB   2  
ATOM   4247  C  CG1  . VAL A 1 138 ? 6.872   1.315   5.652   1.00 10.00 ? 138 VAL A CG1  2  
ATOM   4248  C  CG2  . VAL A 1 138 ? 4.459   1.929   5.645   1.00 10.00 ? 138 VAL A CG2  2  
ATOM   4249  H  H    . VAL A 1 138 ? 5.560   3.983   8.381   1.00 10.00 ? 138 VAL A H    2  
ATOM   4250  H  HA   . VAL A 1 138 ? 5.079   1.050   8.008   1.00 10.00 ? 138 VAL A HA   2  
ATOM   4251  H  HB   . VAL A 1 138 ? 6.061   3.248   6.174   1.00 10.00 ? 138 VAL A HB   2  
ATOM   4252  H  HG11 . VAL A 1 138 ? 7.868   1.572   6.012   1.00 10.00 ? 138 VAL A HG11 2  
ATOM   4253  H  HG12 . VAL A 1 138 ? 6.671   0.264   5.858   1.00 10.00 ? 138 VAL A HG12 2  
ATOM   4254  H  HG13 . VAL A 1 138 ? 6.852   1.473   4.574   1.00 10.00 ? 138 VAL A HG13 2  
ATOM   4255  H  HG21 . VAL A 1 138 ? 4.144   0.899   5.820   1.00 10.00 ? 138 VAL A HG21 2  
ATOM   4256  H  HG22 . VAL A 1 138 ? 3.699   2.606   6.033   1.00 10.00 ? 138 VAL A HG22 2  
ATOM   4257  H  HG23 . VAL A 1 138 ? 4.557   2.083   4.571   1.00 10.00 ? 138 VAL A HG23 2  
ATOM   4258  N  N    . ALA A 1 139 ? 7.426   0.490   8.750   1.00 10.00 ? 139 ALA A N    2  
ATOM   4259  C  CA   . ALA A 1 139 ? 8.753   0.169   9.249   1.00 10.00 ? 139 ALA A CA   2  
ATOM   4260  C  C    . ALA A 1 139 ? 9.717   0.108   8.066   1.00 10.00 ? 139 ALA A C    2  
ATOM   4261  O  O    . ALA A 1 139 ? 9.452   -0.603  7.095   1.00 10.00 ? 139 ALA A O    2  
ATOM   4262  C  CB   . ALA A 1 139 ? 8.717   -1.166  9.996   1.00 10.00 ? 139 ALA A CB   2  
ATOM   4263  H  H    . ALA A 1 139 ? 6.845   -0.275  8.447   1.00 10.00 ? 139 ALA A H    2  
ATOM   4264  H  HA   . ALA A 1 139 ? 9.088   0.937   9.949   1.00 10.00 ? 139 ALA A HA   2  
ATOM   4265  H  HB1  . ALA A 1 139 ? 8.388   -1.964  9.329   1.00 10.00 ? 139 ALA A HB1  2  
ATOM   4266  H  HB2  . ALA A 1 139 ? 9.714   -1.403  10.369  1.00 10.00 ? 139 ALA A HB2  2  
ATOM   4267  H  HB3  . ALA A 1 139 ? 8.030   -1.097  10.841  1.00 10.00 ? 139 ALA A HB3  2  
ATOM   4268  N  N    . ALA A 1 140 ? 10.815  0.862   8.152   1.00 10.00 ? 140 ALA A N    2  
ATOM   4269  C  CA   . ALA A 1 140 ? 11.912  0.857   7.204   1.00 10.00 ? 140 ALA A CA   2  
ATOM   4270  C  C    . ALA A 1 140 ? 13.099  0.117   7.810   1.00 10.00 ? 140 ALA A C    2  
ATOM   4271  O  O    . ALA A 1 140 ? 13.729  0.595   8.755   1.00 10.00 ? 140 ALA A O    2  
ATOM   4272  C  CB   . ALA A 1 140 ? 12.292  2.283   6.839   1.00 10.00 ? 140 ALA A CB   2  
ATOM   4273  H  H    . ALA A 1 140 ? 10.922  1.466   8.958   1.00 10.00 ? 140 ALA A H    2  
ATOM   4274  H  HA   . ALA A 1 140 ? 11.612  0.367   6.280   1.00 10.00 ? 140 ALA A HA   2  
ATOM   4275  H  HB1  . ALA A 1 140 ? 11.460  2.756   6.322   1.00 10.00 ? 140 ALA A HB1  2  
ATOM   4276  H  HB2  . ALA A 1 140 ? 12.544  2.848   7.734   1.00 10.00 ? 140 ALA A HB2  2  
ATOM   4277  H  HB3  . ALA A 1 140 ? 13.157  2.239   6.182   1.00 10.00 ? 140 ALA A HB3  2  
ATOM   4278  N  N    . THR A 1 141 ? 13.383  -1.054  7.249   1.00 10.00 ? 141 THR A N    2  
ATOM   4279  C  CA   . THR A 1 141 ? 14.388  -1.992  7.726   1.00 10.00 ? 141 THR A CA   2  
ATOM   4280  C  C    . THR A 1 141 ? 15.735  -1.652  7.077   1.00 10.00 ? 141 THR A C    2  
ATOM   4281  O  O    . THR A 1 141 ? 15.926  -1.894  5.884   1.00 10.00 ? 141 THR A O    2  
ATOM   4282  C  CB   . THR A 1 141 ? 13.937  -3.425  7.395   1.00 10.00 ? 141 THR A CB   2  
ATOM   4283  O  OG1  . THR A 1 141 ? 12.529  -3.557  7.491   1.00 10.00 ? 141 THR A OG1  2  
ATOM   4284  C  CG2  . THR A 1 141 ? 14.588  -4.426  8.353   1.00 10.00 ? 141 THR A CG2  2  
ATOM   4285  H  H    . THR A 1 141 ? 12.792  -1.328  6.474   1.00 10.00 ? 141 THR A H    2  
ATOM   4286  H  HA   . THR A 1 141 ? 14.462  -1.898  8.811   1.00 10.00 ? 141 THR A HA   2  
ATOM   4287  H  HB   . THR A 1 141 ? 14.230  -3.681  6.377   1.00 10.00 ? 141 THR A HB   2  
ATOM   4288  H  HG1  . THR A 1 141 ? 12.101  -3.061  6.779   1.00 10.00 ? 141 THR A HG1  2  
ATOM   4289  H  HG21 . THR A 1 141 ? 14.265  -4.223  9.376   1.00 10.00 ? 141 THR A HG21 2  
ATOM   4290  H  HG22 . THR A 1 141 ? 14.287  -5.438  8.084   1.00 10.00 ? 141 THR A HG22 2  
ATOM   4291  H  HG23 . THR A 1 141 ? 15.673  -4.347  8.301   1.00 10.00 ? 141 THR A HG23 2  
ATOM   4292  N  N    . VAL A 1 142 ? 16.664  -1.059  7.823   1.00 10.00 ? 142 VAL A N    2  
ATOM   4293  C  CA   . VAL A 1 142 ? 17.867  -0.471  7.255   1.00 10.00 ? 142 VAL A CA   2  
ATOM   4294  C  C    . VAL A 1 142 ? 18.912  -1.573  7.126   1.00 10.00 ? 142 VAL A C    2  
ATOM   4295  O  O    . VAL A 1 142 ? 19.581  -1.864  8.110   1.00 10.00 ? 142 VAL A O    2  
ATOM   4296  C  CB   . VAL A 1 142 ? 18.348  0.660   8.179   1.00 10.00 ? 142 VAL A CB   2  
ATOM   4297  C  CG1  . VAL A 1 142 ? 19.570  1.377   7.602   1.00 10.00 ? 142 VAL A CG1  2  
ATOM   4298  C  CG2  . VAL A 1 142 ? 17.256  1.706   8.431   1.00 10.00 ? 142 VAL A CG2  2  
ATOM   4299  H  H    . VAL A 1 142 ? 16.557  -1.035  8.835   1.00 10.00 ? 142 VAL A H    2  
ATOM   4300  H  HA   . VAL A 1 142 ? 17.657  -0.050  6.274   1.00 10.00 ? 142 VAL A HA   2  
ATOM   4301  H  HB   . VAL A 1 142 ? 18.623  0.225   9.137   1.00 10.00 ? 142 VAL A HB   2  
ATOM   4302  H  HG11 . VAL A 1 142 ? 19.307  1.821   6.642   1.00 10.00 ? 142 VAL A HG11 2  
ATOM   4303  H  HG12 . VAL A 1 142 ? 19.885  2.166   8.285   1.00 10.00 ? 142 VAL A HG12 2  
ATOM   4304  H  HG13 . VAL A 1 142 ? 20.396  0.678   7.479   1.00 10.00 ? 142 VAL A HG13 2  
ATOM   4305  H  HG21 . VAL A 1 142 ? 16.901  2.112   7.485   1.00 10.00 ? 142 VAL A HG21 2  
ATOM   4306  H  HG22 . VAL A 1 142 ? 16.423  1.262   8.974   1.00 10.00 ? 142 VAL A HG22 2  
ATOM   4307  H  HG23 . VAL A 1 142 ? 17.671  2.514   9.034   1.00 10.00 ? 142 VAL A HG23 2  
ATOM   4308  N  N    . LYS A 1 143 ? 19.053  -2.227  5.968   1.00 10.00 ? 143 LYS A N    2  
ATOM   4309  C  CA   . LYS A 1 143 ? 20.000  -3.336  5.863   1.00 10.00 ? 143 LYS A CA   2  
ATOM   4310  C  C    . LYS A 1 143 ? 20.458  -3.643  4.430   1.00 10.00 ? 143 LYS A C    2  
ATOM   4311  O  O    . LYS A 1 143 ? 20.369  -4.783  3.994   1.00 10.00 ? 143 LYS A O    2  
ATOM   4312  C  CB   . LYS A 1 143 ? 19.431  -4.570  6.600   1.00 10.00 ? 143 LYS A CB   2  
ATOM   4313  C  CG   . LYS A 1 143 ? 18.223  -5.213  5.889   1.00 10.00 ? 143 LYS A CG   2  
ATOM   4314  C  CD   . LYS A 1 143 ? 18.571  -6.620  5.370   1.00 10.00 ? 143 LYS A CD   2  
ATOM   4315  C  CE   . LYS A 1 143 ? 18.031  -6.897  3.962   1.00 10.00 ? 143 LYS A CE   2  
ATOM   4316  N  NZ   . LYS A 1 143 ? 16.575  -7.110  3.951   1.00 10.00 ? 143 LYS A NZ   2  
ATOM   4317  H  H    . LYS A 1 143 ? 18.530  -1.915  5.155   1.00 10.00 ? 143 LYS A H    2  
ATOM   4318  H  HA   . LYS A 1 143 ? 20.911  -3.049  6.389   1.00 10.00 ? 143 LYS A HA   2  
ATOM   4319  H  HB2  . LYS A 1 143 ? 20.238  -5.289  6.738   1.00 10.00 ? 143 LYS A HB2  2  
ATOM   4320  H  HB3  . LYS A 1 143 ? 19.112  -4.283  7.603   1.00 10.00 ? 143 LYS A HB3  2  
ATOM   4321  H  HG2  . LYS A 1 143 ? 17.395  -5.289  6.595   1.00 10.00 ? 143 LYS A HG2  2  
ATOM   4322  H  HG3  . LYS A 1 143 ? 17.908  -4.566  5.069   1.00 10.00 ? 143 LYS A HG3  2  
ATOM   4323  H  HD2  . LYS A 1 143 ? 19.652  -6.734  5.295   1.00 10.00 ? 143 LYS A HD2  2  
ATOM   4324  H  HD3  . LYS A 1 143 ? 18.227  -7.377  6.078   1.00 10.00 ? 143 LYS A HD3  2  
ATOM   4325  H  HE2  . LYS A 1 143 ? 18.313  -6.096  3.276   1.00 10.00 ? 143 LYS A HE2  2  
ATOM   4326  H  HE3  . LYS A 1 143 ? 18.492  -7.821  3.614   1.00 10.00 ? 143 LYS A HE3  2  
ATOM   4327  H  HZ1  . LYS A 1 143 ? 16.397  -7.935  4.525   1.00 10.00 ? 143 LYS A HZ1  2  
ATOM   4328  H  HZ2  . LYS A 1 143 ? 16.083  -6.319  4.332   1.00 10.00 ? 143 LYS A HZ2  2  
ATOM   4329  H  HZ3  . LYS A 1 143 ? 16.262  -7.315  3.015   1.00 10.00 ? 143 LYS A HZ3  2  
ATOM   4330  N  N    . LYS A 1 144 ? 21.039  -2.669  3.721   1.00 10.00 ? 144 LYS A N    2  
ATOM   4331  C  CA   . LYS A 1 144 ? 21.693  -2.919  2.436   1.00 10.00 ? 144 LYS A CA   2  
ATOM   4332  C  C    . LYS A 1 144 ? 20.747  -3.454  1.343   1.00 10.00 ? 144 LYS A C    2  
ATOM   4333  O  O    . LYS A 1 144 ? 19.571  -3.743  1.567   1.00 10.00 ? 144 LYS A O    2  
ATOM   4334  C  CB   . LYS A 1 144 ? 22.964  -3.761  2.632   1.00 10.00 ? 144 LYS A CB   2  
ATOM   4335  C  CG   . LYS A 1 144 ? 23.993  -2.980  3.468   1.00 10.00 ? 144 LYS A CG   2  
ATOM   4336  C  CD   . LYS A 1 144 ? 25.236  -3.814  3.798   1.00 10.00 ? 144 LYS A CD   2  
ATOM   4337  C  CE   . LYS A 1 144 ? 26.090  -4.111  2.556   1.00 10.00 ? 144 LYS A CE   2  
ATOM   4338  N  NZ   . LYS A 1 144 ? 27.156  -5.088  2.846   1.00 10.00 ? 144 LYS A NZ   2  
ATOM   4339  H  H    . LYS A 1 144 ? 21.088  -1.739  4.106   1.00 10.00 ? 144 LYS A H    2  
ATOM   4340  H  HA   . LYS A 1 144 ? 22.061  -1.976  2.056   1.00 10.00 ? 144 LYS A HA   2  
ATOM   4341  H  HB2  . LYS A 1 144 ? 22.724  -4.701  3.127   1.00 10.00 ? 144 LYS A HB2  2  
ATOM   4342  H  HB3  . LYS A 1 144 ? 23.384  -3.983  1.653   1.00 10.00 ? 144 LYS A HB3  2  
ATOM   4343  H  HG2  . LYS A 1 144 ? 24.289  -2.070  2.944   1.00 10.00 ? 144 LYS A HG2  2  
ATOM   4344  H  HG3  . LYS A 1 144 ? 23.536  -2.699  4.417   1.00 10.00 ? 144 LYS A HG3  2  
ATOM   4345  H  HD2  . LYS A 1 144 ? 25.834  -3.269  4.530   1.00 10.00 ? 144 LYS A HD2  2  
ATOM   4346  H  HD3  . LYS A 1 144 ? 24.896  -4.748  4.255   1.00 10.00 ? 144 LYS A HD3  2  
ATOM   4347  H  HE2  . LYS A 1 144 ? 25.462  -4.578  1.797   1.00 10.00 ? 144 LYS A HE2  2  
ATOM   4348  H  HE3  . LYS A 1 144 ? 26.515  -3.196  2.141   1.00 10.00 ? 144 LYS A HE3  2  
ATOM   4349  H  HZ1  . LYS A 1 144 ? 26.810  -5.749  3.545   1.00 10.00 ? 144 LYS A HZ1  2  
ATOM   4350  H  HZ2  . LYS A 1 144 ? 27.231  -5.721  2.043   1.00 10.00 ? 144 LYS A HZ2  2  
ATOM   4351  H  HZ3  . LYS A 1 144 ? 28.041  -4.695  3.118   1.00 10.00 ? 144 LYS A HZ3  2  
ATOM   4352  N  N    . ASN A 1 145 ? 21.252  -3.496  0.108   1.00 10.00 ? 145 ASN A N    2  
ATOM   4353  C  CA   . ASN A 1 145 ? 20.487  -3.945  -1.045  1.00 10.00 ? 145 ASN A CA   2  
ATOM   4354  C  C    . ASN A 1 145 ? 20.369  -5.467  -0.992  1.00 10.00 ? 145 ASN A C    2  
ATOM   4355  O  O    . ASN A 1 145 ? 21.292  -6.158  -1.417  1.00 10.00 ? 145 ASN A O    2  
ATOM   4356  C  CB   . ASN A 1 145 ? 21.183  -3.488  -2.335  1.00 10.00 ? 145 ASN A CB   2  
ATOM   4357  C  CG   . ASN A 1 145 ? 20.479  -4.023  -3.581  1.00 10.00 ? 145 ASN A CG   2  
ATOM   4358  O  OD1  . ASN A 1 145 ? 19.308  -4.382  -3.541  1.00 10.00 ? 145 ASN A OD1  2  
ATOM   4359  N  ND2  . ASN A 1 145 ? 21.174  -4.065  -4.714  1.00 10.00 ? 145 ASN A ND2  2  
ATOM   4360  H  H    . ASN A 1 145 ? 22.218  -3.248  -0.032  1.00 10.00 ? 145 ASN A H    2  
ATOM   4361  H  HA   . ASN A 1 145 ? 19.490  -3.498  -1.024  1.00 10.00 ? 145 ASN A HA   2  
ATOM   4362  H  HB2  . ASN A 1 145 ? 21.185  -2.399  -2.377  1.00 10.00 ? 145 ASN A HB2  2  
ATOM   4363  H  HB3  . ASN A 1 145 ? 22.215  -3.843  -2.334  1.00 10.00 ? 145 ASN A HB3  2  
ATOM   4364  H  HD21 . ASN A 1 145 ? 22.139  -3.774  -4.733  1.00 10.00 ? 145 ASN A HD21 2  
ATOM   4365  H  HD22 . ASN A 1 145 ? 20.740  -4.466  -5.531  1.00 10.00 ? 145 ASN A HD22 2  
ATOM   4366  N  N    . ILE A 1 146 ? 19.265  -5.981  -0.438  1.00 10.00 ? 146 ILE A N    2  
ATOM   4367  C  CA   . ILE A 1 146 ? 18.913  -7.403  -0.361  1.00 10.00 ? 146 ILE A CA   2  
ATOM   4368  C  C    . ILE A 1 146 ? 19.734  -8.140  0.703   1.00 10.00 ? 146 ILE A C    2  
ATOM   4369  O  O    . ILE A 1 146 ? 19.157  -8.886  1.491   1.00 10.00 ? 146 ILE A O    2  
ATOM   4370  C  CB   . ILE A 1 146 ? 18.954  -8.103  -1.742  1.00 10.00 ? 146 ILE A CB   2  
ATOM   4371  C  CG1  . ILE A 1 146 ? 17.939  -7.452  -2.700  1.00 10.00 ? 146 ILE A CG1  2  
ATOM   4372  C  CG2  . ILE A 1 146 ? 18.636  -9.601  -1.604  1.00 10.00 ? 146 ILE A CG2  2  
ATOM   4373  C  CD1  . ILE A 1 146 ? 18.241  -7.761  -4.171  1.00 10.00 ? 146 ILE A CD1  2  
ATOM   4374  H  H    . ILE A 1 146 ? 18.630  -5.320  -0.011  1.00 10.00 ? 146 ILE A H    2  
ATOM   4375  H  HA   . ILE A 1 146 ? 17.878  -7.444  -0.023  1.00 10.00 ? 146 ILE A HA   2  
ATOM   4376  H  HB   . ILE A 1 146 ? 19.951  -8.027  -2.172  1.00 10.00 ? 146 ILE A HB   2  
ATOM   4377  H  HG12 . ILE A 1 146 ? 16.933  -7.792  -2.454  1.00 10.00 ? 146 ILE A HG12 2  
ATOM   4378  H  HG13 . ILE A 1 146 ? 17.963  -6.369  -2.593  1.00 10.00 ? 146 ILE A HG13 2  
ATOM   4379  H  HG21 . ILE A 1 146 ? 18.608  -10.078 -2.582  1.00 10.00 ? 146 ILE A HG21 2  
ATOM   4380  H  HG22 . ILE A 1 146 ? 19.406  -10.104 -1.019  1.00 10.00 ? 146 ILE A HG22 2  
ATOM   4381  H  HG23 . ILE A 1 146 ? 17.671  -9.738  -1.115  1.00 10.00 ? 146 ILE A HG23 2  
ATOM   4382  H  HD11 . ILE A 1 146 ? 19.250  -7.430  -4.418  1.00 10.00 ? 146 ILE A HD11 2  
ATOM   4383  H  HD12 . ILE A 1 146 ? 18.149  -8.827  -4.374  1.00 10.00 ? 146 ILE A HD12 2  
ATOM   4384  H  HD13 . ILE A 1 146 ? 17.532  -7.224  -4.801  1.00 10.00 ? 146 ILE A HD13 2  
ATOM   4385  N  N    . GLU A 1 147 ? 21.055  -7.943  0.704   1.00 10.00 ? 147 GLU A N    2  
ATOM   4386  C  CA   . GLU A 1 147 ? 22.027  -8.579  1.583   1.00 10.00 ? 147 GLU A CA   2  
ATOM   4387  C  C    . GLU A 1 147 ? 21.485  -8.840  2.994   1.00 10.00 ? 147 GLU A C    2  
ATOM   4388  O  O    . GLU A 1 147 ? 21.074  -7.910  3.684   1.00 10.00 ? 147 GLU A O    2  
ATOM   4389  C  CB   . GLU A 1 147 ? 23.283  -7.698  1.644   1.00 10.00 ? 147 GLU A CB   2  
ATOM   4390  C  CG   . GLU A 1 147 ? 24.446  -8.440  2.321   1.00 10.00 ? 147 GLU A CG   2  
ATOM   4391  C  CD   . GLU A 1 147 ? 25.633  -7.524  2.545   1.00 10.00 ? 147 GLU A CD   2  
ATOM   4392  O  OE1  . GLU A 1 147 ? 26.284  -7.117  1.556   1.00 10.00 ? 147 GLU A OE1  2  
ATOM   4393  O  OE2  . GLU A 1 147 ? 25.868  -7.133  3.710   1.00 10.00 ? 147 GLU A OE2  2  
ATOM   4394  H  H    . GLU A 1 147 ? 21.424  -7.347  -0.026  1.00 10.00 ? 147 GLU A H    2  
ATOM   4395  H  HA   . GLU A 1 147 ? 22.294  -9.527  1.115   1.00 10.00 ? 147 GLU A HA   2  
ATOM   4396  H  HB2  . GLU A 1 147 ? 23.592  -7.451  0.631   1.00 10.00 ? 147 GLU A HB2  2  
ATOM   4397  H  HB3  . GLU A 1 147 ? 23.059  -6.762  2.170   1.00 10.00 ? 147 GLU A HB3  2  
ATOM   4398  H  HG2  . GLU A 1 147 ? 24.142  -8.823  3.295   1.00 10.00 ? 147 GLU A HG2  2  
ATOM   4399  H  HG3  . GLU A 1 147 ? 24.763  -9.277  1.698   1.00 10.00 ? 147 GLU A HG3  2  
ATOM   4400  N  N    . GLY A 1 148 ? 21.527  -10.101 3.430   1.00 10.00 ? 148 GLY A N    2  
ATOM   4401  C  CA   . GLY A 1 148 ? 21.200  -10.510 4.786   1.00 10.00 ? 148 GLY A CA   2  
ATOM   4402  C  C    . GLY A 1 148 ? 19.995  -11.442 4.780   1.00 10.00 ? 148 GLY A C    2  
ATOM   4403  O  O    . GLY A 1 148 ? 20.151  -12.643 4.577   1.00 10.00 ? 148 GLY A O    2  
ATOM   4404  H  H    . GLY A 1 148 ? 21.840  -10.819 2.794   1.00 10.00 ? 148 GLY A H    2  
ATOM   4405  H  HA2  . GLY A 1 148 ? 22.055  -11.052 5.191   1.00 10.00 ? 148 GLY A HA2  2  
ATOM   4406  H  HA3  . GLY A 1 148 ? 21.005  -9.656  5.435   1.00 10.00 ? 148 GLY A HA3  2  
ATOM   4407  N  N    . ARG A 1 149 ? 18.805  -10.890 5.021   1.00 10.00 ? 149 ARG A N    2  
ATOM   4408  C  CA   . ARG A 1 149 ? 17.545  -11.599 5.174   1.00 10.00 ? 149 ARG A CA   2  
ATOM   4409  C  C    . ARG A 1 149 ? 16.460  -10.531 5.340   1.00 10.00 ? 149 ARG A C    2  
ATOM   4410  O  O    . ARG A 1 149 ? 16.823  -9.339  5.240   1.00 10.00 ? 149 ARG A O    2  
ATOM   4411  C  CB   . ARG A 1 149 ? 17.597  -12.579 6.368   1.00 10.00 ? 149 ARG A CB   2  
ATOM   4412  C  CG   . ARG A 1 149 ? 17.950  -11.928 7.723   1.00 10.00 ? 149 ARG A CG   2  
ATOM   4413  C  CD   . ARG A 1 149 ? 16.817  -12.082 8.750   1.00 10.00 ? 149 ARG A CD   2  
ATOM   4414  N  NE   . ARG A 1 149 ? 15.585  -11.507 8.199   1.00 10.00 ? 149 ARG A NE   2  
ATOM   4415  C  CZ   . ARG A 1 149 ? 14.339  -11.963 8.342   1.00 10.00 ? 149 ARG A CZ   2  
ATOM   4416  N  NH1  . ARG A 1 149 ? 13.989  -12.666 9.424   1.00 10.00 ? 149 ARG A NH1  2  
ATOM   4417  N  NH2  . ARG A 1 149 ? 13.476  -11.705 7.358   1.00 10.00 ? 149 ARG A NH2  2  
ATOM   4418  O  OXT  . ARG A 1 149 ? 15.301  -10.885 5.655   1.00 10.00 ? 149 ARG A OXT  2  
ATOM   4419  H  H    . ARG A 1 149 ? 18.708  -9.881  5.079   1.00 10.00 ? 149 ARG A H    2  
ATOM   4420  H  HA   . ARG A 1 149 ? 17.338  -12.160 4.262   1.00 10.00 ? 149 ARG A HA   2  
ATOM   4421  H  HB2  . ARG A 1 149 ? 16.638  -13.092 6.428   1.00 10.00 ? 149 ARG A HB2  2  
ATOM   4422  H  HB3  . ARG A 1 149 ? 18.340  -13.349 6.158   1.00 10.00 ? 149 ARG A HB3  2  
ATOM   4423  H  HG2  . ARG A 1 149 ? 18.850  -12.403 8.119   1.00 10.00 ? 149 ARG A HG2  2  
ATOM   4424  H  HG3  . ARG A 1 149 ? 18.165  -10.867 7.589   1.00 10.00 ? 149 ARG A HG3  2  
ATOM   4425  H  HD2  . ARG A 1 149 ? 16.688  -13.145 8.964   1.00 10.00 ? 149 ARG A HD2  2  
ATOM   4426  H  HD3  . ARG A 1 149 ? 17.091  -11.560 9.668   1.00 10.00 ? 149 ARG A HD3  2  
ATOM   4427  H  HE   . ARG A 1 149 ? 15.708  -10.941 7.362   1.00 10.00 ? 149 ARG A HE   2  
ATOM   4428  H  HH11 . ARG A 1 149 ? 14.675  -12.814 10.149  1.00 10.00 ? 149 ARG A HH11 2  
ATOM   4429  H  HH12 . ARG A 1 149 ? 13.055  -13.027 9.542   1.00 10.00 ? 149 ARG A HH12 2  
ATOM   4430  H  HH21 . ARG A 1 149 ? 13.901  -11.297 6.510   1.00 10.00 ? 149 ARG A HH21 2  
ATOM   4431  H  HH22 . ARG A 1 149 ? 12.513  -11.997 7.354   1.00 10.00 ? 149 ARG A HH22 2  
HETATM 4432  CU CU   . CU1 B 2 .   ? 16.160  8.179   -7.362  1.00 10.00 ? 150 CU1 A CU   2  
ATOM   4433  N  N    . MET A 1 1   ? -67.767 -27.851 3.432   1.00 10.00 ? 1   MET A N    3  
ATOM   4434  C  CA   . MET A 1 1   ? -67.469 -26.547 4.051   1.00 10.00 ? 1   MET A CA   3  
ATOM   4435  C  C    . MET A 1 1   ? -66.122 -26.685 4.750   1.00 10.00 ? 1   MET A C    3  
ATOM   4436  O  O    . MET A 1 1   ? -65.684 -27.818 4.938   1.00 10.00 ? 1   MET A O    3  
ATOM   4437  C  CB   . MET A 1 1   ? -68.561 -26.125 5.044   1.00 10.00 ? 1   MET A CB   3  
ATOM   4438  C  CG   . MET A 1 1   ? -69.887 -25.767 4.361   1.00 10.00 ? 1   MET A CG   3  
ATOM   4439  S  SD   . MET A 1 1   ? -71.156 -25.163 5.504   1.00 10.00 ? 1   MET A SD   3  
ATOM   4440  C  CE   . MET A 1 1   ? -72.498 -24.823 4.344   1.00 10.00 ? 1   MET A CE   3  
ATOM   4441  H  H1   . MET A 1 1   ? -67.601 -28.545 4.151   1.00 10.00 ? 1   MET A H1   3  
ATOM   4442  H  H2   . MET A 1 1   ? -68.708 -27.903 3.075   1.00 10.00 ? 1   MET A H2   3  
ATOM   4443  H  H3   . MET A 1 1   ? -67.091 -28.020 2.701   1.00 10.00 ? 1   MET A H3   3  
ATOM   4444  H  HA   . MET A 1 1   ? -67.384 -25.793 3.267   1.00 10.00 ? 1   MET A HA   3  
ATOM   4445  H  HB2  . MET A 1 1   ? -68.731 -26.922 5.770   1.00 10.00 ? 1   MET A HB2  3  
ATOM   4446  H  HB3  . MET A 1 1   ? -68.223 -25.238 5.583   1.00 10.00 ? 1   MET A HB3  3  
ATOM   4447  H  HG2  . MET A 1 1   ? -69.710 -24.981 3.626   1.00 10.00 ? 1   MET A HG2  3  
ATOM   4448  H  HG3  . MET A 1 1   ? -70.296 -26.640 3.855   1.00 10.00 ? 1   MET A HG3  3  
ATOM   4449  H  HE1  . MET A 1 1   ? -72.778 -25.742 3.830   1.00 10.00 ? 1   MET A HE1  3  
ATOM   4450  H  HE2  . MET A 1 1   ? -73.355 -24.442 4.899   1.00 10.00 ? 1   MET A HE2  3  
ATOM   4451  H  HE3  . MET A 1 1   ? -72.174 -24.077 3.620   1.00 10.00 ? 1   MET A HE3  3  
ATOM   4452  N  N    . GLY A 1 2   ? -65.480 -25.571 5.105   1.00 10.00 ? 2   GLY A N    3  
ATOM   4453  C  CA   . GLY A 1 2   ? -64.096 -25.583 5.556   1.00 10.00 ? 2   GLY A CA   3  
ATOM   4454  C  C    . GLY A 1 2   ? -63.152 -25.726 4.361   1.00 10.00 ? 2   GLY A C    3  
ATOM   4455  O  O    . GLY A 1 2   ? -63.580 -26.098 3.267   1.00 10.00 ? 2   GLY A O    3  
ATOM   4456  H  H    . GLY A 1 2   ? -65.899 -24.673 4.918   1.00 10.00 ? 2   GLY A H    3  
ATOM   4457  H  HA2  . GLY A 1 2   ? -63.890 -24.641 6.066   1.00 10.00 ? 2   GLY A HA2  3  
ATOM   4458  H  HA3  . GLY A 1 2   ? -63.925 -26.404 6.255   1.00 10.00 ? 2   GLY A HA3  3  
ATOM   4459  N  N    . HIS A 1 3   ? -61.879 -25.388 4.567   1.00 10.00 ? 3   HIS A N    3  
ATOM   4460  C  CA   . HIS A 1 3   ? -60.820 -25.444 3.569   1.00 10.00 ? 3   HIS A CA   3  
ATOM   4461  C  C    . HIS A 1 3   ? -59.863 -26.591 3.919   1.00 10.00 ? 3   HIS A C    3  
ATOM   4462  O  O    . HIS A 1 3   ? -60.207 -27.487 4.687   1.00 10.00 ? 3   HIS A O    3  
ATOM   4463  C  CB   . HIS A 1 3   ? -60.101 -24.085 3.570   1.00 10.00 ? 3   HIS A CB   3  
ATOM   4464  C  CG   . HIS A 1 3   ? -59.347 -23.830 4.852   1.00 10.00 ? 3   HIS A CG   3  
ATOM   4465  N  ND1  . HIS A 1 3   ? -59.870 -24.029 6.131   1.00 10.00 ? 3   HIS A ND1  3  
ATOM   4466  C  CD2  . HIS A 1 3   ? -58.025 -23.502 4.946   1.00 10.00 ? 3   HIS A CD2  3  
ATOM   4467  C  CE1  . HIS A 1 3   ? -58.849 -23.800 6.971   1.00 10.00 ? 3   HIS A CE1  3  
ATOM   4468  N  NE2  . HIS A 1 3   ? -57.732 -23.484 6.290   1.00 10.00 ? 3   HIS A NE2  3  
ATOM   4469  H  H    . HIS A 1 3   ? -61.578 -25.089 5.489   1.00 10.00 ? 3   HIS A H    3  
ATOM   4470  H  HA   . HIS A 1 3   ? -61.230 -25.620 2.574   1.00 10.00 ? 3   HIS A HA   3  
ATOM   4471  H  HB2  . HIS A 1 3   ? -59.412 -24.030 2.726   1.00 10.00 ? 3   HIS A HB2  3  
ATOM   4472  H  HB3  . HIS A 1 3   ? -60.840 -23.294 3.442   1.00 10.00 ? 3   HIS A HB3  3  
ATOM   4473  H  HD2  . HIS A 1 3   ? -57.337 -23.330 4.130   1.00 10.00 ? 3   HIS A HD2  3  
ATOM   4474  H  HE1  . HIS A 1 3   ? -58.913 -23.871 8.047   1.00 10.00 ? 3   HIS A HE1  3  
ATOM   4475  H  HE2  . HIS A 1 3   ? -56.829 -23.285 6.698   1.00 10.00 ? 3   HIS A HE2  3  
ATOM   4476  N  N    . THR A 1 4   ? -58.642 -26.545 3.385   1.00 10.00 ? 4   THR A N    3  
ATOM   4477  C  CA   . THR A 1 4   ? -57.519 -27.358 3.818   1.00 10.00 ? 4   THR A CA   3  
ATOM   4478  C  C    . THR A 1 4   ? -56.253 -26.600 3.419   1.00 10.00 ? 4   THR A C    3  
ATOM   4479  O  O    . THR A 1 4   ? -56.350 -25.481 2.911   1.00 10.00 ? 4   THR A O    3  
ATOM   4480  C  CB   . THR A 1 4   ? -57.605 -28.780 3.236   1.00 10.00 ? 4   THR A CB   3  
ATOM   4481  O  OG1  . THR A 1 4   ? -56.520 -29.554 3.714   1.00 10.00 ? 4   THR A OG1  3  
ATOM   4482  C  CG2  . THR A 1 4   ? -57.598 -28.796 1.703   1.00 10.00 ? 4   THR A CG2  3  
ATOM   4483  H  H    . THR A 1 4   ? -58.377 -25.771 2.789   1.00 10.00 ? 4   THR A H    3  
ATOM   4484  H  HA   . THR A 1 4   ? -57.535 -27.429 4.908   1.00 10.00 ? 4   THR A HA   3  
ATOM   4485  H  HB   . THR A 1 4   ? -58.530 -29.243 3.584   1.00 10.00 ? 4   THR A HB   3  
ATOM   4486  H  HG1  . THR A 1 4   ? -56.653 -30.471 3.458   1.00 10.00 ? 4   THR A HG1  3  
ATOM   4487  H  HG21 . THR A 1 4   ? -58.442 -28.223 1.317   1.00 10.00 ? 4   THR A HG21 3  
ATOM   4488  H  HG22 . THR A 1 4   ? -56.671 -28.370 1.319   1.00 10.00 ? 4   THR A HG22 3  
ATOM   4489  H  HG23 . THR A 1 4   ? -57.686 -29.823 1.348   1.00 10.00 ? 4   THR A HG23 3  
ATOM   4490  N  N    . MET A 1 5   ? -55.082 -27.197 3.643   1.00 10.00 ? 5   MET A N    3  
ATOM   4491  C  CA   . MET A 1 5   ? -53.786 -26.605 3.350   1.00 10.00 ? 5   MET A CA   3  
ATOM   4492  C  C    . MET A 1 5   ? -52.761 -27.727 3.161   1.00 10.00 ? 5   MET A C    3  
ATOM   4493  O  O    . MET A 1 5   ? -52.890 -28.767 3.806   1.00 10.00 ? 5   MET A O    3  
ATOM   4494  C  CB   . MET A 1 5   ? -53.381 -25.639 4.476   1.00 10.00 ? 5   MET A CB   3  
ATOM   4495  C  CG   . MET A 1 5   ? -53.292 -26.315 5.854   1.00 10.00 ? 5   MET A CG   3  
ATOM   4496  S  SD   . MET A 1 5   ? -53.014 -25.201 7.256   1.00 10.00 ? 5   MET A SD   3  
ATOM   4497  C  CE   . MET A 1 5   ? -51.391 -24.525 6.841   1.00 10.00 ? 5   MET A CE   3  
ATOM   4498  H  H    . MET A 1 5   ? -55.100 -28.164 3.960   1.00 10.00 ? 5   MET A H    3  
ATOM   4499  H  HA   . MET A 1 5   ? -53.883 -26.036 2.425   1.00 10.00 ? 5   MET A HA   3  
ATOM   4500  H  HB2  . MET A 1 5   ? -52.414 -25.202 4.230   1.00 10.00 ? 5   MET A HB2  3  
ATOM   4501  H  HB3  . MET A 1 5   ? -54.116 -24.834 4.533   1.00 10.00 ? 5   MET A HB3  3  
ATOM   4502  H  HG2  . MET A 1 5   ? -54.227 -26.833 6.061   1.00 10.00 ? 5   MET A HG2  3  
ATOM   4503  H  HG3  . MET A 1 5   ? -52.486 -27.049 5.852   1.00 10.00 ? 5   MET A HG3  3  
ATOM   4504  H  HE1  . MET A 1 5   ? -51.455 -23.947 5.922   1.00 10.00 ? 5   MET A HE1  3  
ATOM   4505  H  HE2  . MET A 1 5   ? -51.065 -23.875 7.652   1.00 10.00 ? 5   MET A HE2  3  
ATOM   4506  H  HE3  . MET A 1 5   ? -50.679 -25.341 6.719   1.00 10.00 ? 5   MET A HE3  3  
ATOM   4507  N  N    . PRO A 1 6   ? -51.764 -27.555 2.279   1.00 10.00 ? 6   PRO A N    3  
ATOM   4508  C  CA   . PRO A 1 6   ? -50.731 -28.552 2.057   1.00 10.00 ? 6   PRO A CA   3  
ATOM   4509  C  C    . PRO A 1 6   ? -49.709 -28.533 3.197   1.00 10.00 ? 6   PRO A C    3  
ATOM   4510  O  O    . PRO A 1 6   ? -49.617 -27.567 3.956   1.00 10.00 ? 6   PRO A O    3  
ATOM   4511  C  CB   . PRO A 1 6   ? -50.083 -28.154 0.728   1.00 10.00 ? 6   PRO A CB   3  
ATOM   4512  C  CG   . PRO A 1 6   ? -50.211 -26.631 0.733   1.00 10.00 ? 6   PRO A CG   3  
ATOM   4513  C  CD   . PRO A 1 6   ? -51.561 -26.403 1.414   1.00 10.00 ? 6   PRO A CD   3  
ATOM   4514  H  HA   . PRO A 1 6   ? -51.168 -29.549 1.973   1.00 10.00 ? 6   PRO A HA   3  
ATOM   4515  H  HB2  . PRO A 1 6   ? -49.046 -28.482 0.642   1.00 10.00 ? 6   PRO A HB2  3  
ATOM   4516  H  HB3  . PRO A 1 6   ? -50.673 -28.559 -0.097  1.00 10.00 ? 6   PRO A HB3  3  
ATOM   4517  H  HG2  . PRO A 1 6   ? -49.417 -26.204 1.348   1.00 10.00 ? 6   PRO A HG2  3  
ATOM   4518  H  HG3  . PRO A 1 6   ? -50.174 -26.206 -0.271  1.00 10.00 ? 6   PRO A HG3  3  
ATOM   4519  H  HD2  . PRO A 1 6   ? -51.546 -25.466 1.972   1.00 10.00 ? 6   PRO A HD2  3  
ATOM   4520  H  HD3  . PRO A 1 6   ? -52.346 -26.377 0.657   1.00 10.00 ? 6   PRO A HD3  3  
ATOM   4521  N  N    . ALA A 1 7   ? -48.892 -29.587 3.282   1.00 10.00 ? 7   ALA A N    3  
ATOM   4522  C  CA   . ALA A 1 7   ? -47.756 -29.649 4.193   1.00 10.00 ? 7   ALA A CA   3  
ATOM   4523  C  C    . ALA A 1 7   ? -46.643 -28.732 3.676   1.00 10.00 ? 7   ALA A C    3  
ATOM   4524  O  O    . ALA A 1 7   ? -45.623 -29.199 3.168   1.00 10.00 ? 7   ALA A O    3  
ATOM   4525  C  CB   . ALA A 1 7   ? -47.290 -31.103 4.329   1.00 10.00 ? 7   ALA A CB   3  
ATOM   4526  H  H    . ALA A 1 7   ? -49.006 -30.344 2.624   1.00 10.00 ? 7   ALA A H    3  
ATOM   4527  H  HA   . ALA A 1 7   ? -48.063 -29.305 5.183   1.00 10.00 ? 7   ALA A HA   3  
ATOM   4528  H  HB1  . ALA A 1 7   ? -46.988 -31.497 3.358   1.00 10.00 ? 7   ALA A HB1  3  
ATOM   4529  H  HB2  . ALA A 1 7   ? -46.442 -31.152 5.013   1.00 10.00 ? 7   ALA A HB2  3  
ATOM   4530  H  HB3  . ALA A 1 7   ? -48.101 -31.713 4.727   1.00 10.00 ? 7   ALA A HB3  3  
ATOM   4531  N  N    . HIS A 1 8   ? -46.860 -27.419 3.778   1.00 10.00 ? 8   HIS A N    3  
ATOM   4532  C  CA   . HIS A 1 8   ? -45.981 -26.400 3.220   1.00 10.00 ? 8   HIS A CA   3  
ATOM   4533  C  C    . HIS A 1 8   ? -44.648 -26.323 3.973   1.00 10.00 ? 8   HIS A C    3  
ATOM   4534  O  O    . HIS A 1 8   ? -44.403 -25.394 4.741   1.00 10.00 ? 8   HIS A O    3  
ATOM   4535  C  CB   . HIS A 1 8   ? -46.707 -25.049 3.200   1.00 10.00 ? 8   HIS A CB   3  
ATOM   4536  C  CG   . HIS A 1 8   ? -45.933 -23.993 2.454   1.00 10.00 ? 8   HIS A CG   3  
ATOM   4537  N  ND1  . HIS A 1 8   ? -45.783 -23.952 1.068   1.00 10.00 ? 8   HIS A ND1  3  
ATOM   4538  C  CD2  . HIS A 1 8   ? -45.215 -22.979 3.019   1.00 10.00 ? 8   HIS A CD2  3  
ATOM   4539  C  CE1  . HIS A 1 8   ? -44.975 -22.908 0.828   1.00 10.00 ? 8   HIS A CE1  3  
ATOM   4540  N  NE2  . HIS A 1 8   ? -44.619 -22.307 1.978   1.00 10.00 ? 8   HIS A NE2  3  
ATOM   4541  H  H    . HIS A 1 8   ? -47.765 -27.132 4.140   1.00 10.00 ? 8   HIS A H    3  
ATOM   4542  H  HA   . HIS A 1 8   ? -45.769 -26.667 2.182   1.00 10.00 ? 8   HIS A HA   3  
ATOM   4543  H  HB2  . HIS A 1 8   ? -47.668 -25.170 2.700   1.00 10.00 ? 8   HIS A HB2  3  
ATOM   4544  H  HB3  . HIS A 1 8   ? -46.895 -24.714 4.221   1.00 10.00 ? 8   HIS A HB3  3  
ATOM   4545  H  HD2  . HIS A 1 8   ? -45.105 -22.776 4.075   1.00 10.00 ? 8   HIS A HD2  3  
ATOM   4546  H  HE1  . HIS A 1 8   ? -44.651 -22.598 -0.154  1.00 10.00 ? 8   HIS A HE1  3  
ATOM   4547  H  HE2  . HIS A 1 8   ? -44.005 -21.509 2.059   1.00 10.00 ? 8   HIS A HE2  3  
ATOM   4548  N  N    . THR A 1 9   ? -43.770 -27.301 3.745   1.00 10.00 ? 9   THR A N    3  
ATOM   4549  C  CA   . THR A 1 9   ? -42.396 -27.249 4.225   1.00 10.00 ? 9   THR A CA   3  
ATOM   4550  C  C    . THR A 1 9   ? -41.702 -25.998 3.671   1.00 10.00 ? 9   THR A C    3  
ATOM   4551  O  O    . THR A 1 9   ? -41.936 -25.634 2.517   1.00 10.00 ? 9   THR A O    3  
ATOM   4552  C  CB   . THR A 1 9   ? -41.639 -28.532 3.829   1.00 10.00 ? 9   THR A CB   3  
ATOM   4553  O  OG1  . THR A 1 9   ? -40.308 -28.511 4.313   1.00 10.00 ? 9   THR A OG1  3  
ATOM   4554  C  CG2  . THR A 1 9   ? -41.603 -28.795 2.318   1.00 10.00 ? 9   THR A CG2  3  
ATOM   4555  H  H    . THR A 1 9   ? -44.083 -28.090 3.190   1.00 10.00 ? 9   THR A H    3  
ATOM   4556  H  HA   . THR A 1 9   ? -42.451 -27.203 5.313   1.00 10.00 ? 9   THR A HA   3  
ATOM   4557  H  HB   . THR A 1 9   ? -42.145 -29.376 4.303   1.00 10.00 ? 9   THR A HB   3  
ATOM   4558  H  HG1  . THR A 1 9   ? -39.780 -27.861 3.824   1.00 10.00 ? 9   THR A HG1  3  
ATOM   4559  H  HG21 . THR A 1 9   ? -42.611 -28.870 1.913   1.00 10.00 ? 9   THR A HG21 3  
ATOM   4560  H  HG22 . THR A 1 9   ? -41.067 -27.999 1.800   1.00 10.00 ? 9   THR A HG22 3  
ATOM   4561  H  HG23 . THR A 1 9   ? -41.086 -29.738 2.133   1.00 10.00 ? 9   THR A HG23 3  
ATOM   4562  N  N    . PRO A 1 10  ? -40.807 -25.356 4.438   1.00 10.00 ? 10  PRO A N    3  
ATOM   4563  C  CA   . PRO A 1 10  ? -39.852 -24.436 3.851   1.00 10.00 ? 10  PRO A CA   3  
ATOM   4564  C  C    . PRO A 1 10  ? -38.889 -25.235 2.959   1.00 10.00 ? 10  PRO A C    3  
ATOM   4565  O  O    . PRO A 1 10  ? -38.736 -26.445 3.156   1.00 10.00 ? 10  PRO A O    3  
ATOM   4566  C  CB   . PRO A 1 10  ? -39.126 -23.802 5.041   1.00 10.00 ? 10  PRO A CB   3  
ATOM   4567  C  CG   . PRO A 1 10  ? -39.154 -24.914 6.091   1.00 10.00 ? 10  PRO A CG   3  
ATOM   4568  C  CD   . PRO A 1 10  ? -40.498 -25.600 5.839   1.00 10.00 ? 10  PRO A CD   3  
ATOM   4569  H  HA   . PRO A 1 10  ? -40.379 -23.670 3.280   1.00 10.00 ? 10  PRO A HA   3  
ATOM   4570  H  HB2  . PRO A 1 10  ? -38.108 -23.491 4.799   1.00 10.00 ? 10  PRO A HB2  3  
ATOM   4571  H  HB3  . PRO A 1 10  ? -39.703 -22.951 5.404   1.00 10.00 ? 10  PRO A HB3  3  
ATOM   4572  H  HG2  . PRO A 1 10  ? -38.346 -25.618 5.888   1.00 10.00 ? 10  PRO A HG2  3  
ATOM   4573  H  HG3  . PRO A 1 10  ? -39.069 -24.528 7.107   1.00 10.00 ? 10  PRO A HG3  3  
ATOM   4574  H  HD2  . PRO A 1 10  ? -40.410 -26.659 6.083   1.00 10.00 ? 10  PRO A HD2  3  
ATOM   4575  H  HD3  . PRO A 1 10  ? -41.272 -25.140 6.456   1.00 10.00 ? 10  PRO A HD3  3  
ATOM   4576  N  N    . PRO A 1 11  ? -38.241 -24.583 1.983   1.00 10.00 ? 11  PRO A N    3  
ATOM   4577  C  CA   . PRO A 1 11  ? -37.178 -25.179 1.192   1.00 10.00 ? 11  PRO A CA   3  
ATOM   4578  C  C    . PRO A 1 11  ? -35.863 -25.152 1.982   1.00 10.00 ? 11  PRO A C    3  
ATOM   4579  O  O    . PRO A 1 11  ? -35.802 -24.639 3.100   1.00 10.00 ? 11  PRO A O    3  
ATOM   4580  C  CB   . PRO A 1 11  ? -37.093 -24.288 -0.052  1.00 10.00 ? 11  PRO A CB   3  
ATOM   4581  C  CG   . PRO A 1 11  ? -37.414 -22.903 0.512   1.00 10.00 ? 11  PRO A CG   3  
ATOM   4582  C  CD   . PRO A 1 11  ? -38.470 -23.204 1.578   1.00 10.00 ? 11  PRO A CD   3  
ATOM   4583  H  HA   . PRO A 1 11  ? -37.417 -26.204 0.906   1.00 10.00 ? 11  PRO A HA   3  
ATOM   4584  H  HB2  . PRO A 1 11  ? -36.119 -24.314 -0.543  1.00 10.00 ? 11  PRO A HB2  3  
ATOM   4585  H  HB3  . PRO A 1 11  ? -37.873 -24.579 -0.757  1.00 10.00 ? 11  PRO A HB3  3  
ATOM   4586  H  HG2  . PRO A 1 11  ? -36.521 -22.492 0.988   1.00 10.00 ? 11  PRO A HG2  3  
ATOM   4587  H  HG3  . PRO A 1 11  ? -37.779 -22.218 -0.254  1.00 10.00 ? 11  PRO A HG3  3  
ATOM   4588  H  HD2  . PRO A 1 11  ? -38.370 -22.510 2.413   1.00 10.00 ? 11  PRO A HD2  3  
ATOM   4589  H  HD3  . PRO A 1 11  ? -39.464 -23.121 1.134   1.00 10.00 ? 11  PRO A HD3  3  
ATOM   4590  N  N    . ALA A 1 12  ? -34.785 -25.658 1.373   1.00 10.00 ? 12  ALA A N    3  
ATOM   4591  C  CA   . ALA A 1 12  ? -33.439 -25.402 1.866   1.00 10.00 ? 12  ALA A CA   3  
ATOM   4592  C  C    . ALA A 1 12  ? -33.144 -23.900 1.778   1.00 10.00 ? 12  ALA A C    3  
ATOM   4593  O  O    . ALA A 1 12  ? -33.695 -23.211 0.919   1.00 10.00 ? 12  ALA A O    3  
ATOM   4594  C  CB   . ALA A 1 12  ? -32.426 -26.210 1.051   1.00 10.00 ? 12  ALA A CB   3  
ATOM   4595  H  H    . ALA A 1 12  ? -34.885 -26.044 0.448   1.00 10.00 ? 12  ALA A H    3  
ATOM   4596  H  HA   . ALA A 1 12  ? -33.381 -25.722 2.908   1.00 10.00 ? 12  ALA A HA   3  
ATOM   4597  H  HB1  . ALA A 1 12  ? -32.653 -27.274 1.129   1.00 10.00 ? 12  ALA A HB1  3  
ATOM   4598  H  HB2  . ALA A 1 12  ? -32.463 -25.909 0.003   1.00 10.00 ? 12  ALA A HB2  3  
ATOM   4599  H  HB3  . ALA A 1 12  ? -31.421 -26.034 1.436   1.00 10.00 ? 12  ALA A HB3  3  
ATOM   4600  N  N    . GLN A 1 13  ? -32.279 -23.396 2.664   1.00 10.00 ? 13  GLN A N    3  
ATOM   4601  C  CA   . GLN A 1 13  ? -31.935 -21.983 2.758   1.00 10.00 ? 13  GLN A CA   3  
ATOM   4602  C  C    . GLN A 1 13  ? -30.447 -21.777 2.477   1.00 10.00 ? 13  GLN A C    3  
ATOM   4603  O  O    . GLN A 1 13  ? -29.648 -22.700 2.625   1.00 10.00 ? 13  GLN A O    3  
ATOM   4604  C  CB   . GLN A 1 13  ? -32.328 -21.443 4.141   1.00 10.00 ? 13  GLN A CB   3  
ATOM   4605  C  CG   . GLN A 1 13  ? -31.625 -22.168 5.299   1.00 10.00 ? 13  GLN A CG   3  
ATOM   4606  C  CD   . GLN A 1 13  ? -31.962 -21.531 6.642   1.00 10.00 ? 13  GLN A CD   3  
ATOM   4607  O  OE1  . GLN A 1 13  ? -31.105 -20.943 7.291   1.00 10.00 ? 13  GLN A OE1  3  
ATOM   4608  N  NE2  . GLN A 1 13  ? -33.215 -21.639 7.073   1.00 10.00 ? 13  GLN A NE2  3  
ATOM   4609  H  H    . GLN A 1 13  ? -31.787 -24.028 3.276   1.00 10.00 ? 13  GLN A H    3  
ATOM   4610  H  HA   . GLN A 1 13  ? -32.493 -21.409 2.016   1.00 10.00 ? 13  GLN A HA   3  
ATOM   4611  H  HB2  . GLN A 1 13  ? -32.076 -20.382 4.188   1.00 10.00 ? 13  GLN A HB2  3  
ATOM   4612  H  HB3  . GLN A 1 13  ? -33.408 -21.543 4.260   1.00 10.00 ? 13  GLN A HB3  3  
ATOM   4613  H  HG2  . GLN A 1 13  ? -31.924 -23.216 5.327   1.00 10.00 ? 13  GLN A HG2  3  
ATOM   4614  H  HG3  . GLN A 1 13  ? -30.543 -22.119 5.167   1.00 10.00 ? 13  GLN A HG3  3  
ATOM   4615  H  HE21 . GLN A 1 13  ? -33.907 -22.124 6.523   1.00 10.00 ? 13  GLN A HE21 3  
ATOM   4616  H  HE22 . GLN A 1 13  ? -33.453 -21.221 7.960   1.00 10.00 ? 13  GLN A HE22 3  
ATOM   4617  N  N    . THR A 1 14  ? -30.078 -20.552 2.102   1.00 10.00 ? 14  THR A N    3  
ATOM   4618  C  CA   . THR A 1 14  ? -28.710 -20.085 1.954   1.00 10.00 ? 14  THR A CA   3  
ATOM   4619  C  C    . THR A 1 14  ? -28.785 -18.557 1.894   1.00 10.00 ? 14  THR A C    3  
ATOM   4620  O  O    . THR A 1 14  ? -29.886 -18.014 1.783   1.00 10.00 ? 14  THR A O    3  
ATOM   4621  C  CB   . THR A 1 14  ? -28.049 -20.706 0.709   1.00 10.00 ? 14  THR A CB   3  
ATOM   4622  O  OG1  . THR A 1 14  ? -26.688 -20.327 0.651   1.00 10.00 ? 14  THR A OG1  3  
ATOM   4623  C  CG2  . THR A 1 14  ? -28.739 -20.294 -0.597  1.00 10.00 ? 14  THR A CG2  3  
ATOM   4624  H  H    . THR A 1 14  ? -30.774 -19.821 2.003   1.00 10.00 ? 14  THR A H    3  
ATOM   4625  H  HA   . THR A 1 14  ? -28.146 -20.374 2.842   1.00 10.00 ? 14  THR A HA   3  
ATOM   4626  H  HB   . THR A 1 14  ? -28.089 -21.794 0.782   1.00 10.00 ? 14  THR A HB   3  
ATOM   4627  H  HG1  . THR A 1 14  ? -26.185 -20.887 1.249   1.00 10.00 ? 14  THR A HG1  3  
ATOM   4628  H  HG21 . THR A 1 14  ? -28.251 -20.796 -1.433  1.00 10.00 ? 14  THR A HG21 3  
ATOM   4629  H  HG22 . THR A 1 14  ? -29.789 -20.586 -0.579  1.00 10.00 ? 14  THR A HG22 3  
ATOM   4630  H  HG23 . THR A 1 14  ? -28.667 -19.217 -0.749  1.00 10.00 ? 14  THR A HG23 3  
ATOM   4631  N  N    . ALA A 1 15  ? -27.645 -17.868 1.975   1.00 10.00 ? 15  ALA A N    3  
ATOM   4632  C  CA   . ALA A 1 15  ? -27.570 -16.416 1.905   1.00 10.00 ? 15  ALA A CA   3  
ATOM   4633  C  C    . ALA A 1 15  ? -26.112 -16.004 1.684   1.00 10.00 ? 15  ALA A C    3  
ATOM   4634  O  O    . ALA A 1 15  ? -25.222 -16.670 2.214   1.00 10.00 ? 15  ALA A O    3  
ATOM   4635  C  CB   . ALA A 1 15  ? -28.096 -15.795 3.205   1.00 10.00 ? 15  ALA A CB   3  
ATOM   4636  H  H    . ALA A 1 15  ? -26.765 -18.369 2.006   1.00 10.00 ? 15  ALA A H    3  
ATOM   4637  H  HA   . ALA A 1 15  ? -28.196 -16.089 1.075   1.00 10.00 ? 15  ALA A HA   3  
ATOM   4638  H  HB1  . ALA A 1 15  ? -29.146 -16.047 3.352   1.00 10.00 ? 15  ALA A HB1  3  
ATOM   4639  H  HB2  . ALA A 1 15  ? -27.517 -16.165 4.052   1.00 10.00 ? 15  ALA A HB2  3  
ATOM   4640  H  HB3  . ALA A 1 15  ? -28.000 -14.710 3.158   1.00 10.00 ? 15  ALA A HB3  3  
ATOM   4641  N  N    . PRO A 1 16  ? -25.849 -14.934 0.917   1.00 10.00 ? 16  PRO A N    3  
ATOM   4642  C  CA   . PRO A 1 16  ? -24.524 -14.347 0.795   1.00 10.00 ? 16  PRO A CA   3  
ATOM   4643  C  C    . PRO A 1 16  ? -24.246 -13.444 2.006   1.00 10.00 ? 16  PRO A C    3  
ATOM   4644  O  O    . PRO A 1 16  ? -25.043 -13.376 2.941   1.00 10.00 ? 16  PRO A O    3  
ATOM   4645  C  CB   . PRO A 1 16  ? -24.593 -13.544 -0.509  1.00 10.00 ? 16  PRO A CB   3  
ATOM   4646  C  CG   . PRO A 1 16  ? -26.032 -13.026 -0.499  1.00 10.00 ? 16  PRO A CG   3  
ATOM   4647  C  CD   . PRO A 1 16  ? -26.812 -14.187 0.121   1.00 10.00 ? 16  PRO A CD   3  
ATOM   4648  H  HA   . PRO A 1 16  ? -23.750 -15.112 0.724   1.00 10.00 ? 16  PRO A HA   3  
ATOM   4649  H  HB2  . PRO A 1 16  ? -23.864 -12.736 -0.574  1.00 10.00 ? 16  PRO A HB2  3  
ATOM   4650  H  HB3  . PRO A 1 16  ? -24.464 -14.224 -1.352  1.00 10.00 ? 16  PRO A HB3  3  
ATOM   4651  H  HG2  . PRO A 1 16  ? -26.098 -12.152 0.152   1.00 10.00 ? 16  PRO A HG2  3  
ATOM   4652  H  HG3  . PRO A 1 16  ? -26.387 -12.775 -1.500  1.00 10.00 ? 16  PRO A HG3  3  
ATOM   4653  H  HD2  . PRO A 1 16  ? -27.634 -13.805 0.727   1.00 10.00 ? 16  PRO A HD2  3  
ATOM   4654  H  HD3  . PRO A 1 16  ? -27.195 -14.829 -0.674  1.00 10.00 ? 16  PRO A HD3  3  
ATOM   4655  N  N    . ALA A 1 17  ? -23.133 -12.708 1.963   1.00 10.00 ? 17  ALA A N    3  
ATOM   4656  C  CA   . ALA A 1 17  ? -22.815 -11.629 2.886   1.00 10.00 ? 17  ALA A CA   3  
ATOM   4657  C  C    . ALA A 1 17  ? -22.228 -10.486 2.058   1.00 10.00 ? 17  ALA A C    3  
ATOM   4658  O  O    . ALA A 1 17  ? -21.821 -10.712 0.920   1.00 10.00 ? 17  ALA A O    3  
ATOM   4659  C  CB   . ALA A 1 17  ? -21.826 -12.125 3.944   1.00 10.00 ? 17  ALA A CB   3  
ATOM   4660  H  H    . ALA A 1 17  ? -22.542 -12.749 1.143   1.00 10.00 ? 17  ALA A H    3  
ATOM   4661  H  HA   . ALA A 1 17  ? -23.721 -11.274 3.380   1.00 10.00 ? 17  ALA A HA   3  
ATOM   4662  H  HB1  . ALA A 1 17  ? -20.909 -12.472 3.465   1.00 10.00 ? 17  ALA A HB1  3  
ATOM   4663  H  HB2  . ALA A 1 17  ? -21.584 -11.317 4.635   1.00 10.00 ? 17  ALA A HB2  3  
ATOM   4664  H  HB3  . ALA A 1 17  ? -22.271 -12.948 4.505   1.00 10.00 ? 17  ALA A HB3  3  
ATOM   4665  N  N    . ALA A 1 18  ? -22.202 -9.268  2.608   1.00 10.00 ? 18  ALA A N    3  
ATOM   4666  C  CA   . ALA A 1 18  ? -21.703 -8.089  1.912   1.00 10.00 ? 18  ALA A CA   3  
ATOM   4667  C  C    . ALA A 1 18  ? -21.243 -7.049  2.932   1.00 10.00 ? 18  ALA A C    3  
ATOM   4668  O  O    . ALA A 1 18  ? -21.958 -6.784  3.908   1.00 10.00 ? 18  ALA A O    3  
ATOM   4669  C  CB   . ALA A 1 18  ? -22.794 -7.514  1.004   1.00 10.00 ? 18  ALA A CB   3  
ATOM   4670  H  H    . ALA A 1 18  ? -22.515 -9.146  3.560   1.00 10.00 ? 18  ALA A H    3  
ATOM   4671  H  HA   . ALA A 1 18  ? -20.853 -8.375  1.289   1.00 10.00 ? 18  ALA A HA   3  
ATOM   4672  H  HB1  . ALA A 1 18  ? -23.083 -8.253  0.256   1.00 10.00 ? 18  ALA A HB1  3  
ATOM   4673  H  HB2  . ALA A 1 18  ? -23.669 -7.238  1.593   1.00 10.00 ? 18  ALA A HB2  3  
ATOM   4674  H  HB3  . ALA A 1 18  ? -22.412 -6.628  0.494   1.00 10.00 ? 18  ALA A HB3  3  
ATOM   4675  N  N    . GLN A 1 19  ? -20.059 -6.477  2.697   1.00 10.00 ? 19  GLN A N    3  
ATOM   4676  C  CA   . GLN A 1 19  ? -19.451 -5.441  3.521   1.00 10.00 ? 19  GLN A CA   3  
ATOM   4677  C  C    . GLN A 1 19  ? -20.336 -4.194  3.583   1.00 10.00 ? 19  GLN A C    3  
ATOM   4678  O  O    . GLN A 1 19  ? -21.245 -4.027  2.771   1.00 10.00 ? 19  GLN A O    3  
ATOM   4679  C  CB   . GLN A 1 19  ? -18.027 -5.109  3.036   1.00 10.00 ? 19  GLN A CB   3  
ATOM   4680  C  CG   . GLN A 1 19  ? -17.941 -4.603  1.586   1.00 10.00 ? 19  GLN A CG   3  
ATOM   4681  C  CD   . GLN A 1 19  ? -17.829 -5.746  0.580   1.00 10.00 ? 19  GLN A CD   3  
ATOM   4682  O  OE1  . GLN A 1 19  ? -18.831 -6.341  0.197   1.00 10.00 ? 19  GLN A OE1  3  
ATOM   4683  N  NE2  . GLN A 1 19  ? -16.614 -6.087  0.163   1.00 10.00 ? 19  GLN A NE2  3  
ATOM   4684  H  H    . GLN A 1 19  ? -19.600 -6.720  1.828   1.00 10.00 ? 19  GLN A H    3  
ATOM   4685  H  HA   . GLN A 1 19  ? -19.369 -5.839  4.535   1.00 10.00 ? 19  GLN A HA   3  
ATOM   4686  H  HB2  . GLN A 1 19  ? -17.628 -4.329  3.686   1.00 10.00 ? 19  GLN A HB2  3  
ATOM   4687  H  HB3  . GLN A 1 19  ? -17.391 -5.988  3.149   1.00 10.00 ? 19  GLN A HB3  3  
ATOM   4688  H  HG2  . GLN A 1 19  ? -18.811 -3.993  1.340   1.00 10.00 ? 19  GLN A HG2  3  
ATOM   4689  H  HG3  . GLN A 1 19  ? -17.057 -3.972  1.491   1.00 10.00 ? 19  GLN A HG3  3  
ATOM   4690  H  HE21 . GLN A 1 19  ? -15.796 -5.609  0.506   1.00 10.00 ? 19  GLN A HE21 3  
ATOM   4691  H  HE22 . GLN A 1 19  ? -16.532 -6.851  -0.492  1.00 10.00 ? 19  GLN A HE22 3  
ATOM   4692  N  N    . LYS A 1 20  ? -20.089 -3.338  4.578   1.00 10.00 ? 20  LYS A N    3  
ATOM   4693  C  CA   . LYS A 1 20  ? -20.875 -2.148  4.875   1.00 10.00 ? 20  LYS A CA   3  
ATOM   4694  C  C    . LYS A 1 20  ? -19.914 -1.070  5.387   1.00 10.00 ? 20  LYS A C    3  
ATOM   4695  O  O    . LYS A 1 20  ? -18.704 -1.295  5.404   1.00 10.00 ? 20  LYS A O    3  
ATOM   4696  C  CB   . LYS A 1 20  ? -21.972 -2.486  5.906   1.00 10.00 ? 20  LYS A CB   3  
ATOM   4697  C  CG   . LYS A 1 20  ? -22.698 -3.788  5.539   1.00 10.00 ? 20  LYS A CG   3  
ATOM   4698  C  CD   . LYS A 1 20  ? -23.962 -4.037  6.367   1.00 10.00 ? 20  LYS A CD   3  
ATOM   4699  C  CE   . LYS A 1 20  ? -24.427 -5.499  6.237   1.00 10.00 ? 20  LYS A CE   3  
ATOM   4700  N  NZ   . LYS A 1 20  ? -24.372 -6.007  4.847   1.00 10.00 ? 20  LYS A NZ   3  
ATOM   4701  H  H    . LYS A 1 20  ? -19.258 -3.459  5.142   1.00 10.00 ? 20  LYS A H    3  
ATOM   4702  H  HA   . LYS A 1 20  ? -21.343 -1.779  3.961   1.00 10.00 ? 20  LYS A HA   3  
ATOM   4703  H  HB2  . LYS A 1 20  ? -21.523 -2.601  6.894   1.00 10.00 ? 20  LYS A HB2  3  
ATOM   4704  H  HB3  . LYS A 1 20  ? -22.692 -1.667  5.940   1.00 10.00 ? 20  LYS A HB3  3  
ATOM   4705  H  HG2  . LYS A 1 20  ? -22.979 -3.731  4.487   1.00 10.00 ? 20  LYS A HG2  3  
ATOM   4706  H  HG3  . LYS A 1 20  ? -22.011 -4.620  5.702   1.00 10.00 ? 20  LYS A HG3  3  
ATOM   4707  H  HD2  . LYS A 1 20  ? -23.757 -3.830  7.420   1.00 10.00 ? 20  LYS A HD2  3  
ATOM   4708  H  HD3  . LYS A 1 20  ? -24.748 -3.355  6.035   1.00 10.00 ? 20  LYS A HD3  3  
ATOM   4709  H  HE2  . LYS A 1 20  ? -23.788 -6.131  6.858   1.00 10.00 ? 20  LYS A HE2  3  
ATOM   4710  H  HE3  . LYS A 1 20  ? -25.449 -5.574  6.615   1.00 10.00 ? 20  LYS A HE3  3  
ATOM   4711  H  HZ1  . LYS A 1 20  ? -24.853 -5.383  4.217   1.00 10.00 ? 20  LYS A HZ1  3  
ATOM   4712  H  HZ2  . LYS A 1 20  ? -23.404 -6.110  4.539   1.00 10.00 ? 20  LYS A HZ2  3  
ATOM   4713  H  HZ3  . LYS A 1 20  ? -24.801 -6.920  4.799   1.00 10.00 ? 20  LYS A HZ3  3  
ATOM   4714  N  N    . ALA A 1 21  ? -20.445 0.081   5.813   1.00 10.00 ? 21  ALA A N    3  
ATOM   4715  C  CA   . ALA A 1 21  ? -19.663 1.195   6.344   1.00 10.00 ? 21  ALA A CA   3  
ATOM   4716  C  C    . ALA A 1 21  ? -18.609 1.670   5.335   1.00 10.00 ? 21  ALA A C    3  
ATOM   4717  O  O    . ALA A 1 21  ? -17.420 1.765   5.643   1.00 10.00 ? 21  ALA A O    3  
ATOM   4718  C  CB   . ALA A 1 21  ? -19.058 0.832   7.707   1.00 10.00 ? 21  ALA A CB   3  
ATOM   4719  H  H    . ALA A 1 21  ? -21.448 0.186   5.783   1.00 10.00 ? 21  ALA A H    3  
ATOM   4720  H  HA   . ALA A 1 21  ? -20.349 2.027   6.509   1.00 10.00 ? 21  ALA A HA   3  
ATOM   4721  H  HB1  . ALA A 1 21  ? -18.322 0.034   7.604   1.00 10.00 ? 21  ALA A HB1  3  
ATOM   4722  H  HB2  . ALA A 1 21  ? -18.568 1.708   8.133   1.00 10.00 ? 21  ALA A HB2  3  
ATOM   4723  H  HB3  . ALA A 1 21  ? -19.847 0.506   8.385   1.00 10.00 ? 21  ALA A HB3  3  
ATOM   4724  N  N    . GLY A 1 22  ? -19.062 2.005   4.123   1.00 10.00 ? 22  GLY A N    3  
ATOM   4725  C  CA   . GLY A 1 22  ? -18.217 2.521   3.056   1.00 10.00 ? 22  GLY A CA   3  
ATOM   4726  C  C    . GLY A 1 22  ? -17.771 3.954   3.349   1.00 10.00 ? 22  GLY A C    3  
ATOM   4727  O  O    . GLY A 1 22  ? -18.217 4.892   2.687   1.00 10.00 ? 22  GLY A O    3  
ATOM   4728  H  H    . GLY A 1 22  ? -20.050 1.915   3.940   1.00 10.00 ? 22  GLY A H    3  
ATOM   4729  H  HA2  . GLY A 1 22  ? -17.341 1.883   2.932   1.00 10.00 ? 22  GLY A HA2  3  
ATOM   4730  H  HA3  . GLY A 1 22  ? -18.786 2.509   2.126   1.00 10.00 ? 22  GLY A HA3  3  
ATOM   4731  N  N    . ALA A 1 23  ? -16.888 4.118   4.339   1.00 10.00 ? 23  ALA A N    3  
ATOM   4732  C  CA   . ALA A 1 23  ? -16.348 5.399   4.781   1.00 10.00 ? 23  ALA A CA   3  
ATOM   4733  C  C    . ALA A 1 23  ? -15.390 5.984   3.736   1.00 10.00 ? 23  ALA A C    3  
ATOM   4734  O  O    . ALA A 1 23  ? -14.180 6.047   3.951   1.00 10.00 ? 23  ALA A O    3  
ATOM   4735  C  CB   . ALA A 1 23  ? -15.668 5.216   6.142   1.00 10.00 ? 23  ALA A CB   3  
ATOM   4736  H  H    . ALA A 1 23  ? -16.641 3.287   4.867   1.00 10.00 ? 23  ALA A H    3  
ATOM   4737  H  HA   . ALA A 1 23  ? -17.174 6.100   4.918   1.00 10.00 ? 23  ALA A HA   3  
ATOM   4738  H  HB1  . ALA A 1 23  ? -14.841 4.511   6.058   1.00 10.00 ? 23  ALA A HB1  3  
ATOM   4739  H  HB2  . ALA A 1 23  ? -15.286 6.176   6.493   1.00 10.00 ? 23  ALA A HB2  3  
ATOM   4740  H  HB3  . ALA A 1 23  ? -16.390 4.837   6.866   1.00 10.00 ? 23  ALA A HB3  3  
ATOM   4741  N  N    . GLN A 1 24  ? -15.957 6.409   2.606   1.00 10.00 ? 24  GLN A N    3  
ATOM   4742  C  CA   . GLN A 1 24  ? -15.270 7.033   1.487   1.00 10.00 ? 24  GLN A CA   3  
ATOM   4743  C  C    . GLN A 1 24  ? -14.705 8.386   1.926   1.00 10.00 ? 24  GLN A C    3  
ATOM   4744  O  O    . GLN A 1 24  ? -15.370 9.411   1.807   1.00 10.00 ? 24  GLN A O    3  
ATOM   4745  C  CB   . GLN A 1 24  ? -16.257 7.171   0.321   1.00 10.00 ? 24  GLN A CB   3  
ATOM   4746  C  CG   . GLN A 1 24  ? -16.614 5.798   -0.270  1.00 10.00 ? 24  GLN A CG   3  
ATOM   4747  C  CD   . GLN A 1 24  ? -18.038 5.775   -0.814  1.00 10.00 ? 24  GLN A CD   3  
ATOM   4748  O  OE1  . GLN A 1 24  ? -18.261 5.927   -2.009  1.00 10.00 ? 24  GLN A OE1  3  
ATOM   4749  N  NE2  . GLN A 1 24  ? -19.019 5.575   0.062   1.00 10.00 ? 24  GLN A NE2  3  
ATOM   4750  H  H    . GLN A 1 24  ? -16.958 6.270   2.521   1.00 10.00 ? 24  GLN A H    3  
ATOM   4751  H  HA   . GLN A 1 24  ? -14.452 6.392   1.167   1.00 10.00 ? 24  GLN A HA   3  
ATOM   4752  H  HB2  . GLN A 1 24  ? -17.157 7.671   0.683   1.00 10.00 ? 24  GLN A HB2  3  
ATOM   4753  H  HB3  . GLN A 1 24  ? -15.819 7.785   -0.468  1.00 10.00 ? 24  GLN A HB3  3  
ATOM   4754  H  HG2  . GLN A 1 24  ? -15.916 5.567   -1.075  1.00 10.00 ? 24  GLN A HG2  3  
ATOM   4755  H  HG3  . GLN A 1 24  ? -16.528 5.014   0.483   1.00 10.00 ? 24  GLN A HG3  3  
ATOM   4756  H  HE21 . GLN A 1 24  ? -18.810 5.431   1.047   1.00 10.00 ? 24  GLN A HE21 3  
ATOM   4757  H  HE22 . GLN A 1 24  ? -19.968 5.570   -0.274  1.00 10.00 ? 24  GLN A HE22 3  
ATOM   4758  N  N    . ALA A 1 25  ? -13.485 8.364   2.463   1.00 10.00 ? 25  ALA A N    3  
ATOM   4759  C  CA   . ALA A 1 25  ? -12.822 9.505   3.075   1.00 10.00 ? 25  ALA A CA   3  
ATOM   4760  C  C    . ALA A 1 25  ? -11.364 9.177   3.406   1.00 10.00 ? 25  ALA A C    3  
ATOM   4761  O  O    . ALA A 1 25  ? -10.476 9.997   3.188   1.00 10.00 ? 25  ALA A O    3  
ATOM   4762  C  CB   . ALA A 1 25  ? -13.566 9.905   4.355   1.00 10.00 ? 25  ALA A CB   3  
ATOM   4763  H  H    . ALA A 1 25  ? -13.024 7.460   2.493   1.00 10.00 ? 25  ALA A H    3  
ATOM   4764  H  HA   . ALA A 1 25  ? -12.839 10.345  2.378   1.00 10.00 ? 25  ALA A HA   3  
ATOM   4765  H  HB1  . ALA A 1 25  ? -14.578 10.232  4.120   1.00 10.00 ? 25  ALA A HB1  3  
ATOM   4766  H  HB2  . ALA A 1 25  ? -13.616 9.053   5.034   1.00 10.00 ? 25  ALA A HB2  3  
ATOM   4767  H  HB3  . ALA A 1 25  ? -13.037 10.724  4.843   1.00 10.00 ? 25  ALA A HB3  3  
ATOM   4768  N  N    . LEU A 1 26  ? -11.112 7.996   3.979   1.00 10.00 ? 26  LEU A N    3  
ATOM   4769  C  CA   . LEU A 1 26  ? -9.784  7.616   4.438   1.00 10.00 ? 26  LEU A CA   3  
ATOM   4770  C  C    . LEU A 1 26  ? -8.792  7.603   3.261   1.00 10.00 ? 26  LEU A C    3  
ATOM   4771  O  O    . LEU A 1 26  ? -9.064  6.968   2.238   1.00 10.00 ? 26  LEU A O    3  
ATOM   4772  C  CB   . LEU A 1 26  ? -9.880  6.276   5.182   1.00 10.00 ? 26  LEU A CB   3  
ATOM   4773  C  CG   . LEU A 1 26  ? -8.514  5.628   5.467   1.00 10.00 ? 26  LEU A CG   3  
ATOM   4774  C  CD1  . LEU A 1 26  ? -8.500  4.989   6.856   1.00 10.00 ? 26  LEU A CD1  3  
ATOM   4775  C  CD2  . LEU A 1 26  ? -8.176  4.562   4.421   1.00 10.00 ? 26  LEU A CD2  3  
ATOM   4776  H  H    . LEU A 1 26  ? -11.857 7.321   4.083   1.00 10.00 ? 26  LEU A H    3  
ATOM   4777  H  HA   . LEU A 1 26  ? -9.489  8.363   5.173   1.00 10.00 ? 26  LEU A HA   3  
ATOM   4778  H  HB2  . LEU A 1 26  ? -10.391 6.472   6.125   1.00 10.00 ? 26  LEU A HB2  3  
ATOM   4779  H  HB3  . LEU A 1 26  ? -10.498 5.584   4.615   1.00 10.00 ? 26  LEU A HB3  3  
ATOM   4780  H  HG   . LEU A 1 26  ? -7.731  6.382   5.461   1.00 10.00 ? 26  LEU A HG   3  
ATOM   4781  H  HD11 . LEU A 1 26  ? -9.263  4.214   6.925   1.00 10.00 ? 26  LEU A HD11 3  
ATOM   4782  H  HD12 . LEU A 1 26  ? -7.519  4.552   7.037   1.00 10.00 ? 26  LEU A HD12 3  
ATOM   4783  H  HD13 . LEU A 1 26  ? -8.685  5.751   7.613   1.00 10.00 ? 26  LEU A HD13 3  
ATOM   4784  H  HD21 . LEU A 1 26  ? -8.336  4.929   3.411   1.00 10.00 ? 26  LEU A HD21 3  
ATOM   4785  H  HD22 . LEU A 1 26  ? -7.127  4.290   4.520   1.00 10.00 ? 26  LEU A HD22 3  
ATOM   4786  H  HD23 . LEU A 1 26  ? -8.793  3.679   4.569   1.00 10.00 ? 26  LEU A HD23 3  
ATOM   4787  N  N    . PRO A 1 27  ? -7.647  8.300   3.375   1.00 10.00 ? 27  PRO A N    3  
ATOM   4788  C  CA   . PRO A 1 27  ? -6.665  8.360   2.310   1.00 10.00 ? 27  PRO A CA   3  
ATOM   4789  C  C    . PRO A 1 27  ? -5.896  7.040   2.220   1.00 10.00 ? 27  PRO A C    3  
ATOM   4790  O  O    . PRO A 1 27  ? -5.937  6.202   3.120   1.00 10.00 ? 27  PRO A O    3  
ATOM   4791  C  CB   . PRO A 1 27  ? -5.751  9.534   2.667   1.00 10.00 ? 27  PRO A CB   3  
ATOM   4792  C  CG   . PRO A 1 27  ? -5.770  9.521   4.194   1.00 10.00 ? 27  PRO A CG   3  
ATOM   4793  C  CD   . PRO A 1 27  ? -7.202  9.088   4.517   1.00 10.00 ? 27  PRO A CD   3  
ATOM   4794  H  HA   . PRO A 1 27  ? -7.154  8.558   1.354   1.00 10.00 ? 27  PRO A HA   3  
ATOM   4795  H  HB2  . PRO A 1 27  ? -4.743  9.435   2.262   1.00 10.00 ? 27  PRO A HB2  3  
ATOM   4796  H  HB3  . PRO A 1 27  ? -6.205  10.461  2.314   1.00 10.00 ? 27  PRO A HB3  3  
ATOM   4797  H  HG2  . PRO A 1 27  ? -5.074  8.765   4.560   1.00 10.00 ? 27  PRO A HG2  3  
ATOM   4798  H  HG3  . PRO A 1 27  ? -5.525  10.495  4.621   1.00 10.00 ? 27  PRO A HG3  3  
ATOM   4799  H  HD2  . PRO A 1 27  ? -7.196  8.513   5.444   1.00 10.00 ? 27  PRO A HD2  3  
ATOM   4800  H  HD3  . PRO A 1 27  ? -7.837  9.969   4.617   1.00 10.00 ? 27  PRO A HD3  3  
ATOM   4801  N  N    . VAL A 1 28  ? -5.165  6.866   1.122   1.00 10.00 ? 28  VAL A N    3  
ATOM   4802  C  CA   . VAL A 1 28  ? -4.589  5.591   0.717   1.00 10.00 ? 28  VAL A CA   3  
ATOM   4803  C  C    . VAL A 1 28  ? -3.275  5.333   1.462   1.00 10.00 ? 28  VAL A C    3  
ATOM   4804  O  O    . VAL A 1 28  ? -2.211  5.203   0.869   1.00 10.00 ? 28  VAL A O    3  
ATOM   4805  C  CB   . VAL A 1 28  ? -4.468  5.606   -0.818  1.00 10.00 ? 28  VAL A CB   3  
ATOM   4806  C  CG1  . VAL A 1 28  ? -3.409  6.571   -1.368  1.00 10.00 ? 28  VAL A CG1  3  
ATOM   4807  C  CG2  . VAL A 1 28  ? -4.276  4.203   -1.398  1.00 10.00 ? 28  VAL A CG2  3  
ATOM   4808  H  H    . VAL A 1 28  ? -5.137  7.620   0.456   1.00 10.00 ? 28  VAL A H    3  
ATOM   4809  H  HA   . VAL A 1 28  ? -5.287  4.796   0.987   1.00 10.00 ? 28  VAL A HA   3  
ATOM   4810  H  HB   . VAL A 1 28  ? -5.420  5.979   -1.180  1.00 10.00 ? 28  VAL A HB   3  
ATOM   4811  H  HG11 . VAL A 1 28  ? -3.698  6.887   -2.368  1.00 10.00 ? 28  VAL A HG11 3  
ATOM   4812  H  HG12 . VAL A 1 28  ? -3.319  7.457   -0.741  1.00 10.00 ? 28  VAL A HG12 3  
ATOM   4813  H  HG13 . VAL A 1 28  ? -2.445  6.071   -1.439  1.00 10.00 ? 28  VAL A HG13 3  
ATOM   4814  H  HG21 . VAL A 1 28  ? -3.426  3.717   -0.931  1.00 10.00 ? 28  VAL A HG21 3  
ATOM   4815  H  HG22 . VAL A 1 28  ? -5.156  3.600   -1.201  1.00 10.00 ? 28  VAL A HG22 3  
ATOM   4816  H  HG23 . VAL A 1 28  ? -4.116  4.256   -2.475  1.00 10.00 ? 28  VAL A HG23 3  
ATOM   4817  N  N    . THR A 1 29  ? -3.338  5.274   2.790   1.00 10.00 ? 29  THR A N    3  
ATOM   4818  C  CA   . THR A 1 29  ? -2.157  5.099   3.620   1.00 10.00 ? 29  THR A CA   3  
ATOM   4819  C  C    . THR A 1 29  ? -2.568  4.515   4.967   1.00 10.00 ? 29  THR A C    3  
ATOM   4820  O  O    . THR A 1 29  ? -2.277  5.091   6.015   1.00 10.00 ? 29  THR A O    3  
ATOM   4821  C  CB   . THR A 1 29  ? -1.381  6.430   3.709   1.00 10.00 ? 29  THR A CB   3  
ATOM   4822  O  OG1  . THR A 1 29  ? -0.331  6.346   4.650   1.00 10.00 ? 29  THR A OG1  3  
ATOM   4823  C  CG2  . THR A 1 29  ? -2.270  7.629   4.060   1.00 10.00 ? 29  THR A CG2  3  
ATOM   4824  H  H    . THR A 1 29  ? -4.245  5.407   3.231   1.00 10.00 ? 29  THR A H    3  
ATOM   4825  H  HA   . THR A 1 29  ? -1.493  4.366   3.158   1.00 10.00 ? 29  THR A HA   3  
ATOM   4826  H  HB   . THR A 1 29  ? -0.933  6.620   2.733   1.00 10.00 ? 29  THR A HB   3  
ATOM   4827  H  HG1  . THR A 1 29  ? -0.723  6.088   5.496   1.00 10.00 ? 29  THR A HG1  3  
ATOM   4828  H  HG21 . THR A 1 29  ? -1.652  8.524   4.121   1.00 10.00 ? 29  THR A HG21 3  
ATOM   4829  H  HG22 . THR A 1 29  ? -3.021  7.789   3.287   1.00 10.00 ? 29  THR A HG22 3  
ATOM   4830  H  HG23 . THR A 1 29  ? -2.766  7.474   5.018   1.00 10.00 ? 29  THR A HG23 3  
ATOM   4831  N  N    . VAL A 1 30  ? -3.210  3.343   4.932   1.00 10.00 ? 30  VAL A N    3  
ATOM   4832  C  CA   . VAL A 1 30  ? -3.614  2.617   6.128   1.00 10.00 ? 30  VAL A CA   3  
ATOM   4833  C  C    . VAL A 1 30  ? -2.996  1.216   6.125   1.00 10.00 ? 30  VAL A C    3  
ATOM   4834  O  O    . VAL A 1 30  ? -3.677  0.203   6.252   1.00 10.00 ? 30  VAL A O    3  
ATOM   4835  C  CB   . VAL A 1 30  ? -5.149  2.688   6.285   1.00 10.00 ? 30  VAL A CB   3  
ATOM   4836  C  CG1  . VAL A 1 30  ? -5.921  1.962   5.174   1.00 10.00 ? 30  VAL A CG1  3  
ATOM   4837  C  CG2  . VAL A 1 30  ? -5.610  2.194   7.664   1.00 10.00 ? 30  VAL A CG2  3  
ATOM   4838  H  H    . VAL A 1 30  ? -3.406  2.936   4.030   1.00 10.00 ? 30  VAL A H    3  
ATOM   4839  H  HA   . VAL A 1 30  ? -3.187  3.103   7.003   1.00 10.00 ? 30  VAL A HA   3  
ATOM   4840  H  HB   . VAL A 1 30  ? -5.421  3.747   6.226   1.00 10.00 ? 30  VAL A HB   3  
ATOM   4841  H  HG11 . VAL A 1 30  ? -5.726  0.892   5.176   1.00 10.00 ? 30  VAL A HG11 3  
ATOM   4842  H  HG12 . VAL A 1 30  ? -6.991  2.101   5.326   1.00 10.00 ? 30  VAL A HG12 3  
ATOM   4843  H  HG13 . VAL A 1 30  ? -5.647  2.375   4.205   1.00 10.00 ? 30  VAL A HG13 3  
ATOM   4844  H  HG21 . VAL A 1 30  ? -5.415  1.129   7.786   1.00 10.00 ? 30  VAL A HG21 3  
ATOM   4845  H  HG22 . VAL A 1 30  ? -5.087  2.744   8.447   1.00 10.00 ? 30  VAL A HG22 3  
ATOM   4846  H  HG23 . VAL A 1 30  ? -6.680  2.363   7.775   1.00 10.00 ? 30  VAL A HG23 3  
ATOM   4847  N  N    . GLN A 1 31  ? -1.665  1.168   6.039   1.00 10.00 ? 31  GLN A N    3  
ATOM   4848  C  CA   . GLN A 1 31  ? -0.886  -0.035  6.277   1.00 10.00 ? 31  GLN A CA   3  
ATOM   4849  C  C    . GLN A 1 31  ? 0.474   0.395   6.825   1.00 10.00 ? 31  GLN A C    3  
ATOM   4850  O  O    . GLN A 1 31  ? 1.064   1.346   6.317   1.00 10.00 ? 31  GLN A O    3  
ATOM   4851  C  CB   . GLN A 1 31  ? -0.775  -0.823  4.965   1.00 10.00 ? 31  GLN A CB   3  
ATOM   4852  C  CG   . GLN A 1 31  ? 0.146   -2.048  5.038   1.00 10.00 ? 31  GLN A CG   3  
ATOM   4853  C  CD   . GLN A 1 31  ? -0.180  -2.978  6.203   1.00 10.00 ? 31  GLN A CD   3  
ATOM   4854  O  OE1  . GLN A 1 31  ? -1.296  -3.468  6.319   1.00 10.00 ? 31  GLN A OE1  3  
ATOM   4855  N  NE2  . GLN A 1 31  ? 0.784   -3.223  7.084   1.00 10.00 ? 31  GLN A NE2  3  
ATOM   4856  H  H    . GLN A 1 31  ? -1.147  2.014   5.838   1.00 10.00 ? 31  GLN A H    3  
ATOM   4857  H  HA   . GLN A 1 31  ? -1.394  -0.645  7.026   1.00 10.00 ? 31  GLN A HA   3  
ATOM   4858  H  HB2  . GLN A 1 31  ? -1.772  -1.156  4.671   1.00 10.00 ? 31  GLN A HB2  3  
ATOM   4859  H  HB3  . GLN A 1 31  ? -0.395  -0.149  4.198   1.00 10.00 ? 31  GLN A HB3  3  
ATOM   4860  H  HG2  . GLN A 1 31  ? 0.030   -2.631  4.127   1.00 10.00 ? 31  GLN A HG2  3  
ATOM   4861  H  HG3  . GLN A 1 31  ? 1.178   -1.708  5.091   1.00 10.00 ? 31  GLN A HG3  3  
ATOM   4862  H  HE21 . GLN A 1 31  ? 1.711   -2.816  6.962   1.00 10.00 ? 31  GLN A HE21 3  
ATOM   4863  H  HE22 . GLN A 1 31  ? 0.597   -3.865  7.838   1.00 10.00 ? 31  GLN A HE22 3  
ATOM   4864  N  N    . GLY A 1 32  ? 0.963   -0.292  7.860   1.00 10.00 ? 32  GLY A N    3  
ATOM   4865  C  CA   . GLY A 1 32  ? 2.304   -0.083  8.383   1.00 10.00 ? 32  GLY A CA   3  
ATOM   4866  C  C    . GLY A 1 32  ? 3.321   -0.608  7.373   1.00 10.00 ? 32  GLY A C    3  
ATOM   4867  O  O    . GLY A 1 32  ? 3.142   -1.708  6.848   1.00 10.00 ? 32  GLY A O    3  
ATOM   4868  H  H    . GLY A 1 32  ? 0.442   -1.082  8.211   1.00 10.00 ? 32  GLY A H    3  
ATOM   4869  H  HA2  . GLY A 1 32  ? 2.467   0.977   8.585   1.00 10.00 ? 32  GLY A HA2  3  
ATOM   4870  H  HA3  . GLY A 1 32  ? 2.414   -0.643  9.310   1.00 10.00 ? 32  GLY A HA3  3  
ATOM   4871  N  N    . ALA A 1 33  ? 4.356   0.179   7.076   1.00 10.00 ? 33  ALA A N    3  
ATOM   4872  C  CA   . ALA A 1 33  ? 5.317   -0.137  6.029   1.00 10.00 ? 33  ALA A CA   3  
ATOM   4873  C  C    . ALA A 1 33  ? 6.533   -0.876  6.585   1.00 10.00 ? 33  ALA A C    3  
ATOM   4874  O  O    . ALA A 1 33  ? 6.911   -0.676  7.742   1.00 10.00 ? 33  ALA A O    3  
ATOM   4875  C  CB   . ALA A 1 33  ? 5.738   1.157   5.334   1.00 10.00 ? 33  ALA A CB   3  
ATOM   4876  H  H    . ALA A 1 33  ? 4.474   1.045   7.580   1.00 10.00 ? 33  ALA A H    3  
ATOM   4877  H  HA   . ALA A 1 33  ? 4.841   -0.782  5.291   1.00 10.00 ? 33  ALA A HA   3  
ATOM   4878  H  HB1  . ALA A 1 33  ? 4.864   1.657   4.916   1.00 10.00 ? 33  ALA A HB1  3  
ATOM   4879  H  HB2  . ALA A 1 33  ? 6.227   1.824   6.044   1.00 10.00 ? 33  ALA A HB2  3  
ATOM   4880  H  HB3  . ALA A 1 33  ? 6.431   0.923   4.529   1.00 10.00 ? 33  ALA A HB3  3  
ATOM   4881  N  N    . THR A 1 34  ? 7.154   -1.716  5.752   1.00 10.00 ? 34  THR A N    3  
ATOM   4882  C  CA   . THR A 1 34  ? 8.364   -2.447  6.089   1.00 10.00 ? 34  THR A CA   3  
ATOM   4883  C  C    . THR A 1 34  ? 9.490   -1.984  5.161   1.00 10.00 ? 34  THR A C    3  
ATOM   4884  O  O    . THR A 1 34  ? 9.312   -2.009  3.947   1.00 10.00 ? 34  THR A O    3  
ATOM   4885  C  CB   . THR A 1 34  ? 8.095   -3.956  6.014   1.00 10.00 ? 34  THR A CB   3  
ATOM   4886  O  OG1  . THR A 1 34  ? 7.754   -4.363  4.708   1.00 10.00 ? 34  THR A OG1  3  
ATOM   4887  C  CG2  . THR A 1 34  ? 6.914   -4.301  6.924   1.00 10.00 ? 34  THR A CG2  3  
ATOM   4888  H  H    . THR A 1 34  ? 6.765   -1.903  4.831   1.00 10.00 ? 34  THR A H    3  
ATOM   4889  H  HA   . THR A 1 34  ? 8.632   -2.231  7.115   1.00 10.00 ? 34  THR A HA   3  
ATOM   4890  H  HB   . THR A 1 34  ? 8.988   -4.493  6.340   1.00 10.00 ? 34  THR A HB   3  
ATOM   4891  H  HG1  . THR A 1 34  ? 7.557   -5.302  4.707   1.00 10.00 ? 34  THR A HG1  3  
ATOM   4892  H  HG21 . THR A 1 34  ? 6.003   -3.860  6.515   1.00 10.00 ? 34  THR A HG21 3  
ATOM   4893  H  HG22 . THR A 1 34  ? 6.792   -5.381  6.981   1.00 10.00 ? 34  THR A HG22 3  
ATOM   4894  H  HG23 . THR A 1 34  ? 7.088   -3.898  7.921   1.00 10.00 ? 34  THR A HG23 3  
ATOM   4895  N  N    . VAL A 1 35  ? 10.614  -1.506  5.710   1.00 10.00 ? 35  VAL A N    3  
ATOM   4896  C  CA   . VAL A 1 35  ? 11.731  -0.972  4.931   1.00 10.00 ? 35  VAL A CA   3  
ATOM   4897  C  C    . VAL A 1 35  ? 12.896  -1.957  4.961   1.00 10.00 ? 35  VAL A C    3  
ATOM   4898  O  O    . VAL A 1 35  ? 13.404  -2.293  6.030   1.00 10.00 ? 35  VAL A O    3  
ATOM   4899  C  CB   . VAL A 1 35  ? 12.141  0.425   5.429   1.00 10.00 ? 35  VAL A CB   3  
ATOM   4900  C  CG1  . VAL A 1 35  ? 13.360  0.949   4.657   1.00 10.00 ? 35  VAL A CG1  3  
ATOM   4901  C  CG2  . VAL A 1 35  ? 10.991  1.416   5.224   1.00 10.00 ? 35  VAL A CG2  3  
ATOM   4902  H  H    . VAL A 1 35  ? 10.700  -1.523  6.721   1.00 10.00 ? 35  VAL A H    3  
ATOM   4903  H  HA   . VAL A 1 35  ? 11.422  -0.849  3.900   1.00 10.00 ? 35  VAL A HA   3  
ATOM   4904  H  HB   . VAL A 1 35  ? 12.395  0.383   6.488   1.00 10.00 ? 35  VAL A HB   3  
ATOM   4905  H  HG11 . VAL A 1 35  ? 13.553  1.983   4.937   1.00 10.00 ? 35  VAL A HG11 3  
ATOM   4906  H  HG12 . VAL A 1 35  ? 14.247  0.359   4.889   1.00 10.00 ? 35  VAL A HG12 3  
ATOM   4907  H  HG13 . VAL A 1 35  ? 13.171  0.908   3.583   1.00 10.00 ? 35  VAL A HG13 3  
ATOM   4908  H  HG21 . VAL A 1 35  ? 10.083  1.041   5.689   1.00 10.00 ? 35  VAL A HG21 3  
ATOM   4909  H  HG22 . VAL A 1 35  ? 11.245  2.377   5.671   1.00 10.00 ? 35  VAL A HG22 3  
ATOM   4910  H  HG23 . VAL A 1 35  ? 10.809  1.556   4.159   1.00 10.00 ? 35  VAL A HG23 3  
ATOM   4911  N  N    . ALA A 1 36  ? 13.342  -2.426  3.796   1.00 10.00 ? 36  ALA A N    3  
ATOM   4912  C  CA   . ALA A 1 36  ? 14.393  -3.432  3.745   1.00 10.00 ? 36  ALA A CA   3  
ATOM   4913  C  C    . ALA A 1 36  ? 15.772  -2.812  3.968   1.00 10.00 ? 36  ALA A C    3  
ATOM   4914  O  O    . ALA A 1 36  ? 16.427  -2.455  2.994   1.00 10.00 ? 36  ALA A O    3  
ATOM   4915  C  CB   . ALA A 1 36  ? 14.320  -4.189  2.418   1.00 10.00 ? 36  ALA A CB   3  
ATOM   4916  H  H    . ALA A 1 36  ? 12.909  -2.098  2.937   1.00 10.00 ? 36  ALA A H    3  
ATOM   4917  H  HA   . ALA A 1 36  ? 14.230  -4.157  4.537   1.00 10.00 ? 36  ALA A HA   3  
ATOM   4918  H  HB1  . ALA A 1 36  ? 13.389  -4.755  2.385   1.00 10.00 ? 36  ALA A HB1  3  
ATOM   4919  H  HB2  . ALA A 1 36  ? 14.359  -3.492  1.579   1.00 10.00 ? 36  ALA A HB2  3  
ATOM   4920  H  HB3  . ALA A 1 36  ? 15.156  -4.885  2.343   1.00 10.00 ? 36  ALA A HB3  3  
ATOM   4921  N  N    . ALA A 1 37  ? 16.226  -2.690  5.223   1.00 10.00 ? 37  ALA A N    3  
ATOM   4922  C  CA   . ALA A 1 37  ? 17.600  -2.283  5.545   1.00 10.00 ? 37  ALA A CA   3  
ATOM   4923  C  C    . ALA A 1 37  ? 18.592  -2.962  4.593   1.00 10.00 ? 37  ALA A C    3  
ATOM   4924  O  O    . ALA A 1 37  ? 18.579  -4.189  4.492   1.00 10.00 ? 37  ALA A O    3  
ATOM   4925  C  CB   . ALA A 1 37  ? 17.950  -2.628  6.996   1.00 10.00 ? 37  ALA A CB   3  
ATOM   4926  H  H    . ALA A 1 37  ? 15.577  -2.902  5.970   1.00 10.00 ? 37  ALA A H    3  
ATOM   4927  H  HA   . ALA A 1 37  ? 17.667  -1.201  5.423   1.00 10.00 ? 37  ALA A HA   3  
ATOM   4928  H  HB1  . ALA A 1 37  ? 17.667  -1.808  7.650   1.00 10.00 ? 37  ALA A HB1  3  
ATOM   4929  H  HB2  . ALA A 1 37  ? 17.438  -3.538  7.304   1.00 10.00 ? 37  ALA A HB2  3  
ATOM   4930  H  HB3  . ALA A 1 37  ? 19.025  -2.777  7.101   1.00 10.00 ? 37  ALA A HB3  3  
ATOM   4931  N  N    . VAL A 1 38  ? 19.389  -2.152  3.882   1.00 10.00 ? 38  VAL A N    3  
ATOM   4932  C  CA   . VAL A 1 38  ? 19.817  -2.403  2.507   1.00 10.00 ? 38  VAL A CA   3  
ATOM   4933  C  C    . VAL A 1 38  ? 20.030  -3.877  2.125   1.00 10.00 ? 38  VAL A C    3  
ATOM   4934  O  O    . VAL A 1 38  ? 20.788  -4.597  2.782   1.00 10.00 ? 38  VAL A O    3  
ATOM   4935  C  CB   . VAL A 1 38  ? 21.004  -1.519  2.077   1.00 10.00 ? 38  VAL A CB   3  
ATOM   4936  C  CG1  . VAL A 1 38  ? 20.734  -0.030  2.324   1.00 10.00 ? 38  VAL A CG1  3  
ATOM   4937  C  CG2  . VAL A 1 38  ? 22.344  -1.894  2.718   1.00 10.00 ? 38  VAL A CG2  3  
ATOM   4938  H  H    . VAL A 1 38  ? 19.343  -1.177  4.123   1.00 10.00 ? 38  VAL A H    3  
ATOM   4939  H  HA   . VAL A 1 38  ? 18.978  -2.023  1.939   1.00 10.00 ? 38  VAL A HA   3  
ATOM   4940  H  HB   . VAL A 1 38  ? 21.122  -1.654  1.000   1.00 10.00 ? 38  VAL A HB   3  
ATOM   4941  H  HG11 . VAL A 1 38  ? 19.688  0.216   2.157   1.00 10.00 ? 38  VAL A HG11 3  
ATOM   4942  H  HG12 . VAL A 1 38  ? 21.001  0.238   3.345   1.00 10.00 ? 38  VAL A HG12 3  
ATOM   4943  H  HG13 . VAL A 1 38  ? 21.329  0.552   1.621   1.00 10.00 ? 38  VAL A HG13 3  
ATOM   4944  H  HG21 . VAL A 1 38  ? 22.644  -2.893  2.404   1.00 10.00 ? 38  VAL A HG21 3  
ATOM   4945  H  HG22 . VAL A 1 38  ? 23.106  -1.195  2.374   1.00 10.00 ? 38  VAL A HG22 3  
ATOM   4946  H  HG23 . VAL A 1 38  ? 22.272  -1.850  3.805   1.00 10.00 ? 38  VAL A HG23 3  
ATOM   4947  N  N    . PRO A 1 39  ? 19.362  -4.372  1.076   1.00 10.00 ? 39  PRO A N    3  
ATOM   4948  C  CA   . PRO A 1 39  ? 19.727  -5.616  0.424   1.00 10.00 ? 39  PRO A CA   3  
ATOM   4949  C  C    . PRO A 1 39  ? 21.183  -5.627  -0.043  1.00 10.00 ? 39  PRO A C    3  
ATOM   4950  O  O    . PRO A 1 39  ? 21.791  -4.570  -0.197  1.00 10.00 ? 39  PRO A O    3  
ATOM   4951  C  CB   . PRO A 1 39  ? 18.857  -5.638  -0.823  1.00 10.00 ? 39  PRO A CB   3  
ATOM   4952  C  CG   . PRO A 1 39  ? 17.606  -4.873  -0.422  1.00 10.00 ? 39  PRO A CG   3  
ATOM   4953  C  CD   . PRO A 1 39  ? 18.268  -3.745  0.352   1.00 10.00 ? 39  PRO A CD   3  
ATOM   4954  H  HA   . PRO A 1 39  ? 19.497  -6.454  1.078   1.00 10.00 ? 39  PRO A HA   3  
ATOM   4955  H  HB2  . PRO A 1 39  ? 19.364  -5.046  -1.577  1.00 10.00 ? 39  PRO A HB2  3  
ATOM   4956  H  HB3  . PRO A 1 39  ? 18.690  -6.640  -1.193  1.00 10.00 ? 39  PRO A HB3  3  
ATOM   4957  H  HG2  . PRO A 1 39  ? 17.044  -4.491  -1.272  1.00 10.00 ? 39  PRO A HG2  3  
ATOM   4958  H  HG3  . PRO A 1 39  ? 16.977  -5.485  0.226   1.00 10.00 ? 39  PRO A HG3  3  
ATOM   4959  H  HD2  . PRO A 1 39  ? 18.696  -3.040  -0.360  1.00 10.00 ? 39  PRO A HD2  3  
ATOM   4960  H  HD3  . PRO A 1 39  ? 17.523  -3.269  0.983   1.00 10.00 ? 39  PRO A HD3  3  
ATOM   4961  N  N    . PRO A 1 40  ? 21.726  -6.799  -0.393  1.00 10.00 ? 40  PRO A N    3  
ATOM   4962  C  CA   . PRO A 1 40  ? 22.949  -6.883  -1.165  1.00 10.00 ? 40  PRO A CA   3  
ATOM   4963  C  C    . PRO A 1 40  ? 22.633  -6.628  -2.651  1.00 10.00 ? 40  PRO A C    3  
ATOM   4964  O  O    . PRO A 1 40  ? 22.971  -7.452  -3.498  1.00 10.00 ? 40  PRO A O    3  
ATOM   4965  C  CB   . PRO A 1 40  ? 23.448  -8.308  -0.897  1.00 10.00 ? 40  PRO A CB   3  
ATOM   4966  C  CG   . PRO A 1 40  ? 22.146  -9.107  -0.802  1.00 10.00 ? 40  PRO A CG   3  
ATOM   4967  C  CD   . PRO A 1 40  ? 21.175  -8.123  -0.144  1.00 10.00 ? 40  PRO A CD   3  
ATOM   4968  H  HA   . PRO A 1 40  ? 23.696  -6.164  -0.825  1.00 10.00 ? 40  PRO A HA   3  
ATOM   4969  H  HB2  . PRO A 1 40  ? 24.120  -8.689  -1.667  1.00 10.00 ? 40  PRO A HB2  3  
ATOM   4970  H  HB3  . PRO A 1 40  ? 23.950  -8.331  0.071   1.00 10.00 ? 40  PRO A HB3  3  
ATOM   4971  H  HG2  . PRO A 1 40  ? 21.794  -9.345  -1.807  1.00 10.00 ? 40  PRO A HG2  3  
ATOM   4972  H  HG3  . PRO A 1 40  ? 22.262  -10.023 -0.222  1.00 10.00 ? 40  PRO A HG3  3  
ATOM   4973  H  HD2  . PRO A 1 40  ? 20.183  -8.247  -0.579  1.00 10.00 ? 40  PRO A HD2  3  
ATOM   4974  H  HD3  . PRO A 1 40  ? 21.135  -8.306  0.930   1.00 10.00 ? 40  PRO A HD3  3  
ATOM   4975  N  N    . SER A 1 41  ? 21.987  -5.502  -2.988  1.00 10.00 ? 41  SER A N    3  
ATOM   4976  C  CA   . SER A 1 41  ? 21.658  -5.171  -4.375  1.00 10.00 ? 41  SER A CA   3  
ATOM   4977  C  C    . SER A 1 41  ? 21.885  -3.687  -4.640  1.00 10.00 ? 41  SER A C    3  
ATOM   4978  O  O    . SER A 1 41  ? 21.017  -3.020  -5.196  1.00 10.00 ? 41  SER A O    3  
ATOM   4979  C  CB   . SER A 1 41  ? 20.234  -5.623  -4.736  1.00 10.00 ? 41  SER A CB   3  
ATOM   4980  O  OG   . SER A 1 41  ? 19.245  -5.064  -3.892  1.00 10.00 ? 41  SER A OG   3  
ATOM   4981  H  H    . SER A 1 41  ? 21.734  -4.827  -2.268  1.00 10.00 ? 41  SER A H    3  
ATOM   4982  H  HA   . SER A 1 41  ? 22.336  -5.692  -5.052  1.00 10.00 ? 41  SER A HA   3  
ATOM   4983  H  HB2  . SER A 1 41  ? 20.023  -5.331  -5.766  1.00 10.00 ? 41  SER A HB2  3  
ATOM   4984  H  HB3  . SER A 1 41  ? 20.182  -6.711  -4.670  1.00 10.00 ? 41  SER A HB3  3  
ATOM   4985  H  HG   . SER A 1 41  ? 19.477  -4.138  -3.668  1.00 10.00 ? 41  SER A HG   3  
ATOM   4986  N  N    . ILE A 1 42  ? 23.087  -3.216  -4.286  1.00 10.00 ? 42  ILE A N    3  
ATOM   4987  C  CA   . ILE A 1 42  ? 23.499  -1.830  -4.184  1.00 10.00 ? 42  ILE A CA   3  
ATOM   4988  C  C    . ILE A 1 42  ? 23.121  -1.358  -2.775  1.00 10.00 ? 42  ILE A C    3  
ATOM   4989  O  O    . ILE A 1 42  ? 22.450  -2.066  -2.031  1.00 10.00 ? 42  ILE A O    3  
ATOM   4990  C  CB   . ILE A 1 42  ? 22.942  -0.948  -5.316  1.00 10.00 ? 42  ILE A CB   3  
ATOM   4991  C  CG1  . ILE A 1 42  ? 23.238  -1.576  -6.695  1.00 10.00 ? 42  ILE A CG1  3  
ATOM   4992  C  CG2  . ILE A 1 42  ? 23.609  0.430   -5.293  1.00 10.00 ? 42  ILE A CG2  3  
ATOM   4993  C  CD1  . ILE A 1 42  ? 22.309  -1.017  -7.770  1.00 10.00 ? 42  ILE A CD1  3  
ATOM   4994  H  H    . ILE A 1 42  ? 23.703  -3.849  -3.818  1.00 10.00 ? 42  ILE A H    3  
ATOM   4995  H  HA   . ILE A 1 42  ? 24.580  -1.827  -4.297  1.00 10.00 ? 42  ILE A HA   3  
ATOM   4996  H  HB   . ILE A 1 42  ? 21.876  -0.798  -5.136  1.00 10.00 ? 42  ILE A HB   3  
ATOM   4997  H  HG12 . ILE A 1 42  ? 24.279  -1.398  -6.961  1.00 10.00 ? 42  ILE A HG12 3  
ATOM   4998  H  HG13 . ILE A 1 42  ? 23.087  -2.653  -6.708  1.00 10.00 ? 42  ILE A HG13 3  
ATOM   4999  H  HG21 . ILE A 1 42  ? 23.553  0.921   -6.260  1.00 10.00 ? 42  ILE A HG21 3  
ATOM   5000  H  HG22 . ILE A 1 42  ? 23.098  1.067   -4.576  1.00 10.00 ? 42  ILE A HG22 3  
ATOM   5001  H  HG23 . ILE A 1 42  ? 24.658  0.304   -5.025  1.00 10.00 ? 42  ILE A HG23 3  
ATOM   5002  H  HD11 . ILE A 1 42  ? 22.473  0.048   -7.914  1.00 10.00 ? 42  ILE A HD11 3  
ATOM   5003  H  HD12 . ILE A 1 42  ? 22.502  -1.536  -8.708  1.00 10.00 ? 42  ILE A HD12 3  
ATOM   5004  H  HD13 . ILE A 1 42  ? 21.277  -1.191  -7.467  1.00 10.00 ? 42  ILE A HD13 3  
ATOM   5005  N  N    . ARG A 1 43  ? 23.519  -0.146  -2.394  1.00 10.00 ? 43  ARG A N    3  
ATOM   5006  C  CA   . ARG A 1 43  ? 22.982  0.551   -1.234  1.00 10.00 ? 43  ARG A CA   3  
ATOM   5007  C  C    . ARG A 1 43  ? 21.550  1.040   -1.521  1.00 10.00 ? 43  ARG A C    3  
ATOM   5008  O  O    . ARG A 1 43  ? 21.233  2.218   -1.326  1.00 10.00 ? 43  ARG A O    3  
ATOM   5009  C  CB   . ARG A 1 43  ? 23.967  1.655   -0.817  1.00 10.00 ? 43  ARG A CB   3  
ATOM   5010  C  CG   . ARG A 1 43  ? 24.170  2.748   -1.873  1.00 10.00 ? 43  ARG A CG   3  
ATOM   5011  C  CD   . ARG A 1 43  ? 25.583  3.339   -1.824  1.00 10.00 ? 43  ARG A CD   3  
ATOM   5012  N  NE   . ARG A 1 43  ? 25.752  4.379   -2.853  1.00 10.00 ? 43  ARG A NE   3  
ATOM   5013  C  CZ   . ARG A 1 43  ? 26.921  4.942   -3.202  1.00 10.00 ? 43  ARG A CZ   3  
ATOM   5014  N  NH1  . ARG A 1 43  ? 28.046  4.591   -2.569  1.00 10.00 ? 43  ARG A NH1  3  
ATOM   5015  N  NH2  . ARG A 1 43  ? 26.961  5.850   -4.185  1.00 10.00 ? 43  ARG A NH2  3  
ATOM   5016  H  H    . ARG A 1 43  ? 24.102  0.370   -3.024  1.00 10.00 ? 43  ARG A H    3  
ATOM   5017  H  HA   . ARG A 1 43  ? 22.929  -0.143  -0.399  1.00 10.00 ? 43  ARG A HA   3  
ATOM   5018  H  HB2  . ARG A 1 43  ? 23.602  2.132   0.089   1.00 10.00 ? 43  ARG A HB2  3  
ATOM   5019  H  HB3  . ARG A 1 43  ? 24.922  1.178   -0.592  1.00 10.00 ? 43  ARG A HB3  3  
ATOM   5020  H  HG2  . ARG A 1 43  ? 23.985  2.357   -2.868  1.00 10.00 ? 43  ARG A HG2  3  
ATOM   5021  H  HG3  . ARG A 1 43  ? 23.441  3.527   -1.671  1.00 10.00 ? 43  ARG A HG3  3  
ATOM   5022  H  HD2  . ARG A 1 43  ? 25.754  3.767   -0.833  1.00 10.00 ? 43  ARG A HD2  3  
ATOM   5023  H  HD3  . ARG A 1 43  ? 26.294  2.529   -1.999  1.00 10.00 ? 43  ARG A HD3  3  
ATOM   5024  H  HE   . ARG A 1 43  ? 24.910  4.669   -3.333  1.00 10.00 ? 43  ARG A HE   3  
ATOM   5025  H  HH11 . ARG A 1 43  ? 28.001  3.918   -1.818  1.00 10.00 ? 43  ARG A HH11 3  
ATOM   5026  H  HH12 . ARG A 1 43  ? 28.942  4.984   -2.813  1.00 10.00 ? 43  ARG A HH12 3  
ATOM   5027  H  HH21 . ARG A 1 43  ? 26.119  6.120   -4.673  1.00 10.00 ? 43  ARG A HH21 3  
ATOM   5028  H  HH22 . ARG A 1 43  ? 27.830  6.282   -4.464  1.00 10.00 ? 43  ARG A HH22 3  
ATOM   5029  N  N    . ASP A 1 44  ? 20.697  0.130   -2.006  1.00 10.00 ? 44  ASP A N    3  
ATOM   5030  C  CA   . ASP A 1 44  ? 19.279  0.358   -2.226  1.00 10.00 ? 44  ASP A CA   3  
ATOM   5031  C  C    . ASP A 1 44  ? 18.515  0.069   -0.943  1.00 10.00 ? 44  ASP A C    3  
ATOM   5032  O  O    . ASP A 1 44  ? 18.991  -0.653  -0.077  1.00 10.00 ? 44  ASP A O    3  
ATOM   5033  C  CB   . ASP A 1 44  ? 18.736  -0.490  -3.394  1.00 10.00 ? 44  ASP A CB   3  
ATOM   5034  C  CG   . ASP A 1 44  ? 18.508  -1.972  -3.071  1.00 10.00 ? 44  ASP A CG   3  
ATOM   5035  O  OD1  . ASP A 1 44  ? 19.507  -2.662  -2.783  1.00 10.00 ? 44  ASP A OD1  3  
ATOM   5036  O  OD2  . ASP A 1 44  ? 17.344  -2.430  -3.162  1.00 10.00 ? 44  ASP A OD2  3  
ATOM   5037  H  H    . ASP A 1 44  ? 21.007  -0.838  -2.069  1.00 10.00 ? 44  ASP A H    3  
ATOM   5038  H  HA   . ASP A 1 44  ? 19.139  1.404   -2.480  1.00 10.00 ? 44  ASP A HA   3  
ATOM   5039  H  HB2  . ASP A 1 44  ? 17.778  -0.065  -3.693  1.00 10.00 ? 44  ASP A HB2  3  
ATOM   5040  H  HB3  . ASP A 1 44  ? 19.416  -0.424  -4.243  1.00 10.00 ? 44  ASP A HB3  3  
ATOM   5041  N  N    . THR A 1 45  ? 17.316  0.624   -0.825  1.00 10.00 ? 45  THR A N    3  
ATOM   5042  C  CA   . THR A 1 45  ? 16.295  0.106   0.060   1.00 10.00 ? 45  THR A CA   3  
ATOM   5043  C  C    . THR A 1 45  ? 14.970  0.621   -0.481  1.00 10.00 ? 45  THR A C    3  
ATOM   5044  O  O    . THR A 1 45  ? 14.941  1.435   -1.405  1.00 10.00 ? 45  THR A O    3  
ATOM   5045  C  CB   . THR A 1 45  ? 16.544  0.436   1.544   1.00 10.00 ? 45  THR A CB   3  
ATOM   5046  O  OG1  . THR A 1 45  ? 15.466  -0.033  2.322   1.00 10.00 ? 45  THR A OG1  3  
ATOM   5047  C  CG2  . THR A 1 45  ? 16.729  1.915   1.861   1.00 10.00 ? 45  THR A CG2  3  
ATOM   5048  H  H    . THR A 1 45  ? 16.966  1.238   -1.551  1.00 10.00 ? 45  THR A H    3  
ATOM   5049  H  HA   . THR A 1 45  ? 16.293  -0.982  -0.047  1.00 10.00 ? 45  THR A HA   3  
ATOM   5050  H  HB   . THR A 1 45  ? 17.439  -0.091  1.872   1.00 10.00 ? 45  THR A HB   3  
ATOM   5051  H  HG1  . THR A 1 45  ? 15.602  -0.978  2.448   1.00 10.00 ? 45  THR A HG1  3  
ATOM   5052  H  HG21 . THR A 1 45  ? 16.912  2.024   2.929   1.00 10.00 ? 45  THR A HG21 3  
ATOM   5053  H  HG22 . THR A 1 45  ? 17.582  2.312   1.312   1.00 10.00 ? 45  THR A HG22 3  
ATOM   5054  H  HG23 . THR A 1 45  ? 15.824  2.464   1.606   1.00 10.00 ? 45  THR A HG23 3  
ATOM   5055  N  N    . ALA A 1 46  ? 13.874  0.090   0.043   1.00 10.00 ? 46  ALA A N    3  
ATOM   5056  C  CA   . ALA A 1 46  ? 12.535  0.338   -0.427  1.00 10.00 ? 46  ALA A CA   3  
ATOM   5057  C  C    . ALA A 1 46  ? 11.597  0.019   0.720   1.00 10.00 ? 46  ALA A C    3  
ATOM   5058  O  O    . ALA A 1 46  ? 11.944  -0.814  1.563   1.00 10.00 ? 46  ALA A O    3  
ATOM   5059  C  CB   . ALA A 1 46  ? 12.261  -0.578  -1.613  1.00 10.00 ? 46  ALA A CB   3  
ATOM   5060  H  H    . ALA A 1 46  ? 13.955  -0.471  0.882   1.00 10.00 ? 46  ALA A H    3  
ATOM   5061  H  HA   . ALA A 1 46  ? 12.432  1.382   -0.708  1.00 10.00 ? 46  ALA A HA   3  
ATOM   5062  H  HB1  . ALA A 1 46  ? 12.895  -0.321  -2.458  1.00 10.00 ? 46  ALA A HB1  3  
ATOM   5063  H  HB2  . ALA A 1 46  ? 12.512  -1.580  -1.292  1.00 10.00 ? 46  ALA A HB2  3  
ATOM   5064  H  HB3  . ALA A 1 46  ? 11.212  -0.540  -1.909  1.00 10.00 ? 46  ALA A HB3  3  
ATOM   5065  N  N    . ALA A 1 47  ? 10.428  0.663   0.731   1.00 10.00 ? 47  ALA A N    3  
ATOM   5066  C  CA   . ALA A 1 47  ? 9.339   0.267   1.605   1.00 10.00 ? 47  ALA A CA   3  
ATOM   5067  C  C    . ALA A 1 47  ? 8.478   -0.755  0.873   1.00 10.00 ? 47  ALA A C    3  
ATOM   5068  O  O    . ALA A 1 47  ? 8.329   -0.665  -0.347  1.00 10.00 ? 47  ALA A O    3  
ATOM   5069  C  CB   . ALA A 1 47  ? 8.494   1.464   2.035   1.00 10.00 ? 47  ALA A CB   3  
ATOM   5070  H  H    . ALA A 1 47  ? 10.209  1.262   -0.056  1.00 10.00 ? 47  ALA A H    3  
ATOM   5071  H  HA   . ALA A 1 47  ? 9.750   -0.169  2.508   1.00 10.00 ? 47  ALA A HA   3  
ATOM   5072  H  HB1  . ALA A 1 47  ? 7.725   1.100   2.719   1.00 10.00 ? 47  ALA A HB1  3  
ATOM   5073  H  HB2  . ALA A 1 47  ? 9.113   2.196   2.553   1.00 10.00 ? 47  ALA A HB2  3  
ATOM   5074  H  HB3  . ALA A 1 47  ? 8.020   1.926   1.169   1.00 10.00 ? 47  ALA A HB3  3  
ATOM   5075  N  N    . TYR A 1 48  ? 7.895   -1.694  1.618   1.00 10.00 ? 48  TYR A N    3  
ATOM   5076  C  CA   . TYR A 1 48  ? 6.948   -2.669  1.135   1.00 10.00 ? 48  TYR A CA   3  
ATOM   5077  C  C    . TYR A 1 48  ? 5.748   -2.528  2.062   1.00 10.00 ? 48  TYR A C    3  
ATOM   5078  O  O    . TYR A 1 48  ? 5.911   -2.432  3.280   1.00 10.00 ? 48  TYR A O    3  
ATOM   5079  C  CB   . TYR A 1 48  ? 7.566   -4.064  1.112   1.00 10.00 ? 48  TYR A CB   3  
ATOM   5080  C  CG   . TYR A 1 48  ? 8.799   -4.114  0.235   1.00 10.00 ? 48  TYR A CG   3  
ATOM   5081  C  CD1  . TYR A 1 48  ? 8.746   -3.648  -1.096  1.00 10.00 ? 48  TYR A CD1  3  
ATOM   5082  C  CD2  . TYR A 1 48  ? 10.045  -4.385  0.820   1.00 10.00 ? 48  TYR A CD2  3  
ATOM   5083  C  CE1  . TYR A 1 48  ? 9.924   -3.456  -1.832  1.00 10.00 ? 48  TYR A CE1  3  
ATOM   5084  C  CE2  . TYR A 1 48  ? 11.210  -4.260  0.053   1.00 10.00 ? 48  TYR A CE2  3  
ATOM   5085  C  CZ   . TYR A 1 48  ? 11.152  -3.837  -1.278  1.00 10.00 ? 48  TYR A CZ   3  
ATOM   5086  O  OH   . TYR A 1 48  ? 12.290  -3.810  -2.026  1.00 10.00 ? 48  TYR A OH   3  
ATOM   5087  H  H    . TYR A 1 48  ? 7.993   -1.682  2.629   1.00 10.00 ? 48  TYR A H    3  
ATOM   5088  H  HA   . TYR A 1 48  ? 6.703   -2.439  0.105   1.00 10.00 ? 48  TYR A HA   3  
ATOM   5089  H  HB2  . TYR A 1 48  ? 7.818   -4.356  2.131   1.00 10.00 ? 48  TYR A HB2  3  
ATOM   5090  H  HB3  . TYR A 1 48  ? 6.832   -4.773  0.727   1.00 10.00 ? 48  TYR A HB3  3  
ATOM   5091  H  HD1  . TYR A 1 48  ? 7.816   -3.351  -1.544  1.00 10.00 ? 48  TYR A HD1  3  
ATOM   5092  H  HD2  . TYR A 1 48  ? 10.117  -4.657  1.863   1.00 10.00 ? 48  TYR A HD2  3  
ATOM   5093  H  HE1  . TYR A 1 48  ? 9.878   -3.054  -2.833  1.00 10.00 ? 48  TYR A HE1  3  
ATOM   5094  H  HE2  . TYR A 1 48  ? 12.157  -4.440  0.500   1.00 10.00 ? 48  TYR A HE2  3  
ATOM   5095  H  HH   . TYR A 1 48  ? 13.061  -4.086  -1.525  1.00 10.00 ? 48  TYR A HH   3  
ATOM   5096  N  N    . MET A 1 49  ? 4.570   -2.341  1.480   1.00 10.00 ? 49  MET A N    3  
ATOM   5097  C  CA   . MET A 1 49  ? 3.340   -2.023  2.183   1.00 10.00 ? 49  MET A CA   3  
ATOM   5098  C  C    . MET A 1 49  ? 2.189   -2.352  1.241   1.00 10.00 ? 49  MET A C    3  
ATOM   5099  O  O    . MET A 1 49  ? 2.416   -2.881  0.158   1.00 10.00 ? 49  MET A O    3  
ATOM   5100  C  CB   . MET A 1 49  ? 3.331   -0.570  2.692   1.00 10.00 ? 49  MET A CB   3  
ATOM   5101  C  CG   . MET A 1 49  ? 3.192   0.478   1.587   1.00 10.00 ? 49  MET A CG   3  
ATOM   5102  S  SD   . MET A 1 49  ? 3.472   2.198   2.082   1.00 10.00 ? 49  MET A SD   3  
ATOM   5103  C  CE   . MET A 1 49  ? 2.178   2.407   3.325   1.00 10.00 ? 49  MET A CE   3  
ATOM   5104  H  H    . MET A 1 49  ? 4.476   -2.568  0.495   1.00 10.00 ? 49  MET A H    3  
ATOM   5105  H  HA   . MET A 1 49  ? 3.263   -2.686  3.047   1.00 10.00 ? 49  MET A HA   3  
ATOM   5106  H  HB2  . MET A 1 49  ? 2.514   -0.447  3.402   1.00 10.00 ? 49  MET A HB2  3  
ATOM   5107  H  HB3  . MET A 1 49  ? 4.266   -0.370  3.209   1.00 10.00 ? 49  MET A HB3  3  
ATOM   5108  H  HG2  . MET A 1 49  ? 3.928   0.252   0.821   1.00 10.00 ? 49  MET A HG2  3  
ATOM   5109  H  HG3  . MET A 1 49  ? 2.193   0.424   1.159   1.00 10.00 ? 49  MET A HG3  3  
ATOM   5110  H  HE1  . MET A 1 49  ? 2.380   1.750   4.167   1.00 10.00 ? 49  MET A HE1  3  
ATOM   5111  H  HE2  . MET A 1 49  ? 2.181   3.441   3.669   1.00 10.00 ? 49  MET A HE2  3  
ATOM   5112  H  HE3  . MET A 1 49  ? 1.208   2.168   2.893   1.00 10.00 ? 49  MET A HE3  3  
ATOM   5113  N  N    . THR A 1 50  ? 0.966   -2.033  1.644   1.00 10.00 ? 50  THR A N    3  
ATOM   5114  C  CA   . THR A 1 50  ? -0.214  -2.122  0.806   1.00 10.00 ? 50  THR A CA   3  
ATOM   5115  C  C    . THR A 1 50  ? -0.918  -0.764  0.798   1.00 10.00 ? 50  THR A C    3  
ATOM   5116  O  O    . THR A 1 50  ? -1.383  -0.306  1.842   1.00 10.00 ? 50  THR A O    3  
ATOM   5117  C  CB   . THR A 1 50  ? -1.111  -3.234  1.349   1.00 10.00 ? 50  THR A CB   3  
ATOM   5118  O  OG1  . THR A 1 50  ? -0.379  -4.435  1.489   1.00 10.00 ? 50  THR A OG1  3  
ATOM   5119  C  CG2  . THR A 1 50  ? -2.254  -3.481  0.380   1.00 10.00 ? 50  THR A CG2  3  
ATOM   5120  H  H    . THR A 1 50  ? 0.861   -1.581  2.533   1.00 10.00 ? 50  THR A H    3  
ATOM   5121  H  HA   . THR A 1 50  ? 0.061   -2.369  -0.216  1.00 10.00 ? 50  THR A HA   3  
ATOM   5122  H  HB   . THR A 1 50  ? -1.508  -2.935  2.319   1.00 10.00 ? 50  THR A HB   3  
ATOM   5123  H  HG1  . THR A 1 50  ? 0.417   -4.258  1.995   1.00 10.00 ? 50  THR A HG1  3  
ATOM   5124  H  HG21 . THR A 1 50  ? -2.901  -4.258  0.781   1.00 10.00 ? 50  THR A HG21 3  
ATOM   5125  H  HG22 . THR A 1 50  ? -2.818  -2.561  0.253   1.00 10.00 ? 50  THR A HG22 3  
ATOM   5126  H  HG23 . THR A 1 50  ? -1.843  -3.794  -0.579  1.00 10.00 ? 50  THR A HG23 3  
ATOM   5127  N  N    . LEU A 1 51  ? -1.021  -0.114  -0.364  1.00 10.00 ? 51  LEU A N    3  
ATOM   5128  C  CA   . LEU A 1 51  ? -1.744  1.136   -0.479  1.00 10.00 ? 51  LEU A CA   3  
ATOM   5129  C  C    . LEU A 1 51  ? -3.190  0.722   -0.659  1.00 10.00 ? 51  LEU A C    3  
ATOM   5130  O  O    . LEU A 1 51  ? -3.530  0.075   -1.648  1.00 10.00 ? 51  LEU A O    3  
ATOM   5131  C  CB   . LEU A 1 51  ? -1.254  1.936   -1.685  1.00 10.00 ? 51  LEU A CB   3  
ATOM   5132  C  CG   . LEU A 1 51  ? -0.518  3.232   -1.333  1.00 10.00 ? 51  LEU A CG   3  
ATOM   5133  C  CD1  . LEU A 1 51  ? 0.622   3.064   -0.319  1.00 10.00 ? 51  LEU A CD1  3  
ATOM   5134  C  CD2  . LEU A 1 51  ? 0.041   3.833   -2.625  1.00 10.00 ? 51  LEU A CD2  3  
ATOM   5135  H  H    . LEU A 1 51  ? -0.886  -0.617  -1.236  1.00 10.00 ? 51  LEU A H    3  
ATOM   5136  H  HA   . LEU A 1 51  ? -1.642  1.732   0.431   1.00 10.00 ? 51  LEU A HA   3  
ATOM   5137  H  HB2  . LEU A 1 51  ? -0.624  1.299   -2.294  1.00 10.00 ? 51  LEU A HB2  3  
ATOM   5138  H  HB3  . LEU A 1 51  ? -2.129  2.222   -2.268  1.00 10.00 ? 51  LEU A HB3  3  
ATOM   5139  H  HG   . LEU A 1 51  ? -1.258  3.917   -0.927  1.00 10.00 ? 51  LEU A HG   3  
ATOM   5140  H  HD11 . LEU A 1 51  ? 1.141   4.014   -0.192  1.00 10.00 ? 51  LEU A HD11 3  
ATOM   5141  H  HD12 . LEU A 1 51  ? 0.246   2.761   0.656   1.00 10.00 ? 51  LEU A HD12 3  
ATOM   5142  H  HD13 . LEU A 1 51  ? 1.334   2.322   -0.669  1.00 10.00 ? 51  LEU A HD13 3  
ATOM   5143  H  HD21 . LEU A 1 51  ? -0.777  4.092   -3.296  1.00 10.00 ? 51  LEU A HD21 3  
ATOM   5144  H  HD22 . LEU A 1 51  ? 0.616   4.731   -2.403  1.00 10.00 ? 51  LEU A HD22 3  
ATOM   5145  H  HD23 . LEU A 1 51  ? 0.692   3.111   -3.116  1.00 10.00 ? 51  LEU A HD23 3  
ATOM   5146  N  N    . THR A 1 52  ? -3.975  1.054   0.359   1.00 10.00 ? 52  THR A N    3  
ATOM   5147  C  CA   . THR A 1 52  ? -5.283  0.492   0.644   1.00 10.00 ? 52  THR A CA   3  
ATOM   5148  C  C    . THR A 1 52  ? -6.306  1.629   0.679   1.00 10.00 ? 52  THR A C    3  
ATOM   5149  O  O    . THR A 1 52  ? -6.444  2.308   1.694   1.00 10.00 ? 52  THR A O    3  
ATOM   5150  C  CB   . THR A 1 52  ? -5.190  -0.246  1.990   1.00 10.00 ? 52  THR A CB   3  
ATOM   5151  O  OG1  . THR A 1 52  ? -4.081  -1.127  1.989   1.00 10.00 ? 52  THR A OG1  3  
ATOM   5152  C  CG2  . THR A 1 52  ? -6.453  -1.064  2.270   1.00 10.00 ? 52  THR A CG2  3  
ATOM   5153  H  H    . THR A 1 52  ? -3.533  1.614   1.069   1.00 10.00 ? 52  THR A H    3  
ATOM   5154  H  HA   . THR A 1 52  ? -5.562  -0.227  -0.130  1.00 10.00 ? 52  THR A HA   3  
ATOM   5155  H  HB   . THR A 1 52  ? -5.047  0.476   2.796   1.00 10.00 ? 52  THR A HB   3  
ATOM   5156  H  HG1  . THR A 1 52  ? -3.257  -0.622  2.010   1.00 10.00 ? 52  THR A HG1  3  
ATOM   5157  H  HG21 . THR A 1 52  ? -6.600  -1.802  1.480   1.00 10.00 ? 52  THR A HG21 3  
ATOM   5158  H  HG22 . THR A 1 52  ? -6.340  -1.583  3.222   1.00 10.00 ? 52  THR A HG22 3  
ATOM   5159  H  HG23 . THR A 1 52  ? -7.324  -0.411  2.324   1.00 10.00 ? 52  THR A HG23 3  
ATOM   5160  N  N    . ASN A 1 53  ? -6.991  1.878   -0.438  1.00 10.00 ? 53  ASN A N    3  
ATOM   5161  C  CA   . ASN A 1 53  ? -7.823  3.065   -0.593  1.00 10.00 ? 53  ASN A CA   3  
ATOM   5162  C  C    . ASN A 1 53  ? -9.214  2.872   0.010   1.00 10.00 ? 53  ASN A C    3  
ATOM   5163  O  O    . ASN A 1 53  ? -9.807  1.807   -0.152  1.00 10.00 ? 53  ASN A O    3  
ATOM   5164  C  CB   . ASN A 1 53  ? -7.958  3.395   -2.082  1.00 10.00 ? 53  ASN A CB   3  
ATOM   5165  C  CG   . ASN A 1 53  ? -8.369  4.842   -2.258  1.00 10.00 ? 53  ASN A CG   3  
ATOM   5166  O  OD1  . ASN A 1 53  ? -9.516  5.203   -2.037  1.00 10.00 ? 53  ASN A OD1  3  
ATOM   5167  N  ND2  . ASN A 1 53  ? -7.409  5.684   -2.618  1.00 10.00 ? 53  ASN A ND2  3  
ATOM   5168  H  H    . ASN A 1 53  ? -6.789  1.328   -1.266  1.00 10.00 ? 53  ASN A H    3  
ATOM   5169  H  HA   . ASN A 1 53  ? -7.328  3.903   -0.100  1.00 10.00 ? 53  ASN A HA   3  
ATOM   5170  H  HB2  . ASN A 1 53  ? -7.005  3.269   -2.583  1.00 10.00 ? 53  ASN A HB2  3  
ATOM   5171  H  HB3  . ASN A 1 53  ? -8.686  2.736   -2.556  1.00 10.00 ? 53  ASN A HB3  3  
ATOM   5172  H  HD21 . ASN A 1 53  ? -6.484  5.319   -2.778  1.00 10.00 ? 53  ASN A HD21 3  
ATOM   5173  H  HD22 . ASN A 1 53  ? -7.562  6.675   -2.679  1.00 10.00 ? 53  ASN A HD22 3  
ATOM   5174  N  N    . LYS A 1 54  ? -9.754  3.908   0.662   1.00 10.00 ? 54  LYS A N    3  
ATOM   5175  C  CA   . LYS A 1 54  ? -11.153 3.982   1.049   1.00 10.00 ? 54  LYS A CA   3  
ATOM   5176  C  C    . LYS A 1 54  ? -11.610 5.436   0.903   1.00 10.00 ? 54  LYS A C    3  
ATOM   5177  O  O    . LYS A 1 54  ? -12.022 6.072   1.869   1.00 10.00 ? 54  LYS A O    3  
ATOM   5178  C  CB   . LYS A 1 54  ? -11.351 3.461   2.476   1.00 10.00 ? 54  LYS A CB   3  
ATOM   5179  C  CG   . LYS A 1 54  ? -11.114 1.951   2.612   1.00 10.00 ? 54  LYS A CG   3  
ATOM   5180  C  CD   . LYS A 1 54  ? -11.749 1.383   3.891   1.00 10.00 ? 54  LYS A CD   3  
ATOM   5181  C  CE   . LYS A 1 54  ? -11.151 1.998   5.167   1.00 10.00 ? 54  LYS A CE   3  
ATOM   5182  N  NZ   . LYS A 1 54  ? -11.774 1.455   6.392   1.00 10.00 ? 54  LYS A NZ   3  
ATOM   5183  H  H    . LYS A 1 54  ? -9.232  4.765   0.785   1.00 10.00 ? 54  LYS A H    3  
ATOM   5184  H  HA   . LYS A 1 54  ? -11.765 3.386   0.371   1.00 10.00 ? 54  LYS A HA   3  
ATOM   5185  H  HB2  . LYS A 1 54  ? -10.675 3.996   3.135   1.00 10.00 ? 54  LYS A HB2  3  
ATOM   5186  H  HB3  . LYS A 1 54  ? -12.374 3.690   2.761   1.00 10.00 ? 54  LYS A HB3  3  
ATOM   5187  H  HG2  . LYS A 1 54  ? -11.570 1.446   1.759   1.00 10.00 ? 54  LYS A HG2  3  
ATOM   5188  H  HG3  . LYS A 1 54  ? -10.041 1.746   2.594   1.00 10.00 ? 54  LYS A HG3  3  
ATOM   5189  H  HD2  . LYS A 1 54  ? -12.825 1.570   3.851   1.00 10.00 ? 54  LYS A HD2  3  
ATOM   5190  H  HD3  . LYS A 1 54  ? -11.587 0.303   3.891   1.00 10.00 ? 54  LYS A HD3  3  
ATOM   5191  H  HE2  . LYS A 1 54  ? -10.079 1.793   5.192   1.00 10.00 ? 54  LYS A HE2  3  
ATOM   5192  H  HE3  . LYS A 1 54  ? -11.302 3.079   5.160   1.00 10.00 ? 54  LYS A HE3  3  
ATOM   5193  H  HZ1  . LYS A 1 54  ? -11.632 0.456   6.445   1.00 10.00 ? 54  LYS A HZ1  3  
ATOM   5194  H  HZ2  . LYS A 1 54  ? -11.355 1.886   7.205   1.00 10.00 ? 54  LYS A HZ2  3  
ATOM   5195  H  HZ3  . LYS A 1 54  ? -12.765 1.651   6.397   1.00 10.00 ? 54  LYS A HZ3  3  
ATOM   5196  N  N    . SER A 1 55  ? -11.525 5.951   -0.323  1.00 10.00 ? 55  SER A N    3  
ATOM   5197  C  CA   . SER A 1 55  ? -11.943 7.302   -0.694  1.00 10.00 ? 55  SER A CA   3  
ATOM   5198  C  C    . SER A 1 55  ? -12.382 7.359   -2.158  1.00 10.00 ? 55  SER A C    3  
ATOM   5199  O  O    . SER A 1 55  ? -13.338 8.058   -2.475  1.00 10.00 ? 55  SER A O    3  
ATOM   5200  C  CB   . SER A 1 55  ? -10.819 8.309   -0.422  1.00 10.00 ? 55  SER A CB   3  
ATOM   5201  O  OG   . SER A 1 55  ? -11.288 9.636   -0.576  1.00 10.00 ? 55  SER A OG   3  
ATOM   5202  H  H    . SER A 1 55  ? -11.119 5.353   -1.034  1.00 10.00 ? 55  SER A H    3  
ATOM   5203  H  HA   . SER A 1 55  ? -12.801 7.586   -0.088  1.00 10.00 ? 55  SER A HA   3  
ATOM   5204  H  HB2  . SER A 1 55  ? -10.467 8.197   0.602   1.00 10.00 ? 55  SER A HB2  3  
ATOM   5205  H  HB3  . SER A 1 55  ? -9.986  8.131   -1.103  1.00 10.00 ? 55  SER A HB3  3  
ATOM   5206  H  HG   . SER A 1 55  ? -11.941 9.673   -1.283  1.00 10.00 ? 55  SER A HG   3  
ATOM   5207  N  N    . ASP A 1 56  ? -11.661 6.656   -3.035  1.00 10.00 ? 56  ASP A N    3  
ATOM   5208  C  CA   . ASP A 1 56  ? -11.940 6.492   -4.444  1.00 10.00 ? 56  ASP A CA   3  
ATOM   5209  C  C    . ASP A 1 56  ? -11.804 7.826   -5.170  1.00 10.00 ? 56  ASP A C    3  
ATOM   5210  O  O    . ASP A 1 56  ? -12.750 8.363   -5.739  1.00 10.00 ? 56  ASP A O    3  
ATOM   5211  C  CB   . ASP A 1 56  ? -13.271 5.756   -4.658  1.00 10.00 ? 56  ASP A CB   3  
ATOM   5212  C  CG   . ASP A 1 56  ? -13.236 4.919   -5.925  1.00 10.00 ? 56  ASP A CG   3  
ATOM   5213  O  OD1  . ASP A 1 56  ? -12.231 4.188   -6.069  1.00 10.00 ? 56  ASP A OD1  3  
ATOM   5214  O  OD2  . ASP A 1 56  ? -14.198 5.006   -6.714  1.00 10.00 ? 56  ASP A OD2  3  
ATOM   5215  H  H    . ASP A 1 56  ? -10.825 6.188   -2.728  1.00 10.00 ? 56  ASP A H    3  
ATOM   5216  H  HA   . ASP A 1 56  ? -11.126 5.861   -4.795  1.00 10.00 ? 56  ASP A HA   3  
ATOM   5217  H  HB2  . ASP A 1 56  ? -13.446 5.070   -3.832  1.00 10.00 ? 56  ASP A HB2  3  
ATOM   5218  H  HB3  . ASP A 1 56  ? -14.099 6.465   -4.697  1.00 10.00 ? 56  ASP A HB3  3  
ATOM   5219  N  N    . GLN A 1 57  ? -10.588 8.373   -5.103  1.00 10.00 ? 57  GLN A N    3  
ATOM   5220  C  CA   . GLN A 1 57  ? -10.200 9.670   -5.627  1.00 10.00 ? 57  GLN A CA   3  
ATOM   5221  C  C    . GLN A 1 57  ? -8.795  9.527   -6.230  1.00 10.00 ? 57  GLN A C    3  
ATOM   5222  O  O    . GLN A 1 57  ? -8.043  8.657   -5.791  1.00 10.00 ? 57  GLN A O    3  
ATOM   5223  C  CB   . GLN A 1 57  ? -10.198 10.674  -4.463  1.00 10.00 ? 57  GLN A CB   3  
ATOM   5224  C  CG   . GLN A 1 57  ? -11.601 11.029  -3.948  1.00 10.00 ? 57  GLN A CG   3  
ATOM   5225  C  CD   . GLN A 1 57  ? -12.429 11.795  -4.977  1.00 10.00 ? 57  GLN A CD   3  
ATOM   5226  O  OE1  . GLN A 1 57  ? -12.343 13.015  -5.062  1.00 10.00 ? 57  GLN A OE1  3  
ATOM   5227  N  NE2  . GLN A 1 57  ? -13.235 11.096  -5.769  1.00 10.00 ? 57  GLN A NE2  3  
ATOM   5228  H  H    . GLN A 1 57  ? -9.843  7.843   -4.674  1.00 10.00 ? 57  GLN A H    3  
ATOM   5229  H  HA   . GLN A 1 57  ? -10.897 9.973   -6.406  1.00 10.00 ? 57  GLN A HA   3  
ATOM   5230  H  HB2  . GLN A 1 57  ? -9.638  10.234  -3.633  1.00 10.00 ? 57  GLN A HB2  3  
ATOM   5231  H  HB3  . GLN A 1 57  ? -9.699  11.595  -4.770  1.00 10.00 ? 57  GLN A HB3  3  
ATOM   5232  H  HG2  . GLN A 1 57  ? -12.135 10.133  -3.637  1.00 10.00 ? 57  GLN A HG2  3  
ATOM   5233  H  HG3  . GLN A 1 57  ? -11.488 11.669  -3.072  1.00 10.00 ? 57  GLN A HG3  3  
ATOM   5234  H  HE21 . GLN A 1 57  ? -13.262 10.079  -5.702  1.00 10.00 ? 57  GLN A HE21 3  
ATOM   5235  H  HE22 . GLN A 1 57  ? -13.810 11.574  -6.441  1.00 10.00 ? 57  GLN A HE22 3  
ATOM   5236  N  N    . PRO A 1 58  ? -8.430  10.340  -7.234  1.00 10.00 ? 58  PRO A N    3  
ATOM   5237  C  CA   . PRO A 1 58  ? -7.133  10.261  -7.890  1.00 10.00 ? 58  PRO A CA   3  
ATOM   5238  C  C    . PRO A 1 58  ? -6.033  10.835  -6.986  1.00 10.00 ? 58  PRO A C    3  
ATOM   5239  O  O    . PRO A 1 58  ? -5.788  12.040  -7.011  1.00 10.00 ? 58  PRO A O    3  
ATOM   5240  C  CB   . PRO A 1 58  ? -7.301  11.056  -9.190  1.00 10.00 ? 58  PRO A CB   3  
ATOM   5241  C  CG   . PRO A 1 58  ? -8.367  12.094  -8.838  1.00 10.00 ? 58  PRO A CG   3  
ATOM   5242  C  CD   . PRO A 1 58  ? -9.277  11.334  -7.875  1.00 10.00 ? 58  PRO A CD   3  
ATOM   5243  H  HA   . PRO A 1 58  ? -6.899  9.234   -8.152  1.00 10.00 ? 58  PRO A HA   3  
ATOM   5244  H  HB2  . PRO A 1 58  ? -6.370  11.511  -9.530  1.00 10.00 ? 58  PRO A HB2  3  
ATOM   5245  H  HB3  . PRO A 1 58  ? -7.694  10.395  -9.964  1.00 10.00 ? 58  PRO A HB3  3  
ATOM   5246  H  HG2  . PRO A 1 58  ? -7.903  12.933  -8.316  1.00 10.00 ? 58  PRO A HG2  3  
ATOM   5247  H  HG3  . PRO A 1 58  ? -8.903  12.453  -9.718  1.00 10.00 ? 58  PRO A HG3  3  
ATOM   5248  H  HD2  . PRO A 1 58  ? -9.726  12.023  -7.159  1.00 10.00 ? 58  PRO A HD2  3  
ATOM   5249  H  HD3  . PRO A 1 58  ? -10.058 10.827  -8.445  1.00 10.00 ? 58  PRO A HD3  3  
ATOM   5250  N  N    . ILE A 1 59  ? -5.366  9.993   -6.184  1.00 10.00 ? 59  ILE A N    3  
ATOM   5251  C  CA   . ILE A 1 59  ? -4.352  10.468  -5.237  1.00 10.00 ? 59  ILE A CA   3  
ATOM   5252  C  C    . ILE A 1 59  ? -2.950  10.370  -5.855  1.00 10.00 ? 59  ILE A C    3  
ATOM   5253  O  O    . ILE A 1 59  ? -2.657  9.469   -6.643  1.00 10.00 ? 59  ILE A O    3  
ATOM   5254  C  CB   . ILE A 1 59  ? -4.447  9.765   -3.865  1.00 10.00 ? 59  ILE A CB   3  
ATOM   5255  C  CG1  . ILE A 1 59  ? -5.868  9.627   -3.303  1.00 10.00 ? 59  ILE A CG1  3  
ATOM   5256  C  CG2  . ILE A 1 59  ? -3.535  10.436  -2.825  1.00 10.00 ? 59  ILE A CG2  3  
ATOM   5257  C  CD1  . ILE A 1 59  ? -6.567  10.969  -3.155  1.00 10.00 ? 59  ILE A CD1  3  
ATOM   5258  H  H    . ILE A 1 59  ? -5.538  8.997   -6.284  1.00 10.00 ? 59  ILE A H    3  
ATOM   5259  H  HA   . ILE A 1 59  ? -4.539  11.524  -5.036  1.00 10.00 ? 59  ILE A HA   3  
ATOM   5260  H  HB   . ILE A 1 59  ? -4.101  8.753   -3.977  1.00 10.00 ? 59  ILE A HB   3  
ATOM   5261  H  HG12 . ILE A 1 59  ? -6.463  8.996   -3.957  1.00 10.00 ? 59  ILE A HG12 3  
ATOM   5262  H  HG13 . ILE A 1 59  ? -5.824  9.143   -2.327  1.00 10.00 ? 59  ILE A HG13 3  
ATOM   5263  H  HG21 . ILE A 1 59  ? -2.493  10.308  -3.105  1.00 10.00 ? 59  ILE A HG21 3  
ATOM   5264  H  HG22 . ILE A 1 59  ? -3.745  11.503  -2.750  1.00 10.00 ? 59  ILE A HG22 3  
ATOM   5265  H  HG23 . ILE A 1 59  ? -3.679  9.975   -1.848  1.00 10.00 ? 59  ILE A HG23 3  
ATOM   5266  H  HD11 . ILE A 1 59  ? -5.974  11.617  -2.516  1.00 10.00 ? 59  ILE A HD11 3  
ATOM   5267  H  HD12 . ILE A 1 59  ? -6.685  11.420  -4.137  1.00 10.00 ? 59  ILE A HD12 3  
ATOM   5268  H  HD13 . ILE A 1 59  ? -7.545  10.811  -2.705  1.00 10.00 ? 59  ILE A HD13 3  
ATOM   5269  N  N    . LYS A 1 60  ? -2.096  11.332  -5.491  1.00 10.00 ? 60  LYS A N    3  
ATOM   5270  C  CA   . LYS A 1 60  ? -0.782  11.604  -6.051  1.00 10.00 ? 60  LYS A CA   3  
ATOM   5271  C  C    . LYS A 1 60  ? 0.244   11.770  -4.916  1.00 10.00 ? 60  LYS A C    3  
ATOM   5272  O  O    . LYS A 1 60  ? 0.561   12.882  -4.491  1.00 10.00 ? 60  LYS A O    3  
ATOM   5273  C  CB   . LYS A 1 60  ? -0.893  12.845  -6.957  1.00 10.00 ? 60  LYS A CB   3  
ATOM   5274  C  CG   . LYS A 1 60  ? -1.642  14.028  -6.318  1.00 10.00 ? 60  LYS A CG   3  
ATOM   5275  C  CD   . LYS A 1 60  ? -1.804  15.182  -7.312  1.00 10.00 ? 60  LYS A CD   3  
ATOM   5276  C  CE   . LYS A 1 60  ? -2.498  16.346  -6.588  1.00 10.00 ? 60  LYS A CE   3  
ATOM   5277  N  NZ   . LYS A 1 60  ? -2.691  17.533  -7.446  1.00 10.00 ? 60  LYS A NZ   3  
ATOM   5278  H  H    . LYS A 1 60  ? -2.434  12.005  -4.827  1.00 10.00 ? 60  LYS A H    3  
ATOM   5279  H  HA   . LYS A 1 60  ? -0.466  10.760  -6.667  1.00 10.00 ? 60  LYS A HA   3  
ATOM   5280  H  HB2  . LYS A 1 60  ? 0.107   13.152  -7.267  1.00 10.00 ? 60  LYS A HB2  3  
ATOM   5281  H  HB3  . LYS A 1 60  ? -1.460  12.562  -7.840  1.00 10.00 ? 60  LYS A HB3  3  
ATOM   5282  H  HG2  . LYS A 1 60  ? -2.644  13.725  -6.013  1.00 10.00 ? 60  LYS A HG2  3  
ATOM   5283  H  HG3  . LYS A 1 60  ? -1.098  14.380  -5.442  1.00 10.00 ? 60  LYS A HG3  3  
ATOM   5284  H  HD2  . LYS A 1 60  ? -0.817  15.474  -7.676  1.00 10.00 ? 60  LYS A HD2  3  
ATOM   5285  H  HD3  . LYS A 1 60  ? -2.408  14.835  -8.154  1.00 10.00 ? 60  LYS A HD3  3  
ATOM   5286  H  HE2  . LYS A 1 60  ? -3.470  16.019  -6.209  1.00 10.00 ? 60  LYS A HE2  3  
ATOM   5287  H  HE3  . LYS A 1 60  ? -1.881  16.634  -5.740  1.00 10.00 ? 60  LYS A HE3  3  
ATOM   5288  H  HZ1  . LYS A 1 60  ? -3.148  18.258  -6.908  1.00 10.00 ? 60  LYS A HZ1  3  
ATOM   5289  H  HZ2  . LYS A 1 60  ? -1.801  17.884  -7.770  1.00 10.00 ? 60  LYS A HZ2  3  
ATOM   5290  H  HZ3  . LYS A 1 60  ? -3.273  17.303  -8.239  1.00 10.00 ? 60  LYS A HZ3  3  
ATOM   5291  N  N    . LEU A 1 61  ? 0.772   10.656  -4.407  1.00 10.00 ? 61  LEU A N    3  
ATOM   5292  C  CA   . LEU A 1 61  ? 1.634   10.648  -3.227  1.00 10.00 ? 61  LEU A CA   3  
ATOM   5293  C  C    . LEU A 1 61  ? 3.080   10.988  -3.593  1.00 10.00 ? 61  LEU A C    3  
ATOM   5294  O  O    . LEU A 1 61  ? 3.966   10.137  -3.544  1.00 10.00 ? 61  LEU A O    3  
ATOM   5295  C  CB   . LEU A 1 61  ? 1.551   9.277   -2.547  1.00 10.00 ? 61  LEU A CB   3  
ATOM   5296  C  CG   . LEU A 1 61  ? 0.217   9.033   -1.828  1.00 10.00 ? 61  LEU A CG   3  
ATOM   5297  C  CD1  . LEU A 1 61  ? 0.160   7.561   -1.426  1.00 10.00 ? 61  LEU A CD1  3  
ATOM   5298  C  CD2  . LEU A 1 61  ? 0.062   9.903   -0.573  1.00 10.00 ? 61  LEU A CD2  3  
ATOM   5299  H  H    . LEU A 1 61  ? 0.491   9.768   -4.796  1.00 10.00 ? 61  LEU A H    3  
ATOM   5300  H  HA   . LEU A 1 61  ? 1.301   11.406  -2.521  1.00 10.00 ? 61  LEU A HA   3  
ATOM   5301  H  HB2  . LEU A 1 61  ? 1.704   8.508   -3.306  1.00 10.00 ? 61  LEU A HB2  3  
ATOM   5302  H  HB3  . LEU A 1 61  ? 2.351   9.184   -1.814  1.00 10.00 ? 61  LEU A HB3  3  
ATOM   5303  H  HG   . LEU A 1 61  ? -0.610  9.229   -2.509  1.00 10.00 ? 61  LEU A HG   3  
ATOM   5304  H  HD11 . LEU A 1 61  ? -0.711  7.378   -0.801  1.00 10.00 ? 61  LEU A HD11 3  
ATOM   5305  H  HD12 . LEU A 1 61  ? 0.091   6.958   -2.331  1.00 10.00 ? 61  LEU A HD12 3  
ATOM   5306  H  HD13 . LEU A 1 61  ? 1.057   7.286   -0.871  1.00 10.00 ? 61  LEU A HD13 3  
ATOM   5307  H  HD21 . LEU A 1 61  ? -0.001  10.958  -0.834  1.00 10.00 ? 61  LEU A HD21 3  
ATOM   5308  H  HD22 . LEU A 1 61  ? -0.855  9.630   -0.050  1.00 10.00 ? 61  LEU A HD22 3  
ATOM   5309  H  HD23 . LEU A 1 61  ? 0.909   9.747   0.094   1.00 10.00 ? 61  LEU A HD23 3  
ATOM   5310  N  N    . VAL A 1 62  ? 3.341   12.256  -3.914  1.00 10.00 ? 62  VAL A N    3  
ATOM   5311  C  CA   . VAL A 1 62  ? 4.668   12.676  -4.364  1.00 10.00 ? 62  VAL A CA   3  
ATOM   5312  C  C    . VAL A 1 62  ? 5.594   12.935  -3.170  1.00 10.00 ? 62  VAL A C    3  
ATOM   5313  O  O    . VAL A 1 62  ? 6.163   14.016  -3.045  1.00 10.00 ? 62  VAL A O    3  
ATOM   5314  C  CB   . VAL A 1 62  ? 4.561   13.924  -5.269  1.00 10.00 ? 62  VAL A CB   3  
ATOM   5315  C  CG1  . VAL A 1 62  ? 5.857   14.128  -6.072  1.00 10.00 ? 62  VAL A CG1  3  
ATOM   5316  C  CG2  . VAL A 1 62  ? 3.385   13.802  -6.239  1.00 10.00 ? 62  VAL A CG2  3  
ATOM   5317  H  H    . VAL A 1 62  ? 2.551   12.887  -3.973  1.00 10.00 ? 62  VAL A H    3  
ATOM   5318  H  HA   . VAL A 1 62  ? 5.107   11.874  -4.959  1.00 10.00 ? 62  VAL A HA   3  
ATOM   5319  H  HB   . VAL A 1 62  ? 4.388   14.813  -4.663  1.00 10.00 ? 62  VAL A HB   3  
ATOM   5320  H  HG11 . VAL A 1 62  ? 6.106   13.221  -6.622  1.00 10.00 ? 62  VAL A HG11 3  
ATOM   5321  H  HG12 . VAL A 1 62  ? 5.735   14.952  -6.775  1.00 10.00 ? 62  VAL A HG12 3  
ATOM   5322  H  HG13 . VAL A 1 62  ? 6.692   14.369  -5.417  1.00 10.00 ? 62  VAL A HG13 3  
ATOM   5323  H  HG21 . VAL A 1 62  ? 3.457   14.554  -7.023  1.00 10.00 ? 62  VAL A HG21 3  
ATOM   5324  H  HG22 . VAL A 1 62  ? 3.380   12.810  -6.674  1.00 10.00 ? 62  VAL A HG22 3  
ATOM   5325  H  HG23 . VAL A 1 62  ? 2.449   13.947  -5.713  1.00 10.00 ? 62  VAL A HG23 3  
ATOM   5326  N  N    . GLY A 1 63  ? 5.781   11.952  -2.288  1.00 10.00 ? 63  GLY A N    3  
ATOM   5327  C  CA   . GLY A 1 63  ? 6.909   11.991  -1.372  1.00 10.00 ? 63  GLY A CA   3  
ATOM   5328  C  C    . GLY A 1 63  ? 7.160   10.627  -0.748  1.00 10.00 ? 63  GLY A C    3  
ATOM   5329  O  O    . GLY A 1 63  ? 6.239   9.821   -0.655  1.00 10.00 ? 63  GLY A O    3  
ATOM   5330  H  H    . GLY A 1 63  ? 5.292   11.067  -2.407  1.00 10.00 ? 63  GLY A H    3  
ATOM   5331  H  HA2  . GLY A 1 63  ? 7.801   12.253  -1.949  1.00 10.00 ? 63  GLY A HA2  3  
ATOM   5332  H  HA3  . GLY A 1 63  ? 6.741   12.734  -0.593  1.00 10.00 ? 63  GLY A HA3  3  
ATOM   5333  N  N    . ALA A 1 64  ? 8.394   10.391  -0.296  1.00 10.00 ? 64  ALA A N    3  
ATOM   5334  C  CA   . ALA A 1 64  ? 8.737   9.306   0.613   1.00 10.00 ? 64  ALA A CA   3  
ATOM   5335  C  C    . ALA A 1 64  ? 10.065  9.625   1.305   1.00 10.00 ? 64  ALA A C    3  
ATOM   5336  O  O    . ALA A 1 64  ? 11.033  8.890   1.146   1.00 10.00 ? 64  ALA A O    3  
ATOM   5337  C  CB   . ALA A 1 64  ? 8.800   7.989   -0.163  1.00 10.00 ? 64  ALA A CB   3  
ATOM   5338  H  H    . ALA A 1 64  ? 9.108   11.078  -0.478  1.00 10.00 ? 64  ALA A H    3  
ATOM   5339  H  HA   . ALA A 1 64  ? 7.971   9.218   1.384   1.00 10.00 ? 64  ALA A HA   3  
ATOM   5340  H  HB1  . ALA A 1 64  ? 7.835   7.776   -0.624  1.00 10.00 ? 64  ALA A HB1  3  
ATOM   5341  H  HB2  . ALA A 1 64  ? 9.561   8.066   -0.938  1.00 10.00 ? 64  ALA A HB2  3  
ATOM   5342  H  HB3  . ALA A 1 64  ? 9.050   7.172   0.513   1.00 10.00 ? 64  ALA A HB3  3  
ATOM   5343  N  N    . ALA A 1 65  ? 10.149  10.726  2.053   1.00 10.00 ? 65  ALA A N    3  
ATOM   5344  C  CA   . ALA A 1 65  ? 11.408  11.129  2.674   1.00 10.00 ? 65  ALA A CA   3  
ATOM   5345  C  C    . ALA A 1 65  ? 11.611  10.336  3.966   1.00 10.00 ? 65  ALA A C    3  
ATOM   5346  O  O    . ALA A 1 65  ? 10.662  9.752   4.483   1.00 10.00 ? 65  ALA A O    3  
ATOM   5347  C  CB   . ALA A 1 65  ? 11.385  12.636  2.941   1.00 10.00 ? 65  ALA A CB   3  
ATOM   5348  H  H    . ALA A 1 65  ? 9.305   11.231  2.302   1.00 10.00 ? 65  ALA A H    3  
ATOM   5349  H  HA   . ALA A 1 65  ? 12.238  10.922  1.995   1.00 10.00 ? 65  ALA A HA   3  
ATOM   5350  H  HB1  . ALA A 1 65  ? 10.564  12.884  3.613   1.00 10.00 ? 65  ALA A HB1  3  
ATOM   5351  H  HB2  . ALA A 1 65  ? 12.326  12.947  3.397   1.00 10.00 ? 65  ALA A HB2  3  
ATOM   5352  H  HB3  . ALA A 1 65  ? 11.253  13.173  2.002   1.00 10.00 ? 65  ALA A HB3  3  
ATOM   5353  N  N    . THR A 1 66  ? 12.842  10.281  4.487   1.00 10.00 ? 66  THR A N    3  
ATOM   5354  C  CA   . THR A 1 66  ? 13.157  9.512   5.687   1.00 10.00 ? 66  THR A CA   3  
ATOM   5355  C  C    . THR A 1 66  ? 14.566  9.875   6.174   1.00 10.00 ? 66  THR A C    3  
ATOM   5356  O  O    . THR A 1 66  ? 15.458  10.128  5.353   1.00 10.00 ? 66  THR A O    3  
ATOM   5357  C  CB   . THR A 1 66  ? 13.036  8.002   5.383   1.00 10.00 ? 66  THR A CB   3  
ATOM   5358  O  OG1  . THR A 1 66  ? 13.261  7.202   6.527   1.00 10.00 ? 66  THR A OG1  3  
ATOM   5359  C  CG2  . THR A 1 66  ? 13.962  7.556   4.249   1.00 10.00 ? 66  THR A CG2  3  
ATOM   5360  H  H    . THR A 1 66  ? 13.607  10.750  4.026   1.00 10.00 ? 66  THR A H    3  
ATOM   5361  H  HA   . THR A 1 66  ? 12.421  9.773   6.448   1.00 10.00 ? 66  THR A HA   3  
ATOM   5362  H  HB   . THR A 1 66  ? 12.019  7.785   5.067   1.00 10.00 ? 66  THR A HB   3  
ATOM   5363  H  HG1  . THR A 1 66  ? 14.189  7.199   6.768   1.00 10.00 ? 66  THR A HG1  3  
ATOM   5364  H  HG21 . THR A 1 66  ? 13.696  8.067   3.325   1.00 10.00 ? 66  THR A HG21 3  
ATOM   5365  H  HG22 . THR A 1 66  ? 14.993  7.787   4.487   1.00 10.00 ? 66  THR A HG22 3  
ATOM   5366  H  HG23 . THR A 1 66  ? 13.861  6.481   4.100   1.00 10.00 ? 66  THR A HG23 3  
ATOM   5367  N  N    . PRO A 1 67  ? 14.834  9.851   7.487   1.00 10.00 ? 67  PRO A N    3  
ATOM   5368  C  CA   . PRO A 1 67  ? 16.185  9.951   8.014   1.00 10.00 ? 67  PRO A CA   3  
ATOM   5369  C  C    . PRO A 1 67  ? 16.875  8.584   7.887   1.00 10.00 ? 67  PRO A C    3  
ATOM   5370  O  O    . PRO A 1 67  ? 17.306  8.016   8.884   1.00 10.00 ? 67  PRO A O    3  
ATOM   5371  C  CB   . PRO A 1 67  ? 15.987  10.391  9.469   1.00 10.00 ? 67  PRO A CB   3  
ATOM   5372  C  CG   . PRO A 1 67  ? 14.692  9.679   9.859   1.00 10.00 ? 67  PRO A CG   3  
ATOM   5373  C  CD   . PRO A 1 67  ? 13.869  9.719   8.570   1.00 10.00 ? 67  PRO A CD   3  
ATOM   5374  H  HA   . PRO A 1 67  ? 16.773  10.706  7.491   1.00 10.00 ? 67  PRO A HA   3  
ATOM   5375  H  HB2  . PRO A 1 67  ? 16.822  10.133  10.122  1.00 10.00 ? 67  PRO A HB2  3  
ATOM   5376  H  HB3  . PRO A 1 67  ? 15.820  11.469  9.498   1.00 10.00 ? 67  PRO A HB3  3  
ATOM   5377  H  HG2  . PRO A 1 67  ? 14.918  8.644   10.118  1.00 10.00 ? 67  PRO A HG2  3  
ATOM   5378  H  HG3  . PRO A 1 67  ? 14.182  10.168  10.691  1.00 10.00 ? 67  PRO A HG3  3  
ATOM   5379  H  HD2  . PRO A 1 67  ? 13.274  8.811   8.487   1.00 10.00 ? 67  PRO A HD2  3  
ATOM   5380  H  HD3  . PRO A 1 67  ? 13.213  10.592  8.584   1.00 10.00 ? 67  PRO A HD3  3  
ATOM   5381  N  N    . LEU A 1 68  ? 16.963  8.040   6.664   1.00 10.00 ? 68  LEU A N    3  
ATOM   5382  C  CA   . LEU A 1 68  ? 17.498  6.699   6.420   1.00 10.00 ? 68  LEU A CA   3  
ATOM   5383  C  C    . LEU A 1 68  ? 18.291  6.682   5.108   1.00 10.00 ? 68  LEU A C    3  
ATOM   5384  O  O    . LEU A 1 68  ? 19.518  6.589   5.129   1.00 10.00 ? 68  LEU A O    3  
ATOM   5385  C  CB   . LEU A 1 68  ? 16.344  5.679   6.472   1.00 10.00 ? 68  LEU A CB   3  
ATOM   5386  C  CG   . LEU A 1 68  ? 16.788  4.214   6.610   1.00 10.00 ? 68  LEU A CG   3  
ATOM   5387  C  CD1  . LEU A 1 68  ? 15.569  3.366   6.989   1.00 10.00 ? 68  LEU A CD1  3  
ATOM   5388  C  CD2  . LEU A 1 68  ? 17.401  3.654   5.320   1.00 10.00 ? 68  LEU A CD2  3  
ATOM   5389  H  H    . LEU A 1 68  ? 16.588  8.557   5.881   1.00 10.00 ? 68  LEU A H    3  
ATOM   5390  H  HA   . LEU A 1 68  ? 18.200  6.444   7.216   1.00 10.00 ? 68  LEU A HA   3  
ATOM   5391  H  HB2  . LEU A 1 68  ? 15.759  5.909   7.363   1.00 10.00 ? 68  LEU A HB2  3  
ATOM   5392  H  HB3  . LEU A 1 68  ? 15.684  5.779   5.611   1.00 10.00 ? 68  LEU A HB3  3  
ATOM   5393  H  HG   . LEU A 1 68  ? 17.513  4.137   7.419   1.00 10.00 ? 68  LEU A HG   3  
ATOM   5394  H  HD11 . LEU A 1 68  ? 15.163  3.702   7.943   1.00 10.00 ? 68  LEU A HD11 3  
ATOM   5395  H  HD12 . LEU A 1 68  ? 14.801  3.462   6.223   1.00 10.00 ? 68  LEU A HD12 3  
ATOM   5396  H  HD13 . LEU A 1 68  ? 15.855  2.318   7.085   1.00 10.00 ? 68  LEU A HD13 3  
ATOM   5397  H  HD21 . LEU A 1 68  ? 16.756  3.885   4.472   1.00 10.00 ? 68  LEU A HD21 3  
ATOM   5398  H  HD22 . LEU A 1 68  ? 18.393  4.068   5.152   1.00 10.00 ? 68  LEU A HD22 3  
ATOM   5399  H  HD23 . LEU A 1 68  ? 17.502  2.571   5.400   1.00 10.00 ? 68  LEU A HD23 3  
ATOM   5400  N  N    . ALA A 1 69  ? 17.602  6.799   3.967   1.00 10.00 ? 69  ALA A N    3  
ATOM   5401  C  CA   . ALA A 1 69  ? 18.194  6.830   2.633   1.00 10.00 ? 69  ALA A CA   3  
ATOM   5402  C  C    . ALA A 1 69  ? 17.891  8.157   1.935   1.00 10.00 ? 69  ALA A C    3  
ATOM   5403  O  O    . ALA A 1 69  ? 17.118  8.966   2.450   1.00 10.00 ? 69  ALA A O    3  
ATOM   5404  C  CB   . ALA A 1 69  ? 17.698  5.633   1.828   1.00 10.00 ? 69  ALA A CB   3  
ATOM   5405  H  H    . ALA A 1 69  ? 16.598  6.856   4.010   1.00 10.00 ? 69  ALA A H    3  
ATOM   5406  H  HA   . ALA A 1 69  ? 19.276  6.757   2.709   1.00 10.00 ? 69  ALA A HA   3  
ATOM   5407  H  HB1  . ALA A 1 69  ? 18.151  5.643   0.837   1.00 10.00 ? 69  ALA A HB1  3  
ATOM   5408  H  HB2  . ALA A 1 69  ? 17.976  4.706   2.330   1.00 10.00 ? 69  ALA A HB2  3  
ATOM   5409  H  HB3  . ALA A 1 69  ? 16.615  5.679   1.733   1.00 10.00 ? 69  ALA A HB3  3  
ATOM   5410  N  N    . THR A 1 70  ? 18.586  8.426   0.831   1.00 10.00 ? 70  THR A N    3  
ATOM   5411  C  CA   . THR A 1 70  ? 18.796  9.764   0.290   1.00 10.00 ? 70  THR A CA   3  
ATOM   5412  C  C    . THR A 1 70  ? 17.882  10.055  -0.899  1.00 10.00 ? 70  THR A C    3  
ATOM   5413  O  O    . THR A 1 70  ? 17.405  11.177  -1.036  1.00 10.00 ? 70  THR A O    3  
ATOM   5414  C  CB   . THR A 1 70  ? 20.276  9.909   -0.102  1.00 10.00 ? 70  THR A CB   3  
ATOM   5415  O  OG1  . THR A 1 70  ? 21.090  9.554   0.998   1.00 10.00 ? 70  THR A OG1  3  
ATOM   5416  C  CG2  . THR A 1 70  ? 20.636  11.339  -0.507  1.00 10.00 ? 70  THR A CG2  3  
ATOM   5417  H  H    . THR A 1 70  ? 19.194  7.696   0.475   1.00 10.00 ? 70  THR A H    3  
ATOM   5418  H  HA   . THR A 1 70  ? 18.585  10.506  1.061   1.00 10.00 ? 70  THR A HA   3  
ATOM   5419  H  HB   . THR A 1 70  ? 20.504  9.244   -0.938  1.00 10.00 ? 70  THR A HB   3  
ATOM   5420  H  HG1  . THR A 1 70  ? 21.143  8.590   1.036   1.00 10.00 ? 70  THR A HG1  3  
ATOM   5421  H  HG21 . THR A 1 70  ? 21.705  11.392  -0.718  1.00 10.00 ? 70  THR A HG21 3  
ATOM   5422  H  HG22 . THR A 1 70  ? 20.090  11.631  -1.404  1.00 10.00 ? 70  THR A HG22 3  
ATOM   5423  H  HG23 . THR A 1 70  ? 20.400  12.030  0.303   1.00 10.00 ? 70  THR A HG23 3  
ATOM   5424  N  N    . SER A 1 71  ? 17.678  9.068   -1.774  1.00 10.00 ? 71  SER A N    3  
ATOM   5425  C  CA   . SER A 1 71  ? 16.985  9.222   -3.045  1.00 10.00 ? 71  SER A CA   3  
ATOM   5426  C  C    . SER A 1 71  ? 15.617  8.524   -2.978  1.00 10.00 ? 71  SER A C    3  
ATOM   5427  O  O    . SER A 1 71  ? 15.535  7.329   -3.264  1.00 10.00 ? 71  SER A O    3  
ATOM   5428  C  CB   . SER A 1 71  ? 17.878  8.641   -4.152  1.00 10.00 ? 71  SER A CB   3  
ATOM   5429  O  OG   . SER A 1 71  ? 17.443  9.066   -5.429  1.00 10.00 ? 71  SER A OG   3  
ATOM   5430  H  H    . SER A 1 71  ? 18.075  8.155   -1.579  1.00 10.00 ? 71  SER A H    3  
ATOM   5431  H  HA   . SER A 1 71  ? 16.862  10.278  -3.280  1.00 10.00 ? 71  SER A HA   3  
ATOM   5432  H  HB2  . SER A 1 71  ? 18.910  8.968   -4.009  1.00 10.00 ? 71  SER A HB2  3  
ATOM   5433  H  HB3  . SER A 1 71  ? 17.863  7.553   -4.111  1.00 10.00 ? 71  SER A HB3  3  
ATOM   5434  H  HG   . SER A 1 71  ? 17.575  10.014  -5.517  1.00 10.00 ? 71  SER A HG   3  
ATOM   5435  N  N    . PRO A 1 72  ? 14.542  9.227   -2.580  1.00 10.00 ? 72  PRO A N    3  
ATOM   5436  C  CA   . PRO A 1 72  ? 13.205  8.660   -2.514  1.00 10.00 ? 72  PRO A CA   3  
ATOM   5437  C  C    . PRO A 1 72  ? 12.607  8.581   -3.912  1.00 10.00 ? 72  PRO A C    3  
ATOM   5438  O  O    . PRO A 1 72  ? 11.977  9.521   -4.393  1.00 10.00 ? 72  PRO A O    3  
ATOM   5439  C  CB   . PRO A 1 72  ? 12.431  9.593   -1.585  1.00 10.00 ? 72  PRO A CB   3  
ATOM   5440  C  CG   . PRO A 1 72  ? 13.064  10.957  -1.853  1.00 10.00 ? 72  PRO A CG   3  
ATOM   5441  C  CD   . PRO A 1 72  ? 14.533  10.591  -2.068  1.00 10.00 ? 72  PRO A CD   3  
ATOM   5442  H  HA   . PRO A 1 72  ? 13.218  7.647   -2.118  1.00 10.00 ? 72  PRO A HA   3  
ATOM   5443  H  HB2  . PRO A 1 72  ? 11.355  9.581   -1.758  1.00 10.00 ? 72  PRO A HB2  3  
ATOM   5444  H  HB3  . PRO A 1 72  ? 12.663  9.308   -0.561  1.00 10.00 ? 72  PRO A HB3  3  
ATOM   5445  H  HG2  . PRO A 1 72  ? 12.652  11.388  -2.767  1.00 10.00 ? 72  PRO A HG2  3  
ATOM   5446  H  HG3  . PRO A 1 72  ? 12.927  11.647  -1.020  1.00 10.00 ? 72  PRO A HG3  3  
ATOM   5447  H  HD2  . PRO A 1 72  ? 14.994  11.309  -2.746  1.00 10.00 ? 72  PRO A HD2  3  
ATOM   5448  H  HD3  . PRO A 1 72  ? 15.026  10.606  -1.098  1.00 10.00 ? 72  PRO A HD3  3  
ATOM   5449  N  N    . MET A 1 73  ? 12.834  7.446   -4.567  1.00 10.00 ? 73  MET A N    3  
ATOM   5450  C  CA   . MET A 1 73  ? 12.525  7.254   -5.970  1.00 10.00 ? 73  MET A CA   3  
ATOM   5451  C  C    . MET A 1 73  ? 11.338  6.311   -6.108  1.00 10.00 ? 73  MET A C    3  
ATOM   5452  O  O    . MET A 1 73  ? 11.409  5.126   -5.784  1.00 10.00 ? 73  MET A O    3  
ATOM   5453  C  CB   . MET A 1 73  ? 13.762  6.708   -6.674  1.00 10.00 ? 73  MET A CB   3  
ATOM   5454  C  CG   . MET A 1 73  ? 14.890  7.744   -6.788  1.00 10.00 ? 73  MET A CG   3  
ATOM   5455  S  SD   . MET A 1 73  ? 14.984  8.711   -8.322  1.00 10.00 ? 73  MET A SD   3  
ATOM   5456  C  CE   . MET A 1 73  ? 13.425  9.621   -8.331  1.00 10.00 ? 73  MET A CE   3  
ATOM   5457  H  H    . MET A 1 73  ? 13.317  6.690   -4.083  1.00 10.00 ? 73  MET A H    3  
ATOM   5458  H  HA   . MET A 1 73  ? 12.266  8.206   -6.426  1.00 10.00 ? 73  MET A HA   3  
ATOM   5459  H  HB2  . MET A 1 73  ? 14.098  5.889   -6.046  1.00 10.00 ? 73  MET A HB2  3  
ATOM   5460  H  HB3  . MET A 1 73  ? 13.510  6.326   -7.664  1.00 10.00 ? 73  MET A HB3  3  
ATOM   5461  H  HG2  . MET A 1 73  ? 14.855  8.436   -5.948  1.00 10.00 ? 73  MET A HG2  3  
ATOM   5462  H  HG3  . MET A 1 73  ? 15.833  7.202   -6.727  1.00 10.00 ? 73  MET A HG3  3  
ATOM   5463  H  HE1  . MET A 1 73  ? 13.307  10.160  -7.391  1.00 10.00 ? 73  MET A HE1  3  
ATOM   5464  H  HE2  . MET A 1 73  ? 13.444  10.332  -9.156  1.00 10.00 ? 73  MET A HE2  3  
ATOM   5465  H  HE3  . MET A 1 73  ? 12.598  8.931   -8.486  1.00 10.00 ? 73  MET A HE3  3  
ATOM   5466  N  N    . LEU A 1 74  ? 10.237  6.851   -6.615  1.00 10.00 ? 74  LEU A N    3  
ATOM   5467  C  CA   . LEU A 1 74  ? 8.984   6.136   -6.750  1.00 10.00 ? 74  LEU A CA   3  
ATOM   5468  C  C    . LEU A 1 74  ? 9.051   5.258   -8.005  1.00 10.00 ? 74  LEU A C    3  
ATOM   5469  O  O    . LEU A 1 74  ? 9.521   5.699   -9.055  1.00 10.00 ? 74  LEU A O    3  
ATOM   5470  C  CB   . LEU A 1 74  ? 7.843   7.167   -6.803  1.00 10.00 ? 74  LEU A CB   3  
ATOM   5471  C  CG   . LEU A 1 74  ? 7.707   7.918   -5.456  1.00 10.00 ? 74  LEU A CG   3  
ATOM   5472  C  CD1  . LEU A 1 74  ? 8.210   9.362   -5.561  1.00 10.00 ? 74  LEU A CD1  3  
ATOM   5473  C  CD2  . LEU A 1 74  ? 6.264   7.914   -4.937  1.00 10.00 ? 74  LEU A CD2  3  
ATOM   5474  H  H    . LEU A 1 74  ? 10.263  7.828   -6.852  1.00 10.00 ? 74  LEU A H    3  
ATOM   5475  H  HA   . LEU A 1 74  ? 8.846   5.496   -5.878  1.00 10.00 ? 74  LEU A HA   3  
ATOM   5476  H  HB2  . LEU A 1 74  ? 8.062   7.875   -7.603  1.00 10.00 ? 74  LEU A HB2  3  
ATOM   5477  H  HB3  . LEU A 1 74  ? 6.905   6.678   -7.068  1.00 10.00 ? 74  LEU A HB3  3  
ATOM   5478  H  HG   . LEU A 1 74  ? 8.311   7.430   -4.690  1.00 10.00 ? 74  LEU A HG   3  
ATOM   5479  H  HD11 . LEU A 1 74  ? 8.119   9.851   -4.591  1.00 10.00 ? 74  LEU A HD11 3  
ATOM   5480  H  HD12 . LEU A 1 74  ? 9.260   9.374   -5.855  1.00 10.00 ? 74  LEU A HD12 3  
ATOM   5481  H  HD13 . LEU A 1 74  ? 7.626   9.918   -6.295  1.00 10.00 ? 74  LEU A HD13 3  
ATOM   5482  H  HD21 . LEU A 1 74  ? 6.231   8.385   -3.954  1.00 10.00 ? 74  LEU A HD21 3  
ATOM   5483  H  HD22 . LEU A 1 74  ? 5.605   8.460   -5.608  1.00 10.00 ? 74  LEU A HD22 3  
ATOM   5484  H  HD23 . LEU A 1 74  ? 5.907   6.890   -4.838  1.00 10.00 ? 74  LEU A HD23 3  
ATOM   5485  N  N    . MET A 1 75  ? 8.620   4.000   -7.874  1.00 10.00 ? 75  MET A N    3  
ATOM   5486  C  CA   . MET A 1 75  ? 8.539   3.016   -8.944  1.00 10.00 ? 75  MET A CA   3  
ATOM   5487  C  C    . MET A 1 75  ? 7.092   2.549   -9.047  1.00 10.00 ? 75  MET A C    3  
ATOM   5488  O  O    . MET A 1 75  ? 6.245   2.981   -8.271  1.00 10.00 ? 75  MET A O    3  
ATOM   5489  C  CB   . MET A 1 75  ? 9.516   1.854   -8.657  1.00 10.00 ? 75  MET A CB   3  
ATOM   5490  C  CG   . MET A 1 75  ? 10.737  1.909   -9.584  1.00 10.00 ? 75  MET A CG   3  
ATOM   5491  S  SD   . MET A 1 75  ? 12.348  1.734   -8.797  1.00 10.00 ? 75  MET A SD   3  
ATOM   5492  C  CE   . MET A 1 75  ? 13.401  1.932   -10.256 1.00 10.00 ? 75  MET A CE   3  
ATOM   5493  H  H    . MET A 1 75  ? 8.188   3.706   -7.003  1.00 10.00 ? 75  MET A H    3  
ATOM   5494  H  HA   . MET A 1 75  ? 8.755   3.477   -9.904  1.00 10.00 ? 75  MET A HA   3  
ATOM   5495  H  HB2  . MET A 1 75  ? 9.849   1.907   -7.620  1.00 10.00 ? 75  MET A HB2  3  
ATOM   5496  H  HB3  . MET A 1 75  ? 9.022   0.891   -8.791  1.00 10.00 ? 75  MET A HB3  3  
ATOM   5497  H  HG2  . MET A 1 75  ? 10.637  1.166   -10.367 1.00 10.00 ? 75  MET A HG2  3  
ATOM   5498  H  HG3  . MET A 1 75  ? 10.784  2.868   -10.075 1.00 10.00 ? 75  MET A HG3  3  
ATOM   5499  H  HE1  . MET A 1 75  ? 14.449  1.836   -9.980  1.00 10.00 ? 75  MET A HE1  3  
ATOM   5500  H  HE2  . MET A 1 75  ? 13.159  1.186   -11.008 1.00 10.00 ? 75  MET A HE2  3  
ATOM   5501  H  HE3  . MET A 1 75  ? 13.233  2.923   -10.674 1.00 10.00 ? 75  MET A HE3  3  
ATOM   5502  N  N    . THR A 1 76  ? 6.787   1.715   -10.044 1.00 10.00 ? 76  THR A N    3  
ATOM   5503  C  CA   . THR A 1 76  ? 5.484   1.095   -10.155 1.00 10.00 ? 76  THR A CA   3  
ATOM   5504  C  C    . THR A 1 76  ? 5.598   -0.134  -11.049 1.00 10.00 ? 76  THR A C    3  
ATOM   5505  O  O    . THR A 1 76  ? 6.303   -0.098  -12.058 1.00 10.00 ? 76  THR A O    3  
ATOM   5506  C  CB   . THR A 1 76  ? 4.434   2.096   -10.614 1.00 10.00 ? 76  THR A CB   3  
ATOM   5507  O  OG1  . THR A 1 76  ? 3.190   1.445   -10.617 1.00 10.00 ? 76  THR A OG1  3  
ATOM   5508  C  CG2  . THR A 1 76  ? 4.753   2.642   -12.003 1.00 10.00 ? 76  THR A CG2  3  
ATOM   5509  H  H    . THR A 1 76  ? 7.491   1.381   -10.686 1.00 10.00 ? 76  THR A H    3  
ATOM   5510  H  HA   . THR A 1 76  ? 5.185   0.796   -9.163  1.00 10.00 ? 76  THR A HA   3  
ATOM   5511  H  HB   . THR A 1 76  ? 4.386   2.914   -9.897  1.00 10.00 ? 76  THR A HB   3  
ATOM   5512  H  HG1  . THR A 1 76  ? 2.971   1.175   -9.708  1.00 10.00 ? 76  THR A HG1  3  
ATOM   5513  H  HG21 . THR A 1 76  ? 5.759   3.060   -12.004 1.00 10.00 ? 76  THR A HG21 3  
ATOM   5514  H  HG22 . THR A 1 76  ? 4.704   1.838   -12.736 1.00 10.00 ? 76  THR A HG22 3  
ATOM   5515  H  HG23 . THR A 1 76  ? 4.035   3.417   -12.265 1.00 10.00 ? 76  THR A HG23 3  
ATOM   5516  N  N    . THR A 1 77  ? 5.006   -1.263  -10.670 1.00 10.00 ? 77  THR A N    3  
ATOM   5517  C  CA   . THR A 1 77  ? 5.088   -2.476  -11.466 1.00 10.00 ? 77  THR A CA   3  
ATOM   5518  C  C    . THR A 1 77  ? 3.898   -3.359  -11.102 1.00 10.00 ? 77  THR A C    3  
ATOM   5519  O  O    . THR A 1 77  ? 4.031   -4.499  -10.670 1.00 10.00 ? 77  THR A O    3  
ATOM   5520  C  CB   . THR A 1 77  ? 6.466   -3.156  -11.305 1.00 10.00 ? 77  THR A CB   3  
ATOM   5521  O  OG1  . THR A 1 77  ? 7.425   -2.257  -10.788 1.00 10.00 ? 77  THR A OG1  3  
ATOM   5522  C  CG2  . THR A 1 77  ? 6.953   -3.732  -12.636 1.00 10.00 ? 77  THR A CG2  3  
ATOM   5523  H  H    . THR A 1 77  ? 4.442   -1.280  -9.832  1.00 10.00 ? 77  THR A H    3  
ATOM   5524  H  HA   . THR A 1 77  ? 4.977   -2.194  -12.509 1.00 10.00 ? 77  THR A HA   3  
ATOM   5525  H  HB   . THR A 1 77  ? 6.420   -3.972  -10.602 1.00 10.00 ? 77  THR A HB   3  
ATOM   5526  H  HG1  . THR A 1 77  ? 7.464   -1.509  -11.397 1.00 10.00 ? 77  THR A HG1  3  
ATOM   5527  H  HG21 . THR A 1 77  ? 7.904   -4.246  -12.479 1.00 10.00 ? 77  THR A HG21 3  
ATOM   5528  H  HG22 . THR A 1 77  ? 6.226   -4.453  -13.011 1.00 10.00 ? 77  THR A HG22 3  
ATOM   5529  H  HG23 . THR A 1 77  ? 7.088   -2.939  -13.371 1.00 10.00 ? 77  THR A HG23 3  
ATOM   5530  N  N    . THR A 1 78  ? 2.701   -2.808  -11.254 1.00 10.00 ? 78  THR A N    3  
ATOM   5531  C  CA   . THR A 1 78  ? 1.450   -3.513  -11.013 1.00 10.00 ? 78  THR A CA   3  
ATOM   5532  C  C    . THR A 1 78  ? 0.358   -2.961  -11.930 1.00 10.00 ? 78  THR A C    3  
ATOM   5533  O  O    . THR A 1 78  ? 0.030   -1.776  -11.887 1.00 10.00 ? 78  THR A O    3  
ATOM   5534  C  CB   . THR A 1 78  ? 1.067   -3.416  -9.528  1.00 10.00 ? 78  THR A CB   3  
ATOM   5535  O  OG1  . THR A 1 78  ? 1.957   -4.208  -8.770  1.00 10.00 ? 78  THR A OG1  3  
ATOM   5536  C  CG2  . THR A 1 78  ? -0.341  -3.945  -9.250  1.00 10.00 ? 78  THR A CG2  3  
ATOM   5537  H  H    . THR A 1 78  ? 2.688   -1.835  -11.545 1.00 10.00 ? 78  THR A H    3  
ATOM   5538  H  HA   . THR A 1 78  ? 1.597   -4.572  -11.237 1.00 10.00 ? 78  THR A HA   3  
ATOM   5539  H  HB   . THR A 1 78  ? 1.115   -2.375  -9.203  1.00 10.00 ? 78  THR A HB   3  
ATOM   5540  H  HG1  . THR A 1 78  ? 2.787   -4.310  -9.251  1.00 10.00 ? 78  THR A HG1  3  
ATOM   5541  H  HG21 . THR A 1 78  ? -0.516  -3.946  -8.174  1.00 10.00 ? 78  THR A HG21 3  
ATOM   5542  H  HG22 . THR A 1 78  ? -1.089  -3.310  -9.721  1.00 10.00 ? 78  THR A HG22 3  
ATOM   5543  H  HG23 . THR A 1 78  ? -0.435  -4.963  -9.627  1.00 10.00 ? 78  THR A HG23 3  
ATOM   5544  N  N    . HIS A 1 79  ? -0.253  -3.842  -12.725 1.00 10.00 ? 79  HIS A N    3  
ATOM   5545  C  CA   . HIS A 1 79  ? -1.408  -3.519  -13.551 1.00 10.00 ? 79  HIS A CA   3  
ATOM   5546  C  C    . HIS A 1 79  ? -2.620  -3.303  -12.639 1.00 10.00 ? 79  HIS A C    3  
ATOM   5547  O  O    . HIS A 1 79  ? -3.417  -4.218  -12.456 1.00 10.00 ? 79  HIS A O    3  
ATOM   5548  C  CB   . HIS A 1 79  ? -1.668  -4.651  -14.556 1.00 10.00 ? 79  HIS A CB   3  
ATOM   5549  C  CG   . HIS A 1 79  ? -0.630  -4.782  -15.640 1.00 10.00 ? 79  HIS A CG   3  
ATOM   5550  N  ND1  . HIS A 1 79  ? -0.801  -4.359  -16.958 1.00 10.00 ? 79  HIS A ND1  3  
ATOM   5551  C  CD2  . HIS A 1 79  ? 0.584   -5.398  -15.516 1.00 10.00 ? 79  HIS A CD2  3  
ATOM   5552  C  CE1  . HIS A 1 79  ? 0.313   -4.734  -17.603 1.00 10.00 ? 79  HIS A CE1  3  
ATOM   5553  N  NE2  . HIS A 1 79  ? 1.158   -5.364  -16.767 1.00 10.00 ? 79  HIS A NE2  3  
ATOM   5554  H  H    . HIS A 1 79  ? 0.023   -4.809  -12.661 1.00 10.00 ? 79  HIS A H    3  
ATOM   5555  H  HA   . HIS A 1 79  ? -1.213  -2.603  -14.115 1.00 10.00 ? 79  HIS A HA   3  
ATOM   5556  H  HB2  . HIS A 1 79  ? -1.750  -5.602  -14.027 1.00 10.00 ? 79  HIS A HB2  3  
ATOM   5557  H  HB3  . HIS A 1 79  ? -2.623  -4.458  -15.047 1.00 10.00 ? 79  HIS A HB3  3  
ATOM   5558  H  HD2  . HIS A 1 79  ? 1.009   -5.833  -14.624 1.00 10.00 ? 79  HIS A HD2  3  
ATOM   5559  H  HE1  . HIS A 1 79  ? 0.505   -4.557  -18.652 1.00 10.00 ? 79  HIS A HE1  3  
ATOM   5560  H  HE2  . HIS A 1 79  ? 2.060   -5.741  -17.018 1.00 10.00 ? 79  HIS A HE2  3  
ATOM   5561  N  N    . SER A 1 80  ? -2.715  -2.102  -12.056 1.00 10.00 ? 80  SER A N    3  
ATOM   5562  C  CA   . SER A 1 80  ? -3.722  -1.593  -11.113 1.00 10.00 ? 80  SER A CA   3  
ATOM   5563  C  C    . SER A 1 80  ? -3.069  -0.663  -10.078 1.00 10.00 ? 80  SER A C    3  
ATOM   5564  O  O    . SER A 1 80  ? -3.786  -0.039  -9.296  1.00 10.00 ? 80  SER A O    3  
ATOM   5565  C  CB   . SER A 1 80  ? -4.535  -2.695  -10.401 1.00 10.00 ? 80  SER A CB   3  
ATOM   5566  O  OG   . SER A 1 80  ? -5.500  -2.139  -9.524  1.00 10.00 ? 80  SER A OG   3  
ATOM   5567  H  H    . SER A 1 80  ? -1.955  -1.470  -12.283 1.00 10.00 ? 80  SER A H    3  
ATOM   5568  H  HA   . SER A 1 80  ? -4.424  -0.990  -11.690 1.00 10.00 ? 80  SER A HA   3  
ATOM   5569  H  HB2  . SER A 1 80  ? -5.099  -3.288  -11.120 1.00 10.00 ? 80  SER A HB2  3  
ATOM   5570  H  HB3  . SER A 1 80  ? -3.865  -3.346  -9.836  1.00 10.00 ? 80  SER A HB3  3  
ATOM   5571  H  HG   . SER A 1 80  ? -5.131  -1.346  -9.110  1.00 10.00 ? 80  SER A HG   3  
ATOM   5572  N  N    . GLY A 1 81  ? -1.735  -0.590  -10.040 1.00 10.00 ? 81  GLY A N    3  
ATOM   5573  C  CA   . GLY A 1 81  ? -1.012  0.396   -9.264  1.00 10.00 ? 81  GLY A CA   3  
ATOM   5574  C  C    . GLY A 1 81  ? -0.746  1.617   -10.130 1.00 10.00 ? 81  GLY A C    3  
ATOM   5575  O  O    . GLY A 1 81  ? -1.603  2.009   -10.922 1.00 10.00 ? 81  GLY A O    3  
ATOM   5576  H  H    . GLY A 1 81  ? -1.177  -1.125  -10.691 1.00 10.00 ? 81  GLY A H    3  
ATOM   5577  H  HA2  . GLY A 1 81  ? -1.585  0.717   -8.396  1.00 10.00 ? 81  GLY A HA2  3  
ATOM   5578  H  HA3  . GLY A 1 81  ? -0.071  -0.050  -8.946  1.00 10.00 ? 81  GLY A HA3  3  
ATOM   5579  N  N    . GLY A 1 82  ? 0.441   2.209   -9.997  1.00 10.00 ? 82  GLY A N    3  
ATOM   5580  C  CA   . GLY A 1 82  ? 0.819   3.352   -10.822 1.00 10.00 ? 82  GLY A CA   3  
ATOM   5581  C  C    . GLY A 1 82  ? 0.805   3.001   -12.315 1.00 10.00 ? 82  GLY A C    3  
ATOM   5582  O  O    . GLY A 1 82  ? 0.167   3.684   -13.113 1.00 10.00 ? 82  GLY A O    3  
ATOM   5583  H  H    . GLY A 1 82  ? 1.115   1.809   -9.343  1.00 10.00 ? 82  GLY A H    3  
ATOM   5584  H  HA2  . GLY A 1 82  ? 0.121   4.170   -10.640 1.00 10.00 ? 82  GLY A HA2  3  
ATOM   5585  H  HA3  . GLY A 1 82  ? 1.817   3.687   -10.545 1.00 10.00 ? 82  GLY A HA3  3  
ATOM   5586  N  N    . MET A 1 83  ? 1.532   1.945   -12.689 1.00 10.00 ? 83  MET A N    3  
ATOM   5587  C  CA   . MET A 1 83  ? 1.685   1.421   -14.035 1.00 10.00 ? 83  MET A CA   3  
ATOM   5588  C  C    . MET A 1 83  ? 2.400   0.065   -13.924 1.00 10.00 ? 83  MET A C    3  
ATOM   5589  O  O    . MET A 1 83  ? 2.535   -0.489  -12.833 1.00 10.00 ? 83  MET A O    3  
ATOM   5590  C  CB   . MET A 1 83  ? 2.454   2.425   -14.924 1.00 10.00 ? 83  MET A CB   3  
ATOM   5591  C  CG   . MET A 1 83  ? 1.905   2.485   -16.358 1.00 10.00 ? 83  MET A CG   3  
ATOM   5592  S  SD   . MET A 1 83  ? 0.226   3.147   -16.514 1.00 10.00 ? 83  MET A SD   3  
ATOM   5593  C  CE   . MET A 1 83  ? 0.000   3.008   -18.301 1.00 10.00 ? 83  MET A CE   3  
ATOM   5594  H  H    . MET A 1 83  ? 2.020   1.426   -11.965 1.00 10.00 ? 83  MET A H    3  
ATOM   5595  H  HA   . MET A 1 83  ? 0.685   1.249   -14.435 1.00 10.00 ? 83  MET A HA   3  
ATOM   5596  H  HB2  . MET A 1 83  ? 2.371   3.434   -14.519 1.00 10.00 ? 83  MET A HB2  3  
ATOM   5597  H  HB3  . MET A 1 83  ? 3.515   2.172   -14.947 1.00 10.00 ? 83  MET A HB3  3  
ATOM   5598  H  HG2  . MET A 1 83  ? 2.561   3.129   -16.943 1.00 10.00 ? 83  MET A HG2  3  
ATOM   5599  H  HG3  . MET A 1 83  ? 1.909   1.494   -16.807 1.00 10.00 ? 83  MET A HG3  3  
ATOM   5600  H  HE1  . MET A 1 83  ? 0.757   3.604   -18.810 1.00 10.00 ? 83  MET A HE1  3  
ATOM   5601  H  HE2  . MET A 1 83  ? 0.088   1.964   -18.598 1.00 10.00 ? 83  MET A HE2  3  
ATOM   5602  H  HE3  . MET A 1 83  ? -0.991  3.379   -18.560 1.00 10.00 ? 83  MET A HE3  3  
ATOM   5603  N  N    . ALA A 1 84  ? 2.891   -0.461  -15.048 1.00 10.00 ? 84  ALA A N    3  
ATOM   5604  C  CA   . ALA A 1 84  ? 3.545   -1.752  -15.150 1.00 10.00 ? 84  ALA A CA   3  
ATOM   5605  C  C    . ALA A 1 84  ? 4.938   -1.487  -15.705 1.00 10.00 ? 84  ALA A C    3  
ATOM   5606  O  O    . ALA A 1 84  ? 5.260   -1.908  -16.812 1.00 10.00 ? 84  ALA A O    3  
ATOM   5607  C  CB   . ALA A 1 84  ? 2.718   -2.653  -16.067 1.00 10.00 ? 84  ALA A CB   3  
ATOM   5608  H  H    . ALA A 1 84  ? 2.930   0.106   -15.879 1.00 10.00 ? 84  ALA A H    3  
ATOM   5609  H  HA   . ALA A 1 84  ? 3.618   -2.250  -14.186 1.00 10.00 ? 84  ALA A HA   3  
ATOM   5610  H  HB1  . ALA A 1 84  ? 3.209   -3.621  -16.160 1.00 10.00 ? 84  ALA A HB1  3  
ATOM   5611  H  HB2  . ALA A 1 84  ? 1.726   -2.788  -15.635 1.00 10.00 ? 84  ALA A HB2  3  
ATOM   5612  H  HB3  . ALA A 1 84  ? 2.617   -2.204  -17.056 1.00 10.00 ? 84  ALA A HB3  3  
ATOM   5613  N  N    . GLY A 1 85  ? 5.730   -0.700  -14.973 1.00 10.00 ? 85  GLY A N    3  
ATOM   5614  C  CA   . GLY A 1 85  ? 6.917   -0.087  -15.538 1.00 10.00 ? 85  GLY A CA   3  
ATOM   5615  C  C    . GLY A 1 85  ? 7.848   0.388   -14.432 1.00 10.00 ? 85  GLY A C    3  
ATOM   5616  O  O    . GLY A 1 85  ? 7.730   1.530   -13.991 1.00 10.00 ? 85  GLY A O    3  
ATOM   5617  H  H    . GLY A 1 85  ? 5.446   -0.419  -14.040 1.00 10.00 ? 85  GLY A H    3  
ATOM   5618  H  HA2  . GLY A 1 85  ? 7.416   -0.794  -16.195 1.00 10.00 ? 85  GLY A HA2  3  
ATOM   5619  H  HA3  . GLY A 1 85  ? 6.610   0.775   -16.132 1.00 10.00 ? 85  GLY A HA3  3  
ATOM   5620  N  N    . MET A 1 86  ? 8.763   -0.479  -13.979 1.00 10.00 ? 86  MET A N    3  
ATOM   5621  C  CA   . MET A 1 86  ? 9.602   -0.243  -12.807 1.00 10.00 ? 86  MET A CA   3  
ATOM   5622  C  C    . MET A 1 86  ? 10.735  0.735   -13.140 1.00 10.00 ? 86  MET A C    3  
ATOM   5623  O  O    . MET A 1 86  ? 11.916  0.402   -13.111 1.00 10.00 ? 86  MET A O    3  
ATOM   5624  C  CB   . MET A 1 86  ? 10.125  -1.591  -12.294 1.00 10.00 ? 86  MET A CB   3  
ATOM   5625  C  CG   . MET A 1 86  ? 10.516  -1.635  -10.807 1.00 10.00 ? 86  MET A CG   3  
ATOM   5626  S  SD   . MET A 1 86  ? 12.279  -1.432  -10.416 1.00 10.00 ? 86  MET A SD   3  
ATOM   5627  C  CE   . MET A 1 86  ? 12.779  -3.164  -10.307 1.00 10.00 ? 86  MET A CE   3  
ATOM   5628  H  H    . MET A 1 86  ? 8.809   -1.392  -14.406 1.00 10.00 ? 86  MET A H    3  
ATOM   5629  H  HA   . MET A 1 86  ? 8.939   0.183   -12.049 1.00 10.00 ? 86  MET A HA   3  
ATOM   5630  H  HB2  . MET A 1 86  ? 9.299   -2.275  -12.399 1.00 10.00 ? 86  MET A HB2  3  
ATOM   5631  H  HB3  . MET A 1 86  ? 10.939  -1.948  -12.923 1.00 10.00 ? 86  MET A HB3  3  
ATOM   5632  H  HG2  . MET A 1 86  ? 9.927   -0.908  -10.257 1.00 10.00 ? 86  MET A HG2  3  
ATOM   5633  H  HG3  . MET A 1 86  ? 10.225  -2.614  -10.432 1.00 10.00 ? 86  MET A HG3  3  
ATOM   5634  H  HE1  . MET A 1 86  ? 12.542  -3.666  -11.245 1.00 10.00 ? 86  MET A HE1  3  
ATOM   5635  H  HE2  . MET A 1 86  ? 13.851  -3.223  -10.125 1.00 10.00 ? 86  MET A HE2  3  
ATOM   5636  H  HE3  . MET A 1 86  ? 12.245  -3.656  -9.493  1.00 10.00 ? 86  MET A HE3  3  
ATOM   5637  N  N    . LYS A 1 87  ? 10.346  1.962   -13.459 1.00 10.00 ? 87  LYS A N    3  
ATOM   5638  C  CA   . LYS A 1 87  ? 11.202  3.092   -13.777 1.00 10.00 ? 87  LYS A CA   3  
ATOM   5639  C  C    . LYS A 1 87  ? 10.993  4.162   -12.711 1.00 10.00 ? 87  LYS A C    3  
ATOM   5640  O  O    . LYS A 1 87  ? 10.023  4.096   -11.961 1.00 10.00 ? 87  LYS A O    3  
ATOM   5641  C  CB   . LYS A 1 87  ? 10.852  3.608   -15.182 1.00 10.00 ? 87  LYS A CB   3  
ATOM   5642  C  CG   . LYS A 1 87  ? 9.459   4.258   -15.237 1.00 10.00 ? 87  LYS A CG   3  
ATOM   5643  C  CD   . LYS A 1 87  ? 8.784   4.192   -16.614 1.00 10.00 ? 87  LYS A CD   3  
ATOM   5644  C  CE   . LYS A 1 87  ? 9.474   5.037   -17.695 1.00 10.00 ? 87  LYS A CE   3  
ATOM   5645  N  NZ   . LYS A 1 87  ? 10.712  4.418   -18.212 1.00 10.00 ? 87  LYS A NZ   3  
ATOM   5646  H  H    . LYS A 1 87  ? 9.348   2.118   -13.399 1.00 10.00 ? 87  LYS A H    3  
ATOM   5647  H  HA   . LYS A 1 87  ? 12.249  2.785   -13.767 1.00 10.00 ? 87  LYS A HA   3  
ATOM   5648  H  HB2  . LYS A 1 87  ? 11.602  4.342   -15.476 1.00 10.00 ? 87  LYS A HB2  3  
ATOM   5649  H  HB3  . LYS A 1 87  ? 10.894  2.758   -15.865 1.00 10.00 ? 87  LYS A HB3  3  
ATOM   5650  H  HG2  . LYS A 1 87  ? 8.788   3.740   -14.552 1.00 10.00 ? 87  LYS A HG2  3  
ATOM   5651  H  HG3  . LYS A 1 87  ? 9.521   5.295   -14.899 1.00 10.00 ? 87  LYS A HG3  3  
ATOM   5652  H  HD2  . LYS A 1 87  ? 8.682   3.150   -16.927 1.00 10.00 ? 87  LYS A HD2  3  
ATOM   5653  H  HD3  . LYS A 1 87  ? 7.773   4.586   -16.482 1.00 10.00 ? 87  LYS A HD3  3  
ATOM   5654  H  HE2  . LYS A 1 87  ? 8.778   5.155   -18.528 1.00 10.00 ? 87  LYS A HE2  3  
ATOM   5655  H  HE3  . LYS A 1 87  ? 9.694   6.027   -17.291 1.00 10.00 ? 87  LYS A HE3  3  
ATOM   5656  H  HZ1  . LYS A 1 87  ? 11.385  4.310   -17.468 1.00 10.00 ? 87  LYS A HZ1  3  
ATOM   5657  H  HZ2  . LYS A 1 87  ? 10.510  3.510   -18.608 1.00 10.00 ? 87  LYS A HZ2  3  
ATOM   5658  H  HZ3  . LYS A 1 87  ? 11.113  5.005   -18.931 1.00 10.00 ? 87  LYS A HZ3  3  
ATOM   5659  N  N    . MET A 1 88  ? 11.861  5.172   -12.675 1.00 10.00 ? 88  MET A N    3  
ATOM   5660  C  CA   . MET A 1 88  ? 11.801  6.213   -11.662 1.00 10.00 ? 88  MET A CA   3  
ATOM   5661  C  C    . MET A 1 88  ? 10.694  7.179   -12.079 1.00 10.00 ? 88  MET A C    3  
ATOM   5662  O  O    . MET A 1 88  ? 10.939  8.154   -12.787 1.00 10.00 ? 88  MET A O    3  
ATOM   5663  C  CB   . MET A 1 88  ? 13.170  6.903   -11.578 1.00 10.00 ? 88  MET A CB   3  
ATOM   5664  C  CG   . MET A 1 88  ? 14.229  5.954   -11.006 1.00 10.00 ? 88  MET A CG   3  
ATOM   5665  S  SD   . MET A 1 88  ? 15.931  6.568   -11.080 1.00 10.00 ? 88  MET A SD   3  
ATOM   5666  C  CE   . MET A 1 88  ? 16.776  5.235   -10.201 1.00 10.00 ? 88  MET A CE   3  
ATOM   5667  H  H    . MET A 1 88  ? 12.610  5.214   -13.349 1.00 10.00 ? 88  MET A H    3  
ATOM   5668  H  HA   . MET A 1 88  ? 11.568  5.790   -10.683 1.00 10.00 ? 88  MET A HA   3  
ATOM   5669  H  HB2  . MET A 1 88  ? 13.480  7.234   -12.571 1.00 10.00 ? 88  MET A HB2  3  
ATOM   5670  H  HB3  . MET A 1 88  ? 13.099  7.776   -10.927 1.00 10.00 ? 88  MET A HB3  3  
ATOM   5671  H  HG2  . MET A 1 88  ? 13.981  5.754   -9.965  1.00 10.00 ? 88  MET A HG2  3  
ATOM   5672  H  HG3  . MET A 1 88  ? 14.211  5.016   -11.556 1.00 10.00 ? 88  MET A HG3  3  
ATOM   5673  H  HE1  . MET A 1 88  ? 17.841  5.460   -10.158 1.00 10.00 ? 88  MET A HE1  3  
ATOM   5674  H  HE2  . MET A 1 88  ? 16.379  5.163   -9.188  1.00 10.00 ? 88  MET A HE2  3  
ATOM   5675  H  HE3  . MET A 1 88  ? 16.621  4.295   -10.728 1.00 10.00 ? 88  MET A HE3  3  
ATOM   5676  N  N    . VAL A 1 89  ? 9.455   6.854   -11.704 1.00 10.00 ? 89  VAL A N    3  
ATOM   5677  C  CA   . VAL A 1 89  ? 8.297   7.646   -12.081 1.00 10.00 ? 89  VAL A CA   3  
ATOM   5678  C  C    . VAL A 1 89  ? 8.279   8.946   -11.271 1.00 10.00 ? 89  VAL A C    3  
ATOM   5679  O  O    . VAL A 1 89  ? 8.845   8.992   -10.179 1.00 10.00 ? 89  VAL A O    3  
ATOM   5680  C  CB   . VAL A 1 89  ? 6.986   6.840   -11.932 1.00 10.00 ? 89  VAL A CB   3  
ATOM   5681  C  CG1  . VAL A 1 89  ? 6.882   5.769   -13.022 1.00 10.00 ? 89  VAL A CG1  3  
ATOM   5682  C  CG2  . VAL A 1 89  ? 6.805   6.180   -10.561 1.00 10.00 ? 89  VAL A CG2  3  
ATOM   5683  H  H    . VAL A 1 89  ? 9.342   6.076   -11.059 1.00 10.00 ? 89  VAL A H    3  
ATOM   5684  H  HA   . VAL A 1 89  ? 8.425   7.901   -13.133 1.00 10.00 ? 89  VAL A HA   3  
ATOM   5685  H  HB   . VAL A 1 89  ? 6.140   7.513   -12.060 1.00 10.00 ? 89  VAL A HB   3  
ATOM   5686  H  HG11 . VAL A 1 89  ? 7.653   5.013   -12.880 1.00 10.00 ? 89  VAL A HG11 3  
ATOM   5687  H  HG12 . VAL A 1 89  ? 5.903   5.293   -12.972 1.00 10.00 ? 89  VAL A HG12 3  
ATOM   5688  H  HG13 . VAL A 1 89  ? 6.997   6.223   -14.007 1.00 10.00 ? 89  VAL A HG13 3  
ATOM   5689  H  HG21 . VAL A 1 89  ? 5.782   5.815   -10.466 1.00 10.00 ? 89  VAL A HG21 3  
ATOM   5690  H  HG22 . VAL A 1 89  ? 7.475   5.330   -10.467 1.00 10.00 ? 89  VAL A HG22 3  
ATOM   5691  H  HG23 . VAL A 1 89  ? 6.999   6.896   -9.764  1.00 10.00 ? 89  VAL A HG23 3  
ATOM   5692  N  N    . PRO A 1 90  ? 7.616   10.001  -11.777 1.00 10.00 ? 90  PRO A N    3  
ATOM   5693  C  CA   . PRO A 1 90  ? 7.375   11.222  -11.018 1.00 10.00 ? 90  PRO A CA   3  
ATOM   5694  C  C    . PRO A 1 90  ? 6.750   10.910  -9.651  1.00 10.00 ? 90  PRO A C    3  
ATOM   5695  O  O    . PRO A 1 90  ? 7.108   11.526  -8.650  1.00 10.00 ? 90  PRO A O    3  
ATOM   5696  C  CB   . PRO A 1 90  ? 6.506   12.098  -11.928 1.00 10.00 ? 90  PRO A CB   3  
ATOM   5697  C  CG   . PRO A 1 90  ? 5.855   11.118  -12.898 1.00 10.00 ? 90  PRO A CG   3  
ATOM   5698  C  CD   . PRO A 1 90  ? 6.956   10.077  -13.074 1.00 10.00 ? 90  PRO A CD   3  
ATOM   5699  H  HA   . PRO A 1 90  ? 8.298   11.764  -10.845 1.00 10.00 ? 90  PRO A HA   3  
ATOM   5700  H  HB2  . PRO A 1 90  ? 5.769   12.676  -11.386 1.00 10.00 ? 90  PRO A HB2  3  
ATOM   5701  H  HB3  . PRO A 1 90  ? 7.153   12.773  -12.491 1.00 10.00 ? 90  PRO A HB3  3  
ATOM   5702  H  HG2  . PRO A 1 90  ? 4.983   10.661  -12.427 1.00 10.00 ? 90  PRO A HG2  3  
ATOM   5703  H  HG3  . PRO A 1 90  ? 5.573   11.591  -13.839 1.00 10.00 ? 90  PRO A HG3  3  
ATOM   5704  H  HD2  . PRO A 1 90  ? 6.515   9.146   -13.424 1.00 10.00 ? 90  PRO A HD2  3  
ATOM   5705  H  HD3  . PRO A 1 90  ? 7.679   10.433  -13.809 1.00 10.00 ? 90  PRO A HD3  3  
ATOM   5706  N  N    . TRP A 1 91  ? 5.846   9.929   -9.616  1.00 10.00 ? 91  TRP A N    3  
ATOM   5707  C  CA   . TRP A 1 91  ? 5.200   9.359   -8.449  1.00 10.00 ? 91  TRP A CA   3  
ATOM   5708  C  C    . TRP A 1 91  ? 4.330   8.226   -8.996  1.00 10.00 ? 91  TRP A C    3  
ATOM   5709  O  O    . TRP A 1 91  ? 4.176   8.117   -10.214 1.00 10.00 ? 91  TRP A O    3  
ATOM   5710  C  CB   . TRP A 1 91  ? 4.358   10.415  -7.718  1.00 10.00 ? 91  TRP A CB   3  
ATOM   5711  C  CG   . TRP A 1 91  ? 3.362   11.090  -8.594  1.00 10.00 ? 91  TRP A CG   3  
ATOM   5712  C  CD1  . TRP A 1 91  ? 2.168   10.571  -8.927  1.00 10.00 ? 91  TRP A CD1  3  
ATOM   5713  C  CD2  . TRP A 1 91  ? 3.474   12.338  -9.332  1.00 10.00 ? 91  TRP A CD2  3  
ATOM   5714  N  NE1  . TRP A 1 91  ? 1.610   11.315  -9.935  1.00 10.00 ? 91  TRP A NE1  3  
ATOM   5715  C  CE2  . TRP A 1 91  ? 2.373   12.425  -10.224 1.00 10.00 ? 91  TRP A CE2  3  
ATOM   5716  C  CE3  . TRP A 1 91  ? 4.409   13.390  -9.363  1.00 10.00 ? 91  TRP A CE3  3  
ATOM   5717  C  CZ2  . TRP A 1 91  ? 2.259   13.460  -11.155 1.00 10.00 ? 91  TRP A CZ2  3  
ATOM   5718  C  CZ3  . TRP A 1 91  ? 4.246   14.492  -10.221 1.00 10.00 ? 91  TRP A CZ3  3  
ATOM   5719  C  CH2  . TRP A 1 91  ? 3.188   14.512  -11.145 1.00 10.00 ? 91  TRP A CH2  3  
ATOM   5720  H  H    . TRP A 1 91  ? 5.608   9.437   -10.467 1.00 10.00 ? 91  TRP A H    3  
ATOM   5721  H  HA   . TRP A 1 91  ? 5.958   8.954   -7.786  1.00 10.00 ? 91  TRP A HA   3  
ATOM   5722  H  HB2  . TRP A 1 91  ? 3.794   9.951   -6.914  1.00 10.00 ? 91  TRP A HB2  3  
ATOM   5723  H  HB3  . TRP A 1 91  ? 5.016   11.161  -7.278  1.00 10.00 ? 91  TRP A HB3  3  
ATOM   5724  H  HD1  . TRP A 1 91  ? 1.781   9.645   -8.550  1.00 10.00 ? 91  TRP A HD1  3  
ATOM   5725  H  HE1  . TRP A 1 91  ? 0.783   10.974  -10.418 1.00 10.00 ? 91  TRP A HE1  3  
ATOM   5726  H  HE3  . TRP A 1 91  ? 5.268   13.319  -8.723  1.00 10.00 ? 91  TRP A HE3  3  
ATOM   5727  H  HZ2  . TRP A 1 91  ? 1.481   13.410  -11.885 1.00 10.00 ? 91  TRP A HZ2  3  
ATOM   5728  H  HZ3  . TRP A 1 91  ? 4.966   15.297  -10.207 1.00 10.00 ? 91  TRP A HZ3  3  
ATOM   5729  H  HH2  . TRP A 1 91  ? 3.096   15.326  -11.849 1.00 10.00 ? 91  TRP A HH2  3  
ATOM   5730  N  N    . LEU A 1 92  ? 3.739   7.411   -8.122  1.00 10.00 ? 92  LEU A N    3  
ATOM   5731  C  CA   . LEU A 1 92  ? 2.742   6.425   -8.519  1.00 10.00 ? 92  LEU A CA   3  
ATOM   5732  C  C    . LEU A 1 92  ? 1.348   6.982   -8.220  1.00 10.00 ? 92  LEU A C    3  
ATOM   5733  O  O    . LEU A 1 92  ? 0.883   6.935   -7.084  1.00 10.00 ? 92  LEU A O    3  
ATOM   5734  C  CB   . LEU A 1 92  ? 3.029   5.057   -7.876  1.00 10.00 ? 92  LEU A CB   3  
ATOM   5735  C  CG   . LEU A 1 92  ? 3.120   5.042   -6.337  1.00 10.00 ? 92  LEU A CG   3  
ATOM   5736  C  CD1  . LEU A 1 92  ? 2.007   4.170   -5.744  1.00 10.00 ? 92  LEU A CD1  3  
ATOM   5737  C  CD2  . LEU A 1 92  ? 4.471   4.476   -5.885  1.00 10.00 ? 92  LEU A CD2  3  
ATOM   5738  H  H    . LEU A 1 92  ? 3.885   7.564   -7.135  1.00 10.00 ? 92  LEU A H    3  
ATOM   5739  H  HA   . LEU A 1 92  ? 2.793   6.244   -9.594  1.00 10.00 ? 92  LEU A HA   3  
ATOM   5740  H  HB2  . LEU A 1 92  ? 2.257   4.358   -8.200  1.00 10.00 ? 92  LEU A HB2  3  
ATOM   5741  H  HB3  . LEU A 1 92  ? 3.975   4.702   -8.285  1.00 10.00 ? 92  LEU A HB3  3  
ATOM   5742  H  HG   . LEU A 1 92  ? 3.023   6.049   -5.933  1.00 10.00 ? 92  LEU A HG   3  
ATOM   5743  H  HD11 . LEU A 1 92  ? 2.088   4.180   -4.659  1.00 10.00 ? 92  LEU A HD11 3  
ATOM   5744  H  HD12 . LEU A 1 92  ? 1.029   4.555   -6.031  1.00 10.00 ? 92  LEU A HD12 3  
ATOM   5745  H  HD13 . LEU A 1 92  ? 2.106   3.144   -6.101  1.00 10.00 ? 92  LEU A HD13 3  
ATOM   5746  H  HD21 . LEU A 1 92  ? 4.568   3.438   -6.207  1.00 10.00 ? 92  LEU A HD21 3  
ATOM   5747  H  HD22 . LEU A 1 92  ? 5.284   5.057   -6.318  1.00 10.00 ? 92  LEU A HD22 3  
ATOM   5748  H  HD23 . LEU A 1 92  ? 4.544   4.516   -4.798  1.00 10.00 ? 92  LEU A HD23 3  
ATOM   5749  N  N    . THR A 1 93  ? 0.675   7.540   -9.231  1.00 10.00 ? 93  THR A N    3  
ATOM   5750  C  CA   . THR A 1 93  ? -0.650  8.112   -9.047  1.00 10.00 ? 93  THR A CA   3  
ATOM   5751  C  C    . THR A 1 93  ? -1.635  6.948   -8.986  1.00 10.00 ? 93  THR A C    3  
ATOM   5752  O  O    . THR A 1 93  ? -1.595  6.076   -9.851  1.00 10.00 ? 93  THR A O    3  
ATOM   5753  C  CB   . THR A 1 93  ? -1.013  9.001   -10.253 1.00 10.00 ? 93  THR A CB   3  
ATOM   5754  O  OG1  . THR A 1 93  ? 0.132   9.316   -11.025 1.00 10.00 ? 93  THR A OG1  3  
ATOM   5755  C  CG2  . THR A 1 93  ? -1.694  10.294  -9.811  1.00 10.00 ? 93  THR A CG2  3  
ATOM   5756  H  H    . THR A 1 93  ? 1.138   7.751   -10.108 1.00 10.00 ? 93  THR A H    3  
ATOM   5757  H  HA   . THR A 1 93  ? -0.662  8.709   -8.132  1.00 10.00 ? 93  THR A HA   3  
ATOM   5758  H  HB   . THR A 1 93  ? -1.721  8.472   -10.892 1.00 10.00 ? 93  THR A HB   3  
ATOM   5759  H  HG1  . THR A 1 93  ? -0.103  9.269   -11.957 1.00 10.00 ? 93  THR A HG1  3  
ATOM   5760  H  HG21 . THR A 1 93  ? -1.951  10.897  -10.682 1.00 10.00 ? 93  THR A HG21 3  
ATOM   5761  H  HG22 . THR A 1 93  ? -2.607  10.062  -9.259  1.00 10.00 ? 93  THR A HG22 3  
ATOM   5762  H  HG23 . THR A 1 93  ? -1.020  10.855  -9.170  1.00 10.00 ? 93  THR A HG23 3  
ATOM   5763  N  N    . ILE A 1 94  ? -2.518  6.930   -7.988  1.00 10.00 ? 94  ILE A N    3  
ATOM   5764  C  CA   . ILE A 1 94  ? -3.530  5.889   -7.861  1.00 10.00 ? 94  ILE A CA   3  
ATOM   5765  C  C    . ILE A 1 94  ? -4.864  6.466   -8.353  1.00 10.00 ? 94  ILE A C    3  
ATOM   5766  O  O    . ILE A 1 94  ? -5.402  7.380   -7.724  1.00 10.00 ? 94  ILE A O    3  
ATOM   5767  C  CB   . ILE A 1 94  ? -3.557  5.325   -6.433  1.00 10.00 ? 94  ILE A CB   3  
ATOM   5768  C  CG1  . ILE A 1 94  ? -3.893  6.359   -5.352  1.00 10.00 ? 94  ILE A CG1  3  
ATOM   5769  C  CG2  . ILE A 1 94  ? -2.192  4.697   -6.120  1.00 10.00 ? 94  ILE A CG2  3  
ATOM   5770  C  CD1  . ILE A 1 94  ? -5.317  6.173   -4.834  1.00 10.00 ? 94  ILE A CD1  3  
ATOM   5771  H  H    . ILE A 1 94  ? -2.548  7.720   -7.348  1.00 10.00 ? 94  ILE A H    3  
ATOM   5772  H  HA   . ILE A 1 94  ? -3.252  5.022   -8.458  1.00 10.00 ? 94  ILE A HA   3  
ATOM   5773  H  HB   . ILE A 1 94  ? -4.295  4.522   -6.411  1.00 10.00 ? 94  ILE A HB   3  
ATOM   5774  H  HG12 . ILE A 1 94  ? -3.213  6.238   -4.510  1.00 10.00 ? 94  ILE A HG12 3  
ATOM   5775  H  HG13 . ILE A 1 94  ? -3.778  7.369   -5.733  1.00 10.00 ? 94  ILE A HG13 3  
ATOM   5776  H  HG21 . ILE A 1 94  ? -1.925  3.971   -6.888  1.00 10.00 ? 94  ILE A HG21 3  
ATOM   5777  H  HG22 . ILE A 1 94  ? -1.419  5.466   -6.075  1.00 10.00 ? 94  ILE A HG22 3  
ATOM   5778  H  HG23 . ILE A 1 94  ? -2.248  4.184   -5.160  1.00 10.00 ? 94  ILE A HG23 3  
ATOM   5779  H  HD11 . ILE A 1 94  ? -6.053  6.297   -5.626  1.00 10.00 ? 94  ILE A HD11 3  
ATOM   5780  H  HD12 . ILE A 1 94  ? -5.411  5.176   -4.416  1.00 10.00 ? 94  ILE A HD12 3  
ATOM   5781  H  HD13 . ILE A 1 94  ? -5.506  6.907   -4.056  1.00 10.00 ? 94  ILE A HD13 3  
ATOM   5782  N  N    . PRO A 1 95  ? -5.378  6.016   -9.509  1.00 10.00 ? 95  PRO A N    3  
ATOM   5783  C  CA   . PRO A 1 95  ? -6.527  6.634   -10.152 1.00 10.00 ? 95  PRO A CA   3  
ATOM   5784  C  C    . PRO A 1 95  ? -7.821  6.159   -9.490  1.00 10.00 ? 95  PRO A C    3  
ATOM   5785  O  O    . PRO A 1 95  ? -8.581  5.403   -10.091 1.00 10.00 ? 95  PRO A O    3  
ATOM   5786  C  CB   . PRO A 1 95  ? -6.439  6.186   -11.611 1.00 10.00 ? 95  PRO A CB   3  
ATOM   5787  C  CG   . PRO A 1 95  ? -5.803  4.800   -11.515 1.00 10.00 ? 95  PRO A CG   3  
ATOM   5788  C  CD   . PRO A 1 95  ? -4.829  4.959   -10.349 1.00 10.00 ? 95  PRO A CD   3  
ATOM   5789  H  HA   . PRO A 1 95  ? -6.475  7.722   -10.108 1.00 10.00 ? 95  PRO A HA   3  
ATOM   5790  H  HB2  . PRO A 1 95  ? -7.421  6.152   -12.076 1.00 10.00 ? 95  PRO A HB2  3  
ATOM   5791  H  HB3  . PRO A 1 95  ? -5.776  6.854   -12.163 1.00 10.00 ? 95  PRO A HB3  3  
ATOM   5792  H  HG2  . PRO A 1 95  ? -6.567  4.065   -11.253 1.00 10.00 ? 95  PRO A HG2  3  
ATOM   5793  H  HG3  . PRO A 1 95  ? -5.302  4.505   -12.437 1.00 10.00 ? 95  PRO A HG3  3  
ATOM   5794  H  HD2  . PRO A 1 95  ? -4.743  4.012   -9.815  1.00 10.00 ? 95  PRO A HD2  3  
ATOM   5795  H  HD3  . PRO A 1 95  ? -3.858  5.262   -10.741 1.00 10.00 ? 95  PRO A HD3  3  
ATOM   5796  N  N    . ALA A 1 96  ? -8.066  6.587   -8.248  1.00 10.00 ? 96  ALA A N    3  
ATOM   5797  C  CA   . ALA A 1 96  ? -9.107  6.018   -7.410  1.00 10.00 ? 96  ALA A CA   3  
ATOM   5798  C  C    . ALA A 1 96  ? -8.772  4.558   -7.099  1.00 10.00 ? 96  ALA A C    3  
ATOM   5799  O  O    . ALA A 1 96  ? -7.737  4.056   -7.536  1.00 10.00 ? 96  ALA A O    3  
ATOM   5800  C  CB   . ALA A 1 96  ? -10.481 6.249   -8.043  1.00 10.00 ? 96  ALA A CB   3  
ATOM   5801  H  H    . ALA A 1 96  ? -7.377  7.160   -7.784  1.00 10.00 ? 96  ALA A H    3  
ATOM   5802  H  HA   . ALA A 1 96  ? -9.089  6.544   -6.460  1.00 10.00 ? 96  ALA A HA   3  
ATOM   5803  H  HB1  . ALA A 1 96  ? -10.512 7.265   -8.436  1.00 10.00 ? 96  ALA A HB1  3  
ATOM   5804  H  HB2  . ALA A 1 96  ? -10.674 5.539   -8.845  1.00 10.00 ? 96  ALA A HB2  3  
ATOM   5805  H  HB3  . ALA A 1 96  ? -11.259 6.144   -7.297  1.00 10.00 ? 96  ALA A HB3  3  
ATOM   5806  N  N    . ARG A 1 97  ? -9.578  3.908   -6.257  1.00 10.00 ? 97  ARG A N    3  
ATOM   5807  C  CA   . ARG A 1 97  ? -9.487  2.514   -5.843  1.00 10.00 ? 97  ARG A CA   3  
ATOM   5808  C  C    . ARG A 1 97  ? -8.092  1.887   -5.662  1.00 10.00 ? 97  ARG A C    3  
ATOM   5809  O  O    . ARG A 1 97  ? -7.980  0.662   -5.695  1.00 10.00 ? 97  ARG A O    3  
ATOM   5810  C  CB   . ARG A 1 97  ? -10.399 1.675   -6.753  1.00 10.00 ? 97  ARG A CB   3  
ATOM   5811  C  CG   . ARG A 1 97  ? -11.414 0.881   -5.929  1.00 10.00 ? 97  ARG A CG   3  
ATOM   5812  C  CD   . ARG A 1 97  ? -10.750 -0.255  -5.135  1.00 10.00 ? 97  ARG A CD   3  
ATOM   5813  N  NE   . ARG A 1 97  ? -11.750 -1.158  -4.555  1.00 10.00 ? 97  ARG A NE   3  
ATOM   5814  C  CZ   . ARG A 1 97  ? -11.468 -2.252  -3.828  1.00 10.00 ? 97  ARG A CZ   3  
ATOM   5815  N  NH1  . ARG A 1 97  ? -10.206 -2.554  -3.500  1.00 10.00 ? 97  ARG A NH1  3  
ATOM   5816  N  NH2  . ARG A 1 97  ? -12.465 -3.052  -3.431  1.00 10.00 ? 97  ARG A NH2  3  
ATOM   5817  H  H    . ARG A 1 97  ? -10.492 4.320   -6.046  1.00 10.00 ? 97  ARG A H    3  
ATOM   5818  H  HA   . ARG A 1 97  ? -9.922  2.521   -4.844  1.00 10.00 ? 97  ARG A HA   3  
ATOM   5819  H  HB2  . ARG A 1 97  ? -10.974 2.336   -7.405  1.00 10.00 ? 97  ARG A HB2  3  
ATOM   5820  H  HB3  . ARG A 1 97  ? -9.819  1.014   -7.398  1.00 10.00 ? 97  ARG A HB3  3  
ATOM   5821  H  HG2  . ARG A 1 97  ? -11.939 1.567   -5.261  1.00 10.00 ? 97  ARG A HG2  3  
ATOM   5822  H  HG3  . ARG A 1 97  ? -12.142 0.482   -6.630  1.00 10.00 ? 97  ARG A HG3  3  
ATOM   5823  H  HD2  . ARG A 1 97  ? -10.109 -0.825  -5.811  1.00 10.00 ? 97  ARG A HD2  3  
ATOM   5824  H  HD3  . ARG A 1 97  ? -10.142 0.172   -4.335  1.00 10.00 ? 97  ARG A HD3  3  
ATOM   5825  H  HE   . ARG A 1 97  ? -12.714 -0.935  -4.762  1.00 10.00 ? 97  ARG A HE   3  
ATOM   5826  H  HH11 . ARG A 1 97  ? -9.423  -1.954  -3.774  1.00 10.00 ? 97  ARG A HH11 3  
ATOM   5827  H  HH12 . ARG A 1 97  ? -9.980  -3.373  -2.961  1.00 10.00 ? 97  ARG A HH12 3  
ATOM   5828  H  HH21 . ARG A 1 97  ? -13.420 -2.842  -3.684  1.00 10.00 ? 97  ARG A HH21 3  
ATOM   5829  H  HH22 . ARG A 1 97  ? -12.282 -3.888  -2.897  1.00 10.00 ? 97  ARG A HH22 3  
ATOM   5830  N  N    . GLY A 1 98  ? -7.043  2.679   -5.415  1.00 10.00 ? 98  GLY A N    3  
ATOM   5831  C  CA   . GLY A 1 98  ? -5.692  2.196   -5.161  1.00 10.00 ? 98  GLY A CA   3  
ATOM   5832  C  C    . GLY A 1 98  ? -5.675  1.036   -4.169  1.00 10.00 ? 98  GLY A C    3  
ATOM   5833  O  O    . GLY A 1 98  ? -5.823  1.238   -2.967  1.00 10.00 ? 98  GLY A O    3  
ATOM   5834  H  H    . GLY A 1 98  ? -7.152  3.647   -5.689  1.00 10.00 ? 98  GLY A H    3  
ATOM   5835  H  HA2  . GLY A 1 98  ? -5.239  1.895   -6.106  1.00 10.00 ? 98  GLY A HA2  3  
ATOM   5836  H  HA3  . GLY A 1 98  ? -5.094  2.999   -4.737  1.00 10.00 ? 98  GLY A HA3  3  
ATOM   5837  N  N    . THR A 1 99  ? -5.510  -0.179  -4.687  1.00 10.00 ? 99  THR A N    3  
ATOM   5838  C  CA   . THR A 1 99  ? -5.341  -1.381  -3.891  1.00 10.00 ? 99  THR A CA   3  
ATOM   5839  C  C    . THR A 1 99  ? -4.131  -2.103  -4.475  1.00 10.00 ? 99  THR A C    3  
ATOM   5840  O  O    . THR A 1 99  ? -4.230  -3.257  -4.884  1.00 10.00 ? 99  THR A O    3  
ATOM   5841  C  CB   . THR A 1 99  ? -6.620  -2.232  -3.956  1.00 10.00 ? 99  THR A CB   3  
ATOM   5842  O  OG1  . THR A 1 99  ? -7.797  -1.437  -3.926  1.00 10.00 ? 99  THR A OG1  3  
ATOM   5843  C  CG2  . THR A 1 99  ? -6.682  -3.233  -2.799  1.00 10.00 ? 99  THR A CG2  3  
ATOM   5844  H  H    . THR A 1 99  ? -5.446  -0.267  -5.691  1.00 10.00 ? 99  THR A H    3  
ATOM   5845  H  HA   . THR A 1 99  ? -5.136  -1.154  -2.850  1.00 10.00 ? 99  THR A HA   3  
ATOM   5846  H  HB   . THR A 1 99  ? -6.590  -2.777  -4.895  1.00 10.00 ? 99  THR A HB   3  
ATOM   5847  H  HG1  . THR A 1 99  ? -7.688  -0.725  -4.575  1.00 10.00 ? 99  THR A HG1  3  
ATOM   5848  H  HG21 . THR A 1 99  ? -5.786  -3.855  -2.793  1.00 10.00 ? 99  THR A HG21 3  
ATOM   5849  H  HG22 . THR A 1 99  ? -6.753  -2.701  -1.850  1.00 10.00 ? 99  THR A HG22 3  
ATOM   5850  H  HG23 . THR A 1 99  ? -7.552  -3.878  -2.917  1.00 10.00 ? 99  THR A HG23 3  
ATOM   5851  N  N    . LEU A 1 100 ? -2.996  -1.402  -4.536  1.00 10.00 ? 100 LEU A N    3  
ATOM   5852  C  CA   . LEU A 1 100 ? -1.752  -1.989  -5.003  1.00 10.00 ? 100 LEU A CA   3  
ATOM   5853  C  C    . LEU A 1 100 ? -0.878  -2.325  -3.804  1.00 10.00 ? 100 LEU A C    3  
ATOM   5854  O  O    . LEU A 1 100 ? -1.128  -1.867  -2.688  1.00 10.00 ? 100 LEU A O    3  
ATOM   5855  C  CB   . LEU A 1 100 ? -1.090  -1.162  -6.120  1.00 10.00 ? 100 LEU A CB   3  
ATOM   5856  C  CG   . LEU A 1 100 ? -0.460  0.210   -5.815  1.00 10.00 ? 100 LEU A CG   3  
ATOM   5857  C  CD1  . LEU A 1 100 ? -1.470  1.261   -5.352  1.00 10.00 ? 100 LEU A CD1  3  
ATOM   5858  C  CD2  . LEU A 1 100 ? 0.719   0.127   -4.852  1.00 10.00 ? 100 LEU A CD2  3  
ATOM   5859  H  H    . LEU A 1 100 ? -2.958  -0.493  -4.092  1.00 10.00 ? 100 LEU A H    3  
ATOM   5860  H  HA   . LEU A 1 100 ? -1.966  -2.947  -5.478  1.00 10.00 ? 100 LEU A HA   3  
ATOM   5861  H  HB2  . LEU A 1 100 ? -0.301  -1.779  -6.544  1.00 10.00 ? 100 LEU A HB2  3  
ATOM   5862  H  HB3  . LEU A 1 100 ? -1.841  -1.026  -6.898  1.00 10.00 ? 100 LEU A HB3  3  
ATOM   5863  H  HG   . LEU A 1 100 ? -0.032  0.575   -6.746  1.00 10.00 ? 100 LEU A HG   3  
ATOM   5864  H  HD11 . LEU A 1 100 ? -0.969  2.227   -5.325  1.00 10.00 ? 100 LEU A HD11 3  
ATOM   5865  H  HD12 . LEU A 1 100 ? -2.307  1.308   -6.049  1.00 10.00 ? 100 LEU A HD12 3  
ATOM   5866  H  HD13 . LEU A 1 100 ? -1.836  1.033   -4.355  1.00 10.00 ? 100 LEU A HD13 3  
ATOM   5867  H  HD21 . LEU A 1 100 ? 1.385   -0.687  -5.141  1.00 10.00 ? 100 LEU A HD21 3  
ATOM   5868  H  HD22 . LEU A 1 100 ? 1.277   1.063   -4.882  1.00 10.00 ? 100 LEU A HD22 3  
ATOM   5869  H  HD23 . LEU A 1 100 ? 0.345   -0.029  -3.847  1.00 10.00 ? 100 LEU A HD23 3  
ATOM   5870  N  N    . THR A 1 101 ? 0.134   -3.151  -4.040  1.00 10.00 ? 101 THR A N    3  
ATOM   5871  C  CA   . THR A 1 101 ? 0.919   -3.779  -3.003  1.00 10.00 ? 101 THR A CA   3  
ATOM   5872  C  C    . THR A 1 101 ? 2.357   -3.486  -3.369  1.00 10.00 ? 101 THR A C    3  
ATOM   5873  O  O    . THR A 1 101 ? 2.826   -3.938  -4.406  1.00 10.00 ? 101 THR A O    3  
ATOM   5874  C  CB   . THR A 1 101 ? 0.611   -5.282  -2.954  1.00 10.00 ? 101 THR A CB   3  
ATOM   5875  O  OG1  . THR A 1 101 ? -0.791  -5.475  -2.958  1.00 10.00 ? 101 THR A OG1  3  
ATOM   5876  C  CG2  . THR A 1 101 ? 1.180   -5.913  -1.680  1.00 10.00 ? 101 THR A CG2  3  
ATOM   5877  H  H    . THR A 1 101 ? 0.402   -3.359  -4.989  1.00 10.00 ? 101 THR A H    3  
ATOM   5878  H  HA   . THR A 1 101 ? 0.692   -3.354  -2.030  1.00 10.00 ? 101 THR A HA   3  
ATOM   5879  H  HB   . THR A 1 101 ? 1.035   -5.773  -3.832  1.00 10.00 ? 101 THR A HB   3  
ATOM   5880  H  HG1  . THR A 1 101 ? -0.975  -6.417  -2.981  1.00 10.00 ? 101 THR A HG1  3  
ATOM   5881  H  HG21 . THR A 1 101 ? 0.683   -5.490  -0.806  1.00 10.00 ? 101 THR A HG21 3  
ATOM   5882  H  HG22 . THR A 1 101 ? 1.014   -6.991  -1.695  1.00 10.00 ? 101 THR A HG22 3  
ATOM   5883  H  HG23 . THR A 1 101 ? 2.249   -5.721  -1.600  1.00 10.00 ? 101 THR A HG23 3  
ATOM   5884  N  N    . LEU A 1 102 ? 3.043   -2.713  -2.538  1.00 10.00 ? 102 LEU A N    3  
ATOM   5885  C  CA   . LEU A 1 102 ? 4.386   -2.268  -2.807  1.00 10.00 ? 102 LEU A CA   3  
ATOM   5886  C  C    . LEU A 1 102 ? 5.262   -3.462  -2.456  1.00 10.00 ? 102 LEU A C    3  
ATOM   5887  O  O    . LEU A 1 102 ? 5.326   -3.860  -1.294  1.00 10.00 ? 102 LEU A O    3  
ATOM   5888  C  CB   . LEU A 1 102 ? 4.712   -1.031  -1.954  1.00 10.00 ? 102 LEU A CB   3  
ATOM   5889  C  CG   . LEU A 1 102 ? 4.074   0.261   -2.500  1.00 10.00 ? 102 LEU A CG   3  
ATOM   5890  C  CD1  . LEU A 1 102 ? 2.589   0.348   -2.152  1.00 10.00 ? 102 LEU A CD1  3  
ATOM   5891  C  CD2  . LEU A 1 102 ? 4.780   1.500   -1.930  1.00 10.00 ? 102 LEU A CD2  3  
ATOM   5892  H  H    . LEU A 1 102 ? 2.612   -2.427  -1.673  1.00 10.00 ? 102 LEU A H    3  
ATOM   5893  H  HA   . LEU A 1 102 ? 4.485   -2.009  -3.859  1.00 10.00 ? 102 LEU A HA   3  
ATOM   5894  H  HB2  . LEU A 1 102 ? 4.369   -1.188  -0.934  1.00 10.00 ? 102 LEU A HB2  3  
ATOM   5895  H  HB3  . LEU A 1 102 ? 5.796   -0.915  -1.936  1.00 10.00 ? 102 LEU A HB3  3  
ATOM   5896  H  HG   . LEU A 1 102 ? 4.159   0.288   -3.587  1.00 10.00 ? 102 LEU A HG   3  
ATOM   5897  H  HD11 . LEU A 1 102 ? 2.184   1.280   -2.544  1.00 10.00 ? 102 LEU A HD11 3  
ATOM   5898  H  HD12 . LEU A 1 102 ? 2.047   -0.478  -2.598  1.00 10.00 ? 102 LEU A HD12 3  
ATOM   5899  H  HD13 . LEU A 1 102 ? 2.447   0.310   -1.077  1.00 10.00 ? 102 LEU A HD13 3  
ATOM   5900  H  HD21 . LEU A 1 102 ? 5.852   1.455   -2.112  1.00 10.00 ? 102 LEU A HD21 3  
ATOM   5901  H  HD22 . LEU A 1 102 ? 4.382   2.396   -2.407  1.00 10.00 ? 102 LEU A HD22 3  
ATOM   5902  H  HD23 . LEU A 1 102 ? 4.617   1.574   -0.857  1.00 10.00 ? 102 LEU A HD23 3  
ATOM   5903  N  N    . GLN A 1 103 ? 5.852   -4.080  -3.480  1.00 10.00 ? 103 GLN A N    3  
ATOM   5904  C  CA   . GLN A 1 103 ? 6.607   -5.315  -3.427  1.00 10.00 ? 103 GLN A CA   3  
ATOM   5905  C  C    . GLN A 1 103 ? 7.933   -5.118  -4.157  1.00 10.00 ? 103 GLN A C    3  
ATOM   5906  O  O    . GLN A 1 103 ? 8.005   -4.387  -5.144  1.00 10.00 ? 103 GLN A O    3  
ATOM   5907  C  CB   . GLN A 1 103 ? 5.832   -6.417  -4.151  1.00 10.00 ? 103 GLN A CB   3  
ATOM   5908  C  CG   . GLN A 1 103 ? 4.478   -6.728  -3.506  1.00 10.00 ? 103 GLN A CG   3  
ATOM   5909  C  CD   . GLN A 1 103 ? 3.532   -7.311  -4.544  1.00 10.00 ? 103 GLN A CD   3  
ATOM   5910  O  OE1  . GLN A 1 103 ? 3.179   -8.484  -4.487  1.00 10.00 ? 103 GLN A OE1  3  
ATOM   5911  N  NE2  . GLN A 1 103 ? 3.128   -6.498  -5.513  1.00 10.00 ? 103 GLN A NE2  3  
ATOM   5912  H  H    . GLN A 1 103 ? 5.753   -3.669  -4.403  1.00 10.00 ? 103 GLN A H    3  
ATOM   5913  H  HA   . GLN A 1 103 ? 6.780   -5.604  -2.389  1.00 10.00 ? 103 GLN A HA   3  
ATOM   5914  H  HB2  . GLN A 1 103 ? 5.686   -6.085  -5.180  1.00 10.00 ? 103 GLN A HB2  3  
ATOM   5915  H  HB3  . GLN A 1 103 ? 6.424   -7.333  -4.176  1.00 10.00 ? 103 GLN A HB3  3  
ATOM   5916  H  HG2  . GLN A 1 103 ? 4.617   -7.434  -2.687  1.00 10.00 ? 103 GLN A HG2  3  
ATOM   5917  H  HG3  . GLN A 1 103 ? 4.019   -5.829  -3.107  1.00 10.00 ? 103 GLN A HG3  3  
ATOM   5918  H  HE21 . GLN A 1 103 ? 3.397   -5.505  -5.527  1.00 10.00 ? 103 GLN A HE21 3  
ATOM   5919  H  HE22 . GLN A 1 103 ? 2.583   -6.873  -6.267  1.00 10.00 ? 103 GLN A HE22 3  
ATOM   5920  N  N    . ARG A 1 104 ? 8.951   -5.833  -3.677  1.00 10.00 ? 104 ARG A N    3  
ATOM   5921  C  CA   . ARG A 1 104 ? 10.333  -5.845  -4.166  1.00 10.00 ? 104 ARG A CA   3  
ATOM   5922  C  C    . ARG A 1 104 ? 10.470  -5.482  -5.647  1.00 10.00 ? 104 ARG A C    3  
ATOM   5923  O  O    . ARG A 1 104 ? 11.217  -4.566  -5.992  1.00 10.00 ? 104 ARG A O    3  
ATOM   5924  C  CB   . ARG A 1 104 ? 10.998  -7.190  -3.837  1.00 10.00 ? 104 ARG A CB   3  
ATOM   5925  C  CG   . ARG A 1 104 ? 12.381  -7.032  -3.189  1.00 10.00 ? 104 ARG A CG   3  
ATOM   5926  C  CD   . ARG A 1 104 ? 13.378  -6.201  -4.015  1.00 10.00 ? 104 ARG A CD   3  
ATOM   5927  N  NE   . ARG A 1 104 ? 14.757  -6.608  -3.692  1.00 10.00 ? 104 ARG A NE   3  
ATOM   5928  C  CZ   . ARG A 1 104 ? 15.843  -5.826  -3.568  1.00 10.00 ? 104 ARG A CZ   3  
ATOM   5929  N  NH1  . ARG A 1 104 ? 15.772  -4.505  -3.796  1.00 10.00 ? 104 ARG A NH1  3  
ATOM   5930  N  NH2  . ARG A 1 104 ? 17.001  -6.376  -3.211  1.00 10.00 ? 104 ARG A NH2  3  
ATOM   5931  H  H    . ARG A 1 104 ? 8.735   -6.333  -2.828  1.00 10.00 ? 104 ARG A H    3  
ATOM   5932  H  HA   . ARG A 1 104 ? 10.864  -5.076  -3.625  1.00 10.00 ? 104 ARG A HA   3  
ATOM   5933  H  HB2  . ARG A 1 104 ? 10.383  -7.750  -3.133  1.00 10.00 ? 104 ARG A HB2  3  
ATOM   5934  H  HB3  . ARG A 1 104 ? 11.090  -7.792  -4.742  1.00 10.00 ? 104 ARG A HB3  3  
ATOM   5935  H  HG2  . ARG A 1 104 ? 12.277  -6.593  -2.197  1.00 10.00 ? 104 ARG A HG2  3  
ATOM   5936  H  HG3  . ARG A 1 104 ? 12.775  -8.043  -3.066  1.00 10.00 ? 104 ARG A HG3  3  
ATOM   5937  H  HD2  . ARG A 1 104 ? 13.223  -6.404  -5.075  1.00 10.00 ? 104 ARG A HD2  3  
ATOM   5938  H  HD3  . ARG A 1 104 ? 13.200  -5.142  -3.855  1.00 10.00 ? 104 ARG A HD3  3  
ATOM   5939  H  HE   . ARG A 1 104 ? 14.892  -7.627  -3.700  1.00 10.00 ? 104 ARG A HE   3  
ATOM   5940  H  HH11 . ARG A 1 104 ? 14.913  -4.103  -4.127  1.00 10.00 ? 104 ARG A HH11 3  
ATOM   5941  H  HH12 . ARG A 1 104 ? 16.542  -3.852  -3.576  1.00 10.00 ? 104 ARG A HH12 3  
ATOM   5942  H  HH21 . ARG A 1 104 ? 17.015  -7.266  -2.692  1.00 10.00 ? 104 ARG A HH21 3  
ATOM   5943  H  HH22 . ARG A 1 104 ? 17.873  -5.853  -3.300  1.00 10.00 ? 104 ARG A HH22 3  
ATOM   5944  N  N    . ASP A 1 105 ? 9.722   -6.181  -6.507  1.00 10.00 ? 105 ASP A N    3  
ATOM   5945  C  CA   . ASP A 1 105 ? 9.584   -5.835  -7.911  1.00 10.00 ? 105 ASP A CA   3  
ATOM   5946  C  C    . ASP A 1 105 ? 8.132   -6.044  -8.352  1.00 10.00 ? 105 ASP A C    3  
ATOM   5947  O  O    . ASP A 1 105 ? 7.836   -6.922  -9.160  1.00 10.00 ? 105 ASP A O    3  
ATOM   5948  C  CB   . ASP A 1 105 ? 10.590  -6.652  -8.728  1.00 10.00 ? 105 ASP A CB   3  
ATOM   5949  C  CG   . ASP A 1 105 ? 10.640  -6.222  -10.184 1.00 10.00 ? 105 ASP A CG   3  
ATOM   5950  O  OD1  . ASP A 1 105 ? 10.175  -5.106  -10.494 1.00 10.00 ? 105 ASP A OD1  3  
ATOM   5951  O  OD2  . ASP A 1 105 ? 11.206  -7.022  -10.963 1.00 10.00 ? 105 ASP A OD2  3  
ATOM   5952  H  H    . ASP A 1 105 ? 9.134   -6.915  -6.143  1.00 10.00 ? 105 ASP A H    3  
ATOM   5953  H  HA   . ASP A 1 105 ? 9.811   -4.779  -8.044  1.00 10.00 ? 105 ASP A HA   3  
ATOM   5954  H  HB2  . ASP A 1 105 ? 11.587  -6.516  -8.307  1.00 10.00 ? 105 ASP A HB2  3  
ATOM   5955  H  HB3  . ASP A 1 105 ? 10.327  -7.709  -8.674  1.00 10.00 ? 105 ASP A HB3  3  
ATOM   5956  N  N    . GLY A 1 106 ? 7.207   -5.260  -7.784  1.00 10.00 ? 106 GLY A N    3  
ATOM   5957  C  CA   . GLY A 1 106 ? 5.800   -5.316  -8.136  1.00 10.00 ? 106 GLY A CA   3  
ATOM   5958  C  C    . GLY A 1 106 ? 5.088   -4.097  -7.583  1.00 10.00 ? 106 GLY A C    3  
ATOM   5959  O  O    . GLY A 1 106 ? 4.281   -4.228  -6.671  1.00 10.00 ? 106 GLY A O    3  
ATOM   5960  H  H    . GLY A 1 106 ? 7.471   -4.592  -7.069  1.00 10.00 ? 106 GLY A H    3  
ATOM   5961  H  HA2  . GLY A 1 106 ? 5.716   -5.289  -9.209  1.00 10.00 ? 106 GLY A HA2  3  
ATOM   5962  H  HA3  . GLY A 1 106 ? 5.318   -6.221  -7.774  1.00 10.00 ? 106 GLY A HA3  3  
ATOM   5963  N  N    . ASP A 1 107 ? 5.442   -2.923  -8.120  1.00 10.00 ? 107 ASP A N    3  
ATOM   5964  C  CA   . ASP A 1 107 ? 5.137   -1.610  -7.561  1.00 10.00 ? 107 ASP A CA   3  
ATOM   5965  C  C    . ASP A 1 107 ? 5.859   -1.434  -6.234  1.00 10.00 ? 107 ASP A C    3  
ATOM   5966  O  O    . ASP A 1 107 ? 6.186   -2.427  -5.608  1.00 10.00 ? 107 ASP A O    3  
ATOM   5967  C  CB   . ASP A 1 107 ? 3.624   -1.325  -7.521  1.00 10.00 ? 107 ASP A CB   3  
ATOM   5968  C  CG   . ASP A 1 107 ? 3.296   0.163   -7.493  1.00 10.00 ? 107 ASP A CG   3  
ATOM   5969  O  OD1  . ASP A 1 107 ? 4.010   0.881   -6.766  1.00 10.00 ? 107 ASP A OD1  3  
ATOM   5970  O  OD2  . ASP A 1 107 ? 2.400   0.576   -8.269  1.00 10.00 ? 107 ASP A OD2  3  
ATOM   5971  H  H    . ASP A 1 107 ? 6.139   -2.943  -8.852  1.00 10.00 ? 107 ASP A H    3  
ATOM   5972  H  HA   . ASP A 1 107 ? 5.644   -0.924  -8.221  1.00 10.00 ? 107 ASP A HA   3  
ATOM   5973  H  HB2  . ASP A 1 107 ? 3.148   -1.760  -8.395  1.00 10.00 ? 107 ASP A HB2  3  
ATOM   5974  H  HB3  . ASP A 1 107 ? 3.193   -1.794  -6.635  1.00 10.00 ? 107 ASP A HB3  3  
ATOM   5975  N  N    . HIS A 1 108 ? 6.237   -0.210  -5.876  1.00 10.00 ? 108 HIS A N    3  
ATOM   5976  C  CA   . HIS A 1 108 ? 7.030   0.147   -4.696  1.00 10.00 ? 108 HIS A CA   3  
ATOM   5977  C  C    . HIS A 1 108 ? 7.668   1.532   -4.845  1.00 10.00 ? 108 HIS A C    3  
ATOM   5978  O  O    . HIS A 1 108 ? 7.638   2.144   -5.911  1.00 10.00 ? 108 HIS A O    3  
ATOM   5979  C  CB   . HIS A 1 108 ? 8.140   -0.869  -4.353  1.00 10.00 ? 108 HIS A CB   3  
ATOM   5980  C  CG   . HIS A 1 108 ? 9.106   -1.105  -5.483  1.00 10.00 ? 108 HIS A CG   3  
ATOM   5981  N  ND1  . HIS A 1 108 ? 8.882   -1.874  -6.597  1.00 10.00 ? 108 HIS A ND1  3  
ATOM   5982  C  CD2  . HIS A 1 108 ? 10.392  -0.649  -5.548  1.00 10.00 ? 108 HIS A CD2  3  
ATOM   5983  C  CE1  . HIS A 1 108 ? 10.037  -1.931  -7.277  1.00 10.00 ? 108 HIS A CE1  3  
ATOM   5984  N  NE2  . HIS A 1 108 ? 10.985  -1.158  -6.713  1.00 10.00 ? 108 HIS A NE2  3  
ATOM   5985  H  H    . HIS A 1 108 ? 5.747   0.533   -6.380  1.00 10.00 ? 108 HIS A H    3  
ATOM   5986  H  HA   . HIS A 1 108 ? 6.326   0.158   -3.873  1.00 10.00 ? 108 HIS A HA   3  
ATOM   5987  H  HB2  . HIS A 1 108 ? 8.711   -0.511  -3.497  1.00 10.00 ? 108 HIS A HB2  3  
ATOM   5988  H  HB3  . HIS A 1 108 ? 7.730   -1.818  -4.014  1.00 10.00 ? 108 HIS A HB3  3  
ATOM   5989  H  HD1  . HIS A 1 108 ? 7.999   -2.303  -6.847  1.00 10.00 ? 108 HIS A HD1  3  
ATOM   5990  H  HD2  . HIS A 1 108 ? 10.857  -0.033  -4.795  1.00 10.00 ? 108 HIS A HD2  3  
ATOM   5991  H  HE1  . HIS A 1 108 ? 10.193  -2.538  -8.148  1.00 10.00 ? 108 HIS A HE1  3  
ATOM   5992  N  N    . VAL A 1 109 ? 8.328   1.990   -3.779  1.00 10.00 ? 109 VAL A N    3  
ATOM   5993  C  CA   . VAL A 1 109 ? 9.225   3.132   -3.794  1.00 10.00 ? 109 VAL A CA   3  
ATOM   5994  C  C    . VAL A 1 109 ? 10.596  2.601   -3.391  1.00 10.00 ? 109 VAL A C    3  
ATOM   5995  O  O    . VAL A 1 109 ? 10.686  1.929   -2.365  1.00 10.00 ? 109 VAL A O    3  
ATOM   5996  C  CB   . VAL A 1 109 ? 8.726   4.186   -2.792  1.00 10.00 ? 109 VAL A CB   3  
ATOM   5997  C  CG1  . VAL A 1 109 ? 9.681   5.383   -2.738  1.00 10.00 ? 109 VAL A CG1  3  
ATOM   5998  C  CG2  . VAL A 1 109 ? 7.315   4.665   -3.160  1.00 10.00 ? 109 VAL A CG2  3  
ATOM   5999  H  H    . VAL A 1 109 ? 8.373   1.419   -2.944  1.00 10.00 ? 109 VAL A H    3  
ATOM   6000  H  HA   . VAL A 1 109 ? 9.289   3.570   -4.789  1.00 10.00 ? 109 VAL A HA   3  
ATOM   6001  H  HB   . VAL A 1 109 ? 8.683   3.743   -1.795  1.00 10.00 ? 109 VAL A HB   3  
ATOM   6002  H  HG11 . VAL A 1 109 ? 9.282   6.121   -2.049  1.00 10.00 ? 109 VAL A HG11 3  
ATOM   6003  H  HG12 . VAL A 1 109 ? 10.666  5.079   -2.384  1.00 10.00 ? 109 VAL A HG12 3  
ATOM   6004  H  HG13 . VAL A 1 109 ? 9.782   5.836   -3.721  1.00 10.00 ? 109 VAL A HG13 3  
ATOM   6005  H  HG21 . VAL A 1 109 ? 7.299   5.028   -4.186  1.00 10.00 ? 109 VAL A HG21 3  
ATOM   6006  H  HG22 . VAL A 1 109 ? 6.600   3.848   -3.063  1.00 10.00 ? 109 VAL A HG22 3  
ATOM   6007  H  HG23 . VAL A 1 109 ? 7.009   5.469   -2.490  1.00 10.00 ? 109 VAL A HG23 3  
ATOM   6008  N  N    . MET A 1 110 ? 11.641  2.886   -4.177  1.00 10.00 ? 110 MET A N    3  
ATOM   6009  C  CA   . MET A 1 110 ? 13.018  2.641   -3.779  1.00 10.00 ? 110 MET A CA   3  
ATOM   6010  C  C    . MET A 1 110 ? 13.557  3.911   -3.134  1.00 10.00 ? 110 MET A C    3  
ATOM   6011  O  O    . MET A 1 110 ? 13.797  4.917   -3.794  1.00 10.00 ? 110 MET A O    3  
ATOM   6012  C  CB   . MET A 1 110 ? 13.898  2.173   -4.945  1.00 10.00 ? 110 MET A CB   3  
ATOM   6013  C  CG   . MET A 1 110 ? 13.334  0.873   -5.523  1.00 10.00 ? 110 MET A CG   3  
ATOM   6014  S  SD   . MET A 1 110 ? 14.373  -0.139  -6.611  1.00 10.00 ? 110 MET A SD   3  
ATOM   6015  C  CE   . MET A 1 110 ? 15.458  1.113   -7.340  1.00 10.00 ? 110 MET A CE   3  
ATOM   6016  H  H    . MET A 1 110 ? 11.502  3.519   -4.958  1.00 10.00 ? 110 MET A H    3  
ATOM   6017  H  HA   . MET A 1 110 ? 13.043  1.843   -3.041  1.00 10.00 ? 110 MET A HA   3  
ATOM   6018  H  HB2  . MET A 1 110 ? 13.939  2.942   -5.718  1.00 10.00 ? 110 MET A HB2  3  
ATOM   6019  H  HB3  . MET A 1 110 ? 14.903  1.991   -4.563  1.00 10.00 ? 110 MET A HB3  3  
ATOM   6020  H  HG2  . MET A 1 110 ? 13.063  0.213   -4.702  1.00 10.00 ? 110 MET A HG2  3  
ATOM   6021  H  HG3  . MET A 1 110 ? 12.434  1.146   -6.065  1.00 10.00 ? 110 MET A HG3  3  
ATOM   6022  H  HE1  . MET A 1 110 ? 16.148  1.467   -6.574  1.00 10.00 ? 110 MET A HE1  3  
ATOM   6023  H  HE2  . MET A 1 110 ? 16.035  0.661   -8.146  1.00 10.00 ? 110 MET A HE2  3  
ATOM   6024  H  HE3  . MET A 1 110 ? 14.891  1.960   -7.714  1.00 10.00 ? 110 MET A HE3  3  
ATOM   6025  N  N    . LEU A 1 111 ? 13.749  3.857   -1.825  1.00 10.00 ? 111 LEU A N    3  
ATOM   6026  C  CA   . LEU A 1 111 ? 14.452  4.872   -1.079  1.00 10.00 ? 111 LEU A CA   3  
ATOM   6027  C  C    . LEU A 1 111 ? 15.935  4.535   -1.194  1.00 10.00 ? 111 LEU A C    3  
ATOM   6028  O  O    . LEU A 1 111 ? 16.525  3.946   -0.296  1.00 10.00 ? 111 LEU A O    3  
ATOM   6029  C  CB   . LEU A 1 111 ? 13.922  4.903   0.358   1.00 10.00 ? 111 LEU A CB   3  
ATOM   6030  C  CG   . LEU A 1 111 ? 12.422  5.251   0.388   1.00 10.00 ? 111 LEU A CG   3  
ATOM   6031  C  CD1  . LEU A 1 111 ? 11.515  4.016   0.447   1.00 10.00 ? 111 LEU A CD1  3  
ATOM   6032  C  CD2  . LEU A 1 111 ? 12.138  6.116   1.609   1.00 10.00 ? 111 LEU A CD2  3  
ATOM   6033  H  H    . LEU A 1 111 ? 13.638  2.951   -1.392  1.00 10.00 ? 111 LEU A H    3  
ATOM   6034  H  HA   . LEU A 1 111 ? 14.293  5.855   -1.513  1.00 10.00 ? 111 LEU A HA   3  
ATOM   6035  H  HB2  . LEU A 1 111 ? 14.095  3.949   0.856   1.00 10.00 ? 111 LEU A HB2  3  
ATOM   6036  H  HB3  . LEU A 1 111 ? 14.481  5.675   0.886   1.00 10.00 ? 111 LEU A HB3  3  
ATOM   6037  H  HG   . LEU A 1 111 ? 12.158  5.842   -0.490  1.00 10.00 ? 111 LEU A HG   3  
ATOM   6038  H  HD11 . LEU A 1 111 ? 10.477  4.325   0.572   1.00 10.00 ? 111 LEU A HD11 3  
ATOM   6039  H  HD12 . LEU A 1 111 ? 11.587  3.455   -0.479  1.00 10.00 ? 111 LEU A HD12 3  
ATOM   6040  H  HD13 . LEU A 1 111 ? 11.797  3.376   1.284   1.00 10.00 ? 111 LEU A HD13 3  
ATOM   6041  H  HD21 . LEU A 1 111 ? 12.411  5.582   2.517   1.00 10.00 ? 111 LEU A HD21 3  
ATOM   6042  H  HD22 . LEU A 1 111 ? 12.720  7.032   1.514   1.00 10.00 ? 111 LEU A HD22 3  
ATOM   6043  H  HD23 . LEU A 1 111 ? 11.080  6.368   1.640   1.00 10.00 ? 111 LEU A HD23 3  
ATOM   6044  N  N    . MET A 1 112 ? 16.529  4.854   -2.342  1.00 10.00 ? 112 MET A N    3  
ATOM   6045  C  CA   . MET A 1 112 ? 17.858  4.385   -2.698  1.00 10.00 ? 112 MET A CA   3  
ATOM   6046  C  C    . MET A 1 112 ? 18.911  5.301   -2.068  1.00 10.00 ? 112 MET A C    3  
ATOM   6047  O  O    . MET A 1 112 ? 18.641  6.473   -1.805  1.00 10.00 ? 112 MET A O    3  
ATOM   6048  C  CB   . MET A 1 112 ? 17.942  4.329   -4.232  1.00 10.00 ? 112 MET A CB   3  
ATOM   6049  C  CG   . MET A 1 112 ? 19.190  3.621   -4.767  1.00 10.00 ? 112 MET A CG   3  
ATOM   6050  S  SD   . MET A 1 112 ? 19.221  3.455   -6.569  1.00 10.00 ? 112 MET A SD   3  
ATOM   6051  C  CE   . MET A 1 112 ? 20.740  2.498   -6.766  1.00 10.00 ? 112 MET A CE   3  
ATOM   6052  H  H    . MET A 1 112 ? 16.016  5.436   -3.002  1.00 10.00 ? 112 MET A H    3  
ATOM   6053  H  HA   . MET A 1 112 ? 17.984  3.375   -2.308  1.00 10.00 ? 112 MET A HA   3  
ATOM   6054  H  HB2  . MET A 1 112 ? 17.074  3.779   -4.601  1.00 10.00 ? 112 MET A HB2  3  
ATOM   6055  H  HB3  . MET A 1 112 ? 17.903  5.337   -4.643  1.00 10.00 ? 112 MET A HB3  3  
ATOM   6056  H  HG2  . MET A 1 112 ? 20.083  4.169   -4.469  1.00 10.00 ? 112 MET A HG2  3  
ATOM   6057  H  HG3  . MET A 1 112 ? 19.231  2.617   -4.354  1.00 10.00 ? 112 MET A HG3  3  
ATOM   6058  H  HE1  . MET A 1 112 ? 20.640  1.548   -6.241  1.00 10.00 ? 112 MET A HE1  3  
ATOM   6059  H  HE2  . MET A 1 112 ? 20.905  2.312   -7.826  1.00 10.00 ? 112 MET A HE2  3  
ATOM   6060  H  HE3  . MET A 1 112 ? 21.578  3.061   -6.359  1.00 10.00 ? 112 MET A HE3  3  
ATOM   6061  N  N    . GLY A 1 113 ? 20.124  4.798   -1.822  1.00 10.00 ? 113 GLY A N    3  
ATOM   6062  C  CA   . GLY A 1 113 ? 21.215  5.644   -1.372  1.00 10.00 ? 113 GLY A CA   3  
ATOM   6063  C  C    . GLY A 1 113 ? 21.191  5.806   0.142   1.00 10.00 ? 113 GLY A C    3  
ATOM   6064  O  O    . GLY A 1 113 ? 20.804  6.867   0.624   1.00 10.00 ? 113 GLY A O    3  
ATOM   6065  H  H    . GLY A 1 113 ? 20.308  3.804   -1.926  1.00 10.00 ? 113 GLY A H    3  
ATOM   6066  H  HA2  . GLY A 1 113 ? 22.161  5.231   -1.694  1.00 10.00 ? 113 GLY A HA2  3  
ATOM   6067  H  HA3  . GLY A 1 113 ? 21.136  6.631   -1.832  1.00 10.00 ? 113 GLY A HA3  3  
ATOM   6068  N  N    . LEU A 1 114 ? 21.591  4.782   0.903   1.00 10.00 ? 114 LEU A N    3  
ATOM   6069  C  CA   . LEU A 1 114 ? 21.677  4.904   2.361   1.00 10.00 ? 114 LEU A CA   3  
ATOM   6070  C  C    . LEU A 1 114 ? 22.463  6.156   2.779   1.00 10.00 ? 114 LEU A C    3  
ATOM   6071  O  O    . LEU A 1 114 ? 23.490  6.458   2.174   1.00 10.00 ? 114 LEU A O    3  
ATOM   6072  C  CB   . LEU A 1 114 ? 22.236  3.620   3.004   1.00 10.00 ? 114 LEU A CB   3  
ATOM   6073  C  CG   . LEU A 1 114 ? 23.735  3.318   2.784   1.00 10.00 ? 114 LEU A CG   3  
ATOM   6074  C  CD1  . LEU A 1 114 ? 24.633  3.937   3.866   1.00 10.00 ? 114 LEU A CD1  3  
ATOM   6075  C  CD2  . LEU A 1 114 ? 23.983  1.805   2.856   1.00 10.00 ? 114 LEU A CD2  3  
ATOM   6076  H  H    . LEU A 1 114 ? 21.819  3.902   0.458   1.00 10.00 ? 114 LEU A H    3  
ATOM   6077  H  HA   . LEU A 1 114 ? 20.655  4.998   2.724   1.00 10.00 ? 114 LEU A HA   3  
ATOM   6078  H  HB2  . LEU A 1 114 ? 22.059  3.682   4.076   1.00 10.00 ? 114 LEU A HB2  3  
ATOM   6079  H  HB3  . LEU A 1 114 ? 21.645  2.790   2.618   1.00 10.00 ? 114 LEU A HB3  3  
ATOM   6080  H  HG   . LEU A 1 114 ? 24.045  3.680   1.804   1.00 10.00 ? 114 LEU A HG   3  
ATOM   6081  H  HD11 . LEU A 1 114 ? 24.324  3.589   4.852   1.00 10.00 ? 114 LEU A HD11 3  
ATOM   6082  H  HD12 . LEU A 1 114 ? 25.667  3.635   3.698   1.00 10.00 ? 114 LEU A HD12 3  
ATOM   6083  H  HD13 . LEU A 1 114 ? 24.600  5.020   3.847   1.00 10.00 ? 114 LEU A HD13 3  
ATOM   6084  H  HD21 . LEU A 1 114 ? 25.033  1.592   2.654   1.00 10.00 ? 114 LEU A HD21 3  
ATOM   6085  H  HD22 . LEU A 1 114 ? 23.731  1.427   3.847   1.00 10.00 ? 114 LEU A HD22 3  
ATOM   6086  H  HD23 . LEU A 1 114 ? 23.381  1.279   2.120   1.00 10.00 ? 114 LEU A HD23 3  
ATOM   6087  N  N    . LYS A 1 115 ? 21.997  6.876   3.810   1.00 10.00 ? 115 LYS A N    3  
ATOM   6088  C  CA   . LYS A 1 115 ? 22.830  7.840   4.522   1.00 10.00 ? 115 LYS A CA   3  
ATOM   6089  C  C    . LYS A 1 115 ? 23.718  7.079   5.509   1.00 10.00 ? 115 LYS A C    3  
ATOM   6090  O  O    . LYS A 1 115 ? 24.939  7.171   5.429   1.00 10.00 ? 115 LYS A O    3  
ATOM   6091  C  CB   . LYS A 1 115 ? 21.997  8.912   5.256   1.00 10.00 ? 115 LYS A CB   3  
ATOM   6092  C  CG   . LYS A 1 115 ? 21.612  10.114  4.375   1.00 10.00 ? 115 LYS A CG   3  
ATOM   6093  C  CD   . LYS A 1 115 ? 20.175  10.094  3.839   1.00 10.00 ? 115 LYS A CD   3  
ATOM   6094  C  CE   . LYS A 1 115 ? 19.113  10.403  4.909   1.00 10.00 ? 115 LYS A CE   3  
ATOM   6095  N  NZ   . LYS A 1 115 ? 17.814  10.773  4.302   1.00 10.00 ? 115 LYS A NZ   3  
ATOM   6096  H  H    . LYS A 1 115 ? 21.110  6.619   4.226   1.00 10.00 ? 115 LYS A H    3  
ATOM   6097  H  HA   . LYS A 1 115 ? 23.500  8.341   3.822   1.00 10.00 ? 115 LYS A HA   3  
ATOM   6098  H  HB2  . LYS A 1 115 ? 21.125  8.477   5.740   1.00 10.00 ? 115 LYS A HB2  3  
ATOM   6099  H  HB3  . LYS A 1 115 ? 22.636  9.316   6.043   1.00 10.00 ? 115 LYS A HB3  3  
ATOM   6100  H  HG2  . LYS A 1 115 ? 21.751  11.027  4.955   1.00 10.00 ? 115 LYS A HG2  3  
ATOM   6101  H  HG3  . LYS A 1 115 ? 22.292  10.172  3.523   1.00 10.00 ? 115 LYS A HG3  3  
ATOM   6102  H  HD2  . LYS A 1 115 ? 20.127  10.855  3.056   1.00 10.00 ? 115 LYS A HD2  3  
ATOM   6103  H  HD3  . LYS A 1 115 ? 19.997  9.120   3.386   1.00 10.00 ? 115 LYS A HD3  3  
ATOM   6104  H  HE2  . LYS A 1 115 ? 18.988  9.524   5.542   1.00 10.00 ? 115 LYS A HE2  3  
ATOM   6105  H  HE3  . LYS A 1 115 ? 19.446  11.232  5.535   1.00 10.00 ? 115 LYS A HE3  3  
ATOM   6106  H  HZ1  . LYS A 1 115 ? 17.547  10.098  3.594   1.00 10.00 ? 115 LYS A HZ1  3  
ATOM   6107  H  HZ2  . LYS A 1 115 ? 17.050  10.771  4.976   1.00 10.00 ? 115 LYS A HZ2  3  
ATOM   6108  H  HZ3  . LYS A 1 115 ? 17.863  11.681  3.865   1.00 10.00 ? 115 LYS A HZ3  3  
ATOM   6109  N  N    . ARG A 1 116 ? 23.102  6.343   6.444   1.00 10.00 ? 116 ARG A N    3  
ATOM   6110  C  CA   . ARG A 1 116 ? 23.791  5.564   7.475   1.00 10.00 ? 116 ARG A CA   3  
ATOM   6111  C  C    . ARG A 1 116 ? 22.820  4.839   8.421   1.00 10.00 ? 116 ARG A C    3  
ATOM   6112  O  O    . ARG A 1 116 ? 22.914  3.619   8.544   1.00 10.00 ? 116 ARG A O    3  
ATOM   6113  C  CB   . ARG A 1 116 ? 24.813  6.407   8.273   1.00 10.00 ? 116 ARG A CB   3  
ATOM   6114  C  CG   . ARG A 1 116 ? 26.251  5.932   8.016   1.00 10.00 ? 116 ARG A CG   3  
ATOM   6115  C  CD   . ARG A 1 116 ? 27.260  6.833   8.737   1.00 10.00 ? 116 ARG A CD   3  
ATOM   6116  N  NE   . ARG A 1 116 ? 28.639  6.386   8.483   1.00 10.00 ? 116 ARG A NE   3  
ATOM   6117  C  CZ   . ARG A 1 116 ? 29.743  6.989   8.955   1.00 10.00 ? 116 ARG A CZ   3  
ATOM   6118  N  NH1  . ARG A 1 116 ? 29.629  8.076   9.725   1.00 10.00 ? 116 ARG A NH1  3  
ATOM   6119  N  NH2  . ARG A 1 116 ? 30.953  6.502   8.654   1.00 10.00 ? 116 ARG A NH2  3  
ATOM   6120  H  H    . ARG A 1 116 ? 22.094  6.290   6.406   1.00 10.00 ? 116 ARG A H    3  
ATOM   6121  H  HA   . ARG A 1 116 ? 24.340  4.782   6.949   1.00 10.00 ? 116 ARG A HA   3  
ATOM   6122  H  HB2  . ARG A 1 116 ? 24.723  7.465   8.022   1.00 10.00 ? 116 ARG A HB2  3  
ATOM   6123  H  HB3  . ARG A 1 116 ? 24.626  6.302   9.343   1.00 10.00 ? 116 ARG A HB3  3  
ATOM   6124  H  HG2  . ARG A 1 116 ? 26.353  4.906   8.375   1.00 10.00 ? 116 ARG A HG2  3  
ATOM   6125  H  HG3  . ARG A 1 116 ? 26.461  5.950   6.946   1.00 10.00 ? 116 ARG A HG3  3  
ATOM   6126  H  HD2  . ARG A 1 116 ? 27.131  7.853   8.366   1.00 10.00 ? 116 ARG A HD2  3  
ATOM   6127  H  HD3  . ARG A 1 116 ? 27.051  6.804   9.809   1.00 10.00 ? 116 ARG A HD3  3  
ATOM   6128  H  HE   . ARG A 1 116 ? 28.738  5.569   7.897   1.00 10.00 ? 116 ARG A HE   3  
ATOM   6129  H  HH11 . ARG A 1 116 ? 28.710  8.432   9.942   1.00 10.00 ? 116 ARG A HH11 3  
ATOM   6130  H  HH12 . ARG A 1 116 ? 30.436  8.555   10.098  1.00 10.00 ? 116 ARG A HH12 3  
ATOM   6131  H  HH21 . ARG A 1 116 ? 31.047  5.681   8.073   1.00 10.00 ? 116 ARG A HH21 3  
ATOM   6132  H  HH22 . ARG A 1 116 ? 31.795  6.940   8.999   1.00 10.00 ? 116 ARG A HH22 3  
ATOM   6133  N  N    . PRO A 1 117 ? 21.935  5.548   9.144   1.00 10.00 ? 117 PRO A N    3  
ATOM   6134  C  CA   . PRO A 1 117 ? 21.204  4.958   10.257  1.00 10.00 ? 117 PRO A CA   3  
ATOM   6135  C  C    . PRO A 1 117 ? 20.091  4.024   9.768   1.00 10.00 ? 117 PRO A C    3  
ATOM   6136  O  O    . PRO A 1 117 ? 18.950  4.442   9.593   1.00 10.00 ? 117 PRO A O    3  
ATOM   6137  C  CB   . PRO A 1 117 ? 20.676  6.141   11.075  1.00 10.00 ? 117 PRO A CB   3  
ATOM   6138  C  CG   . PRO A 1 117 ? 20.520  7.242   10.028  1.00 10.00 ? 117 PRO A CG   3  
ATOM   6139  C  CD   . PRO A 1 117 ? 21.692  6.984   9.083   1.00 10.00 ? 117 PRO A CD   3  
ATOM   6140  H  HA   . PRO A 1 117 ? 21.882  4.387   10.893  1.00 10.00 ? 117 PRO A HA   3  
ATOM   6141  H  HB2  . PRO A 1 117 ? 19.739  5.922   11.590  1.00 10.00 ? 117 PRO A HB2  3  
ATOM   6142  H  HB3  . PRO A 1 117 ? 21.433  6.446   11.799  1.00 10.00 ? 117 PRO A HB3  3  
ATOM   6143  H  HG2  . PRO A 1 117 ? 19.584  7.087   9.492   1.00 10.00 ? 117 PRO A HG2  3  
ATOM   6144  H  HG3  . PRO A 1 117 ? 20.541  8.241   10.465  1.00 10.00 ? 117 PRO A HG3  3  
ATOM   6145  H  HD2  . PRO A 1 117 ? 21.415  7.328   8.088   1.00 10.00 ? 117 PRO A HD2  3  
ATOM   6146  H  HD3  . PRO A 1 117 ? 22.566  7.529   9.441   1.00 10.00 ? 117 PRO A HD3  3  
ATOM   6147  N  N    . LEU A 1 118 ? 20.426  2.746   9.575   1.00 10.00 ? 118 LEU A N    3  
ATOM   6148  C  CA   . LEU A 1 118 ? 19.487  1.678   9.270   1.00 10.00 ? 118 LEU A CA   3  
ATOM   6149  C  C    . LEU A 1 118 ? 19.946  0.399   9.962   1.00 10.00 ? 118 LEU A C    3  
ATOM   6150  O  O    . LEU A 1 118 ? 21.130  0.255   10.268  1.00 10.00 ? 118 LEU A O    3  
ATOM   6151  C  CB   . LEU A 1 118 ? 19.393  1.485   7.752   1.00 10.00 ? 118 LEU A CB   3  
ATOM   6152  C  CG   . LEU A 1 118 ? 20.736  1.100   7.100   1.00 10.00 ? 118 LEU A CG   3  
ATOM   6153  C  CD1  . LEU A 1 118 ? 20.828  -0.405  6.830   1.00 10.00 ? 118 LEU A CD1  3  
ATOM   6154  C  CD2  . LEU A 1 118 ? 20.896  1.863   5.785   1.00 10.00 ? 118 LEU A CD2  3  
ATOM   6155  H  H    . LEU A 1 118 ? 21.403  2.479   9.645   1.00 10.00 ? 118 LEU A H    3  
ATOM   6156  H  HA   . LEU A 1 118 ? 18.499  1.941   9.653   1.00 10.00 ? 118 LEU A HA   3  
ATOM   6157  H  HB2  . LEU A 1 118 ? 18.636  0.732   7.527   1.00 10.00 ? 118 LEU A HB2  3  
ATOM   6158  H  HB3  . LEU A 1 118 ? 19.056  2.432   7.337   1.00 10.00 ? 118 LEU A HB3  3  
ATOM   6159  H  HG   . LEU A 1 118 ? 21.574  1.381   7.737   1.00 10.00 ? 118 LEU A HG   3  
ATOM   6160  H  HD11 . LEU A 1 118 ? 20.738  -0.969  7.757   1.00 10.00 ? 118 LEU A HD11 3  
ATOM   6161  H  HD12 . LEU A 1 118 ? 20.035  -0.703  6.150   1.00 10.00 ? 118 LEU A HD12 3  
ATOM   6162  H  HD13 . LEU A 1 118 ? 21.791  -0.638  6.376   1.00 10.00 ? 118 LEU A HD13 3  
ATOM   6163  H  HD21 . LEU A 1 118 ? 20.068  1.636   5.113   1.00 10.00 ? 118 LEU A HD21 3  
ATOM   6164  H  HD22 . LEU A 1 118 ? 20.912  2.933   5.989   1.00 10.00 ? 118 LEU A HD22 3  
ATOM   6165  H  HD23 . LEU A 1 118 ? 21.836  1.579   5.315   1.00 10.00 ? 118 LEU A HD23 3  
ATOM   6166  N  N    . LYS A 1 119 ? 19.019  -0.528  10.208  1.00 10.00 ? 119 LYS A N    3  
ATOM   6167  C  CA   . LYS A 1 119 ? 19.301  -1.814  10.816  1.00 10.00 ? 119 LYS A CA   3  
ATOM   6168  C  C    . LYS A 1 119 ? 18.072  -2.680  10.556  1.00 10.00 ? 119 LYS A C    3  
ATOM   6169  O  O    . LYS A 1 119 ? 16.963  -2.152  10.535  1.00 10.00 ? 119 LYS A O    3  
ATOM   6170  C  CB   . LYS A 1 119 ? 19.499  -1.600  12.321  1.00 10.00 ? 119 LYS A CB   3  
ATOM   6171  C  CG   . LYS A 1 119 ? 19.975  -2.852  13.080  1.00 10.00 ? 119 LYS A CG   3  
ATOM   6172  C  CD   . LYS A 1 119 ? 21.482  -2.793  13.374  1.00 10.00 ? 119 LYS A CD   3  
ATOM   6173  C  CE   . LYS A 1 119 ? 21.788  -2.140  14.733  1.00 10.00 ? 119 LYS A CE   3  
ATOM   6174  N  NZ   . LYS A 1 119 ? 21.112  -0.840  14.921  1.00 10.00 ? 119 LYS A NZ   3  
ATOM   6175  H  H    . LYS A 1 119 ? 18.038  -0.352  10.021  1.00 10.00 ? 119 LYS A H    3  
ATOM   6176  H  HA   . LYS A 1 119 ? 20.192  -2.254  10.366  1.00 10.00 ? 119 LYS A HA   3  
ATOM   6177  H  HB2  . LYS A 1 119 ? 20.196  -0.781  12.480  1.00 10.00 ? 119 LYS A HB2  3  
ATOM   6178  H  HB3  . LYS A 1 119 ? 18.536  -1.280  12.706  1.00 10.00 ? 119 LYS A HB3  3  
ATOM   6179  H  HG2  . LYS A 1 119 ? 19.419  -2.954  14.015  1.00 10.00 ? 119 LYS A HG2  3  
ATOM   6180  H  HG3  . LYS A 1 119 ? 19.763  -3.749  12.499  1.00 10.00 ? 119 LYS A HG3  3  
ATOM   6181  H  HD2  . LYS A 1 119 ? 21.866  -3.816  13.410  1.00 10.00 ? 119 LYS A HD2  3  
ATOM   6182  H  HD3  . LYS A 1 119 ? 22.002  -2.273  12.565  1.00 10.00 ? 119 LYS A HD3  3  
ATOM   6183  H  HE2  . LYS A 1 119 ? 21.457  -2.811  15.529  1.00 10.00 ? 119 LYS A HE2  3  
ATOM   6184  H  HE3  . LYS A 1 119 ? 22.867  -2.005  14.826  1.00 10.00 ? 119 LYS A HE3  3  
ATOM   6185  H  HZ1  . LYS A 1 119 ? 21.345  -0.189  14.188  1.00 10.00 ? 119 LYS A HZ1  3  
ATOM   6186  H  HZ2  . LYS A 1 119 ? 20.099  -0.965  14.919  1.00 10.00 ? 119 LYS A HZ2  3  
ATOM   6187  H  HZ3  . LYS A 1 119 ? 21.334  -0.439  15.819  1.00 10.00 ? 119 LYS A HZ3  3  
ATOM   6188  N  N    . VAL A 1 120 ? 18.243  -3.986  10.354  1.00 10.00 ? 120 VAL A N    3  
ATOM   6189  C  CA   . VAL A 1 120 ? 17.115  -4.900  10.418  1.00 10.00 ? 120 VAL A CA   3  
ATOM   6190  C  C    . VAL A 1 120 ? 16.712  -5.007  11.889  1.00 10.00 ? 120 VAL A C    3  
ATOM   6191  O  O    . VAL A 1 120 ? 17.415  -5.668  12.651  1.00 10.00 ? 120 VAL A O    3  
ATOM   6192  C  CB   . VAL A 1 120 ? 17.505  -6.273  9.840   1.00 10.00 ? 120 VAL A CB   3  
ATOM   6193  C  CG1  . VAL A 1 120 ? 16.362  -7.278  10.031  1.00 10.00 ? 120 VAL A CG1  3  
ATOM   6194  C  CG2  . VAL A 1 120 ? 17.828  -6.164  8.346   1.00 10.00 ? 120 VAL A CG2  3  
ATOM   6195  H  H    . VAL A 1 120 ? 19.172  -4.379  10.374  1.00 10.00 ? 120 VAL A H    3  
ATOM   6196  H  HA   . VAL A 1 120 ? 16.285  -4.508  9.830   1.00 10.00 ? 120 VAL A HA   3  
ATOM   6197  H  HB   . VAL A 1 120 ? 18.388  -6.651  10.359  1.00 10.00 ? 120 VAL A HB   3  
ATOM   6198  H  HG11 . VAL A 1 120 ? 16.181  -7.456  11.092  1.00 10.00 ? 120 VAL A HG11 3  
ATOM   6199  H  HG12 . VAL A 1 120 ? 15.451  -6.888  9.582   1.00 10.00 ? 120 VAL A HG12 3  
ATOM   6200  H  HG13 . VAL A 1 120 ? 16.619  -8.227  9.561   1.00 10.00 ? 120 VAL A HG13 3  
ATOM   6201  H  HG21 . VAL A 1 120 ? 18.104  -7.145  7.958   1.00 10.00 ? 120 VAL A HG21 3  
ATOM   6202  H  HG22 . VAL A 1 120 ? 16.954  -5.800  7.805   1.00 10.00 ? 120 VAL A HG22 3  
ATOM   6203  H  HG23 . VAL A 1 120 ? 18.663  -5.481  8.190   1.00 10.00 ? 120 VAL A HG23 3  
ATOM   6204  N  N    . GLY A 1 121 ? 15.602  -4.389  12.299  1.00 10.00 ? 121 GLY A N    3  
ATOM   6205  C  CA   . GLY A 1 121 ? 15.153  -4.516  13.679  1.00 10.00 ? 121 GLY A CA   3  
ATOM   6206  C  C    . GLY A 1 121 ? 14.138  -3.436  14.010  1.00 10.00 ? 121 GLY A C    3  
ATOM   6207  O  O    . GLY A 1 121 ? 12.989  -3.739  14.345  1.00 10.00 ? 121 GLY A O    3  
ATOM   6208  H  H    . GLY A 1 121 ? 15.069  -3.797  11.654  1.00 10.00 ? 121 GLY A H    3  
ATOM   6209  H  HA2  . GLY A 1 121 ? 14.723  -5.503  13.842  1.00 10.00 ? 121 GLY A HA2  3  
ATOM   6210  H  HA3  . GLY A 1 121 ? 15.998  -4.405  14.360  1.00 10.00 ? 121 GLY A HA3  3  
ATOM   6211  N  N    . GLU A 1 122 ? 14.603  -2.199  13.893  1.00 10.00 ? 122 GLU A N    3  
ATOM   6212  C  CA   . GLU A 1 122 ? 14.082  -0.972  14.404  1.00 10.00 ? 122 GLU A CA   3  
ATOM   6213  C  C    . GLU A 1 122 ? 12.826  -0.544  13.661  1.00 10.00 ? 122 GLU A C    3  
ATOM   6214  O  O    . GLU A 1 122 ? 12.306  -1.243  12.793  1.00 10.00 ? 122 GLU A O    3  
ATOM   6215  C  CB   . GLU A 1 122 ? 15.241  0.035   14.235  1.00 10.00 ? 122 GLU A CB   3  
ATOM   6216  C  CG   . GLU A 1 122 ? 16.290  -0.043  15.358  1.00 10.00 ? 122 GLU A CG   3  
ATOM   6217  C  CD   . GLU A 1 122 ? 17.417  -1.029  15.085  1.00 10.00 ? 122 GLU A CD   3  
ATOM   6218  O  OE1  . GLU A 1 122 ? 17.132  -2.094  14.500  1.00 10.00 ? 122 GLU A OE1  3  
ATOM   6219  O  OE2  . GLU A 1 122 ? 18.574  -0.690  15.419  1.00 10.00 ? 122 GLU A OE2  3  
ATOM   6220  H  H    . GLU A 1 122 ? 15.575  -2.080  13.645  1.00 10.00 ? 122 GLU A H    3  
ATOM   6221  H  HA   . GLU A 1 122 ? 13.819  -1.079  15.458  1.00 10.00 ? 122 GLU A HA   3  
ATOM   6222  H  HB2  . GLU A 1 122 ? 15.731  -0.097  13.267  1.00 10.00 ? 122 GLU A HB2  3  
ATOM   6223  H  HB3  . GLU A 1 122 ? 14.864  1.039   14.219  1.00 10.00 ? 122 GLU A HB3  3  
ATOM   6224  H  HG2  . GLU A 1 122 ? 16.750  0.941   15.455  1.00 10.00 ? 122 GLU A HG2  3  
ATOM   6225  H  HG3  . GLU A 1 122 ? 15.820  -0.288  16.311  1.00 10.00 ? 122 GLU A HG3  3  
ATOM   6226  N  N    . THR A 1 123 ? 12.382  0.651   14.022  1.00 10.00 ? 123 THR A N    3  
ATOM   6227  C  CA   . THR A 1 123 ? 11.280  1.368   13.422  1.00 10.00 ? 123 THR A CA   3  
ATOM   6228  C  C    . THR A 1 123 ? 11.755  2.801   13.209  1.00 10.00 ? 123 THR A C    3  
ATOM   6229  O  O    . THR A 1 123 ? 12.287  3.403   14.141  1.00 10.00 ? 123 THR A O    3  
ATOM   6230  C  CB   . THR A 1 123 ? 10.061  1.280   14.348  1.00 10.00 ? 123 THR A CB   3  
ATOM   6231  O  OG1  . THR A 1 123 ? 9.759   -0.079  14.600  1.00 10.00 ? 123 THR A OG1  3  
ATOM   6232  C  CG2  . THR A 1 123 ? 8.827   1.945   13.731  1.00 10.00 ? 123 THR A CG2  3  
ATOM   6233  H  H    . THR A 1 123 ? 12.926  1.137   14.718  1.00 10.00 ? 123 THR A H    3  
ATOM   6234  H  HA   . THR A 1 123 ? 11.045  0.924   12.462  1.00 10.00 ? 123 THR A HA   3  
ATOM   6235  H  HB   . THR A 1 123 ? 10.306  1.766   15.295  1.00 10.00 ? 123 THR A HB   3  
ATOM   6236  H  HG1  . THR A 1 123 ? 9.031   -0.125  15.224  1.00 10.00 ? 123 THR A HG1  3  
ATOM   6237  H  HG21 . THR A 1 123 ? 9.021   3.000   13.535  1.00 10.00 ? 123 THR A HG21 3  
ATOM   6238  H  HG22 . THR A 1 123 ? 8.566   1.448   12.797  1.00 10.00 ? 123 THR A HG22 3  
ATOM   6239  H  HG23 . THR A 1 123 ? 7.986   1.867   14.421  1.00 10.00 ? 123 THR A HG23 3  
ATOM   6240  N  N    . VAL A 1 124 ? 11.605  3.324   11.992  1.00 10.00 ? 124 VAL A N    3  
ATOM   6241  C  CA   . VAL A 1 124 ? 11.987  4.676   11.621  1.00 10.00 ? 124 VAL A CA   3  
ATOM   6242  C  C    . VAL A 1 124 ? 10.735  5.365   11.085  1.00 10.00 ? 124 VAL A C    3  
ATOM   6243  O  O    . VAL A 1 124 ? 9.938   4.747   10.381  1.00 10.00 ? 124 VAL A O    3  
ATOM   6244  C  CB   . VAL A 1 124 ? 13.123  4.623   10.582  1.00 10.00 ? 124 VAL A CB   3  
ATOM   6245  C  CG1  . VAL A 1 124 ? 13.432  6.011   10.005  1.00 10.00 ? 124 VAL A CG1  3  
ATOM   6246  C  CG2  . VAL A 1 124 ? 14.401  4.068   11.227  1.00 10.00 ? 124 VAL A CG2  3  
ATOM   6247  H  H    . VAL A 1 124 ? 11.119  2.784   11.280  1.00 10.00 ? 124 VAL A H    3  
ATOM   6248  H  HA   . VAL A 1 124 ? 12.339  5.228   12.493  1.00 10.00 ? 124 VAL A HA   3  
ATOM   6249  H  HB   . VAL A 1 124 ? 12.831  3.967   9.759   1.00 10.00 ? 124 VAL A HB   3  
ATOM   6250  H  HG11 . VAL A 1 124 ? 14.318  5.960   9.374   1.00 10.00 ? 124 VAL A HG11 3  
ATOM   6251  H  HG12 . VAL A 1 124 ? 12.600  6.361   9.394   1.00 10.00 ? 124 VAL A HG12 3  
ATOM   6252  H  HG13 . VAL A 1 124 ? 13.611  6.718   10.814  1.00 10.00 ? 124 VAL A HG13 3  
ATOM   6253  H  HG21 . VAL A 1 124 ? 14.721  4.720   12.041  1.00 10.00 ? 124 VAL A HG21 3  
ATOM   6254  H  HG22 . VAL A 1 124 ? 14.228  3.069   11.624  1.00 10.00 ? 124 VAL A HG22 3  
ATOM   6255  H  HG23 . VAL A 1 124 ? 15.198  4.013   10.485  1.00 10.00 ? 124 VAL A HG23 3  
ATOM   6256  N  N    . ASN A 1 125 ? 10.549  6.640   11.430  1.00 10.00 ? 125 ASN A N    3  
ATOM   6257  C  CA   . ASN A 1 125 ? 9.455   7.424   10.881  1.00 10.00 ? 125 ASN A CA   3  
ATOM   6258  C  C    . ASN A 1 125 ? 9.835   7.854   9.471   1.00 10.00 ? 125 ASN A C    3  
ATOM   6259  O  O    . ASN A 1 125 ? 10.878  8.477   9.278   1.00 10.00 ? 125 ASN A O    3  
ATOM   6260  C  CB   . ASN A 1 125 ? 9.145   8.645   11.759  1.00 10.00 ? 125 ASN A CB   3  
ATOM   6261  C  CG   . ASN A 1 125 ? 8.449   8.280   13.069  1.00 10.00 ? 125 ASN A CG   3  
ATOM   6262  O  OD1  . ASN A 1 125 ? 8.078   7.134   13.304  1.00 10.00 ? 125 ASN A OD1  3  
ATOM   6263  N  ND2  . ASN A 1 125 ? 8.264   9.261   13.948  1.00 10.00 ? 125 ASN A ND2  3  
ATOM   6264  H  H    . ASN A 1 125 ? 11.246  7.108   11.988  1.00 10.00 ? 125 ASN A H    3  
ATOM   6265  H  HA   . ASN A 1 125 ? 8.555   6.815   10.829  1.00 10.00 ? 125 ASN A HA   3  
ATOM   6266  H  HB2  . ASN A 1 125 ? 10.068  9.187   11.969  1.00 10.00 ? 125 ASN A HB2  3  
ATOM   6267  H  HB3  . ASN A 1 125 ? 8.475   9.304   11.206  1.00 10.00 ? 125 ASN A HB3  3  
ATOM   6268  H  HD21 . ASN A 1 125 ? 8.576   10.198  13.747  1.00 10.00 ? 125 ASN A HD21 3  
ATOM   6269  H  HD22 . ASN A 1 125 ? 7.803   9.040   14.817  1.00 10.00 ? 125 ASN A HD22 3  
ATOM   6270  N  N    . ILE A 1 126 ? 8.974   7.558   8.499   1.00 10.00 ? 126 ILE A N    3  
ATOM   6271  C  CA   . ILE A 1 126 ? 9.098   8.080   7.149   1.00 10.00 ? 126 ILE A CA   3  
ATOM   6272  C  C    . ILE A 1 126 ? 8.530   9.502   7.186   1.00 10.00 ? 126 ILE A C    3  
ATOM   6273  O  O    . ILE A 1 126 ? 8.054   9.963   8.228   1.00 10.00 ? 126 ILE A O    3  
ATOM   6274  C  CB   . ILE A 1 126 ? 8.330   7.138   6.189   1.00 10.00 ? 126 ILE A CB   3  
ATOM   6275  C  CG1  . ILE A 1 126 ? 8.897   7.142   4.760   1.00 10.00 ? 126 ILE A CG1  3  
ATOM   6276  C  CG2  . ILE A 1 126 ? 6.825   7.439   6.152   1.00 10.00 ? 126 ILE A CG2  3  
ATOM   6277  C  CD1  . ILE A 1 126 ? 8.333   5.993   3.920   1.00 10.00 ? 126 ILE A CD1  3  
ATOM   6278  H  H    . ILE A 1 126 ? 8.113   7.081   8.744   1.00 10.00 ? 126 ILE A H    3  
ATOM   6279  H  HA   . ILE A 1 126 ? 10.152  8.111   6.867   1.00 10.00 ? 126 ILE A HA   3  
ATOM   6280  H  HB   . ILE A 1 126 ? 8.459   6.124   6.572   1.00 10.00 ? 126 ILE A HB   3  
ATOM   6281  H  HG12 . ILE A 1 126 ? 8.676   8.083   4.258   1.00 10.00 ? 126 ILE A HG12 3  
ATOM   6282  H  HG13 . ILE A 1 126 ? 9.974   7.003   4.806   1.00 10.00 ? 126 ILE A HG13 3  
ATOM   6283  H  HG21 . ILE A 1 126 ? 6.463   7.650   7.153   1.00 10.00 ? 126 ILE A HG21 3  
ATOM   6284  H  HG22 . ILE A 1 126 ? 6.616   8.301   5.517   1.00 10.00 ? 126 ILE A HG22 3  
ATOM   6285  H  HG23 . ILE A 1 126 ? 6.284   6.578   5.762   1.00 10.00 ? 126 ILE A HG23 3  
ATOM   6286  H  HD11 . ILE A 1 126 ? 8.523   5.043   4.421   1.00 10.00 ? 126 ILE A HD11 3  
ATOM   6287  H  HD12 . ILE A 1 126 ? 7.261   6.120   3.767   1.00 10.00 ? 126 ILE A HD12 3  
ATOM   6288  H  HD13 . ILE A 1 126 ? 8.832   5.985   2.951   1.00 10.00 ? 126 ILE A HD13 3  
ATOM   6289  N  N    . THR A 1 127 ? 8.541   10.219  6.066   1.00 10.00 ? 127 THR A N    3  
ATOM   6290  C  CA   . THR A 1 127 ? 7.781   11.441  5.939   1.00 10.00 ? 127 THR A CA   3  
ATOM   6291  C  C    . THR A 1 127 ? 7.258   11.548  4.516   1.00 10.00 ? 127 THR A C    3  
ATOM   6292  O  O    . THR A 1 127 ? 8.023   11.683  3.561   1.00 10.00 ? 127 THR A O    3  
ATOM   6293  C  CB   . THR A 1 127 ? 8.565   12.679  6.387   1.00 10.00 ? 127 THR A CB   3  
ATOM   6294  O  OG1  . THR A 1 127 ? 9.174   12.448  7.642   1.00 10.00 ? 127 THR A OG1  3  
ATOM   6295  C  CG2  . THR A 1 127 ? 7.599   13.864  6.520   1.00 10.00 ? 127 THR A CG2  3  
ATOM   6296  H  H    . THR A 1 127 ? 8.989   9.859   5.230   1.00 10.00 ? 127 THR A H    3  
ATOM   6297  H  HA   . THR A 1 127 ? 6.934   11.346  6.609   1.00 10.00 ? 127 THR A HA   3  
ATOM   6298  H  HB   . THR A 1 127 ? 9.339   12.917  5.657   1.00 10.00 ? 127 THR A HB   3  
ATOM   6299  H  HG1  . THR A 1 127 ? 8.703   11.728  8.084   1.00 10.00 ? 127 THR A HG1  3  
ATOM   6300  H  HG21 . THR A 1 127 ? 6.818   13.635  7.248   1.00 10.00 ? 127 THR A HG21 3  
ATOM   6301  H  HG22 . THR A 1 127 ? 8.145   14.747  6.851   1.00 10.00 ? 127 THR A HG22 3  
ATOM   6302  H  HG23 . THR A 1 127 ? 7.120   14.079  5.565   1.00 10.00 ? 127 THR A HG23 3  
ATOM   6303  N  N    . LEU A 1 128 ? 5.939   11.482  4.390   1.00 10.00 ? 128 LEU A N    3  
ATOM   6304  C  CA   . LEU A 1 128 ? 5.239   11.766  3.159   1.00 10.00 ? 128 LEU A CA   3  
ATOM   6305  C  C    . LEU A 1 128 ? 5.058   13.276  3.107   1.00 10.00 ? 128 LEU A C    3  
ATOM   6306  O  O    . LEU A 1 128 ? 4.788   13.887  4.141   1.00 10.00 ? 128 LEU A O    3  
ATOM   6307  C  CB   . LEU A 1 128 ? 3.879   11.050  3.190   1.00 10.00 ? 128 LEU A CB   3  
ATOM   6308  C  CG   . LEU A 1 128 ? 3.618   10.149  1.982   1.00 10.00 ? 128 LEU A CG   3  
ATOM   6309  C  CD1  . LEU A 1 128 ? 3.561   10.978  0.694   1.00 10.00 ? 128 LEU A CD1  3  
ATOM   6310  C  CD2  . LEU A 1 128 ? 4.605   8.978   1.900   1.00 10.00 ? 128 LEU A CD2  3  
ATOM   6311  H  H    . LEU A 1 128 ? 5.387   11.478  5.241   1.00 10.00 ? 128 LEU A H    3  
ATOM   6312  H  HA   . LEU A 1 128 ? 5.844   11.440  2.314   1.00 10.00 ? 128 LEU A HA   3  
ATOM   6313  H  HB2  . LEU A 1 128 ? 3.814   10.428  4.082   1.00 10.00 ? 128 LEU A HB2  3  
ATOM   6314  H  HB3  . LEU A 1 128 ? 3.076   11.786  3.247   1.00 10.00 ? 128 LEU A HB3  3  
ATOM   6315  H  HG   . LEU A 1 128 ? 2.640   9.703   2.143   1.00 10.00 ? 128 LEU A HG   3  
ATOM   6316  H  HD11 . LEU A 1 128 ? 3.322   10.330  -0.145  1.00 10.00 ? 128 LEU A HD11 3  
ATOM   6317  H  HD12 . LEU A 1 128 ? 2.789   11.743  0.787   1.00 10.00 ? 128 LEU A HD12 3  
ATOM   6318  H  HD13 . LEU A 1 128 ? 4.513   11.462  0.492   1.00 10.00 ? 128 LEU A HD13 3  
ATOM   6319  H  HD21 . LEU A 1 128 ? 4.535   8.378   2.808   1.00 10.00 ? 128 LEU A HD21 3  
ATOM   6320  H  HD22 . LEU A 1 128 ? 4.355   8.349   1.045   1.00 10.00 ? 128 LEU A HD22 3  
ATOM   6321  H  HD23 . LEU A 1 128 ? 5.630   9.324   1.792   1.00 10.00 ? 128 LEU A HD23 3  
ATOM   6322  N  N    . LYS A 1 129 ? 5.207   13.871  1.923   1.00 10.00 ? 129 LYS A N    3  
ATOM   6323  C  CA   . LYS A 1 129 ? 4.928   15.278  1.690   1.00 10.00 ? 129 LYS A CA   3  
ATOM   6324  C  C    . LYS A 1 129 ? 4.412   15.403  0.259   1.00 10.00 ? 129 LYS A C    3  
ATOM   6325  O  O    . LYS A 1 129 ? 5.183   15.618  -0.670  1.00 10.00 ? 129 LYS A O    3  
ATOM   6326  C  CB   . LYS A 1 129 ? 6.171   16.133  1.983   1.00 10.00 ? 129 LYS A CB   3  
ATOM   6327  C  CG   . LYS A 1 129 ? 5.816   17.581  2.351   1.00 10.00 ? 129 LYS A CG   3  
ATOM   6328  C  CD   . LYS A 1 129 ? 5.062   18.326  1.236   1.00 10.00 ? 129 LYS A CD   3  
ATOM   6329  C  CE   . LYS A 1 129 ? 4.777   19.792  1.590   1.00 10.00 ? 129 LYS A CE   3  
ATOM   6330  N  NZ   . LYS A 1 129 ? 6.008   20.594  1.741   1.00 10.00 ? 129 LYS A NZ   3  
ATOM   6331  H  H    . LYS A 1 129 ? 5.442   13.307  1.119   1.00 10.00 ? 129 LYS A H    3  
ATOM   6332  H  HA   . LYS A 1 129 ? 4.145   15.588  2.372   1.00 10.00 ? 129 LYS A HA   3  
ATOM   6333  H  HB2  . LYS A 1 129 ? 6.686   15.709  2.847   1.00 10.00 ? 129 LYS A HB2  3  
ATOM   6334  H  HB3  . LYS A 1 129 ? 6.864   16.112  1.141   1.00 10.00 ? 129 LYS A HB3  3  
ATOM   6335  H  HG2  . LYS A 1 129 ? 5.198   17.566  3.252   1.00 10.00 ? 129 LYS A HG2  3  
ATOM   6336  H  HG3  . LYS A 1 129 ? 6.754   18.082  2.585   1.00 10.00 ? 129 LYS A HG3  3  
ATOM   6337  H  HD2  . LYS A 1 129 ? 5.617   18.254  0.297   1.00 10.00 ? 129 LYS A HD2  3  
ATOM   6338  H  HD3  . LYS A 1 129 ? 4.086   17.858  1.090   1.00 10.00 ? 129 LYS A HD3  3  
ATOM   6339  H  HE2  . LYS A 1 129 ? 4.170   20.225  0.791   1.00 10.00 ? 129 LYS A HE2  3  
ATOM   6340  H  HE3  . LYS A 1 129 ? 4.197   19.829  2.515   1.00 10.00 ? 129 LYS A HE3  3  
ATOM   6341  H  HZ1  . LYS A 1 129 ? 6.560   20.547  0.896   1.00 10.00 ? 129 LYS A HZ1  3  
ATOM   6342  H  HZ2  . LYS A 1 129 ? 5.766   21.559  1.921   1.00 10.00 ? 129 LYS A HZ2  3  
ATOM   6343  H  HZ3  . LYS A 1 129 ? 6.556   20.248  2.516   1.00 10.00 ? 129 LYS A HZ3  3  
ATOM   6344  N  N    . ALA A 1 130 ? 3.105   15.224  0.076   1.00 10.00 ? 130 ALA A N    3  
ATOM   6345  C  CA   . ALA A 1 130 ? 2.516   15.088  -1.247  1.00 10.00 ? 130 ALA A CA   3  
ATOM   6346  C  C    . ALA A 1 130 ? 2.245   16.458  -1.867  1.00 10.00 ? 130 ALA A C    3  
ATOM   6347  O  O    . ALA A 1 130 ? 1.841   17.389  -1.169  1.00 10.00 ? 130 ALA A O    3  
ATOM   6348  C  CB   . ALA A 1 130 ? 1.224   14.274  -1.145  1.00 10.00 ? 130 ALA A CB   3  
ATOM   6349  H  H    . ALA A 1 130 ? 2.504   15.218  0.892   1.00 10.00 ? 130 ALA A H    3  
ATOM   6350  H  HA   . ALA A 1 130 ? 3.207   14.534  -1.886  1.00 10.00 ? 130 ALA A HA   3  
ATOM   6351  H  HB1  . ALA A 1 130 ? 0.514   14.782  -0.493  1.00 10.00 ? 130 ALA A HB1  3  
ATOM   6352  H  HB2  . ALA A 1 130 ? 0.781   14.159  -2.135  1.00 10.00 ? 130 ALA A HB2  3  
ATOM   6353  H  HB3  . ALA A 1 130 ? 1.442   13.286  -0.738  1.00 10.00 ? 130 ALA A HB3  3  
ATOM   6354  N  N    . THR A 1 131 ? 2.393   16.552  -3.195  1.00 10.00 ? 131 THR A N    3  
ATOM   6355  C  CA   . THR A 1 131 ? 2.029   17.728  -3.991  1.00 10.00 ? 131 THR A CA   3  
ATOM   6356  C  C    . THR A 1 131 ? 0.558   18.103  -3.792  1.00 10.00 ? 131 THR A C    3  
ATOM   6357  O  O    . THR A 1 131 ? 0.162   19.254  -3.957  1.00 10.00 ? 131 THR A O    3  
ATOM   6358  C  CB   . THR A 1 131 ? 2.386   17.478  -5.470  1.00 10.00 ? 131 THR A CB   3  
ATOM   6359  O  OG1  . THR A 1 131 ? 2.469   18.699  -6.171  1.00 10.00 ? 131 THR A OG1  3  
ATOM   6360  C  CG2  . THR A 1 131 ? 1.366   16.580  -6.181  1.00 10.00 ? 131 THR A CG2  3  
ATOM   6361  H  H    . THR A 1 131 ? 2.743   15.745  -3.688  1.00 10.00 ? 131 THR A H    3  
ATOM   6362  H  HA   . THR A 1 131 ? 2.604   18.575  -3.629  1.00 10.00 ? 131 THR A HA   3  
ATOM   6363  H  HB   . THR A 1 131 ? 3.371   17.009  -5.513  1.00 10.00 ? 131 THR A HB   3  
ATOM   6364  H  HG1  . THR A 1 131 ? 2.888   18.548  -7.023  1.00 10.00 ? 131 THR A HG1  3  
ATOM   6365  H  HG21 . THR A 1 131 ? 1.761   16.258  -7.145  1.00 10.00 ? 131 THR A HG21 3  
ATOM   6366  H  HG22 . THR A 1 131 ? 1.134   15.702  -5.581  1.00 10.00 ? 131 THR A HG22 3  
ATOM   6367  H  HG23 . THR A 1 131 ? 0.449   17.140  -6.355  1.00 10.00 ? 131 THR A HG23 3  
ATOM   6368  N  N    . ASP A 1 132 ? -0.249  17.114  -3.405  1.00 10.00 ? 132 ASP A N    3  
ATOM   6369  C  CA   . ASP A 1 132 ? -1.622  17.287  -2.980  1.00 10.00 ? 132 ASP A CA   3  
ATOM   6370  C  C    . ASP A 1 132 ? -1.785  18.335  -1.868  1.00 10.00 ? 132 ASP A C    3  
ATOM   6371  O  O    . ASP A 1 132 ? -2.835  18.964  -1.764  1.00 10.00 ? 132 ASP A O    3  
ATOM   6372  C  CB   . ASP A 1 132 ? -2.131  15.909  -2.556  1.00 10.00 ? 132 ASP A CB   3  
ATOM   6373  C  CG   . ASP A 1 132 ? -3.576  15.967  -2.111  1.00 10.00 ? 132 ASP A CG   3  
ATOM   6374  O  OD1  . ASP A 1 132 ? -4.444  16.049  -3.003  1.00 10.00 ? 132 ASP A OD1  3  
ATOM   6375  O  OD2  . ASP A 1 132 ? -3.783  15.903  -0.881  1.00 10.00 ? 132 ASP A OD2  3  
ATOM   6376  H  H    . ASP A 1 132 ? 0.139   16.189  -3.318  1.00 10.00 ? 132 ASP A H    3  
ATOM   6377  H  HA   . ASP A 1 132 ? -2.182  17.656  -3.833  1.00 10.00 ? 132 ASP A HA   3  
ATOM   6378  H  HB2  . ASP A 1 132 ? -2.061  15.207  -3.384  1.00 10.00 ? 132 ASP A HB2  3  
ATOM   6379  H  HB3  . ASP A 1 132 ? -1.534  15.538  -1.724  1.00 10.00 ? 132 ASP A HB3  3  
ATOM   6380  N  N    . GLY A 1 133 ? -0.740  18.549  -1.065  1.00 10.00 ? 133 GLY A N    3  
ATOM   6381  C  CA   . GLY A 1 133 ? -0.717  19.571  -0.031  1.00 10.00 ? 133 GLY A CA   3  
ATOM   6382  C  C    . GLY A 1 133 ? -1.009  18.940  1.322   1.00 10.00 ? 133 GLY A C    3  
ATOM   6383  O  O    . GLY A 1 133 ? -1.880  19.400  2.058   1.00 10.00 ? 133 GLY A O    3  
ATOM   6384  H  H    . GLY A 1 133 ? 0.106   18.013  -1.210  1.00 10.00 ? 133 GLY A H    3  
ATOM   6385  H  HA2  . GLY A 1 133 ? 0.278   20.014  -0.005  1.00 10.00 ? 133 GLY A HA2  3  
ATOM   6386  H  HA3  . GLY A 1 133 ? -1.439  20.363  -0.235  1.00 10.00 ? 133 GLY A HA3  3  
ATOM   6387  N  N    . ARG A 1 134 ? -0.258  17.889  1.655   1.00 10.00 ? 134 ARG A N    3  
ATOM   6388  C  CA   . ARG A 1 134 ? -0.281  17.251  2.959   1.00 10.00 ? 134 ARG A CA   3  
ATOM   6389  C  C    . ARG A 1 134 ? 1.132   16.782  3.286   1.00 10.00 ? 134 ARG A C    3  
ATOM   6390  O  O    . ARG A 1 134 ? 1.954   16.613  2.383   1.00 10.00 ? 134 ARG A O    3  
ATOM   6391  C  CB   . ARG A 1 134 ? -1.257  16.061  2.980   1.00 10.00 ? 134 ARG A CB   3  
ATOM   6392  C  CG   . ARG A 1 134 ? -2.704  16.455  3.318   1.00 10.00 ? 134 ARG A CG   3  
ATOM   6393  C  CD   . ARG A 1 134 ? -3.638  16.458  2.103   1.00 10.00 ? 134 ARG A CD   3  
ATOM   6394  N  NE   . ARG A 1 134 ? -5.025  16.701  2.531   1.00 10.00 ? 134 ARG A NE   3  
ATOM   6395  C  CZ   . ARG A 1 134 ? -6.120  16.551  1.766   1.00 10.00 ? 134 ARG A CZ   3  
ATOM   6396  N  NH1  . ARG A 1 134 ? -6.012  16.249  0.472   1.00 10.00 ? 134 ARG A NH1  3  
ATOM   6397  N  NH2  . ARG A 1 134 ? -7.332  16.699  2.314   1.00 10.00 ? 134 ARG A NH2  3  
ATOM   6398  H  H    . ARG A 1 134 ? 0.477   17.590  1.025   1.00 10.00 ? 134 ARG A H    3  
ATOM   6399  H  HA   . ARG A 1 134 ? -0.556  17.980  3.724   1.00 10.00 ? 134 ARG A HA   3  
ATOM   6400  H  HB2  . ARG A 1 134 ? -1.207  15.514  2.038   1.00 10.00 ? 134 ARG A HB2  3  
ATOM   6401  H  HB3  . ARG A 1 134 ? -0.935  15.380  3.770   1.00 10.00 ? 134 ARG A HB3  3  
ATOM   6402  H  HG2  . ARG A 1 134 ? -3.085  15.715  4.025   1.00 10.00 ? 134 ARG A HG2  3  
ATOM   6403  H  HG3  . ARG A 1 134 ? -2.730  17.430  3.806   1.00 10.00 ? 134 ARG A HG3  3  
ATOM   6404  H  HD2  . ARG A 1 134 ? -3.328  17.231  1.396   1.00 10.00 ? 134 ARG A HD2  3  
ATOM   6405  H  HD3  . ARG A 1 134 ? -3.572  15.487  1.608   1.00 10.00 ? 134 ARG A HD3  3  
ATOM   6406  H  HE   . ARG A 1 134 ? -5.139  16.986  3.493   1.00 10.00 ? 134 ARG A HE   3  
ATOM   6407  H  HH11 . ARG A 1 134 ? -5.083  16.158  0.048   1.00 10.00 ? 134 ARG A HH11 3  
ATOM   6408  H  HH12 . ARG A 1 134 ? -6.799  16.138  -0.145  1.00 10.00 ? 134 ARG A HH12 3  
ATOM   6409  H  HH21 . ARG A 1 134 ? -7.431  16.916  3.294   1.00 10.00 ? 134 ARG A HH21 3  
ATOM   6410  H  HH22 . ARG A 1 134 ? -8.166  16.579  1.759   1.00 10.00 ? 134 ARG A HH22 3  
ATOM   6411  N  N    . THR A 1 135 ? 1.369   16.552  4.578   1.00 10.00 ? 135 THR A N    3  
ATOM   6412  C  CA   . THR A 1 135 ? 2.580   16.017  5.165   1.00 10.00 ? 135 THR A CA   3  
ATOM   6413  C  C    . THR A 1 135 ? 2.108   14.908  6.104   1.00 10.00 ? 135 THR A C    3  
ATOM   6414  O  O    . THR A 1 135 ? 1.037   15.052  6.694   1.00 10.00 ? 135 THR A O    3  
ATOM   6415  C  CB   . THR A 1 135 ? 3.323   17.124  5.930   1.00 10.00 ? 135 THR A CB   3  
ATOM   6416  O  OG1  . THR A 1 135 ? 3.531   18.246  5.091   1.00 10.00 ? 135 THR A OG1  3  
ATOM   6417  C  CG2  . THR A 1 135 ? 4.684   16.642  6.444   1.00 10.00 ? 135 THR A CG2  3  
ATOM   6418  H  H    . THR A 1 135 ? 0.591   16.575  5.222   1.00 10.00 ? 135 THR A H    3  
ATOM   6419  H  HA   . THR A 1 135 ? 3.212   15.622  4.380   1.00 10.00 ? 135 THR A HA   3  
ATOM   6420  H  HB   . THR A 1 135 ? 2.712   17.435  6.781   1.00 10.00 ? 135 THR A HB   3  
ATOM   6421  H  HG1  . THR A 1 135 ? 3.762   18.996  5.645   1.00 10.00 ? 135 THR A HG1  3  
ATOM   6422  H  HG21 . THR A 1 135 ? 4.555   15.827  7.156   1.00 10.00 ? 135 THR A HG21 3  
ATOM   6423  H  HG22 . THR A 1 135 ? 5.295   16.293  5.611   1.00 10.00 ? 135 THR A HG22 3  
ATOM   6424  H  HG23 . THR A 1 135 ? 5.201   17.460  6.946   1.00 10.00 ? 135 THR A HG23 3  
ATOM   6425  N  N    . LEU A 1 136 ? 2.853   13.808  6.223   1.00 10.00 ? 136 LEU A N    3  
ATOM   6426  C  CA   . LEU A 1 136 ? 2.467   12.672  7.053   1.00 10.00 ? 136 LEU A CA   3  
ATOM   6427  C  C    . LEU A 1 136 ? 3.739   11.970  7.516   1.00 10.00 ? 136 LEU A C    3  
ATOM   6428  O  O    . LEU A 1 136 ? 4.760   12.098  6.849   1.00 10.00 ? 136 LEU A O    3  
ATOM   6429  C  CB   . LEU A 1 136 ? 1.583   11.742  6.219   1.00 10.00 ? 136 LEU A CB   3  
ATOM   6430  C  CG   . LEU A 1 136 ? 0.892   10.619  7.009   1.00 10.00 ? 136 LEU A CG   3  
ATOM   6431  C  CD1  . LEU A 1 136 ? -0.122  11.165  8.022   1.00 10.00 ? 136 LEU A CD1  3  
ATOM   6432  C  CD2  . LEU A 1 136 ? 0.169   9.697   6.022   1.00 10.00 ? 136 LEU A CD2  3  
ATOM   6433  H  H    . LEU A 1 136 ? 3.725   13.731  5.702   1.00 10.00 ? 136 LEU A H    3  
ATOM   6434  H  HA   . LEU A 1 136 ? 1.929   13.040  7.927   1.00 10.00 ? 136 LEU A HA   3  
ATOM   6435  H  HB2  . LEU A 1 136 ? 0.818   12.335  5.718   1.00 10.00 ? 136 LEU A HB2  3  
ATOM   6436  H  HB3  . LEU A 1 136 ? 2.228   11.303  5.460   1.00 10.00 ? 136 LEU A HB3  3  
ATOM   6437  H  HG   . LEU A 1 136 ? 1.632   10.026  7.543   1.00 10.00 ? 136 LEU A HG   3  
ATOM   6438  H  HD11 . LEU A 1 136 ? -0.669  10.336  8.474   1.00 10.00 ? 136 LEU A HD11 3  
ATOM   6439  H  HD12 . LEU A 1 136 ? 0.382   11.710  8.819   1.00 10.00 ? 136 LEU A HD12 3  
ATOM   6440  H  HD13 . LEU A 1 136 ? -0.831  11.827  7.524   1.00 10.00 ? 136 LEU A HD13 3  
ATOM   6441  H  HD21 . LEU A 1 136 ? -0.309  8.877   6.558   1.00 10.00 ? 136 LEU A HD21 3  
ATOM   6442  H  HD22 . LEU A 1 136 ? -0.591  10.261  5.479   1.00 10.00 ? 136 LEU A HD22 3  
ATOM   6443  H  HD23 . LEU A 1 136 ? 0.882   9.280   5.309   1.00 10.00 ? 136 LEU A HD23 3  
ATOM   6444  N  N    . ASN A 1 137 ? 3.694   11.264  8.648   1.00 10.00 ? 137 ASN A N    3  
ATOM   6445  C  CA   . ASN A 1 137 ? 4.849   10.854  9.437   1.00 10.00 ? 137 ASN A CA   3  
ATOM   6446  C  C    . ASN A 1 137 ? 4.665   9.414   9.909   1.00 10.00 ? 137 ASN A C    3  
ATOM   6447  O  O    . ASN A 1 137 ? 4.587   9.140   11.104  1.00 10.00 ? 137 ASN A O    3  
ATOM   6448  C  CB   . ASN A 1 137 ? 5.001   11.808  10.632  1.00 10.00 ? 137 ASN A CB   3  
ATOM   6449  C  CG   . ASN A 1 137 ? 3.778   11.832  11.557  1.00 10.00 ? 137 ASN A CG   3  
ATOM   6450  O  OD1  . ASN A 1 137 ? 2.648   11.619  11.122  1.00 10.00 ? 137 ASN A OD1  3  
ATOM   6451  N  ND2  . ASN A 1 137 ? 3.984   12.118  12.840  1.00 10.00 ? 137 ASN A ND2  3  
ATOM   6452  H  H    . ASN A 1 137 ? 2.809   11.147  9.127   1.00 10.00 ? 137 ASN A H    3  
ATOM   6453  H  HA   . ASN A 1 137 ? 5.759   10.907  8.840   1.00 10.00 ? 137 ASN A HA   3  
ATOM   6454  H  HB2  . ASN A 1 137 ? 5.878   11.504  11.201  1.00 10.00 ? 137 ASN A HB2  3  
ATOM   6455  H  HB3  . ASN A 1 137 ? 5.166   12.814  10.253  1.00 10.00 ? 137 ASN A HB3  3  
ATOM   6456  H  HD21 . ASN A 1 137 ? 4.916   12.280  13.187  1.00 10.00 ? 137 ASN A HD21 3  
ATOM   6457  H  HD22 . ASN A 1 137 ? 3.189   12.129  13.460  1.00 10.00 ? 137 ASN A HD22 3  
ATOM   6458  N  N    . VAL A 1 138 ? 4.582   8.482   8.964   1.00 10.00 ? 138 VAL A N    3  
ATOM   6459  C  CA   . VAL A 1 138 ? 4.179   7.118   9.265   1.00 10.00 ? 138 VAL A CA   3  
ATOM   6460  C  C    . VAL A 1 138 ? 5.380   6.346   9.825   1.00 10.00 ? 138 VAL A C    3  
ATOM   6461  O  O    . VAL A 1 138 ? 6.503   6.509   9.350   1.00 10.00 ? 138 VAL A O    3  
ATOM   6462  C  CB   . VAL A 1 138 ? 3.633   6.453   7.988   1.00 10.00 ? 138 VAL A CB   3  
ATOM   6463  C  CG1  . VAL A 1 138 ? 3.091   5.044   8.268   1.00 10.00 ? 138 VAL A CG1  3  
ATOM   6464  C  CG2  . VAL A 1 138 ? 2.537   7.284   7.311   1.00 10.00 ? 138 VAL A CG2  3  
ATOM   6465  H  H    . VAL A 1 138 ? 4.714   8.749   8.001   1.00 10.00 ? 138 VAL A H    3  
ATOM   6466  H  HA   . VAL A 1 138 ? 3.383   7.160   10.011  1.00 10.00 ? 138 VAL A HA   3  
ATOM   6467  H  HB   . VAL A 1 138 ? 4.448   6.383   7.274   1.00 10.00 ? 138 VAL A HB   3  
ATOM   6468  H  HG11 . VAL A 1 138 ? 3.887   4.390   8.622   1.00 10.00 ? 138 VAL A HG11 3  
ATOM   6469  H  HG12 . VAL A 1 138 ? 2.301   5.090   9.018   1.00 10.00 ? 138 VAL A HG12 3  
ATOM   6470  H  HG13 . VAL A 1 138 ? 2.685   4.614   7.352   1.00 10.00 ? 138 VAL A HG13 3  
ATOM   6471  H  HG21 . VAL A 1 138 ? 1.736   7.500   8.018   1.00 10.00 ? 138 VAL A HG21 3  
ATOM   6472  H  HG22 . VAL A 1 138 ? 2.958   8.214   6.929   1.00 10.00 ? 138 VAL A HG22 3  
ATOM   6473  H  HG23 . VAL A 1 138 ? 2.132   6.733   6.462   1.00 10.00 ? 138 VAL A HG23 3  
ATOM   6474  N  N    . ALA A 1 139 ? 5.149   5.490   10.823  1.00 10.00 ? 139 ALA A N    3  
ATOM   6475  C  CA   . ALA A 1 139 ? 6.190   4.661   11.412  1.00 10.00 ? 139 ALA A CA   3  
ATOM   6476  C  C    . ALA A 1 139 ? 6.382   3.420   10.539  1.00 10.00 ? 139 ALA A C    3  
ATOM   6477  O  O    . ALA A 1 139 ? 5.412   2.712   10.271  1.00 10.00 ? 139 ALA A O    3  
ATOM   6478  C  CB   . ALA A 1 139 ? 5.784   4.278   12.837  1.00 10.00 ? 139 ALA A CB   3  
ATOM   6479  H  H    . ALA A 1 139 ? 4.206   5.369   11.156  1.00 10.00 ? 139 ALA A H    3  
ATOM   6480  H  HA   . ALA A 1 139 ? 7.124   5.217   11.476  1.00 10.00 ? 139 ALA A HA   3  
ATOM   6481  H  HB1  . ALA A 1 139 ? 4.846   3.722   12.826  1.00 10.00 ? 139 ALA A HB1  3  
ATOM   6482  H  HB2  . ALA A 1 139 ? 6.561   3.657   13.283  1.00 10.00 ? 139 ALA A HB2  3  
ATOM   6483  H  HB3  . ALA A 1 139 ? 5.664   5.180   13.439  1.00 10.00 ? 139 ALA A HB3  3  
ATOM   6484  N  N    . ALA A 1 140 ? 7.613   3.171   10.080  1.00 10.00 ? 140 ALA A N    3  
ATOM   6485  C  CA   . ALA A 1 140 ? 7.948   2.053   9.210   1.00 10.00 ? 140 ALA A CA   3  
ATOM   6486  C  C    . ALA A 1 140 ? 8.983   1.157   9.888   1.00 10.00 ? 140 ALA A C    3  
ATOM   6487  O  O    . ALA A 1 140 ? 9.997   1.647   10.381  1.00 10.00 ? 140 ALA A O    3  
ATOM   6488  C  CB   . ALA A 1 140 ? 8.494   2.588   7.888   1.00 10.00 ? 140 ALA A CB   3  
ATOM   6489  H  H    . ALA A 1 140 ? 8.377   3.795   10.323  1.00 10.00 ? 140 ALA A H    3  
ATOM   6490  H  HA   . ALA A 1 140 ? 7.053   1.472   8.991   1.00 10.00 ? 140 ALA A HA   3  
ATOM   6491  H  HB1  . ALA A 1 140 ? 7.781   3.280   7.440   1.00 10.00 ? 140 ALA A HB1  3  
ATOM   6492  H  HB2  . ALA A 1 140 ? 9.443   3.101   8.053   1.00 10.00 ? 140 ALA A HB2  3  
ATOM   6493  H  HB3  . ALA A 1 140 ? 8.650   1.747   7.216   1.00 10.00 ? 140 ALA A HB3  3  
ATOM   6494  N  N    . THR A 1 141 ? 8.736   -0.152  9.914   1.00 10.00 ? 141 THR A N    3  
ATOM   6495  C  CA   . THR A 1 141 ? 9.595   -1.125  10.580  1.00 10.00 ? 141 THR A CA   3  
ATOM   6496  C  C    . THR A 1 141 ? 10.722  -1.509  9.625   1.00 10.00 ? 141 THR A C    3  
ATOM   6497  O  O    . THR A 1 141 ? 10.465  -1.899  8.490   1.00 10.00 ? 141 THR A O    3  
ATOM   6498  C  CB   . THR A 1 141 ? 8.748   -2.341  10.979  1.00 10.00 ? 141 THR A CB   3  
ATOM   6499  O  OG1  . THR A 1 141 ? 7.459   -1.926  11.389  1.00 10.00 ? 141 THR A OG1  3  
ATOM   6500  C  CG2  . THR A 1 141 ? 9.415   -3.078  12.141  1.00 10.00 ? 141 THR A CG2  3  
ATOM   6501  H  H    . THR A 1 141 ? 7.906   -0.502  9.444   1.00 10.00 ? 141 THR A H    3  
ATOM   6502  H  HA   . THR A 1 141 ? 10.038  -0.707  11.486  1.00 10.00 ? 141 THR A HA   3  
ATOM   6503  H  HB   . THR A 1 141 ? 8.643   -3.007  10.121  1.00 10.00 ? 141 THR A HB   3  
ATOM   6504  H  HG1  . THR A 1 141 ? 6.917   -2.697  11.572  1.00 10.00 ? 141 THR A HG1  3  
ATOM   6505  H  HG21 . THR A 1 141 ? 9.383   -2.454  13.036  1.00 10.00 ? 141 THR A HG21 3  
ATOM   6506  H  HG22 . THR A 1 141 ? 8.889   -4.013  12.337  1.00 10.00 ? 141 THR A HG22 3  
ATOM   6507  H  HG23 . THR A 1 141 ? 10.457  -3.270  11.893  1.00 10.00 ? 141 THR A HG23 3  
ATOM   6508  N  N    . VAL A 1 142 ? 11.979  -1.406  10.048  1.00 10.00 ? 142 VAL A N    3  
ATOM   6509  C  CA   . VAL A 1 142 ? 13.097  -1.637  9.165   1.00 10.00 ? 142 VAL A CA   3  
ATOM   6510  C  C    . VAL A 1 142 ? 13.383  -3.141  9.206   1.00 10.00 ? 142 VAL A C    3  
ATOM   6511  O  O    . VAL A 1 142 ? 13.917  -3.648  10.193  1.00 10.00 ? 142 VAL A O    3  
ATOM   6512  C  CB   . VAL A 1 142 ? 14.276  -0.742  9.569   1.00 10.00 ? 142 VAL A CB   3  
ATOM   6513  C  CG1  . VAL A 1 142 ? 15.303  -0.766  8.435   1.00 10.00 ? 142 VAL A CG1  3  
ATOM   6514  C  CG2  . VAL A 1 142 ? 13.842  0.714   9.790   1.00 10.00 ? 142 VAL A CG2  3  
ATOM   6515  H  H    . VAL A 1 142 ? 12.194  -1.229  11.022  1.00 10.00 ? 142 VAL A H    3  
ATOM   6516  H  HA   . VAL A 1 142 ? 12.811  -1.333  8.161   1.00 10.00 ? 142 VAL A HA   3  
ATOM   6517  H  HB   . VAL A 1 142 ? 14.715  -1.110  10.495  1.00 10.00 ? 142 VAL A HB   3  
ATOM   6518  H  HG11 . VAL A 1 142 ? 15.558  -1.801  8.215   1.00 10.00 ? 142 VAL A HG11 3  
ATOM   6519  H  HG12 . VAL A 1 142 ? 14.889  -0.307  7.537   1.00 10.00 ? 142 VAL A HG12 3  
ATOM   6520  H  HG13 . VAL A 1 142 ? 16.197  -0.219  8.733   1.00 10.00 ? 142 VAL A HG13 3  
ATOM   6521  H  HG21 . VAL A 1 142 ? 13.209  0.798   10.673  1.00 10.00 ? 142 VAL A HG21 3  
ATOM   6522  H  HG22 . VAL A 1 142 ? 14.725  1.334   9.941   1.00 10.00 ? 142 VAL A HG22 3  
ATOM   6523  H  HG23 . VAL A 1 142 ? 13.295  1.082   8.921   1.00 10.00 ? 142 VAL A HG23 3  
ATOM   6524  N  N    . LYS A 1 143 ? 12.923  -3.868  8.184   1.00 10.00 ? 143 LYS A N    3  
ATOM   6525  C  CA   . LYS A 1 143 ? 12.906  -5.321  8.097   1.00 10.00 ? 143 LYS A CA   3  
ATOM   6526  C  C    . LYS A 1 143 ? 13.119  -5.715  6.632   1.00 10.00 ? 143 LYS A C    3  
ATOM   6527  O  O    . LYS A 1 143 ? 12.339  -5.305  5.778   1.00 10.00 ? 143 LYS A O    3  
ATOM   6528  C  CB   . LYS A 1 143 ? 11.541  -5.864  8.571   1.00 10.00 ? 143 LYS A CB   3  
ATOM   6529  C  CG   . LYS A 1 143 ? 11.263  -5.693  10.072  1.00 10.00 ? 143 LYS A CG   3  
ATOM   6530  C  CD   . LYS A 1 143 ? 11.996  -6.749  10.919  1.00 10.00 ? 143 LYS A CD   3  
ATOM   6531  C  CE   . LYS A 1 143 ? 12.567  -6.157  12.213  1.00 10.00 ? 143 LYS A CE   3  
ATOM   6532  N  NZ   . LYS A 1 143 ? 11.543  -5.642  13.147  1.00 10.00 ? 143 LYS A NZ   3  
ATOM   6533  H  H    . LYS A 1 143 ? 12.592  -3.362  7.367   1.00 10.00 ? 143 LYS A H    3  
ATOM   6534  H  HA   . LYS A 1 143 ? 13.712  -5.727  8.706   1.00 10.00 ? 143 LYS A HA   3  
ATOM   6535  H  HB2  . LYS A 1 143 ? 10.761  -5.334  8.021   1.00 10.00 ? 143 LYS A HB2  3  
ATOM   6536  H  HB3  . LYS A 1 143 ? 11.464  -6.923  8.319   1.00 10.00 ? 143 LYS A HB3  3  
ATOM   6537  H  HG2  . LYS A 1 143 ? 11.546  -4.684  10.362  1.00 10.00 ? 143 LYS A HG2  3  
ATOM   6538  H  HG3  . LYS A 1 143 ? 10.188  -5.802  10.233  1.00 10.00 ? 143 LYS A HG3  3  
ATOM   6539  H  HD2  . LYS A 1 143 ? 11.331  -7.590  11.130  1.00 10.00 ? 143 LYS A HD2  3  
ATOM   6540  H  HD3  . LYS A 1 143 ? 12.842  -7.138  10.351  1.00 10.00 ? 143 LYS A HD3  3  
ATOM   6541  H  HE2  . LYS A 1 143 ? 13.170  -6.913  12.721  1.00 10.00 ? 143 LYS A HE2  3  
ATOM   6542  H  HE3  . LYS A 1 143 ? 13.216  -5.333  11.929  1.00 10.00 ? 143 LYS A HE3  3  
ATOM   6543  H  HZ1  . LYS A 1 143 ? 11.073  -6.395  13.628  1.00 10.00 ? 143 LYS A HZ1  3  
ATOM   6544  H  HZ2  . LYS A 1 143 ? 11.999  -5.036  13.831  1.00 10.00 ? 143 LYS A HZ2  3  
ATOM   6545  H  HZ3  . LYS A 1 143 ? 10.869  -5.078  12.656  1.00 10.00 ? 143 LYS A HZ3  3  
ATOM   6546  N  N    . LYS A 1 144 ? 14.149  -6.522  6.344   1.00 10.00 ? 144 LYS A N    3  
ATOM   6547  C  CA   . LYS A 1 144 ? 14.377  -7.103  5.020   1.00 10.00 ? 144 LYS A CA   3  
ATOM   6548  C  C    . LYS A 1 144 ? 13.144  -7.884  4.562   1.00 10.00 ? 144 LYS A C    3  
ATOM   6549  O  O    . LYS A 1 144 ? 12.681  -7.714  3.437   1.00 10.00 ? 144 LYS A O    3  
ATOM   6550  C  CB   . LYS A 1 144 ? 15.606  -8.027  5.061   1.00 10.00 ? 144 LYS A CB   3  
ATOM   6551  C  CG   . LYS A 1 144 ? 16.236  -8.155  3.664   1.00 10.00 ? 144 LYS A CG   3  
ATOM   6552  C  CD   . LYS A 1 144 ? 17.318  -7.082  3.463   1.00 10.00 ? 144 LYS A CD   3  
ATOM   6553  C  CE   . LYS A 1 144 ? 18.666  -7.609  3.982   1.00 10.00 ? 144 LYS A CE   3  
ATOM   6554  N  NZ   . LYS A 1 144 ? 19.678  -6.543  4.124   1.00 10.00 ? 144 LYS A NZ   3  
ATOM   6555  H  H    . LYS A 1 144 ? 14.765  -6.804  7.091   1.00 10.00 ? 144 LYS A H    3  
ATOM   6556  H  HA   . LYS A 1 144 ? 14.570  -6.335  4.270   1.00 10.00 ? 144 LYS A HA   3  
ATOM   6557  H  HB2  . LYS A 1 144 ? 16.345  -7.636  5.759   1.00 10.00 ? 144 LYS A HB2  3  
ATOM   6558  H  HB3  . LYS A 1 144 ? 15.305  -9.015  5.415   1.00 10.00 ? 144 LYS A HB3  3  
ATOM   6559  H  HG2  . LYS A 1 144 ? 16.675  -9.147  3.540   1.00 10.00 ? 144 LYS A HG2  3  
ATOM   6560  H  HG3  . LYS A 1 144 ? 15.466  -8.055  2.894   1.00 10.00 ? 144 LYS A HG3  3  
ATOM   6561  H  HD2  . LYS A 1 144 ? 17.405  -6.857  2.399   1.00 10.00 ? 144 LYS A HD2  3  
ATOM   6562  H  HD3  . LYS A 1 144 ? 17.019  -6.167  3.974   1.00 10.00 ? 144 LYS A HD3  3  
ATOM   6563  H  HE2  . LYS A 1 144 ? 18.518  -8.062  4.963   1.00 10.00 ? 144 LYS A HE2  3  
ATOM   6564  H  HE3  . LYS A 1 144 ? 19.036  -8.376  3.297   1.00 10.00 ? 144 LYS A HE3  3  
ATOM   6565  H  HZ1  . LYS A 1 144 ? 20.490  -6.869  4.624   1.00 10.00 ? 144 LYS A HZ1  3  
ATOM   6566  H  HZ2  . LYS A 1 144 ? 19.993  -6.158  3.238   1.00 10.00 ? 144 LYS A HZ2  3  
ATOM   6567  H  HZ3  . LYS A 1 144 ? 19.280  -5.743  4.610   1.00 10.00 ? 144 LYS A HZ3  3  
ATOM   6568  N  N    . ASN A 1 145 ? 12.659  -8.773  5.437   1.00 10.00 ? 145 ASN A N    3  
ATOM   6569  C  CA   . ASN A 1 145 ? 11.804  -9.886  5.044   1.00 10.00 ? 145 ASN A CA   3  
ATOM   6570  C  C    . ASN A 1 145 ? 12.578  -10.801 4.088   1.00 10.00 ? 145 ASN A C    3  
ATOM   6571  O  O    . ASN A 1 145 ? 13.786  -10.636 3.915   1.00 10.00 ? 145 ASN A O    3  
ATOM   6572  C  CB   . ASN A 1 145 ? 10.474  -9.377  4.465   1.00 10.00 ? 145 ASN A CB   3  
ATOM   6573  C  CG   . ASN A 1 145 ? 9.351   -10.357 4.776   1.00 10.00 ? 145 ASN A CG   3  
ATOM   6574  O  OD1  . ASN A 1 145 ? 9.190   -11.363 4.096   1.00 10.00 ? 145 ASN A OD1  3  
ATOM   6575  N  ND2  . ASN A 1 145 ? 8.597   -10.102 5.841   1.00 10.00 ? 145 ASN A ND2  3  
ATOM   6576  H  H    . ASN A 1 145 ? 13.128  -8.846  6.325   1.00 10.00 ? 145 ASN A H    3  
ATOM   6577  H  HA   . ASN A 1 145 ? 11.587  -10.480 5.930   1.00 10.00 ? 145 ASN A HA   3  
ATOM   6578  H  HB2  . ASN A 1 145 ? 10.223  -8.410  4.904   1.00 10.00 ? 145 ASN A HB2  3  
ATOM   6579  H  HB3  . ASN A 1 145 ? 10.556  -9.250  3.384   1.00 10.00 ? 145 ASN A HB3  3  
ATOM   6580  H  HD21 . ASN A 1 145 ? 8.767   -9.279  6.397   1.00 10.00 ? 145 ASN A HD21 3  
ATOM   6581  H  HD22 . ASN A 1 145 ? 7.856   -10.747 6.069   1.00 10.00 ? 145 ASN A HD22 3  
ATOM   6582  N  N    . ILE A 1 146 ? 11.911  -11.782 3.483   1.00 10.00 ? 146 ILE A N    3  
ATOM   6583  C  CA   . ILE A 1 146 ? 12.528  -12.524 2.393   1.00 10.00 ? 146 ILE A CA   3  
ATOM   6584  C  C    . ILE A 1 146 ? 12.703  -11.581 1.198   1.00 10.00 ? 146 ILE A C    3  
ATOM   6585  O  O    . ILE A 1 146 ? 11.872  -10.702 0.972   1.00 10.00 ? 146 ILE A O    3  
ATOM   6586  C  CB   . ILE A 1 146 ? 11.739  -13.803 2.050   1.00 10.00 ? 146 ILE A CB   3  
ATOM   6587  C  CG1  . ILE A 1 146 ? 10.347  -13.514 1.458   1.00 10.00 ? 146 ILE A CG1  3  
ATOM   6588  C  CG2  . ILE A 1 146 ? 11.648  -14.698 3.296   1.00 10.00 ? 146 ILE A CG2  3  
ATOM   6589  C  CD1  . ILE A 1 146 ? 9.607   -14.791 1.048   1.00 10.00 ? 146 ILE A CD1  3  
ATOM   6590  H  H    . ILE A 1 146 ? 10.918  -11.878 3.649   1.00 10.00 ? 146 ILE A H    3  
ATOM   6591  H  HA   . ILE A 1 146 ? 13.520  -12.840 2.719   1.00 10.00 ? 146 ILE A HA   3  
ATOM   6592  H  HB   . ILE A 1 146 ? 12.317  -14.342 1.297   1.00 10.00 ? 146 ILE A HB   3  
ATOM   6593  H  HG12 . ILE A 1 146 ? 9.734   -12.972 2.176   1.00 10.00 ? 146 ILE A HG12 3  
ATOM   6594  H  HG13 . ILE A 1 146 ? 10.455  -12.903 0.561   1.00 10.00 ? 146 ILE A HG13 3  
ATOM   6595  H  HG21 . ILE A 1 146 ? 10.958  -14.269 4.023   1.00 10.00 ? 146 ILE A HG21 3  
ATOM   6596  H  HG22 . ILE A 1 146 ? 11.304  -15.694 3.021   1.00 10.00 ? 146 ILE A HG22 3  
ATOM   6597  H  HG23 . ILE A 1 146 ? 12.633  -14.796 3.754   1.00 10.00 ? 146 ILE A HG23 3  
ATOM   6598  H  HD11 . ILE A 1 146 ? 8.695   -14.519 0.516   1.00 10.00 ? 146 ILE A HD11 3  
ATOM   6599  H  HD12 . ILE A 1 146 ? 10.235  -15.392 0.390   1.00 10.00 ? 146 ILE A HD12 3  
ATOM   6600  H  HD13 . ILE A 1 146 ? 9.333   -15.374 1.926   1.00 10.00 ? 146 ILE A HD13 3  
ATOM   6601  N  N    . GLU A 1 147 ? 13.785  -11.763 0.443   1.00 10.00 ? 147 GLU A N    3  
ATOM   6602  C  CA   . GLU A 1 147 ? 14.068  -11.055 -0.792  1.00 10.00 ? 147 GLU A CA   3  
ATOM   6603  C  C    . GLU A 1 147 ? 14.872  -12.026 -1.668  1.00 10.00 ? 147 GLU A C    3  
ATOM   6604  O  O    . GLU A 1 147 ? 15.147  -13.141 -1.217  1.00 10.00 ? 147 GLU A O    3  
ATOM   6605  C  CB   . GLU A 1 147 ? 14.817  -9.745  -0.486  1.00 10.00 ? 147 GLU A CB   3  
ATOM   6606  C  CG   . GLU A 1 147 ? 16.241  -9.973  0.055   1.00 10.00 ? 147 GLU A CG   3  
ATOM   6607  C  CD   . GLU A 1 147 ? 17.152  -8.800  -0.261  1.00 10.00 ? 147 GLU A CD   3  
ATOM   6608  O  OE1  . GLU A 1 147 ? 17.084  -8.326  -1.420  1.00 10.00 ? 147 GLU A OE1  3  
ATOM   6609  O  OE2  . GLU A 1 147 ? 17.913  -8.406  0.649   1.00 10.00 ? 147 GLU A OE2  3  
ATOM   6610  H  H    . GLU A 1 147 ? 14.412  -12.534 0.632   1.00 10.00 ? 147 GLU A H    3  
ATOM   6611  H  HA   . GLU A 1 147 ? 13.134  -10.821 -1.305  1.00 10.00 ? 147 GLU A HA   3  
ATOM   6612  H  HB2  . GLU A 1 147 ? 14.860  -9.193  -1.427  1.00 10.00 ? 147 GLU A HB2  3  
ATOM   6613  H  HB3  . GLU A 1 147 ? 14.278  -9.129  0.247   1.00 10.00 ? 147 GLU A HB3  3  
ATOM   6614  H  HG2  . GLU A 1 147 ? 16.198  -10.133 1.132   1.00 10.00 ? 147 GLU A HG2  3  
ATOM   6615  H  HG3  . GLU A 1 147 ? 16.716  -10.839 -0.400  1.00 10.00 ? 147 GLU A HG3  3  
ATOM   6616  N  N    . GLY A 1 148 ? 15.282  -11.626 -2.875  1.00 10.00 ? 148 GLY A N    3  
ATOM   6617  C  CA   . GLY A 1 148 ? 16.140  -12.459 -3.718  1.00 10.00 ? 148 GLY A CA   3  
ATOM   6618  C  C    . GLY A 1 148 ? 15.782  -12.245 -5.181  1.00 10.00 ? 148 GLY A C    3  
ATOM   6619  O  O    . GLY A 1 148 ? 15.428  -13.189 -5.885  1.00 10.00 ? 148 GLY A O    3  
ATOM   6620  H  H    . GLY A 1 148 ? 15.021  -10.697 -3.220  1.00 10.00 ? 148 GLY A H    3  
ATOM   6621  H  HA2  . GLY A 1 148 ? 17.182  -12.180 -3.556  1.00 10.00 ? 148 GLY A HA2  3  
ATOM   6622  H  HA3  . GLY A 1 148 ? 16.019  -13.519 -3.487  1.00 10.00 ? 148 GLY A HA3  3  
ATOM   6623  N  N    . ARG A 1 149 ? 15.847  -10.978 -5.586  1.00 10.00 ? 149 ARG A N    3  
ATOM   6624  C  CA   . ARG A 1 149 ? 14.879  -10.275 -6.412  1.00 10.00 ? 149 ARG A CA   3  
ATOM   6625  C  C    . ARG A 1 149 ? 14.221  -9.324  -5.410  1.00 10.00 ? 149 ARG A C    3  
ATOM   6626  O  O    . ARG A 1 149 ? 14.740  -9.256  -4.262  1.00 10.00 ? 149 ARG A O    3  
ATOM   6627  C  CB   . ARG A 1 149 ? 13.882  -11.209 -7.136  1.00 10.00 ? 149 ARG A CB   3  
ATOM   6628  C  CG   . ARG A 1 149 ? 12.854  -10.532 -8.060  1.00 10.00 ? 149 ARG A CG   3  
ATOM   6629  C  CD   . ARG A 1 149 ? 13.502  -9.582  -9.078  1.00 10.00 ? 149 ARG A CD   3  
ATOM   6630  N  NE   . ARG A 1 149 ? 12.559  -9.164  -10.132 1.00 10.00 ? 149 ARG A NE   3  
ATOM   6631  C  CZ   . ARG A 1 149 ? 12.149  -9.906  -11.169 1.00 10.00 ? 149 ARG A CZ   3  
ATOM   6632  N  NH1  . ARG A 1 149 ? 12.564  -11.171 -11.297 1.00 10.00 ? 149 ARG A NH1  3  
ATOM   6633  N  NH2  . ARG A 1 149 ? 11.326  -9.365  -12.069 1.00 10.00 ? 149 ARG A NH2  3  
ATOM   6634  O  OXT  . ARG A 1 149 ? 13.240  -8.663  -5.797  1.00 10.00 ? 149 ARG A OXT  3  
ATOM   6635  H  H    . ARG A 1 149 ? 16.129  -10.337 -4.849  1.00 10.00 ? 149 ARG A H    3  
ATOM   6636  H  HA   . ARG A 1 149 ? 15.432  -9.687  -7.143  1.00 10.00 ? 149 ARG A HA   3  
ATOM   6637  H  HB2  . ARG A 1 149 ? 14.453  -11.900 -7.757  1.00 10.00 ? 149 ARG A HB2  3  
ATOM   6638  H  HB3  . ARG A 1 149 ? 13.323  -11.779 -6.393  1.00 10.00 ? 149 ARG A HB3  3  
ATOM   6639  H  HG2  . ARG A 1 149 ? 12.313  -11.327 -8.572  1.00 10.00 ? 149 ARG A HG2  3  
ATOM   6640  H  HG3  . ARG A 1 149 ? 12.123  -9.979  -7.469  1.00 10.00 ? 149 ARG A HG3  3  
ATOM   6641  H  HD2  . ARG A 1 149 ? 13.813  -8.683  -8.540  1.00 10.00 ? 149 ARG A HD2  3  
ATOM   6642  H  HD3  . ARG A 1 149 ? 14.390  -10.035 -9.521  1.00 10.00 ? 149 ARG A HD3  3  
ATOM   6643  H  HE   . ARG A 1 149 ? 12.197  -8.205  -10.114 1.00 10.00 ? 149 ARG A HE   3  
ATOM   6644  H  HH11 . ARG A 1 149 ? 13.172  -11.550 -10.587 1.00 10.00 ? 149 ARG A HH11 3  
ATOM   6645  H  HH12 . ARG A 1 149 ? 12.269  -11.753 -12.066 1.00 10.00 ? 149 ARG A HH12 3  
ATOM   6646  H  HH21 . ARG A 1 149 ? 11.075  -8.382  -11.894 1.00 10.00 ? 149 ARG A HH21 3  
ATOM   6647  H  HH22 . ARG A 1 149 ? 10.955  -9.848  -12.869 1.00 10.00 ? 149 ARG A HH22 3  
HETATM 6648  CU CU   . CU1 B 2 .   ? 12.490  -0.610  -8.135  1.00 10.00 ? 150 CU1 A CU   3  
ATOM   6649  N  N    . MET A 1 1   ? -33.597 -46.562 29.442  1.00 10.00 ? 1   MET A N    4  
ATOM   6650  C  CA   . MET A 1 1   ? -34.172 -45.210 29.336  1.00 10.00 ? 1   MET A CA   4  
ATOM   6651  C  C    . MET A 1 1   ? -33.211 -44.367 28.505  1.00 10.00 ? 1   MET A C    4  
ATOM   6652  O  O    . MET A 1 1   ? -32.081 -44.805 28.302  1.00 10.00 ? 1   MET A O    4  
ATOM   6653  C  CB   . MET A 1 1   ? -34.403 -44.575 30.718  1.00 10.00 ? 1   MET A CB   4  
ATOM   6654  C  CG   . MET A 1 1   ? -35.437 -45.348 31.548  1.00 10.00 ? 1   MET A CG   4  
ATOM   6655  S  SD   . MET A 1 1   ? -34.877 -46.955 32.165  1.00 10.00 ? 1   MET A SD   4  
ATOM   6656  C  CE   . MET A 1 1   ? -36.454 -47.667 32.686  1.00 10.00 ? 1   MET A CE   4  
ATOM   6657  H  H1   . MET A 1 1   ? -32.618 -46.435 29.667  1.00 10.00 ? 1   MET A H1   4  
ATOM   6658  H  H2   . MET A 1 1   ? -34.073 -47.103 30.154  1.00 10.00 ? 1   MET A H2   4  
ATOM   6659  H  H3   . MET A 1 1   ? -33.646 -47.019 28.544  1.00 10.00 ? 1   MET A H3   4  
ATOM   6660  H  HA   . MET A 1 1   ? -35.128 -45.275 28.814  1.00 10.00 ? 1   MET A HA   4  
ATOM   6661  H  HB2  . MET A 1 1   ? -33.463 -44.521 31.269  1.00 10.00 ? 1   MET A HB2  4  
ATOM   6662  H  HB3  . MET A 1 1   ? -34.779 -43.560 30.578  1.00 10.00 ? 1   MET A HB3  4  
ATOM   6663  H  HG2  . MET A 1 1   ? -35.716 -44.747 32.415  1.00 10.00 ? 1   MET A HG2  4  
ATOM   6664  H  HG3  . MET A 1 1   ? -36.329 -45.499 30.940  1.00 10.00 ? 1   MET A HG3  4  
ATOM   6665  H  HE1  . MET A 1 1   ? -36.902 -47.033 33.450  1.00 10.00 ? 1   MET A HE1  4  
ATOM   6666  H  HE2  . MET A 1 1   ? -37.125 -47.743 31.831  1.00 10.00 ? 1   MET A HE2  4  
ATOM   6667  H  HE3  . MET A 1 1   ? -36.277 -48.660 33.097  1.00 10.00 ? 1   MET A HE3  4  
ATOM   6668  N  N    . GLY A 1 2   ? -33.650 -43.203 28.029  1.00 10.00 ? 2   GLY A N    4  
ATOM   6669  C  CA   . GLY A 1 2   ? -32.864 -42.303 27.204  1.00 10.00 ? 2   GLY A CA   4  
ATOM   6670  C  C    . GLY A 1 2   ? -33.770 -41.143 26.805  1.00 10.00 ? 2   GLY A C    4  
ATOM   6671  O  O    . GLY A 1 2   ? -34.930 -41.116 27.215  1.00 10.00 ? 2   GLY A O    4  
ATOM   6672  H  H    . GLY A 1 2   ? -34.592 -42.877 28.216  1.00 10.00 ? 2   GLY A H    4  
ATOM   6673  H  HA2  . GLY A 1 2   ? -32.011 -41.928 27.770  1.00 10.00 ? 2   GLY A HA2  4  
ATOM   6674  H  HA3  . GLY A 1 2   ? -32.515 -42.823 26.310  1.00 10.00 ? 2   GLY A HA3  4  
ATOM   6675  N  N    . HIS A 1 3   ? -33.254 -40.199 26.016  1.00 10.00 ? 3   HIS A N    4  
ATOM   6676  C  CA   . HIS A 1 3   ? -33.999 -39.053 25.520  1.00 10.00 ? 3   HIS A CA   4  
ATOM   6677  C  C    . HIS A 1 3   ? -33.255 -38.512 24.299  1.00 10.00 ? 3   HIS A C    4  
ATOM   6678  O  O    . HIS A 1 3   ? -32.099 -38.875 24.076  1.00 10.00 ? 3   HIS A O    4  
ATOM   6679  C  CB   . HIS A 1 3   ? -34.122 -37.993 26.625  1.00 10.00 ? 3   HIS A CB   4  
ATOM   6680  C  CG   . HIS A 1 3   ? -34.918 -36.787 26.202  1.00 10.00 ? 3   HIS A CG   4  
ATOM   6681  N  ND1  . HIS A 1 3   ? -34.370 -35.572 25.795  1.00 10.00 ? 3   HIS A ND1  4  
ATOM   6682  C  CD2  . HIS A 1 3   ? -36.269 -36.765 26.009  1.00 10.00 ? 3   HIS A CD2  4  
ATOM   6683  C  CE1  . HIS A 1 3   ? -35.411 -34.829 25.390  1.00 10.00 ? 3   HIS A CE1  4  
ATOM   6684  N  NE2  . HIS A 1 3   ? -36.560 -35.520 25.501  1.00 10.00 ? 3   HIS A NE2  4  
ATOM   6685  H  H    . HIS A 1 3   ? -32.306 -40.276 25.667  1.00 10.00 ? 3   HIS A H    4  
ATOM   6686  H  HA   . HIS A 1 3   ? -34.995 -39.377 25.211  1.00 10.00 ? 3   HIS A HA   4  
ATOM   6687  H  HB2  . HIS A 1 3   ? -34.609 -38.429 27.497  1.00 10.00 ? 3   HIS A HB2  4  
ATOM   6688  H  HB3  . HIS A 1 3   ? -33.123 -37.665 26.918  1.00 10.00 ? 3   HIS A HB3  4  
ATOM   6689  H  HD2  . HIS A 1 3   ? -36.962 -37.575 26.184  1.00 10.00 ? 3   HIS A HD2  4  
ATOM   6690  H  HE1  . HIS A 1 3   ? -35.335 -33.825 25.001  1.00 10.00 ? 3   HIS A HE1  4  
ATOM   6691  H  HE2  . HIS A 1 3   ? -37.473 -35.185 25.229  1.00 10.00 ? 3   HIS A HE2  4  
ATOM   6692  N  N    . THR A 1 4   ? -33.907 -37.674 23.493  1.00 10.00 ? 4   THR A N    4  
ATOM   6693  C  CA   . THR A 1 4   ? -33.299 -36.956 22.387  1.00 10.00 ? 4   THR A CA   4  
ATOM   6694  C  C    . THR A 1 4   ? -34.120 -35.680 22.203  1.00 10.00 ? 4   THR A C    4  
ATOM   6695  O  O    . THR A 1 4   ? -35.323 -35.692 22.466  1.00 10.00 ? 4   THR A O    4  
ATOM   6696  C  CB   . THR A 1 4   ? -33.289 -37.833 21.123  1.00 10.00 ? 4   THR A CB   4  
ATOM   6697  O  OG1  . THR A 1 4   ? -32.708 -39.093 21.398  1.00 10.00 ? 4   THR A OG1  4  
ATOM   6698  C  CG2  . THR A 1 4   ? -32.493 -37.187 19.984  1.00 10.00 ? 4   THR A CG2  4  
ATOM   6699  H  H    . THR A 1 4   ? -34.848 -37.378 23.724  1.00 10.00 ? 4   THR A H    4  
ATOM   6700  H  HA   . THR A 1 4   ? -32.276 -36.686 22.657  1.00 10.00 ? 4   THR A HA   4  
ATOM   6701  H  HB   . THR A 1 4   ? -34.315 -37.995 20.787  1.00 10.00 ? 4   THR A HB   4  
ATOM   6702  H  HG1  . THR A 1 4   ? -32.195 -39.030 22.214  1.00 10.00 ? 4   THR A HG1  4  
ATOM   6703  H  HG21 . THR A 1 4   ? -32.965 -36.260 19.660  1.00 10.00 ? 4   THR A HG21 4  
ATOM   6704  H  HG22 . THR A 1 4   ? -31.473 -36.981 20.309  1.00 10.00 ? 4   THR A HG22 4  
ATOM   6705  H  HG23 . THR A 1 4   ? -32.460 -37.872 19.137  1.00 10.00 ? 4   THR A HG23 4  
ATOM   6706  N  N    . MET A 1 5   ? -33.471 -34.591 21.788  1.00 10.00 ? 5   MET A N    4  
ATOM   6707  C  CA   . MET A 1 5   ? -34.068 -33.278 21.595  1.00 10.00 ? 5   MET A CA   4  
ATOM   6708  C  C    . MET A 1 5   ? -33.876 -32.865 20.131  1.00 10.00 ? 5   MET A C    4  
ATOM   6709  O  O    . MET A 1 5   ? -32.916 -33.318 19.505  1.00 10.00 ? 5   MET A O    4  
ATOM   6710  C  CB   . MET A 1 5   ? -33.437 -32.266 22.571  1.00 10.00 ? 5   MET A CB   4  
ATOM   6711  C  CG   . MET A 1 5   ? -31.906 -32.146 22.487  1.00 10.00 ? 5   MET A CG   4  
ATOM   6712  S  SD   . MET A 1 5   ? -30.955 -33.470 23.284  1.00 10.00 ? 5   MET A SD   4  
ATOM   6713  C  CE   . MET A 1 5   ? -29.278 -32.946 22.870  1.00 10.00 ? 5   MET A CE   4  
ATOM   6714  H  H    . MET A 1 5   ? -32.501 -34.677 21.520  1.00 10.00 ? 5   MET A H    4  
ATOM   6715  H  HA   . MET A 1 5   ? -35.134 -33.332 21.813  1.00 10.00 ? 5   MET A HA   4  
ATOM   6716  H  HB2  . MET A 1 5   ? -33.856 -31.281 22.367  1.00 10.00 ? 5   MET A HB2  4  
ATOM   6717  H  HB3  . MET A 1 5   ? -33.703 -32.539 23.593  1.00 10.00 ? 5   MET A HB3  4  
ATOM   6718  H  HG2  . MET A 1 5   ? -31.598 -32.071 21.445  1.00 10.00 ? 5   MET A HG2  4  
ATOM   6719  H  HG3  . MET A 1 5   ? -31.620 -31.221 22.986  1.00 10.00 ? 5   MET A HG3  4  
ATOM   6720  H  HE1  . MET A 1 5   ? -28.571 -33.659 23.293  1.00 10.00 ? 5   MET A HE1  4  
ATOM   6721  H  HE2  . MET A 1 5   ? -29.164 -32.917 21.787  1.00 10.00 ? 5   MET A HE2  4  
ATOM   6722  H  HE3  . MET A 1 5   ? -29.093 -31.958 23.289  1.00 10.00 ? 5   MET A HE3  4  
ATOM   6723  N  N    . PRO A 1 6   ? -34.771 -32.039 19.566  1.00 10.00 ? 6   PRO A N    4  
ATOM   6724  C  CA   . PRO A 1 6   ? -34.623 -31.530 18.212  1.00 10.00 ? 6   PRO A CA   4  
ATOM   6725  C  C    . PRO A 1 6   ? -33.502 -30.485 18.150  1.00 10.00 ? 6   PRO A C    4  
ATOM   6726  O  O    . PRO A 1 6   ? -32.918 -30.118 19.169  1.00 10.00 ? 6   PRO A O    4  
ATOM   6727  C  CB   . PRO A 1 6   ? -35.987 -30.922 17.869  1.00 10.00 ? 6   PRO A CB   4  
ATOM   6728  C  CG   . PRO A 1 6   ? -36.492 -30.436 19.227  1.00 10.00 ? 6   PRO A CG   4  
ATOM   6729  C  CD   . PRO A 1 6   ? -35.980 -31.514 20.183  1.00 10.00 ? 6   PRO A CD   4  
ATOM   6730  H  HA   . PRO A 1 6   ? -34.395 -32.341 17.518  1.00 10.00 ? 6   PRO A HA   4  
ATOM   6731  H  HB2  . PRO A 1 6   ? -35.932 -30.115 17.137  1.00 10.00 ? 6   PRO A HB2  4  
ATOM   6732  H  HB3  . PRO A 1 6   ? -36.649 -31.709 17.505  1.00 10.00 ? 6   PRO A HB3  4  
ATOM   6733  H  HG2  . PRO A 1 6   ? -36.020 -29.482 19.469  1.00 10.00 ? 6   PRO A HG2  4  
ATOM   6734  H  HG3  . PRO A 1 6   ? -37.578 -30.336 19.258  1.00 10.00 ? 6   PRO A HG3  4  
ATOM   6735  H  HD2  . PRO A 1 6   ? -35.797 -31.078 21.166  1.00 10.00 ? 6   PRO A HD2  4  
ATOM   6736  H  HD3  . PRO A 1 6   ? -36.718 -32.313 20.260  1.00 10.00 ? 6   PRO A HD3  4  
ATOM   6737  N  N    . ALA A 1 7   ? -33.228 -29.987 16.943  1.00 10.00 ? 7   ALA A N    4  
ATOM   6738  C  CA   . ALA A 1 7   ? -32.308 -28.893 16.683  1.00 10.00 ? 7   ALA A CA   4  
ATOM   6739  C  C    . ALA A 1 7   ? -32.828 -28.148 15.455  1.00 10.00 ? 7   ALA A C    4  
ATOM   6740  O  O    . ALA A 1 7   ? -33.698 -28.667 14.754  1.00 10.00 ? 7   ALA A O    4  
ATOM   6741  C  CB   . ALA A 1 7   ? -30.896 -29.441 16.454  1.00 10.00 ? 7   ALA A CB   4  
ATOM   6742  H  H    . ALA A 1 7   ? -33.780 -30.269 16.142  1.00 10.00 ? 7   ALA A H    4  
ATOM   6743  H  HA   . ALA A 1 7   ? -32.299 -28.206 17.531  1.00 10.00 ? 7   ALA A HA   4  
ATOM   6744  H  HB1  . ALA A 1 7   ? -30.562 -29.977 17.343  1.00 10.00 ? 7   ALA A HB1  4  
ATOM   6745  H  HB2  . ALA A 1 7   ? -30.894 -30.122 15.603  1.00 10.00 ? 7   ALA A HB2  4  
ATOM   6746  H  HB3  . ALA A 1 7   ? -30.206 -28.620 16.257  1.00 10.00 ? 7   ALA A HB3  4  
ATOM   6747  N  N    . HIS A 1 8   ? -32.312 -26.942 15.208  1.00 10.00 ? 8   HIS A N    4  
ATOM   6748  C  CA   . HIS A 1 8   ? -32.762 -26.051 14.146  1.00 10.00 ? 8   HIS A CA   4  
ATOM   6749  C  C    . HIS A 1 8   ? -31.561 -25.233 13.674  1.00 10.00 ? 8   HIS A C    4  
ATOM   6750  O  O    . HIS A 1 8   ? -30.470 -25.351 14.234  1.00 10.00 ? 8   HIS A O    4  
ATOM   6751  C  CB   . HIS A 1 8   ? -33.877 -25.132 14.673  1.00 10.00 ? 8   HIS A CB   4  
ATOM   6752  C  CG   . HIS A 1 8   ? -35.067 -25.874 15.225  1.00 10.00 ? 8   HIS A CG   4  
ATOM   6753  N  ND1  . HIS A 1 8   ? -35.273 -26.162 16.575  1.00 10.00 ? 8   HIS A ND1  4  
ATOM   6754  C  CD2  . HIS A 1 8   ? -36.055 -26.452 14.480  1.00 10.00 ? 8   HIS A CD2  4  
ATOM   6755  C  CE1  . HIS A 1 8   ? -36.386 -26.908 16.613  1.00 10.00 ? 8   HIS A CE1  4  
ATOM   6756  N  NE2  . HIS A 1 8   ? -36.877 -27.098 15.375  1.00 10.00 ? 8   HIS A NE2  4  
ATOM   6757  H  H    . HIS A 1 8   ? -31.538 -26.606 15.764  1.00 10.00 ? 8   HIS A H    4  
ATOM   6758  H  HA   . HIS A 1 8   ? -33.138 -26.633 13.303  1.00 10.00 ? 8   HIS A HA   4  
ATOM   6759  H  HB2  . HIS A 1 8   ? -33.471 -24.502 15.466  1.00 10.00 ? 8   HIS A HB2  4  
ATOM   6760  H  HB3  . HIS A 1 8   ? -34.224 -24.484 13.868  1.00 10.00 ? 8   HIS A HB3  4  
ATOM   6761  H  HD2  . HIS A 1 8   ? -36.145 -26.442 13.404  1.00 10.00 ? 8   HIS A HD2  4  
ATOM   6762  H  HE1  . HIS A 1 8   ? -36.825 -27.308 17.516  1.00 10.00 ? 8   HIS A HE1  4  
ATOM   6763  H  HE2  . HIS A 1 8   ? -37.698 -27.638 15.143  1.00 10.00 ? 8   HIS A HE2  4  
ATOM   6764  N  N    . THR A 1 9   ? -31.740 -24.404 12.645  1.00 10.00 ? 9   THR A N    4  
ATOM   6765  C  CA   . THR A 1 9   ? -30.702 -23.528 12.117  1.00 10.00 ? 9   THR A CA   4  
ATOM   6766  C  C    . THR A 1 9   ? -31.415 -22.343 11.455  1.00 10.00 ? 9   THR A C    4  
ATOM   6767  O  O    . THR A 1 9   ? -32.418 -22.572 10.779  1.00 10.00 ? 9   THR A O    4  
ATOM   6768  C  CB   . THR A 1 9   ? -29.837 -24.310 11.113  1.00 10.00 ? 9   THR A CB   4  
ATOM   6769  O  OG1  . THR A 1 9   ? -29.366 -25.509 11.697  1.00 10.00 ? 9   THR A OG1  4  
ATOM   6770  C  CG2  . THR A 1 9   ? -28.620 -23.514 10.636  1.00 10.00 ? 9   THR A CG2  4  
ATOM   6771  H  H    . THR A 1 9   ? -32.644 -24.336 12.196  1.00 10.00 ? 9   THR A H    4  
ATOM   6772  H  HA   . THR A 1 9   ? -30.080 -23.189 12.946  1.00 10.00 ? 9   THR A HA   4  
ATOM   6773  H  HB   . THR A 1 9   ? -30.444 -24.568 10.242  1.00 10.00 ? 9   THR A HB   4  
ATOM   6774  H  HG1  . THR A 1 9   ? -29.415 -25.432 12.660  1.00 10.00 ? 9   THR A HG1  4  
ATOM   6775  H  HG21 . THR A 1 9   ? -28.053 -24.119 9.927   1.00 10.00 ? 9   THR A HG21 4  
ATOM   6776  H  HG22 . THR A 1 9   ? -28.932 -22.597 10.135  1.00 10.00 ? 9   THR A HG22 4  
ATOM   6777  H  HG23 . THR A 1 9   ? -27.975 -23.271 11.480  1.00 10.00 ? 9   THR A HG23 4  
ATOM   6778  N  N    . PRO A 1 10  ? -30.973 -21.093 11.670  1.00 10.00 ? 10  PRO A N    4  
ATOM   6779  C  CA   . PRO A 1 10  ? -31.617 -19.931 11.077  1.00 10.00 ? 10  PRO A CA   4  
ATOM   6780  C  C    . PRO A 1 10  ? -31.316 -19.855 9.574   1.00 10.00 ? 10  PRO A C    4  
ATOM   6781  O  O    . PRO A 1 10  ? -30.337 -20.443 9.113   1.00 10.00 ? 10  PRO A O    4  
ATOM   6782  C  CB   . PRO A 1 10  ? -31.034 -18.727 11.826  1.00 10.00 ? 10  PRO A CB   4  
ATOM   6783  C  CG   . PRO A 1 10  ? -29.636 -19.207 12.212  1.00 10.00 ? 10  PRO A CG   4  
ATOM   6784  C  CD   . PRO A 1 10  ? -29.854 -20.691 12.507  1.00 10.00 ? 10  PRO A CD   4  
ATOM   6785  H  HA   . PRO A 1 10  ? -32.693 -19.986 11.249  1.00 10.00 ? 10  PRO A HA   4  
ATOM   6786  H  HB2  . PRO A 1 10  ? -31.000 -17.822 11.218  1.00 10.00 ? 10  PRO A HB2  4  
ATOM   6787  H  HB3  . PRO A 1 10  ? -31.615 -18.548 12.732  1.00 10.00 ? 10  PRO A HB3  4  
ATOM   6788  H  HG2  . PRO A 1 10  ? -28.970 -19.101 11.353  1.00 10.00 ? 10  PRO A HG2  4  
ATOM   6789  H  HG3  . PRO A 1 10  ? -29.231 -18.667 13.069  1.00 10.00 ? 10  PRO A HG3  4  
ATOM   6790  H  HD2  . PRO A 1 10  ? -28.942 -21.244 12.286  1.00 10.00 ? 10  PRO A HD2  4  
ATOM   6791  H  HD3  . PRO A 1 10  ? -30.126 -20.818 13.556  1.00 10.00 ? 10  PRO A HD3  4  
ATOM   6792  N  N    . PRO A 1 11  ? -32.138 -19.126 8.801   1.00 10.00 ? 11  PRO A N    4  
ATOM   6793  C  CA   . PRO A 1 11  ? -31.877 -18.852 7.397   1.00 10.00 ? 11  PRO A CA   4  
ATOM   6794  C  C    . PRO A 1 11  ? -30.771 -17.797 7.253   1.00 10.00 ? 11  PRO A C    4  
ATOM   6795  O  O    . PRO A 1 11  ? -30.238 -17.296 8.243   1.00 10.00 ? 11  PRO A O    4  
ATOM   6796  C  CB   . PRO A 1 11  ? -33.217 -18.347 6.850   1.00 10.00 ? 11  PRO A CB   4  
ATOM   6797  C  CG   . PRO A 1 11  ? -33.815 -17.615 8.052   1.00 10.00 ? 11  PRO A CG   4  
ATOM   6798  C  CD   . PRO A 1 11  ? -33.368 -18.479 9.232   1.00 10.00 ? 11  PRO A CD   4  
ATOM   6799  H  HA   . PRO A 1 11  ? -31.579 -19.760 6.871   1.00 10.00 ? 11  PRO A HA   4  
ATOM   6800  H  HB2  . PRO A 1 11  ? -33.120 -17.698 5.979   1.00 10.00 ? 11  PRO A HB2  4  
ATOM   6801  H  HB3  . PRO A 1 11  ? -33.848 -19.203 6.605   1.00 10.00 ? 11  PRO A HB3  4  
ATOM   6802  H  HG2  . PRO A 1 11  ? -33.363 -16.624 8.134   1.00 10.00 ? 11  PRO A HG2  4  
ATOM   6803  H  HG3  . PRO A 1 11  ? -34.900 -17.528 7.988   1.00 10.00 ? 11  PRO A HG3  4  
ATOM   6804  H  HD2  . PRO A 1 11  ? -33.222 -17.856 10.116  1.00 10.00 ? 11  PRO A HD2  4  
ATOM   6805  H  HD3  . PRO A 1 11  ? -34.122 -19.241 9.430   1.00 10.00 ? 11  PRO A HD3  4  
ATOM   6806  N  N    . ALA A 1 12  ? -30.453 -17.434 6.007   1.00 10.00 ? 12  ALA A N    4  
ATOM   6807  C  CA   . ALA A 1 12  ? -29.541 -16.353 5.661   1.00 10.00 ? 12  ALA A CA   4  
ATOM   6808  C  C    . ALA A 1 12  ? -30.138 -15.607 4.468   1.00 10.00 ? 12  ALA A C    4  
ATOM   6809  O  O    . ALA A 1 12  ? -31.062 -16.115 3.832   1.00 10.00 ? 12  ALA A O    4  
ATOM   6810  C  CB   . ALA A 1 12  ? -28.161 -16.928 5.330   1.00 10.00 ? 12  ALA A CB   4  
ATOM   6811  H  H    . ALA A 1 12  ? -30.976 -17.815 5.230   1.00 10.00 ? 12  ALA A H    4  
ATOM   6812  H  HA   . ALA A 1 12  ? -29.448 -15.656 6.495   1.00 10.00 ? 12  ALA A HA   4  
ATOM   6813  H  HB1  . ALA A 1 12  ? -27.474 -16.121 5.073   1.00 10.00 ? 12  ALA A HB1  4  
ATOM   6814  H  HB2  . ALA A 1 12  ? -27.770 -17.463 6.196   1.00 10.00 ? 12  ALA A HB2  4  
ATOM   6815  H  HB3  . ALA A 1 12  ? -28.236 -17.616 4.487   1.00 10.00 ? 12  ALA A HB3  4  
ATOM   6816  N  N    . GLN A 1 13  ? -29.634 -14.403 4.179   1.00 10.00 ? 13  GLN A N    4  
ATOM   6817  C  CA   . GLN A 1 13  ? -30.090 -13.557 3.085   1.00 10.00 ? 13  GLN A CA   4  
ATOM   6818  C  C    . GLN A 1 13  ? -28.879 -12.822 2.508   1.00 10.00 ? 13  GLN A C    4  
ATOM   6819  O  O    . GLN A 1 13  ? -27.814 -12.810 3.125   1.00 10.00 ? 13  GLN A O    4  
ATOM   6820  C  CB   . GLN A 1 13  ? -31.139 -12.552 3.589   1.00 10.00 ? 13  GLN A CB   4  
ATOM   6821  C  CG   . GLN A 1 13  ? -32.396 -13.235 4.144   1.00 10.00 ? 13  GLN A CG   4  
ATOM   6822  C  CD   . GLN A 1 13  ? -33.462 -12.217 4.535   1.00 10.00 ? 13  GLN A CD   4  
ATOM   6823  O  OE1  . GLN A 1 13  ? -33.752 -12.030 5.711   1.00 10.00 ? 13  GLN A OE1  4  
ATOM   6824  N  NE2  . GLN A 1 13  ? -34.057 -11.545 3.554   1.00 10.00 ? 13  GLN A NE2  4  
ATOM   6825  H  H    . GLN A 1 13  ? -28.822 -14.067 4.680   1.00 10.00 ? 13  GLN A H    4  
ATOM   6826  H  HA   . GLN A 1 13  ? -30.525 -14.169 2.293   1.00 10.00 ? 13  GLN A HA   4  
ATOM   6827  H  HB2  . GLN A 1 13  ? -30.699 -11.929 4.369   1.00 10.00 ? 13  GLN A HB2  4  
ATOM   6828  H  HB3  . GLN A 1 13  ? -31.429 -11.908 2.758   1.00 10.00 ? 13  GLN A HB3  4  
ATOM   6829  H  HG2  . GLN A 1 13  ? -32.808 -13.915 3.399   1.00 10.00 ? 13  GLN A HG2  4  
ATOM   6830  H  HG3  . GLN A 1 13  ? -32.141 -13.808 5.036   1.00 10.00 ? 13  GLN A HG3  4  
ATOM   6831  H  HE21 . GLN A 1 13  ? -33.808 -11.711 2.591   1.00 10.00 ? 13  GLN A HE21 4  
ATOM   6832  H  HE22 . GLN A 1 13  ? -34.762 -10.868 3.800   1.00 10.00 ? 13  GLN A HE22 4  
ATOM   6833  N  N    . THR A 1 14  ? -29.050 -12.210 1.335   1.00 10.00 ? 14  THR A N    4  
ATOM   6834  C  CA   . THR A 1 14  ? -28.030 -11.464 0.614   1.00 10.00 ? 14  THR A CA   4  
ATOM   6835  C  C    . THR A 1 14  ? -28.695 -10.210 0.049   1.00 10.00 ? 14  THR A C    4  
ATOM   6836  O  O    . THR A 1 14  ? -29.833 -10.306 -0.410  1.00 10.00 ? 14  THR A O    4  
ATOM   6837  C  CB   . THR A 1 14  ? -27.501 -12.332 -0.537  1.00 10.00 ? 14  THR A CB   4  
ATOM   6838  O  OG1  . THR A 1 14  ? -28.591 -12.859 -1.273  1.00 10.00 ? 14  THR A OG1  4  
ATOM   6839  C  CG2  . THR A 1 14  ? -26.651 -13.497 -0.025  1.00 10.00 ? 14  THR A CG2  4  
ATOM   6840  H  H    . THR A 1 14  ? -29.951 -12.250 0.881   1.00 10.00 ? 14  THR A H    4  
ATOM   6841  H  HA   . THR A 1 14  ? -27.211 -11.175 1.275   1.00 10.00 ? 14  THR A HA   4  
ATOM   6842  H  HB   . THR A 1 14  ? -26.885 -11.716 -1.195  1.00 10.00 ? 14  THR A HB   4  
ATOM   6843  H  HG1  . THR A 1 14  ? -29.217 -12.149 -1.452  1.00 10.00 ? 14  THR A HG1  4  
ATOM   6844  H  HG21 . THR A 1 14  ? -26.245 -14.049 -0.873  1.00 10.00 ? 14  THR A HG21 4  
ATOM   6845  H  HG22 . THR A 1 14  ? -25.827 -13.120 0.581   1.00 10.00 ? 14  THR A HG22 4  
ATOM   6846  H  HG23 . THR A 1 14  ? -27.256 -14.176 0.576   1.00 10.00 ? 14  THR A HG23 4  
ATOM   6847  N  N    . ALA A 1 15  ? -28.001 -9.067  0.056   1.00 10.00 ? 15  ALA A N    4  
ATOM   6848  C  CA   . ALA A 1 15  ? -28.488 -7.802  -0.481  1.00 10.00 ? 15  ALA A CA   4  
ATOM   6849  C  C    . ALA A 1 15  ? -27.469 -7.266  -1.494  1.00 10.00 ? 15  ALA A C    4  
ATOM   6850  O  O    . ALA A 1 15  ? -26.281 -7.552  -1.346  1.00 10.00 ? 15  ALA A O    4  
ATOM   6851  C  CB   . ALA A 1 15  ? -28.678 -6.812  0.673   1.00 10.00 ? 15  ALA A CB   4  
ATOM   6852  H  H    . ALA A 1 15  ? -27.039 -9.070  0.369   1.00 10.00 ? 15  ALA A H    4  
ATOM   6853  H  HA   . ALA A 1 15  ? -29.452 -7.954  -0.966  1.00 10.00 ? 15  ALA A HA   4  
ATOM   6854  H  HB1  . ALA A 1 15  ? -29.409 -7.206  1.379   1.00 10.00 ? 15  ALA A HB1  4  
ATOM   6855  H  HB2  . ALA A 1 15  ? -27.729 -6.656  1.189   1.00 10.00 ? 15  ALA A HB2  4  
ATOM   6856  H  HB3  . ALA A 1 15  ? -29.032 -5.854  0.292   1.00 10.00 ? 15  ALA A HB3  4  
ATOM   6857  N  N    . PRO A 1 16  ? -27.906 -6.520  -2.523  1.00 10.00 ? 16  PRO A N    4  
ATOM   6858  C  CA   . PRO A 1 16  ? -27.015 -5.914  -3.501  1.00 10.00 ? 16  PRO A CA   4  
ATOM   6859  C  C    . PRO A 1 16  ? -26.317 -4.684  -2.909  1.00 10.00 ? 16  PRO A C    4  
ATOM   6860  O  O    . PRO A 1 16  ? -26.581 -4.291  -1.773  1.00 10.00 ? 16  PRO A O    4  
ATOM   6861  C  CB   . PRO A 1 16  ? -27.929 -5.534  -4.672  1.00 10.00 ? 16  PRO A CB   4  
ATOM   6862  C  CG   . PRO A 1 16  ? -29.243 -5.188  -3.972  1.00 10.00 ? 16  PRO A CG   4  
ATOM   6863  C  CD   . PRO A 1 16  ? -29.293 -6.202  -2.829  1.00 10.00 ? 16  PRO A CD   4  
ATOM   6864  H  HA   . PRO A 1 16  ? -26.261 -6.629  -3.837  1.00 10.00 ? 16  PRO A HA   4  
ATOM   6865  H  HB2  . PRO A 1 16  ? -27.549 -4.704  -5.270  1.00 10.00 ? 16  PRO A HB2  4  
ATOM   6866  H  HB3  . PRO A 1 16  ? -28.082 -6.408  -5.307  1.00 10.00 ? 16  PRO A HB3  4  
ATOM   6867  H  HG2  . PRO A 1 16  ? -29.180 -4.179  -3.561  1.00 10.00 ? 16  PRO A HG2  4  
ATOM   6868  H  HG3  . PRO A 1 16  ? -30.103 -5.269  -4.638  1.00 10.00 ? 16  PRO A HG3  4  
ATOM   6869  H  HD2  . PRO A 1 16  ? -29.819 -5.774  -1.975  1.00 10.00 ? 16  PRO A HD2  4  
ATOM   6870  H  HD3  . PRO A 1 16  ? -29.803 -7.105  -3.170  1.00 10.00 ? 16  PRO A HD3  4  
ATOM   6871  N  N    . ALA A 1 17  ? -25.444 -4.055  -3.701  1.00 10.00 ? 17  ALA A N    4  
ATOM   6872  C  CA   . ALA A 1 17  ? -24.772 -2.807  -3.375  1.00 10.00 ? 17  ALA A CA   4  
ATOM   6873  C  C    . ALA A 1 17  ? -24.436 -2.105  -4.691  1.00 10.00 ? 17  ALA A C    4  
ATOM   6874  O  O    . ALA A 1 17  ? -24.520 -2.727  -5.750  1.00 10.00 ? 17  ALA A O    4  
ATOM   6875  C  CB   . ALA A 1 17  ? -23.508 -3.095  -2.558  1.00 10.00 ? 17  ALA A CB   4  
ATOM   6876  H  H    . ALA A 1 17  ? -25.296 -4.378  -4.649  1.00 10.00 ? 17  ALA A H    4  
ATOM   6877  H  HA   . ALA A 1 17  ? -25.441 -2.169  -2.794  1.00 10.00 ? 17  ALA A HA   4  
ATOM   6878  H  HB1  . ALA A 1 17  ? -22.830 -3.728  -3.133  1.00 10.00 ? 17  ALA A HB1  4  
ATOM   6879  H  HB2  . ALA A 1 17  ? -23.003 -2.161  -2.312  1.00 10.00 ? 17  ALA A HB2  4  
ATOM   6880  H  HB3  . ALA A 1 17  ? -23.775 -3.606  -1.632  1.00 10.00 ? 17  ALA A HB3  4  
ATOM   6881  N  N    . ALA A 1 18  ? -24.066 -0.823  -4.631  1.00 10.00 ? 18  ALA A N    4  
ATOM   6882  C  CA   . ALA A 1 18  ? -23.701 -0.013  -5.783  1.00 10.00 ? 18  ALA A CA   4  
ATOM   6883  C  C    . ALA A 1 18  ? -22.932 1.206   -5.276  1.00 10.00 ? 18  ALA A C    4  
ATOM   6884  O  O    . ALA A 1 18  ? -22.915 1.457   -4.071  1.00 10.00 ? 18  ALA A O    4  
ATOM   6885  C  CB   . ALA A 1 18  ? -24.961 0.415   -6.545  1.00 10.00 ? 18  ALA A CB   4  
ATOM   6886  H  H    . ALA A 1 18  ? -23.970 -0.361  -3.734  1.00 10.00 ? 18  ALA A H    4  
ATOM   6887  H  HA   . ALA A 1 18  ? -23.054 -0.591  -6.446  1.00 10.00 ? 18  ALA A HA   4  
ATOM   6888  H  HB1  . ALA A 1 18  ? -25.499 -0.464  -6.903  1.00 10.00 ? 18  ALA A HB1  4  
ATOM   6889  H  HB2  . ALA A 1 18  ? -25.615 0.990   -5.888  1.00 10.00 ? 18  ALA A HB2  4  
ATOM   6890  H  HB3  . ALA A 1 18  ? -24.688 1.029   -7.403  1.00 10.00 ? 18  ALA A HB3  4  
ATOM   6891  N  N    . GLN A 1 19  ? -22.306 1.965   -6.180  1.00 10.00 ? 19  GLN A N    4  
ATOM   6892  C  CA   . GLN A 1 19  ? -21.567 3.176   -5.859  1.00 10.00 ? 19  GLN A CA   4  
ATOM   6893  C  C    . GLN A 1 19  ? -21.619 4.074   -7.100  1.00 10.00 ? 19  GLN A C    4  
ATOM   6894  O  O    . GLN A 1 19  ? -21.695 3.560   -8.213  1.00 10.00 ? 19  GLN A O    4  
ATOM   6895  C  CB   . GLN A 1 19  ? -20.122 2.809   -5.461  1.00 10.00 ? 19  GLN A CB   4  
ATOM   6896  C  CG   . GLN A 1 19  ? -19.561 3.692   -4.337  1.00 10.00 ? 19  GLN A CG   4  
ATOM   6897  C  CD   . GLN A 1 19  ? -19.533 5.167   -4.714  1.00 10.00 ? 19  GLN A CD   4  
ATOM   6898  O  OE1  . GLN A 1 19  ? -20.474 5.902   -4.417  1.00 10.00 ? 19  GLN A OE1  4  
ATOM   6899  N  NE2  . GLN A 1 19  ? -18.501 5.602   -5.429  1.00 10.00 ? 19  GLN A NE2  4  
ATOM   6900  H  H    . GLN A 1 19  ? -22.368 1.740   -7.166  1.00 10.00 ? 19  GLN A H    4  
ATOM   6901  H  HA   . GLN A 1 19  ? -22.069 3.675   -5.029  1.00 10.00 ? 19  GLN A HA   4  
ATOM   6902  H  HB2  . GLN A 1 19  ? -20.100 1.784   -5.087  1.00 10.00 ? 19  GLN A HB2  4  
ATOM   6903  H  HB3  . GLN A 1 19  ? -19.471 2.859   -6.336  1.00 10.00 ? 19  GLN A HB3  4  
ATOM   6904  H  HG2  . GLN A 1 19  ? -20.182 3.569   -3.449  1.00 10.00 ? 19  GLN A HG2  4  
ATOM   6905  H  HG3  . GLN A 1 19  ? -18.551 3.361   -4.092  1.00 10.00 ? 19  GLN A HG3  4  
ATOM   6906  H  HE21 . GLN A 1 19  ? -17.755 4.971   -5.685  1.00 10.00 ? 19  GLN A HE21 4  
ATOM   6907  H  HE22 . GLN A 1 19  ? -18.460 6.574   -5.692  1.00 10.00 ? 19  GLN A HE22 4  
ATOM   6908  N  N    . LYS A 1 20  ? -21.611 5.397   -6.909  1.00 10.00 ? 20  LYS A N    4  
ATOM   6909  C  CA   . LYS A 1 20  ? -21.536 6.393   -7.966  1.00 10.00 ? 20  LYS A CA   4  
ATOM   6910  C  C    . LYS A 1 20  ? -21.101 7.715   -7.331  1.00 10.00 ? 20  LYS A C    4  
ATOM   6911  O  O    . LYS A 1 20  ? -21.603 8.057   -6.258  1.00 10.00 ? 20  LYS A O    4  
ATOM   6912  C  CB   . LYS A 1 20  ? -22.870 6.519   -8.733  1.00 10.00 ? 20  LYS A CB   4  
ATOM   6913  C  CG   . LYS A 1 20  ? -24.042 7.194   -7.996  1.00 10.00 ? 20  LYS A CG   4  
ATOM   6914  C  CD   . LYS A 1 20  ? -24.701 6.334   -6.901  1.00 10.00 ? 20  LYS A CD   4  
ATOM   6915  C  CE   . LYS A 1 20  ? -24.992 7.137   -5.622  1.00 10.00 ? 20  LYS A CE   4  
ATOM   6916  N  NZ   . LYS A 1 20  ? -23.769 7.441   -4.847  1.00 10.00 ? 20  LYS A NZ   4  
ATOM   6917  H  H    . LYS A 1 20  ? -21.489 5.751   -5.968  1.00 10.00 ? 20  LYS A H    4  
ATOM   6918  H  HA   . LYS A 1 20  ? -20.767 6.071   -8.672  1.00 10.00 ? 20  LYS A HA   4  
ATOM   6919  H  HB2  . LYS A 1 20  ? -22.662 7.128   -9.615  1.00 10.00 ? 20  LYS A HB2  4  
ATOM   6920  H  HB3  . LYS A 1 20  ? -23.188 5.538   -9.089  1.00 10.00 ? 20  LYS A HB3  4  
ATOM   6921  H  HG2  . LYS A 1 20  ? -23.734 8.167   -7.616  1.00 10.00 ? 20  LYS A HG2  4  
ATOM   6922  H  HG3  . LYS A 1 20  ? -24.808 7.396   -8.748  1.00 10.00 ? 20  LYS A HG3  4  
ATOM   6923  H  HD2  . LYS A 1 20  ? -25.651 5.969   -7.298  1.00 10.00 ? 20  LYS A HD2  4  
ATOM   6924  H  HD3  . LYS A 1 20  ? -24.108 5.452   -6.667  1.00 10.00 ? 20  LYS A HD3  4  
ATOM   6925  H  HE2  . LYS A 1 20  ? -25.499 8.066   -5.892  1.00 10.00 ? 20  LYS A HE2  4  
ATOM   6926  H  HE3  . LYS A 1 20  ? -25.668 6.557   -4.990  1.00 10.00 ? 20  LYS A HE3  4  
ATOM   6927  H  HZ1  . LYS A 1 20  ? -23.982 8.061   -4.079  1.00 10.00 ? 20  LYS A HZ1  4  
ATOM   6928  H  HZ2  . LYS A 1 20  ? -23.356 6.597   -4.476  1.00 10.00 ? 20  LYS A HZ2  4  
ATOM   6929  H  HZ3  . LYS A 1 20  ? -23.065 7.886   -5.432  1.00 10.00 ? 20  LYS A HZ3  4  
ATOM   6930  N  N    . ALA A 1 21  ? -20.186 8.450   -7.962  1.00 10.00 ? 21  ALA A N    4  
ATOM   6931  C  CA   . ALA A 1 21  ? -19.700 9.745   -7.503  1.00 10.00 ? 21  ALA A CA   4  
ATOM   6932  C  C    . ALA A 1 21  ? -19.086 10.454  -8.710  1.00 10.00 ? 21  ALA A C    4  
ATOM   6933  O  O    . ALA A 1 21  ? -18.964 9.839   -9.769  1.00 10.00 ? 21  ALA A O    4  
ATOM   6934  C  CB   . ALA A 1 21  ? -18.673 9.553   -6.381  1.00 10.00 ? 21  ALA A CB   4  
ATOM   6935  H  H    . ALA A 1 21  ? -19.835 8.167   -8.871  1.00 10.00 ? 21  ALA A H    4  
ATOM   6936  H  HA   . ALA A 1 21  ? -20.536 10.341  -7.132  1.00 10.00 ? 21  ALA A HA   4  
ATOM   6937  H  HB1  . ALA A 1 21  ? -18.311 10.523  -6.039  1.00 10.00 ? 21  ALA A HB1  4  
ATOM   6938  H  HB2  . ALA A 1 21  ? -19.131 9.036   -5.538  1.00 10.00 ? 21  ALA A HB2  4  
ATOM   6939  H  HB3  . ALA A 1 21  ? -17.828 8.967   -6.746  1.00 10.00 ? 21  ALA A HB3  4  
ATOM   6940  N  N    . GLY A 1 22  ? -18.712 11.728  -8.568  1.00 10.00 ? 22  GLY A N    4  
ATOM   6941  C  CA   . GLY A 1 22  ? -18.153 12.502  -9.662  1.00 10.00 ? 22  GLY A CA   4  
ATOM   6942  C  C    . GLY A 1 22  ? -17.924 13.946  -9.226  1.00 10.00 ? 22  GLY A C    4  
ATOM   6943  O  O    . GLY A 1 22  ? -17.864 14.227  -8.026  1.00 10.00 ? 22  GLY A O    4  
ATOM   6944  H  H    . GLY A 1 22  ? -18.806 12.207  -7.682  1.00 10.00 ? 22  GLY A H    4  
ATOM   6945  H  HA2  . GLY A 1 22  ? -17.200 12.068  -9.968  1.00 10.00 ? 22  GLY A HA2  4  
ATOM   6946  H  HA3  . GLY A 1 22  ? -18.845 12.482  -10.505 1.00 10.00 ? 22  GLY A HA3  4  
ATOM   6947  N  N    . ALA A 1 23  ? -17.814 14.847  -10.210 1.00 10.00 ? 23  ALA A N    4  
ATOM   6948  C  CA   . ALA A 1 23  ? -17.465 16.250  -10.018 1.00 10.00 ? 23  ALA A CA   4  
ATOM   6949  C  C    . ALA A 1 23  ? -16.124 16.365  -9.280  1.00 10.00 ? 23  ALA A C    4  
ATOM   6950  O  O    . ALA A 1 23  ? -15.330 15.425  -9.298  1.00 10.00 ? 23  ALA A O    4  
ATOM   6951  C  CB   . ALA A 1 23  ? -18.620 16.988  -9.324  1.00 10.00 ? 23  ALA A CB   4  
ATOM   6952  H  H    . ALA A 1 23  ? -17.867 14.515  -11.161 1.00 10.00 ? 23  ALA A H    4  
ATOM   6953  H  HA   . ALA A 1 23  ? -17.333 16.693  -11.006 1.00 10.00 ? 23  ALA A HA   4  
ATOM   6954  H  HB1  . ALA A 1 23  ? -18.454 18.065  -9.353  1.00 10.00 ? 23  ALA A HB1  4  
ATOM   6955  H  HB2  . ALA A 1 23  ? -19.554 16.775  -9.844  1.00 10.00 ? 23  ALA A HB2  4  
ATOM   6956  H  HB3  . ALA A 1 23  ? -18.714 16.671  -8.285  1.00 10.00 ? 23  ALA A HB3  4  
ATOM   6957  N  N    . GLN A 1 24  ? -15.879 17.502  -8.618  1.00 10.00 ? 24  GLN A N    4  
ATOM   6958  C  CA   . GLN A 1 24  ? -14.707 17.697  -7.773  1.00 10.00 ? 24  GLN A CA   4  
ATOM   6959  C  C    . GLN A 1 24  ? -13.429 17.521  -8.610  1.00 10.00 ? 24  GLN A C    4  
ATOM   6960  O  O    . GLN A 1 24  ? -13.400 17.914  -9.775  1.00 10.00 ? 24  GLN A O    4  
ATOM   6961  C  CB   . GLN A 1 24  ? -14.794 16.759  -6.551  1.00 10.00 ? 24  GLN A CB   4  
ATOM   6962  C  CG   . GLN A 1 24  ? -16.118 16.910  -5.784  1.00 10.00 ? 24  GLN A CG   4  
ATOM   6963  C  CD   . GLN A 1 24  ? -16.351 15.725  -4.856  1.00 10.00 ? 24  GLN A CD   4  
ATOM   6964  O  OE1  . GLN A 1 24  ? -16.056 15.791  -3.667  1.00 10.00 ? 24  GLN A OE1  4  
ATOM   6965  N  NE2  . GLN A 1 24  ? -16.886 14.629  -5.387  1.00 10.00 ? 24  GLN A NE2  4  
ATOM   6966  H  H    . GLN A 1 24  ? -16.538 18.260  -8.683  1.00 10.00 ? 24  GLN A H    4  
ATOM   6967  H  HA   . GLN A 1 24  ? -14.713 18.723  -7.408  1.00 10.00 ? 24  GLN A HA   4  
ATOM   6968  H  HB2  . GLN A 1 24  ? -14.688 15.723  -6.878  1.00 10.00 ? 24  GLN A HB2  4  
ATOM   6969  H  HB3  . GLN A 1 24  ? -13.985 16.979  -5.853  1.00 10.00 ? 24  GLN A HB3  4  
ATOM   6970  H  HG2  . GLN A 1 24  ? -16.086 17.829  -5.198  1.00 10.00 ? 24  GLN A HG2  4  
ATOM   6971  H  HG3  . GLN A 1 24  ? -16.973 16.965  -6.455  1.00 10.00 ? 24  GLN A HG3  4  
ATOM   6972  H  HE21 . GLN A 1 24  ? -17.141 14.587  -6.373  1.00 10.00 ? 24  GLN A HE21 4  
ATOM   6973  H  HE22 . GLN A 1 24  ? -17.042 13.837  -4.785  1.00 10.00 ? 24  GLN A HE22 4  
ATOM   6974  N  N    . ALA A 1 25  ? -12.380 16.933  -8.032  1.00 10.00 ? 25  ALA A N    4  
ATOM   6975  C  CA   . ALA A 1 25  ? -11.168 16.539  -8.729  1.00 10.00 ? 25  ALA A CA   4  
ATOM   6976  C  C    . ALA A 1 25  ? -10.566 15.379  -7.942  1.00 10.00 ? 25  ALA A C    4  
ATOM   6977  O  O    . ALA A 1 25  ? -10.745 15.313  -6.726  1.00 10.00 ? 25  ALA A O    4  
ATOM   6978  C  CB   . ALA A 1 25  ? -10.194 17.717  -8.814  1.00 10.00 ? 25  ALA A CB   4  
ATOM   6979  H  H    . ALA A 1 25  ? -12.444 16.614  -7.075  1.00 10.00 ? 25  ALA A H    4  
ATOM   6980  H  HA   . ALA A 1 25  ? -11.419 16.201  -9.736  1.00 10.00 ? 25  ALA A HA   4  
ATOM   6981  H  HB1  . ALA A 1 25  ? -9.280  17.402  -9.319  1.00 10.00 ? 25  ALA A HB1  4  
ATOM   6982  H  HB2  . ALA A 1 25  ? -10.646 18.533  -9.379  1.00 10.00 ? 25  ALA A HB2  4  
ATOM   6983  H  HB3  . ALA A 1 25  ? -9.944  18.069  -7.812  1.00 10.00 ? 25  ALA A HB3  4  
ATOM   6984  N  N    . LEU A 1 26  ? -9.887  14.455  -8.625  1.00 10.00 ? 26  LEU A N    4  
ATOM   6985  C  CA   . LEU A 1 26  ? -9.302  13.278  -8.006  1.00 10.00 ? 26  LEU A CA   4  
ATOM   6986  C  C    . LEU A 1 26  ? -7.838  13.580  -7.668  1.00 10.00 ? 26  LEU A C    4  
ATOM   6987  O  O    . LEU A 1 26  ? -7.084  13.924  -8.576  1.00 10.00 ? 26  LEU A O    4  
ATOM   6988  C  CB   . LEU A 1 26  ? -9.442  12.099  -8.978  1.00 10.00 ? 26  LEU A CB   4  
ATOM   6989  C  CG   . LEU A 1 26  ? -8.787  10.818  -8.435  1.00 10.00 ? 26  LEU A CG   4  
ATOM   6990  C  CD1  . LEU A 1 26  ? -9.734  9.628   -8.600  1.00 10.00 ? 26  LEU A CD1  4  
ATOM   6991  C  CD2  . LEU A 1 26  ? -7.479  10.532  -9.180  1.00 10.00 ? 26  LEU A CD2  4  
ATOM   6992  H  H    . LEU A 1 26  ? -9.719  14.584  -9.612  1.00 10.00 ? 26  LEU A H    4  
ATOM   6993  H  HA   . LEU A 1 26  ? -9.876  13.022  -7.117  1.00 10.00 ? 26  LEU A HA   4  
ATOM   6994  H  HB2  . LEU A 1 26  ? -10.508 11.926  -9.132  1.00 10.00 ? 26  LEU A HB2  4  
ATOM   6995  H  HB3  . LEU A 1 26  ? -9.003  12.359  -9.943  1.00 10.00 ? 26  LEU A HB3  4  
ATOM   6996  H  HG   . LEU A 1 26  ? -8.573  10.924  -7.371  1.00 10.00 ? 26  LEU A HG   4  
ATOM   6997  H  HD11 . LEU A 1 26  ? -9.980  9.481   -9.652  1.00 10.00 ? 26  LEU A HD11 4  
ATOM   6998  H  HD12 . LEU A 1 26  ? -9.250  8.733   -8.216  1.00 10.00 ? 26  LEU A HD12 4  
ATOM   6999  H  HD13 . LEU A 1 26  ? -10.649 9.801   -8.033  1.00 10.00 ? 26  LEU A HD13 4  
ATOM   7000  H  HD21 . LEU A 1 26  ? -6.848  11.419  -9.203  1.00 10.00 ? 26  LEU A HD21 4  
ATOM   7001  H  HD22 . LEU A 1 26  ? -6.935  9.728   -8.686  1.00 10.00 ? 26  LEU A HD22 4  
ATOM   7002  H  HD23 . LEU A 1 26  ? -7.709  10.234  -10.199 1.00 10.00 ? 26  LEU A HD23 4  
ATOM   7003  N  N    . PRO A 1 27  ? -7.410  13.473  -6.399  1.00 10.00 ? 27  PRO A N    4  
ATOM   7004  C  CA   . PRO A 1 27  ? -6.011  13.644  -6.043  1.00 10.00 ? 27  PRO A CA   4  
ATOM   7005  C  C    . PRO A 1 27  ? -5.209  12.426  -6.511  1.00 10.00 ? 27  PRO A C    4  
ATOM   7006  O  O    . PRO A 1 27  ? -5.765  11.346  -6.714  1.00 10.00 ? 27  PRO A O    4  
ATOM   7007  C  CB   . PRO A 1 27  ? -6.000  13.778  -4.520  1.00 10.00 ? 27  PRO A CB   4  
ATOM   7008  C  CG   . PRO A 1 27  ? -7.190  12.918  -4.094  1.00 10.00 ? 27  PRO A CG   4  
ATOM   7009  C  CD   . PRO A 1 27  ? -8.200  13.137  -5.223  1.00 10.00 ? 27  PRO A CD   4  
ATOM   7010  H  HA   . PRO A 1 27  ? -5.605  14.549  -6.499  1.00 10.00 ? 27  PRO A HA   4  
ATOM   7011  H  HB2  . PRO A 1 27  ? -5.060  13.442  -4.084  1.00 10.00 ? 27  PRO A HB2  4  
ATOM   7012  H  HB3  . PRO A 1 27  ? -6.194  14.818  -4.251  1.00 10.00 ? 27  PRO A HB3  4  
ATOM   7013  H  HG2  . PRO A 1 27  ? -6.891  11.868  -4.080  1.00 10.00 ? 27  PRO A HG2  4  
ATOM   7014  H  HG3  . PRO A 1 27  ? -7.592  13.207  -3.123  1.00 10.00 ? 27  PRO A HG3  4  
ATOM   7015  H  HD2  . PRO A 1 27  ? -8.787  12.229  -5.358  1.00 10.00 ? 27  PRO A HD2  4  
ATOM   7016  H  HD3  . PRO A 1 27  ? -8.856  13.976  -4.981  1.00 10.00 ? 27  PRO A HD3  4  
ATOM   7017  N  N    . VAL A 1 28  ? -3.890  12.580  -6.656  1.00 10.00 ? 28  VAL A N    4  
ATOM   7018  C  CA   . VAL A 1 28  ? -3.055  11.593  -7.334  1.00 10.00 ? 28  VAL A CA   4  
ATOM   7019  C  C    . VAL A 1 28  ? -2.665  10.438  -6.410  1.00 10.00 ? 28  VAL A C    4  
ATOM   7020  O  O    . VAL A 1 28  ? -1.497  10.074  -6.304  1.00 10.00 ? 28  VAL A O    4  
ATOM   7021  C  CB   . VAL A 1 28  ? -1.809  12.309  -7.894  1.00 10.00 ? 28  VAL A CB   4  
ATOM   7022  C  CG1  . VAL A 1 28  ? -2.196  13.312  -8.982  1.00 10.00 ? 28  VAL A CG1  4  
ATOM   7023  C  CG2  . VAL A 1 28  ? -0.969  13.050  -6.839  1.00 10.00 ? 28  VAL A CG2  4  
ATOM   7024  H  H    . VAL A 1 28  ? -3.490  13.483  -6.465  1.00 10.00 ? 28  VAL A H    4  
ATOM   7025  H  HA   . VAL A 1 28  ? -3.609  11.144  -8.158  1.00 10.00 ? 28  VAL A HA   4  
ATOM   7026  H  HB   . VAL A 1 28  ? -1.179  11.551  -8.347  1.00 10.00 ? 28  VAL A HB   4  
ATOM   7027  H  HG11 . VAL A 1 28  ? -1.300  13.689  -9.475  1.00 10.00 ? 28  VAL A HG11 4  
ATOM   7028  H  HG12 . VAL A 1 28  ? -2.838  12.839  -9.724  1.00 10.00 ? 28  VAL A HG12 4  
ATOM   7029  H  HG13 . VAL A 1 28  ? -2.727  14.149  -8.530  1.00 10.00 ? 28  VAL A HG13 4  
ATOM   7030  H  HG21 . VAL A 1 28  ? -0.054  13.409  -7.309  1.00 10.00 ? 28  VAL A HG21 4  
ATOM   7031  H  HG22 . VAL A 1 28  ? -1.510  13.905  -6.435  1.00 10.00 ? 28  VAL A HG22 4  
ATOM   7032  H  HG23 . VAL A 1 28  ? -0.688  12.392  -6.018  1.00 10.00 ? 28  VAL A HG23 4  
ATOM   7033  N  N    . THR A 1 29  ? -3.659  9.813   -5.783  1.00 10.00 ? 29  THR A N    4  
ATOM   7034  C  CA   . THR A 1 29  ? -3.460  8.750   -4.816  1.00 10.00 ? 29  THR A CA   4  
ATOM   7035  C  C    . THR A 1 29  ? -4.737  7.914   -4.740  1.00 10.00 ? 29  THR A C    4  
ATOM   7036  O  O    . THR A 1 29  ? -5.368  7.871   -3.686  1.00 10.00 ? 29  THR A O    4  
ATOM   7037  C  CB   . THR A 1 29  ? -3.065  9.326   -3.437  1.00 10.00 ? 29  THR A CB   4  
ATOM   7038  O  OG1  . THR A 1 29  ? -4.066  10.187  -2.924  1.00 10.00 ? 29  THR A OG1  4  
ATOM   7039  C  CG2  . THR A 1 29  ? -1.736  10.083  -3.414  1.00 10.00 ? 29  THR A CG2  4  
ATOM   7040  H  H    . THR A 1 29  ? -4.608  10.102  -5.997  1.00 10.00 ? 29  THR A H    4  
ATOM   7041  H  HA   . THR A 1 29  ? -2.662  8.089   -5.160  1.00 10.00 ? 29  THR A HA   4  
ATOM   7042  H  HB   . THR A 1 29  ? -2.965  8.475   -2.766  1.00 10.00 ? 29  THR A HB   4  
ATOM   7043  H  HG1  . THR A 1 29  ? -4.880  9.661   -2.912  1.00 10.00 ? 29  THR A HG1  4  
ATOM   7044  H  HG21 . THR A 1 29  ? -0.959  9.477   -3.882  1.00 10.00 ? 29  THR A HG21 4  
ATOM   7045  H  HG22 . THR A 1 29  ? -1.825  11.033  -3.942  1.00 10.00 ? 29  THR A HG22 4  
ATOM   7046  H  HG23 . THR A 1 29  ? -1.448  10.280  -2.381  1.00 10.00 ? 29  THR A HG23 4  
ATOM   7047  N  N    . VAL A 1 30  ? -5.124  7.277   -5.850  1.00 10.00 ? 30  VAL A N    4  
ATOM   7048  C  CA   . VAL A 1 30  ? -6.279  6.384   -5.912  1.00 10.00 ? 30  VAL A CA   4  
ATOM   7049  C  C    . VAL A 1 30  ? -5.793  4.939   -6.058  1.00 10.00 ? 30  VAL A C    4  
ATOM   7050  O  O    . VAL A 1 30  ? -6.089  4.256   -7.034  1.00 10.00 ? 30  VAL A O    4  
ATOM   7051  C  CB   . VAL A 1 30  ? -7.287  6.871   -6.976  1.00 10.00 ? 30  VAL A CB   4  
ATOM   7052  C  CG1  . VAL A 1 30  ? -6.726  6.932   -8.404  1.00 10.00 ? 30  VAL A CG1  4  
ATOM   7053  C  CG2  . VAL A 1 30  ? -8.588  6.053   -6.944  1.00 10.00 ? 30  VAL A CG2  4  
ATOM   7054  H  H    . VAL A 1 30  ? -4.565  7.378   -6.684  1.00 10.00 ? 30  VAL A H    4  
ATOM   7055  H  HA   . VAL A 1 30  ? -6.810  6.418   -4.963  1.00 10.00 ? 30  VAL A HA   4  
ATOM   7056  H  HB   . VAL A 1 30  ? -7.556  7.891   -6.698  1.00 10.00 ? 30  VAL A HB   4  
ATOM   7057  H  HG11 . VAL A 1 30  ? -7.486  7.329   -9.076  1.00 10.00 ? 30  VAL A HG11 4  
ATOM   7058  H  HG12 . VAL A 1 30  ? -5.861  7.593   -8.435  1.00 10.00 ? 30  VAL A HG12 4  
ATOM   7059  H  HG13 . VAL A 1 30  ? -6.444  5.944   -8.762  1.00 10.00 ? 30  VAL A HG13 4  
ATOM   7060  H  HG21 . VAL A 1 30  ? -8.422  5.028   -7.274  1.00 10.00 ? 30  VAL A HG21 4  
ATOM   7061  H  HG22 . VAL A 1 30  ? -8.993  6.039   -5.932  1.00 10.00 ? 30  VAL A HG22 4  
ATOM   7062  H  HG23 . VAL A 1 30  ? -9.327  6.503   -7.606  1.00 10.00 ? 30  VAL A HG23 4  
ATOM   7063  N  N    . GLN A 1 31  ? -5.020  4.480   -5.071  1.00 10.00 ? 31  GLN A N    4  
ATOM   7064  C  CA   . GLN A 1 31  ? -4.470  3.136   -5.029  1.00 10.00 ? 31  GLN A CA   4  
ATOM   7065  C  C    . GLN A 1 31  ? -4.667  2.507   -3.648  1.00 10.00 ? 31  GLN A C    4  
ATOM   7066  O  O    . GLN A 1 31  ? -4.554  3.188   -2.631  1.00 10.00 ? 31  GLN A O    4  
ATOM   7067  C  CB   . GLN A 1 31  ? -2.986  3.223   -5.400  1.00 10.00 ? 31  GLN A CB   4  
ATOM   7068  C  CG   . GLN A 1 31  ? -2.295  1.858   -5.378  1.00 10.00 ? 31  GLN A CG   4  
ATOM   7069  C  CD   . GLN A 1 31  ? -3.010  0.840   -6.262  1.00 10.00 ? 31  GLN A CD   4  
ATOM   7070  O  OE1  . GLN A 1 31  ? -3.672  -0.064  -5.764  1.00 10.00 ? 31  GLN A OE1  4  
ATOM   7071  N  NE2  . GLN A 1 31  ? -2.923  1.001   -7.573  1.00 10.00 ? 31  GLN A NE2  4  
ATOM   7072  H  H    . GLN A 1 31  ? -4.768  5.104   -4.321  1.00 10.00 ? 31  GLN A H    4  
ATOM   7073  H  HA   . GLN A 1 31  ? -4.989  2.515   -5.760  1.00 10.00 ? 31  GLN A HA   4  
ATOM   7074  H  HB2  . GLN A 1 31  ? -2.907  3.652   -6.400  1.00 10.00 ? 31  GLN A HB2  4  
ATOM   7075  H  HB3  . GLN A 1 31  ? -2.473  3.884   -4.699  1.00 10.00 ? 31  GLN A HB3  4  
ATOM   7076  H  HG2  . GLN A 1 31  ? -1.271  1.993   -5.718  1.00 10.00 ? 31  GLN A HG2  4  
ATOM   7077  H  HG3  . GLN A 1 31  ? -2.257  1.482   -4.356  1.00 10.00 ? 31  GLN A HG3  4  
ATOM   7078  H  HE21 . GLN A 1 31  ? -2.433  1.817   -7.934  1.00 10.00 ? 31  GLN A HE21 4  
ATOM   7079  H  HE22 . GLN A 1 31  ? -3.415  0.369   -8.185  1.00 10.00 ? 31  GLN A HE22 4  
ATOM   7080  N  N    . GLY A 1 32  ? -4.915  1.194   -3.625  1.00 10.00 ? 32  GLY A N    4  
ATOM   7081  C  CA   . GLY A 1 32  ? -4.972  0.375   -2.428  1.00 10.00 ? 32  GLY A CA   4  
ATOM   7082  C  C    . GLY A 1 32  ? -3.602  -0.252  -2.192  1.00 10.00 ? 32  GLY A C    4  
ATOM   7083  O  O    . GLY A 1 32  ? -3.335  -1.355  -2.663  1.00 10.00 ? 32  GLY A O    4  
ATOM   7084  H  H    . GLY A 1 32  ? -4.892  0.686   -4.503  1.00 10.00 ? 32  GLY A H    4  
ATOM   7085  H  HA2  . GLY A 1 32  ? -5.290  0.951   -1.558  1.00 10.00 ? 32  GLY A HA2  4  
ATOM   7086  H  HA3  . GLY A 1 32  ? -5.689  -0.425  -2.605  1.00 10.00 ? 32  GLY A HA3  4  
ATOM   7087  N  N    . ALA A 1 33  ? -2.720  0.468   -1.495  1.00 10.00 ? 33  ALA A N    4  
ATOM   7088  C  CA   . ALA A 1 33  ? -1.367  0.005   -1.217  1.00 10.00 ? 33  ALA A CA   4  
ATOM   7089  C  C    . ALA A 1 33  ? -1.359  -1.380  -0.566  1.00 10.00 ? 33  ALA A C    4  
ATOM   7090  O  O    . ALA A 1 33  ? -2.181  -1.659  0.309   1.00 10.00 ? 33  ALA A O    4  
ATOM   7091  C  CB   . ALA A 1 33  ? -0.643  1.030   -0.341  1.00 10.00 ? 33  ALA A CB   4  
ATOM   7092  H  H    . ALA A 1 33  ? -3.009  1.370   -1.143  1.00 10.00 ? 33  ALA A H    4  
ATOM   7093  H  HA   . ALA A 1 33  ? -0.838  -0.074  -2.162  1.00 10.00 ? 33  ALA A HA   4  
ATOM   7094  H  HB1  . ALA A 1 33  ? -0.614  1.995   -0.847  1.00 10.00 ? 33  ALA A HB1  4  
ATOM   7095  H  HB2  . ALA A 1 33  ? -1.168  1.142   0.608   1.00 10.00 ? 33  ALA A HB2  4  
ATOM   7096  H  HB3  . ALA A 1 33  ? 0.377   0.697   -0.149  1.00 10.00 ? 33  ALA A HB3  4  
ATOM   7097  N  N    . THR A 1 34  ? -0.413  -2.234  -0.974  1.00 10.00 ? 34  THR A N    4  
ATOM   7098  C  CA   . THR A 1 34  ? -0.169  -3.514  -0.329  1.00 10.00 ? 34  THR A CA   4  
ATOM   7099  C  C    . THR A 1 34  ? 1.242   -3.490  0.235   1.00 10.00 ? 34  THR A C    4  
ATOM   7100  O  O    . THR A 1 34  ? 2.127   -2.942  -0.423  1.00 10.00 ? 34  THR A O    4  
ATOM   7101  C  CB   . THR A 1 34  ? -0.384  -4.695  -1.290  1.00 10.00 ? 34  THR A CB   4  
ATOM   7102  O  OG1  . THR A 1 34  ? 0.689   -4.919  -2.182  1.00 10.00 ? 34  THR A OG1  4  
ATOM   7103  C  CG2  . THR A 1 34  ? -1.669  -4.515  -2.100  1.00 10.00 ? 34  THR A CG2  4  
ATOM   7104  H  H    . THR A 1 34  ? 0.269   -1.942  -1.661  1.00 10.00 ? 34  THR A H    4  
ATOM   7105  H  HA   . THR A 1 34  ? -0.874  -3.633  0.487   1.00 10.00 ? 34  THR A HA   4  
ATOM   7106  H  HB   . THR A 1 34  ? -0.458  -5.593  -0.678  1.00 10.00 ? 34  THR A HB   4  
ATOM   7107  H  HG1  . THR A 1 34  ? 0.850   -4.126  -2.711  1.00 10.00 ? 34  THR A HG1  4  
ATOM   7108  H  HG21 . THR A 1 34  ? -1.554  -3.678  -2.792  1.00 10.00 ? 34  THR A HG21 4  
ATOM   7109  H  HG22 . THR A 1 34  ? -1.872  -5.419  -2.671  1.00 10.00 ? 34  THR A HG22 4  
ATOM   7110  H  HG23 . THR A 1 34  ? -2.502  -4.308  -1.428  1.00 10.00 ? 34  THR A HG23 4  
ATOM   7111  N  N    . VAL A 1 35  ? 1.447   -4.052  1.430   1.00 10.00 ? 35  VAL A N    4  
ATOM   7112  C  CA   . VAL A 1 35  ? 2.765   -4.257  2.011   1.00 10.00 ? 35  VAL A CA   4  
ATOM   7113  C  C    . VAL A 1 35  ? 3.036   -5.751  2.060   1.00 10.00 ? 35  VAL A C    4  
ATOM   7114  O  O    . VAL A 1 35  ? 2.173   -6.523  2.480   1.00 10.00 ? 35  VAL A O    4  
ATOM   7115  C  CB   . VAL A 1 35  ? 2.895   -3.617  3.403   1.00 10.00 ? 35  VAL A CB   4  
ATOM   7116  C  CG1  . VAL A 1 35  ? 4.359   -3.683  3.861   1.00 10.00 ? 35  VAL A CG1  4  
ATOM   7117  C  CG2  . VAL A 1 35  ? 2.449   -2.153  3.378   1.00 10.00 ? 35  VAL A CG2  4  
ATOM   7118  H  H    . VAL A 1 35  ? 0.661   -4.489  1.902   1.00 10.00 ? 35  VAL A H    4  
ATOM   7119  H  HA   . VAL A 1 35  ? 3.518   -3.811  1.374   1.00 10.00 ? 35  VAL A HA   4  
ATOM   7120  H  HB   . VAL A 1 35  ? 2.275   -4.156  4.121   1.00 10.00 ? 35  VAL A HB   4  
ATOM   7121  H  HG11 . VAL A 1 35  ? 4.654   -4.714  4.043   1.00 10.00 ? 35  VAL A HG11 4  
ATOM   7122  H  HG12 . VAL A 1 35  ? 5.007   -3.255  3.099   1.00 10.00 ? 35  VAL A HG12 4  
ATOM   7123  H  HG13 . VAL A 1 35  ? 4.497   -3.119  4.779   1.00 10.00 ? 35  VAL A HG13 4  
ATOM   7124  H  HG21 . VAL A 1 35  ? 2.995   -1.605  2.610   1.00 10.00 ? 35  VAL A HG21 4  
ATOM   7125  H  HG22 . VAL A 1 35  ? 1.385   -2.111  3.166   1.00 10.00 ? 35  VAL A HG22 4  
ATOM   7126  H  HG23 . VAL A 1 35  ? 2.625   -1.688  4.348   1.00 10.00 ? 35  VAL A HG23 4  
ATOM   7127  N  N    . ALA A 1 36  ? 4.236   -6.156  1.642   1.00 10.00 ? 36  ALA A N    4  
ATOM   7128  C  CA   . ALA A 1 36  ? 4.667   -7.525  1.780   1.00 10.00 ? 36  ALA A CA   4  
ATOM   7129  C  C    . ALA A 1 36  ? 4.751   -7.861  3.265   1.00 10.00 ? 36  ALA A C    4  
ATOM   7130  O  O    . ALA A 1 36  ? 5.460   -7.211  4.022   1.00 10.00 ? 36  ALA A O    4  
ATOM   7131  C  CB   . ALA A 1 36  ? 5.993   -7.740  1.047   1.00 10.00 ? 36  ALA A CB   4  
ATOM   7132  H  H    . ALA A 1 36  ? 4.924   -5.473  1.357   1.00 10.00 ? 36  ALA A H    4  
ATOM   7133  H  HA   . ALA A 1 36  ? 3.917   -8.155  1.314   1.00 10.00 ? 36  ALA A HA   4  
ATOM   7134  H  HB1  . ALA A 1 36  ? 6.370   -8.743  1.247   1.00 10.00 ? 36  ALA A HB1  4  
ATOM   7135  H  HB2  . ALA A 1 36  ? 5.832   -7.628  -0.025  1.00 10.00 ? 36  ALA A HB2  4  
ATOM   7136  H  HB3  . ALA A 1 36  ? 6.731   -7.008  1.369   1.00 10.00 ? 36  ALA A HB3  4  
ATOM   7137  N  N    . ALA A 1 37  ? 3.992   -8.867  3.686   1.00 10.00 ? 37  ALA A N    4  
ATOM   7138  C  CA   . ALA A 1 37  ? 3.992   -9.334  5.067   1.00 10.00 ? 37  ALA A CA   4  
ATOM   7139  C  C    . ALA A 1 37  ? 5.420   -9.642  5.524   1.00 10.00 ? 37  ALA A C    4  
ATOM   7140  O  O    . ALA A 1 37  ? 5.999   -8.935  6.345   1.00 10.00 ? 37  ALA A O    4  
ATOM   7141  C  CB   . ALA A 1 37  ? 3.056   -10.539 5.197   1.00 10.00 ? 37  ALA A CB   4  
ATOM   7142  H  H    . ALA A 1 37  ? 3.344   -9.238  3.012   1.00 10.00 ? 37  ALA A H    4  
ATOM   7143  H  HA   . ALA A 1 37  ? 3.617   -8.545  5.705   1.00 10.00 ? 37  ALA A HA   4  
ATOM   7144  H  HB1  . ALA A 1 37  ? 3.082   -10.919 6.217   1.00 10.00 ? 37  ALA A HB1  4  
ATOM   7145  H  HB2  . ALA A 1 37  ? 2.037   -10.232 4.961   1.00 10.00 ? 37  ALA A HB2  4  
ATOM   7146  H  HB3  . ALA A 1 37  ? 3.354   -11.331 4.510   1.00 10.00 ? 37  ALA A HB3  4  
ATOM   7147  N  N    . VAL A 1 38  ? 5.983   -10.699 4.944   1.00 10.00 ? 38  VAL A N    4  
ATOM   7148  C  CA   . VAL A 1 38  ? 7.375   -11.103 5.081   1.00 10.00 ? 38  VAL A CA   4  
ATOM   7149  C  C    . VAL A 1 38  ? 7.840   -11.634 3.715   1.00 10.00 ? 38  VAL A C    4  
ATOM   7150  O  O    . VAL A 1 38  ? 7.436   -12.736 3.325   1.00 10.00 ? 38  VAL A O    4  
ATOM   7151  C  CB   . VAL A 1 38  ? 7.515   -12.158 6.196   1.00 10.00 ? 38  VAL A CB   4  
ATOM   7152  C  CG1  . VAL A 1 38  ? 8.970   -12.623 6.322   1.00 10.00 ? 38  VAL A CG1  4  
ATOM   7153  C  CG2  . VAL A 1 38  ? 7.095   -11.576 7.552   1.00 10.00 ? 38  VAL A CG2  4  
ATOM   7154  H  H    . VAL A 1 38  ? 5.389   -11.222 4.329   1.00 10.00 ? 38  VAL A H    4  
ATOM   7155  H  HA   . VAL A 1 38  ? 7.978   -10.247 5.382   1.00 10.00 ? 38  VAL A HA   4  
ATOM   7156  H  HB   . VAL A 1 38  ? 6.887   -13.022 5.974   1.00 10.00 ? 38  VAL A HB   4  
ATOM   7157  H  HG11 . VAL A 1 38  ? 9.615   -11.762 6.493   1.00 10.00 ? 38  VAL A HG11 4  
ATOM   7158  H  HG12 . VAL A 1 38  ? 9.068   -13.314 7.159   1.00 10.00 ? 38  VAL A HG12 4  
ATOM   7159  H  HG13 . VAL A 1 38  ? 9.284   -13.139 5.416   1.00 10.00 ? 38  VAL A HG13 4  
ATOM   7160  H  HG21 . VAL A 1 38  ? 6.030   -11.344 7.547   1.00 10.00 ? 38  VAL A HG21 4  
ATOM   7161  H  HG22 . VAL A 1 38  ? 7.283   -12.300 8.344   1.00 10.00 ? 38  VAL A HG22 4  
ATOM   7162  H  HG23 . VAL A 1 38  ? 7.667   -10.670 7.758   1.00 10.00 ? 38  VAL A HG23 4  
ATOM   7163  N  N    . PRO A 1 39  ? 8.645   -10.874 2.952   1.00 10.00 ? 39  PRO A N    4  
ATOM   7164  C  CA   . PRO A 1 39  ? 9.270   -11.372 1.735   1.00 10.00 ? 39  PRO A CA   4  
ATOM   7165  C  C    . PRO A 1 39  ? 10.261  -12.492 2.078   1.00 10.00 ? 39  PRO A C    4  
ATOM   7166  O  O    . PRO A 1 39  ? 10.664  -12.614 3.237   1.00 10.00 ? 39  PRO A O    4  
ATOM   7167  C  CB   . PRO A 1 39  ? 10.014  -10.186 1.108   1.00 10.00 ? 39  PRO A CB   4  
ATOM   7168  C  CG   . PRO A 1 39  ? 9.627   -8.964  1.936   1.00 10.00 ? 39  PRO A CG   4  
ATOM   7169  C  CD   . PRO A 1 39  ? 9.077   -9.521  3.246   1.00 10.00 ? 39  PRO A CD   4  
ATOM   7170  H  HA   . PRO A 1 39  ? 8.493   -11.725 1.056   1.00 10.00 ? 39  PRO A HA   4  
ATOM   7171  H  HB2  . PRO A 1 39  ? 11.094  -10.329 1.178   1.00 10.00 ? 39  PRO A HB2  4  
ATOM   7172  H  HB3  . PRO A 1 39  ? 9.739   -10.045 0.061   1.00 10.00 ? 39  PRO A HB3  4  
ATOM   7173  H  HG2  . PRO A 1 39  ? 10.499  -8.334  2.106   1.00 10.00 ? 39  PRO A HG2  4  
ATOM   7174  H  HG3  . PRO A 1 39  ? 8.849   -8.403  1.417   1.00 10.00 ? 39  PRO A HG3  4  
ATOM   7175  H  HD2  . PRO A 1 39  ? 9.871   -9.554  3.996   1.00 10.00 ? 39  PRO A HD2  4  
ATOM   7176  H  HD3  . PRO A 1 39  ? 8.252   -8.895  3.589   1.00 10.00 ? 39  PRO A HD3  4  
ATOM   7177  N  N    . PRO A 1 40  ? 10.706  -13.283 1.088   1.00 10.00 ? 40  PRO A N    4  
ATOM   7178  C  CA   . PRO A 1 40  ? 11.749  -14.282 1.258   1.00 10.00 ? 40  PRO A CA   4  
ATOM   7179  C  C    . PRO A 1 40  ? 13.110  -13.591 1.358   1.00 10.00 ? 40  PRO A C    4  
ATOM   7180  O  O    . PRO A 1 40  ? 13.971  -13.701 0.490   1.00 10.00 ? 40  PRO A O    4  
ATOM   7181  C  CB   . PRO A 1 40  ? 11.620  -15.181 0.036   1.00 10.00 ? 40  PRO A CB   4  
ATOM   7182  C  CG   . PRO A 1 40  ? 11.176  -14.211 -1.058  1.00 10.00 ? 40  PRO A CG   4  
ATOM   7183  C  CD   . PRO A 1 40  ? 10.297  -13.211 -0.303  1.00 10.00 ? 40  PRO A CD   4  
ATOM   7184  H  HA   . PRO A 1 40  ? 11.585  -14.877 2.159   1.00 10.00 ? 40  PRO A HA   4  
ATOM   7185  H  HB2  . PRO A 1 40  ? 12.535  -15.720 -0.214  1.00 10.00 ? 40  PRO A HB2  4  
ATOM   7186  H  HB3  . PRO A 1 40  ? 10.815  -15.876 0.257   1.00 10.00 ? 40  PRO A HB3  4  
ATOM   7187  H  HG2  . PRO A 1 40  ? 12.046  -13.693 -1.465  1.00 10.00 ? 40  PRO A HG2  4  
ATOM   7188  H  HG3  . PRO A 1 40  ? 10.635  -14.712 -1.862  1.00 10.00 ? 40  PRO A HG3  4  
ATOM   7189  H  HD2  . PRO A 1 40  ? 10.460  -12.212 -0.703  1.00 10.00 ? 40  PRO A HD2  4  
ATOM   7190  H  HD3  . PRO A 1 40  ? 9.251   -13.500 -0.405  1.00 10.00 ? 40  PRO A HD3  4  
ATOM   7191  N  N    . SER A 1 41  ? 13.266  -12.852 2.449   1.00 10.00 ? 41  SER A N    4  
ATOM   7192  C  CA   . SER A 1 41  ? 14.434  -12.080 2.821   1.00 10.00 ? 41  SER A CA   4  
ATOM   7193  C  C    . SER A 1 41  ? 14.385  -11.917 4.341   1.00 10.00 ? 41  SER A C    4  
ATOM   7194  O  O    . SER A 1 41  ? 15.357  -12.227 5.026   1.00 10.00 ? 41  SER A O    4  
ATOM   7195  C  CB   . SER A 1 41  ? 14.425  -10.738 2.071   1.00 10.00 ? 41  SER A CB   4  
ATOM   7196  O  OG   . SER A 1 41  ? 15.610  -10.016 2.331   1.00 10.00 ? 41  SER A OG   4  
ATOM   7197  H  H    . SER A 1 41  ? 12.472  -12.844 3.078   1.00 10.00 ? 41  SER A H    4  
ATOM   7198  H  HA   . SER A 1 41  ? 15.333  -12.637 2.552   1.00 10.00 ? 41  SER A HA   4  
ATOM   7199  H  HB2  . SER A 1 41  ? 14.351  -10.915 0.996   1.00 10.00 ? 41  SER A HB2  4  
ATOM   7200  H  HB3  . SER A 1 41  ? 13.571  -10.133 2.380   1.00 10.00 ? 41  SER A HB3  4  
ATOM   7201  H  HG   . SER A 1 41  ? 16.367  -10.521 2.022   1.00 10.00 ? 41  SER A HG   4  
ATOM   7202  N  N    . ILE A 1 42  ? 13.210  -11.520 4.855   1.00 10.00 ? 42  ILE A N    4  
ATOM   7203  C  CA   . ILE A 1 42  ? 12.918  -11.300 6.261   1.00 10.00 ? 42  ILE A CA   4  
ATOM   7204  C  C    . ILE A 1 42  ? 13.629  -10.024 6.715   1.00 10.00 ? 42  ILE A C    4  
ATOM   7205  O  O    . ILE A 1 42  ? 14.673  -9.665  6.178   1.00 10.00 ? 42  ILE A O    4  
ATOM   7206  C  CB   . ILE A 1 42  ? 13.210  -12.546 7.127   1.00 10.00 ? 42  ILE A CB   4  
ATOM   7207  C  CG1  . ILE A 1 42  ? 12.630  -13.814 6.463   1.00 10.00 ? 42  ILE A CG1  4  
ATOM   7208  C  CG2  . ILE A 1 42  ? 12.596  -12.349 8.520   1.00 10.00 ? 42  ILE A CG2  4  
ATOM   7209  C  CD1  . ILE A 1 42  ? 12.777  -15.078 7.313   1.00 10.00 ? 42  ILE A CD1  4  
ATOM   7210  H  H    . ILE A 1 42  ? 12.461  -11.284 4.228   1.00 10.00 ? 42  ILE A H    4  
ATOM   7211  H  HA   . ILE A 1 42  ? 11.846  -11.115 6.308   1.00 10.00 ? 42  ILE A HA   4  
ATOM   7212  H  HB   . ILE A 1 42  ? 14.286  -12.670 7.248   1.00 10.00 ? 42  ILE A HB   4  
ATOM   7213  H  HG12 . ILE A 1 42  ? 11.574  -13.664 6.241   1.00 10.00 ? 42  ILE A HG12 4  
ATOM   7214  H  HG13 . ILE A 1 42  ? 13.152  -14.010 5.528   1.00 10.00 ? 42  ILE A HG13 4  
ATOM   7215  H  HG21 . ILE A 1 42  ? 11.517  -12.229 8.428   1.00 10.00 ? 42  ILE A HG21 4  
ATOM   7216  H  HG22 . ILE A 1 42  ? 12.816  -13.199 9.162   1.00 10.00 ? 42  ILE A HG22 4  
ATOM   7217  H  HG23 . ILE A 1 42  ? 13.020  -11.470 9.001   1.00 10.00 ? 42  ILE A HG23 4  
ATOM   7218  H  HD11 . ILE A 1 42  ? 12.099  -15.049 8.165   1.00 10.00 ? 42  ILE A HD11 4  
ATOM   7219  H  HD12 . ILE A 1 42  ? 12.523  -15.946 6.704   1.00 10.00 ? 42  ILE A HD12 4  
ATOM   7220  H  HD13 . ILE A 1 42  ? 13.806  -15.175 7.660   1.00 10.00 ? 42  ILE A HD13 4  
ATOM   7221  N  N    . ARG A 1 43  ? 13.032  -9.283  7.654   1.00 10.00 ? 43  ARG A N    4  
ATOM   7222  C  CA   . ARG A 1 43  ? 13.550  -8.042  8.196   1.00 10.00 ? 43  ARG A CA   4  
ATOM   7223  C  C    . ARG A 1 43  ? 13.373  -6.881  7.221   1.00 10.00 ? 43  ARG A C    4  
ATOM   7224  O  O    . ARG A 1 43  ? 12.866  -5.833  7.613   1.00 10.00 ? 43  ARG A O    4  
ATOM   7225  C  CB   . ARG A 1 43  ? 14.996  -8.223  8.652   1.00 10.00 ? 43  ARG A CB   4  
ATOM   7226  C  CG   . ARG A 1 43  ? 15.397  -7.117  9.614   1.00 10.00 ? 43  ARG A CG   4  
ATOM   7227  C  CD   . ARG A 1 43  ? 16.864  -7.353  9.983   1.00 10.00 ? 43  ARG A CD   4  
ATOM   7228  N  NE   . ARG A 1 43  ? 17.401  -6.290  10.849  1.00 10.00 ? 43  ARG A NE   4  
ATOM   7229  C  CZ   . ARG A 1 43  ? 17.187  -6.176  12.170  1.00 10.00 ? 43  ARG A CZ   4  
ATOM   7230  N  NH1  . ARG A 1 43  ? 16.386  -7.047  12.792  1.00 10.00 ? 43  ARG A NH1  4  
ATOM   7231  N  NH2  . ARG A 1 43  ? 17.772  -5.190  12.860  1.00 10.00 ? 43  ARG A NH2  4  
ATOM   7232  H  H    . ARG A 1 43  ? 12.159  -9.585  8.041   1.00 10.00 ? 43  ARG A H    4  
ATOM   7233  H  HA   . ARG A 1 43  ? 12.953  -7.831  9.082   1.00 10.00 ? 43  ARG A HA   4  
ATOM   7234  H  HB2  . ARG A 1 43  ? 15.069  -9.172  9.178   1.00 10.00 ? 43  ARG A HB2  4  
ATOM   7235  H  HB3  . ARG A 1 43  ? 15.678  -8.218  7.801   1.00 10.00 ? 43  ARG A HB3  4  
ATOM   7236  H  HG2  . ARG A 1 43  ? 15.284  -6.155  9.115   1.00 10.00 ? 43  ARG A HG2  4  
ATOM   7237  H  HG3  . ARG A 1 43  ? 14.730  -7.167  10.475  1.00 10.00 ? 43  ARG A HG3  4  
ATOM   7238  H  HD2  . ARG A 1 43  ? 16.982  -8.342  10.431  1.00 10.00 ? 43  ARG A HD2  4  
ATOM   7239  H  HD3  . ARG A 1 43  ? 17.434  -7.362  9.050   1.00 10.00 ? 43  ARG A HD3  4  
ATOM   7240  H  HE   . ARG A 1 43  ? 18.004  -5.619  10.391  1.00 10.00 ? 43  ARG A HE   4  
ATOM   7241  H  HH11 . ARG A 1 43  ? 15.944  -7.775  12.251  1.00 10.00 ? 43  ARG A HH11 4  
ATOM   7242  H  HH12 . ARG A 1 43  ? 16.201  -6.996  13.783  1.00 10.00 ? 43  ARG A HH12 4  
ATOM   7243  H  HH21 . ARG A 1 43  ? 18.385  -4.533  12.399  1.00 10.00 ? 43  ARG A HH21 4  
ATOM   7244  H  HH22 . ARG A 1 43  ? 17.627  -5.089  13.854  1.00 10.00 ? 43  ARG A HH22 4  
ATOM   7245  N  N    . ASP A 1 44  ? 13.776  -7.056  5.965   1.00 10.00 ? 44  ASP A N    4  
ATOM   7246  C  CA   . ASP A 1 44  ? 13.435  -6.120  4.909   1.00 10.00 ? 44  ASP A CA   4  
ATOM   7247  C  C    . ASP A 1 44  ? 12.006  -6.399  4.445   1.00 10.00 ? 44  ASP A C    4  
ATOM   7248  O  O    . ASP A 1 44  ? 11.522  -7.524  4.579   1.00 10.00 ? 44  ASP A O    4  
ATOM   7249  C  CB   . ASP A 1 44  ? 14.436  -6.213  3.751   1.00 10.00 ? 44  ASP A CB   4  
ATOM   7250  C  CG   . ASP A 1 44  ? 14.141  -5.182  2.667   1.00 10.00 ? 44  ASP A CG   4  
ATOM   7251  O  OD1  . ASP A 1 44  ? 13.523  -4.151  3.016   1.00 10.00 ? 44  ASP A OD1  4  
ATOM   7252  O  OD2  . ASP A 1 44  ? 14.533  -5.439  1.511   1.00 10.00 ? 44  ASP A OD2  4  
ATOM   7253  H  H    . ASP A 1 44  ? 14.127  -7.971  5.710   1.00 10.00 ? 44  ASP A H    4  
ATOM   7254  H  HA   . ASP A 1 44  ? 13.481  -5.114  5.318   1.00 10.00 ? 44  ASP A HA   4  
ATOM   7255  H  HB2  . ASP A 1 44  ? 15.445  -6.036  4.122   1.00 10.00 ? 44  ASP A HB2  4  
ATOM   7256  H  HB3  . ASP A 1 44  ? 14.394  -7.209  3.308   1.00 10.00 ? 44  ASP A HB3  4  
ATOM   7257  N  N    . THR A 1 45  ? 11.339  -5.379  3.909   1.00 10.00 ? 45  THR A N    4  
ATOM   7258  C  CA   . THR A 1 45  ? 10.041  -5.474  3.271   1.00 10.00 ? 45  THR A CA   4  
ATOM   7259  C  C    . THR A 1 45  ? 9.707   -4.136  2.610   1.00 10.00 ? 45  THR A C    4  
ATOM   7260  O  O    . THR A 1 45  ? 10.437  -3.156  2.754   1.00 10.00 ? 45  THR A O    4  
ATOM   7261  C  CB   . THR A 1 45  ? 8.941   -5.962  4.228   1.00 10.00 ? 45  THR A CB   4  
ATOM   7262  O  OG1  . THR A 1 45  ? 7.765   -6.098  3.467   1.00 10.00 ? 45  THR A OG1  4  
ATOM   7263  C  CG2  . THR A 1 45  ? 8.678   -5.030  5.411   1.00 10.00 ? 45  THR A CG2  4  
ATOM   7264  H  H    . THR A 1 45  ? 11.886  -4.539  3.691   1.00 10.00 ? 45  THR A H    4  
ATOM   7265  H  HA   . THR A 1 45  ? 10.142  -6.214  2.476   1.00 10.00 ? 45  THR A HA   4  
ATOM   7266  H  HB   . THR A 1 45  ? 9.189   -6.944  4.627   1.00 10.00 ? 45  THR A HB   4  
ATOM   7267  H  HG1  . THR A 1 45  ? 7.056   -6.436  4.029   1.00 10.00 ? 45  THR A HG1  4  
ATOM   7268  H  HG21 . THR A 1 45  ? 8.357   -4.050  5.060   1.00 10.00 ? 45  THR A HG21 4  
ATOM   7269  H  HG22 . THR A 1 45  ? 7.895   -5.451  6.042   1.00 10.00 ? 45  THR A HG22 4  
ATOM   7270  H  HG23 . THR A 1 45  ? 9.587   -4.925  6.005   1.00 10.00 ? 45  THR A HG23 4  
ATOM   7271  N  N    . ALA A 1 46  ? 8.614   -4.096  1.847   1.00 10.00 ? 46  ALA A N    4  
ATOM   7272  C  CA   . ALA A 1 46  ? 8.252   -2.962  1.026   1.00 10.00 ? 46  ALA A CA   4  
ATOM   7273  C  C    . ALA A 1 46  ? 6.762   -2.937  0.722   1.00 10.00 ? 46  ALA A C    4  
ATOM   7274  O  O    . ALA A 1 46  ? 6.081   -3.962  0.833   1.00 10.00 ? 46  ALA A O    4  
ATOM   7275  C  CB   . ALA A 1 46  ? 9.056   -3.031  -0.269  1.00 10.00 ? 46  ALA A CB   4  
ATOM   7276  H  H    . ALA A 1 46  ? 7.981   -4.886  1.877   1.00 10.00 ? 46  ALA A H    4  
ATOM   7277  H  HA   . ALA A 1 46  ? 8.477   -2.060  1.581   1.00 10.00 ? 46  ALA A HA   4  
ATOM   7278  H  HB1  . ALA A 1 46  ? 10.121  -2.993  -0.057  1.00 10.00 ? 46  ALA A HB1  4  
ATOM   7279  H  HB2  . ALA A 1 46  ? 8.837   -3.986  -0.725  1.00 10.00 ? 46  ALA A HB2  4  
ATOM   7280  H  HB3  . ALA A 1 46  ? 8.784   -2.229  -0.954  1.00 10.00 ? 46  ALA A HB3  4  
ATOM   7281  N  N    . ALA A 1 47  ? 6.288   -1.755  0.309   1.00 10.00 ? 47  ALA A N    4  
ATOM   7282  C  CA   . ALA A 1 47  ? 4.967   -1.591  -0.280  1.00 10.00 ? 47  ALA A CA   4  
ATOM   7283  C  C    . ALA A 1 47  ? 5.064   -1.743  -1.794  1.00 10.00 ? 47  ALA A C    4  
ATOM   7284  O  O    . ALA A 1 47  ? 6.034   -1.267  -2.384  1.00 10.00 ? 47  ALA A O    4  
ATOM   7285  C  CB   . ALA A 1 47  ? 4.333   -0.256  0.112   1.00 10.00 ? 47  ALA A CB   4  
ATOM   7286  H  H    . ALA A 1 47  ? 6.953   -0.993  0.214   1.00 10.00 ? 47  ALA A H    4  
ATOM   7287  H  HA   . ALA A 1 47  ? 4.337   -2.374  0.109   1.00 10.00 ? 47  ALA A HA   4  
ATOM   7288  H  HB1  . ALA A 1 47  ? 3.298   -0.247  -0.241  1.00 10.00 ? 47  ALA A HB1  4  
ATOM   7289  H  HB2  . ALA A 1 47  ? 4.337   -0.147  1.196   1.00 10.00 ? 47  ALA A HB2  4  
ATOM   7290  H  HB3  . ALA A 1 47  ? 4.881   0.569   -0.342  1.00 10.00 ? 47  ALA A HB3  4  
ATOM   7291  N  N    . TYR A 1 48  ? 4.077   -2.408  -2.407  1.00 10.00 ? 48  TYR A N    4  
ATOM   7292  C  CA   . TYR A 1 48  ? 4.062   -2.751  -3.819  1.00 10.00 ? 48  TYR A CA   4  
ATOM   7293  C  C    . TYR A 1 48  ? 2.660   -2.448  -4.348  1.00 10.00 ? 48  TYR A C    4  
ATOM   7294  O  O    . TYR A 1 48  ? 1.690   -3.032  -3.866  1.00 10.00 ? 48  TYR A O    4  
ATOM   7295  C  CB   . TYR A 1 48  ? 4.452   -4.205  -4.037  1.00 10.00 ? 48  TYR A CB   4  
ATOM   7296  C  CG   . TYR A 1 48  ? 5.855   -4.536  -3.569  1.00 10.00 ? 48  TYR A CG   4  
ATOM   7297  C  CD1  . TYR A 1 48  ? 6.966   -3.712  -3.864  1.00 10.00 ? 48  TYR A CD1  4  
ATOM   7298  C  CD2  . TYR A 1 48  ? 6.040   -5.683  -2.793  1.00 10.00 ? 48  TYR A CD2  4  
ATOM   7299  C  CE1  . TYR A 1 48  ? 8.264   -4.113  -3.515  1.00 10.00 ? 48  TYR A CE1  4  
ATOM   7300  C  CE2  . TYR A 1 48  ? 7.328   -6.037  -2.391  1.00 10.00 ? 48  TYR A CE2  4  
ATOM   7301  C  CZ   . TYR A 1 48  ? 8.448   -5.311  -2.815  1.00 10.00 ? 48  TYR A CZ   4  
ATOM   7302  O  OH   . TYR A 1 48  ? 9.697   -5.702  -2.435  1.00 10.00 ? 48  TYR A OH   4  
ATOM   7303  H  H    . TYR A 1 48  ? 3.229   -2.631  -1.890  1.00 10.00 ? 48  TYR A H    4  
ATOM   7304  H  HA   . TYR A 1 48  ? 4.846   -2.208  -4.324  1.00 10.00 ? 48  TYR A HA   4  
ATOM   7305  H  HB2  . TYR A 1 48  ? 3.724   -4.838  -3.527  1.00 10.00 ? 48  TYR A HB2  4  
ATOM   7306  H  HB3  . TYR A 1 48  ? 4.395   -4.420  -5.105  1.00 10.00 ? 48  TYR A HB3  4  
ATOM   7307  H  HD1  . TYR A 1 48  ? 6.862   -2.770  -4.377  1.00 10.00 ? 48  TYR A HD1  4  
ATOM   7308  H  HD2  . TYR A 1 48  ? 5.197   -6.280  -2.478  1.00 10.00 ? 48  TYR A HD2  4  
ATOM   7309  H  HE1  . TYR A 1 48  ? 9.103   -3.481  -3.764  1.00 10.00 ? 48  TYR A HE1  4  
ATOM   7310  H  HE2  . TYR A 1 48  ? 7.420   -6.819  -1.684  1.00 10.00 ? 48  TYR A HE2  4  
ATOM   7311  H  HH   . TYR A 1 48  ? 10.384  -5.087  -2.698  1.00 10.00 ? 48  TYR A HH   4  
ATOM   7312  N  N    . MET A 1 49  ? 2.533   -1.456  -5.227  1.00 10.00 ? 49  MET A N    4  
ATOM   7313  C  CA   . MET A 1 49  ? 1.270   -0.949  -5.741  1.00 10.00 ? 49  MET A CA   4  
ATOM   7314  C  C    . MET A 1 49  ? 1.530   -0.121  -7.002  1.00 10.00 ? 49  MET A C    4  
ATOM   7315  O  O    . MET A 1 49  ? 2.644   -0.127  -7.508  1.00 10.00 ? 49  MET A O    4  
ATOM   7316  C  CB   . MET A 1 49  ? 0.451   -0.243  -4.651  1.00 10.00 ? 49  MET A CB   4  
ATOM   7317  C  CG   . MET A 1 49  ? 1.055   1.044   -4.073  1.00 10.00 ? 49  MET A CG   4  
ATOM   7318  S  SD   . MET A 1 49  ? 2.488   0.825   -2.986  1.00 10.00 ? 49  MET A SD   4  
ATOM   7319  C  CE   . MET A 1 49  ? 2.594   2.480   -2.269  1.00 10.00 ? 49  MET A CE   4  
ATOM   7320  H  H    . MET A 1 49  ? 3.371   -1.139  -5.706  1.00 10.00 ? 49  MET A H    4  
ATOM   7321  H  HA   . MET A 1 49  ? 0.687   -1.813  -6.065  1.00 10.00 ? 49  MET A HA   4  
ATOM   7322  H  HB2  . MET A 1 49  ? -0.529  -0.030  -5.065  1.00 10.00 ? 49  MET A HB2  4  
ATOM   7323  H  HB3  . MET A 1 49  ? 0.296   -0.944  -3.834  1.00 10.00 ? 49  MET A HB3  4  
ATOM   7324  H  HG2  . MET A 1 49  ? 1.324   1.728   -4.875  1.00 10.00 ? 49  MET A HG2  4  
ATOM   7325  H  HG3  . MET A 1 49  ? 0.283   1.524   -3.474  1.00 10.00 ? 49  MET A HG3  4  
ATOM   7326  H  HE1  . MET A 1 49  ? 1.702   2.675   -1.676  1.00 10.00 ? 49  MET A HE1  4  
ATOM   7327  H  HE2  . MET A 1 49  ? 3.473   2.532   -1.628  1.00 10.00 ? 49  MET A HE2  4  
ATOM   7328  H  HE3  . MET A 1 49  ? 2.671   3.221   -3.061  1.00 10.00 ? 49  MET A HE3  4  
ATOM   7329  N  N    . THR A 1 50  ? 0.519   0.563   -7.539  1.00 10.00 ? 50  THR A N    4  
ATOM   7330  C  CA   . THR A 1 50  ? 0.643   1.433   -8.704  1.00 10.00 ? 50  THR A CA   4  
ATOM   7331  C  C    . THR A 1 50  ? 0.119   2.838   -8.365  1.00 10.00 ? 50  THR A C    4  
ATOM   7332  O  O    . THR A 1 50  ? -1.048  2.960   -8.006  1.00 10.00 ? 50  THR A O    4  
ATOM   7333  C  CB   . THR A 1 50  ? -0.154  0.779   -9.839  1.00 10.00 ? 50  THR A CB   4  
ATOM   7334  O  OG1  . THR A 1 50  ? 0.218   -0.580  -9.970  1.00 10.00 ? 50  THR A OG1  4  
ATOM   7335  C  CG2  . THR A 1 50  ? 0.091   1.487   -11.163 1.00 10.00 ? 50  THR A CG2  4  
ATOM   7336  H  H    . THR A 1 50  ? -0.400  0.457   -7.145  1.00 10.00 ? 50  THR A H    4  
ATOM   7337  H  HA   . THR A 1 50  ? 1.679   1.512   -9.023  1.00 10.00 ? 50  THR A HA   4  
ATOM   7338  H  HB   . THR A 1 50  ? -1.221  0.818   -9.620  1.00 10.00 ? 50  THR A HB   4  
ATOM   7339  H  HG1  . THR A 1 50  ? 1.178   -0.642  -9.987  1.00 10.00 ? 50  THR A HG1  4  
ATOM   7340  H  HG21 . THR A 1 50  ? -0.179  2.536   -11.062 1.00 10.00 ? 50  THR A HG21 4  
ATOM   7341  H  HG22 . THR A 1 50  ? 1.142   1.400   -11.430 1.00 10.00 ? 50  THR A HG22 4  
ATOM   7342  H  HG23 . THR A 1 50  ? -0.523  1.023   -11.933 1.00 10.00 ? 50  THR A HG23 4  
ATOM   7343  N  N    . LEU A 1 51  ? 0.922   3.904   -8.486  1.00 10.00 ? 51  LEU A N    4  
ATOM   7344  C  CA   . LEU A 1 51  ? 0.420   5.264   -8.270  1.00 10.00 ? 51  LEU A CA   4  
ATOM   7345  C  C    . LEU A 1 51  ? -0.238  5.719   -9.555  1.00 10.00 ? 51  LEU A C    4  
ATOM   7346  O  O    . LEU A 1 51  ? 0.315   5.508   -10.632 1.00 10.00 ? 51  LEU A O    4  
ATOM   7347  C  CB   . LEU A 1 51  ? 1.532   6.268   -7.934  1.00 10.00 ? 51  LEU A CB   4  
ATOM   7348  C  CG   . LEU A 1 51  ? 1.584   6.634   -6.441  1.00 10.00 ? 51  LEU A CG   4  
ATOM   7349  C  CD1  . LEU A 1 51  ? 1.653   5.437   -5.483  1.00 10.00 ? 51  LEU A CD1  4  
ATOM   7350  C  CD2  . LEU A 1 51  ? 2.773   7.557   -6.169  1.00 10.00 ? 51  LEU A CD2  4  
ATOM   7351  H  H    . LEU A 1 51  ? 1.805   3.795   -8.975  1.00 10.00 ? 51  LEU A H    4  
ATOM   7352  H  HA   . LEU A 1 51  ? -0.333  5.276   -7.475  1.00 10.00 ? 51  LEU A HA   4  
ATOM   7353  H  HB2  . LEU A 1 51  ? 2.475   5.936   -8.355  1.00 10.00 ? 51  LEU A HB2  4  
ATOM   7354  H  HB3  . LEU A 1 51  ? 1.308   7.211   -8.438  1.00 10.00 ? 51  LEU A HB3  4  
ATOM   7355  H  HG   . LEU A 1 51  ? 0.678   7.208   -6.236  1.00 10.00 ? 51  LEU A HG   4  
ATOM   7356  H  HD11 . LEU A 1 51  ? 2.593   4.909   -5.613  1.00 10.00 ? 51  LEU A HD11 4  
ATOM   7357  H  HD12 . LEU A 1 51  ? 1.601   5.799   -4.455  1.00 10.00 ? 51  LEU A HD12 4  
ATOM   7358  H  HD13 . LEU A 1 51  ? 0.827   4.746   -5.644  1.00 10.00 ? 51  LEU A HD13 4  
ATOM   7359  H  HD21 . LEU A 1 51  ? 3.708   7.021   -6.333  1.00 10.00 ? 51  LEU A HD21 4  
ATOM   7360  H  HD22 . LEU A 1 51  ? 2.722   8.415   -6.836  1.00 10.00 ? 51  LEU A HD22 4  
ATOM   7361  H  HD23 . LEU A 1 51  ? 2.742   7.909   -5.138  1.00 10.00 ? 51  LEU A HD23 4  
ATOM   7362  N  N    . THR A 1 52  ? -1.411  6.334   -9.410  1.00 10.00 ? 52  THR A N    4  
ATOM   7363  C  CA   . THR A 1 52  ? -2.317  6.654   -10.491 1.00 10.00 ? 52  THR A CA   4  
ATOM   7364  C  C    . THR A 1 52  ? -2.496  8.170   -10.588 1.00 10.00 ? 52  THR A C    4  
ATOM   7365  O  O    . THR A 1 52  ? -3.516  8.714   -10.163 1.00 10.00 ? 52  THR A O    4  
ATOM   7366  C  CB   . THR A 1 52  ? -3.632  5.915   -10.210 1.00 10.00 ? 52  THR A CB   4  
ATOM   7367  O  OG1  . THR A 1 52  ? -3.360  4.571   -9.866  1.00 10.00 ? 52  THR A OG1  4  
ATOM   7368  C  CG2  . THR A 1 52  ? -4.527  5.931   -11.447 1.00 10.00 ? 52  THR A CG2  4  
ATOM   7369  H  H    . THR A 1 52  ? -1.782  6.439   -8.476  1.00 10.00 ? 52  THR A H    4  
ATOM   7370  H  HA   . THR A 1 52  ? -1.923  6.298   -11.442 1.00 10.00 ? 52  THR A HA   4  
ATOM   7371  H  HB   . THR A 1 52  ? -4.137  6.377   -9.357  1.00 10.00 ? 52  THR A HB   4  
ATOM   7372  H  HG1  . THR A 1 52  ? -2.730  4.207   -10.492 1.00 10.00 ? 52  THR A HG1  4  
ATOM   7373  H  HG21 . THR A 1 52  ? -4.010  5.462   -12.284 1.00 10.00 ? 52  THR A HG21 4  
ATOM   7374  H  HG22 . THR A 1 52  ? -5.451  5.391   -11.239 1.00 10.00 ? 52  THR A HG22 4  
ATOM   7375  H  HG23 . THR A 1 52  ? -4.757  6.960   -11.705 1.00 10.00 ? 52  THR A HG23 4  
ATOM   7376  N  N    . ASN A 1 53  ? -1.520  8.862   -11.181 1.00 10.00 ? 53  ASN A N    4  
ATOM   7377  C  CA   . ASN A 1 53  ? -1.581  10.318  -11.277 1.00 10.00 ? 53  ASN A CA   4  
ATOM   7378  C  C    . ASN A 1 53  ? -2.489  10.725  -12.440 1.00 10.00 ? 53  ASN A C    4  
ATOM   7379  O  O    . ASN A 1 53  ? -2.085  10.713  -13.608 1.00 10.00 ? 53  ASN A O    4  
ATOM   7380  C  CB   . ASN A 1 53  ? -0.183  10.922  -11.443 1.00 10.00 ? 53  ASN A CB   4  
ATOM   7381  C  CG   . ASN A 1 53  ? 0.615   10.931  -10.139 1.00 10.00 ? 53  ASN A CG   4  
ATOM   7382  O  OD1  . ASN A 1 53  ? 0.553   9.999   -9.347  1.00 10.00 ? 53  ASN A OD1  4  
ATOM   7383  N  ND2  . ASN A 1 53  ? 1.349   12.008  -9.879  1.00 10.00 ? 53  ASN A ND2  4  
ATOM   7384  H  H    . ASN A 1 53  ? -0.660  8.378   -11.416 1.00 10.00 ? 53  ASN A H    4  
ATOM   7385  H  HA   . ASN A 1 53  ? -1.997  10.721  -10.355 1.00 10.00 ? 53  ASN A HA   4  
ATOM   7386  H  HB2  . ASN A 1 53  ? 0.354   10.365  -12.207 1.00 10.00 ? 53  ASN A HB2  4  
ATOM   7387  H  HB3  . ASN A 1 53  ? -0.296  11.953  -11.780 1.00 10.00 ? 53  ASN A HB3  4  
ATOM   7388  H  HD21 . ASN A 1 53  ? 1.312   12.820  -10.468 1.00 10.00 ? 53  ASN A HD21 4  
ATOM   7389  H  HD22 . ASN A 1 53  ? 1.854   12.036  -9.007  1.00 10.00 ? 53  ASN A HD22 4  
ATOM   7390  N  N    . LYS A 1 54  ? -3.731  11.098  -12.112 1.00 10.00 ? 54  LYS A N    4  
ATOM   7391  C  CA   . LYS A 1 54  ? -4.729  11.558  -13.074 1.00 10.00 ? 54  LYS A CA   4  
ATOM   7392  C  C    . LYS A 1 54  ? -4.968  13.058  -12.891 1.00 10.00 ? 54  LYS A C    4  
ATOM   7393  O  O    . LYS A 1 54  ? -6.110  13.498  -12.784 1.00 10.00 ? 54  LYS A O    4  
ATOM   7394  C  CB   . LYS A 1 54  ? -6.030  10.764  -12.877 1.00 10.00 ? 54  LYS A CB   4  
ATOM   7395  C  CG   . LYS A 1 54  ? -5.890  9.287   -13.263 1.00 10.00 ? 54  LYS A CG   4  
ATOM   7396  C  CD   . LYS A 1 54  ? -7.021  8.425   -12.673 1.00 10.00 ? 54  LYS A CD   4  
ATOM   7397  C  CE   . LYS A 1 54  ? -8.446  8.943   -12.932 1.00 10.00 ? 54  LYS A CE   4  
ATOM   7398  N  NZ   . LYS A 1 54  ? -8.765  9.057   -14.369 1.00 10.00 ? 54  LYS A NZ   4  
ATOM   7399  H  H    . LYS A 1 54  ? -3.975  11.105  -11.127 1.00 10.00 ? 54  LYS A H    4  
ATOM   7400  H  HA   . LYS A 1 54  ? -4.399  11.407  -14.099 1.00 10.00 ? 54  LYS A HA   4  
ATOM   7401  H  HB2  . LYS A 1 54  ? -6.310  10.849  -11.828 1.00 10.00 ? 54  LYS A HB2  4  
ATOM   7402  H  HB3  . LYS A 1 54  ? -6.818  11.205  -13.489 1.00 10.00 ? 54  LYS A HB3  4  
ATOM   7403  H  HG2  . LYS A 1 54  ? -5.855  9.193   -14.348 1.00 10.00 ? 54  LYS A HG2  4  
ATOM   7404  H  HG3  . LYS A 1 54  ? -4.946  8.910   -12.868 1.00 10.00 ? 54  LYS A HG3  4  
ATOM   7405  H  HD2  . LYS A 1 54  ? -6.924  7.405   -13.051 1.00 10.00 ? 54  LYS A HD2  4  
ATOM   7406  H  HD3  . LYS A 1 54  ? -6.877  8.380   -11.590 1.00 10.00 ? 54  LYS A HD3  4  
ATOM   7407  H  HE2  . LYS A 1 54  ? -9.152  8.250   -12.469 1.00 10.00 ? 54  LYS A HE2  4  
ATOM   7408  H  HE3  . LYS A 1 54  ? -8.580  9.917   -12.458 1.00 10.00 ? 54  LYS A HE3  4  
ATOM   7409  H  HZ1  . LYS A 1 54  ? -8.150  9.727   -14.806 1.00 10.00 ? 54  LYS A HZ1  4  
ATOM   7410  H  HZ2  . LYS A 1 54  ? -8.667  8.159   -14.824 1.00 10.00 ? 54  LYS A HZ2  4  
ATOM   7411  H  HZ3  . LYS A 1 54  ? -9.719  9.374   -14.480 1.00 10.00 ? 54  LYS A HZ3  4  
ATOM   7412  N  N    . SER A 1 55  ? -3.891  13.842  -12.950 1.00 10.00 ? 55  SER A N    4  
ATOM   7413  C  CA   . SER A 1 55  ? -3.927  15.294  -12.897 1.00 10.00 ? 55  SER A CA   4  
ATOM   7414  C  C    . SER A 1 55  ? -2.493  15.797  -13.048 1.00 10.00 ? 55  SER A C    4  
ATOM   7415  O  O    . SER A 1 55  ? -1.550  15.120  -12.630 1.00 10.00 ? 55  SER A O    4  
ATOM   7416  C  CB   . SER A 1 55  ? -4.559  15.789  -11.590 1.00 10.00 ? 55  SER A CB   4  
ATOM   7417  O  OG   . SER A 1 55  ? -3.975  15.135  -10.484 1.00 10.00 ? 55  SER A OG   4  
ATOM   7418  H  H    . SER A 1 55  ? -2.970  13.429  -12.991 1.00 10.00 ? 55  SER A H    4  
ATOM   7419  H  HA   . SER A 1 55  ? -4.521  15.658  -13.737 1.00 10.00 ? 55  SER A HA   4  
ATOM   7420  H  HB2  . SER A 1 55  ? -4.419  16.865  -11.504 1.00 10.00 ? 55  SER A HB2  4  
ATOM   7421  H  HB3  . SER A 1 55  ? -5.632  15.596  -11.586 1.00 10.00 ? 55  SER A HB3  4  
ATOM   7422  H  HG   . SER A 1 55  ? -3.032  15.321  -10.471 1.00 10.00 ? 55  SER A HG   4  
ATOM   7423  N  N    . ASP A 1 56  ? -2.335  16.967  -13.663 1.00 10.00 ? 56  ASP A N    4  
ATOM   7424  C  CA   . ASP A 1 56  ? -1.043  17.530  -14.005 1.00 10.00 ? 56  ASP A CA   4  
ATOM   7425  C  C    . ASP A 1 56  ? -0.526  18.370  -12.839 1.00 10.00 ? 56  ASP A C    4  
ATOM   7426  O  O    . ASP A 1 56  ? -0.546  19.601  -12.882 1.00 10.00 ? 56  ASP A O    4  
ATOM   7427  C  CB   . ASP A 1 56  ? -1.191  18.358  -15.282 1.00 10.00 ? 56  ASP A CB   4  
ATOM   7428  C  CG   . ASP A 1 56  ? 0.146   18.903  -15.767 1.00 10.00 ? 56  ASP A CG   4  
ATOM   7429  O  OD1  . ASP A 1 56  ? 1.179   18.359  -15.323 1.00 10.00 ? 56  ASP A OD1  4  
ATOM   7430  O  OD2  . ASP A 1 56  ? 0.103   19.833  -16.599 1.00 10.00 ? 56  ASP A OD2  4  
ATOM   7431  H  H    . ASP A 1 56  ? -3.147  17.498  -13.930 1.00 10.00 ? 56  ASP A H    4  
ATOM   7432  H  HA   . ASP A 1 56  ? -0.351  16.715  -14.212 1.00 10.00 ? 56  ASP A HA   4  
ATOM   7433  H  HB2  . ASP A 1 56  ? -1.609  17.737  -16.071 1.00 10.00 ? 56  ASP A HB2  4  
ATOM   7434  H  HB3  . ASP A 1 56  ? -1.856  19.199  -15.087 1.00 10.00 ? 56  ASP A HB3  4  
ATOM   7435  N  N    . GLN A 1 57  ? -0.167  17.707  -11.739 1.00 10.00 ? 57  GLN A N    4  
ATOM   7436  C  CA   . GLN A 1 57  ? 0.337   18.365  -10.541 1.00 10.00 ? 57  GLN A CA   4  
ATOM   7437  C  C    . GLN A 1 57  ? 1.653   17.698  -10.109 1.00 10.00 ? 57  GLN A C    4  
ATOM   7438  O  O    . GLN A 1 57  ? 1.678   16.476  -9.954  1.00 10.00 ? 57  GLN A O    4  
ATOM   7439  C  CB   . GLN A 1 57  ? -0.715  18.312  -9.421  1.00 10.00 ? 57  GLN A CB   4  
ATOM   7440  C  CG   . GLN A 1 57  ? -1.740  19.459  -9.464  1.00 10.00 ? 57  GLN A CG   4  
ATOM   7441  C  CD   . GLN A 1 57  ? -2.971  19.185  -10.321 1.00 10.00 ? 57  GLN A CD   4  
ATOM   7442  O  OE1  . GLN A 1 57  ? -3.952  18.631  -9.836  1.00 10.00 ? 57  GLN A OE1  4  
ATOM   7443  N  NE2  . GLN A 1 57  ? -2.968  19.601  -11.583 1.00 10.00 ? 57  GLN A NE2  4  
ATOM   7444  H  H    . GLN A 1 57  ? -0.221  16.696  -11.754 1.00 10.00 ? 57  GLN A H    4  
ATOM   7445  H  HA   . GLN A 1 57  ? 0.524   19.414  -10.755 1.00 10.00 ? 57  GLN A HA   4  
ATOM   7446  H  HB2  . GLN A 1 57  ? -1.215  17.339  -9.393  1.00 10.00 ? 57  GLN A HB2  4  
ATOM   7447  H  HB3  . GLN A 1 57  ? -0.183  18.453  -8.482  1.00 10.00 ? 57  GLN A HB3  4  
ATOM   7448  H  HG2  . GLN A 1 57  ? -2.106  19.607  -8.447  1.00 10.00 ? 57  GLN A HG2  4  
ATOM   7449  H  HG3  . GLN A 1 57  ? -1.267  20.391  -9.773  1.00 10.00 ? 57  GLN A HG3  4  
ATOM   7450  H  HE21 . GLN A 1 57  ? -2.123  19.999  -11.992 1.00 10.00 ? 57  GLN A HE21 4  
ATOM   7451  H  HE22 . GLN A 1 57  ? -3.805  19.512  -12.134 1.00 10.00 ? 57  GLN A HE22 4  
ATOM   7452  N  N    . PRO A 1 58  ? 2.742   18.462  -9.908  1.00 10.00 ? 58  PRO A N    4  
ATOM   7453  C  CA   . PRO A 1 58  ? 4.024   17.929  -9.479  1.00 10.00 ? 58  PRO A CA   4  
ATOM   7454  C  C    . PRO A 1 58  ? 4.037   17.711  -7.966  1.00 10.00 ? 58  PRO A C    4  
ATOM   7455  O  O    . PRO A 1 58  ? 4.256   18.663  -7.219  1.00 10.00 ? 58  PRO A O    4  
ATOM   7456  C  CB   . PRO A 1 58  ? 5.054   18.967  -9.930  1.00 10.00 ? 58  PRO A CB   4  
ATOM   7457  C  CG   . PRO A 1 58  ? 4.290   20.287  -9.834  1.00 10.00 ? 58  PRO A CG   4  
ATOM   7458  C  CD   . PRO A 1 58  ? 2.857   19.887  -10.193 1.00 10.00 ? 58  PRO A CD   4  
ATOM   7459  H  HA   . PRO A 1 58  ? 4.251   16.991  -9.962  1.00 10.00 ? 58  PRO A HA   4  
ATOM   7460  H  HB2  . PRO A 1 58  ? 5.956   18.959  -9.319  1.00 10.00 ? 58  PRO A HB2  4  
ATOM   7461  H  HB3  . PRO A 1 58  ? 5.311   18.783  -10.975 1.00 10.00 ? 58  PRO A HB3  4  
ATOM   7462  H  HG2  . PRO A 1 58  ? 4.319   20.661  -8.810  1.00 10.00 ? 58  PRO A HG2  4  
ATOM   7463  H  HG3  . PRO A 1 58  ? 4.687   21.042  -10.514 1.00 10.00 ? 58  PRO A HG3  4  
ATOM   7464  H  HD2  . PRO A 1 58  ? 2.155   20.478  -9.602  1.00 10.00 ? 58  PRO A HD2  4  
ATOM   7465  H  HD3  . PRO A 1 58  ? 2.695   20.060  -11.259 1.00 10.00 ? 58  PRO A HD3  4  
ATOM   7466  N  N    . ILE A 1 59  ? 3.833   16.473  -7.500  1.00 10.00 ? 59  ILE A N    4  
ATOM   7467  C  CA   . ILE A 1 59  ? 3.873   16.158  -6.075  1.00 10.00 ? 59  ILE A CA   4  
ATOM   7468  C  C    . ILE A 1 59  ? 5.259   15.591  -5.740  1.00 10.00 ? 59  ILE A C    4  
ATOM   7469  O  O    . ILE A 1 59  ? 5.855   14.843  -6.517  1.00 10.00 ? 59  ILE A O    4  
ATOM   7470  C  CB   . ILE A 1 59  ? 2.707   15.234  -5.646  1.00 10.00 ? 59  ILE A CB   4  
ATOM   7471  C  CG1  . ILE A 1 59  ? 1.349   15.959  -5.580  1.00 10.00 ? 59  ILE A CG1  4  
ATOM   7472  C  CG2  . ILE A 1 59  ? 2.951   14.630  -4.251  1.00 10.00 ? 59  ILE A CG2  4  
ATOM   7473  C  CD1  . ILE A 1 59  ? 0.813   16.412  -6.939  1.00 10.00 ? 59  ILE A CD1  4  
ATOM   7474  H  H    . ILE A 1 59  ? 3.806   15.699  -8.159  1.00 10.00 ? 59  ILE A H    4  
ATOM   7475  H  HA   . ILE A 1 59  ? 3.736   17.074  -5.504  1.00 10.00 ? 59  ILE A HA   4  
ATOM   7476  H  HB   . ILE A 1 59  ? 2.613   14.414  -6.349  1.00 10.00 ? 59  ILE A HB   4  
ATOM   7477  H  HG12 . ILE A 1 59  ? 0.611   15.270  -5.168  1.00 10.00 ? 59  ILE A HG12 4  
ATOM   7478  H  HG13 . ILE A 1 59  ? 1.416   16.821  -4.914  1.00 10.00 ? 59  ILE A HG13 4  
ATOM   7479  H  HG21 . ILE A 1 59  ? 2.091   14.033  -3.947  1.00 10.00 ? 59  ILE A HG21 4  
ATOM   7480  H  HG22 . ILE A 1 59  ? 3.819   13.972  -4.258  1.00 10.00 ? 59  ILE A HG22 4  
ATOM   7481  H  HG23 . ILE A 1 59  ? 3.103   15.425  -3.520  1.00 10.00 ? 59  ILE A HG23 4  
ATOM   7482  H  HD11 . ILE A 1 59  ? 1.374   17.276  -7.289  1.00 10.00 ? 59  ILE A HD11 4  
ATOM   7483  H  HD12 . ILE A 1 59  ? 0.885   15.605  -7.667  1.00 10.00 ? 59  ILE A HD12 4  
ATOM   7484  H  HD13 . ILE A 1 59  ? -0.234  16.699  -6.839  1.00 10.00 ? 59  ILE A HD13 4  
ATOM   7485  N  N    . LYS A 1 60  ? 5.778   15.959  -4.569  1.00 10.00 ? 60  LYS A N    4  
ATOM   7486  C  CA   . LYS A 1 60  ? 6.983   15.409  -3.985  1.00 10.00 ? 60  LYS A CA   4  
ATOM   7487  C  C    . LYS A 1 60  ? 6.662   14.931  -2.571  1.00 10.00 ? 60  LYS A C    4  
ATOM   7488  O  O    . LYS A 1 60  ? 6.635   15.705  -1.613  1.00 10.00 ? 60  LYS A O    4  
ATOM   7489  C  CB   . LYS A 1 60  ? 8.116   16.431  -4.065  1.00 10.00 ? 60  LYS A CB   4  
ATOM   7490  C  CG   . LYS A 1 60  ? 7.850   17.765  -3.361  1.00 10.00 ? 60  LYS A CG   4  
ATOM   7491  C  CD   . LYS A 1 60  ? 8.171   18.963  -4.259  1.00 10.00 ? 60  LYS A CD   4  
ATOM   7492  C  CE   . LYS A 1 60  ? 7.260   19.139  -5.489  1.00 10.00 ? 60  LYS A CE   4  
ATOM   7493  N  NZ   . LYS A 1 60  ? 5.826   19.212  -5.151  1.00 10.00 ? 60  LYS A NZ   4  
ATOM   7494  H  H    . LYS A 1 60  ? 5.237   16.582  -3.975  1.00 10.00 ? 60  LYS A H    4  
ATOM   7495  H  HA   . LYS A 1 60  ? 7.316   14.543  -4.561  1.00 10.00 ? 60  LYS A HA   4  
ATOM   7496  H  HB2  . LYS A 1 60  ? 9.025   15.988  -3.656  1.00 10.00 ? 60  LYS A HB2  4  
ATOM   7497  H  HB3  . LYS A 1 60  ? 8.278   16.621  -5.119  1.00 10.00 ? 60  LYS A HB3  4  
ATOM   7498  H  HG2  . LYS A 1 60  ? 6.839   17.832  -2.966  1.00 10.00 ? 60  LYS A HG2  4  
ATOM   7499  H  HG3  . LYS A 1 60  ? 8.538   17.801  -2.517  1.00 10.00 ? 60  LYS A HG3  4  
ATOM   7500  H  HD2  . LYS A 1 60  ? 8.124   19.860  -3.642  1.00 10.00 ? 60  LYS A HD2  4  
ATOM   7501  H  HD3  . LYS A 1 60  ? 9.197   18.826  -4.602  1.00 10.00 ? 60  LYS A HD3  4  
ATOM   7502  H  HE2  . LYS A 1 60  ? 7.537   20.060  -6.005  1.00 10.00 ? 60  LYS A HE2  4  
ATOM   7503  H  HE3  . LYS A 1 60  ? 7.396   18.310  -6.184  1.00 10.00 ? 60  LYS A HE3  4  
ATOM   7504  H  HZ1  . LYS A 1 60  ? 5.527   19.995  -4.567  1.00 10.00 ? 60  LYS A HZ1  4  
ATOM   7505  H  HZ2  . LYS A 1 60  ? 5.239   19.218  -5.979  1.00 10.00 ? 60  LYS A HZ2  4  
ATOM   7506  H  HZ3  . LYS A 1 60  ? 5.508   18.430  -4.585  1.00 10.00 ? 60  LYS A HZ3  4  
ATOM   7507  N  N    . LEU A 1 61  ? 6.406   13.630  -2.462  1.00 10.00 ? 61  LEU A N    4  
ATOM   7508  C  CA   . LEU A 1 61  ? 6.171   12.979  -1.185  1.00 10.00 ? 61  LEU A CA   4  
ATOM   7509  C  C    . LEU A 1 61  ? 7.531   12.697  -0.558  1.00 10.00 ? 61  LEU A C    4  
ATOM   7510  O  O    . LEU A 1 61  ? 8.432   12.266  -1.268  1.00 10.00 ? 61  LEU A O    4  
ATOM   7511  C  CB   . LEU A 1 61  ? 5.182   11.804  -1.304  1.00 10.00 ? 61  LEU A CB   4  
ATOM   7512  C  CG   . LEU A 1 61  ? 5.683   10.419  -1.743  1.00 10.00 ? 61  LEU A CG   4  
ATOM   7513  C  CD1  . LEU A 1 61  ? 6.347   10.423  -3.122  1.00 10.00 ? 61  LEU A CD1  4  
ATOM   7514  C  CD2  . LEU A 1 61  ? 6.569   9.771   -0.674  1.00 10.00 ? 61  LEU A CD2  4  
ATOM   7515  H  H    . LEU A 1 61  ? 6.536   13.070  -3.287  1.00 10.00 ? 61  LEU A H    4  
ATOM   7516  H  HA   . LEU A 1 61  ? 5.647   13.657  -0.540  1.00 10.00 ? 61  LEU A HA   4  
ATOM   7517  H  HB2  . LEU A 1 61  ? 4.713   11.675  -0.328  1.00 10.00 ? 61  LEU A HB2  4  
ATOM   7518  H  HB3  . LEU A 1 61  ? 4.389   12.106  -1.991  1.00 10.00 ? 61  LEU A HB3  4  
ATOM   7519  H  HG   . LEU A 1 61  ? 4.791   9.795   -1.821  1.00 10.00 ? 61  LEU A HG   4  
ATOM   7520  H  HD11 . LEU A 1 61  ? 6.575   9.399   -3.416  1.00 10.00 ? 61  LEU A HD11 4  
ATOM   7521  H  HD12 . LEU A 1 61  ? 5.671   10.858  -3.859  1.00 10.00 ? 61  LEU A HD12 4  
ATOM   7522  H  HD13 . LEU A 1 61  ? 7.272   10.995  -3.104  1.00 10.00 ? 61  LEU A HD13 4  
ATOM   7523  H  HD21 . LEU A 1 61  ? 7.613   10.036  -0.812  1.00 10.00 ? 61  LEU A HD21 4  
ATOM   7524  H  HD22 . LEU A 1 61  ? 6.243   10.102  0.313   1.00 10.00 ? 61  LEU A HD22 4  
ATOM   7525  H  HD23 . LEU A 1 61  ? 6.484   8.687   -0.739  1.00 10.00 ? 61  LEU A HD23 4  
ATOM   7526  N  N    . VAL A 1 62  ? 7.728   13.021  0.724   1.00 10.00 ? 62  VAL A N    4  
ATOM   7527  C  CA   . VAL A 1 62  ? 9.000   12.802  1.402   1.00 10.00 ? 62  VAL A CA   4  
ATOM   7528  C  C    . VAL A 1 62  ? 8.686   12.288  2.806   1.00 10.00 ? 62  VAL A C    4  
ATOM   7529  O  O    . VAL A 1 62  ? 9.150   12.819  3.813   1.00 10.00 ? 62  VAL A O    4  
ATOM   7530  C  CB   . VAL A 1 62  ? 9.828   14.109  1.424   1.00 10.00 ? 62  VAL A CB   4  
ATOM   7531  C  CG1  . VAL A 1 62  ? 11.264  13.846  1.906   1.00 10.00 ? 62  VAL A CG1  4  
ATOM   7532  C  CG2  . VAL A 1 62  ? 9.897   14.787  0.048   1.00 10.00 ? 62  VAL A CG2  4  
ATOM   7533  H  H    . VAL A 1 62  ? 6.986   13.424  1.287   1.00 10.00 ? 62  VAL A H    4  
ATOM   7534  H  HA   . VAL A 1 62  ? 9.574   12.027  0.893   1.00 10.00 ? 62  VAL A HA   4  
ATOM   7535  H  HB   . VAL A 1 62  ? 9.357   14.822  2.102   1.00 10.00 ? 62  VAL A HB   4  
ATOM   7536  H  HG11 . VAL A 1 62  ? 11.872  14.743  1.781   1.00 10.00 ? 62  VAL A HG11 4  
ATOM   7537  H  HG12 . VAL A 1 62  ? 11.288  13.577  2.960   1.00 10.00 ? 62  VAL A HG12 4  
ATOM   7538  H  HG13 . VAL A 1 62  ? 11.705  13.031  1.335   1.00 10.00 ? 62  VAL A HG13 4  
ATOM   7539  H  HG21 . VAL A 1 62  ? 10.566  15.646  0.087   1.00 10.00 ? 62  VAL A HG21 4  
ATOM   7540  H  HG22 . VAL A 1 62  ? 10.268  14.084  -0.694  1.00 10.00 ? 62  VAL A HG22 4  
ATOM   7541  H  HG23 . VAL A 1 62  ? 8.913   15.144  -0.253  1.00 10.00 ? 62  VAL A HG23 4  
ATOM   7542  N  N    . GLY A 1 63  ? 7.891   11.222  2.885   1.00 10.00 ? 63  GLY A N    4  
ATOM   7543  C  CA   . GLY A 1 63  ? 7.804   10.447  4.101   1.00 10.00 ? 63  GLY A CA   4  
ATOM   7544  C  C    . GLY A 1 63  ? 7.157   9.101   3.832   1.00 10.00 ? 63  GLY A C    4  
ATOM   7545  O  O    . GLY A 1 63  ? 6.406   8.949   2.871   1.00 10.00 ? 63  GLY A O    4  
ATOM   7546  H  H    . GLY A 1 63  ? 7.505   10.807  2.047   1.00 10.00 ? 63  GLY A H    4  
ATOM   7547  H  HA2  . GLY A 1 63  ? 8.823   10.257  4.452   1.00 10.00 ? 63  GLY A HA2  4  
ATOM   7548  H  HA3  . GLY A 1 63  ? 7.242   10.988  4.862   1.00 10.00 ? 63  GLY A HA3  4  
ATOM   7549  N  N    . ALA A 1 64  ? 7.419   8.170   4.740   1.00 10.00 ? 64  ALA A N    4  
ATOM   7550  C  CA   . ALA A 1 64  ? 6.668   6.964   5.022   1.00 10.00 ? 64  ALA A CA   4  
ATOM   7551  C  C    . ALA A 1 64  ? 7.057   6.628   6.463   1.00 10.00 ? 64  ALA A C    4  
ATOM   7552  O  O    . ALA A 1 64  ? 8.245   6.634   6.766   1.00 10.00 ? 64  ALA A O    4  
ATOM   7553  C  CB   . ALA A 1 64  ? 7.048   5.852   4.040   1.00 10.00 ? 64  ALA A CB   4  
ATOM   7554  H  H    . ALA A 1 64  ? 8.084   8.409   5.458   1.00 10.00 ? 64  ALA A H    4  
ATOM   7555  H  HA   . ALA A 1 64  ? 5.600   7.157   4.938   1.00 10.00 ? 64  ALA A HA   4  
ATOM   7556  H  HB1  . ALA A 1 64  ? 6.550   4.926   4.327   1.00 10.00 ? 64  ALA A HB1  4  
ATOM   7557  H  HB2  . ALA A 1 64  ? 6.732   6.127   3.034   1.00 10.00 ? 64  ALA A HB2  4  
ATOM   7558  H  HB3  . ALA A 1 64  ? 8.126   5.696   4.041   1.00 10.00 ? 64  ALA A HB3  4  
ATOM   7559  N  N    . ALA A 1 65  ? 6.105   6.431   7.373   1.00 10.00 ? 65  ALA A N    4  
ATOM   7560  C  CA   . ALA A 1 65  ? 6.368   6.156   8.780   1.00 10.00 ? 65  ALA A CA   4  
ATOM   7561  C  C    . ALA A 1 65  ? 5.197   5.344   9.321   1.00 10.00 ? 65  ALA A C    4  
ATOM   7562  O  O    . ALA A 1 65  ? 4.072   5.533   8.862   1.00 10.00 ? 65  ALA A O    4  
ATOM   7563  C  CB   . ALA A 1 65  ? 6.529   7.471   9.548   1.00 10.00 ? 65  ALA A CB   4  
ATOM   7564  H  H    . ALA A 1 65  ? 5.138   6.606   7.114   1.00 10.00 ? 65  ALA A H    4  
ATOM   7565  H  HA   . ALA A 1 65  ? 7.283   5.568   8.877   1.00 10.00 ? 65  ALA A HA   4  
ATOM   7566  H  HB1  . ALA A 1 65  ? 5.625   8.073   9.446   1.00 10.00 ? 65  ALA A HB1  4  
ATOM   7567  H  HB2  . ALA A 1 65  ? 6.704   7.261   10.603  1.00 10.00 ? 65  ALA A HB2  4  
ATOM   7568  H  HB3  . ALA A 1 65  ? 7.379   8.028   9.151   1.00 10.00 ? 65  ALA A HB3  4  
ATOM   7569  N  N    . THR A 1 66  ? 5.448   4.395   10.229  1.00 10.00 ? 66  THR A N    4  
ATOM   7570  C  CA   . THR A 1 66  ? 4.466   3.363   10.528  1.00 10.00 ? 66  THR A CA   4  
ATOM   7571  C  C    . THR A 1 66  ? 4.906   2.507   11.724  1.00 10.00 ? 66  THR A C    4  
ATOM   7572  O  O    . THR A 1 66  ? 6.107   2.375   11.988  1.00 10.00 ? 66  THR A O    4  
ATOM   7573  C  CB   . THR A 1 66  ? 4.274   2.497   9.264   1.00 10.00 ? 66  THR A CB   4  
ATOM   7574  O  OG1  . THR A 1 66  ? 3.476   1.364   9.525   1.00 10.00 ? 66  THR A OG1  4  
ATOM   7575  C  CG2  . THR A 1 66  ? 5.596   2.045   8.635   1.00 10.00 ? 66  THR A CG2  4  
ATOM   7576  H  H    . THR A 1 66  ? 6.382   4.259   10.590  1.00 10.00 ? 66  THR A H    4  
ATOM   7577  H  HA   . THR A 1 66  ? 3.526   3.860   10.770  1.00 10.00 ? 66  THR A HA   4  
ATOM   7578  H  HB   . THR A 1 66  ? 3.757   3.082   8.512   1.00 10.00 ? 66  THR A HB   4  
ATOM   7579  H  HG1  . THR A 1 66  ? 2.558   1.599   9.312   1.00 10.00 ? 66  THR A HG1  4  
ATOM   7580  H  HG21 . THR A 1 66  ? 6.216   1.550   9.376   1.00 10.00 ? 66  THR A HG21 4  
ATOM   7581  H  HG22 . THR A 1 66  ? 5.388   1.361   7.813   1.00 10.00 ? 66  THR A HG22 4  
ATOM   7582  H  HG23 . THR A 1 66  ? 6.144   2.894   8.228   1.00 10.00 ? 66  THR A HG23 4  
ATOM   7583  N  N    . PRO A 1 67  ? 3.961   1.864   12.433  1.00 10.00 ? 67  PRO A N    4  
ATOM   7584  C  CA   . PRO A 1 67  ? 4.268   0.783   13.357  1.00 10.00 ? 67  PRO A CA   4  
ATOM   7585  C  C    . PRO A 1 67  ? 4.789   -0.476  12.642  1.00 10.00 ? 67  PRO A C    4  
ATOM   7586  O  O    . PRO A 1 67  ? 5.196   -1.415  13.326  1.00 10.00 ? 67  PRO A O    4  
ATOM   7587  C  CB   . PRO A 1 67  ? 2.959   0.501   14.101  1.00 10.00 ? 67  PRO A CB   4  
ATOM   7588  C  CG   . PRO A 1 67  ? 1.893   0.887   13.078  1.00 10.00 ? 67  PRO A CG   4  
ATOM   7589  C  CD   . PRO A 1 67  ? 2.521   2.095   12.386  1.00 10.00 ? 67  PRO A CD   4  
ATOM   7590  H  HA   . PRO A 1 67  ? 5.018   1.104   14.081  1.00 10.00 ? 67  PRO A HA   4  
ATOM   7591  H  HB2  . PRO A 1 67  ? 2.866   -0.538  14.422  1.00 10.00 ? 67  PRO A HB2  4  
ATOM   7592  H  HB3  . PRO A 1 67  ? 2.881   1.165   14.963  1.00 10.00 ? 67  PRO A HB3  4  
ATOM   7593  H  HG2  . PRO A 1 67  ? 1.773   0.075   12.359  1.00 10.00 ? 67  PRO A HG2  4  
ATOM   7594  H  HG3  . PRO A 1 67  ? 0.934   1.124   13.542  1.00 10.00 ? 67  PRO A HG3  4  
ATOM   7595  H  HD2  . PRO A 1 67  ? 2.108   2.191   11.384  1.00 10.00 ? 67  PRO A HD2  4  
ATOM   7596  H  HD3  . PRO A 1 67  ? 2.294   2.996   12.957  1.00 10.00 ? 67  PRO A HD3  4  
ATOM   7597  N  N    . LEU A 1 68  ? 4.806   -0.515  11.301  1.00 10.00 ? 68  LEU A N    4  
ATOM   7598  C  CA   . LEU A 1 68  ? 5.204   -1.693  10.540  1.00 10.00 ? 68  LEU A CA   4  
ATOM   7599  C  C    . LEU A 1 68  ? 6.720   -1.933  10.607  1.00 10.00 ? 68  LEU A C    4  
ATOM   7600  O  O    . LEU A 1 68  ? 7.167   -3.001  11.027  1.00 10.00 ? 68  LEU A O    4  
ATOM   7601  C  CB   . LEU A 1 68  ? 4.685   -1.537  9.098   1.00 10.00 ? 68  LEU A CB   4  
ATOM   7602  C  CG   . LEU A 1 68  ? 4.619   -2.852  8.312   1.00 10.00 ? 68  LEU A CG   4  
ATOM   7603  C  CD1  . LEU A 1 68  ? 3.470   -2.784  7.300   1.00 10.00 ? 68  LEU A CD1  4  
ATOM   7604  C  CD2  . LEU A 1 68  ? 5.930   -3.191  7.595   1.00 10.00 ? 68  LEU A CD2  4  
ATOM   7605  H  H    . LEU A 1 68  ? 4.407   0.247   10.760  1.00 10.00 ? 68  LEU A H    4  
ATOM   7606  H  HA   . LEU A 1 68  ? 4.700   -2.551  10.988  1.00 10.00 ? 68  LEU A HA   4  
ATOM   7607  H  HB2  . LEU A 1 68  ? 3.664   -1.160  9.165   1.00 10.00 ? 68  LEU A HB2  4  
ATOM   7608  H  HB3  . LEU A 1 68  ? 5.270   -0.806  8.541   1.00 10.00 ? 68  LEU A HB3  4  
ATOM   7609  H  HG   . LEU A 1 68  ? 4.390   -3.651  9.006   1.00 10.00 ? 68  LEU A HG   4  
ATOM   7610  H  HD11 . LEU A 1 68  ? 3.407   -3.721  6.747   1.00 10.00 ? 68  LEU A HD11 4  
ATOM   7611  H  HD12 . LEU A 1 68  ? 2.524   -2.634  7.820   1.00 10.00 ? 68  LEU A HD12 4  
ATOM   7612  H  HD13 . LEU A 1 68  ? 3.631   -1.955  6.612   1.00 10.00 ? 68  LEU A HD13 4  
ATOM   7613  H  HD21 . LEU A 1 68  ? 6.719   -3.382  8.321   1.00 10.00 ? 68  LEU A HD21 4  
ATOM   7614  H  HD22 . LEU A 1 68  ? 5.797   -4.093  6.997   1.00 10.00 ? 68  LEU A HD22 4  
ATOM   7615  H  HD23 . LEU A 1 68  ? 6.226   -2.372  6.939   1.00 10.00 ? 68  LEU A HD23 4  
ATOM   7616  N  N    . ALA A 1 69  ? 7.515   -0.938  10.192  1.00 10.00 ? 69  ALA A N    4  
ATOM   7617  C  CA   . ALA A 1 69  ? 8.951   -1.069  9.953   1.00 10.00 ? 69  ALA A CA   4  
ATOM   7618  C  C    . ALA A 1 69  ? 9.730   0.129   10.495  1.00 10.00 ? 69  ALA A C    4  
ATOM   7619  O  O    . ALA A 1 69  ? 9.141   1.168   10.793  1.00 10.00 ? 69  ALA A O    4  
ATOM   7620  C  CB   . ALA A 1 69  ? 9.190   -1.185  8.456   1.00 10.00 ? 69  ALA A CB   4  
ATOM   7621  H  H    . ALA A 1 69  ? 7.087   -0.069  9.920   1.00 10.00 ? 69  ALA A H    4  
ATOM   7622  H  HA   . ALA A 1 69  ? 9.324   -1.971  10.434  1.00 10.00 ? 69  ALA A HA   4  
ATOM   7623  H  HB1  . ALA A 1 69  ? 8.633   -2.030  8.054   1.00 10.00 ? 69  ALA A HB1  4  
ATOM   7624  H  HB2  . ALA A 1 69  ? 8.868   -0.262  7.974   1.00 10.00 ? 69  ALA A HB2  4  
ATOM   7625  H  HB3  . ALA A 1 69  ? 10.253  -1.338  8.278   1.00 10.00 ? 69  ALA A HB3  4  
ATOM   7626  N  N    . THR A 1 70  ? 11.039  -0.037  10.691  1.00 10.00 ? 70  THR A N    4  
ATOM   7627  C  CA   . THR A 1 70  ? 11.897  0.899   11.413  1.00 10.00 ? 70  THR A CA   4  
ATOM   7628  C  C    . THR A 1 70  ? 12.566  1.899   10.468  1.00 10.00 ? 70  THR A C    4  
ATOM   7629  O  O    . THR A 1 70  ? 12.687  3.074   10.803  1.00 10.00 ? 70  THR A O    4  
ATOM   7630  C  CB   . THR A 1 70  ? 12.951  0.110   12.210  1.00 10.00 ? 70  THR A CB   4  
ATOM   7631  O  OG1  . THR A 1 70  ? 12.328  -0.924  12.944  1.00 10.00 ? 70  THR A OG1  4  
ATOM   7632  C  CG2  . THR A 1 70  ? 13.699  1.003   13.203  1.00 10.00 ? 70  THR A CG2  4  
ATOM   7633  H  H    . THR A 1 70  ? 11.440  -0.932  10.435  1.00 10.00 ? 70  THR A H    4  
ATOM   7634  H  HA   . THR A 1 70  ? 11.294  1.459   12.128  1.00 10.00 ? 70  THR A HA   4  
ATOM   7635  H  HB   . THR A 1 70  ? 13.675  -0.336  11.524  1.00 10.00 ? 70  THR A HB   4  
ATOM   7636  H  HG1  . THR A 1 70  ? 12.083  -1.633  12.336  1.00 10.00 ? 70  THR A HG1  4  
ATOM   7637  H  HG21 . THR A 1 70  ? 14.408  0.398   13.770  1.00 10.00 ? 70  THR A HG21 4  
ATOM   7638  H  HG22 . THR A 1 70  ? 14.249  1.785   12.679  1.00 10.00 ? 70  THR A HG22 4  
ATOM   7639  H  HG23 . THR A 1 70  ? 12.996  1.463   13.897  1.00 10.00 ? 70  THR A HG23 4  
ATOM   7640  N  N    . SER A 1 71  ? 13.030  1.423   9.310   1.00 10.00 ? 71  SER A N    4  
ATOM   7641  C  CA   . SER A 1 71  ? 13.833  2.164   8.348   1.00 10.00 ? 71  SER A CA   4  
ATOM   7642  C  C    . SER A 1 71  ? 13.049  2.316   7.034   1.00 10.00 ? 71  SER A C    4  
ATOM   7643  O  O    . SER A 1 71  ? 13.231  1.528   6.106   1.00 10.00 ? 71  SER A O    4  
ATOM   7644  C  CB   . SER A 1 71  ? 15.167  1.425   8.153   1.00 10.00 ? 71  SER A CB   4  
ATOM   7645  O  OG   . SER A 1 71  ? 16.128  2.274   7.554   1.00 10.00 ? 71  SER A OG   4  
ATOM   7646  H  H    . SER A 1 71  ? 12.827  0.460   9.073   1.00 10.00 ? 71  SER A H    4  
ATOM   7647  H  HA   . SER A 1 71  ? 14.085  3.146   8.744   1.00 10.00 ? 71  SER A HA   4  
ATOM   7648  H  HB2  . SER A 1 71  ? 15.552  1.099   9.120   1.00 10.00 ? 71  SER A HB2  4  
ATOM   7649  H  HB3  . SER A 1 71  ? 15.023  0.541   7.533   1.00 10.00 ? 71  SER A HB3  4  
ATOM   7650  H  HG   . SER A 1 71  ? 16.364  2.970   8.173   1.00 10.00 ? 71  SER A HG   4  
ATOM   7651  N  N    . PRO A 1 72  ? 12.148  3.304   6.944   1.00 10.00 ? 72  PRO A N    4  
ATOM   7652  C  CA   . PRO A 1 72  ? 11.403  3.584   5.729   1.00 10.00 ? 72  PRO A CA   4  
ATOM   7653  C  C    . PRO A 1 72  ? 12.295  4.316   4.726   1.00 10.00 ? 72  PRO A C    4  
ATOM   7654  O  O    . PRO A 1 72  ? 12.610  5.490   4.906   1.00 10.00 ? 72  PRO A O    4  
ATOM   7655  C  CB   . PRO A 1 72  ? 10.218  4.437   6.181   1.00 10.00 ? 72  PRO A CB   4  
ATOM   7656  C  CG   . PRO A 1 72  ? 10.759  5.177   7.406   1.00 10.00 ? 72  PRO A CG   4  
ATOM   7657  C  CD   . PRO A 1 72  ? 11.716  4.169   8.029   1.00 10.00 ? 72  PRO A CD   4  
ATOM   7658  H  HA   . PRO A 1 72  ? 11.048  2.663   5.266   1.00 10.00 ? 72  PRO A HA   4  
ATOM   7659  H  HB2  . PRO A 1 72  ? 9.889   5.123   5.402   1.00 10.00 ? 72  PRO A HB2  4  
ATOM   7660  H  HB3  . PRO A 1 72  ? 9.396   3.790   6.488   1.00 10.00 ? 72  PRO A HB3  4  
ATOM   7661  H  HG2  . PRO A 1 72  ? 11.311  6.062   7.085   1.00 10.00 ? 72  PRO A HG2  4  
ATOM   7662  H  HG3  . PRO A 1 72  ? 9.975   5.463   8.107   1.00 10.00 ? 72  PRO A HG3  4  
ATOM   7663  H  HD2  . PRO A 1 72  ? 12.539  4.698   8.510   1.00 10.00 ? 72  PRO A HD2  4  
ATOM   7664  H  HD3  . PRO A 1 72  ? 11.163  3.577   8.759   1.00 10.00 ? 72  PRO A HD3  4  
ATOM   7665  N  N    . MET A 1 73  ? 12.699  3.610   3.671   1.00 10.00 ? 73  MET A N    4  
ATOM   7666  C  CA   . MET A 1 73  ? 13.622  4.073   2.654   1.00 10.00 ? 73  MET A CA   4  
ATOM   7667  C  C    . MET A 1 73  ? 12.952  3.984   1.284   1.00 10.00 ? 73  MET A C    4  
ATOM   7668  O  O    . MET A 1 73  ? 12.522  2.916   0.852   1.00 10.00 ? 73  MET A O    4  
ATOM   7669  C  CB   . MET A 1 73  ? 14.863  3.184   2.702   1.00 10.00 ? 73  MET A CB   4  
ATOM   7670  C  CG   . MET A 1 73  ? 15.694  3.421   3.969   1.00 10.00 ? 73  MET A CG   4  
ATOM   7671  S  SD   . MET A 1 73  ? 16.448  5.064   4.088   1.00 10.00 ? 73  MET A SD   4  
ATOM   7672  C  CE   . MET A 1 73  ? 17.303  4.903   5.669   1.00 10.00 ? 73  MET A CE   4  
ATOM   7673  H  H    . MET A 1 73  ? 12.402  2.644   3.593   1.00 10.00 ? 73  MET A H    4  
ATOM   7674  H  HA   . MET A 1 73  ? 13.915  5.108   2.836   1.00 10.00 ? 73  MET A HA   4  
ATOM   7675  H  HB2  . MET A 1 73  ? 14.517  2.152   2.682   1.00 10.00 ? 73  MET A HB2  4  
ATOM   7676  H  HB3  . MET A 1 73  ? 15.483  3.376   1.827   1.00 10.00 ? 73  MET A HB3  4  
ATOM   7677  H  HG2  . MET A 1 73  ? 15.072  3.265   4.849   1.00 10.00 ? 73  MET A HG2  4  
ATOM   7678  H  HG3  . MET A 1 73  ? 16.497  2.686   3.994   1.00 10.00 ? 73  MET A HG3  4  
ATOM   7679  H  HE1  . MET A 1 73  ? 18.002  4.069   5.619   1.00 10.00 ? 73  MET A HE1  4  
ATOM   7680  H  HE2  . MET A 1 73  ? 17.843  5.825   5.875   1.00 10.00 ? 73  MET A HE2  4  
ATOM   7681  H  HE3  . MET A 1 73  ? 16.569  4.727   6.453   1.00 10.00 ? 73  MET A HE3  4  
ATOM   7682  N  N    . LEU A 1 74  ? 12.869  5.116   0.592   1.00 10.00 ? 74  LEU A N    4  
ATOM   7683  C  CA   . LEU A 1 74  ? 12.296  5.207   -0.742  1.00 10.00 ? 74  LEU A CA   4  
ATOM   7684  C  C    . LEU A 1 74  ? 13.359  4.813   -1.779  1.00 10.00 ? 74  LEU A C    4  
ATOM   7685  O  O    . LEU A 1 74  ? 14.521  5.195   -1.648  1.00 10.00 ? 74  LEU A O    4  
ATOM   7686  C  CB   . LEU A 1 74  ? 11.796  6.652   -0.939  1.00 10.00 ? 74  LEU A CB   4  
ATOM   7687  C  CG   . LEU A 1 74  ? 10.516  6.909   -0.113  1.00 10.00 ? 74  LEU A CG   4  
ATOM   7688  C  CD1  . LEU A 1 74  ? 10.284  8.394   0.188   1.00 10.00 ? 74  LEU A CD1  4  
ATOM   7689  C  CD2  . LEU A 1 74  ? 9.285   6.380   -0.853  1.00 10.00 ? 74  LEU A CD2  4  
ATOM   7690  H  H    . LEU A 1 74  ? 13.233  5.956   1.015   1.00 10.00 ? 74  LEU A H    4  
ATOM   7691  H  HA   . LEU A 1 74  ? 11.466  4.500   -0.810  1.00 10.00 ? 74  LEU A HA   4  
ATOM   7692  H  HB2  . LEU A 1 74  ? 12.591  7.313   -0.599  1.00 10.00 ? 74  LEU A HB2  4  
ATOM   7693  H  HB3  . LEU A 1 74  ? 11.626  6.881   -1.993  1.00 10.00 ? 74  LEU A HB3  4  
ATOM   7694  H  HG   . LEU A 1 74  ? 10.593  6.401   0.851   1.00 10.00 ? 74  LEU A HG   4  
ATOM   7695  H  HD11 . LEU A 1 74  ? 10.065  8.937   -0.730  1.00 10.00 ? 74  LEU A HD11 4  
ATOM   7696  H  HD12 . LEU A 1 74  ? 9.433   8.498   0.861   1.00 10.00 ? 74  LEU A HD12 4  
ATOM   7697  H  HD13 . LEU A 1 74  ? 11.163  8.821   0.672   1.00 10.00 ? 74  LEU A HD13 4  
ATOM   7698  H  HD21 . LEU A 1 74  ? 9.108   6.970   -1.752  1.00 10.00 ? 74  LEU A HD21 4  
ATOM   7699  H  HD22 . LEU A 1 74  ? 9.440   5.342   -1.137  1.00 10.00 ? 74  LEU A HD22 4  
ATOM   7700  H  HD23 . LEU A 1 74  ? 8.409   6.449   -0.208  1.00 10.00 ? 74  LEU A HD23 4  
ATOM   7701  N  N    . MET A 1 75  ? 12.963  4.040   -2.797  1.00 10.00 ? 75  MET A N    4  
ATOM   7702  C  CA   . MET A 1 75  ? 13.795  3.674   -3.941  1.00 10.00 ? 75  MET A CA   4  
ATOM   7703  C  C    . MET A 1 75  ? 13.133  4.123   -5.235  1.00 10.00 ? 75  MET A C    4  
ATOM   7704  O  O    . MET A 1 75  ? 11.956  4.469   -5.252  1.00 10.00 ? 75  MET A O    4  
ATOM   7705  C  CB   . MET A 1 75  ? 14.035  2.156   -3.996  1.00 10.00 ? 75  MET A CB   4  
ATOM   7706  C  CG   . MET A 1 75  ? 15.316  1.762   -3.255  1.00 10.00 ? 75  MET A CG   4  
ATOM   7707  S  SD   . MET A 1 75  ? 15.085  0.827   -1.744  1.00 10.00 ? 75  MET A SD   4  
ATOM   7708  C  CE   . MET A 1 75  ? 16.813  0.552   -1.293  1.00 10.00 ? 75  MET A CE   4  
ATOM   7709  H  H    . MET A 1 75  ? 11.979  3.791   -2.857  1.00 10.00 ? 75  MET A H    4  
ATOM   7710  H  HA   . MET A 1 75  ? 14.748  4.198   -3.904  1.00 10.00 ? 75  MET A HA   4  
ATOM   7711  H  HB2  . MET A 1 75  ? 13.164  1.617   -3.621  1.00 10.00 ? 75  MET A HB2  4  
ATOM   7712  H  HB3  . MET A 1 75  ? 14.176  1.853   -5.033  1.00 10.00 ? 75  MET A HB3  4  
ATOM   7713  H  HG2  . MET A 1 75  ? 15.928  1.162   -3.920  1.00 10.00 ? 75  MET A HG2  4  
ATOM   7714  H  HG3  . MET A 1 75  ? 15.892  2.637   -2.989  1.00 10.00 ? 75  MET A HG3  4  
ATOM   7715  H  HE1  . MET A 1 75  ? 17.299  1.515   -1.146  1.00 10.00 ? 75  MET A HE1  4  
ATOM   7716  H  HE2  . MET A 1 75  ? 16.855  -0.018  -0.365  1.00 10.00 ? 75  MET A HE2  4  
ATOM   7717  H  HE3  . MET A 1 75  ? 17.328  0.005   -2.082  1.00 10.00 ? 75  MET A HE3  4  
ATOM   7718  N  N    . THR A 1 76  ? 13.898  4.073   -6.328  1.00 10.00 ? 76  THR A N    4  
ATOM   7719  C  CA   . THR A 1 76  ? 13.421  4.400   -7.652  1.00 10.00 ? 76  THR A CA   4  
ATOM   7720  C  C    . THR A 1 76  ? 14.025  3.392   -8.631  1.00 10.00 ? 76  THR A C    4  
ATOM   7721  O  O    . THR A 1 76  ? 15.242  3.258   -8.689  1.00 10.00 ? 76  THR A O    4  
ATOM   7722  C  CB   . THR A 1 76  ? 13.702  5.872   -7.947  1.00 10.00 ? 76  THR A CB   4  
ATOM   7723  O  OG1  . THR A 1 76  ? 13.215  6.236   -9.214  1.00 10.00 ? 76  THR A OG1  4  
ATOM   7724  C  CG2  . THR A 1 76  ? 15.181  6.250   -7.864  1.00 10.00 ? 76  THR A CG2  4  
ATOM   7725  H  H    . THR A 1 76  ? 14.859  3.762   -6.275  1.00 10.00 ? 76  THR A H    4  
ATOM   7726  H  HA   . THR A 1 76  ? 12.345  4.333   -7.656  1.00 10.00 ? 76  THR A HA   4  
ATOM   7727  H  HB   . THR A 1 76  ? 13.144  6.433   -7.198  1.00 10.00 ? 76  THR A HB   4  
ATOM   7728  H  HG1  . THR A 1 76  ? 12.507  5.620   -9.480  1.00 10.00 ? 76  THR A HG1  4  
ATOM   7729  H  HG21 . THR A 1 76  ? 15.587  5.960   -6.896  1.00 10.00 ? 76  THR A HG21 4  
ATOM   7730  H  HG22 . THR A 1 76  ? 15.741  5.751   -8.653  1.00 10.00 ? 76  THR A HG22 4  
ATOM   7731  H  HG23 . THR A 1 76  ? 15.280  7.327   -7.989  1.00 10.00 ? 76  THR A HG23 4  
ATOM   7732  N  N    . THR A 1 77  ? 13.201  2.623   -9.343  1.00 10.00 ? 77  THR A N    4  
ATOM   7733  C  CA   . THR A 1 77  ? 13.680  1.713   -10.377 1.00 10.00 ? 77  THR A CA   4  
ATOM   7734  C  C    . THR A 1 77  ? 12.694  1.745   -11.551 1.00 10.00 ? 77  THR A C    4  
ATOM   7735  O  O    . THR A 1 77  ? 12.309  0.714   -12.095 1.00 10.00 ? 77  THR A O    4  
ATOM   7736  C  CB   . THR A 1 77  ? 13.823  0.296   -9.780  1.00 10.00 ? 77  THR A CB   4  
ATOM   7737  O  OG1  . THR A 1 77  ? 14.206  0.340   -8.419  1.00 10.00 ? 77  THR A OG1  4  
ATOM   7738  C  CG2  . THR A 1 77  ? 14.847  -0.545  -10.546 1.00 10.00 ? 77  THR A CG2  4  
ATOM   7739  H  H    . THR A 1 77  ? 12.239  2.961   -9.411  1.00 10.00 ? 77  THR A H    4  
ATOM   7740  H  HA   . THR A 1 77  ? 14.654  2.032   -10.735 1.00 10.00 ? 77  THR A HA   4  
ATOM   7741  H  HB   . THR A 1 77  ? 12.863  -0.211  -9.813  1.00 10.00 ? 77  THR A HB   4  
ATOM   7742  H  HG1  . THR A 1 77  ? 13.603  0.932   -7.966  1.00 10.00 ? 77  THR A HG1  4  
ATOM   7743  H  HG21 . THR A 1 77  ? 15.830  -0.076  -10.497 1.00 10.00 ? 77  THR A HG21 4  
ATOM   7744  H  HG22 . THR A 1 77  ? 14.902  -1.539  -10.103 1.00 10.00 ? 77  THR A HG22 4  
ATOM   7745  H  HG23 . THR A 1 77  ? 14.543  -0.644  -11.589 1.00 10.00 ? 77  THR A HG23 4  
ATOM   7746  N  N    . THR A 1 78  ? 12.318  2.938   -11.999 1.00 10.00 ? 78  THR A N    4  
ATOM   7747  C  CA   . THR A 1 78  ? 11.376  3.138   -13.086 1.00 10.00 ? 78  THR A CA   4  
ATOM   7748  C  C    . THR A 1 78  ? 11.602  4.513   -13.722 1.00 10.00 ? 78  THR A C    4  
ATOM   7749  O  O    . THR A 1 78  ? 10.856  5.458   -13.462 1.00 10.00 ? 78  THR A O    4  
ATOM   7750  C  CB   . THR A 1 78  ? 9.936   2.958   -12.576 1.00 10.00 ? 78  THR A CB   4  
ATOM   7751  O  OG1  . THR A 1 78  ? 9.821   1.801   -11.771 1.00 10.00 ? 78  THR A OG1  4  
ATOM   7752  C  CG2  . THR A 1 78  ? 8.980   2.821   -13.756 1.00 10.00 ? 78  THR A CG2  4  
ATOM   7753  H  H    . THR A 1 78  ? 12.557  3.754   -11.439 1.00 10.00 ? 78  THR A H    4  
ATOM   7754  H  HA   . THR A 1 78  ? 11.562  2.381   -13.849 1.00 10.00 ? 78  THR A HA   4  
ATOM   7755  H  HB   . THR A 1 78  ? 9.627   3.823   -11.996 1.00 10.00 ? 78  THR A HB   4  
ATOM   7756  H  HG1  . THR A 1 78  ? 10.433  1.137   -12.119 1.00 10.00 ? 78  THR A HG1  4  
ATOM   7757  H  HG21 . THR A 1 78  ? 9.060   3.700   -14.392 1.00 10.00 ? 78  THR A HG21 4  
ATOM   7758  H  HG22 . THR A 1 78  ? 9.229   1.928   -14.328 1.00 10.00 ? 78  THR A HG22 4  
ATOM   7759  H  HG23 . THR A 1 78  ? 7.963   2.747   -13.377 1.00 10.00 ? 78  THR A HG23 4  
ATOM   7760  N  N    . HIS A 1 79  ? 12.610  4.601   -14.599 1.00 10.00 ? 79  HIS A N    4  
ATOM   7761  C  CA   . HIS A 1 79  ? 12.924  5.798   -15.372 1.00 10.00 ? 79  HIS A CA   4  
ATOM   7762  C  C    . HIS A 1 79  ? 11.734  6.202   -16.246 1.00 10.00 ? 79  HIS A C    4  
ATOM   7763  O  O    . HIS A 1 79  ? 11.640  5.789   -17.397 1.00 10.00 ? 79  HIS A O    4  
ATOM   7764  C  CB   . HIS A 1 79  ? 14.195  5.569   -16.200 1.00 10.00 ? 79  HIS A CB   4  
ATOM   7765  C  CG   . HIS A 1 79  ? 14.630  6.789   -16.969 1.00 10.00 ? 79  HIS A CG   4  
ATOM   7766  N  ND1  . HIS A 1 79  ? 14.605  6.923   -18.357 1.00 10.00 ? 79  HIS A ND1  4  
ATOM   7767  C  CD2  . HIS A 1 79  ? 15.127  7.932   -16.414 1.00 10.00 ? 79  HIS A CD2  4  
ATOM   7768  C  CE1  . HIS A 1 79  ? 15.073  8.154   -18.607 1.00 10.00 ? 79  HIS A CE1  4  
ATOM   7769  N  NE2  . HIS A 1 79  ? 15.395  8.782   -17.462 1.00 10.00 ? 79  HIS A NE2  4  
ATOM   7770  H  H    . HIS A 1 79  ? 13.178  3.782   -14.744 1.00 10.00 ? 79  HIS A H    4  
ATOM   7771  H  HA   . HIS A 1 79  ? 13.133  6.606   -14.678 1.00 10.00 ? 79  HIS A HA   4  
ATOM   7772  H  HB2  . HIS A 1 79  ? 15.008  5.303   -15.527 1.00 10.00 ? 79  HIS A HB2  4  
ATOM   7773  H  HB3  . HIS A 1 79  ? 14.038  4.747   -16.898 1.00 10.00 ? 79  HIS A HB3  4  
ATOM   7774  H  HD2  . HIS A 1 79  ? 15.282  8.124   -15.364 1.00 10.00 ? 79  HIS A HD2  4  
ATOM   7775  H  HE1  . HIS A 1 79  ? 15.182  8.580   -19.594 1.00 10.00 ? 79  HIS A HE1  4  
ATOM   7776  H  HE2  . HIS A 1 79  ? 15.771  9.717   -17.388 1.00 10.00 ? 79  HIS A HE2  4  
ATOM   7777  N  N    . SER A 1 80  ? 10.817  6.980   -15.666 1.00 10.00 ? 80  SER A N    4  
ATOM   7778  C  CA   . SER A 1 80  ? 9.529   7.400   -16.218 1.00 10.00 ? 80  SER A CA   4  
ATOM   7779  C  C    . SER A 1 80  ? 8.681   7.976   -15.085 1.00 10.00 ? 80  SER A C    4  
ATOM   7780  O  O    . SER A 1 80  ? 7.978   8.961   -15.294 1.00 10.00 ? 80  SER A O    4  
ATOM   7781  C  CB   . SER A 1 80  ? 8.754   6.252   -16.894 1.00 10.00 ? 80  SER A CB   4  
ATOM   7782  O  OG   . SER A 1 80  ? 7.544   6.728   -17.459 1.00 10.00 ? 80  SER A OG   4  
ATOM   7783  H  H    . SER A 1 80  ? 11.017  7.239   -14.701 1.00 10.00 ? 80  SER A H    4  
ATOM   7784  H  HA   . SER A 1 80  ? 9.713   8.182   -16.957 1.00 10.00 ? 80  SER A HA   4  
ATOM   7785  H  HB2  . SER A 1 80  ? 9.319   5.812   -17.714 1.00 10.00 ? 80  SER A HB2  4  
ATOM   7786  H  HB3  . SER A 1 80  ? 8.532   5.475   -16.161 1.00 10.00 ? 80  SER A HB3  4  
ATOM   7787  H  HG   . SER A 1 80  ? 7.116   7.341   -16.852 1.00 10.00 ? 80  SER A HG   4  
ATOM   7788  N  N    . GLY A 1 81  ? 8.704   7.335   -13.911 1.00 10.00 ? 81  GLY A N    4  
ATOM   7789  C  CA   . GLY A 1 81  ? 8.099   7.887   -12.712 1.00 10.00 ? 81  GLY A CA   4  
ATOM   7790  C  C    . GLY A 1 81  ? 9.178   8.716   -12.037 1.00 10.00 ? 81  GLY A C    4  
ATOM   7791  O  O    . GLY A 1 81  ? 9.287   9.921   -12.263 1.00 10.00 ? 81  GLY A O    4  
ATOM   7792  H  H    . GLY A 1 81  ? 9.340   6.551   -13.785 1.00 10.00 ? 81  GLY A H    4  
ATOM   7793  H  HA2  . GLY A 1 81  ? 7.231   8.507   -12.938 1.00 10.00 ? 81  GLY A HA2  4  
ATOM   7794  H  HA3  . GLY A 1 81  ? 7.794   7.073   -12.054 1.00 10.00 ? 81  GLY A HA3  4  
ATOM   7795  N  N    . GLY A 1 82  ? 10.019  8.031   -11.269 1.00 10.00 ? 82  GLY A N    4  
ATOM   7796  C  CA   . GLY A 1 82  ? 11.325  8.516   -10.875 1.00 10.00 ? 82  GLY A CA   4  
ATOM   7797  C  C    . GLY A 1 82  ? 12.369  8.130   -11.929 1.00 10.00 ? 82  GLY A C    4  
ATOM   7798  O  O    . GLY A 1 82  ? 12.121  8.237   -13.132 1.00 10.00 ? 82  GLY A O    4  
ATOM   7799  H  H    . GLY A 1 82  ? 9.795   7.053   -11.064 1.00 10.00 ? 82  GLY A H    4  
ATOM   7800  H  HA2  . GLY A 1 82  ? 11.319  9.601   -10.757 1.00 10.00 ? 82  GLY A HA2  4  
ATOM   7801  H  HA3  . GLY A 1 82  ? 11.568  8.070   -9.911  1.00 10.00 ? 82  GLY A HA3  4  
ATOM   7802  N  N    . MET A 1 83  ? 13.546  7.706   -11.456 1.00 10.00 ? 83  MET A N    4  
ATOM   7803  C  CA   . MET A 1 83  ? 14.720  7.331   -12.229 1.00 10.00 ? 83  MET A CA   4  
ATOM   7804  C  C    . MET A 1 83  ? 14.913  5.807   -12.176 1.00 10.00 ? 83  MET A C    4  
ATOM   7805  O  O    . MET A 1 83  ? 13.985  5.072   -11.847 1.00 10.00 ? 83  MET A O    4  
ATOM   7806  C  CB   . MET A 1 83  ? 15.941  8.098   -11.688 1.00 10.00 ? 83  MET A CB   4  
ATOM   7807  C  CG   . MET A 1 83  ? 15.728  9.619   -11.684 1.00 10.00 ? 83  MET A CG   4  
ATOM   7808  S  SD   . MET A 1 83  ? 15.416  10.361  -13.308 1.00 10.00 ? 83  MET A SD   4  
ATOM   7809  C  CE   . MET A 1 83  ? 15.234  12.094  -12.835 1.00 10.00 ? 83  MET A CE   4  
ATOM   7810  H  H    . MET A 1 83  ? 13.581  7.485   -10.467 1.00 10.00 ? 83  MET A H    4  
ATOM   7811  H  HA   . MET A 1 83  ? 14.577  7.610   -13.269 1.00 10.00 ? 83  MET A HA   4  
ATOM   7812  H  HB2  . MET A 1 83  ? 16.151  7.769   -10.669 1.00 10.00 ? 83  MET A HB2  4  
ATOM   7813  H  HB3  . MET A 1 83  ? 16.813  7.898   -12.312 1.00 10.00 ? 83  MET A HB3  4  
ATOM   7814  H  HG2  . MET A 1 83  ? 14.897  9.873   -11.028 1.00 10.00 ? 83  MET A HG2  4  
ATOM   7815  H  HG3  . MET A 1 83  ? 16.627  10.083  -11.281 1.00 10.00 ? 83  MET A HG3  4  
ATOM   7816  H  HE1  . MET A 1 83  ? 15.039  12.685  -13.729 1.00 10.00 ? 83  MET A HE1  4  
ATOM   7817  H  HE2  . MET A 1 83  ? 14.398  12.194  -12.144 1.00 10.00 ? 83  MET A HE2  4  
ATOM   7818  H  HE3  . MET A 1 83  ? 16.151  12.440  -12.361 1.00 10.00 ? 83  MET A HE3  4  
ATOM   7819  N  N    . ALA A 1 84  ? 16.118  5.319   -12.496 1.00 10.00 ? 84  ALA A N    4  
ATOM   7820  C  CA   . ALA A 1 84  ? 16.469  3.910   -12.514 1.00 10.00 ? 84  ALA A CA   4  
ATOM   7821  C  C    . ALA A 1 84  ? 17.675  3.770   -11.599 1.00 10.00 ? 84  ALA A C    4  
ATOM   7822  O  O    . ALA A 1 84  ? 18.810  3.708   -12.064 1.00 10.00 ? 84  ALA A O    4  
ATOM   7823  C  CB   . ALA A 1 84  ? 16.774  3.454   -13.945 1.00 10.00 ? 84  ALA A CB   4  
ATOM   7824  H  H    . ALA A 1 84  ? 16.905  5.945   -12.581 1.00 10.00 ? 84  ALA A H    4  
ATOM   7825  H  HA   . ALA A 1 84  ? 15.659  3.292   -12.139 1.00 10.00 ? 84  ALA A HA   4  
ATOM   7826  H  HB1  . ALA A 1 84  ? 17.168  2.437   -13.927 1.00 10.00 ? 84  ALA A HB1  4  
ATOM   7827  H  HB2  . ALA A 1 84  ? 15.857  3.458   -14.533 1.00 10.00 ? 84  ALA A HB2  4  
ATOM   7828  H  HB3  . ALA A 1 84  ? 17.508  4.114   -14.409 1.00 10.00 ? 84  ALA A HB3  4  
ATOM   7829  N  N    . GLY A 1 85  ? 17.430  3.807   -10.291 1.00 10.00 ? 85  GLY A N    4  
ATOM   7830  C  CA   . GLY A 1 85  ? 18.479  3.886   -9.297  1.00 10.00 ? 85  GLY A CA   4  
ATOM   7831  C  C    . GLY A 1 85  ? 17.968  3.342   -7.966  1.00 10.00 ? 85  GLY A C    4  
ATOM   7832  O  O    . GLY A 1 85  ? 17.548  4.126   -7.115  1.00 10.00 ? 85  GLY A O    4  
ATOM   7833  H  H    . GLY A 1 85  ? 16.471  3.822   -9.955  1.00 10.00 ? 85  GLY A H    4  
ATOM   7834  H  HA2  . GLY A 1 85  ? 19.348  3.343   -9.655  1.00 10.00 ? 85  GLY A HA2  4  
ATOM   7835  H  HA3  . GLY A 1 85  ? 18.755  4.934   -9.169  1.00 10.00 ? 85  GLY A HA3  4  
ATOM   7836  N  N    . MET A 1 86  ? 17.980  2.015   -7.780  1.00 10.00 ? 86  MET A N    4  
ATOM   7837  C  CA   . MET A 1 86  ? 17.367  1.350   -6.626  1.00 10.00 ? 86  MET A CA   4  
ATOM   7838  C  C    . MET A 1 86  ? 18.265  1.491   -5.388  1.00 10.00 ? 86  MET A C    4  
ATOM   7839  O  O    . MET A 1 86  ? 18.730  0.517   -4.804  1.00 10.00 ? 86  MET A O    4  
ATOM   7840  C  CB   . MET A 1 86  ? 17.084  -0.117  -6.975  1.00 10.00 ? 86  MET A CB   4  
ATOM   7841  C  CG   . MET A 1 86  ? 15.969  -0.787  -6.149  1.00 10.00 ? 86  MET A CG   4  
ATOM   7842  S  SD   . MET A 1 86  ? 16.385  -1.576  -4.558  1.00 10.00 ? 86  MET A SD   4  
ATOM   7843  C  CE   . MET A 1 86  ? 15.891  -3.280  -4.906  1.00 10.00 ? 86  MET A CE   4  
ATOM   7844  H  H    . MET A 1 86  ? 18.322  1.431   -8.528  1.00 10.00 ? 86  MET A H    4  
ATOM   7845  H  HA   . MET A 1 86  ? 16.405  1.846   -6.467  1.00 10.00 ? 86  MET A HA   4  
ATOM   7846  H  HB2  . MET A 1 86  ? 16.736  -0.109  -8.004  1.00 10.00 ? 86  MET A HB2  4  
ATOM   7847  H  HB3  . MET A 1 86  ? 18.004  -0.699  -6.930  1.00 10.00 ? 86  MET A HB3  4  
ATOM   7848  H  HG2  . MET A 1 86  ? 15.182  -0.057  -5.979  1.00 10.00 ? 86  MET A HG2  4  
ATOM   7849  H  HG3  . MET A 1 86  ? 15.554  -1.569  -6.785  1.00 10.00 ? 86  MET A HG3  4  
ATOM   7850  H  HE1  . MET A 1 86  ? 14.829  -3.329  -5.147  1.00 10.00 ? 86  MET A HE1  4  
ATOM   7851  H  HE2  . MET A 1 86  ? 16.471  -3.654  -5.749  1.00 10.00 ? 86  MET A HE2  4  
ATOM   7852  H  HE3  . MET A 1 86  ? 16.094  -3.899  -4.032  1.00 10.00 ? 86  MET A HE3  4  
ATOM   7853  N  N    . LYS A 1 87  ? 18.499  2.735   -4.996  1.00 10.00 ? 87  LYS A N    4  
ATOM   7854  C  CA   . LYS A 1 87  ? 19.317  3.169   -3.878  1.00 10.00 ? 87  LYS A CA   4  
ATOM   7855  C  C    . LYS A 1 87  ? 18.453  4.068   -3.000  1.00 10.00 ? 87  LYS A C    4  
ATOM   7856  O  O    . LYS A 1 87  ? 17.360  4.455   -3.412  1.00 10.00 ? 87  LYS A O    4  
ATOM   7857  C  CB   . LYS A 1 87  ? 20.556  3.902   -4.416  1.00 10.00 ? 87  LYS A CB   4  
ATOM   7858  C  CG   . LYS A 1 87  ? 20.202  5.243   -5.084  1.00 10.00 ? 87  LYS A CG   4  
ATOM   7859  C  CD   . LYS A 1 87  ? 21.254  5.689   -6.105  1.00 10.00 ? 87  LYS A CD   4  
ATOM   7860  C  CE   . LYS A 1 87  ? 22.624  5.927   -5.453  1.00 10.00 ? 87  LYS A CE   4  
ATOM   7861  N  NZ   . LYS A 1 87  ? 23.624  6.424   -6.422  1.00 10.00 ? 87  LYS A NZ   4  
ATOM   7862  H  H    . LYS A 1 87  ? 17.985  3.446   -5.500  1.00 10.00 ? 87  LYS A H    4  
ATOM   7863  H  HA   . LYS A 1 87  ? 19.640  2.307   -3.291  1.00 10.00 ? 87  LYS A HA   4  
ATOM   7864  H  HB2  . LYS A 1 87  ? 21.250  4.083   -3.595  1.00 10.00 ? 87  LYS A HB2  4  
ATOM   7865  H  HB3  . LYS A 1 87  ? 21.042  3.246   -5.140  1.00 10.00 ? 87  LYS A HB3  4  
ATOM   7866  H  HG2  . LYS A 1 87  ? 19.263  5.149   -5.626  1.00 10.00 ? 87  LYS A HG2  4  
ATOM   7867  H  HG3  . LYS A 1 87  ? 20.068  6.012   -4.320  1.00 10.00 ? 87  LYS A HG3  4  
ATOM   7868  H  HD2  . LYS A 1 87  ? 21.320  4.922   -6.881  1.00 10.00 ? 87  LYS A HD2  4  
ATOM   7869  H  HD3  . LYS A 1 87  ? 20.887  6.610   -6.564  1.00 10.00 ? 87  LYS A HD3  4  
ATOM   7870  H  HE2  . LYS A 1 87  ? 22.516  6.657   -4.648  1.00 10.00 ? 87  LYS A HE2  4  
ATOM   7871  H  HE3  . LYS A 1 87  ? 22.991  4.992   -5.024  1.00 10.00 ? 87  LYS A HE3  4  
ATOM   7872  H  HZ1  . LYS A 1 87  ? 24.510  6.566   -5.955  1.00 10.00 ? 87  LYS A HZ1  4  
ATOM   7873  H  HZ2  . LYS A 1 87  ? 23.755  5.752   -7.166  1.00 10.00 ? 87  LYS A HZ2  4  
ATOM   7874  H  HZ3  . LYS A 1 87  ? 23.323  7.304   -6.818  1.00 10.00 ? 87  LYS A HZ3  4  
ATOM   7875  N  N    . MET A 1 88  ? 18.943  4.434   -1.817  1.00 10.00 ? 88  MET A N    4  
ATOM   7876  C  CA   . MET A 1 88  ? 18.145  5.150   -0.833  1.00 10.00 ? 88  MET A CA   4  
ATOM   7877  C  C    . MET A 1 88  ? 18.109  6.629   -1.215  1.00 10.00 ? 88  MET A C    4  
ATOM   7878  O  O    . MET A 1 88  ? 18.771  7.471   -0.611  1.00 10.00 ? 88  MET A O    4  
ATOM   7879  C  CB   . MET A 1 88  ? 18.726  4.907   0.567   1.00 10.00 ? 88  MET A CB   4  
ATOM   7880  C  CG   . MET A 1 88  ? 18.621  3.421   0.923   1.00 10.00 ? 88  MET A CG   4  
ATOM   7881  S  SD   . MET A 1 88  ? 19.202  2.970   2.577   1.00 10.00 ? 88  MET A SD   4  
ATOM   7882  C  CE   . MET A 1 88  ? 18.833  1.200   2.560   1.00 10.00 ? 88  MET A CE   4  
ATOM   7883  H  H    . MET A 1 88  ? 19.872  4.145   -1.552  1.00 10.00 ? 88  MET A H    4  
ATOM   7884  H  HA   . MET A 1 88  ? 17.120  4.775   -0.837  1.00 10.00 ? 88  MET A HA   4  
ATOM   7885  H  HB2  . MET A 1 88  ? 19.770  5.221   0.605   1.00 10.00 ? 88  MET A HB2  4  
ATOM   7886  H  HB3  . MET A 1 88  ? 18.156  5.484   1.297   1.00 10.00 ? 88  MET A HB3  4  
ATOM   7887  H  HG2  . MET A 1 88  ? 17.576  3.131   0.842   1.00 10.00 ? 88  MET A HG2  4  
ATOM   7888  H  HG3  . MET A 1 88  ? 19.200  2.842   0.207   1.00 10.00 ? 88  MET A HG3  4  
ATOM   7889  H  HE1  . MET A 1 88  ? 19.393  0.719   1.759   1.00 10.00 ? 88  MET A HE1  4  
ATOM   7890  H  HE2  . MET A 1 88  ? 19.123  0.769   3.517   1.00 10.00 ? 88  MET A HE2  4  
ATOM   7891  H  HE3  . MET A 1 88  ? 17.765  1.053   2.405   1.00 10.00 ? 88  MET A HE3  4  
ATOM   7892  N  N    . VAL A 1 89  ? 17.352  6.921   -2.272  1.00 10.00 ? 89  VAL A N    4  
ATOM   7893  C  CA   . VAL A 1 89  ? 17.118  8.272   -2.746  1.00 10.00 ? 89  VAL A CA   4  
ATOM   7894  C  C    . VAL A 1 89  ? 16.362  9.068   -1.678  1.00 10.00 ? 89  VAL A C    4  
ATOM   7895  O  O    . VAL A 1 89  ? 15.667  8.478   -0.851  1.00 10.00 ? 89  VAL A O    4  
ATOM   7896  C  CB   . VAL A 1 89  ? 16.372  8.247   -4.097  1.00 10.00 ? 89  VAL A CB   4  
ATOM   7897  C  CG1  . VAL A 1 89  ? 17.306  7.750   -5.206  1.00 10.00 ? 89  VAL A CG1  4  
ATOM   7898  C  CG2  . VAL A 1 89  ? 15.094  7.399   -4.073  1.00 10.00 ? 89  VAL A CG2  4  
ATOM   7899  H  H    . VAL A 1 89  ? 16.862  6.150   -2.714  1.00 10.00 ? 89  VAL A H    4  
ATOM   7900  H  HA   . VAL A 1 89  ? 18.102  8.719   -2.876  1.00 10.00 ? 89  VAL A HA   4  
ATOM   7901  H  HB   . VAL A 1 89  ? 16.065  9.258   -4.359  1.00 10.00 ? 89  VAL A HB   4  
ATOM   7902  H  HG11 . VAL A 1 89  ? 18.232  8.325   -5.202  1.00 10.00 ? 89  VAL A HG11 4  
ATOM   7903  H  HG12 . VAL A 1 89  ? 17.534  6.695   -5.060  1.00 10.00 ? 89  VAL A HG12 4  
ATOM   7904  H  HG13 . VAL A 1 89  ? 16.824  7.883   -6.173  1.00 10.00 ? 89  VAL A HG13 4  
ATOM   7905  H  HG21 . VAL A 1 89  ? 15.341  6.344   -3.995  1.00 10.00 ? 89  VAL A HG21 4  
ATOM   7906  H  HG22 . VAL A 1 89  ? 14.462  7.684   -3.233  1.00 10.00 ? 89  VAL A HG22 4  
ATOM   7907  H  HG23 . VAL A 1 89  ? 14.538  7.555   -4.998  1.00 10.00 ? 89  VAL A HG23 4  
ATOM   7908  N  N    . PRO A 1 90  ? 16.473  10.407  -1.681  1.00 10.00 ? 90  PRO A N    4  
ATOM   7909  C  CA   . PRO A 1 90  ? 15.812  11.241  -0.693  1.00 10.00 ? 90  PRO A CA   4  
ATOM   7910  C  C    . PRO A 1 90  ? 14.285  11.090  -0.729  1.00 10.00 ? 90  PRO A C    4  
ATOM   7911  O  O    . PRO A 1 90  ? 13.633  11.283  0.294   1.00 10.00 ? 90  PRO A O    4  
ATOM   7912  C  CB   . PRO A 1 90  ? 16.338  12.653  -0.940  1.00 10.00 ? 90  PRO A CB   4  
ATOM   7913  C  CG   . PRO A 1 90  ? 16.682  12.647  -2.426  1.00 10.00 ? 90  PRO A CG   4  
ATOM   7914  C  CD   . PRO A 1 90  ? 17.244  11.236  -2.598  1.00 10.00 ? 90  PRO A CD   4  
ATOM   7915  H  HA   . PRO A 1 90  ? 16.131  10.978  0.304   1.00 10.00 ? 90  PRO A HA   4  
ATOM   7916  H  HB2  . PRO A 1 90  ? 15.633  13.419  -0.643  1.00 10.00 ? 90  PRO A HB2  4  
ATOM   7917  H  HB3  . PRO A 1 90  ? 17.262  12.787  -0.374  1.00 10.00 ? 90  PRO A HB3  4  
ATOM   7918  H  HG2  . PRO A 1 90  ? 15.769  12.762  -3.014  1.00 10.00 ? 90  PRO A HG2  4  
ATOM   7919  H  HG3  . PRO A 1 90  ? 17.404  13.421  -2.690  1.00 10.00 ? 90  PRO A HG3  4  
ATOM   7920  H  HD2  . PRO A 1 90  ? 17.168  10.941  -3.642  1.00 10.00 ? 90  PRO A HD2  4  
ATOM   7921  H  HD3  . PRO A 1 90  ? 18.290  11.220  -2.290  1.00 10.00 ? 90  PRO A HD3  4  
ATOM   7922  N  N    . TRP A 1 91  ? 13.722  10.705  -1.880  1.00 10.00 ? 91  TRP A N    4  
ATOM   7923  C  CA   . TRP A 1 91  ? 12.333  10.332  -2.077  1.00 10.00 ? 91  TRP A CA   4  
ATOM   7924  C  C    . TRP A 1 91  ? 12.210  9.870   -3.533  1.00 10.00 ? 91  TRP A C    4  
ATOM   7925  O  O    . TRP A 1 91  ? 13.198  9.932   -4.268  1.00 10.00 ? 91  TRP A O    4  
ATOM   7926  C  CB   . TRP A 1 91  ? 11.398  11.516  -1.784  1.00 10.00 ? 91  TRP A CB   4  
ATOM   7927  C  CG   . TRP A 1 91  ? 11.695  12.723  -2.603  1.00 10.00 ? 91  TRP A CG   4  
ATOM   7928  C  CD1  . TRP A 1 91  ? 11.248  12.913  -3.854  1.00 10.00 ? 91  TRP A CD1  4  
ATOM   7929  C  CD2  . TRP A 1 91  ? 12.610  13.818  -2.348  1.00 10.00 ? 91  TRP A CD2  4  
ATOM   7930  N  NE1  . TRP A 1 91  ? 12.009  13.874  -4.472  1.00 10.00 ? 91  TRP A NE1  4  
ATOM   7931  C  CE2  . TRP A 1 91  ? 12.888  14.457  -3.583  1.00 10.00 ? 91  TRP A CE2  4  
ATOM   7932  C  CE3  . TRP A 1 91  ? 13.272  14.307  -1.211  1.00 10.00 ? 91  TRP A CE3  4  
ATOM   7933  C  CZ2  . TRP A 1 91  ? 13.889  15.426  -3.697  1.00 10.00 ? 91  TRP A CZ2  4  
ATOM   7934  C  CZ3  . TRP A 1 91  ? 14.155  15.400  -1.289  1.00 10.00 ? 91  TRP A CZ3  4  
ATOM   7935  C  CH2  . TRP A 1 91  ? 14.515  15.919  -2.542  1.00 10.00 ? 91  TRP A CH2  4  
ATOM   7936  H  H    . TRP A 1 91  ? 14.292  10.518  -2.694  1.00 10.00 ? 91  TRP A H    4  
ATOM   7937  H  HA   . TRP A 1 91  ? 12.110  9.498   -1.419  1.00 10.00 ? 91  TRP A HA   4  
ATOM   7938  H  HB2  . TRP A 1 91  ? 10.394  11.206  -2.042  1.00 10.00 ? 91  TRP A HB2  4  
ATOM   7939  H  HB3  . TRP A 1 91  ? 11.415  11.773  -0.728  1.00 10.00 ? 91  TRP A HB3  4  
ATOM   7940  H  HD1  . TRP A 1 91  ? 10.541  12.269  -4.328  1.00 10.00 ? 91  TRP A HD1  4  
ATOM   7941  H  HE1  . TRP A 1 91  ? 11.917  14.041  -5.470  1.00 10.00 ? 91  TRP A HE1  4  
ATOM   7942  H  HE3  . TRP A 1 91  ? 13.072  13.815  -0.282  1.00 10.00 ? 91  TRP A HE3  4  
ATOM   7943  H  HZ2  . TRP A 1 91  ? 14.208  15.726  -4.668  1.00 10.00 ? 91  TRP A HZ2  4  
ATOM   7944  H  HZ3  . TRP A 1 91  ? 14.612  15.790  -0.391  1.00 10.00 ? 91  TRP A HZ3  4  
ATOM   7945  H  HH2  . TRP A 1 91  ? 15.269  16.690  -2.617  1.00 10.00 ? 91  TRP A HH2  4  
ATOM   7946  N  N    . LEU A 1 92  ? 11.010  9.461   -3.962  1.00 10.00 ? 92  LEU A N    4  
ATOM   7947  C  CA   . LEU A 1 92  ? 10.673  9.277   -5.371  1.00 10.00 ? 92  LEU A CA   4  
ATOM   7948  C  C    . LEU A 1 92  ? 9.614   10.317  -5.747  1.00 10.00 ? 92  LEU A C    4  
ATOM   7949  O  O    . LEU A 1 92  ? 8.475   10.248  -5.297  1.00 10.00 ? 92  LEU A O    4  
ATOM   7950  C  CB   . LEU A 1 92  ? 10.273  7.815   -5.662  1.00 10.00 ? 92  LEU A CB   4  
ATOM   7951  C  CG   . LEU A 1 92  ? 8.995   7.304   -4.965  1.00 10.00 ? 92  LEU A CG   4  
ATOM   7952  C  CD1  . LEU A 1 92  ? 7.807   7.263   -5.939  1.00 10.00 ? 92  LEU A CD1  4  
ATOM   7953  C  CD2  . LEU A 1 92  ? 9.207   5.881   -4.434  1.00 10.00 ? 92  LEU A CD2  4  
ATOM   7954  H  H    . LEU A 1 92  ? 10.239  9.455   -3.310  1.00 10.00 ? 92  LEU A H    4  
ATOM   7955  H  HA   . LEU A 1 92  ? 11.552  9.467   -5.991  1.00 10.00 ? 92  LEU A HA   4  
ATOM   7956  H  HB2  . LEU A 1 92  ? 10.165  7.691   -6.741  1.00 10.00 ? 92  LEU A HB2  4  
ATOM   7957  H  HB3  . LEU A 1 92  ? 11.116  7.195   -5.349  1.00 10.00 ? 92  LEU A HB3  4  
ATOM   7958  H  HG   . LEU A 1 92  ? 8.748   7.943   -4.116  1.00 10.00 ? 92  LEU A HG   4  
ATOM   7959  H  HD11 . LEU A 1 92  ? 7.632   8.235   -6.397  1.00 10.00 ? 92  LEU A HD11 4  
ATOM   7960  H  HD12 . LEU A 1 92  ? 8.004   6.543   -6.731  1.00 10.00 ? 92  LEU A HD12 4  
ATOM   7961  H  HD13 . LEU A 1 92  ? 6.905   6.962   -5.405  1.00 10.00 ? 92  LEU A HD13 4  
ATOM   7962  H  HD21 . LEU A 1 92  ? 8.311   5.541   -3.914  1.00 10.00 ? 92  LEU A HD21 4  
ATOM   7963  H  HD22 . LEU A 1 92  ? 9.414   5.200   -5.259  1.00 10.00 ? 92  LEU A HD22 4  
ATOM   7964  H  HD23 . LEU A 1 92  ? 10.046  5.858   -3.738  1.00 10.00 ? 92  LEU A HD23 4  
ATOM   7965  N  N    . THR A 1 93  ? 9.996   11.344  -6.509  1.00 10.00 ? 93  THR A N    4  
ATOM   7966  C  CA   . THR A 1 93  ? 9.119   12.464  -6.818  1.00 10.00 ? 93  THR A CA   4  
ATOM   7967  C  C    . THR A 1 93  ? 8.135   12.022  -7.904  1.00 10.00 ? 93  THR A C    4  
ATOM   7968  O  O    . THR A 1 93  ? 8.490   11.191  -8.737  1.00 10.00 ? 93  THR A O    4  
ATOM   7969  C  CB   . THR A 1 93  ? 9.987   13.614  -7.372  1.00 10.00 ? 93  THR A CB   4  
ATOM   7970  O  OG1  . THR A 1 93  ? 11.366  13.394  -7.116  1.00 10.00 ? 93  THR A OG1  4  
ATOM   7971  C  CG2  . THR A 1 93  ? 9.589   14.956  -6.767  1.00 10.00 ? 93  THR A CG2  4  
ATOM   7972  H  H    . THR A 1 93  ? 10.983  11.515  -6.667  1.00 10.00 ? 93  THR A H    4  
ATOM   7973  H  HA   . THR A 1 93  ? 8.595   12.793  -5.915  1.00 10.00 ? 93  THR A HA   4  
ATOM   7974  H  HB   . THR A 1 93  ? 9.842   13.687  -8.451  1.00 10.00 ? 93  THR A HB   4  
ATOM   7975  H  HG1  . THR A 1 93  ? 11.876  13.784  -7.833  1.00 10.00 ? 93  THR A HG1  4  
ATOM   7976  H  HG21 . THR A 1 93  ? 10.196  15.753  -7.198  1.00 10.00 ? 93  THR A HG21 4  
ATOM   7977  H  HG22 . THR A 1 93  ? 8.538   15.155  -6.978  1.00 10.00 ? 93  THR A HG22 4  
ATOM   7978  H  HG23 . THR A 1 93  ? 9.752   14.925  -5.691  1.00 10.00 ? 93  THR A HG23 4  
ATOM   7979  N  N    . ILE A 1 94  ? 6.926   12.596  -7.936  1.00 10.00 ? 94  ILE A N    4  
ATOM   7980  C  CA   . ILE A 1 94  ? 5.987   12.384  -9.030  1.00 10.00 ? 94  ILE A CA   4  
ATOM   7981  C  C    . ILE A 1 94  ? 5.739   13.731  -9.724  1.00 10.00 ? 94  ILE A C    4  
ATOM   7982  O  O    . ILE A 1 94  ? 4.841   14.481  -9.331  1.00 10.00 ? 94  ILE A O    4  
ATOM   7983  C  CB   . ILE A 1 94  ? 4.741   11.624  -8.538  1.00 10.00 ? 94  ILE A CB   4  
ATOM   7984  C  CG1  . ILE A 1 94  ? 3.944   12.333  -7.435  1.00 10.00 ? 94  ILE A CG1  4  
ATOM   7985  C  CG2  . ILE A 1 94  ? 5.196   10.236  -8.071  1.00 10.00 ? 94  ILE A CG2  4  
ATOM   7986  C  CD1  . ILE A 1 94  ? 2.942   11.432  -6.713  1.00 10.00 ? 94  ILE A CD1  4  
ATOM   7987  H  H    . ILE A 1 94  ? 6.648   13.276  -7.233  1.00 10.00 ? 94  ILE A H    4  
ATOM   7988  H  HA   . ILE A 1 94  ? 6.411   11.715  -9.773  1.00 10.00 ? 94  ILE A HA   4  
ATOM   7989  H  HB   . ILE A 1 94  ? 4.080   11.492  -9.392  1.00 10.00 ? 94  ILE A HB   4  
ATOM   7990  H  HG12 . ILE A 1 94  ? 4.616   12.725  -6.677  1.00 10.00 ? 94  ILE A HG12 4  
ATOM   7991  H  HG13 . ILE A 1 94  ? 3.392   13.144  -7.902  1.00 10.00 ? 94  ILE A HG13 4  
ATOM   7992  H  HG21 . ILE A 1 94  ? 5.705   10.301  -7.108  1.00 10.00 ? 94  ILE A HG21 4  
ATOM   7993  H  HG22 . ILE A 1 94  ? 4.332   9.580   -7.992  1.00 10.00 ? 94  ILE A HG22 4  
ATOM   7994  H  HG23 . ILE A 1 94  ? 5.882   9.805   -8.797  1.00 10.00 ? 94  ILE A HG23 4  
ATOM   7995  H  HD11 . ILE A 1 94  ? 2.331   10.882  -7.426  1.00 10.00 ? 94  ILE A HD11 4  
ATOM   7996  H  HD12 . ILE A 1 94  ? 3.480   10.735  -6.072  1.00 10.00 ? 94  ILE A HD12 4  
ATOM   7997  H  HD13 . ILE A 1 94  ? 2.295   12.045  -6.086  1.00 10.00 ? 94  ILE A HD13 4  
ATOM   7998  N  N    . PRO A 1 95  ? 6.564   14.079  -10.732 1.00 10.00 ? 95  PRO A N    4  
ATOM   7999  C  CA   . PRO A 1 95  ? 6.591   15.403  -11.340 1.00 10.00 ? 95  PRO A CA   4  
ATOM   8000  C  C    . PRO A 1 95  ? 5.434   15.569  -12.327 1.00 10.00 ? 95  PRO A C    4  
ATOM   8001  O  O    . PRO A 1 95  ? 5.646   15.831  -13.507 1.00 10.00 ? 95  PRO A O    4  
ATOM   8002  C  CB   . PRO A 1 95  ? 7.938   15.477  -12.061 1.00 10.00 ? 95  PRO A CB   4  
ATOM   8003  C  CG   . PRO A 1 95  ? 8.189   14.032  -12.480 1.00 10.00 ? 95  PRO A CG   4  
ATOM   8004  C  CD   . PRO A 1 95  ? 7.601   13.236  -11.319 1.00 10.00 ? 95  PRO A CD   4  
ATOM   8005  H  HA   . PRO A 1 95  ? 6.538   16.188  -10.585 1.00 10.00 ? 95  PRO A HA   4  
ATOM   8006  H  HB2  . PRO A 1 95  ? 7.884   16.131  -12.929 1.00 10.00 ? 95  PRO A HB2  4  
ATOM   8007  H  HB3  . PRO A 1 95  ? 8.715   15.805  -11.369 1.00 10.00 ? 95  PRO A HB3  4  
ATOM   8008  H  HG2  . PRO A 1 95  ? 7.621   13.815  -13.388 1.00 10.00 ? 95  PRO A HG2  4  
ATOM   8009  H  HG3  . PRO A 1 95  ? 9.247   13.817  -12.638 1.00 10.00 ? 95  PRO A HG3  4  
ATOM   8010  H  HD2  . PRO A 1 95  ? 7.206   12.295  -11.705 1.00 10.00 ? 95  PRO A HD2  4  
ATOM   8011  H  HD3  . PRO A 1 95  ? 8.385   13.041  -10.588 1.00 10.00 ? 95  PRO A HD3  4  
ATOM   8012  N  N    . ALA A 1 96  ? 4.208   15.394  -11.839 1.00 10.00 ? 96  ALA A N    4  
ATOM   8013  C  CA   . ALA A 1 96  ? 3.035   15.189  -12.650 1.00 10.00 ? 96  ALA A CA   4  
ATOM   8014  C  C    . ALA A 1 96  ? 3.151   13.877  -13.417 1.00 10.00 ? 96  ALA A C    4  
ATOM   8015  O  O    . ALA A 1 96  ? 4.226   13.315  -13.612 1.00 10.00 ? 96  ALA A O    4  
ATOM   8016  C  CB   . ALA A 1 96  ? 2.743   16.397  -13.534 1.00 10.00 ? 96  ALA A CB   4  
ATOM   8017  H  H    . ALA A 1 96  ? 4.102   15.212  -10.853 1.00 10.00 ? 96  ALA A H    4  
ATOM   8018  H  HA   . ALA A 1 96  ? 2.199   15.086  -11.960 1.00 10.00 ? 96  ALA A HA   4  
ATOM   8019  H  HB1  . ALA A 1 96  ? 3.480   16.510  -14.326 1.00 10.00 ? 96  ALA A HB1  4  
ATOM   8020  H  HB2  . ALA A 1 96  ? 1.771   16.261  -13.995 1.00 10.00 ? 96  ALA A HB2  4  
ATOM   8021  H  HB3  . ALA A 1 96  ? 2.736   17.292  -12.914 1.00 10.00 ? 96  ALA A HB3  4  
ATOM   8022  N  N    . ARG A 1 97  ? 1.987   13.339  -13.759 1.00 10.00 ? 97  ARG A N    4  
ATOM   8023  C  CA   . ARG A 1 97  ? 1.819   12.054  -14.419 1.00 10.00 ? 97  ARG A CA   4  
ATOM   8024  C  C    . ARG A 1 97  ? 2.751   10.945  -13.912 1.00 10.00 ? 97  ARG A C    4  
ATOM   8025  O  O    . ARG A 1 97  ? 3.162   10.077  -14.679 1.00 10.00 ? 97  ARG A O    4  
ATOM   8026  C  CB   . ARG A 1 97  ? 1.870   12.244  -15.943 1.00 10.00 ? 97  ARG A CB   4  
ATOM   8027  C  CG   . ARG A 1 97  ? 0.655   13.021  -16.471 1.00 10.00 ? 97  ARG A CG   4  
ATOM   8028  C  CD   . ARG A 1 97  ? -0.644  12.321  -16.044 1.00 10.00 ? 97  ARG A CD   4  
ATOM   8029  N  NE   . ARG A 1 97  ? -1.722  12.499  -17.022 1.00 10.00 ? 97  ARG A NE   4  
ATOM   8030  C  CZ   . ARG A 1 97  ? -2.742  11.635  -17.149 1.00 10.00 ? 97  ARG A CZ   4  
ATOM   8031  N  NH1  . ARG A 1 97  ? -2.952  10.706  -16.206 1.00 10.00 ? 97  ARG A NH1  4  
ATOM   8032  N  NH2  . ARG A 1 97  ? -3.536  11.698  -18.223 1.00 10.00 ? 97  ARG A NH2  4  
ATOM   8033  H  H    . ARG A 1 97  ? 1.177   13.908  -13.580 1.00 10.00 ? 97  ARG A H    4  
ATOM   8034  H  HA   . ARG A 1 97  ? 0.833   11.696  -14.137 1.00 10.00 ? 97  ARG A HA   4  
ATOM   8035  H  HB2  . ARG A 1 97  ? 2.790   12.765  -16.216 1.00 10.00 ? 97  ARG A HB2  4  
ATOM   8036  H  HB3  . ARG A 1 97  ? 1.880   11.271  -16.436 1.00 10.00 ? 97  ARG A HB3  4  
ATOM   8037  H  HG2  . ARG A 1 97  ? 0.668   14.050  -16.103 1.00 10.00 ? 97  ARG A HG2  4  
ATOM   8038  H  HG3  . ARG A 1 97  ? 0.733   13.042  -17.559 1.00 10.00 ? 97  ARG A HG3  4  
ATOM   8039  H  HD2  . ARG A 1 97  ? -0.433  11.253  -15.962 1.00 10.00 ? 97  ARG A HD2  4  
ATOM   8040  H  HD3  . ARG A 1 97  ? -0.967  12.707  -15.075 1.00 10.00 ? 97  ARG A HD3  4  
ATOM   8041  H  HE   . ARG A 1 97  ? -1.611  13.254  -17.687 1.00 10.00 ? 97  ARG A HE   4  
ATOM   8042  H  HH11 . ARG A 1 97  ? -2.433  10.738  -15.323 1.00 10.00 ? 97  ARG A HH11 4  
ATOM   8043  H  HH12 . ARG A 1 97  ? -3.628  9.971   -16.328 1.00 10.00 ? 97  ARG A HH12 4  
ATOM   8044  H  HH21 . ARG A 1 97  ? -3.365  12.386  -18.943 1.00 10.00 ? 97  ARG A HH21 4  
ATOM   8045  H  HH22 . ARG A 1 97  ? -4.295  11.047  -18.357 1.00 10.00 ? 97  ARG A HH22 4  
ATOM   8046  N  N    . GLY A 1 98  ? 2.973   10.886  -12.596 1.00 10.00 ? 98  GLY A N    4  
ATOM   8047  C  CA   . GLY A 1 98  ? 3.476   9.693   -11.935 1.00 10.00 ? 98  GLY A CA   4  
ATOM   8048  C  C    . GLY A 1 98  ? 2.443   8.566   -11.998 1.00 10.00 ? 98  GLY A C    4  
ATOM   8049  O  O    . GLY A 1 98  ? 1.864   8.171   -10.991 1.00 10.00 ? 98  GLY A O    4  
ATOM   8050  H  H    . GLY A 1 98  ? 2.743   11.687  -12.028 1.00 10.00 ? 98  GLY A H    4  
ATOM   8051  H  HA2  . GLY A 1 98  ? 4.406   9.369   -12.406 1.00 10.00 ? 98  GLY A HA2  4  
ATOM   8052  H  HA3  . GLY A 1 98  ? 3.679   9.920   -10.892 1.00 10.00 ? 98  GLY A HA3  4  
ATOM   8053  N  N    . THR A 1 99  ? 2.209   8.017   -13.186 1.00 10.00 ? 99  THR A N    4  
ATOM   8054  C  CA   . THR A 1 99  ? 1.468   6.777   -13.340 1.00 10.00 ? 99  THR A CA   4  
ATOM   8055  C  C    . THR A 1 99  ? 2.452   5.635   -13.148 1.00 10.00 ? 99  THR A C    4  
ATOM   8056  O  O    . THR A 1 99  ? 2.629   4.801   -14.037 1.00 10.00 ? 99  THR A O    4  
ATOM   8057  C  CB   . THR A 1 99  ? 0.718   6.761   -14.683 1.00 10.00 ? 99  THR A CB   4  
ATOM   8058  O  OG1  . THR A 1 99  ? 0.152   5.491   -14.924 1.00 10.00 ? 99  THR A OG1  4  
ATOM   8059  C  CG2  . THR A 1 99  ? 1.621   7.141   -15.858 1.00 10.00 ? 99  THR A CG2  4  
ATOM   8060  H  H    . THR A 1 99  ? 2.724   8.389   -13.976 1.00 10.00 ? 99  THR A H    4  
ATOM   8061  H  HA   . THR A 1 99  ? 0.740   6.658   -12.556 1.00 10.00 ? 99  THR A HA   4  
ATOM   8062  H  HB   . THR A 1 99  ? -0.097  7.484   -14.628 1.00 10.00 ? 99  THR A HB   4  
ATOM   8063  H  HG1  . THR A 1 99  ? 0.871   4.845   -14.885 1.00 10.00 ? 99  THR A HG1  4  
ATOM   8064  H  HG21 . THR A 1 99  ? 2.548   6.568   -15.822 1.00 10.00 ? 99  THR A HG21 4  
ATOM   8065  H  HG22 . THR A 1 99  ? 1.105   6.935   -16.794 1.00 10.00 ? 99  THR A HG22 4  
ATOM   8066  H  HG23 . THR A 1 99  ? 1.857   8.202   -15.816 1.00 10.00 ? 99  THR A HG23 4  
ATOM   8067  N  N    . LEU A 1 100 ? 3.112   5.625   -11.989 1.00 10.00 ? 100 LEU A N    4  
ATOM   8068  C  CA   . LEU A 1 100 ? 4.261   4.762   -11.800 1.00 10.00 ? 100 LEU A CA   4  
ATOM   8069  C  C    . LEU A 1 100 ? 3.848   3.464   -11.121 1.00 10.00 ? 100 LEU A C    4  
ATOM   8070  O  O    . LEU A 1 100 ? 2.715   3.300   -10.667 1.00 10.00 ? 100 LEU A O    4  
ATOM   8071  C  CB   . LEU A 1 100 ? 5.401   5.507   -11.102 1.00 10.00 ? 100 LEU A CB   4  
ATOM   8072  C  CG   . LEU A 1 100 ? 5.129   5.761   -9.616  1.00 10.00 ? 100 LEU A CG   4  
ATOM   8073  C  CD1  . LEU A 1 100 ? 6.243   5.172   -8.761  1.00 10.00 ? 100 LEU A CD1  4  
ATOM   8074  C  CD2  . LEU A 1 100 ? 5.040   7.256   -9.336  1.00 10.00 ? 100 LEU A CD2  4  
ATOM   8075  H  H    . LEU A 1 100 ? 2.786   6.221   -11.229 1.00 10.00 ? 100 LEU A H    4  
ATOM   8076  H  HA   . LEU A 1 100 ? 4.664   4.489   -12.777 1.00 10.00 ? 100 LEU A HA   4  
ATOM   8077  H  HB2  . LEU A 1 100 ? 6.317   4.924   -11.211 1.00 10.00 ? 100 LEU A HB2  4  
ATOM   8078  H  HB3  . LEU A 1 100 ? 5.557   6.452   -11.623 1.00 10.00 ? 100 LEU A HB3  4  
ATOM   8079  H  HG   . LEU A 1 100 ? 4.206   5.277   -9.317  1.00 10.00 ? 100 LEU A HG   4  
ATOM   8080  H  HD11 . LEU A 1 100 ? 6.017   5.305   -7.703  1.00 10.00 ? 100 LEU A HD11 4  
ATOM   8081  H  HD12 . LEU A 1 100 ? 6.320   4.108   -8.979  1.00 10.00 ? 100 LEU A HD12 4  
ATOM   8082  H  HD13 . LEU A 1 100 ? 7.180   5.676   -8.996  1.00 10.00 ? 100 LEU A HD13 4  
ATOM   8083  H  HD21 . LEU A 1 100 ? 5.950   7.742   -9.690  1.00 10.00 ? 100 LEU A HD21 4  
ATOM   8084  H  HD22 . LEU A 1 100 ? 4.176   7.680   -9.842  1.00 10.00 ? 100 LEU A HD22 4  
ATOM   8085  H  HD23 . LEU A 1 100 ? 4.944   7.409   -8.264  1.00 10.00 ? 100 LEU A HD23 4  
ATOM   8086  N  N    . THR A 1 101 ? 4.800   2.545   -11.066 1.00 10.00 ? 101 THR A N    4  
ATOM   8087  C  CA   . THR A 1 101 ? 4.622   1.171   -10.664 1.00 10.00 ? 101 THR A CA   4  
ATOM   8088  C  C    . THR A 1 101 ? 5.678   0.929   -9.599  1.00 10.00 ? 101 THR A C    4  
ATOM   8089  O  O    . THR A 1 101 ? 6.836   1.309   -9.765  1.00 10.00 ? 101 THR A O    4  
ATOM   8090  C  CB   . THR A 1 101 ? 4.694   0.234   -11.883 1.00 10.00 ? 101 THR A CB   4  
ATOM   8091  O  OG1  . THR A 1 101 ? 4.371   -1.087  -11.510 1.00 10.00 ? 101 THR A OG1  4  
ATOM   8092  C  CG2  . THR A 1 101 ? 6.031   0.267   -12.631 1.00 10.00 ? 101 THR A CG2  4  
ATOM   8093  H  H    . THR A 1 101 ? 5.752   2.868   -11.133 1.00 10.00 ? 101 THR A H    4  
ATOM   8094  H  HA   . THR A 1 101 ? 3.634   1.042   -10.223 1.00 10.00 ? 101 THR A HA   4  
ATOM   8095  H  HB   . THR A 1 101 ? 3.925   0.547   -12.589 1.00 10.00 ? 101 THR A HB   4  
ATOM   8096  H  HG1  . THR A 1 101 ? 5.100   -1.451  -10.990 1.00 10.00 ? 101 THR A HG1  4  
ATOM   8097  H  HG21 . THR A 1 101 ? 6.858   -0.008  -11.977 1.00 10.00 ? 101 THR A HG21 4  
ATOM   8098  H  HG22 . THR A 1 101 ? 5.993   -0.431  -13.467 1.00 10.00 ? 101 THR A HG22 4  
ATOM   8099  H  HG23 . THR A 1 101 ? 6.204   1.268   -13.022 1.00 10.00 ? 101 THR A HG23 4  
ATOM   8100  N  N    . LEU A 1 102 ? 5.225   0.398   -8.473  1.00 10.00 ? 102 LEU A N    4  
ATOM   8101  C  CA   . LEU A 1 102 ? 5.973   0.237   -7.256  1.00 10.00 ? 102 LEU A CA   4  
ATOM   8102  C  C    . LEU A 1 102 ? 5.985   -1.265  -7.025  1.00 10.00 ? 102 LEU A C    4  
ATOM   8103  O  O    . LEU A 1 102 ? 4.963   -1.838  -6.653  1.00 10.00 ? 102 LEU A O    4  
ATOM   8104  C  CB   . LEU A 1 102 ? 5.297   1.027   -6.117  1.00 10.00 ? 102 LEU A CB   4  
ATOM   8105  C  CG   . LEU A 1 102 ? 5.044   2.512   -6.457  1.00 10.00 ? 102 LEU A CG   4  
ATOM   8106  C  CD1  . LEU A 1 102 ? 3.669   2.783   -7.074  1.00 10.00 ? 102 LEU A CD1  4  
ATOM   8107  C  CD2  . LEU A 1 102 ? 5.201   3.377   -5.202  1.00 10.00 ? 102 LEU A CD2  4  
ATOM   8108  H  H    . LEU A 1 102 ? 4.269   0.074   -8.446  1.00 10.00 ? 102 LEU A H    4  
ATOM   8109  H  HA   . LEU A 1 102 ? 6.995   0.589   -7.382  1.00 10.00 ? 102 LEU A HA   4  
ATOM   8110  H  HB2  . LEU A 1 102 ? 4.349   0.584   -5.827  1.00 10.00 ? 102 LEU A HB2  4  
ATOM   8111  H  HB3  . LEU A 1 102 ? 5.953   0.958   -5.252  1.00 10.00 ? 102 LEU A HB3  4  
ATOM   8112  H  HG   . LEU A 1 102 ? 5.758   2.841   -7.202  1.00 10.00 ? 102 LEU A HG   4  
ATOM   8113  H  HD11 . LEU A 1 102 ? 2.878   2.502   -6.383  1.00 10.00 ? 102 LEU A HD11 4  
ATOM   8114  H  HD12 . LEU A 1 102 ? 3.589   3.843   -7.310  1.00 10.00 ? 102 LEU A HD12 4  
ATOM   8115  H  HD13 . LEU A 1 102 ? 3.554   2.238   -8.003  1.00 10.00 ? 102 LEU A HD13 4  
ATOM   8116  H  HD21 . LEU A 1 102 ? 4.487   3.059   -4.446  1.00 10.00 ? 102 LEU A HD21 4  
ATOM   8117  H  HD22 . LEU A 1 102 ? 6.208   3.282   -4.798  1.00 10.00 ? 102 LEU A HD22 4  
ATOM   8118  H  HD23 . LEU A 1 102 ? 5.028   4.425   -5.445  1.00 10.00 ? 102 LEU A HD23 4  
ATOM   8119  N  N    . GLN A 1 103 ? 7.111   -1.913  -7.310  1.00 10.00 ? 103 GLN A N    4  
ATOM   8120  C  CA   . GLN A 1 103 ? 7.277   -3.347  -7.167  1.00 10.00 ? 103 GLN A CA   4  
ATOM   8121  C  C    . GLN A 1 103 ? 8.734   -3.583  -6.783  1.00 10.00 ? 103 GLN A C    4  
ATOM   8122  O  O    . GLN A 1 103 ? 9.518   -2.640  -6.764  1.00 10.00 ? 103 GLN A O    4  
ATOM   8123  C  CB   . GLN A 1 103 ? 6.828   -4.112  -8.425  1.00 10.00 ? 103 GLN A CB   4  
ATOM   8124  C  CG   . GLN A 1 103 ? 7.753   -4.011  -9.633  1.00 10.00 ? 103 GLN A CG   4  
ATOM   8125  C  CD   . GLN A 1 103 ? 7.404   -2.863  -10.556 1.00 10.00 ? 103 GLN A CD   4  
ATOM   8126  O  OE1  . GLN A 1 103 ? 6.633   -1.968  -10.221 1.00 10.00 ? 103 GLN A OE1  4  
ATOM   8127  N  NE2  . GLN A 1 103 ? 7.949   -2.892  -11.757 1.00 10.00 ? 103 GLN A NE2  4  
ATOM   8128  H  H    . GLN A 1 103 ? 7.950   -1.384  -7.534  1.00 10.00 ? 103 GLN A H    4  
ATOM   8129  H  HA   . GLN A 1 103 ? 6.632   -3.710  -6.374  1.00 10.00 ? 103 GLN A HA   4  
ATOM   8130  H  HB2  . GLN A 1 103 ? 6.769   -5.168  -8.166  1.00 10.00 ? 103 GLN A HB2  4  
ATOM   8131  H  HB3  . GLN A 1 103 ? 5.837   -3.788  -8.746  1.00 10.00 ? 103 GLN A HB3  4  
ATOM   8132  H  HG2  . GLN A 1 103 ? 8.790   -3.922  -9.336  1.00 10.00 ? 103 GLN A HG2  4  
ATOM   8133  H  HG3  . GLN A 1 103 ? 7.631   -4.928  -10.212 1.00 10.00 ? 103 GLN A HG3  4  
ATOM   8134  H  HE21 . GLN A 1 103 ? 8.644   -3.619  -11.985 1.00 10.00 ? 103 GLN A HE21 4  
ATOM   8135  H  HE22 . GLN A 1 103 ? 7.675   -2.189  -12.410 1.00 10.00 ? 103 GLN A HE22 4  
ATOM   8136  N  N    . ARG A 1 104 ? 9.115   -4.826  -6.498  1.00 10.00 ? 104 ARG A N    4  
ATOM   8137  C  CA   . ARG A 1 104 ? 10.509  -5.191  -6.222  1.00 10.00 ? 104 ARG A CA   4  
ATOM   8138  C  C    . ARG A 1 104 ? 11.490  -4.449  -7.147  1.00 10.00 ? 104 ARG A C    4  
ATOM   8139  O  O    . ARG A 1 104 ? 12.460  -3.843  -6.693  1.00 10.00 ? 104 ARG A O    4  
ATOM   8140  C  CB   . ARG A 1 104 ? 10.700  -6.707  -6.372  1.00 10.00 ? 104 ARG A CB   4  
ATOM   8141  C  CG   . ARG A 1 104 ? 9.636   -7.505  -5.610  1.00 10.00 ? 104 ARG A CG   4  
ATOM   8142  C  CD   . ARG A 1 104 ? 10.089  -8.942  -5.359  1.00 10.00 ? 104 ARG A CD   4  
ATOM   8143  N  NE   . ARG A 1 104 ? 10.416  -9.643  -6.609  1.00 10.00 ? 104 ARG A NE   4  
ATOM   8144  C  CZ   . ARG A 1 104 ? 10.889  -10.898 -6.675  1.00 10.00 ? 104 ARG A CZ   4  
ATOM   8145  N  NH1  . ARG A 1 104 ? 11.082  -11.608 -5.562  1.00 10.00 ? 104 ARG A NH1  4  
ATOM   8146  N  NH2  . ARG A 1 104 ? 11.177  -11.436 -7.866  1.00 10.00 ? 104 ARG A NH2  4  
ATOM   8147  H  H    . ARG A 1 104 ? 8.383   -5.516  -6.442  1.00 10.00 ? 104 ARG A H    4  
ATOM   8148  H  HA   . ARG A 1 104 ? 10.735  -4.913  -5.192  1.00 10.00 ? 104 ARG A HA   4  
ATOM   8149  H  HB2  . ARG A 1 104 ? 10.658  -6.980  -7.429  1.00 10.00 ? 104 ARG A HB2  4  
ATOM   8150  H  HB3  . ARG A 1 104 ? 11.690  -6.956  -5.986  1.00 10.00 ? 104 ARG A HB3  4  
ATOM   8151  H  HG2  . ARG A 1 104 ? 9.460   -7.046  -4.639  1.00 10.00 ? 104 ARG A HG2  4  
ATOM   8152  H  HG3  . ARG A 1 104 ? 8.699   -7.520  -6.170  1.00 10.00 ? 104 ARG A HG3  4  
ATOM   8153  H  HD2  . ARG A 1 104 ? 10.952  -8.930  -4.687  1.00 10.00 ? 104 ARG A HD2  4  
ATOM   8154  H  HD3  . ARG A 1 104 ? 9.269   -9.457  -4.859  1.00 10.00 ? 104 ARG A HD3  4  
ATOM   8155  H  HE   . ARG A 1 104 ? 10.245  -9.133  -7.464  1.00 10.00 ? 104 ARG A HE   4  
ATOM   8156  H  HH11 . ARG A 1 104 ? 10.805  -11.216 -4.655  1.00 10.00 ? 104 ARG A HH11 4  
ATOM   8157  H  HH12 . ARG A 1 104 ? 11.338  -12.582 -5.558  1.00 10.00 ? 104 ARG A HH12 4  
ATOM   8158  H  HH21 . ARG A 1 104 ? 11.031  -10.908 -8.714  1.00 10.00 ? 104 ARG A HH21 4  
ATOM   8159  H  HH22 . ARG A 1 104 ? 11.542  -12.373 -7.936  1.00 10.00 ? 104 ARG A HH22 4  
ATOM   8160  N  N    . ASP A 1 105 ? 11.197  -4.510  -8.445  1.00 10.00 ? 105 ASP A N    4  
ATOM   8161  C  CA   . ASP A 1 105 ? 11.952  -3.966  -9.566  1.00 10.00 ? 105 ASP A CA   4  
ATOM   8162  C  C    . ASP A 1 105 ? 11.421  -2.614  -10.079 1.00 10.00 ? 105 ASP A C    4  
ATOM   8163  O  O    . ASP A 1 105 ? 11.811  -2.210  -11.171 1.00 10.00 ? 105 ASP A O    4  
ATOM   8164  C  CB   . ASP A 1 105 ? 11.883  -5.008  -10.698 1.00 10.00 ? 105 ASP A CB   4  
ATOM   8165  C  CG   . ASP A 1 105 ? 10.433  -5.369  -10.996 1.00 10.00 ? 105 ASP A CG   4  
ATOM   8166  O  OD1  . ASP A 1 105 ? 9.892   -6.133  -10.165 1.00 10.00 ? 105 ASP A OD1  4  
ATOM   8167  O  OD2  . ASP A 1 105 ? 9.856   -4.800  -11.948 1.00 10.00 ? 105 ASP A OD2  4  
ATOM   8168  H  H    . ASP A 1 105 ? 10.425  -5.119  -8.720  1.00 10.00 ? 105 ASP A H    4  
ATOM   8169  H  HA   . ASP A 1 105 ? 12.996  -3.831  -9.281  1.00 10.00 ? 105 ASP A HA   4  
ATOM   8170  H  HB2  . ASP A 1 105 ? 12.359  -4.628  -11.603 1.00 10.00 ? 105 ASP A HB2  4  
ATOM   8171  H  HB3  . ASP A 1 105 ? 12.406  -5.913  -10.388 1.00 10.00 ? 105 ASP A HB3  4  
ATOM   8172  N  N    . GLY A 1 106 ? 10.581  -1.883  -9.331  1.00 10.00 ? 106 GLY A N    4  
ATOM   8173  C  CA   . GLY A 1 106 ? 10.040  -0.600  -9.794  1.00 10.00 ? 106 GLY A CA   4  
ATOM   8174  C  C    . GLY A 1 106 ? 9.848   0.369   -8.639  1.00 10.00 ? 106 GLY A C    4  
ATOM   8175  O  O    . GLY A 1 106 ? 9.699   -0.087  -7.515  1.00 10.00 ? 106 GLY A O    4  
ATOM   8176  H  H    . GLY A 1 106 ? 10.330  -2.188  -8.395  1.00 10.00 ? 106 GLY A H    4  
ATOM   8177  H  HA2  . GLY A 1 106 ? 10.748  -0.132  -10.464 1.00 10.00 ? 106 GLY A HA2  4  
ATOM   8178  H  HA3  . GLY A 1 106 ? 9.097   -0.734  -10.319 1.00 10.00 ? 106 GLY A HA3  4  
ATOM   8179  N  N    . ASP A 1 107 ? 9.928   1.681   -8.890  1.00 10.00 ? 107 ASP A N    4  
ATOM   8180  C  CA   . ASP A 1 107 ? 9.995   2.749   -7.887  1.00 10.00 ? 107 ASP A CA   4  
ATOM   8181  C  C    . ASP A 1 107 ? 9.172   2.460   -6.625  1.00 10.00 ? 107 ASP A C    4  
ATOM   8182  O  O    . ASP A 1 107 ? 7.977   2.710   -6.626  1.00 10.00 ? 107 ASP A O    4  
ATOM   8183  C  CB   . ASP A 1 107 ? 9.458   4.064   -8.483  1.00 10.00 ? 107 ASP A CB   4  
ATOM   8184  C  CG   . ASP A 1 107 ? 10.204  4.726   -9.626  1.00 10.00 ? 107 ASP A CG   4  
ATOM   8185  O  OD1  . ASP A 1 107 ? 11.392  4.403   -9.829  1.00 10.00 ? 107 ASP A OD1  4  
ATOM   8186  O  OD2  . ASP A 1 107 ? 9.575   5.577   -10.287 1.00 10.00 ? 107 ASP A OD2  4  
ATOM   8187  H  H    . ASP A 1 107 ? 9.960   1.956   -9.868  1.00 10.00 ? 107 ASP A H    4  
ATOM   8188  H  HA   . ASP A 1 107 ? 11.024  2.828   -7.570  1.00 10.00 ? 107 ASP A HA   4  
ATOM   8189  H  HB2  . ASP A 1 107 ? 8.470   3.834   -8.866  1.00 10.00 ? 107 ASP A HB2  4  
ATOM   8190  H  HB3  . ASP A 1 107 ? 9.370   4.807   -7.692  1.00 10.00 ? 107 ASP A HB3  4  
ATOM   8191  N  N    . HIS A 1 108 ? 9.774   1.958   -5.541  1.00 10.00 ? 108 HIS A N    4  
ATOM   8192  C  CA   . HIS A 1 108 ? 9.024   1.396   -4.418  1.00 10.00 ? 108 HIS A CA   4  
ATOM   8193  C  C    . HIS A 1 108 ? 9.454   2.003   -3.080  1.00 10.00 ? 108 HIS A C    4  
ATOM   8194  O  O    . HIS A 1 108 ? 10.425  2.759   -3.006  1.00 10.00 ? 108 HIS A O    4  
ATOM   8195  C  CB   . HIS A 1 108 ? 9.183   -0.130  -4.390  1.00 10.00 ? 108 HIS A CB   4  
ATOM   8196  C  CG   . HIS A 1 108 ? 10.621  -0.584  -4.394  1.00 10.00 ? 108 HIS A CG   4  
ATOM   8197  N  ND1  . HIS A 1 108 ? 11.438  -0.617  -5.494  1.00 10.00 ? 108 HIS A ND1  4  
ATOM   8198  C  CD2  . HIS A 1 108 ? 11.319  -1.110  -3.343  1.00 10.00 ? 108 HIS A CD2  4  
ATOM   8199  C  CE1  . HIS A 1 108 ? 12.589  -1.194  -5.122  1.00 10.00 ? 108 HIS A CE1  4  
ATOM   8200  N  NE2  . HIS A 1 108 ? 12.600  -1.466  -3.801  1.00 10.00 ? 108 HIS A NE2  4  
ATOM   8201  H  H    . HIS A 1 108 ? 10.780  1.917   -5.506  1.00 10.00 ? 108 HIS A H    4  
ATOM   8202  H  HA   . HIS A 1 108 ? 7.962   1.600   -4.572  1.00 10.00 ? 108 HIS A HA   4  
ATOM   8203  H  HB2  . HIS A 1 108 ? 8.678   -0.549  -3.519  1.00 10.00 ? 108 HIS A HB2  4  
ATOM   8204  H  HB3  . HIS A 1 108 ? 8.689   -0.545  -5.267  1.00 10.00 ? 108 HIS A HB3  4  
ATOM   8205  H  HD1  . HIS A 1 108 ? 11.174  -0.305  -6.424  1.00 10.00 ? 108 HIS A HD1  4  
ATOM   8206  H  HD2  . HIS A 1 108 ? 10.923  -1.261  -2.351  1.00 10.00 ? 108 HIS A HD2  4  
ATOM   8207  H  HE1  . HIS A 1 108 ? 13.382  -1.433  -5.807  1.00 10.00 ? 108 HIS A HE1  4  
ATOM   8208  N  N    . VAL A 1 109 ? 8.743   1.627   -2.011  1.00 10.00 ? 109 VAL A N    4  
ATOM   8209  C  CA   . VAL A 1 109 ? 9.000   2.065   -0.649  1.00 10.00 ? 109 VAL A CA   4  
ATOM   8210  C  C    . VAL A 1 109 ? 9.514   0.845   0.112   1.00 10.00 ? 109 VAL A C    4  
ATOM   8211  O  O    . VAL A 1 109 ? 8.717   -0.054  0.372   1.00 10.00 ? 109 VAL A O    4  
ATOM   8212  C  CB   . VAL A 1 109 ? 7.695   2.592   -0.012  1.00 10.00 ? 109 VAL A CB   4  
ATOM   8213  C  CG1  . VAL A 1 109 ? 8.014   3.343   1.288   1.00 10.00 ? 109 VAL A CG1  4  
ATOM   8214  C  CG2  . VAL A 1 109 ? 6.884   3.492   -0.957  1.00 10.00 ? 109 VAL A CG2  4  
ATOM   8215  H  H    . VAL A 1 109 ? 8.021   0.924   -2.120  1.00 10.00 ? 109 VAL A H    4  
ATOM   8216  H  HA   . VAL A 1 109 ? 9.747   2.858   -0.629  1.00 10.00 ? 109 VAL A HA   4  
ATOM   8217  H  HB   . VAL A 1 109 ? 7.043   1.755   0.242   1.00 10.00 ? 109 VAL A HB   4  
ATOM   8218  H  HG11 . VAL A 1 109 ? 8.635   4.214   1.079   1.00 10.00 ? 109 VAL A HG11 4  
ATOM   8219  H  HG12 . VAL A 1 109 ? 7.089   3.671   1.762   1.00 10.00 ? 109 VAL A HG12 4  
ATOM   8220  H  HG13 . VAL A 1 109 ? 8.544   2.688   1.981   1.00 10.00 ? 109 VAL A HG13 4  
ATOM   8221  H  HG21 . VAL A 1 109 ? 6.046   3.932   -0.415  1.00 10.00 ? 109 VAL A HG21 4  
ATOM   8222  H  HG22 . VAL A 1 109 ? 7.503   4.288   -1.361  1.00 10.00 ? 109 VAL A HG22 4  
ATOM   8223  H  HG23 . VAL A 1 109 ? 6.481   2.904   -1.782  1.00 10.00 ? 109 VAL A HG23 4  
ATOM   8224  N  N    . MET A 1 110 ? 10.809  0.791   0.453   1.00 10.00 ? 110 MET A N    4  
ATOM   8225  C  CA   . MET A 1 110 ? 11.349  -0.255  1.312   1.00 10.00 ? 110 MET A CA   4  
ATOM   8226  C  C    . MET A 1 110 ? 11.127  0.138   2.768   1.00 10.00 ? 110 MET A C    4  
ATOM   8227  O  O    . MET A 1 110 ? 11.828  0.969   3.337   1.00 10.00 ? 110 MET A O    4  
ATOM   8228  C  CB   . MET A 1 110 ? 12.818  -0.582  1.003   1.00 10.00 ? 110 MET A CB   4  
ATOM   8229  C  CG   . MET A 1 110 ? 12.896  -1.341  -0.323  1.00 10.00 ? 110 MET A CG   4  
ATOM   8230  S  SD   . MET A 1 110 ? 14.442  -2.213  -0.703  1.00 10.00 ? 110 MET A SD   4  
ATOM   8231  C  CE   . MET A 1 110 ? 13.780  -3.836  -1.146  1.00 10.00 ? 110 MET A CE   4  
ATOM   8232  H  H    . MET A 1 110 ? 11.407  1.594   0.283   1.00 10.00 ? 110 MET A H    4  
ATOM   8233  H  HA   . MET A 1 110 ? 10.792  -1.172  1.139   1.00 10.00 ? 110 MET A HA   4  
ATOM   8234  H  HB2  . MET A 1 110 ? 13.428  0.321   0.974   1.00 10.00 ? 110 MET A HB2  4  
ATOM   8235  H  HB3  . MET A 1 110 ? 13.195  -1.241  1.787   1.00 10.00 ? 110 MET A HB3  4  
ATOM   8236  H  HG2  . MET A 1 110 ? 12.122  -2.102  -0.328  1.00 10.00 ? 110 MET A HG2  4  
ATOM   8237  H  HG3  . MET A 1 110 ? 12.688  -0.628  -1.114  1.00 10.00 ? 110 MET A HG3  4  
ATOM   8238  H  HE1  . MET A 1 110 ? 14.608  -4.512  -1.358  1.00 10.00 ? 110 MET A HE1  4  
ATOM   8239  H  HE2  . MET A 1 110 ? 13.213  -4.231  -0.304  1.00 10.00 ? 110 MET A HE2  4  
ATOM   8240  H  HE3  . MET A 1 110 ? 13.133  -3.758  -2.018  1.00 10.00 ? 110 MET A HE3  4  
ATOM   8241  N  N    . LEU A 1 111 ? 10.124  -0.488  3.368   1.00 10.00 ? 111 LEU A N    4  
ATOM   8242  C  CA   . LEU A 1 111 ? 9.785   -0.394  4.769   1.00 10.00 ? 111 LEU A CA   4  
ATOM   8243  C  C    . LEU A 1 111 ? 10.693  -1.394  5.481   1.00 10.00 ? 111 LEU A C    4  
ATOM   8244  O  O    . LEU A 1 111 ? 10.245  -2.439  5.947   1.00 10.00 ? 111 LEU A O    4  
ATOM   8245  C  CB   . LEU A 1 111 ? 8.289   -0.719  4.918   1.00 10.00 ? 111 LEU A CB   4  
ATOM   8246  C  CG   . LEU A 1 111 ? 7.379   0.314   4.230   1.00 10.00 ? 111 LEU A CG   4  
ATOM   8247  C  CD1  . LEU A 1 111 ? 5.935   -0.198  4.233   1.00 10.00 ? 111 LEU A CD1  4  
ATOM   8248  C  CD2  . LEU A 1 111 ? 7.434   1.676   4.932   1.00 10.00 ? 111 LEU A CD2  4  
ATOM   8249  H  H    . LEU A 1 111 ? 9.756   -1.280  2.863   1.00 10.00 ? 111 LEU A H    4  
ATOM   8250  H  HA   . LEU A 1 111 ? 9.991   0.599   5.164   1.00 10.00 ? 111 LEU A HA   4  
ATOM   8251  H  HB2  . LEU A 1 111 ? 8.103   -1.697  4.471   1.00 10.00 ? 111 LEU A HB2  4  
ATOM   8252  H  HB3  . LEU A 1 111 ? 8.021   -0.773  5.970   1.00 10.00 ? 111 LEU A HB3  4  
ATOM   8253  H  HG   . LEU A 1 111 ? 7.680   0.442   3.189   1.00 10.00 ? 111 LEU A HG   4  
ATOM   8254  H  HD11 . LEU A 1 111 ? 5.885   -1.145  3.697   1.00 10.00 ? 111 LEU A HD11 4  
ATOM   8255  H  HD12 . LEU A 1 111 ? 5.586   -0.342  5.256   1.00 10.00 ? 111 LEU A HD12 4  
ATOM   8256  H  HD13 . LEU A 1 111 ? 5.288   0.520   3.729   1.00 10.00 ? 111 LEU A HD13 4  
ATOM   8257  H  HD21 . LEU A 1 111 ? 8.412   2.135   4.796   1.00 10.00 ? 111 LEU A HD21 4  
ATOM   8258  H  HD22 . LEU A 1 111 ? 6.684   2.341   4.504   1.00 10.00 ? 111 LEU A HD22 4  
ATOM   8259  H  HD23 . LEU A 1 111 ? 7.237   1.558   5.998   1.00 10.00 ? 111 LEU A HD23 4  
ATOM   8260  N  N    . MET A 1 112 ? 11.988  -1.081  5.531   1.00 10.00 ? 112 MET A N    4  
ATOM   8261  C  CA   . MET A 1 112 ? 13.009  -2.028  5.941   1.00 10.00 ? 112 MET A CA   4  
ATOM   8262  C  C    . MET A 1 112 ? 13.102  -2.048  7.469   1.00 10.00 ? 112 MET A C    4  
ATOM   8263  O  O    . MET A 1 112 ? 12.853  -1.040  8.127   1.00 10.00 ? 112 MET A O    4  
ATOM   8264  C  CB   . MET A 1 112 ? 14.324  -1.624  5.256   1.00 10.00 ? 112 MET A CB   4  
ATOM   8265  C  CG   . MET A 1 112 ? 15.474  -2.617  5.463   1.00 10.00 ? 112 MET A CG   4  
ATOM   8266  S  SD   . MET A 1 112 ? 17.035  -2.173  4.655   1.00 10.00 ? 112 MET A SD   4  
ATOM   8267  C  CE   . MET A 1 112 ? 16.571  -2.243  2.909   1.00 10.00 ? 112 MET A CE   4  
ATOM   8268  H  H    . MET A 1 112 ? 12.294  -0.172  5.191   1.00 10.00 ? 112 MET A H    4  
ATOM   8269  H  HA   . MET A 1 112 ? 12.725  -3.016  5.580   1.00 10.00 ? 112 MET A HA   4  
ATOM   8270  H  HB2  . MET A 1 112 ? 14.124  -1.555  4.187   1.00 10.00 ? 112 MET A HB2  4  
ATOM   8271  H  HB3  . MET A 1 112 ? 14.641  -0.644  5.606   1.00 10.00 ? 112 MET A HB3  4  
ATOM   8272  H  HG2  . MET A 1 112 ? 15.687  -2.699  6.527   1.00 10.00 ? 112 MET A HG2  4  
ATOM   8273  H  HG3  . MET A 1 112 ? 15.180  -3.594  5.088   1.00 10.00 ? 112 MET A HG3  4  
ATOM   8274  H  HE1  . MET A 1 112 ? 15.814  -1.492  2.691   1.00 10.00 ? 112 MET A HE1  4  
ATOM   8275  H  HE2  . MET A 1 112 ? 17.454  -2.048  2.303   1.00 10.00 ? 112 MET A HE2  4  
ATOM   8276  H  HE3  . MET A 1 112 ? 16.184  -3.233  2.675   1.00 10.00 ? 112 MET A HE3  4  
ATOM   8277  N  N    . GLY A 1 113 ? 13.445  -3.190  8.066   1.00 10.00 ? 113 GLY A N    4  
ATOM   8278  C  CA   . GLY A 1 113 ? 13.555  -3.298  9.512   1.00 10.00 ? 113 GLY A CA   4  
ATOM   8279  C  C    . GLY A 1 113 ? 12.170  -3.499  10.117  1.00 10.00 ? 113 GLY A C    4  
ATOM   8280  O  O    . GLY A 1 113 ? 11.714  -2.689  10.922  1.00 10.00 ? 113 GLY A O    4  
ATOM   8281  H  H    . GLY A 1 113 ? 13.485  -4.049  7.524   1.00 10.00 ? 113 GLY A H    4  
ATOM   8282  H  HA2  . GLY A 1 113 ? 14.183  -4.151  9.761   1.00 10.00 ? 113 GLY A HA2  4  
ATOM   8283  H  HA3  . GLY A 1 113 ? 14.019  -2.404  9.931   1.00 10.00 ? 113 GLY A HA3  4  
ATOM   8284  N  N    . LEU A 1 114 ? 11.510  -4.580  9.709   1.00 10.00 ? 114 LEU A N    4  
ATOM   8285  C  CA   . LEU A 1 114 ? 10.215  -5.033  10.194  1.00 10.00 ? 114 LEU A CA   4  
ATOM   8286  C  C    . LEU A 1 114 ? 10.212  -5.088  11.729  1.00 10.00 ? 114 LEU A C    4  
ATOM   8287  O  O    . LEU A 1 114 ? 11.117  -5.679  12.315  1.00 10.00 ? 114 LEU A O    4  
ATOM   8288  C  CB   . LEU A 1 114 ? 9.966   -6.395  9.525   1.00 10.00 ? 114 LEU A CB   4  
ATOM   8289  C  CG   . LEU A 1 114 ? 8.807   -7.223  10.095  1.00 10.00 ? 114 LEU A CG   4  
ATOM   8290  C  CD1  . LEU A 1 114 ? 8.047   -7.907  8.952   1.00 10.00 ? 114 LEU A CD1  4  
ATOM   8291  C  CD2  . LEU A 1 114 ? 9.342   -8.305  11.048  1.00 10.00 ? 114 LEU A CD2  4  
ATOM   8292  H  H    . LEU A 1 114 ? 11.981  -5.176  9.038   1.00 10.00 ? 114 LEU A H    4  
ATOM   8293  H  HA   . LEU A 1 114 ? 9.442   -4.345  9.852   1.00 10.00 ? 114 LEU A HA   4  
ATOM   8294  H  HB2  . LEU A 1 114 ? 9.778   -6.196  8.468   1.00 10.00 ? 114 LEU A HB2  4  
ATOM   8295  H  HB3  . LEU A 1 114 ? 10.874  -6.993  9.586   1.00 10.00 ? 114 LEU A HB3  4  
ATOM   8296  H  HG   . LEU A 1 114 ? 8.116   -6.564  10.618  1.00 10.00 ? 114 LEU A HG   4  
ATOM   8297  H  HD11 . LEU A 1 114 ? 7.246   -8.526  9.356   1.00 10.00 ? 114 LEU A HD11 4  
ATOM   8298  H  HD12 . LEU A 1 114 ? 7.607   -7.156  8.294   1.00 10.00 ? 114 LEU A HD12 4  
ATOM   8299  H  HD13 . LEU A 1 114 ? 8.728   -8.534  8.375   1.00 10.00 ? 114 LEU A HD13 4  
ATOM   8300  H  HD21 . LEU A 1 114 ? 9.769   -7.852  11.941  1.00 10.00 ? 114 LEU A HD21 4  
ATOM   8301  H  HD22 . LEU A 1 114 ? 8.541   -8.976  11.351  1.00 10.00 ? 114 LEU A HD22 4  
ATOM   8302  H  HD23 . LEU A 1 114 ? 10.106  -8.904  10.551  1.00 10.00 ? 114 LEU A HD23 4  
ATOM   8303  N  N    . LYS A 1 115 ? 9.220   -4.459  12.379  1.00 10.00 ? 115 LYS A N    4  
ATOM   8304  C  CA   . LYS A 1 115 ? 9.036   -4.543  13.825  1.00 10.00 ? 115 LYS A CA   4  
ATOM   8305  C  C    . LYS A 1 115 ? 8.193   -5.776  14.180  1.00 10.00 ? 115 LYS A C    4  
ATOM   8306  O  O    . LYS A 1 115 ? 8.698   -6.725  14.774  1.00 10.00 ? 115 LYS A O    4  
ATOM   8307  C  CB   . LYS A 1 115 ? 8.398   -3.253  14.384  1.00 10.00 ? 115 LYS A CB   4  
ATOM   8308  C  CG   . LYS A 1 115 ? 9.407   -2.136  14.721  1.00 10.00 ? 115 LYS A CG   4  
ATOM   8309  C  CD   . LYS A 1 115 ? 9.413   -0.921  13.782  1.00 10.00 ? 115 LYS A CD   4  
ATOM   8310  C  CE   . LYS A 1 115 ? 8.061   -0.192  13.705  1.00 10.00 ? 115 LYS A CE   4  
ATOM   8311  N  NZ   . LYS A 1 115 ? 8.174   1.219   13.269  1.00 10.00 ? 115 LYS A NZ   4  
ATOM   8312  H  H    . LYS A 1 115 ? 8.509   -3.973  11.840  1.00 10.00 ? 115 LYS A H    4  
ATOM   8313  H  HA   . LYS A 1 115 ? 10.002  -4.686  14.313  1.00 10.00 ? 115 LYS A HA   4  
ATOM   8314  H  HB2  . LYS A 1 115 ? 7.611   -2.898  13.720  1.00 10.00 ? 115 LYS A HB2  4  
ATOM   8315  H  HB3  . LYS A 1 115 ? 7.928   -3.521  15.332  1.00 10.00 ? 115 LYS A HB3  4  
ATOM   8316  H  HG2  . LYS A 1 115 ? 9.190   -1.777  15.727  1.00 10.00 ? 115 LYS A HG2  4  
ATOM   8317  H  HG3  . LYS A 1 115 ? 10.419  -2.547  14.743  1.00 10.00 ? 115 LYS A HG3  4  
ATOM   8318  H  HD2  . LYS A 1 115 ? 10.182  -0.237  14.147  1.00 10.00 ? 115 LYS A HD2  4  
ATOM   8319  H  HD3  . LYS A 1 115 ? 9.704   -1.273  12.794  1.00 10.00 ? 115 LYS A HD3  4  
ATOM   8320  H  HE2  . LYS A 1 115 ? 7.466   -0.723  12.970  1.00 10.00 ? 115 LYS A HE2  4  
ATOM   8321  H  HE3  . LYS A 1 115 ? 7.553   -0.226  14.669  1.00 10.00 ? 115 LYS A HE3  4  
ATOM   8322  H  HZ1  . LYS A 1 115 ? 8.619   1.793   13.968  1.00 10.00 ? 115 LYS A HZ1  4  
ATOM   8323  H  HZ2  . LYS A 1 115 ? 8.703   1.284   12.406  1.00 10.00 ? 115 LYS A HZ2  4  
ATOM   8324  H  HZ3  . LYS A 1 115 ? 7.262   1.613   13.038  1.00 10.00 ? 115 LYS A HZ3  4  
ATOM   8325  N  N    . ARG A 1 116 ? 6.892   -5.742  13.877  1.00 10.00 ? 116 ARG A N    4  
ATOM   8326  C  CA   . ARG A 1 116 ? 5.972   -6.821  14.241  1.00 10.00 ? 116 ARG A CA   4  
ATOM   8327  C  C    . ARG A 1 116 ? 6.106   -7.985  13.252  1.00 10.00 ? 116 ARG A C    4  
ATOM   8328  O  O    . ARG A 1 116 ? 6.523   -7.773  12.118  1.00 10.00 ? 116 ARG A O    4  
ATOM   8329  C  CB   . ARG A 1 116 ? 4.524   -6.294  14.257  1.00 10.00 ? 116 ARG A CB   4  
ATOM   8330  C  CG   . ARG A 1 116 ? 4.054   -5.844  15.646  1.00 10.00 ? 116 ARG A CG   4  
ATOM   8331  C  CD   . ARG A 1 116 ? 4.811   -4.621  16.171  1.00 10.00 ? 116 ARG A CD   4  
ATOM   8332  N  NE   . ARG A 1 116 ? 4.307   -4.243  17.502  1.00 10.00 ? 116 ARG A NE   4  
ATOM   8333  C  CZ   . ARG A 1 116 ? 4.759   -3.213  18.234  1.00 10.00 ? 116 ARG A CZ   4  
ATOM   8334  N  NH1  . ARG A 1 116 ? 5.699   -2.406  17.729  1.00 10.00 ? 116 ARG A NH1  4  
ATOM   8335  N  NH2  . ARG A 1 116 ? 4.272   -2.998  19.461  1.00 10.00 ? 116 ARG A NH2  4  
ATOM   8336  H  H    . ARG A 1 116 ? 6.552   -4.983  13.306  1.00 10.00 ? 116 ARG A H    4  
ATOM   8337  H  HA   . ARG A 1 116 ? 6.230   -7.183  15.236  1.00 10.00 ? 116 ARG A HA   4  
ATOM   8338  H  HB2  . ARG A 1 116 ? 4.403   -5.478  13.544  1.00 10.00 ? 116 ARG A HB2  4  
ATOM   8339  H  HB3  . ARG A 1 116 ? 3.850   -7.097  13.949  1.00 10.00 ? 116 ARG A HB3  4  
ATOM   8340  H  HG2  . ARG A 1 116 ? 2.993   -5.597  15.573  1.00 10.00 ? 116 ARG A HG2  4  
ATOM   8341  H  HG3  . ARG A 1 116 ? 4.164   -6.675  16.345  1.00 10.00 ? 116 ARG A HG3  4  
ATOM   8342  H  HD2  . ARG A 1 116 ? 5.872   -4.867  16.245  1.00 10.00 ? 116 ARG A HD2  4  
ATOM   8343  H  HD3  . ARG A 1 116 ? 4.671   -3.800  15.464  1.00 10.00 ? 116 ARG A HD3  4  
ATOM   8344  H  HE   . ARG A 1 116 ? 3.580   -4.833  17.883  1.00 10.00 ? 116 ARG A HE   4  
ATOM   8345  H  HH11 . ARG A 1 116 ? 6.031   -2.574  16.792  1.00 10.00 ? 116 ARG A HH11 4  
ATOM   8346  H  HH12 . ARG A 1 116 ? 6.073   -1.630  18.254  1.00 10.00 ? 116 ARG A HH12 4  
ATOM   8347  H  HH21 . ARG A 1 116 ? 3.566   -3.609  19.847  1.00 10.00 ? 116 ARG A HH21 4  
ATOM   8348  H  HH22 . ARG A 1 116 ? 4.599   -2.232  20.032  1.00 10.00 ? 116 ARG A HH22 4  
ATOM   8349  N  N    . PRO A 1 117 ? 5.714   -9.213  13.621  1.00 10.00 ? 117 PRO A N    4  
ATOM   8350  C  CA   . PRO A 1 117 ? 5.601   -10.310 12.674  1.00 10.00 ? 117 PRO A CA   4  
ATOM   8351  C  C    . PRO A 1 117 ? 4.349   -10.102 11.809  1.00 10.00 ? 117 PRO A C    4  
ATOM   8352  O  O    . PRO A 1 117 ? 3.339   -10.772 12.013  1.00 10.00 ? 117 PRO A O    4  
ATOM   8353  C  CB   . PRO A 1 117 ? 5.524   -11.566 13.550  1.00 10.00 ? 117 PRO A CB   4  
ATOM   8354  C  CG   . PRO A 1 117 ? 4.813   -11.067 14.810  1.00 10.00 ? 117 PRO A CG   4  
ATOM   8355  C  CD   . PRO A 1 117 ? 5.330   -9.635  14.959  1.00 10.00 ? 117 PRO A CD   4  
ATOM   8356  H  HA   . PRO A 1 117 ? 6.478   -10.378 12.028  1.00 10.00 ? 117 PRO A HA   4  
ATOM   8357  H  HB2  . PRO A 1 117 ? 4.999   -12.393 13.070  1.00 10.00 ? 117 PRO A HB2  4  
ATOM   8358  H  HB3  . PRO A 1 117 ? 6.536   -11.877 13.814  1.00 10.00 ? 117 PRO A HB3  4  
ATOM   8359  H  HG2  . PRO A 1 117 ? 3.736   -11.049 14.633  1.00 10.00 ? 117 PRO A HG2  4  
ATOM   8360  H  HG3  . PRO A 1 117 ? 5.037   -11.683 15.682  1.00 10.00 ? 117 PRO A HG3  4  
ATOM   8361  H  HD2  . PRO A 1 117 ? 4.553   -9.002  15.388  1.00 10.00 ? 117 PRO A HD2  4  
ATOM   8362  H  HD3  . PRO A 1 117 ? 6.213   -9.632  15.601  1.00 10.00 ? 117 PRO A HD3  4  
ATOM   8363  N  N    . LEU A 1 118 ? 4.403   -9.149  10.869  1.00 10.00 ? 118 LEU A N    4  
ATOM   8364  C  CA   . LEU A 1 118 ? 3.276   -8.768  10.029  1.00 10.00 ? 118 LEU A CA   4  
ATOM   8365  C  C    . LEU A 1 118 ? 2.575   -9.974  9.393   1.00 10.00 ? 118 LEU A C    4  
ATOM   8366  O  O    . LEU A 1 118 ? 3.219   -10.855 8.821   1.00 10.00 ? 118 LEU A O    4  
ATOM   8367  C  CB   . LEU A 1 118 ? 3.762   -7.798  8.947   1.00 10.00 ? 118 LEU A CB   4  
ATOM   8368  C  CG   . LEU A 1 118 ? 3.841   -6.325  9.376   1.00 10.00 ? 118 LEU A CG   4  
ATOM   8369  C  CD1  . LEU A 1 118 ? 2.474   -5.712  9.705   1.00 10.00 ? 118 LEU A CD1  4  
ATOM   8370  C  CD2  . LEU A 1 118 ? 4.792   -6.064  10.538  1.00 10.00 ? 118 LEU A CD2  4  
ATOM   8371  H  H    . LEU A 1 118 ? 5.234   -8.568  10.795  1.00 10.00 ? 118 LEU A H    4  
ATOM   8372  H  HA   . LEU A 1 118 ? 2.549   -8.272  10.667  1.00 10.00 ? 118 LEU A HA   4  
ATOM   8373  H  HB2  . LEU A 1 118 ? 4.742   -8.122  8.594   1.00 10.00 ? 118 LEU A HB2  4  
ATOM   8374  H  HB3  . LEU A 1 118 ? 3.087   -7.853  8.097   1.00 10.00 ? 118 LEU A HB3  4  
ATOM   8375  H  HG   . LEU A 1 118 ? 4.265   -5.823  8.515   1.00 10.00 ? 118 LEU A HG   4  
ATOM   8376  H  HD11 . LEU A 1 118 ? 2.571   -4.641  9.873   1.00 10.00 ? 118 LEU A HD11 4  
ATOM   8377  H  HD12 . LEU A 1 118 ? 1.794   -5.868  8.875   1.00 10.00 ? 118 LEU A HD12 4  
ATOM   8378  H  HD13 . LEU A 1 118 ? 2.046   -6.152  10.605  1.00 10.00 ? 118 LEU A HD13 4  
ATOM   8379  H  HD21 . LEU A 1 118 ? 4.853   -4.999  10.758  1.00 10.00 ? 118 LEU A HD21 4  
ATOM   8380  H  HD22 . LEU A 1 118 ? 4.425   -6.574  11.425  1.00 10.00 ? 118 LEU A HD22 4  
ATOM   8381  H  HD23 . LEU A 1 118 ? 5.782   -6.414  10.258  1.00 10.00 ? 118 LEU A HD23 4  
ATOM   8382  N  N    . LYS A 1 119 ? 1.245   -9.995  9.486   1.00 10.00 ? 119 LYS A N    4  
ATOM   8383  C  CA   . LYS A 1 119 ? 0.396   -11.106 9.107   1.00 10.00 ? 119 LYS A CA   4  
ATOM   8384  C  C    . LYS A 1 119 ? -0.132  -10.884 7.692   1.00 10.00 ? 119 LYS A C    4  
ATOM   8385  O  O    . LYS A 1 119 ? -0.728  -9.850  7.403   1.00 10.00 ? 119 LYS A O    4  
ATOM   8386  C  CB   . LYS A 1 119 ? -0.760  -11.182 10.116  1.00 10.00 ? 119 LYS A CB   4  
ATOM   8387  C  CG   . LYS A 1 119 ? -1.737  -12.331 9.840   1.00 10.00 ? 119 LYS A CG   4  
ATOM   8388  C  CD   . LYS A 1 119 ? -2.877  -12.285 10.867  1.00 10.00 ? 119 LYS A CD   4  
ATOM   8389  C  CE   . LYS A 1 119 ? -4.012  -13.261 10.525  1.00 10.00 ? 119 LYS A CE   4  
ATOM   8390  N  NZ   . LYS A 1 119 ? -3.563  -14.668 10.502  1.00 10.00 ? 119 LYS A NZ   4  
ATOM   8391  H  H    . LYS A 1 119 ? 0.778   -9.192  9.914   1.00 10.00 ? 119 LYS A H    4  
ATOM   8392  H  HA   . LYS A 1 119 ? 0.964   -12.036 9.159   1.00 10.00 ? 119 LYS A HA   4  
ATOM   8393  H  HB2  . LYS A 1 119 ? -0.342  -11.302 11.117  1.00 10.00 ? 119 LYS A HB2  4  
ATOM   8394  H  HB3  . LYS A 1 119 ? -1.308  -10.241 10.083  1.00 10.00 ? 119 LYS A HB3  4  
ATOM   8395  H  HG2  . LYS A 1 119 ? -2.163  -12.209 8.843   1.00 10.00 ? 119 LYS A HG2  4  
ATOM   8396  H  HG3  . LYS A 1 119 ? -1.190  -13.273 9.894   1.00 10.00 ? 119 LYS A HG3  4  
ATOM   8397  H  HD2  . LYS A 1 119 ? -2.482  -12.481 11.866  1.00 10.00 ? 119 LYS A HD2  4  
ATOM   8398  H  HD3  . LYS A 1 119 ? -3.297  -11.276 10.870  1.00 10.00 ? 119 LYS A HD3  4  
ATOM   8399  H  HE2  . LYS A 1 119 ? -4.801  -13.150 11.272  1.00 10.00 ? 119 LYS A HE2  4  
ATOM   8400  H  HE3  . LYS A 1 119 ? -4.429  -12.999 9.550   1.00 10.00 ? 119 LYS A HE3  4  
ATOM   8401  H  HZ1  . LYS A 1 119 ? -2.876  -14.798 9.773   1.00 10.00 ? 119 LYS A HZ1  4  
ATOM   8402  H  HZ2  . LYS A 1 119 ? -3.159  -14.920 11.394  1.00 10.00 ? 119 LYS A HZ2  4  
ATOM   8403  H  HZ3  . LYS A 1 119 ? -4.351  -15.273 10.316  1.00 10.00 ? 119 LYS A HZ3  4  
ATOM   8404  N  N    . VAL A 1 120 ? 0.006   -11.890 6.826   1.00 10.00 ? 120 VAL A N    4  
ATOM   8405  C  CA   . VAL A 1 120 ? -0.732  -11.930 5.572   1.00 10.00 ? 120 VAL A CA   4  
ATOM   8406  C  C    . VAL A 1 120 ? -2.228  -11.838 5.905   1.00 10.00 ? 120 VAL A C    4  
ATOM   8407  O  O    . VAL A 1 120 ? -2.786  -12.807 6.422   1.00 10.00 ? 120 VAL A O    4  
ATOM   8408  C  CB   . VAL A 1 120 ? -0.393  -13.228 4.810   1.00 10.00 ? 120 VAL A CB   4  
ATOM   8409  C  CG1  . VAL A 1 120 ? -1.198  -13.347 3.509   1.00 10.00 ? 120 VAL A CG1  4  
ATOM   8410  C  CG2  . VAL A 1 120 ? 1.097   -13.291 4.452   1.00 10.00 ? 120 VAL A CG2  4  
ATOM   8411  H  H    . VAL A 1 120 ? 0.508   -12.715 7.112   1.00 10.00 ? 120 VAL A H    4  
ATOM   8412  H  HA   . VAL A 1 120 ? -0.428  -11.079 4.964   1.00 10.00 ? 120 VAL A HA   4  
ATOM   8413  H  HB   . VAL A 1 120 ? -0.632  -14.086 5.441   1.00 10.00 ? 120 VAL A HB   4  
ATOM   8414  H  HG11 . VAL A 1 120 ? -0.925  -14.267 2.992   1.00 10.00 ? 120 VAL A HG11 4  
ATOM   8415  H  HG12 . VAL A 1 120 ? -2.268  -13.378 3.716   1.00 10.00 ? 120 VAL A HG12 4  
ATOM   8416  H  HG13 . VAL A 1 120 ? -0.982  -12.501 2.859   1.00 10.00 ? 120 VAL A HG13 4  
ATOM   8417  H  HG21 . VAL A 1 120 ? 1.310   -14.228 3.938   1.00 10.00 ? 120 VAL A HG21 4  
ATOM   8418  H  HG22 . VAL A 1 120 ? 1.353   -12.462 3.793   1.00 10.00 ? 120 VAL A HG22 4  
ATOM   8419  H  HG23 . VAL A 1 120 ? 1.714   -13.246 5.350   1.00 10.00 ? 120 VAL A HG23 4  
ATOM   8420  N  N    . GLY A 1 121 ? -2.866  -10.687 5.663   1.00 10.00 ? 121 GLY A N    4  
ATOM   8421  C  CA   . GLY A 1 121 ? -4.270  -10.466 5.972   1.00 10.00 ? 121 GLY A CA   4  
ATOM   8422  C  C    . GLY A 1 121 ? -4.470  -9.348  6.993   1.00 10.00 ? 121 GLY A C    4  
ATOM   8423  O  O    . GLY A 1 121 ? -5.613  -8.982  7.257   1.00 10.00 ? 121 GLY A O    4  
ATOM   8424  H  H    . GLY A 1 121 ? -2.342  -9.873  5.341   1.00 10.00 ? 121 GLY A H    4  
ATOM   8425  H  HA2  . GLY A 1 121 ? -4.775  -10.177 5.051   1.00 10.00 ? 121 GLY A HA2  4  
ATOM   8426  H  HA3  . GLY A 1 121 ? -4.752  -11.366 6.353   1.00 10.00 ? 121 GLY A HA3  4  
ATOM   8427  N  N    . GLU A 1 122 ? -3.397  -8.780  7.559   1.00 10.00 ? 122 GLU A N    4  
ATOM   8428  C  CA   . GLU A 1 122 ? -3.508  -7.550  8.306   1.00 10.00 ? 122 GLU A CA   4  
ATOM   8429  C  C    . GLU A 1 122 ? -3.804  -6.410  7.333   1.00 10.00 ? 122 GLU A C    4  
ATOM   8430  O  O    . GLU A 1 122 ? -3.906  -6.560  6.113   1.00 10.00 ? 122 GLU A O    4  
ATOM   8431  C  CB   . GLU A 1 122 ? -2.195  -7.282  9.060   1.00 10.00 ? 122 GLU A CB   4  
ATOM   8432  C  CG   . GLU A 1 122 ? -2.284  -7.402  10.581  1.00 10.00 ? 122 GLU A CG   4  
ATOM   8433  C  CD   . GLU A 1 122 ? -0.900  -7.203  11.190  1.00 10.00 ? 122 GLU A CD   4  
ATOM   8434  O  OE1  . GLU A 1 122 ? -0.002  -7.987  10.810  1.00 10.00 ? 122 GLU A OE1  4  
ATOM   8435  O  OE2  . GLU A 1 122 ? -0.753  -6.255  11.988  1.00 10.00 ? 122 GLU A OE2  4  
ATOM   8436  H  H    . GLU A 1 122 ? -2.448  -9.051  7.335   1.00 10.00 ? 122 GLU A H    4  
ATOM   8437  H  HA   . GLU A 1 122 ? -4.327  -7.623  9.024   1.00 10.00 ? 122 GLU A HA   4  
ATOM   8438  H  HB2  . GLU A 1 122 ? -1.432  -7.965  8.726   1.00 10.00 ? 122 GLU A HB2  4  
ATOM   8439  H  HB3  . GLU A 1 122 ? -1.804  -6.302  8.820   1.00 10.00 ? 122 GLU A HB3  4  
ATOM   8440  H  HG2  . GLU A 1 122 ? -2.963  -6.646  10.976  1.00 10.00 ? 122 GLU A HG2  4  
ATOM   8441  H  HG3  . GLU A 1 122 ? -2.651  -8.390  10.858  1.00 10.00 ? 122 GLU A HG3  4  
ATOM   8442  N  N    . THR A 1 123 ? -3.893  -5.230  7.917   1.00 10.00 ? 123 THR A N    4  
ATOM   8443  C  CA   . THR A 1 123 ? -4.026  -3.949  7.247   1.00 10.00 ? 123 THR A CA   4  
ATOM   8444  C  C    . THR A 1 123 ? -3.483  -2.915  8.227   1.00 10.00 ? 123 THR A C    4  
ATOM   8445  O  O    . THR A 1 123 ? -3.902  -2.912  9.383   1.00 10.00 ? 123 THR A O    4  
ATOM   8446  C  CB   . THR A 1 123 ? -5.490  -3.701  6.847   1.00 10.00 ? 123 THR A CB   4  
ATOM   8447  O  OG1  . THR A 1 123 ? -5.871  -4.607  5.829   1.00 10.00 ? 123 THR A OG1  4  
ATOM   8448  C  CG2  . THR A 1 123 ? -5.711  -2.287  6.303   1.00 10.00 ? 123 THR A CG2  4  
ATOM   8449  H  H    . THR A 1 123 ? -3.652  -5.250  8.899   1.00 10.00 ? 123 THR A H    4  
ATOM   8450  H  HA   . THR A 1 123 ? -3.412  -3.966  6.351   1.00 10.00 ? 123 THR A HA   4  
ATOM   8451  H  HB   . THR A 1 123 ? -6.129  -3.846  7.720   1.00 10.00 ? 123 THR A HB   4  
ATOM   8452  H  HG1  . THR A 1 123 ? -5.378  -5.429  5.931   1.00 10.00 ? 123 THR A HG1  4  
ATOM   8453  H  HG21 . THR A 1 123 ? -5.509  -1.546  7.076   1.00 10.00 ? 123 THR A HG21 4  
ATOM   8454  H  HG22 . THR A 1 123 ? -5.059  -2.109  5.447   1.00 10.00 ? 123 THR A HG22 4  
ATOM   8455  H  HG23 . THR A 1 123 ? -6.748  -2.183  5.982   1.00 10.00 ? 123 THR A HG23 4  
ATOM   8456  N  N    . VAL A 1 124 ? -2.503  -2.110  7.809   1.00 10.00 ? 124 VAL A N    4  
ATOM   8457  C  CA   . VAL A 1 124 ? -1.732  -1.258  8.707   1.00 10.00 ? 124 VAL A CA   4  
ATOM   8458  C  C    . VAL A 1 124 ? -1.538  0.110   8.055   1.00 10.00 ? 124 VAL A C    4  
ATOM   8459  O  O    . VAL A 1 124 ? -1.407  0.215   6.835   1.00 10.00 ? 124 VAL A O    4  
ATOM   8460  C  CB   . VAL A 1 124 ? -0.396  -1.945  9.058   1.00 10.00 ? 124 VAL A CB   4  
ATOM   8461  C  CG1  . VAL A 1 124 ? 0.553   -1.016  9.826   1.00 10.00 ? 124 VAL A CG1  4  
ATOM   8462  C  CG2  . VAL A 1 124 ? -0.640  -3.189  9.926   1.00 10.00 ? 124 VAL A CG2  4  
ATOM   8463  H  H    . VAL A 1 124 ? -2.253  -2.104  6.822   1.00 10.00 ? 124 VAL A H    4  
ATOM   8464  H  HA   . VAL A 1 124 ? -2.286  -1.098  9.633   1.00 10.00 ? 124 VAL A HA   4  
ATOM   8465  H  HB   . VAL A 1 124 ? 0.100   -2.252  8.135   1.00 10.00 ? 124 VAL A HB   4  
ATOM   8466  H  HG11 . VAL A 1 124 ? 1.427   -1.575  10.160  1.00 10.00 ? 124 VAL A HG11 4  
ATOM   8467  H  HG12 . VAL A 1 124 ? 0.897   -0.205  9.184   1.00 10.00 ? 124 VAL A HG12 4  
ATOM   8468  H  HG13 . VAL A 1 124 ? 0.045   -0.602  10.698  1.00 10.00 ? 124 VAL A HG13 4  
ATOM   8469  H  HG21 . VAL A 1 124 ? -1.252  -3.918  9.399   1.00 10.00 ? 124 VAL A HG21 4  
ATOM   8470  H  HG22 . VAL A 1 124 ? 0.308   -3.663  10.176  1.00 10.00 ? 124 VAL A HG22 4  
ATOM   8471  H  HG23 . VAL A 1 124 ? -1.146  -2.908  10.850  1.00 10.00 ? 124 VAL A HG23 4  
ATOM   8472  N  N    . ASN A 1 125 ? -1.536  1.163   8.875   1.00 10.00 ? 125 ASN A N    4  
ATOM   8473  C  CA   . ASN A 1 125 ? -1.358  2.526   8.400   1.00 10.00 ? 125 ASN A CA   4  
ATOM   8474  C  C    . ASN A 1 125 ? 0.103   2.769   8.035   1.00 10.00 ? 125 ASN A C    4  
ATOM   8475  O  O    . ASN A 1 125 ? 1.007   2.510   8.835   1.00 10.00 ? 125 ASN A O    4  
ATOM   8476  C  CB   . ASN A 1 125 ? -1.828  3.551   9.443   1.00 10.00 ? 125 ASN A CB   4  
ATOM   8477  C  CG   . ASN A 1 125 ? -3.349  3.667   9.536   1.00 10.00 ? 125 ASN A CG   4  
ATOM   8478  O  OD1  . ASN A 1 125 ? -4.088  3.013   8.810   1.00 10.00 ? 125 ASN A OD1  4  
ATOM   8479  N  ND2  . ASN A 1 125 ? -3.842  4.517   10.433  1.00 10.00 ? 125 ASN A ND2  4  
ATOM   8480  H  H    . ASN A 1 125 ? -1.632  1.008   9.867   1.00 10.00 ? 125 ASN A H    4  
ATOM   8481  H  HA   . ASN A 1 125 ? -1.962  2.665   7.507   1.00 10.00 ? 125 ASN A HA   4  
ATOM   8482  H  HB2  . ASN A 1 125 ? -1.415  3.296   10.420  1.00 10.00 ? 125 ASN A HB2  4  
ATOM   8483  H  HB3  . ASN A 1 125 ? -1.446  4.532   9.155   1.00 10.00 ? 125 ASN A HB3  4  
ATOM   8484  H  HD21 . ASN A 1 125 ? -3.227  5.028   11.050  1.00 10.00 ? 125 ASN A HD21 4  
ATOM   8485  H  HD22 . ASN A 1 125 ? -4.843  4.537   10.568  1.00 10.00 ? 125 ASN A HD22 4  
ATOM   8486  N  N    . ILE A 1 126 ? 0.315   3.315   6.838   1.00 10.00 ? 126 ILE A N    4  
ATOM   8487  C  CA   . ILE A 1 126 ? 1.533   3.991   6.443   1.00 10.00 ? 126 ILE A CA   4  
ATOM   8488  C  C    . ILE A 1 126 ? 1.234   5.487   6.393   1.00 10.00 ? 126 ILE A C    4  
ATOM   8489  O  O    . ILE A 1 126 ? 0.309   5.909   5.703   1.00 10.00 ? 126 ILE A O    4  
ATOM   8490  C  CB   . ILE A 1 126 ? 2.088   3.415   5.132   1.00 10.00 ? 126 ILE A CB   4  
ATOM   8491  C  CG1  . ILE A 1 126 ? 1.054   3.348   3.997   1.00 10.00 ? 126 ILE A CG1  4  
ATOM   8492  C  CG2  . ILE A 1 126 ? 2.654   2.014   5.418   1.00 10.00 ? 126 ILE A CG2  4  
ATOM   8493  C  CD1  . ILE A 1 126 ? 1.726   2.998   2.672   1.00 10.00 ? 126 ILE A CD1  4  
ATOM   8494  H  H    . ILE A 1 126 ? -0.481  3.444   6.221   1.00 10.00 ? 126 ILE A H    4  
ATOM   8495  H  HA   . ILE A 1 126 ? 2.303   3.847   7.187   1.00 10.00 ? 126 ILE A HA   4  
ATOM   8496  H  HB   . ILE A 1 126 ? 2.899   4.070   4.814   1.00 10.00 ? 126 ILE A HB   4  
ATOM   8497  H  HG12 . ILE A 1 126 ? 0.293   2.602   4.220   1.00 10.00 ? 126 ILE A HG12 4  
ATOM   8498  H  HG13 . ILE A 1 126 ? 0.574   4.315   3.866   1.00 10.00 ? 126 ILE A HG13 4  
ATOM   8499  H  HG21 . ILE A 1 126 ? 3.206   1.639   4.559   1.00 10.00 ? 126 ILE A HG21 4  
ATOM   8500  H  HG22 . ILE A 1 126 ? 3.341   2.048   6.262   1.00 10.00 ? 126 ILE A HG22 4  
ATOM   8501  H  HG23 . ILE A 1 126 ? 1.841   1.325   5.650   1.00 10.00 ? 126 ILE A HG23 4  
ATOM   8502  H  HD11 . ILE A 1 126 ? 2.555   3.685   2.500   1.00 10.00 ? 126 ILE A HD11 4  
ATOM   8503  H  HD12 . ILE A 1 126 ? 2.096   1.974   2.697   1.00 10.00 ? 126 ILE A HD12 4  
ATOM   8504  H  HD13 . ILE A 1 126 ? 1.001   3.096   1.865   1.00 10.00 ? 126 ILE A HD13 4  
ATOM   8505  N  N    . THR A 1 127 ? 1.975   6.283   7.167   1.00 10.00 ? 127 THR A N    4  
ATOM   8506  C  CA   . THR A 1 127 ? 1.833   7.727   7.196   1.00 10.00 ? 127 THR A CA   4  
ATOM   8507  C  C    . THR A 1 127 ? 2.942   8.348   6.364   1.00 10.00 ? 127 THR A C    4  
ATOM   8508  O  O    . THR A 1 127 ? 4.114   8.143   6.670   1.00 10.00 ? 127 THR A O    4  
ATOM   8509  C  CB   . THR A 1 127 ? 1.824   8.245   8.639   1.00 10.00 ? 127 THR A CB   4  
ATOM   8510  O  OG1  . THR A 1 127 ? 0.844   7.538   9.376   1.00 10.00 ? 127 THR A OG1  4  
ATOM   8511  C  CG2  . THR A 1 127 ? 1.482   9.742   8.673   1.00 10.00 ? 127 THR A CG2  4  
ATOM   8512  H  H    . THR A 1 127 ? 2.685   5.882   7.767   1.00 10.00 ? 127 THR A H    4  
ATOM   8513  H  HA   . THR A 1 127 ? 0.891   7.997   6.752   1.00 10.00 ? 127 THR A HA   4  
ATOM   8514  H  HB   . THR A 1 127 ? 2.804   8.081   9.090   1.00 10.00 ? 127 THR A HB   4  
ATOM   8515  H  HG1  . THR A 1 127 ? 0.909   7.791   10.300  1.00 10.00 ? 127 THR A HG1  4  
ATOM   8516  H  HG21 . THR A 1 127 ? 2.221   10.319  8.114   1.00 10.00 ? 127 THR A HG21 4  
ATOM   8517  H  HG22 . THR A 1 127 ? 0.500   9.913   8.228   1.00 10.00 ? 127 THR A HG22 4  
ATOM   8518  H  HG23 . THR A 1 127 ? 1.469   10.096  9.703   1.00 10.00 ? 127 THR A HG23 4  
ATOM   8519  N  N    . LEU A 1 128 ? 2.576   9.095   5.322   1.00 10.00 ? 128 LEU A N    4  
ATOM   8520  C  CA   . LEU A 1 128 ? 3.513   9.842   4.497   1.00 10.00 ? 128 LEU A CA   4  
ATOM   8521  C  C    . LEU A 1 128 ? 3.459   11.324  4.856   1.00 10.00 ? 128 LEU A C    4  
ATOM   8522  O  O    . LEU A 1 128 ? 2.581   11.753  5.606   1.00 10.00 ? 128 LEU A O    4  
ATOM   8523  C  CB   . LEU A 1 128 ? 3.295   9.578   2.996   1.00 10.00 ? 128 LEU A CB   4  
ATOM   8524  C  CG   . LEU A 1 128 ? 1.851   9.361   2.527   1.00 10.00 ? 128 LEU A CG   4  
ATOM   8525  C  CD1  . LEU A 1 128 ? 1.082   10.672  2.626   1.00 10.00 ? 128 LEU A CD1  4  
ATOM   8526  C  CD2  . LEU A 1 128 ? 1.856   8.895   1.067   1.00 10.00 ? 128 LEU A CD2  4  
ATOM   8527  H  H    . LEU A 1 128 ? 1.584   9.295   5.210   1.00 10.00 ? 128 LEU A H    4  
ATOM   8528  H  HA   . LEU A 1 128 ? 4.530   9.524   4.721   1.00 10.00 ? 128 LEU A HA   4  
ATOM   8529  H  HB2  . LEU A 1 128 ? 3.697   10.427  2.436   1.00 10.00 ? 128 LEU A HB2  4  
ATOM   8530  H  HB3  . LEU A 1 128 ? 3.854   8.678   2.739   1.00 10.00 ? 128 LEU A HB3  4  
ATOM   8531  H  HG   . LEU A 1 128 ? 1.357   8.591   3.122   1.00 10.00 ? 128 LEU A HG   4  
ATOM   8532  H  HD11 . LEU A 1 128 ? 1.607   11.442  2.062   1.00 10.00 ? 128 LEU A HD11 4  
ATOM   8533  H  HD12 . LEU A 1 128 ? 0.083   10.533  2.217   1.00 10.00 ? 128 LEU A HD12 4  
ATOM   8534  H  HD13 . LEU A 1 128 ? 1.012   10.974  3.667   1.00 10.00 ? 128 LEU A HD13 4  
ATOM   8535  H  HD21 . LEU A 1 128 ? 0.832   8.748   0.723   1.00 10.00 ? 128 LEU A HD21 4  
ATOM   8536  H  HD22 . LEU A 1 128 ? 2.343   9.639   0.435   1.00 10.00 ? 128 LEU A HD22 4  
ATOM   8537  H  HD23 . LEU A 1 128 ? 2.391   7.949   0.982   1.00 10.00 ? 128 LEU A HD23 4  
ATOM   8538  N  N    . LYS A 1 129 ? 4.427   12.083  4.333   1.00 10.00 ? 129 LYS A N    4  
ATOM   8539  C  CA   . LYS A 1 129 ? 4.564   13.519  4.483   1.00 10.00 ? 129 LYS A CA   4  
ATOM   8540  C  C    . LYS A 1 129 ? 5.100   14.077  3.171   1.00 10.00 ? 129 LYS A C    4  
ATOM   8541  O  O    . LYS A 1 129 ? 6.303   14.066  2.926   1.00 10.00 ? 129 LYS A O    4  
ATOM   8542  C  CB   . LYS A 1 129 ? 5.509   13.866  5.641   1.00 10.00 ? 129 LYS A CB   4  
ATOM   8543  C  CG   . LYS A 1 129 ? 4.846   13.665  7.007   1.00 10.00 ? 129 LYS A CG   4  
ATOM   8544  C  CD   . LYS A 1 129 ? 5.724   14.273  8.108   1.00 10.00 ? 129 LYS A CD   4  
ATOM   8545  C  CE   . LYS A 1 129 ? 4.994   14.242  9.458   1.00 10.00 ? 129 LYS A CE   4  
ATOM   8546  N  NZ   . LYS A 1 129 ? 5.782   14.884  10.531  1.00 10.00 ? 129 LYS A NZ   4  
ATOM   8547  H  H    . LYS A 1 129 ? 5.077   11.652  3.693   1.00 10.00 ? 129 LYS A H    4  
ATOM   8548  H  HA   . LYS A 1 129 ? 3.600   13.984  4.671   1.00 10.00 ? 129 LYS A HA   4  
ATOM   8549  H  HB2  . LYS A 1 129 ? 6.422   13.273  5.575   1.00 10.00 ? 129 LYS A HB2  4  
ATOM   8550  H  HB3  . LYS A 1 129 ? 5.769   14.922  5.542   1.00 10.00 ? 129 LYS A HB3  4  
ATOM   8551  H  HG2  . LYS A 1 129 ? 3.883   14.174  6.994   1.00 10.00 ? 129 LYS A HG2  4  
ATOM   8552  H  HG3  . LYS A 1 129 ? 4.682   12.601  7.188   1.00 10.00 ? 129 LYS A HG3  4  
ATOM   8553  H  HD2  . LYS A 1 129 ? 6.660   13.712  8.160   1.00 10.00 ? 129 LYS A HD2  4  
ATOM   8554  H  HD3  . LYS A 1 129 ? 5.946   15.309  7.840   1.00 10.00 ? 129 LYS A HD3  4  
ATOM   8555  H  HE2  . LYS A 1 129 ? 4.044   14.772  9.361   1.00 10.00 ? 129 LYS A HE2  4  
ATOM   8556  H  HE3  . LYS A 1 129 ? 4.785   13.205  9.732   1.00 10.00 ? 129 LYS A HE3  4  
ATOM   8557  H  HZ1  . LYS A 1 129 ? 6.663   14.404  10.655  1.00 10.00 ? 129 LYS A HZ1  4  
ATOM   8558  H  HZ2  . LYS A 1 129 ? 5.962   15.852  10.299  1.00 10.00 ? 129 LYS A HZ2  4  
ATOM   8559  H  HZ3  . LYS A 1 129 ? 5.267   14.851  11.400  1.00 10.00 ? 129 LYS A HZ3  4  
ATOM   8560  N  N    . ALA A 1 130 ? 4.210   14.570  2.314   1.00 10.00 ? 130 ALA A N    4  
ATOM   8561  C  CA   . ALA A 1 130 ? 4.618   15.419  1.208   1.00 10.00 ? 130 ALA A CA   4  
ATOM   8562  C  C    . ALA A 1 130 ? 4.754   16.851  1.695   1.00 10.00 ? 130 ALA A C    4  
ATOM   8563  O  O    . ALA A 1 130 ? 3.841   17.381  2.325   1.00 10.00 ? 130 ALA A O    4  
ATOM   8564  C  CB   . ALA A 1 130 ? 3.624   15.330  0.048   1.00 10.00 ? 130 ALA A CB   4  
ATOM   8565  H  H    . ALA A 1 130 ? 3.227   14.448  2.527   1.00 10.00 ? 130 ALA A H    4  
ATOM   8566  H  HA   . ALA A 1 130 ? 5.602   15.122  0.862   1.00 10.00 ? 130 ALA A HA   4  
ATOM   8567  H  HB1  . ALA A 1 130 ? 3.410   14.289  -0.193  1.00 10.00 ? 130 ALA A HB1  4  
ATOM   8568  H  HB2  . ALA A 1 130 ? 2.702   15.837  0.320   1.00 10.00 ? 130 ALA A HB2  4  
ATOM   8569  H  HB3  . ALA A 1 130 ? 4.042   15.824  -0.830  1.00 10.00 ? 130 ALA A HB3  4  
ATOM   8570  N  N    . THR A 1 131 ? 5.872   17.488  1.344   1.00 10.00 ? 131 THR A N    4  
ATOM   8571  C  CA   . THR A 1 131 ? 6.092   18.909  1.585   1.00 10.00 ? 131 THR A CA   4  
ATOM   8572  C  C    . THR A 1 131 ? 5.049   19.767  0.860   1.00 10.00 ? 131 THR A C    4  
ATOM   8573  O  O    . THR A 1 131 ? 4.909   20.944  1.181   1.00 10.00 ? 131 THR A O    4  
ATOM   8574  C  CB   . THR A 1 131 ? 7.535   19.294  1.213   1.00 10.00 ? 131 THR A CB   4  
ATOM   8575  O  OG1  . THR A 1 131 ? 7.753   20.675  1.426   1.00 10.00 ? 131 THR A OG1  4  
ATOM   8576  C  CG2  . THR A 1 131 ? 7.896   18.933  -0.232  1.00 10.00 ? 131 THR A CG2  4  
ATOM   8577  H  H    . THR A 1 131 ? 6.562   16.980  0.809   1.00 10.00 ? 131 THR A H    4  
ATOM   8578  H  HA   . THR A 1 131 ? 5.967   19.096  2.652   1.00 10.00 ? 131 THR A HA   4  
ATOM   8579  H  HB   . THR A 1 131 ? 8.218   18.753  1.870   1.00 10.00 ? 131 THR A HB   4  
ATOM   8580  H  HG1  . THR A 1 131 ? 6.935   21.162  1.257   1.00 10.00 ? 131 THR A HG1  4  
ATOM   8581  H  HG21 . THR A 1 131 ? 8.905   19.283  -0.448  1.00 10.00 ? 131 THR A HG21 4  
ATOM   8582  H  HG22 . THR A 1 131 ? 7.877   17.851  -0.373  1.00 10.00 ? 131 THR A HG22 4  
ATOM   8583  H  HG23 . THR A 1 131 ? 7.203   19.401  -0.931  1.00 10.00 ? 131 THR A HG23 4  
ATOM   8584  N  N    . ASP A 1 132 ? 4.324   19.187  -0.102  1.00 10.00 ? 132 ASP A N    4  
ATOM   8585  C  CA   . ASP A 1 132 ? 3.179   19.813  -0.744  1.00 10.00 ? 132 ASP A CA   4  
ATOM   8586  C  C    . ASP A 1 132 ? 2.005   19.992  0.222   1.00 10.00 ? 132 ASP A C    4  
ATOM   8587  O  O    . ASP A 1 132 ? 1.121   20.804  -0.038  1.00 10.00 ? 132 ASP A O    4  
ATOM   8588  C  CB   . ASP A 1 132 ? 2.762   18.962  -1.949  1.00 10.00 ? 132 ASP A CB   4  
ATOM   8589  C  CG   . ASP A 1 132 ? 3.834   18.999  -3.019  1.00 10.00 ? 132 ASP A CG   4  
ATOM   8590  O  OD1  . ASP A 1 132 ? 4.134   20.104  -3.522  1.00 10.00 ? 132 ASP A OD1  4  
ATOM   8591  O  OD2  . ASP A 1 132 ? 4.417   17.935  -3.337  1.00 10.00 ? 132 ASP A OD2  4  
ATOM   8592  H  H    . ASP A 1 132 ? 4.564   18.253  -0.395  1.00 10.00 ? 132 ASP A H    4  
ATOM   8593  H  HA   . ASP A 1 132 ? 3.472   20.804  -1.095  1.00 10.00 ? 132 ASP A HA   4  
ATOM   8594  H  HB2  . ASP A 1 132 ? 2.573   17.932  -1.646  1.00 10.00 ? 132 ASP A HB2  4  
ATOM   8595  H  HB3  . ASP A 1 132 ? 1.849   19.376  -2.381  1.00 10.00 ? 132 ASP A HB3  4  
ATOM   8596  N  N    . GLY A 1 133 ? 1.970   19.221  1.315   1.00 10.00 ? 133 GLY A N    4  
ATOM   8597  C  CA   . GLY A 1 133 ? 0.942   19.308  2.343   1.00 10.00 ? 133 GLY A CA   4  
ATOM   8598  C  C    . GLY A 1 133 ? 0.363   17.940  2.706   1.00 10.00 ? 133 GLY A C    4  
ATOM   8599  O  O    . GLY A 1 133 ? -0.315  17.816  3.724   1.00 10.00 ? 133 GLY A O    4  
ATOM   8600  H  H    . GLY A 1 133 ? 2.747   18.598  1.500   1.00 10.00 ? 133 GLY A H    4  
ATOM   8601  H  HA2  . GLY A 1 133 ? 1.392   19.741  3.237   1.00 10.00 ? 133 GLY A HA2  4  
ATOM   8602  H  HA3  . GLY A 1 133 ? 0.117   19.948  2.032   1.00 10.00 ? 133 GLY A HA3  4  
ATOM   8603  N  N    . ARG A 1 134 ? 0.627   16.895  1.912   1.00 10.00 ? 134 ARG A N    4  
ATOM   8604  C  CA   . ARG A 1 134 ? 0.022   15.584  2.133   1.00 10.00 ? 134 ARG A CA   4  
ATOM   8605  C  C    . ARG A 1 134 ? 0.795   14.847  3.228   1.00 10.00 ? 134 ARG A C    4  
ATOM   8606  O  O    . ARG A 1 134 ? 1.525   13.892  2.972   1.00 10.00 ? 134 ARG A O    4  
ATOM   8607  C  CB   . ARG A 1 134 ? -0.084  14.767  0.832   1.00 10.00 ? 134 ARG A CB   4  
ATOM   8608  C  CG   . ARG A 1 134 ? -0.905  15.517  -0.227  1.00 10.00 ? 134 ARG A CG   4  
ATOM   8609  C  CD   . ARG A 1 134 ? -1.044  14.741  -1.550  1.00 10.00 ? 134 ARG A CD   4  
ATOM   8610  N  NE   . ARG A 1 134 ? -1.960  13.581  -1.485  1.00 10.00 ? 134 ARG A NE   4  
ATOM   8611  C  CZ   . ARG A 1 134 ? -3.303  13.651  -1.515  1.00 10.00 ? 134 ARG A CZ   4  
ATOM   8612  N  NH1  . ARG A 1 134 ? -3.903  14.839  -1.381  1.00 10.00 ? 134 ARG A NH1  4  
ATOM   8613  N  NH2  . ARG A 1 134 ? -4.055  12.556  -1.691  1.00 10.00 ? 134 ARG A NH2  4  
ATOM   8614  H  H    . ARG A 1 134 ? 1.237   17.032  1.122   1.00 10.00 ? 134 ARG A H    4  
ATOM   8615  H  HA   . ARG A 1 134 ? -1.002  15.721  2.489   1.00 10.00 ? 134 ARG A HA   4  
ATOM   8616  H  HB2  . ARG A 1 134 ? 0.906   14.539  0.442   1.00 10.00 ? 134 ARG A HB2  4  
ATOM   8617  H  HB3  . ARG A 1 134 ? -0.578  13.824  1.071   1.00 10.00 ? 134 ARG A HB3  4  
ATOM   8618  H  HG2  . ARG A 1 134 ? -1.880  15.763  0.192   1.00 10.00 ? 134 ARG A HG2  4  
ATOM   8619  H  HG3  . ARG A 1 134 ? -0.395  16.454  -0.456  1.00 10.00 ? 134 ARG A HG3  4  
ATOM   8620  H  HD2  . ARG A 1 134 ? -1.383  15.430  -2.326  1.00 10.00 ? 134 ARG A HD2  4  
ATOM   8621  H  HD3  . ARG A 1 134 ? -0.055  14.391  -1.851  1.00 10.00 ? 134 ARG A HD3  4  
ATOM   8622  H  HE   . ARG A 1 134 ? -1.525  12.668  -1.516  1.00 10.00 ? 134 ARG A HE   4  
ATOM   8623  H  HH11 . ARG A 1 134 ? -3.332  15.663  -1.263  1.00 10.00 ? 134 ARG A HH11 4  
ATOM   8624  H  HH12 . ARG A 1 134 ? -4.906  14.939  -1.387  1.00 10.00 ? 134 ARG A HH12 4  
ATOM   8625  H  HH21 . ARG A 1 134 ? -3.681  11.659  -2.019  1.00 10.00 ? 134 ARG A HH21 4  
ATOM   8626  H  HH22 . ARG A 1 134 ? -5.059  12.607  -1.631  1.00 10.00 ? 134 ARG A HH22 4  
ATOM   8627  N  N    . THR A 1 135 ? 0.595   15.313  4.458   1.00 10.00 ? 135 THR A N    4  
ATOM   8628  C  CA   . THR A 1 135 ? 0.784   14.565  5.685   1.00 10.00 ? 135 THR A CA   4  
ATOM   8629  C  C    . THR A 1 135 ? -0.501  13.776  5.894   1.00 10.00 ? 135 THR A C    4  
ATOM   8630  O  O    . THR A 1 135 ? -1.537  14.372  6.180   1.00 10.00 ? 135 THR A O    4  
ATOM   8631  C  CB   . THR A 1 135 ? 1.066   15.530  6.843   1.00 10.00 ? 135 THR A CB   4  
ATOM   8632  O  OG1  . THR A 1 135 ? 2.293   16.186  6.593   1.00 10.00 ? 135 THR A OG1  4  
ATOM   8633  C  CG2  . THR A 1 135 ? 1.161   14.801  8.188   1.00 10.00 ? 135 THR A CG2  4  
ATOM   8634  H  H    . THR A 1 135 ? 0.015   16.137  4.508   1.00 10.00 ? 135 THR A H    4  
ATOM   8635  H  HA   . THR A 1 135 ? 1.622   13.891  5.578   1.00 10.00 ? 135 THR A HA   4  
ATOM   8636  H  HB   . THR A 1 135 ? 0.269   16.274  6.908   1.00 10.00 ? 135 THR A HB   4  
ATOM   8637  H  HG1  . THR A 1 135 ? 2.220   16.647  5.751   1.00 10.00 ? 135 THR A HG1  4  
ATOM   8638  H  HG21 . THR A 1 135 ? 1.492   15.501  8.955   1.00 10.00 ? 135 THR A HG21 4  
ATOM   8639  H  HG22 . THR A 1 135 ? 0.182   14.414  8.474   1.00 10.00 ? 135 THR A HG22 4  
ATOM   8640  H  HG23 . THR A 1 135 ? 1.863   13.971  8.124   1.00 10.00 ? 135 THR A HG23 4  
ATOM   8641  N  N    . LEU A 1 136 ? -0.460  12.460  5.679   1.00 10.00 ? 136 LEU A N    4  
ATOM   8642  C  CA   . LEU A 1 136 ? -1.665  11.644  5.645   1.00 10.00 ? 136 LEU A CA   4  
ATOM   8643  C  C    . LEU A 1 136 ? -1.300  10.203  5.976   1.00 10.00 ? 136 LEU A C    4  
ATOM   8644  O  O    . LEU A 1 136 ? -0.186  9.774   5.675   1.00 10.00 ? 136 LEU A O    4  
ATOM   8645  C  CB   . LEU A 1 136 ? -2.301  11.762  4.253   1.00 10.00 ? 136 LEU A CB   4  
ATOM   8646  C  CG   . LEU A 1 136 ? -3.650  11.045  4.080   1.00 10.00 ? 136 LEU A CG   4  
ATOM   8647  C  CD1  . LEU A 1 136 ? -4.738  11.636  4.986   1.00 10.00 ? 136 LEU A CD1  4  
ATOM   8648  C  CD2  . LEU A 1 136 ? -4.092  11.166  2.618   1.00 10.00 ? 136 LEU A CD2  4  
ATOM   8649  H  H    . LEU A 1 136 ? 0.430   12.002  5.499   1.00 10.00 ? 136 LEU A H    4  
ATOM   8650  H  HA   . LEU A 1 136 ? -2.355  12.012  6.405   1.00 10.00 ? 136 LEU A HA   4  
ATOM   8651  H  HB2  . LEU A 1 136 ? -2.440  12.818  4.020   1.00 10.00 ? 136 LEU A HB2  4  
ATOM   8652  H  HB3  . LEU A 1 136 ? -1.592  11.345  3.542   1.00 10.00 ? 136 LEU A HB3  4  
ATOM   8653  H  HG   . LEU A 1 136 ? -3.542  9.984   4.302   1.00 10.00 ? 136 LEU A HG   4  
ATOM   8654  H  HD11 . LEU A 1 136 ? -4.824  12.710  4.815   1.00 10.00 ? 136 LEU A HD11 4  
ATOM   8655  H  HD12 . LEU A 1 136 ? -5.695  11.163  4.765   1.00 10.00 ? 136 LEU A HD12 4  
ATOM   8656  H  HD13 . LEU A 1 136 ? -4.508  11.458  6.036   1.00 10.00 ? 136 LEU A HD13 4  
ATOM   8657  H  HD21 . LEU A 1 136 ? -3.339  10.722  1.965   1.00 10.00 ? 136 LEU A HD21 4  
ATOM   8658  H  HD22 . LEU A 1 136 ? -5.035  10.640  2.472   1.00 10.00 ? 136 LEU A HD22 4  
ATOM   8659  H  HD23 . LEU A 1 136 ? -4.223  12.216  2.351   1.00 10.00 ? 136 LEU A HD23 4  
ATOM   8660  N  N    . ASN A 1 137 ? -2.239  9.484   6.592   1.00 10.00 ? 137 ASN A N    4  
ATOM   8661  C  CA   . ASN A 1 137 ? -2.160  8.093   6.989   1.00 10.00 ? 137 ASN A CA   4  
ATOM   8662  C  C    . ASN A 1 137 ? -3.030  7.311   6.024   1.00 10.00 ? 137 ASN A C    4  
ATOM   8663  O  O    . ASN A 1 137 ? -4.156  7.710   5.738   1.00 10.00 ? 137 ASN A O    4  
ATOM   8664  C  CB   . ASN A 1 137 ? -2.632  7.907   8.434   1.00 10.00 ? 137 ASN A CB   4  
ATOM   8665  C  CG   . ASN A 1 137 ? -4.114  8.230   8.612   1.00 10.00 ? 137 ASN A CG   4  
ATOM   8666  O  OD1  . ASN A 1 137 ? -4.531  9.363   8.391   1.00 10.00 ? 137 ASN A OD1  4  
ATOM   8667  N  ND2  . ASN A 1 137 ? -4.917  7.247   9.007   1.00 10.00 ? 137 ASN A ND2  4  
ATOM   8668  H  H    . ASN A 1 137 ? -3.176  9.852   6.638   1.00 10.00 ? 137 ASN A H    4  
ATOM   8669  H  HA   . ASN A 1 137 ? -1.142  7.734   6.932   1.00 10.00 ? 137 ASN A HA   4  
ATOM   8670  H  HB2  . ASN A 1 137 ? -2.444  6.875   8.727   1.00 10.00 ? 137 ASN A HB2  4  
ATOM   8671  H  HB3  . ASN A 1 137 ? -2.046  8.557   9.078   1.00 10.00 ? 137 ASN A HB3  4  
ATOM   8672  H  HD21 . ASN A 1 137 ? -4.556  6.318   9.172   1.00 10.00 ? 137 ASN A HD21 4  
ATOM   8673  H  HD22 . ASN A 1 137 ? -5.901  7.447   9.101   1.00 10.00 ? 137 ASN A HD22 4  
ATOM   8674  N  N    . VAL A 1 138 ? -2.477  6.234   5.485   1.00 10.00 ? 138 VAL A N    4  
ATOM   8675  C  CA   . VAL A 1 138 ? -3.067  5.473   4.409   1.00 10.00 ? 138 VAL A CA   4  
ATOM   8676  C  C    . VAL A 1 138 ? -3.009  4.009   4.837   1.00 10.00 ? 138 VAL A C    4  
ATOM   8677  O  O    . VAL A 1 138 ? -1.938  3.506   5.165   1.00 10.00 ? 138 VAL A O    4  
ATOM   8678  C  CB   . VAL A 1 138 ? -2.266  5.799   3.137   1.00 10.00 ? 138 VAL A CB   4  
ATOM   8679  C  CG1  . VAL A 1 138 ? -2.371  4.707   2.063   1.00 10.00 ? 138 VAL A CG1  4  
ATOM   8680  C  CG2  . VAL A 1 138 ? -2.735  7.134   2.542   1.00 10.00 ? 138 VAL A CG2  4  
ATOM   8681  H  H    . VAL A 1 138 ? -1.518  5.997   5.724   1.00 10.00 ? 138 VAL A H    4  
ATOM   8682  H  HA   . VAL A 1 138 ? -4.110  5.756   4.267   1.00 10.00 ? 138 VAL A HA   4  
ATOM   8683  H  HB   . VAL A 1 138 ? -1.223  5.941   3.431   1.00 10.00 ? 138 VAL A HB   4  
ATOM   8684  H  HG11 . VAL A 1 138 ? -3.417  4.523   1.819   1.00 10.00 ? 138 VAL A HG11 4  
ATOM   8685  H  HG12 . VAL A 1 138 ? -1.846  5.026   1.162   1.00 10.00 ? 138 VAL A HG12 4  
ATOM   8686  H  HG13 . VAL A 1 138 ? -1.913  3.780   2.411   1.00 10.00 ? 138 VAL A HG13 4  
ATOM   8687  H  HG21 . VAL A 1 138 ? -2.606  7.934   3.270   1.00 10.00 ? 138 VAL A HG21 4  
ATOM   8688  H  HG22 . VAL A 1 138 ? -2.142  7.373   1.659   1.00 10.00 ? 138 VAL A HG22 4  
ATOM   8689  H  HG23 . VAL A 1 138 ? -3.786  7.072   2.259   1.00 10.00 ? 138 VAL A HG23 4  
ATOM   8690  N  N    . ALA A 1 139 ? -4.162  3.340   4.882   1.00 10.00 ? 139 ALA A N    4  
ATOM   8691  C  CA   . ALA A 1 139 ? -4.273  1.973   5.364   1.00 10.00 ? 139 ALA A CA   4  
ATOM   8692  C  C    . ALA A 1 139 ? -3.902  1.025   4.232   1.00 10.00 ? 139 ALA A C    4  
ATOM   8693  O  O    . ALA A 1 139 ? -4.649  0.896   3.264   1.00 10.00 ? 139 ALA A O    4  
ATOM   8694  C  CB   . ALA A 1 139 ? -5.699  1.723   5.862   1.00 10.00 ? 139 ALA A CB   4  
ATOM   8695  H  H    . ALA A 1 139 ? -5.005  3.798   4.576   1.00 10.00 ? 139 ALA A H    4  
ATOM   8696  H  HA   . ALA A 1 139 ? -3.595  1.810   6.201   1.00 10.00 ? 139 ALA A HA   4  
ATOM   8697  H  HB1  . ALA A 1 139 ? -5.784  0.697   6.215   1.00 10.00 ? 139 ALA A HB1  4  
ATOM   8698  H  HB2  . ALA A 1 139 ? -5.925  2.401   6.686   1.00 10.00 ? 139 ALA A HB2  4  
ATOM   8699  H  HB3  . ALA A 1 139 ? -6.416  1.883   5.056   1.00 10.00 ? 139 ALA A HB3  4  
ATOM   8700  N  N    . ALA A 1 140 ? -2.736  0.389   4.342   1.00 10.00 ? 140 ALA A N    4  
ATOM   8701  C  CA   . ALA A 1 140 ? -2.225  -0.530  3.343   1.00 10.00 ? 140 ALA A CA   4  
ATOM   8702  C  C    . ALA A 1 140 ? -2.508  -1.964  3.773   1.00 10.00 ? 140 ALA A C    4  
ATOM   8703  O  O    . ALA A 1 140 ? -2.409  -2.280  4.959   1.00 10.00 ? 140 ALA A O    4  
ATOM   8704  C  CB   . ALA A 1 140 ? -0.723  -0.319  3.197   1.00 10.00 ? 140 ALA A CB   4  
ATOM   8705  H  H    . ALA A 1 140 ? -2.195  0.495   5.196   1.00 10.00 ? 140 ALA A H    4  
ATOM   8706  H  HA   . ALA A 1 140 ? -2.695  -0.327  2.381   1.00 10.00 ? 140 ALA A HA   4  
ATOM   8707  H  HB1  . ALA A 1 140 ? -0.357  -0.959  2.395   1.00 10.00 ? 140 ALA A HB1  4  
ATOM   8708  H  HB2  . ALA A 1 140 ? -0.518  0.723   2.956   1.00 10.00 ? 140 ALA A HB2  4  
ATOM   8709  H  HB3  . ALA A 1 140 ? -0.231  -0.582  4.135   1.00 10.00 ? 140 ALA A HB3  4  
ATOM   8710  N  N    . THR A 1 141 ? -2.826  -2.834  2.816   1.00 10.00 ? 141 THR A N    4  
ATOM   8711  C  CA   . THR A 1 141 ? -3.193  -4.216  3.088   1.00 10.00 ? 141 THR A CA   4  
ATOM   8712  C  C    . THR A 1 141 ? -1.910  -5.029  3.263   1.00 10.00 ? 141 THR A C    4  
ATOM   8713  O  O    . THR A 1 141 ? -1.028  -4.987  2.406   1.00 10.00 ? 141 THR A O    4  
ATOM   8714  C  CB   . THR A 1 141 ? -4.035  -4.748  1.920   1.00 10.00 ? 141 THR A CB   4  
ATOM   8715  O  OG1  . THR A 1 141 ? -4.965  -3.760  1.521   1.00 10.00 ? 141 THR A OG1  4  
ATOM   8716  C  CG2  . THR A 1 141 ? -4.797  -6.011  2.330   1.00 10.00 ? 141 THR A CG2  4  
ATOM   8717  H  H    . THR A 1 141 ? -2.881  -2.509  1.853   1.00 10.00 ? 141 THR A H    4  
ATOM   8718  H  HA   . THR A 1 141 ? -3.795  -4.251  3.996   1.00 10.00 ? 141 THR A HA   4  
ATOM   8719  H  HB   . THR A 1 141 ? -3.382  -4.969  1.074   1.00 10.00 ? 141 THR A HB   4  
ATOM   8720  H  HG1  . THR A 1 141 ? -5.459  -4.072  0.760   1.00 10.00 ? 141 THR A HG1  4  
ATOM   8721  H  HG21 . THR A 1 141 ? -5.494  -5.775  3.136   1.00 10.00 ? 141 THR A HG21 4  
ATOM   8722  H  HG22 . THR A 1 141 ? -5.358  -6.399  1.480   1.00 10.00 ? 141 THR A HG22 4  
ATOM   8723  H  HG23 . THR A 1 141 ? -4.103  -6.776  2.679   1.00 10.00 ? 141 THR A HG23 4  
ATOM   8724  N  N    . VAL A 1 142 ? -1.770  -5.768  4.362   1.00 10.00 ? 142 VAL A N    4  
ATOM   8725  C  CA   . VAL A 1 142 ? -0.529  -6.457  4.650   1.00 10.00 ? 142 VAL A CA   4  
ATOM   8726  C  C    . VAL A 1 142 ? -0.647  -7.828  4.009   1.00 10.00 ? 142 VAL A C    4  
ATOM   8727  O  O    . VAL A 1 142 ? -1.185  -8.751  4.609   1.00 10.00 ? 142 VAL A O    4  
ATOM   8728  C  CB   . VAL A 1 142 ? -0.318  -6.525  6.165   1.00 10.00 ? 142 VAL A CB   4  
ATOM   8729  C  CG1  . VAL A 1 142 ? 0.945   -7.308  6.530   1.00 10.00 ? 142 VAL A CG1  4  
ATOM   8730  C  CG2  . VAL A 1 142 ? -0.213  -5.107  6.742   1.00 10.00 ? 142 VAL A CG2  4  
ATOM   8731  H  H    . VAL A 1 142 ? -2.556  -5.962  4.976   1.00 10.00 ? 142 VAL A H    4  
ATOM   8732  H  HA   . VAL A 1 142 ? 0.326   -5.925  4.231   1.00 10.00 ? 142 VAL A HA   4  
ATOM   8733  H  HB   . VAL A 1 142 ? -1.174  -7.032  6.602   1.00 10.00 ? 142 VAL A HB   4  
ATOM   8734  H  HG11 . VAL A 1 142 ? 1.833   -6.739  6.248   1.00 10.00 ? 142 VAL A HG11 4  
ATOM   8735  H  HG12 . VAL A 1 142 ? 0.933   -7.483  7.605   1.00 10.00 ? 142 VAL A HG12 4  
ATOM   8736  H  HG13 . VAL A 1 142 ? 0.969   -8.277  6.036   1.00 10.00 ? 142 VAL A HG13 4  
ATOM   8737  H  HG21 . VAL A 1 142 ? -0.042  -5.157  7.813   1.00 10.00 ? 142 VAL A HG21 4  
ATOM   8738  H  HG22 . VAL A 1 142 ? 0.618   -4.574  6.280   1.00 10.00 ? 142 VAL A HG22 4  
ATOM   8739  H  HG23 . VAL A 1 142 ? -1.128  -4.544  6.568   1.00 10.00 ? 142 VAL A HG23 4  
ATOM   8740  N  N    . LYS A 1 143 ? -0.190  -7.960  2.771   1.00 10.00 ? 143 LYS A N    4  
ATOM   8741  C  CA   . LYS A 1 143 ? 0.030   -9.250  2.155   1.00 10.00 ? 143 LYS A CA   4  
ATOM   8742  C  C    . LYS A 1 143 ? 1.017   -9.051  1.012   1.00 10.00 ? 143 LYS A C    4  
ATOM   8743  O  O    . LYS A 1 143 ? 0.922   -8.063  0.285   1.00 10.00 ? 143 LYS A O    4  
ATOM   8744  C  CB   . LYS A 1 143 ? -1.280  -9.890  1.674   1.00 10.00 ? 143 LYS A CB   4  
ATOM   8745  C  CG   . LYS A 1 143 ? -2.154  -8.961  0.817   1.00 10.00 ? 143 LYS A CG   4  
ATOM   8746  C  CD   . LYS A 1 143 ? -2.732  -9.749  -0.365  1.00 10.00 ? 143 LYS A CD   4  
ATOM   8747  C  CE   . LYS A 1 143 ? -3.622  -8.863  -1.249  1.00 10.00 ? 143 LYS A CE   4  
ATOM   8748  N  NZ   . LYS A 1 143 ? -3.937  -9.524  -2.532  1.00 10.00 ? 143 LYS A NZ   4  
ATOM   8749  H  H    . LYS A 1 143 ? 0.300   -7.172  2.351   1.00 10.00 ? 143 LYS A H    4  
ATOM   8750  H  HA   . LYS A 1 143 ? 0.483   -9.902  2.908   1.00 10.00 ? 143 LYS A HA   4  
ATOM   8751  H  HB2  . LYS A 1 143 ? -1.011  -10.779 1.102   1.00 10.00 ? 143 LYS A HB2  4  
ATOM   8752  H  HB3  . LYS A 1 143 ? -1.867  -10.217 2.533   1.00 10.00 ? 143 LYS A HB3  4  
ATOM   8753  H  HG2  . LYS A 1 143 ? -2.953  -8.559  1.440   1.00 10.00 ? 143 LYS A HG2  4  
ATOM   8754  H  HG3  . LYS A 1 143 ? -1.565  -8.124  0.441   1.00 10.00 ? 143 LYS A HG3  4  
ATOM   8755  H  HD2  . LYS A 1 143 ? -1.894  -10.138 -0.950  1.00 10.00 ? 143 LYS A HD2  4  
ATOM   8756  H  HD3  . LYS A 1 143 ? -3.310  -10.592 0.019   1.00 10.00 ? 143 LYS A HD3  4  
ATOM   8757  H  HE2  . LYS A 1 143 ? -4.545  -8.628  -0.715  1.00 10.00 ? 143 LYS A HE2  4  
ATOM   8758  H  HE3  . LYS A 1 143 ? -3.102  -7.928  -1.469  1.00 10.00 ? 143 LYS A HE3  4  
ATOM   8759  H  HZ1  . LYS A 1 143 ? -4.515  -8.925  -3.104  1.00 10.00 ? 143 LYS A HZ1  4  
ATOM   8760  H  HZ2  . LYS A 1 143 ? -3.066  -9.698  -3.031  1.00 10.00 ? 143 LYS A HZ2  4  
ATOM   8761  H  HZ3  . LYS A 1 143 ? -4.409  -10.403 -2.381  1.00 10.00 ? 143 LYS A HZ3  4  
ATOM   8762  N  N    . LYS A 1 144 ? 1.948   -9.989  0.845   1.00 10.00 ? 144 LYS A N    4  
ATOM   8763  C  CA   . LYS A 1 144 ? 2.783   -10.001 -0.343  1.00 10.00 ? 144 LYS A CA   4  
ATOM   8764  C  C    . LYS A 1 144 ? 1.966   -10.488 -1.539  1.00 10.00 ? 144 LYS A C    4  
ATOM   8765  O  O    . LYS A 1 144 ? 0.964   -11.183 -1.368  1.00 10.00 ? 144 LYS A O    4  
ATOM   8766  C  CB   . LYS A 1 144 ? 4.076   -10.782 -0.085  1.00 10.00 ? 144 LYS A CB   4  
ATOM   8767  C  CG   . LYS A 1 144 ? 3.912   -12.269 0.249   1.00 10.00 ? 144 LYS A CG   4  
ATOM   8768  C  CD   . LYS A 1 144 ? 5.266   -12.755 0.783   1.00 10.00 ? 144 LYS A CD   4  
ATOM   8769  C  CE   . LYS A 1 144 ? 5.256   -14.241 1.152   1.00 10.00 ? 144 LYS A CE   4  
ATOM   8770  N  NZ   . LYS A 1 144 ? 6.580   -14.670 1.647   1.00 10.00 ? 144 LYS A NZ   4  
ATOM   8771  H  H    . LYS A 1 144 ? 1.918   -10.813 1.421   1.00 10.00 ? 144 LYS A H    4  
ATOM   8772  H  HA   . LYS A 1 144 ? 3.084   -8.978  -0.573  1.00 10.00 ? 144 LYS A HA   4  
ATOM   8773  H  HB2  . LYS A 1 144 ? 4.715   -10.692 -0.962  1.00 10.00 ? 144 LYS A HB2  4  
ATOM   8774  H  HB3  . LYS A 1 144 ? 4.584   -10.299 0.747   1.00 10.00 ? 144 LYS A HB3  4  
ATOM   8775  H  HG2  . LYS A 1 144 ? 3.144   -12.421 1.007   1.00 10.00 ? 144 LYS A HG2  4  
ATOM   8776  H  HG3  . LYS A 1 144 ? 3.634   -12.816 -0.657  1.00 10.00 ? 144 LYS A HG3  4  
ATOM   8777  H  HD2  . LYS A 1 144 ? 6.020   -12.572 0.016   1.00 10.00 ? 144 LYS A HD2  4  
ATOM   8778  H  HD3  . LYS A 1 144 ? 5.521   -12.168 1.666   1.00 10.00 ? 144 LYS A HD3  4  
ATOM   8779  H  HE2  . LYS A 1 144 ? 4.510   -14.411 1.931   1.00 10.00 ? 144 LYS A HE2  4  
ATOM   8780  H  HE3  . LYS A 1 144 ? 4.988   -14.830 0.272   1.00 10.00 ? 144 LYS A HE3  4  
ATOM   8781  H  HZ1  . LYS A 1 144 ? 6.541   -15.619 1.989   1.00 10.00 ? 144 LYS A HZ1  4  
ATOM   8782  H  HZ2  . LYS A 1 144 ? 7.259   -14.613 0.902   1.00 10.00 ? 144 LYS A HZ2  4  
ATOM   8783  H  HZ3  . LYS A 1 144 ? 6.883   -14.058 2.404   1.00 10.00 ? 144 LYS A HZ3  4  
ATOM   8784  N  N    . ASN A 1 145 ? 2.365   -10.051 -2.732  1.00 10.00 ? 145 ASN A N    4  
ATOM   8785  C  CA   . ASN A 1 145 ? 1.736   -10.377 -4.002  1.00 10.00 ? 145 ASN A CA   4  
ATOM   8786  C  C    . ASN A 1 145 ? 2.881   -10.447 -5.003  1.00 10.00 ? 145 ASN A C    4  
ATOM   8787  O  O    . ASN A 1 145 ? 3.800   -9.634  -4.897  1.00 10.00 ? 145 ASN A O    4  
ATOM   8788  C  CB   . ASN A 1 145 ? 0.751   -9.277  -4.434  1.00 10.00 ? 145 ASN A CB   4  
ATOM   8789  C  CG   . ASN A 1 145 ? -0.353  -9.019  -3.414  1.00 10.00 ? 145 ASN A CG   4  
ATOM   8790  O  OD1  . ASN A 1 145 ? -1.431  -9.610  -3.475  1.00 10.00 ? 145 ASN A OD1  4  
ATOM   8791  N  ND2  . ASN A 1 145 ? -0.117  -8.110  -2.472  1.00 10.00 ? 145 ASN A ND2  4  
ATOM   8792  H  H    . ASN A 1 145 ? 3.229   -9.531  -2.807  1.00 10.00 ? 145 ASN A H    4  
ATOM   8793  H  HA   . ASN A 1 145 ? 1.220   -11.337 -3.938  1.00 10.00 ? 145 ASN A HA   4  
ATOM   8794  H  HB2  . ASN A 1 145 ? 1.296   -8.348  -4.609  1.00 10.00 ? 145 ASN A HB2  4  
ATOM   8795  H  HB3  . ASN A 1 145 ? 0.289   -9.581  -5.374  1.00 10.00 ? 145 ASN A HB3  4  
ATOM   8796  H  HD21 . ASN A 1 145 ? 0.758   -7.602  -2.456  1.00 10.00 ? 145 ASN A HD21 4  
ATOM   8797  H  HD22 . ASN A 1 145 ? -0.760  -7.969  -1.714  1.00 10.00 ? 145 ASN A HD22 4  
ATOM   8798  N  N    . ILE A 1 146 ? 2.839   -11.399 -5.936  1.00 10.00 ? 146 ILE A N    4  
ATOM   8799  C  CA   . ILE A 1 146 ? 3.917   -11.713 -6.868  1.00 10.00 ? 146 ILE A CA   4  
ATOM   8800  C  C    . ILE A 1 146 ? 5.289   -11.770 -6.176  1.00 10.00 ? 146 ILE A C    4  
ATOM   8801  O  O    . ILE A 1 146 ? 6.304   -11.377 -6.752  1.00 10.00 ? 146 ILE A O    4  
ATOM   8802  C  CB   . ILE A 1 146 ? 3.862   -10.826 -8.133  1.00 10.00 ? 146 ILE A CB   4  
ATOM   8803  C  CG1  . ILE A 1 146 ? 4.068   -9.326  -7.850  1.00 10.00 ? 146 ILE A CG1  4  
ATOM   8804  C  CG2  . ILE A 1 146 ? 2.528   -11.060 -8.860  1.00 10.00 ? 146 ILE A CG2  4  
ATOM   8805  C  CD1  . ILE A 1 146 ? 4.300   -8.509  -9.126  1.00 10.00 ? 146 ILE A CD1  4  
ATOM   8806  H  H    . ILE A 1 146 ? 2.135   -12.130 -5.807  1.00 10.00 ? 146 ILE A H    4  
ATOM   8807  H  HA   . ILE A 1 146 ? 3.733   -12.737 -7.196  1.00 10.00 ? 146 ILE A HA   4  
ATOM   8808  H  HB   . ILE A 1 146 ? 4.659   -11.161 -8.798  1.00 10.00 ? 146 ILE A HB   4  
ATOM   8809  H  HG12 . ILE A 1 146 ? 3.198   -8.917  -7.336  1.00 10.00 ? 146 ILE A HG12 4  
ATOM   8810  H  HG13 . ILE A 1 146 ? 4.945   -9.191  -7.218  1.00 10.00 ? 146 ILE A HG13 4  
ATOM   8811  H  HG21 . ILE A 1 146 ? 2.366   -12.129 -9.002  1.00 10.00 ? 146 ILE A HG21 4  
ATOM   8812  H  HG22 . ILE A 1 146 ? 1.701   -10.651 -8.279  1.00 10.00 ? 146 ILE A HG22 4  
ATOM   8813  H  HG23 . ILE A 1 146 ? 2.542   -10.587 -9.840  1.00 10.00 ? 146 ILE A HG23 4  
ATOM   8814  H  HD11 . ILE A 1 146 ? 4.538   -7.481  -8.851  1.00 10.00 ? 146 ILE A HD11 4  
ATOM   8815  H  HD12 . ILE A 1 146 ? 5.134   -8.926  -9.689  1.00 10.00 ? 146 ILE A HD12 4  
ATOM   8816  H  HD13 . ILE A 1 146 ? 3.406   -8.502  -9.748  1.00 10.00 ? 146 ILE A HD13 4  
ATOM   8817  N  N    . GLU A 1 147 ? 5.323   -12.302 -4.949  1.00 10.00 ? 147 GLU A N    4  
ATOM   8818  C  CA   . GLU A 1 147 ? 6.524   -12.480 -4.153  1.00 10.00 ? 147 GLU A CA   4  
ATOM   8819  C  C    . GLU A 1 147 ? 6.295   -13.701 -3.260  1.00 10.00 ? 147 GLU A C    4  
ATOM   8820  O  O    . GLU A 1 147 ? 5.631   -13.625 -2.224  1.00 10.00 ? 147 GLU A O    4  
ATOM   8821  C  CB   . GLU A 1 147 ? 6.808   -11.188 -3.372  1.00 10.00 ? 147 GLU A CB   4  
ATOM   8822  C  CG   . GLU A 1 147 ? 7.959   -11.309 -2.362  1.00 10.00 ? 147 GLU A CG   4  
ATOM   8823  C  CD   . GLU A 1 147 ? 9.244   -11.801 -3.007  1.00 10.00 ? 147 GLU A CD   4  
ATOM   8824  O  OE1  . GLU A 1 147 ? 9.299   -12.997 -3.360  1.00 10.00 ? 147 GLU A OE1  4  
ATOM   8825  O  OE2  . GLU A 1 147 ? 10.167  -10.975 -3.162  1.00 10.00 ? 147 GLU A OE2  4  
ATOM   8826  H  H    . GLU A 1 147 ? 4.444   -12.607 -4.523  1.00 10.00 ? 147 GLU A H    4  
ATOM   8827  H  HA   . GLU A 1 147 ? 7.356   -12.681 -4.828  1.00 10.00 ? 147 GLU A HA   4  
ATOM   8828  H  HB2  . GLU A 1 147 ? 7.054   -10.403 -4.088  1.00 10.00 ? 147 GLU A HB2  4  
ATOM   8829  H  HB3  . GLU A 1 147 ? 5.904   -10.891 -2.845  1.00 10.00 ? 147 GLU A HB3  4  
ATOM   8830  H  HG2  . GLU A 1 147 ? 8.139   -10.329 -1.920  1.00 10.00 ? 147 GLU A HG2  4  
ATOM   8831  H  HG3  . GLU A 1 147 ? 7.685   -11.999 -1.568  1.00 10.00 ? 147 GLU A HG3  4  
ATOM   8832  N  N    . GLY A 1 148 ? 6.757   -14.871 -3.704  1.00 10.00 ? 148 GLY A N    4  
ATOM   8833  C  CA   . GLY A 1 148 ? 6.310   -16.146 -3.164  1.00 10.00 ? 148 GLY A CA   4  
ATOM   8834  C  C    . GLY A 1 148 ? 4.944   -16.490 -3.760  1.00 10.00 ? 148 GLY A C    4  
ATOM   8835  O  O    . GLY A 1 148 ? 4.801   -17.514 -4.425  1.00 10.00 ? 148 GLY A O    4  
ATOM   8836  H  H    . GLY A 1 148 ? 7.337   -14.869 -4.529  1.00 10.00 ? 148 GLY A H    4  
ATOM   8837  H  HA2  . GLY A 1 148 ? 7.030   -16.916 -3.440  1.00 10.00 ? 148 GLY A HA2  4  
ATOM   8838  H  HA3  . GLY A 1 148 ? 6.240   -16.108 -2.076  1.00 10.00 ? 148 GLY A HA3  4  
ATOM   8839  N  N    . ARG A 1 149 ? 3.955   -15.618 -3.548  1.00 10.00 ? 149 ARG A N    4  
ATOM   8840  C  CA   . ARG A 1 149 ? 2.726   -15.538 -4.318  1.00 10.00 ? 149 ARG A CA   4  
ATOM   8841  C  C    . ARG A 1 149 ? 2.415   -14.048 -4.435  1.00 10.00 ? 149 ARG A C    4  
ATOM   8842  O  O    . ARG A 1 149 ? 1.557   -13.678 -5.265  1.00 10.00 ? 149 ARG A O    4  
ATOM   8843  C  CB   . ARG A 1 149 ? 1.581   -16.292 -3.630  1.00 10.00 ? 149 ARG A CB   4  
ATOM   8844  C  CG   . ARG A 1 149 ? 1.875   -17.794 -3.540  1.00 10.00 ? 149 ARG A CG   4  
ATOM   8845  C  CD   . ARG A 1 149 ? 0.616   -18.583 -3.157  1.00 10.00 ? 149 ARG A CD   4  
ATOM   8846  N  NE   . ARG A 1 149 ? 0.898   -20.023 -3.012  1.00 10.00 ? 149 ARG A NE   4  
ATOM   8847  C  CZ   . ARG A 1 149 ? 1.095   -20.886 -4.023  1.00 10.00 ? 149 ARG A CZ   4  
ATOM   8848  N  NH1  . ARG A 1 149 ? 1.054   -20.455 -5.288  1.00 10.00 ? 149 ARG A NH1  4  
ATOM   8849  N  NH2  . ARG A 1 149 ? 1.334   -22.177 -3.763  1.00 10.00 ? 149 ARG A NH2  4  
ATOM   8850  O  OXT  . ARG A 1 149 ? 3.094   -13.277 -3.719  1.00 10.00 ? 149 ARG A OXT  4  
ATOM   8851  H  H    . ARG A 1 149 ? 4.144   -14.744 -3.057  1.00 10.00 ? 149 ARG A H    4  
ATOM   8852  H  HA   . ARG A 1 149 ? 2.881   -15.932 -5.323  1.00 10.00 ? 149 ARG A HA   4  
ATOM   8853  H  HB2  . ARG A 1 149 ? 1.415   -15.881 -2.634  1.00 10.00 ? 149 ARG A HB2  4  
ATOM   8854  H  HB3  . ARG A 1 149 ? 0.683   -16.133 -4.227  1.00 10.00 ? 149 ARG A HB3  4  
ATOM   8855  H  HG2  . ARG A 1 149 ? 2.251   -18.131 -4.506  1.00 10.00 ? 149 ARG A HG2  4  
ATOM   8856  H  HG3  . ARG A 1 149 ? 2.648   -17.961 -2.789  1.00 10.00 ? 149 ARG A HG3  4  
ATOM   8857  H  HD2  . ARG A 1 149 ? 0.258   -18.207 -2.197  1.00 10.00 ? 149 ARG A HD2  4  
ATOM   8858  H  HD3  . ARG A 1 149 ? -0.177  -18.417 -3.889  1.00 10.00 ? 149 ARG A HD3  4  
ATOM   8859  H  HE   . ARG A 1 149 ? 0.938   -20.366 -2.062  1.00 10.00 ? 149 ARG A HE   4  
ATOM   8860  H  HH11 . ARG A 1 149 ? 0.899   -19.473 -5.463  1.00 10.00 ? 149 ARG A HH11 4  
ATOM   8861  H  HH12 . ARG A 1 149 ? 1.205   -21.071 -6.073  1.00 10.00 ? 149 ARG A HH12 4  
ATOM   8862  H  HH21 . ARG A 1 149 ? 1.369   -22.513 -2.812  1.00 10.00 ? 149 ARG A HH21 4  
ATOM   8863  H  HH22 . ARG A 1 149 ? 1.489   -22.841 -4.508  1.00 10.00 ? 149 ARG A HH22 4  
HETATM 8864  CU CU   . CU1 B 2 .   ? 14.564  -1.239  -2.918  1.00 10.00 ? 150 CU1 A CU   4  
ATOM   8865  N  N    . MET A 1 1   ? -58.991 -11.409 30.249  1.00 10.00 ? 1   MET A N    5  
ATOM   8866  C  CA   . MET A 1 1   ? -57.637 -10.938 30.585  1.00 10.00 ? 1   MET A CA   5  
ATOM   8867  C  C    . MET A 1 1   ? -56.663 -11.811 29.800  1.00 10.00 ? 1   MET A C    5  
ATOM   8868  O  O    . MET A 1 1   ? -57.141 -12.627 29.013  1.00 10.00 ? 1   MET A O    5  
ATOM   8869  C  CB   . MET A 1 1   ? -57.379 -10.981 32.099  1.00 10.00 ? 1   MET A CB   5  
ATOM   8870  C  CG   . MET A 1 1   ? -58.269 -10.008 32.884  1.00 10.00 ? 1   MET A CG   5  
ATOM   8871  S  SD   . MET A 1 1   ? -57.922 -9.984  34.661  1.00 10.00 ? 1   MET A SD   5  
ATOM   8872  C  CE   . MET A 1 1   ? -59.097 -8.724  35.203  1.00 10.00 ? 1   MET A CE   5  
ATOM   8873  H  H1   . MET A 1 1   ? -59.222 -12.204 30.826  1.00 10.00 ? 1   MET A H1   5  
ATOM   8874  H  H2   . MET A 1 1   ? -59.682 -10.680 30.331  1.00 10.00 ? 1   MET A H2   5  
ATOM   8875  H  H3   . MET A 1 1   ? -58.915 -11.746 29.292  1.00 10.00 ? 1   MET A H3   5  
ATOM   8876  H  HA   . MET A 1 1   ? -57.518 -9.915  30.223  1.00 10.00 ? 1   MET A HA   5  
ATOM   8877  H  HB2  . MET A 1 1   ? -57.539 -11.994 32.472  1.00 10.00 ? 1   MET A HB2  5  
ATOM   8878  H  HB3  . MET A 1 1   ? -56.344 -10.702 32.299  1.00 10.00 ? 1   MET A HB3  5  
ATOM   8879  H  HG2  . MET A 1 1   ? -58.112 -8.997  32.505  1.00 10.00 ? 1   MET A HG2  5  
ATOM   8880  H  HG3  . MET A 1 1   ? -59.317 -10.275 32.760  1.00 10.00 ? 1   MET A HG3  5  
ATOM   8881  H  HE1  . MET A 1 1   ? -58.876 -7.782  34.704  1.00 10.00 ? 1   MET A HE1  5  
ATOM   8882  H  HE2  . MET A 1 1   ? -60.111 -9.043  34.962  1.00 10.00 ? 1   MET A HE2  5  
ATOM   8883  H  HE3  . MET A 1 1   ? -59.003 -8.596  36.280  1.00 10.00 ? 1   MET A HE3  5  
ATOM   8884  N  N    . GLY A 1 2   ? -55.353 -11.638 29.993  1.00 10.00 ? 2   GLY A N    5  
ATOM   8885  C  CA   . GLY A 1 2   ? -54.347 -12.287 29.167  1.00 10.00 ? 2   GLY A CA   5  
ATOM   8886  C  C    . GLY A 1 2   ? -54.167 -11.524 27.854  1.00 10.00 ? 2   GLY A C    5  
ATOM   8887  O  O    . GLY A 1 2   ? -55.082 -10.837 27.402  1.00 10.00 ? 2   GLY A O    5  
ATOM   8888  H  H    . GLY A 1 2   ? -55.036 -10.937 30.645  1.00 10.00 ? 2   GLY A H    5  
ATOM   8889  H  HA2  . GLY A 1 2   ? -53.405 -12.292 29.717  1.00 10.00 ? 2   GLY A HA2  5  
ATOM   8890  H  HA3  . GLY A 1 2   ? -54.629 -13.319 28.951  1.00 10.00 ? 2   GLY A HA3  5  
ATOM   8891  N  N    . HIS A 1 3   ? -52.973 -11.623 27.265  1.00 10.00 ? 3   HIS A N    5  
ATOM   8892  C  CA   . HIS A 1 3   ? -52.583 -10.986 26.015  1.00 10.00 ? 3   HIS A CA   5  
ATOM   8893  C  C    . HIS A 1 3   ? -51.245 -11.614 25.613  1.00 10.00 ? 3   HIS A C    5  
ATOM   8894  O  O    . HIS A 1 3   ? -50.676 -12.367 26.405  1.00 10.00 ? 3   HIS A O    5  
ATOM   8895  C  CB   . HIS A 1 3   ? -52.459 -9.465  26.210  1.00 10.00 ? 3   HIS A CB   5  
ATOM   8896  C  CG   . HIS A 1 3   ? -52.164 -8.714  24.938  1.00 10.00 ? 3   HIS A CG   5  
ATOM   8897  N  ND1  . HIS A 1 3   ? -52.472 -9.169  23.656  1.00 10.00 ? 3   HIS A ND1  5  
ATOM   8898  C  CD2  . HIS A 1 3   ? -51.508 -7.520  24.853  1.00 10.00 ? 3   HIS A CD2  5  
ATOM   8899  C  CE1  . HIS A 1 3   ? -52.008 -8.226  22.822  1.00 10.00 ? 3   HIS A CE1  5  
ATOM   8900  N  NE2  . HIS A 1 3   ? -51.421 -7.230  23.510  1.00 10.00 ? 3   HIS A NE2  5  
ATOM   8901  H  H    . HIS A 1 3   ? -52.255 -12.215 27.666  1.00 10.00 ? 3   HIS A H    5  
ATOM   8902  H  HA   . HIS A 1 3   ? -53.333 -11.207 25.254  1.00 10.00 ? 3   HIS A HA   5  
ATOM   8903  H  HB2  . HIS A 1 3   ? -53.395 -9.068  26.603  1.00 10.00 ? 3   HIS A HB2  5  
ATOM   8904  H  HB3  . HIS A 1 3   ? -51.669 -9.263  26.935  1.00 10.00 ? 3   HIS A HB3  5  
ATOM   8905  H  HD2  . HIS A 1 3   ? -51.124 -6.931  25.673  1.00 10.00 ? 3   HIS A HD2  5  
ATOM   8906  H  HE1  . HIS A 1 3   ? -52.077 -8.271  21.745  1.00 10.00 ? 3   HIS A HE1  5  
ATOM   8907  H  HE2  . HIS A 1 3   ? -50.981 -6.417  23.104  1.00 10.00 ? 3   HIS A HE2  5  
ATOM   8908  N  N    . THR A 1 4   ? -50.732 -11.323 24.416  1.00 10.00 ? 4   THR A N    5  
ATOM   8909  C  CA   . THR A 1 4   ? -49.414 -11.763 23.983  1.00 10.00 ? 4   THR A CA   5  
ATOM   8910  C  C    . THR A 1 4   ? -48.946 -10.893 22.814  1.00 10.00 ? 4   THR A C    5  
ATOM   8911  O  O    . THR A 1 4   ? -49.668 -9.998  22.380  1.00 10.00 ? 4   THR A O    5  
ATOM   8912  C  CB   . THR A 1 4   ? -49.420 -13.266 23.643  1.00 10.00 ? 4   THR A CB   5  
ATOM   8913  O  OG1  . THR A 1 4   ? -48.102 -13.704 23.368  1.00 10.00 ? 4   THR A OG1  5  
ATOM   8914  C  CG2  . THR A 1 4   ? -50.327 -13.593 22.452  1.00 10.00 ? 4   THR A CG2  5  
ATOM   8915  H  H    . THR A 1 4   ? -51.213 -10.655 23.816  1.00 10.00 ? 4   THR A H    5  
ATOM   8916  H  HA   . THR A 1 4   ? -48.715 -11.600 24.806  1.00 10.00 ? 4   THR A HA   5  
ATOM   8917  H  HB   . THR A 1 4   ? -49.783 -13.832 24.503  1.00 10.00 ? 4   THR A HB   5  
ATOM   8918  H  HG1  . THR A 1 4   ? -47.684 -13.961 24.196  1.00 10.00 ? 4   THR A HG1  5  
ATOM   8919  H  HG21 . THR A 1 4   ? -51.354 -13.303 22.673  1.00 10.00 ? 4   THR A HG21 5  
ATOM   8920  H  HG22 . THR A 1 4   ? -49.995 -13.071 21.554  1.00 10.00 ? 4   THR A HG22 5  
ATOM   8921  H  HG23 . THR A 1 4   ? -50.300 -14.666 22.263  1.00 10.00 ? 4   THR A HG23 5  
ATOM   8922  N  N    . MET A 1 5   ? -47.740 -11.172 22.316  1.00 10.00 ? 5   MET A N    5  
ATOM   8923  C  CA   . MET A 1 5   ? -47.078 -10.481 21.216  1.00 10.00 ? 5   MET A CA   5  
ATOM   8924  C  C    . MET A 1 5   ? -45.842 -11.304 20.811  1.00 10.00 ? 5   MET A C    5  
ATOM   8925  O  O    . MET A 1 5   ? -44.717 -10.941 21.150  1.00 10.00 ? 5   MET A O    5  
ATOM   8926  C  CB   . MET A 1 5   ? -46.729 -9.028  21.620  1.00 10.00 ? 5   MET A CB   5  
ATOM   8927  C  CG   . MET A 1 5   ? -47.652 -7.978  20.979  1.00 10.00 ? 5   MET A CG   5  
ATOM   8928  S  SD   . MET A 1 5   ? -47.105 -7.271  19.398  1.00 10.00 ? 5   MET A SD   5  
ATOM   8929  C  CE   . MET A 1 5   ? -47.039 -8.726  18.329  1.00 10.00 ? 5   MET A CE   5  
ATOM   8930  H  H    . MET A 1 5   ? -47.299 -12.006 22.689  1.00 10.00 ? 5   MET A H    5  
ATOM   8931  H  HA   . MET A 1 5   ? -47.760 -10.442 20.370  1.00 10.00 ? 5   MET A HA   5  
ATOM   8932  H  HB2  . MET A 1 5   ? -46.789 -8.934  22.705  1.00 10.00 ? 5   MET A HB2  5  
ATOM   8933  H  HB3  . MET A 1 5   ? -45.713 -8.760  21.328  1.00 10.00 ? 5   MET A HB3  5  
ATOM   8934  H  HG2  . MET A 1 5   ? -48.657 -8.370  20.846  1.00 10.00 ? 5   MET A HG2  5  
ATOM   8935  H  HG3  . MET A 1 5   ? -47.715 -7.136  21.669  1.00 10.00 ? 5   MET A HG3  5  
ATOM   8936  H  HE1  . MET A 1 5   ? -48.014 -9.209  18.305  1.00 10.00 ? 5   MET A HE1  5  
ATOM   8937  H  HE2  . MET A 1 5   ? -46.769 -8.407  17.323  1.00 10.00 ? 5   MET A HE2  5  
ATOM   8938  H  HE3  . MET A 1 5   ? -46.281 -9.416  18.695  1.00 10.00 ? 5   MET A HE3  5  
ATOM   8939  N  N    . PRO A 1 6   ? -46.023 -12.437 20.114  1.00 10.00 ? 6   PRO A N    5  
ATOM   8940  C  CA   . PRO A 1 6   ? -44.904 -13.218 19.614  1.00 10.00 ? 6   PRO A CA   5  
ATOM   8941  C  C    . PRO A 1 6   ? -44.206 -12.457 18.482  1.00 10.00 ? 6   PRO A C    5  
ATOM   8942  O  O    . PRO A 1 6   ? -44.823 -11.632 17.809  1.00 10.00 ? 6   PRO A O    5  
ATOM   8943  C  CB   . PRO A 1 6   ? -45.515 -14.535 19.130  1.00 10.00 ? 6   PRO A CB   5  
ATOM   8944  C  CG   . PRO A 1 6   ? -46.925 -14.125 18.707  1.00 10.00 ? 6   PRO A CG   5  
ATOM   8945  C  CD   . PRO A 1 6   ? -47.288 -13.037 19.719  1.00 10.00 ? 6   PRO A CD   5  
ATOM   8946  H  HA   . PRO A 1 6   ? -44.190 -13.418 20.416  1.00 10.00 ? 6   PRO A HA   5  
ATOM   8947  H  HB2  . PRO A 1 6   ? -44.951 -14.988 18.313  1.00 10.00 ? 6   PRO A HB2  5  
ATOM   8948  H  HB3  . PRO A 1 6   ? -45.582 -15.230 19.969  1.00 10.00 ? 6   PRO A HB3  5  
ATOM   8949  H  HG2  . PRO A 1 6   ? -46.888 -13.690 17.706  1.00 10.00 ? 6   PRO A HG2  5  
ATOM   8950  H  HG3  . PRO A 1 6   ? -47.625 -14.961 18.727  1.00 10.00 ? 6   PRO A HG3  5  
ATOM   8951  H  HD2  . PRO A 1 6   ? -47.972 -12.327 19.255  1.00 10.00 ? 6   PRO A HD2  5  
ATOM   8952  H  HD3  . PRO A 1 6   ? -47.754 -13.494 20.593  1.00 10.00 ? 6   PRO A HD3  5  
ATOM   8953  N  N    . ALA A 1 7   ? -42.920 -12.744 18.266  1.00 10.00 ? 7   ALA A N    5  
ATOM   8954  C  CA   . ALA A 1 7   ? -42.101 -12.145 17.225  1.00 10.00 ? 7   ALA A CA   5  
ATOM   8955  C  C    . ALA A 1 7   ? -40.878 -13.039 17.027  1.00 10.00 ? 7   ALA A C    5  
ATOM   8956  O  O    . ALA A 1 7   ? -40.659 -13.956 17.819  1.00 10.00 ? 7   ALA A O    5  
ATOM   8957  C  CB   . ALA A 1 7   ? -41.688 -10.726 17.635  1.00 10.00 ? 7   ALA A CB   5  
ATOM   8958  H  H    . ALA A 1 7   ? -42.455 -13.459 18.812  1.00 10.00 ? 7   ALA A H    5  
ATOM   8959  H  HA   . ALA A 1 7   ? -42.668 -12.105 16.293  1.00 10.00 ? 7   ALA A HA   5  
ATOM   8960  H  HB1  . ALA A 1 7   ? -41.122 -10.759 18.567  1.00 10.00 ? 7   ALA A HB1  5  
ATOM   8961  H  HB2  . ALA A 1 7   ? -41.070 -10.278 16.857  1.00 10.00 ? 7   ALA A HB2  5  
ATOM   8962  H  HB3  . ALA A 1 7   ? -42.573 -10.106 17.779  1.00 10.00 ? 7   ALA A HB3  5  
ATOM   8963  N  N    . HIS A 1 8   ? -40.089 -12.776 15.983  1.00 10.00 ? 8   HIS A N    5  
ATOM   8964  C  CA   . HIS A 1 8   ? -38.847 -13.474 15.687  1.00 10.00 ? 8   HIS A CA   5  
ATOM   8965  C  C    . HIS A 1 8   ? -38.016 -12.551 14.792  1.00 10.00 ? 8   HIS A C    5  
ATOM   8966  O  O    . HIS A 1 8   ? -38.532 -11.548 14.301  1.00 10.00 ? 8   HIS A O    5  
ATOM   8967  C  CB   . HIS A 1 8   ? -39.149 -14.824 15.015  1.00 10.00 ? 8   HIS A CB   5  
ATOM   8968  C  CG   . HIS A 1 8   ? -37.952 -15.723 14.817  1.00 10.00 ? 8   HIS A CG   5  
ATOM   8969  N  ND1  . HIS A 1 8   ? -36.687 -15.535 15.380  1.00 10.00 ? 8   HIS A ND1  5  
ATOM   8970  C  CD2  . HIS A 1 8   ? -37.937 -16.851 14.048  1.00 10.00 ? 8   HIS A CD2  5  
ATOM   8971  C  CE1  . HIS A 1 8   ? -35.941 -16.560 14.941  1.00 10.00 ? 8   HIS A CE1  5  
ATOM   8972  N  NE2  . HIS A 1 8   ? -36.663 -17.364 14.140  1.00 10.00 ? 8   HIS A NE2  5  
ATOM   8973  H  H    . HIS A 1 8   ? -40.283 -11.982 15.385  1.00 10.00 ? 8   HIS A H    5  
ATOM   8974  H  HA   . HIS A 1 8   ? -38.307 -13.645 16.620  1.00 10.00 ? 8   HIS A HA   5  
ATOM   8975  H  HB2  . HIS A 1 8   ? -39.859 -15.374 15.634  1.00 10.00 ? 8   HIS A HB2  5  
ATOM   8976  H  HB3  . HIS A 1 8   ? -39.614 -14.639 14.046  1.00 10.00 ? 8   HIS A HB3  5  
ATOM   8977  H  HD2  . HIS A 1 8   ? -38.764 -17.262 13.486  1.00 10.00 ? 8   HIS A HD2  5  
ATOM   8978  H  HE1  . HIS A 1 8   ? -34.903 -16.717 15.196  1.00 10.00 ? 8   HIS A HE1  5  
ATOM   8979  H  HE2  . HIS A 1 8   ? -36.328 -18.206 13.695  1.00 10.00 ? 8   HIS A HE2  5  
ATOM   8980  N  N    . THR A 1 9   ? -36.739 -12.872 14.601  1.00 10.00 ? 9   THR A N    5  
ATOM   8981  C  CA   . THR A 1 9   ? -35.786 -12.091 13.829  1.00 10.00 ? 9   THR A CA   5  
ATOM   8982  C  C    . THR A 1 9   ? -34.650 -13.019 13.371  1.00 10.00 ? 9   THR A C    5  
ATOM   8983  O  O    . THR A 1 9   ? -33.527 -12.900 13.863  1.00 10.00 ? 9   THR A O    5  
ATOM   8984  C  CB   . THR A 1 9   ? -35.308 -10.882 14.663  1.00 10.00 ? 9   THR A CB   5  
ATOM   8985  O  OG1  . THR A 1 9   ? -34.191 -10.269 14.055  1.00 10.00 ? 9   THR A OG1  5  
ATOM   8986  C  CG2  . THR A 1 9   ? -34.947 -11.227 16.115  1.00 10.00 ? 9   THR A CG2  5  
ATOM   8987  H  H    . THR A 1 9   ? -36.412 -13.739 15.021  1.00 10.00 ? 9   THR A H    5  
ATOM   8988  H  HA   . THR A 1 9   ? -36.270 -11.683 12.941  1.00 10.00 ? 9   THR A HA   5  
ATOM   8989  H  HB   . THR A 1 9   ? -36.115 -10.148 14.691  1.00 10.00 ? 9   THR A HB   5  
ATOM   8990  H  HG1  . THR A 1 9   ? -33.494 -10.935 13.990  1.00 10.00 ? 9   THR A HG1  5  
ATOM   8991  H  HG21 . THR A 1 9   ? -35.829 -11.561 16.661  1.00 10.00 ? 9   THR A HG21 5  
ATOM   8992  H  HG22 . THR A 1 9   ? -34.186 -12.006 16.154  1.00 10.00 ? 9   THR A HG22 5  
ATOM   8993  H  HG23 . THR A 1 9   ? -34.560 -10.334 16.606  1.00 10.00 ? 9   THR A HG23 5  
ATOM   8994  N  N    . PRO A 1 10  ? -34.916 -13.962 12.452  1.00 10.00 ? 10  PRO A N    5  
ATOM   8995  C  CA   . PRO A 1 10  ? -33.911 -14.912 12.004  1.00 10.00 ? 10  PRO A CA   5  
ATOM   8996  C  C    . PRO A 1 10  ? -32.792 -14.194 11.235  1.00 10.00 ? 10  PRO A C    5  
ATOM   8997  O  O    . PRO A 1 10  ? -33.037 -13.148 10.634  1.00 10.00 ? 10  PRO A O    5  
ATOM   8998  C  CB   . PRO A 1 10  ? -34.662 -15.913 11.121  1.00 10.00 ? 10  PRO A CB   5  
ATOM   8999  C  CG   . PRO A 1 10  ? -35.833 -15.093 10.579  1.00 10.00 ? 10  PRO A CG   5  
ATOM   9000  C  CD   . PRO A 1 10  ? -36.169 -14.155 11.739  1.00 10.00 ? 10  PRO A CD   5  
ATOM   9001  H  HA   . PRO A 1 10  ? -33.509 -15.426 12.877  1.00 10.00 ? 10  PRO A HA   5  
ATOM   9002  H  HB2  . PRO A 1 10  ? -34.041 -16.319 10.320  1.00 10.00 ? 10  PRO A HB2  5  
ATOM   9003  H  HB3  . PRO A 1 10  ? -35.050 -16.723 11.739  1.00 10.00 ? 10  PRO A HB3  5  
ATOM   9004  H  HG2  . PRO A 1 10  ? -35.491 -14.504 9.726   1.00 10.00 ? 10  PRO A HG2  5  
ATOM   9005  H  HG3  . PRO A 1 10  ? -36.680 -15.716 10.289  1.00 10.00 ? 10  PRO A HG3  5  
ATOM   9006  H  HD2  . PRO A 1 10  ? -36.576 -13.224 11.345  1.00 10.00 ? 10  PRO A HD2  5  
ATOM   9007  H  HD3  . PRO A 1 10  ? -36.895 -14.631 12.397  1.00 10.00 ? 10  PRO A HD3  5  
ATOM   9008  N  N    . PRO A 1 11  ? -31.564 -14.735 11.250  1.00 10.00 ? 11  PRO A N    5  
ATOM   9009  C  CA   . PRO A 1 11  ? -30.431 -14.158 10.544  1.00 10.00 ? 11  PRO A CA   5  
ATOM   9010  C  C    . PRO A 1 11  ? -30.536 -14.411 9.035   1.00 10.00 ? 11  PRO A C    5  
ATOM   9011  O  O    . PRO A 1 11  ? -31.427 -15.120 8.568   1.00 10.00 ? 11  PRO A O    5  
ATOM   9012  C  CB   . PRO A 1 11  ? -29.205 -14.853 11.146  1.00 10.00 ? 11  PRO A CB   5  
ATOM   9013  C  CG   . PRO A 1 11  ? -29.742 -16.243 11.490  1.00 10.00 ? 11  PRO A CG   5  
ATOM   9014  C  CD   . PRO A 1 11  ? -31.168 -15.945 11.954  1.00 10.00 ? 11  PRO A CD   5  
ATOM   9015  H  HA   . PRO A 1 11  ? -30.373 -13.083 10.725  1.00 10.00 ? 11  PRO A HA   5  
ATOM   9016  H  HB2  . PRO A 1 11  ? -28.352 -14.897 10.467  1.00 10.00 ? 11  PRO A HB2  5  
ATOM   9017  H  HB3  . PRO A 1 11  ? -28.920 -14.343 12.068  1.00 10.00 ? 11  PRO A HB3  5  
ATOM   9018  H  HG2  . PRO A 1 11  ? -29.773 -16.853 10.586  1.00 10.00 ? 11  PRO A HG2  5  
ATOM   9019  H  HG3  . PRO A 1 11  ? -29.150 -16.740 12.259  1.00 10.00 ? 11  PRO A HG3  5  
ATOM   9020  H  HD2  . PRO A 1 11  ? -31.822 -16.787 11.723  1.00 10.00 ? 11  PRO A HD2  5  
ATOM   9021  H  HD3  . PRO A 1 11  ? -31.165 -15.752 13.028  1.00 10.00 ? 11  PRO A HD3  5  
ATOM   9022  N  N    . ALA A 1 12  ? -29.587 -13.854 8.277   1.00 10.00 ? 12  ALA A N    5  
ATOM   9023  C  CA   . ALA A 1 12  ? -29.420 -14.077 6.850   1.00 10.00 ? 12  ALA A CA   5  
ATOM   9024  C  C    . ALA A 1 12  ? -27.920 -14.074 6.556   1.00 10.00 ? 12  ALA A C    5  
ATOM   9025  O  O    . ALA A 1 12  ? -27.133 -13.646 7.400   1.00 10.00 ? 12  ALA A O    5  
ATOM   9026  C  CB   . ALA A 1 12  ? -30.149 -12.983 6.066   1.00 10.00 ? 12  ALA A CB   5  
ATOM   9027  H  H    . ALA A 1 12  ? -28.833 -13.342 8.718   1.00 10.00 ? 12  ALA A H    5  
ATOM   9028  H  HA   . ALA A 1 12  ? -29.829 -15.051 6.574   1.00 10.00 ? 12  ALA A HA   5  
ATOM   9029  H  HB1  . ALA A 1 12  ? -29.742 -12.004 6.325   1.00 10.00 ? 12  ALA A HB1  5  
ATOM   9030  H  HB2  . ALA A 1 12  ? -30.028 -13.149 4.995   1.00 10.00 ? 12  ALA A HB2  5  
ATOM   9031  H  HB3  . ALA A 1 12  ? -31.212 -13.004 6.308   1.00 10.00 ? 12  ALA A HB3  5  
ATOM   9032  N  N    . GLN A 1 13  ? -27.523 -14.564 5.379   1.00 10.00 ? 13  GLN A N    5  
ATOM   9033  C  CA   . GLN A 1 13  ? -26.135 -14.700 4.966   1.00 10.00 ? 13  GLN A CA   5  
ATOM   9034  C  C    . GLN A 1 13  ? -26.132 -14.835 3.441   1.00 10.00 ? 13  GLN A C    5  
ATOM   9035  O  O    . GLN A 1 13  ? -27.178 -15.101 2.850   1.00 10.00 ? 13  GLN A O    5  
ATOM   9036  C  CB   . GLN A 1 13  ? -25.525 -15.927 5.668   1.00 10.00 ? 13  GLN A CB   5  
ATOM   9037  C  CG   . GLN A 1 13  ? -24.016 -16.091 5.438   1.00 10.00 ? 13  GLN A CG   5  
ATOM   9038  C  CD   . GLN A 1 13  ? -23.433 -17.184 6.328   1.00 10.00 ? 13  GLN A CD   5  
ATOM   9039  O  OE1  . GLN A 1 13  ? -23.034 -18.239 5.849   1.00 10.00 ? 13  GLN A OE1  5  
ATOM   9040  N  NE2  . GLN A 1 13  ? -23.377 -16.944 7.635   1.00 10.00 ? 13  GLN A NE2  5  
ATOM   9041  H  H    . GLN A 1 13  ? -28.206 -14.864 4.694   1.00 10.00 ? 13  GLN A H    5  
ATOM   9042  H  HA   . GLN A 1 13  ? -25.587 -13.800 5.249   1.00 10.00 ? 13  GLN A HA   5  
ATOM   9043  H  HB2  . GLN A 1 13  ? -25.691 -15.821 6.741   1.00 10.00 ? 13  GLN A HB2  5  
ATOM   9044  H  HB3  . GLN A 1 13  ? -26.037 -16.831 5.333   1.00 10.00 ? 13  GLN A HB3  5  
ATOM   9045  H  HG2  . GLN A 1 13  ? -23.826 -16.372 4.402   1.00 10.00 ? 13  GLN A HG2  5  
ATOM   9046  H  HG3  . GLN A 1 13  ? -23.502 -15.153 5.651   1.00 10.00 ? 13  GLN A HG3  5  
ATOM   9047  H  HE21 . GLN A 1 13  ? -23.718 -16.073 8.012   1.00 10.00 ? 13  GLN A HE21 5  
ATOM   9048  H  HE22 . GLN A 1 13  ? -22.994 -17.657 8.236   1.00 10.00 ? 13  GLN A HE22 5  
ATOM   9049  N  N    . THR A 1 14  ? -24.975 -14.647 2.805   1.00 10.00 ? 14  THR A N    5  
ATOM   9050  C  CA   . THR A 1 14  ? -24.773 -14.895 1.387   1.00 10.00 ? 14  THR A CA   5  
ATOM   9051  C  C    . THR A 1 14  ? -23.279 -15.146 1.167   1.00 10.00 ? 14  THR A C    5  
ATOM   9052  O  O    . THR A 1 14  ? -22.521 -15.202 2.135   1.00 10.00 ? 14  THR A O    5  
ATOM   9053  C  CB   . THR A 1 14  ? -25.336 -13.737 0.542   1.00 10.00 ? 14  THR A CB   5  
ATOM   9054  O  OG1  . THR A 1 14  ? -25.223 -14.046 -0.835  1.00 10.00 ? 14  THR A OG1  5  
ATOM   9055  C  CG2  . THR A 1 14  ? -24.629 -12.406 0.819   1.00 10.00 ? 14  THR A CG2  5  
ATOM   9056  H  H    . THR A 1 14  ? -24.127 -14.471 3.329   1.00 10.00 ? 14  THR A H    5  
ATOM   9057  H  HA   . THR A 1 14  ? -25.302 -15.811 1.115   1.00 10.00 ? 14  THR A HA   5  
ATOM   9058  H  HB   . THR A 1 14  ? -26.396 -13.610 0.773   1.00 10.00 ? 14  THR A HB   5  
ATOM   9059  H  HG1  . THR A 1 14  ? -25.988 -14.569 -1.097  1.00 10.00 ? 14  THR A HG1  5  
ATOM   9060  H  HG21 . THR A 1 14  ? -24.741 -12.131 1.868   1.00 10.00 ? 14  THR A HG21 5  
ATOM   9061  H  HG22 . THR A 1 14  ? -23.570 -12.473 0.576   1.00 10.00 ? 14  THR A HG22 5  
ATOM   9062  H  HG23 . THR A 1 14  ? -25.080 -11.626 0.205   1.00 10.00 ? 14  THR A HG23 5  
ATOM   9063  N  N    . ALA A 1 15  ? -22.871 -15.299 -0.093  1.00 10.00 ? 15  ALA A N    5  
ATOM   9064  C  CA   . ALA A 1 15  ? -21.518 -15.665 -0.491  1.00 10.00 ? 15  ALA A CA   5  
ATOM   9065  C  C    . ALA A 1 15  ? -21.285 -15.243 -1.948  1.00 10.00 ? 15  ALA A C    5  
ATOM   9066  O  O    . ALA A 1 15  ? -21.536 -16.038 -2.852  1.00 10.00 ? 15  ALA A O    5  
ATOM   9067  C  CB   . ALA A 1 15  ? -21.331 -17.177 -0.314  1.00 10.00 ? 15  ALA A CB   5  
ATOM   9068  H  H    . ALA A 1 15  ? -23.563 -15.126 -0.817  1.00 10.00 ? 15  ALA A H    5  
ATOM   9069  H  HA   . ALA A 1 15  ? -20.794 -15.180 0.162   1.00 10.00 ? 15  ALA A HA   5  
ATOM   9070  H  HB1  . ALA A 1 15  ? -22.073 -17.723 -0.899  1.00 10.00 ? 15  ALA A HB1  5  
ATOM   9071  H  HB2  . ALA A 1 15  ? -20.333 -17.463 -0.648  1.00 10.00 ? 15  ALA A HB2  5  
ATOM   9072  H  HB3  . ALA A 1 15  ? -21.440 -17.445 0.737   1.00 10.00 ? 15  ALA A HB3  5  
ATOM   9073  N  N    . PRO A 1 16  ? -20.851 -13.999 -2.206  1.00 10.00 ? 16  PRO A N    5  
ATOM   9074  C  CA   . PRO A 1 16  ? -20.614 -13.525 -3.561  1.00 10.00 ? 16  PRO A CA   5  
ATOM   9075  C  C    . PRO A 1 16  ? -19.338 -14.151 -4.136  1.00 10.00 ? 16  PRO A C    5  
ATOM   9076  O  O    . PRO A 1 16  ? -18.497 -14.660 -3.398  1.00 10.00 ? 16  PRO A O    5  
ATOM   9077  C  CB   . PRO A 1 16  ? -20.499 -12.004 -3.435  1.00 10.00 ? 16  PRO A CB   5  
ATOM   9078  C  CG   . PRO A 1 16  ? -19.920 -11.818 -2.032  1.00 10.00 ? 16  PRO A CG   5  
ATOM   9079  C  CD   . PRO A 1 16  ? -20.562 -12.956 -1.235  1.00 10.00 ? 16  PRO A CD   5  
ATOM   9080  H  HA   . PRO A 1 16  ? -21.459 -13.775 -4.205  1.00 10.00 ? 16  PRO A HA   5  
ATOM   9081  H  HB2  . PRO A 1 16  ? -19.868 -11.559 -4.206  1.00 10.00 ? 16  PRO A HB2  5  
ATOM   9082  H  HB3  . PRO A 1 16  ? -21.497 -11.564 -3.470  1.00 10.00 ? 16  PRO A HB3  5  
ATOM   9083  H  HG2  . PRO A 1 16  ? -18.840 -11.967 -2.068  1.00 10.00 ? 16  PRO A HG2  5  
ATOM   9084  H  HG3  . PRO A 1 16  ? -20.150 -10.837 -1.614  1.00 10.00 ? 16  PRO A HG3  5  
ATOM   9085  H  HD2  . PRO A 1 16  ? -19.866 -13.285 -0.462  1.00 10.00 ? 16  PRO A HD2  5  
ATOM   9086  H  HD3  . PRO A 1 16  ? -21.494 -12.615 -0.784  1.00 10.00 ? 16  PRO A HD3  5  
ATOM   9087  N  N    . ALA A 1 17  ? -19.191 -14.091 -5.462  1.00 10.00 ? 17  ALA A N    5  
ATOM   9088  C  CA   . ALA A 1 17  ? -18.032 -14.568 -6.201  1.00 10.00 ? 17  ALA A CA   5  
ATOM   9089  C  C    . ALA A 1 17  ? -18.047 -13.878 -7.565  1.00 10.00 ? 17  ALA A C    5  
ATOM   9090  O  O    . ALA A 1 17  ? -19.023 -13.202 -7.890  1.00 10.00 ? 17  ALA A O    5  
ATOM   9091  C  CB   . ALA A 1 17  ? -18.096 -16.093 -6.345  1.00 10.00 ? 17  ALA A CB   5  
ATOM   9092  H  H    . ALA A 1 17  ? -19.884 -13.616 -6.029  1.00 10.00 ? 17  ALA A H    5  
ATOM   9093  H  HA   . ALA A 1 17  ? -17.120 -14.290 -5.670  1.00 10.00 ? 17  ALA A HA   5  
ATOM   9094  H  HB1  . ALA A 1 17  ? -17.229 -16.452 -6.901  1.00 10.00 ? 17  ALA A HB1  5  
ATOM   9095  H  HB2  . ALA A 1 17  ? -18.098 -16.560 -5.360  1.00 10.00 ? 17  ALA A HB2  5  
ATOM   9096  H  HB3  . ALA A 1 17  ? -19.004 -16.378 -6.878  1.00 10.00 ? 17  ALA A HB3  5  
ATOM   9097  N  N    . ALA A 1 18  ? -16.984 -14.038 -8.358  1.00 10.00 ? 18  ALA A N    5  
ATOM   9098  C  CA   . ALA A 1 18  ? -16.864 -13.447 -9.682  1.00 10.00 ? 18  ALA A CA   5  
ATOM   9099  C  C    . ALA A 1 18  ? -15.826 -14.233 -10.480 1.00 10.00 ? 18  ALA A C    5  
ATOM   9100  O  O    . ALA A 1 18  ? -15.076 -15.022 -9.905  1.00 10.00 ? 18  ALA A O    5  
ATOM   9101  C  CB   . ALA A 1 18  ? -16.456 -11.974 -9.561  1.00 10.00 ? 18  ALA A CB   5  
ATOM   9102  H  H    . ALA A 1 18  ? -16.218 -14.637 -8.077  1.00 10.00 ? 18  ALA A H    5  
ATOM   9103  H  HA   . ALA A 1 18  ? -17.825 -13.513 -10.197 1.00 10.00 ? 18  ALA A HA   5  
ATOM   9104  H  HB1  . ALA A 1 18  ? -16.368 -11.529 -10.552 1.00 10.00 ? 18  ALA A HB1  5  
ATOM   9105  H  HB2  . ALA A 1 18  ? -17.207 -11.422 -8.995  1.00 10.00 ? 18  ALA A HB2  5  
ATOM   9106  H  HB3  . ALA A 1 18  ? -15.495 -11.897 -9.051  1.00 10.00 ? 18  ALA A HB3  5  
ATOM   9107  N  N    . GLN A 1 19  ? -15.793 -14.016 -11.798 1.00 10.00 ? 19  GLN A N    5  
ATOM   9108  C  CA   . GLN A 1 19  ? -14.773 -14.574 -12.678 1.00 10.00 ? 19  GLN A CA   5  
ATOM   9109  C  C    . GLN A 1 19  ? -13.471 -13.768 -12.564 1.00 10.00 ? 19  GLN A C    5  
ATOM   9110  O  O    . GLN A 1 19  ? -13.354 -12.883 -11.719 1.00 10.00 ? 19  GLN A O    5  
ATOM   9111  C  CB   . GLN A 1 19  ? -15.314 -14.660 -14.115 1.00 10.00 ? 19  GLN A CB   5  
ATOM   9112  C  CG   . GLN A 1 19  ? -15.589 -13.292 -14.762 1.00 10.00 ? 19  GLN A CG   5  
ATOM   9113  C  CD   . GLN A 1 19  ? -16.144 -13.430 -16.179 1.00 10.00 ? 19  GLN A CD   5  
ATOM   9114  O  OE1  . GLN A 1 19  ? -16.207 -14.522 -16.734 1.00 10.00 ? 19  GLN A OE1  5  
ATOM   9115  N  NE2  . GLN A 1 19  ? -16.558 -12.320 -16.781 1.00 10.00 ? 19  GLN A NE2  5  
ATOM   9116  H  H    . GLN A 1 19  ? -16.432 -13.339 -12.182 1.00 10.00 ? 19  GLN A H    5  
ATOM   9117  H  HA   . GLN A 1 19  ? -14.557 -15.594 -12.356 1.00 10.00 ? 19  GLN A HA   5  
ATOM   9118  H  HB2  . GLN A 1 19  ? -14.601 -15.206 -14.734 1.00 10.00 ? 19  GLN A HB2  5  
ATOM   9119  H  HB3  . GLN A 1 19  ? -16.244 -15.232 -14.098 1.00 10.00 ? 19  GLN A HB3  5  
ATOM   9120  H  HG2  . GLN A 1 19  ? -16.315 -12.741 -14.165 1.00 10.00 ? 19  GLN A HG2  5  
ATOM   9121  H  HG3  . GLN A 1 19  ? -14.665 -12.716 -14.816 1.00 10.00 ? 19  GLN A HG3  5  
ATOM   9122  H  HE21 . GLN A 1 19  ? -16.501 -11.426 -16.319 1.00 10.00 ? 19  GLN A HE21 5  
ATOM   9123  H  HE22 . GLN A 1 19  ? -16.930 -12.398 -17.716 1.00 10.00 ? 19  GLN A HE22 5  
ATOM   9124  N  N    . LYS A 1 20  ? -12.492 -14.065 -13.423 1.00 10.00 ? 20  LYS A N    5  
ATOM   9125  C  CA   . LYS A 1 20  ? -11.192 -13.411 -13.441 1.00 10.00 ? 20  LYS A CA   5  
ATOM   9126  C  C    . LYS A 1 20  ? -10.593 -13.562 -14.841 1.00 10.00 ? 20  LYS A C    5  
ATOM   9127  O  O    . LYS A 1 20  ? -11.160 -14.273 -15.670 1.00 10.00 ? 20  LYS A O    5  
ATOM   9128  C  CB   . LYS A 1 20  ? -10.288 -14.015 -12.352 1.00 10.00 ? 20  LYS A CB   5  
ATOM   9129  C  CG   . LYS A 1 20  ? -10.131 -15.538 -12.481 1.00 10.00 ? 20  LYS A CG   5  
ATOM   9130  C  CD   . LYS A 1 20  ? -9.217  -16.075 -11.373 1.00 10.00 ? 20  LYS A CD   5  
ATOM   9131  C  CE   . LYS A 1 20  ? -9.079  -17.601 -11.488 1.00 10.00 ? 20  LYS A CE   5  
ATOM   9132  N  NZ   . LYS A 1 20  ? -8.219  -18.167 -10.427 1.00 10.00 ? 20  LYS A NZ   5  
ATOM   9133  H  H    . LYS A 1 20  ? -12.649 -14.730 -14.168 1.00 10.00 ? 20  LYS A H    5  
ATOM   9134  H  HA   . LYS A 1 20  ? -11.320 -12.345 -13.246 1.00 10.00 ? 20  LYS A HA   5  
ATOM   9135  H  HB2  . LYS A 1 20  ? -9.305  -13.544 -12.401 1.00 10.00 ? 20  LYS A HB2  5  
ATOM   9136  H  HB3  . LYS A 1 20  ? -10.722 -13.787 -11.377 1.00 10.00 ? 20  LYS A HB3  5  
ATOM   9137  H  HG2  . LYS A 1 20  ? -11.111 -16.011 -12.395 1.00 10.00 ? 20  LYS A HG2  5  
ATOM   9138  H  HG3  . LYS A 1 20  ? -9.708  -15.783 -13.457 1.00 10.00 ? 20  LYS A HG3  5  
ATOM   9139  H  HD2  . LYS A 1 20  ? -8.238  -15.598 -11.465 1.00 10.00 ? 20  LYS A HD2  5  
ATOM   9140  H  HD3  . LYS A 1 20  ? -9.651  -15.808 -10.406 1.00 10.00 ? 20  LYS A HD3  5  
ATOM   9141  H  HE2  . LYS A 1 20  ? -10.069 -18.057 -11.418 1.00 10.00 ? 20  LYS A HE2  5  
ATOM   9142  H  HE3  . LYS A 1 20  ? -8.652  -17.851 -12.462 1.00 10.00 ? 20  LYS A HE3  5  
ATOM   9143  H  HZ1  . LYS A 1 20  ? -8.608  -17.967 -9.515  1.00 10.00 ? 20  LYS A HZ1  5  
ATOM   9144  H  HZ2  . LYS A 1 20  ? -8.156  -19.170 -10.538 1.00 10.00 ? 20  LYS A HZ2  5  
ATOM   9145  H  HZ3  . LYS A 1 20  ? -7.288  -17.776 -10.482 1.00 10.00 ? 20  LYS A HZ3  5  
ATOM   9146  N  N    . ALA A 1 21  ? -9.444  -12.923 -15.081 1.00 10.00 ? 21  ALA A N    5  
ATOM   9147  C  CA   . ALA A 1 21  ? -8.760  -12.912 -16.369 1.00 10.00 ? 21  ALA A CA   5  
ATOM   9148  C  C    . ALA A 1 21  ? -9.650  -12.278 -17.447 1.00 10.00 ? 21  ALA A C    5  
ATOM   9149  O  O    . ALA A 1 21  ? -10.393 -11.341 -17.153 1.00 10.00 ? 21  ALA A O    5  
ATOM   9150  C  CB   . ALA A 1 21  ? -8.246  -14.317 -16.718 1.00 10.00 ? 21  ALA A CB   5  
ATOM   9151  H  H    . ALA A 1 21  ? -9.067  -12.337 -14.353 1.00 10.00 ? 21  ALA A H    5  
ATOM   9152  H  HA   . ALA A 1 21  ? -7.887  -12.267 -16.260 1.00 10.00 ? 21  ALA A HA   5  
ATOM   9153  H  HB1  . ALA A 1 21  ? -9.071  -14.983 -16.975 1.00 10.00 ? 21  ALA A HB1  5  
ATOM   9154  H  HB2  . ALA A 1 21  ? -7.555  -14.264 -17.560 1.00 10.00 ? 21  ALA A HB2  5  
ATOM   9155  H  HB3  . ALA A 1 21  ? -7.709  -14.732 -15.865 1.00 10.00 ? 21  ALA A HB3  5  
ATOM   9156  N  N    . GLY A 1 22  ? -9.559  -12.740 -18.698 1.00 10.00 ? 22  GLY A N    5  
ATOM   9157  C  CA   . GLY A 1 22  ? -10.315 -12.187 -19.815 1.00 10.00 ? 22  GLY A CA   5  
ATOM   9158  C  C    . GLY A 1 22  ? -9.731  -10.849 -20.271 1.00 10.00 ? 22  GLY A C    5  
ATOM   9159  O  O    . GLY A 1 22  ? -9.258  -10.724 -21.398 1.00 10.00 ? 22  GLY A O    5  
ATOM   9160  H  H    . GLY A 1 22  ? -8.932  -13.504 -18.895 1.00 10.00 ? 22  GLY A H    5  
ATOM   9161  H  HA2  . GLY A 1 22  ? -10.276 -12.894 -20.644 1.00 10.00 ? 22  GLY A HA2  5  
ATOM   9162  H  HA3  . GLY A 1 22  ? -11.360 -12.050 -19.530 1.00 10.00 ? 22  GLY A HA3  5  
ATOM   9163  N  N    . ALA A 1 23  ? -9.754  -9.845  -19.392 1.00 10.00 ? 23  ALA A N    5  
ATOM   9164  C  CA   . ALA A 1 23  ? -9.187  -8.533  -19.659 1.00 10.00 ? 23  ALA A CA   5  
ATOM   9165  C  C    . ALA A 1 23  ? -7.664  -8.635  -19.784 1.00 10.00 ? 23  ALA A C    5  
ATOM   9166  O  O    . ALA A 1 23  ? -6.956  -8.639  -18.779 1.00 10.00 ? 23  ALA A O    5  
ATOM   9167  C  CB   . ALA A 1 23  ? -9.594  -7.567  -18.542 1.00 10.00 ? 23  ALA A CB   5  
ATOM   9168  H  H    . ALA A 1 23  ? -10.130 -10.037 -18.469 1.00 10.00 ? 23  ALA A H    5  
ATOM   9169  H  HA   . ALA A 1 23  ? -9.601  -8.150  -20.593 1.00 10.00 ? 23  ALA A HA   5  
ATOM   9170  H  HB1  . ALA A 1 23  ? -9.167  -6.583  -18.736 1.00 10.00 ? 23  ALA A HB1  5  
ATOM   9171  H  HB2  . ALA A 1 23  ? -10.681 -7.481  -18.507 1.00 10.00 ? 23  ALA A HB2  5  
ATOM   9172  H  HB3  . ALA A 1 23  ? -9.233  -7.929  -17.578 1.00 10.00 ? 23  ALA A HB3  5  
ATOM   9173  N  N    . GLN A 1 24  ? -7.155  -8.718  -21.017 1.00 10.00 ? 24  GLN A N    5  
ATOM   9174  C  CA   . GLN A 1 24  ? -5.725  -8.777  -21.294 1.00 10.00 ? 24  GLN A CA   5  
ATOM   9175  C  C    . GLN A 1 24  ? -5.059  -7.427  -21.021 1.00 10.00 ? 24  GLN A C    5  
ATOM   9176  O  O    . GLN A 1 24  ? -4.709  -6.691  -21.940 1.00 10.00 ? 24  GLN A O    5  
ATOM   9177  C  CB   . GLN A 1 24  ? -5.474  -9.269  -22.727 1.00 10.00 ? 24  GLN A CB   5  
ATOM   9178  C  CG   . GLN A 1 24  ? -6.006  -10.692 -22.944 1.00 10.00 ? 24  GLN A CG   5  
ATOM   9179  C  CD   . GLN A 1 24  ? -5.666  -11.214 -24.336 1.00 10.00 ? 24  GLN A CD   5  
ATOM   9180  O  OE1  . GLN A 1 24  ? -6.543  -11.402 -25.170 1.00 10.00 ? 24  GLN A OE1  5  
ATOM   9181  N  NE2  . GLN A 1 24  ? -4.385  -11.457 -24.602 1.00 10.00 ? 24  GLN A NE2  5  
ATOM   9182  H  H    . GLN A 1 24  ? -7.800  -8.799  -21.791 1.00 10.00 ? 24  GLN A H    5  
ATOM   9183  H  HA   . GLN A 1 24  ? -5.266  -9.479  -20.599 1.00 10.00 ? 24  GLN A HA   5  
ATOM   9184  H  HB2  . GLN A 1 24  ? -5.952  -8.593  -23.439 1.00 10.00 ? 24  GLN A HB2  5  
ATOM   9185  H  HB3  . GLN A 1 24  ? -4.399  -9.261  -22.909 1.00 10.00 ? 24  GLN A HB3  5  
ATOM   9186  H  HG2  . GLN A 1 24  ? -5.578  -11.364 -22.200 1.00 10.00 ? 24  GLN A HG2  5  
ATOM   9187  H  HG3  . GLN A 1 24  ? -7.090  -10.700 -22.834 1.00 10.00 ? 24  GLN A HG3  5  
ATOM   9188  H  HE21 . GLN A 1 24  ? -3.675  -11.292 -23.907 1.00 10.00 ? 24  GLN A HE21 5  
ATOM   9189  H  HE22 . GLN A 1 24  ? -4.147  -11.801 -25.520 1.00 10.00 ? 24  GLN A HE22 5  
ATOM   9190  N  N    . ALA A 1 25  ? -4.878  -7.126  -19.737 1.00 10.00 ? 25  ALA A N    5  
ATOM   9191  C  CA   . ALA A 1 25  ? -4.263  -5.922  -19.213 1.00 10.00 ? 25  ALA A CA   5  
ATOM   9192  C  C    . ALA A 1 25  ? -3.784  -6.251  -17.798 1.00 10.00 ? 25  ALA A C    5  
ATOM   9193  O  O    . ALA A 1 25  ? -4.079  -7.339  -17.302 1.00 10.00 ? 25  ALA A O    5  
ATOM   9194  C  CB   . ALA A 1 25  ? -5.315  -4.816  -19.212 1.00 10.00 ? 25  ALA A CB   5  
ATOM   9195  H  H    . ALA A 1 25  ? -5.232  -7.776  -19.036 1.00 10.00 ? 25  ALA A H    5  
ATOM   9196  H  HA   . ALA A 1 25  ? -3.412  -5.630  -19.830 1.00 10.00 ? 25  ALA A HA   5  
ATOM   9197  H  HB1  . ALA A 1 25  ? -6.160  -5.129  -18.597 1.00 10.00 ? 25  ALA A HB1  5  
ATOM   9198  H  HB2  . ALA A 1 25  ? -4.894  -3.891  -18.822 1.00 10.00 ? 25  ALA A HB2  5  
ATOM   9199  H  HB3  . ALA A 1 25  ? -5.662  -4.656  -20.233 1.00 10.00 ? 25  ALA A HB3  5  
ATOM   9200  N  N    . LEU A 1 26  ? -3.048  -5.346  -17.145 1.00 10.00 ? 26  LEU A N    5  
ATOM   9201  C  CA   . LEU A 1 26  ? -2.550  -5.579  -15.792 1.00 10.00 ? 26  LEU A CA   5  
ATOM   9202  C  C    . LEU A 1 26  ? -2.588  -4.271  -14.994 1.00 10.00 ? 26  LEU A C    5  
ATOM   9203  O  O    . LEU A 1 26  ? -2.119  -3.241  -15.486 1.00 10.00 ? 26  LEU A O    5  
ATOM   9204  C  CB   . LEU A 1 26  ? -1.172  -6.257  -15.858 1.00 10.00 ? 26  LEU A CB   5  
ATOM   9205  C  CG   . LEU A 1 26  ? -0.357  -6.210  -14.554 1.00 10.00 ? 26  LEU A CG   5  
ATOM   9206  C  CD1  . LEU A 1 26  ? 0.410   -7.522  -14.389 1.00 10.00 ? 26  LEU A CD1  5  
ATOM   9207  C  CD2  . LEU A 1 26  ? 0.630   -5.037  -14.547 1.00 10.00 ? 26  LEU A CD2  5  
ATOM   9208  H  H    . LEU A 1 26  ? -2.842  -4.450  -17.583 1.00 10.00 ? 26  LEU A H    5  
ATOM   9209  H  HA   . LEU A 1 26  ? -3.209  -6.298  -15.311 1.00 10.00 ? 26  LEU A HA   5  
ATOM   9210  H  HB2  . LEU A 1 26  ? -1.361  -7.299  -16.119 1.00 10.00 ? 26  LEU A HB2  5  
ATOM   9211  H  HB3  . LEU A 1 26  ? -0.575  -5.842  -16.663 1.00 10.00 ? 26  LEU A HB3  5  
ATOM   9212  H  HG   . LEU A 1 26  ? -1.005  -6.112  -13.688 1.00 10.00 ? 26  LEU A HG   5  
ATOM   9213  H  HD11 . LEU A 1 26  ? 0.955   -7.504  -13.449 1.00 10.00 ? 26  LEU A HD11 5  
ATOM   9214  H  HD12 . LEU A 1 26  ? -0.290  -8.357  -14.361 1.00 10.00 ? 26  LEU A HD12 5  
ATOM   9215  H  HD13 . LEU A 1 26  ? 1.109   -7.658  -15.214 1.00 10.00 ? 26  LEU A HD13 5  
ATOM   9216  H  HD21 . LEU A 1 26  ? 1.418   -5.198  -15.282 1.00 10.00 ? 26  LEU A HD21 5  
ATOM   9217  H  HD22 . LEU A 1 26  ? 0.132   -4.096  -14.765 1.00 10.00 ? 26  LEU A HD22 5  
ATOM   9218  H  HD23 . LEU A 1 26  ? 1.067   -4.956  -13.554 1.00 10.00 ? 26  LEU A HD23 5  
ATOM   9219  N  N    . PRO A 1 27  ? -3.183  -4.275  -13.788 1.00 10.00 ? 27  PRO A N    5  
ATOM   9220  C  CA   . PRO A 1 27  ? -3.311  -3.082  -12.976 1.00 10.00 ? 27  PRO A CA   5  
ATOM   9221  C  C    . PRO A 1 27  ? -1.977  -2.780  -12.292 1.00 10.00 ? 27  PRO A C    5  
ATOM   9222  O  O    . PRO A 1 27  ? -1.014  -3.538  -12.400 1.00 10.00 ? 27  PRO A O    5  
ATOM   9223  C  CB   . PRO A 1 27  ? -4.415  -3.410  -11.967 1.00 10.00 ? 27  PRO A CB   5  
ATOM   9224  C  CG   . PRO A 1 27  ? -4.223  -4.909  -11.733 1.00 10.00 ? 27  PRO A CG   5  
ATOM   9225  C  CD   . PRO A 1 27  ? -3.761  -5.422  -13.097 1.00 10.00 ? 27  PRO A CD   5  
ATOM   9226  H  HA   . PRO A 1 27  ? -3.608  -2.225  -13.584 1.00 10.00 ? 27  PRO A HA   5  
ATOM   9227  H  HB2  . PRO A 1 27  ? -4.348  -2.829  -11.048 1.00 10.00 ? 27  PRO A HB2  5  
ATOM   9228  H  HB3  . PRO A 1 27  ? -5.385  -3.245  -12.440 1.00 10.00 ? 27  PRO A HB3  5  
ATOM   9229  H  HG2  . PRO A 1 27  ? -3.426  -5.072  -11.009 1.00 10.00 ? 27  PRO A HG2  5  
ATOM   9230  H  HG3  . PRO A 1 27  ? -5.140  -5.399  -11.407 1.00 10.00 ? 27  PRO A HG3  5  
ATOM   9231  H  HD2  . PRO A 1 27  ? -3.028  -6.219  -12.946 1.00 10.00 ? 27  PRO A HD2  5  
ATOM   9232  H  HD3  . PRO A 1 27  ? -4.625  -5.791  -13.651 1.00 10.00 ? 27  PRO A HD3  5  
ATOM   9233  N  N    . VAL A 1 28  ? -1.928  -1.676  -11.549 1.00 10.00 ? 28  VAL A N    5  
ATOM   9234  C  CA   . VAL A 1 28  ? -0.681  -1.099  -11.072 1.00 10.00 ? 28  VAL A CA   5  
ATOM   9235  C  C    . VAL A 1 28  ? -0.184  -1.798  -9.802  1.00 10.00 ? 28  VAL A C    5  
ATOM   9236  O  O    . VAL A 1 28  ? -0.054  -1.205  -8.736  1.00 10.00 ? 28  VAL A O    5  
ATOM   9237  C  CB   . VAL A 1 28  ? -0.869  0.423   -10.943 1.00 10.00 ? 28  VAL A CB   5  
ATOM   9238  C  CG1  . VAL A 1 28  ? -1.762  0.902   -9.789  1.00 10.00 ? 28  VAL A CG1  5  
ATOM   9239  C  CG2  . VAL A 1 28  ? 0.491   1.103   -10.900 1.00 10.00 ? 28  VAL A CG2  5  
ATOM   9240  H  H    . VAL A 1 28  ? -2.754  -1.105  -11.509 1.00 10.00 ? 28  VAL A H    5  
ATOM   9241  H  HA   . VAL A 1 28  ? 0.073   -1.278  -11.840 1.00 10.00 ? 28  VAL A HA   5  
ATOM   9242  H  HB   . VAL A 1 28  ? -1.363  0.766   -11.843 1.00 10.00 ? 28  VAL A HB   5  
ATOM   9243  H  HG11 . VAL A 1 28  ? -2.686  0.326   -9.768  1.00 10.00 ? 28  VAL A HG11 5  
ATOM   9244  H  HG12 . VAL A 1 28  ? -1.265  0.829   -8.824  1.00 10.00 ? 28  VAL A HG12 5  
ATOM   9245  H  HG13 . VAL A 1 28  ? -1.998  1.953   -9.948  1.00 10.00 ? 28  VAL A HG13 5  
ATOM   9246  H  HG21 . VAL A 1 28  ? 1.046   0.907   -11.812 1.00 10.00 ? 28  VAL A HG21 5  
ATOM   9247  H  HG22 . VAL A 1 28  ? 0.357   2.178   -10.780 1.00 10.00 ? 28  VAL A HG22 5  
ATOM   9248  H  HG23 . VAL A 1 28  ? 1.061   0.687   -10.080 1.00 10.00 ? 28  VAL A HG23 5  
ATOM   9249  N  N    . THR A 1 29  ? 0.090   -3.094  -9.914  1.00 10.00 ? 29  THR A N    5  
ATOM   9250  C  CA   . THR A 1 29  ? 0.549   -3.902  -8.799  1.00 10.00 ? 29  THR A CA   5  
ATOM   9251  C  C    . THR A 1 29  ? 1.270   -5.127  -9.354  1.00 10.00 ? 29  THR A C    5  
ATOM   9252  O  O    . THR A 1 29  ? 0.738   -6.235  -9.359  1.00 10.00 ? 29  THR A O    5  
ATOM   9253  C  CB   . THR A 1 29  ? -0.616  -4.189  -7.830  1.00 10.00 ? 29  THR A CB   5  
ATOM   9254  O  OG1  . THR A 1 29  ? -0.195  -5.032  -6.777  1.00 10.00 ? 29  THR A OG1  5  
ATOM   9255  C  CG2  . THR A 1 29  ? -1.861  -4.764  -8.518  1.00 10.00 ? 29  THR A CG2  5  
ATOM   9256  H  H    . THR A 1 29  ? -0.012  -3.529  -10.828 1.00 10.00 ? 29  THR A H    5  
ATOM   9257  H  HA   . THR A 1 29  ? 1.293   -3.336  -8.233  1.00 10.00 ? 29  THR A HA   5  
ATOM   9258  H  HB   . THR A 1 29  ? -0.909  -3.242  -7.373  1.00 10.00 ? 29  THR A HB   5  
ATOM   9259  H  HG1  . THR A 1 29  ? -0.927  -5.186  -6.176  1.00 10.00 ? 29  THR A HG1  5  
ATOM   9260  H  HG21 . THR A 1 29  ? -2.645  -4.920  -7.782  1.00 10.00 ? 29  THR A HG21 5  
ATOM   9261  H  HG22 . THR A 1 29  ? -2.222  -4.064  -9.269  1.00 10.00 ? 29  THR A HG22 5  
ATOM   9262  H  HG23 . THR A 1 29  ? -1.637  -5.718  -8.994  1.00 10.00 ? 29  THR A HG23 5  
ATOM   9263  N  N    . VAL A 1 30  ? 2.493   -4.922  -9.851  1.00 10.00 ? 30  VAL A N    5  
ATOM   9264  C  CA   . VAL A 1 30  ? 3.354   -6.033  -10.226 1.00 10.00 ? 30  VAL A CA   5  
ATOM   9265  C  C    . VAL A 1 30  ? 4.804   -5.734  -9.840  1.00 10.00 ? 30  VAL A C    5  
ATOM   9266  O  O    . VAL A 1 30  ? 5.736   -5.907  -10.619 1.00 10.00 ? 30  VAL A O    5  
ATOM   9267  C  CB   . VAL A 1 30  ? 3.098   -6.399  -11.704 1.00 10.00 ? 30  VAL A CB   5  
ATOM   9268  C  CG1  . VAL A 1 30  ? 3.573   -5.325  -12.693 1.00 10.00 ? 30  VAL A CG1  5  
ATOM   9269  C  CG2  . VAL A 1 30  ? 3.693   -7.766  -12.073 1.00 10.00 ? 30  VAL A CG2  5  
ATOM   9270  H  H    . VAL A 1 30  ? 2.864   -3.986  -9.896  1.00 10.00 ? 30  VAL A H    5  
ATOM   9271  H  HA   . VAL A 1 30  ? 3.086   -6.894  -9.617  1.00 10.00 ? 30  VAL A HA   5  
ATOM   9272  H  HB   . VAL A 1 30  ? 2.011   -6.482  -11.820 1.00 10.00 ? 30  VAL A HB   5  
ATOM   9273  H  HG11 . VAL A 1 30  ? 4.653   -5.192  -12.661 1.00 10.00 ? 30  VAL A HG11 5  
ATOM   9274  H  HG12 . VAL A 1 30  ? 3.308   -5.624  -13.706 1.00 10.00 ? 30  VAL A HG12 5  
ATOM   9275  H  HG13 . VAL A 1 30  ? 3.087   -4.377  -12.464 1.00 10.00 ? 30  VAL A HG13 5  
ATOM   9276  H  HG21 . VAL A 1 30  ? 3.317   -8.528  -11.389 1.00 10.00 ? 30  VAL A HG21 5  
ATOM   9277  H  HG22 . VAL A 1 30  ? 3.396   -8.030  -13.088 1.00 10.00 ? 30  VAL A HG22 5  
ATOM   9278  H  HG23 . VAL A 1 30  ? 4.781   -7.746  -12.024 1.00 10.00 ? 30  VAL A HG23 5  
ATOM   9279  N  N    . GLN A 1 31  ? 4.999   -5.391  -8.565  1.00 10.00 ? 31  GLN A N    5  
ATOM   9280  C  CA   . GLN A 1 31  ? 6.302   -5.406  -7.921  1.00 10.00 ? 31  GLN A CA   5  
ATOM   9281  C  C    . GLN A 1 31  ? 6.086   -5.637  -6.425  1.00 10.00 ? 31  GLN A C    5  
ATOM   9282  O  O    . GLN A 1 31  ? 5.153   -5.088  -5.844  1.00 10.00 ? 31  GLN A O    5  
ATOM   9283  C  CB   . GLN A 1 31  ? 7.020   -4.087  -8.224  1.00 10.00 ? 31  GLN A CB   5  
ATOM   9284  C  CG   . GLN A 1 31  ? 8.325   -3.880  -7.443  1.00 10.00 ? 31  GLN A CG   5  
ATOM   9285  C  CD   . GLN A 1 31  ? 9.329   -5.011  -7.642  1.00 10.00 ? 31  GLN A CD   5  
ATOM   9286  O  OE1  . GLN A 1 31  ? 9.701   -5.333  -8.764  1.00 10.00 ? 31  GLN A OE1  5  
ATOM   9287  N  NE2  . GLN A 1 31  ? 9.770   -5.635  -6.555  1.00 10.00 ? 31  GLN A NE2  5  
ATOM   9288  H  H    . GLN A 1 31  ? 4.210   -5.111  -7.993  1.00 10.00 ? 31  GLN A H    5  
ATOM   9289  H  HA   . GLN A 1 31  ? 6.887   -6.234  -8.325  1.00 10.00 ? 31  GLN A HA   5  
ATOM   9290  H  HB2  . GLN A 1 31  ? 7.239   -4.044  -9.292  1.00 10.00 ? 31  GLN A HB2  5  
ATOM   9291  H  HB3  . GLN A 1 31  ? 6.336   -3.278  -7.979  1.00 10.00 ? 31  GLN A HB3  5  
ATOM   9292  H  HG2  . GLN A 1 31  ? 8.797   -2.962  -7.781  1.00 10.00 ? 31  GLN A HG2  5  
ATOM   9293  H  HG3  . GLN A 1 31  ? 8.087   -3.762  -6.390  1.00 10.00 ? 31  GLN A HG3  5  
ATOM   9294  H  HE21 . GLN A 1 31  ? 9.457   -5.332  -5.634  1.00 10.00 ? 31  GLN A HE21 5  
ATOM   9295  H  HE22 . GLN A 1 31  ? 10.459  -6.364  -6.660  1.00 10.00 ? 31  GLN A HE22 5  
ATOM   9296  N  N    . GLY A 1 32  ? 6.937   -6.464  -5.813  1.00 10.00 ? 32  GLY A N    5  
ATOM   9297  C  CA   . GLY A 1 32  ? 6.935   -6.700  -4.378  1.00 10.00 ? 32  GLY A CA   5  
ATOM   9298  C  C    . GLY A 1 32  ? 7.558   -5.513  -3.651  1.00 10.00 ? 32  GLY A C    5  
ATOM   9299  O  O    . GLY A 1 32  ? 8.465   -4.871  -4.186  1.00 10.00 ? 32  GLY A O    5  
ATOM   9300  H  H    . GLY A 1 32  ? 7.697   -6.858  -6.348  1.00 10.00 ? 32  GLY A H    5  
ATOM   9301  H  HA2  . GLY A 1 32  ? 5.920   -6.885  -4.022  1.00 10.00 ? 32  GLY A HA2  5  
ATOM   9302  H  HA3  . GLY A 1 32  ? 7.555   -7.569  -4.180  1.00 10.00 ? 32  GLY A HA3  5  
ATOM   9303  N  N    . ALA A 1 33  ? 7.093   -5.214  -2.439  1.00 10.00 ? 33  ALA A N    5  
ATOM   9304  C  CA   . ALA A 1 33  ? 7.589   -4.067  -1.700  1.00 10.00 ? 33  ALA A CA   5  
ATOM   9305  C  C    . ALA A 1 33  ? 8.923   -4.399  -1.031  1.00 10.00 ? 33  ALA A C    5  
ATOM   9306  O  O    . ALA A 1 33  ? 9.195   -5.554  -0.694  1.00 10.00 ? 33  ALA A O    5  
ATOM   9307  C  CB   . ALA A 1 33  ? 6.533   -3.600  -0.696  1.00 10.00 ? 33  ALA A CB   5  
ATOM   9308  H  H    . ALA A 1 33  ? 6.460   -5.854  -1.966  1.00 10.00 ? 33  ALA A H    5  
ATOM   9309  H  HA   . ALA A 1 33  ? 7.746   -3.243  -2.394  1.00 10.00 ? 33  ALA A HA   5  
ATOM   9310  H  HB1  . ALA A 1 33  ? 5.629   -3.303  -1.225  1.00 10.00 ? 33  ALA A HB1  5  
ATOM   9311  H  HB2  . ALA A 1 33  ? 6.274   -4.401  -0.009  1.00 10.00 ? 33  ALA A HB2  5  
ATOM   9312  H  HB3  . ALA A 1 33  ? 6.906   -2.747  -0.129  1.00 10.00 ? 33  ALA A HB3  5  
ATOM   9313  N  N    . THR A 1 34  ? 9.757   -3.381  -0.814  1.00 10.00 ? 34  THR A N    5  
ATOM   9314  C  CA   . THR A 1 34  ? 10.959  -3.503  -0.011  1.00 10.00 ? 34  THR A CA   5  
ATOM   9315  C  C    . THR A 1 34  ? 10.981  -2.299  0.937   1.00 10.00 ? 34  THR A C    5  
ATOM   9316  O  O    . THR A 1 34  ? 10.823  -1.178  0.457   1.00 10.00 ? 34  THR A O    5  
ATOM   9317  C  CB   . THR A 1 34  ? 12.205  -3.626  -0.910  1.00 10.00 ? 34  THR A CB   5  
ATOM   9318  O  OG1  . THR A 1 34  ? 12.681  -2.374  -1.334  1.00 10.00 ? 34  THR A OG1  5  
ATOM   9319  C  CG2  . THR A 1 34  ? 11.992  -4.463  -2.179  1.00 10.00 ? 34  THR A CG2  5  
ATOM   9320  H  H    . THR A 1 34  ? 9.522   -2.449  -1.123  1.00 10.00 ? 34  THR A H    5  
ATOM   9321  H  HA   . THR A 1 34  ? 10.899  -4.409  0.582   1.00 10.00 ? 34  THR A HA   5  
ATOM   9322  H  HB   . THR A 1 34  ? 12.993  -4.083  -0.311  1.00 10.00 ? 34  THR A HB   5  
ATOM   9323  H  HG1  . THR A 1 34  ? 12.011  -1.939  -1.881  1.00 10.00 ? 34  THR A HG1  5  
ATOM   9324  H  HG21 . THR A 1 34  ? 11.579  -5.441  -1.942  1.00 10.00 ? 34  THR A HG21 5  
ATOM   9325  H  HG22 . THR A 1 34  ? 11.311  -3.951  -2.862  1.00 10.00 ? 34  THR A HG22 5  
ATOM   9326  H  HG23 . THR A 1 34  ? 12.949  -4.596  -2.684  1.00 10.00 ? 34  THR A HG23 5  
ATOM   9327  N  N    . VAL A 1 35  ? 11.096  -2.513  2.256   1.00 10.00 ? 35  VAL A N    5  
ATOM   9328  C  CA   . VAL A 1 35  ? 11.100  -1.457  3.268   1.00 10.00 ? 35  VAL A CA   5  
ATOM   9329  C  C    . VAL A 1 35  ? 12.466  -1.383  3.939   1.00 10.00 ? 35  VAL A C    5  
ATOM   9330  O  O    . VAL A 1 35  ? 13.061  -2.421  4.224   1.00 10.00 ? 35  VAL A O    5  
ATOM   9331  C  CB   . VAL A 1 35  ? 9.940   -1.642  4.264   1.00 10.00 ? 35  VAL A CB   5  
ATOM   9332  C  CG1  . VAL A 1 35  ? 10.076  -2.838  5.200   1.00 10.00 ? 35  VAL A CG1  5  
ATOM   9333  C  CG2  . VAL A 1 35  ? 9.735   -0.374  5.104   1.00 10.00 ? 35  VAL A CG2  5  
ATOM   9334  H  H    . VAL A 1 35  ? 11.199  -3.466  2.587   1.00 10.00 ? 35  VAL A H    5  
ATOM   9335  H  HA   . VAL A 1 35  ? 10.940  -0.502  2.787   1.00 10.00 ? 35  VAL A HA   5  
ATOM   9336  H  HB   . VAL A 1 35  ? 9.047   -1.841  3.682   1.00 10.00 ? 35  VAL A HB   5  
ATOM   9337  H  HG11 . VAL A 1 35  ? 10.986  -2.745  5.785   1.00 10.00 ? 35  VAL A HG11 5  
ATOM   9338  H  HG12 . VAL A 1 35  ? 9.223   -2.876  5.878   1.00 10.00 ? 35  VAL A HG12 5  
ATOM   9339  H  HG13 . VAL A 1 35  ? 10.081  -3.754  4.614   1.00 10.00 ? 35  VAL A HG13 5  
ATOM   9340  H  HG21 . VAL A 1 35  ? 10.611  -0.183  5.724   1.00 10.00 ? 35  VAL A HG21 5  
ATOM   9341  H  HG22 . VAL A 1 35  ? 9.566   0.482   4.451   1.00 10.00 ? 35  VAL A HG22 5  
ATOM   9342  H  HG23 . VAL A 1 35  ? 8.867   -0.497  5.753   1.00 10.00 ? 35  VAL A HG23 5  
ATOM   9343  N  N    . ALA A 1 36  ? 12.992  -0.176  4.177   1.00 10.00 ? 36  ALA A N    5  
ATOM   9344  C  CA   . ALA A 1 36  ? 14.338  -0.057  4.718   1.00 10.00 ? 36  ALA A CA   5  
ATOM   9345  C  C    . ALA A 1 36  ? 14.397  -0.468  6.198   1.00 10.00 ? 36  ALA A C    5  
ATOM   9346  O  O    . ALA A 1 36  ? 14.060  0.316   7.080   1.00 10.00 ? 36  ALA A O    5  
ATOM   9347  C  CB   . ALA A 1 36  ? 14.933  1.326   4.428   1.00 10.00 ? 36  ALA A CB   5  
ATOM   9348  H  H    . ALA A 1 36  ? 12.475  0.667   3.931   1.00 10.00 ? 36  ALA A H    5  
ATOM   9349  H  HA   . ALA A 1 36  ? 14.956  -0.751  4.161   1.00 10.00 ? 36  ALA A HA   5  
ATOM   9350  H  HB1  . ALA A 1 36  ? 14.274  2.126   4.748   1.00 10.00 ? 36  ALA A HB1  5  
ATOM   9351  H  HB2  . ALA A 1 36  ? 15.891  1.431   4.938   1.00 10.00 ? 36  ALA A HB2  5  
ATOM   9352  H  HB3  . ALA A 1 36  ? 15.094  1.426   3.354   1.00 10.00 ? 36  ALA A HB3  5  
ATOM   9353  N  N    . ALA A 1 37  ? 14.827  -1.704  6.473   1.00 10.00 ? 37  ALA A N    5  
ATOM   9354  C  CA   . ALA A 1 37  ? 15.097  -2.209  7.820   1.00 10.00 ? 37  ALA A CA   5  
ATOM   9355  C  C    . ALA A 1 37  ? 15.969  -1.232  8.616   1.00 10.00 ? 37  ALA A C    5  
ATOM   9356  O  O    . ALA A 1 37  ? 17.133  -1.063  8.251   1.00 10.00 ? 37  ALA A O    5  
ATOM   9357  C  CB   . ALA A 1 37  ? 15.820  -3.558  7.734   1.00 10.00 ? 37  ALA A CB   5  
ATOM   9358  H  H    . ALA A 1 37  ? 14.908  -2.337  5.692   1.00 10.00 ? 37  ALA A H    5  
ATOM   9359  H  HA   . ALA A 1 37  ? 14.139  -2.355  8.317   1.00 10.00 ? 37  ALA A HA   5  
ATOM   9360  H  HB1  . ALA A 1 37  ? 15.924  -3.981  8.733   1.00 10.00 ? 37  ALA A HB1  5  
ATOM   9361  H  HB2  . ALA A 1 37  ? 15.264  -4.253  7.115   1.00 10.00 ? 37  ALA A HB2  5  
ATOM   9362  H  HB3  . ALA A 1 37  ? 16.812  -3.435  7.303   1.00 10.00 ? 37  ALA A HB3  5  
ATOM   9363  N  N    . VAL A 1 38  ? 15.418  -0.641  9.690   1.00 10.00 ? 38  VAL A N    5  
ATOM   9364  C  CA   . VAL A 1 38  ? 15.930  0.506   10.460  1.00 10.00 ? 38  VAL A CA   5  
ATOM   9365  C  C    . VAL A 1 38  ? 17.228  1.100   9.881   1.00 10.00 ? 38  VAL A C    5  
ATOM   9366  O  O    . VAL A 1 38  ? 18.320  0.597   10.173  1.00 10.00 ? 38  VAL A O    5  
ATOM   9367  C  CB   . VAL A 1 38  ? 16.071  0.175   11.961  1.00 10.00 ? 38  VAL A CB   5  
ATOM   9368  C  CG1  . VAL A 1 38  ? 16.571  1.383   12.761  1.00 10.00 ? 38  VAL A CG1  5  
ATOM   9369  C  CG2  . VAL A 1 38  ? 14.730  -0.206  12.598  1.00 10.00 ? 38  VAL A CG2  5  
ATOM   9370  H  H    . VAL A 1 38  ? 14.482  -0.941  9.919   1.00 10.00 ? 38  VAL A H    5  
ATOM   9371  H  HA   . VAL A 1 38  ? 15.142  1.255   10.421  1.00 10.00 ? 38  VAL A HA   5  
ATOM   9372  H  HB   . VAL A 1 38  ? 16.784  -0.636  12.097  1.00 10.00 ? 38  VAL A HB   5  
ATOM   9373  H  HG11 . VAL A 1 38  ? 15.924  2.239   12.569  1.00 10.00 ? 38  VAL A HG11 5  
ATOM   9374  H  HG12 . VAL A 1 38  ? 16.544  1.145   13.825  1.00 10.00 ? 38  VAL A HG12 5  
ATOM   9375  H  HG13 . VAL A 1 38  ? 17.595  1.637   12.492  1.00 10.00 ? 38  VAL A HG13 5  
ATOM   9376  H  HG21 . VAL A 1 38  ? 14.887  -0.522  13.629  1.00 10.00 ? 38  VAL A HG21 5  
ATOM   9377  H  HG22 . VAL A 1 38  ? 14.065  0.658   12.599  1.00 10.00 ? 38  VAL A HG22 5  
ATOM   9378  H  HG23 . VAL A 1 38  ? 14.264  -1.020  12.057  1.00 10.00 ? 38  VAL A HG23 5  
ATOM   9379  N  N    . PRO A 1 39  ? 17.145  2.141   9.041   1.00 10.00 ? 39  PRO A N    5  
ATOM   9380  C  CA   . PRO A 1 39  ? 18.328  2.814   8.531   1.00 10.00 ? 39  PRO A CA   5  
ATOM   9381  C  C    . PRO A 1 39  ? 18.982  3.590   9.684   1.00 10.00 ? 39  PRO A C    5  
ATOM   9382  O  O    . PRO A 1 39  ? 18.374  3.718   10.748  1.00 10.00 ? 39  PRO A O    5  
ATOM   9383  C  CB   . PRO A 1 39  ? 17.797  3.713   7.411   1.00 10.00 ? 39  PRO A CB   5  
ATOM   9384  C  CG   . PRO A 1 39  ? 16.359  4.029   7.810   1.00 10.00 ? 39  PRO A CG   5  
ATOM   9385  C  CD   . PRO A 1 39  ? 15.927  2.836   8.654   1.00 10.00 ? 39  PRO A CD   5  
ATOM   9386  H  HA   . PRO A 1 39  ? 19.036  2.094   8.121   1.00 10.00 ? 39  PRO A HA   5  
ATOM   9387  H  HB2  . PRO A 1 39  ? 18.383  4.620   7.257   1.00 10.00 ? 39  PRO A HB2  5  
ATOM   9388  H  HB3  . PRO A 1 39  ? 17.753  3.133   6.491   1.00 10.00 ? 39  PRO A HB3  5  
ATOM   9389  H  HG2  . PRO A 1 39  ? 16.332  4.929   8.422   1.00 10.00 ? 39  PRO A HG2  5  
ATOM   9390  H  HG3  . PRO A 1 39  ? 15.722  4.139   6.931   1.00 10.00 ? 39  PRO A HG3  5  
ATOM   9391  H  HD2  . PRO A 1 39  ? 15.377  3.212   9.518   1.00 10.00 ? 39  PRO A HD2  5  
ATOM   9392  H  HD3  . PRO A 1 39  ? 15.296  2.179   8.061   1.00 10.00 ? 39  PRO A HD3  5  
ATOM   9393  N  N    . PRO A 1 40  ? 20.206  4.117   9.521   1.00 10.00 ? 40  PRO A N    5  
ATOM   9394  C  CA   . PRO A 1 40  ? 20.842  4.963   10.524  1.00 10.00 ? 40  PRO A CA   5  
ATOM   9395  C  C    . PRO A 1 40  ? 20.183  6.351   10.531  1.00 10.00 ? 40  PRO A C    5  
ATOM   9396  O  O    . PRO A 1 40  ? 20.830  7.366   10.284  1.00 10.00 ? 40  PRO A O    5  
ATOM   9397  C  CB   . PRO A 1 40  ? 22.319  5.005   10.120  1.00 10.00 ? 40  PRO A CB   5  
ATOM   9398  C  CG   . PRO A 1 40  ? 22.243  4.907   8.597   1.00 10.00 ? 40  PRO A CG   5  
ATOM   9399  C  CD   . PRO A 1 40  ? 21.087  3.929   8.380   1.00 10.00 ? 40  PRO A CD   5  
ATOM   9400  H  HA   . PRO A 1 40  ? 20.756  4.526   11.521  1.00 10.00 ? 40  PRO A HA   5  
ATOM   9401  H  HB2  . PRO A 1 40  ? 22.841  5.901   10.459  1.00 10.00 ? 40  PRO A HB2  5  
ATOM   9402  H  HB3  . PRO A 1 40  ? 22.822  4.118   10.508  1.00 10.00 ? 40  PRO A HB3  5  
ATOM   9403  H  HG2  . PRO A 1 40  ? 21.978  5.880   8.179   1.00 10.00 ? 40  PRO A HG2  5  
ATOM   9404  H  HG3  . PRO A 1 40  ? 23.178  4.559   8.165   1.00 10.00 ? 40  PRO A HG3  5  
ATOM   9405  H  HD2  . PRO A 1 40  ? 20.600  4.142   7.431   1.00 10.00 ? 40  PRO A HD2  5  
ATOM   9406  H  HD3  . PRO A 1 40  ? 21.468  2.907   8.382   1.00 10.00 ? 40  PRO A HD3  5  
ATOM   9407  N  N    . SER A 1 41  ? 18.879  6.389   10.807  1.00 10.00 ? 41  SER A N    5  
ATOM   9408  C  CA   . SER A 1 41  ? 18.053  7.581   10.783  1.00 10.00 ? 41  SER A CA   5  
ATOM   9409  C  C    . SER A 1 41  ? 16.793  7.314   11.613  1.00 10.00 ? 41  SER A C    5  
ATOM   9410  O  O    . SER A 1 41  ? 15.708  7.744   11.230  1.00 10.00 ? 41  SER A O    5  
ATOM   9411  C  CB   . SER A 1 41  ? 17.732  7.949   9.322   1.00 10.00 ? 41  SER A CB   5  
ATOM   9412  O  OG   . SER A 1 41  ? 16.929  9.112   9.260   1.00 10.00 ? 41  SER A OG   5  
ATOM   9413  H  H    . SER A 1 41  ? 18.409  5.511   10.999  1.00 10.00 ? 41  SER A H    5  
ATOM   9414  H  HA   . SER A 1 41  ? 18.594  8.408   11.245  1.00 10.00 ? 41  SER A HA   5  
ATOM   9415  H  HB2  . SER A 1 41  ? 18.656  8.130   8.770   1.00 10.00 ? 41  SER A HB2  5  
ATOM   9416  H  HB3  . SER A 1 41  ? 17.196  7.127   8.844   1.00 10.00 ? 41  SER A HB3  5  
ATOM   9417  H  HG   . SER A 1 41  ? 16.147  8.948   9.807   1.00 10.00 ? 41  SER A HG   5  
ATOM   9418  N  N    . ILE A 1 42  ? 16.953  6.633   12.758  1.00 10.00 ? 42  ILE A N    5  
ATOM   9419  C  CA   . ILE A 1 42  ? 15.886  6.294   13.682  1.00 10.00 ? 42  ILE A CA   5  
ATOM   9420  C  C    . ILE A 1 42  ? 14.974  5.240   13.032  1.00 10.00 ? 42  ILE A C    5  
ATOM   9421  O  O    . ILE A 1 42  ? 15.244  4.753   11.935  1.00 10.00 ? 42  ILE A O    5  
ATOM   9422  C  CB   . ILE A 1 42  ? 15.175  7.572   14.197  1.00 10.00 ? 42  ILE A CB   5  
ATOM   9423  C  CG1  . ILE A 1 42  ? 16.147  8.737   14.496  1.00 10.00 ? 42  ILE A CG1  5  
ATOM   9424  C  CG2  . ILE A 1 42  ? 14.352  7.322   15.470  1.00 10.00 ? 42  ILE A CG2  5  
ATOM   9425  C  CD1  . ILE A 1 42  ? 17.208  8.400   15.551  1.00 10.00 ? 42  ILE A CD1  5  
ATOM   9426  H  H    . ILE A 1 42  ? 17.852  6.258   12.993  1.00 10.00 ? 42  ILE A H    5  
ATOM   9427  H  HA   . ILE A 1 42  ? 16.366  5.809   14.531  1.00 10.00 ? 42  ILE A HA   5  
ATOM   9428  H  HB   . ILE A 1 42  ? 14.485  7.910   13.426  1.00 10.00 ? 42  ILE A HB   5  
ATOM   9429  H  HG12 . ILE A 1 42  ? 16.652  9.064   13.589  1.00 10.00 ? 42  ILE A HG12 5  
ATOM   9430  H  HG13 . ILE A 1 42  ? 15.573  9.593   14.851  1.00 10.00 ? 42  ILE A HG13 5  
ATOM   9431  H  HG21 . ILE A 1 42  ? 14.878  6.630   16.127  1.00 10.00 ? 42  ILE A HG21 5  
ATOM   9432  H  HG22 . ILE A 1 42  ? 14.182  8.257   16.003  1.00 10.00 ? 42  ILE A HG22 5  
ATOM   9433  H  HG23 . ILE A 1 42  ? 13.372  6.927   15.216  1.00 10.00 ? 42  ILE A HG23 5  
ATOM   9434  H  HD11 . ILE A 1 42  ? 17.834  9.278   15.716  1.00 10.00 ? 42  ILE A HD11 5  
ATOM   9435  H  HD12 . ILE A 1 42  ? 16.737  8.128   16.495  1.00 10.00 ? 42  ILE A HD12 5  
ATOM   9436  H  HD13 . ILE A 1 42  ? 17.842  7.581   15.213  1.00 10.00 ? 42  ILE A HD13 5  
ATOM   9437  N  N    . ARG A 1 43  ? 13.927  4.823   13.743  1.00 10.00 ? 43  ARG A N    5  
ATOM   9438  C  CA   . ARG A 1 43  ? 12.923  3.895   13.247  1.00 10.00 ? 43  ARG A CA   5  
ATOM   9439  C  C    . ARG A 1 43  ? 12.280  4.383   11.945  1.00 10.00 ? 43  ARG A C    5  
ATOM   9440  O  O    . ARG A 1 43  ? 11.811  3.573   11.151  1.00 10.00 ? 43  ARG A O    5  
ATOM   9441  C  CB   . ARG A 1 43  ? 11.887  3.656   14.350  1.00 10.00 ? 43  ARG A CB   5  
ATOM   9442  C  CG   . ARG A 1 43  ? 10.964  4.861   14.555  1.00 10.00 ? 43  ARG A CG   5  
ATOM   9443  C  CD   . ARG A 1 43  ? 10.396  4.873   15.972  1.00 10.00 ? 43  ARG A CD   5  
ATOM   9444  N  NE   . ARG A 1 43  ? 9.713   3.610   16.315  1.00 10.00 ? 43  ARG A NE   5  
ATOM   9445  C  CZ   . ARG A 1 43  ? 9.127   3.359   17.494  1.00 10.00 ? 43  ARG A CZ   5  
ATOM   9446  N  NH1  . ARG A 1 43  ? 9.003   4.334   18.401  1.00 10.00 ? 43  ARG A NH1  5  
ATOM   9447  N  NH2  . ARG A 1 43  ? 8.680   2.130   17.758  1.00 10.00 ? 43  ARG A NH2  5  
ATOM   9448  H  H    . ARG A 1 43  ? 13.814  5.181   14.674  1.00 10.00 ? 43  ARG A H    5  
ATOM   9449  H  HA   . ARG A 1 43  ? 13.415  2.946   13.044  1.00 10.00 ? 43  ARG A HA   5  
ATOM   9450  H  HB2  . ARG A 1 43  ? 11.270  2.802   14.088  1.00 10.00 ? 43  ARG A HB2  5  
ATOM   9451  H  HB3  . ARG A 1 43  ? 12.418  3.423   15.274  1.00 10.00 ? 43  ARG A HB3  5  
ATOM   9452  H  HG2  . ARG A 1 43  ? 11.519  5.789   14.417  1.00 10.00 ? 43  ARG A HG2  5  
ATOM   9453  H  HG3  . ARG A 1 43  ? 10.161  4.838   13.819  1.00 10.00 ? 43  ARG A HG3  5  
ATOM   9454  H  HD2  . ARG A 1 43  ? 11.240  5.043   16.648  1.00 10.00 ? 43  ARG A HD2  5  
ATOM   9455  H  HD3  . ARG A 1 43  ? 9.711   5.720   16.038  1.00 10.00 ? 43  ARG A HD3  5  
ATOM   9456  H  HE   . ARG A 1 43  ? 9.727   2.844   15.642  1.00 10.00 ? 43  ARG A HE   5  
ATOM   9457  H  HH11 . ARG A 1 43  ? 9.349   5.256   18.181  1.00 10.00 ? 43  ARG A HH11 5  
ATOM   9458  H  HH12 . ARG A 1 43  ? 8.550   4.182   19.289  1.00 10.00 ? 43  ARG A HH12 5  
ATOM   9459  H  HH21 . ARG A 1 43  ? 8.849   1.386   17.071  1.00 10.00 ? 43  ARG A HH21 5  
ATOM   9460  H  HH22 . ARG A 1 43  ? 8.262   1.869   18.636  1.00 10.00 ? 43  ARG A HH22 5  
ATOM   9461  N  N    . ASP A 1 44  ? 12.214  5.702   11.754  1.00 10.00 ? 44  ASP A N    5  
ATOM   9462  C  CA   . ASP A 1 44  ? 11.734  6.362   10.556  1.00 10.00 ? 44  ASP A CA   5  
ATOM   9463  C  C    . ASP A 1 44  ? 12.353  5.705   9.324   1.00 10.00 ? 44  ASP A C    5  
ATOM   9464  O  O    . ASP A 1 44  ? 13.545  5.402   9.300   1.00 10.00 ? 44  ASP A O    5  
ATOM   9465  C  CB   . ASP A 1 44  ? 12.109  7.853   10.593  1.00 10.00 ? 44  ASP A CB   5  
ATOM   9466  C  CG   . ASP A 1 44  ? 11.756  8.588   11.886  1.00 10.00 ? 44  ASP A CG   5  
ATOM   9467  O  OD1  . ASP A 1 44  ? 11.940  7.982   12.969  1.00 10.00 ? 44  ASP A OD1  5  
ATOM   9468  O  OD2  . ASP A 1 44  ? 11.314  9.748   11.763  1.00 10.00 ? 44  ASP A OD2  5  
ATOM   9469  H  H    . ASP A 1 44  ? 12.488  6.345   12.495  1.00 10.00 ? 44  ASP A H    5  
ATOM   9470  H  HA   . ASP A 1 44  ? 10.652  6.255   10.536  1.00 10.00 ? 44  ASP A HA   5  
ATOM   9471  H  HB2  . ASP A 1 44  ? 13.185  7.939   10.452  1.00 10.00 ? 44  ASP A HB2  5  
ATOM   9472  H  HB3  . ASP A 1 44  ? 11.621  8.360   9.760   1.00 10.00 ? 44  ASP A HB3  5  
ATOM   9473  N  N    . THR A 1 45  ? 11.546  5.458   8.295   1.00 10.00 ? 45  THR A N    5  
ATOM   9474  C  CA   . THR A 1 45  ? 11.995  4.726   7.131   1.00 10.00 ? 45  THR A CA   5  
ATOM   9475  C  C    . THR A 1 45  ? 11.044  5.018   5.978   1.00 10.00 ? 45  THR A C    5  
ATOM   9476  O  O    . THR A 1 45  ? 10.155  5.862   6.101   1.00 10.00 ? 45  THR A O    5  
ATOM   9477  C  CB   . THR A 1 45  ? 12.062  3.228   7.474   1.00 10.00 ? 45  THR A CB   5  
ATOM   9478  O  OG1  . THR A 1 45  ? 12.601  2.516   6.388   1.00 10.00 ? 45  THR A OG1  5  
ATOM   9479  C  CG2  . THR A 1 45  ? 10.677  2.650   7.774   1.00 10.00 ? 45  THR A CG2  5  
ATOM   9480  H  H    . THR A 1 45  ? 10.581  5.758   8.289   1.00 10.00 ? 45  THR A H    5  
ATOM   9481  H  HA   . THR A 1 45  ? 12.989  5.072   6.844   1.00 10.00 ? 45  THR A HA   5  
ATOM   9482  H  HB   . THR A 1 45  ? 12.714  3.074   8.340   1.00 10.00 ? 45  THR A HB   5  
ATOM   9483  H  HG1  . THR A 1 45  ? 12.984  1.696   6.725   1.00 10.00 ? 45  THR A HG1  5  
ATOM   9484  H  HG21 . THR A 1 45  ? 10.748  1.569   7.835   1.00 10.00 ? 45  THR A HG21 5  
ATOM   9485  H  HG22 . THR A 1 45  ? 10.313  3.050   8.719   1.00 10.00 ? 45  THR A HG22 5  
ATOM   9486  H  HG23 . THR A 1 45  ? 9.963   2.882   6.986   1.00 10.00 ? 45  THR A HG23 5  
ATOM   9487  N  N    . ALA A 1 46  ? 11.210  4.281   4.882   1.00 10.00 ? 46  ALA A N    5  
ATOM   9488  C  CA   . ALA A 1 46  ? 10.292  4.259   3.766   1.00 10.00 ? 46  ALA A CA   5  
ATOM   9489  C  C    . ALA A 1 46  ? 10.443  2.951   2.998   1.00 10.00 ? 46  ALA A C    5  
ATOM   9490  O  O    . ALA A 1 46  ? 11.400  2.204   3.232   1.00 10.00 ? 46  ALA A O    5  
ATOM   9491  C  CB   . ALA A 1 46  ? 10.520  5.491   2.888   1.00 10.00 ? 46  ALA A CB   5  
ATOM   9492  H  H    . ALA A 1 46  ? 11.896  3.529   4.926   1.00 10.00 ? 46  ALA A H    5  
ATOM   9493  H  HA   . ALA A 1 46  ? 9.290   4.269   4.171   1.00 10.00 ? 46  ALA A HA   5  
ATOM   9494  H  HB1  . ALA A 1 46  ? 10.185  6.384   3.410   1.00 10.00 ? 46  ALA A HB1  5  
ATOM   9495  H  HB2  . ALA A 1 46  ? 11.581  5.594   2.704   1.00 10.00 ? 46  ALA A HB2  5  
ATOM   9496  H  HB3  . ALA A 1 46  ? 9.990   5.402   1.939   1.00 10.00 ? 46  ALA A HB3  5  
ATOM   9497  N  N    . ALA A 1 47  ? 9.484   2.679   2.103   1.00 10.00 ? 47  ALA A N    5  
ATOM   9498  C  CA   . ALA A 1 47  ? 9.571   1.572   1.160   1.00 10.00 ? 47  ALA A CA   5  
ATOM   9499  C  C    . ALA A 1 47  ? 9.874   2.068   -0.243  1.00 10.00 ? 47  ALA A C    5  
ATOM   9500  O  O    . ALA A 1 47  ? 9.575   3.213   -0.585  1.00 10.00 ? 47  ALA A O    5  
ATOM   9501  C  CB   . ALA A 1 47  ? 8.331   0.675   1.196   1.00 10.00 ? 47  ALA A CB   5  
ATOM   9502  H  H    . ALA A 1 47  ? 8.724   3.348   1.988   1.00 10.00 ? 47  ALA A H    5  
ATOM   9503  H  HA   . ALA A 1 47  ? 10.430  0.973   1.426   1.00 10.00 ? 47  ALA A HA   5  
ATOM   9504  H  HB1  . ALA A 1 47  ? 7.424   1.267   1.088   1.00 10.00 ? 47  ALA A HB1  5  
ATOM   9505  H  HB2  . ALA A 1 47  ? 8.372   -0.051  0.384   1.00 10.00 ? 47  ALA A HB2  5  
ATOM   9506  H  HB3  . ALA A 1 47  ? 8.308   0.127   2.136   1.00 10.00 ? 47  ALA A HB3  5  
ATOM   9507  N  N    . TYR A 1 48  ? 10.508  1.190   -1.023  1.00 10.00 ? 48  TYR A N    5  
ATOM   9508  C  CA   . TYR A 1 48  ? 11.145  1.492   -2.284  1.00 10.00 ? 48  TYR A CA   5  
ATOM   9509  C  C    . TYR A 1 48  ? 10.801  0.344   -3.232  1.00 10.00 ? 48  TYR A C    5  
ATOM   9510  O  O    . TYR A 1 48  ? 11.129  -0.808  -2.952  1.00 10.00 ? 48  TYR A O    5  
ATOM   9511  C  CB   . TYR A 1 48  ? 12.643  1.700   -2.060  1.00 10.00 ? 48  TYR A CB   5  
ATOM   9512  C  CG   . TYR A 1 48  ? 12.915  2.837   -1.090  1.00 10.00 ? 48  TYR A CG   5  
ATOM   9513  C  CD1  . TYR A 1 48  ? 12.353  4.106   -1.327  1.00 10.00 ? 48  TYR A CD1  5  
ATOM   9514  C  CD2  . TYR A 1 48  ? 13.514  2.578   0.153   1.00 10.00 ? 48  TYR A CD2  5  
ATOM   9515  C  CE1  . TYR A 1 48  ? 12.448  5.120   -0.365  1.00 10.00 ? 48  TYR A CE1  5  
ATOM   9516  C  CE2  . TYR A 1 48  ? 13.681  3.621   1.076   1.00 10.00 ? 48  TYR A CE2  5  
ATOM   9517  C  CZ   . TYR A 1 48  ? 13.207  4.909   0.790   1.00 10.00 ? 48  TYR A CZ   5  
ATOM   9518  O  OH   . TYR A 1 48  ? 13.648  5.994   1.494   1.00 10.00 ? 48  TYR A OH   5  
ATOM   9519  H  H    . TYR A 1 48  ? 10.612  0.231   -0.705  1.00 10.00 ? 48  TYR A H    5  
ATOM   9520  H  HA   . TYR A 1 48  ? 10.766  2.441   -2.634  1.00 10.00 ? 48  TYR A HA   5  
ATOM   9521  H  HB2  . TYR A 1 48  ? 13.082  0.772   -1.691  1.00 10.00 ? 48  TYR A HB2  5  
ATOM   9522  H  HB3  . TYR A 1 48  ? 13.110  1.939   -3.016  1.00 10.00 ? 48  TYR A HB3  5  
ATOM   9523  H  HD1  . TYR A 1 48  ? 11.793  4.303   -2.222  1.00 10.00 ? 48  TYR A HD1  5  
ATOM   9524  H  HD2  . TYR A 1 48  ? 13.842  1.584   0.411   1.00 10.00 ? 48  TYR A HD2  5  
ATOM   9525  H  HE1  . TYR A 1 48  ? 12.018  6.089   -0.565  1.00 10.00 ? 48  TYR A HE1  5  
ATOM   9526  H  HE2  . TYR A 1 48  ? 14.148  3.409   2.014   1.00 10.00 ? 48  TYR A HE2  5  
ATOM   9527  H  HH   . TYR A 1 48  ? 13.314  6.811   1.099   1.00 10.00 ? 48  TYR A HH   5  
ATOM   9528  N  N    . MET A 1 49  ? 10.003  0.637   -4.256  1.00 10.00 ? 49  MET A N    5  
ATOM   9529  C  CA   . MET A 1 49  ? 9.365   -0.323  -5.147  1.00 10.00 ? 49  MET A CA   5  
ATOM   9530  C  C    . MET A 1 49  ? 8.928   0.430   -6.402  1.00 10.00 ? 49  MET A C    5  
ATOM   9531  O  O    . MET A 1 49  ? 9.273   1.598   -6.549  1.00 10.00 ? 49  MET A O    5  
ATOM   9532  C  CB   . MET A 1 49  ? 8.231   -1.079  -4.437  1.00 10.00 ? 49  MET A CB   5  
ATOM   9533  C  CG   . MET A 1 49  ? 7.055   -0.199  -4.008  1.00 10.00 ? 49  MET A CG   5  
ATOM   9534  S  SD   . MET A 1 49  ? 5.719   -1.121  -3.205  1.00 10.00 ? 49  MET A SD   5  
ATOM   9535  C  CE   . MET A 1 49  ? 4.555   0.211   -2.844  1.00 10.00 ? 49  MET A CE   5  
ATOM   9536  H  H    . MET A 1 49  ? 9.925   1.610   -4.532  1.00 10.00 ? 49  MET A H    5  
ATOM   9537  H  HA   . MET A 1 49  ? 10.116  -1.054  -5.451  1.00 10.00 ? 49  MET A HA   5  
ATOM   9538  H  HB2  . MET A 1 49  ? 7.849   -1.859  -5.093  1.00 10.00 ? 49  MET A HB2  5  
ATOM   9539  H  HB3  . MET A 1 49  ? 8.643   -1.559  -3.552  1.00 10.00 ? 49  MET A HB3  5  
ATOM   9540  H  HG2  . MET A 1 49  ? 7.412   0.560   -3.313  1.00 10.00 ? 49  MET A HG2  5  
ATOM   9541  H  HG3  . MET A 1 49  ? 6.630   0.280   -4.888  1.00 10.00 ? 49  MET A HG3  5  
ATOM   9542  H  HE1  . MET A 1 49  ? 3.675   -0.212  -2.362  1.00 10.00 ? 49  MET A HE1  5  
ATOM   9543  H  HE2  . MET A 1 49  ? 5.023   0.931   -2.175  1.00 10.00 ? 49  MET A HE2  5  
ATOM   9544  H  HE3  . MET A 1 49  ? 4.261   0.698   -3.773  1.00 10.00 ? 49  MET A HE3  5  
ATOM   9545  N  N    . THR A 1 50  ? 8.173   -0.206  -7.299  1.00 10.00 ? 50  THR A N    5  
ATOM   9546  C  CA   . THR A 1 50  ? 7.515   0.512   -8.395  1.00 10.00 ? 50  THR A CA   5  
ATOM   9547  C  C    . THR A 1 50  ? 6.021   0.194   -8.459  1.00 10.00 ? 50  THR A C    5  
ATOM   9548  O  O    . THR A 1 50  ? 5.594   -0.920  -8.169  1.00 10.00 ? 50  THR A O    5  
ATOM   9549  C  CB   . THR A 1 50  ? 8.233   0.309   -9.746  1.00 10.00 ? 50  THR A CB   5  
ATOM   9550  O  OG1  . THR A 1 50  ? 7.429   0.743   -10.832 1.00 10.00 ? 50  THR A OG1  5  
ATOM   9551  C  CG2  . THR A 1 50  ? 8.640   -1.144  -9.995  1.00 10.00 ? 50  THR A CG2  5  
ATOM   9552  H  H    . THR A 1 50  ? 7.861   -1.142  -7.074  1.00 10.00 ? 50  THR A H    5  
ATOM   9553  H  HA   . THR A 1 50  ? 7.554   1.579   -8.184  1.00 10.00 ? 50  THR A HA   5  
ATOM   9554  H  HB   . THR A 1 50  ? 9.144   0.907   -9.748  1.00 10.00 ? 50  THR A HB   5  
ATOM   9555  H  HG1  . THR A 1 50  ? 7.276   1.697   -10.746 1.00 10.00 ? 50  THR A HG1  5  
ATOM   9556  H  HG21 . THR A 1 50  ? 9.453   -1.421  -9.324  1.00 10.00 ? 50  THR A HG21 5  
ATOM   9557  H  HG22 . THR A 1 50  ? 7.788   -1.802  -9.838  1.00 10.00 ? 50  THR A HG22 5  
ATOM   9558  H  HG23 . THR A 1 50  ? 8.991   -1.254  -11.021 1.00 10.00 ? 50  THR A HG23 5  
ATOM   9559  N  N    . LEU A 1 51  ? 5.241   1.204   -8.850  1.00 10.00 ? 51  LEU A N    5  
ATOM   9560  C  CA   . LEU A 1 51  ? 3.925   1.052   -9.435  1.00 10.00 ? 51  LEU A CA   5  
ATOM   9561  C  C    . LEU A 1 51  ? 4.157   0.965   -10.932 1.00 10.00 ? 51  LEU A C    5  
ATOM   9562  O  O    . LEU A 1 51  ? 4.579   1.942   -11.543 1.00 10.00 ? 51  LEU A O    5  
ATOM   9563  C  CB   . LEU A 1 51  ? 3.092   2.306   -9.175  1.00 10.00 ? 51  LEU A CB   5  
ATOM   9564  C  CG   . LEU A 1 51  ? 2.175   2.181   -7.951  1.00 10.00 ? 51  LEU A CG   5  
ATOM   9565  C  CD1  . LEU A 1 51  ? 2.965   1.877   -6.671  1.00 10.00 ? 51  LEU A CD1  5  
ATOM   9566  C  CD2  . LEU A 1 51  ? 1.396   3.485   -7.773  1.00 10.00 ? 51  LEU A CD2  5  
ATOM   9567  H  H    . LEU A 1 51  ? 5.708   2.069   -9.089  1.00 10.00 ? 51  LEU A H    5  
ATOM   9568  H  HA   . LEU A 1 51  ? 3.419   0.155   -9.067  1.00 10.00 ? 51  LEU A HA   5  
ATOM   9569  H  HB2  . LEU A 1 51  ? 3.765   3.159   -9.138  1.00 10.00 ? 51  LEU A HB2  5  
ATOM   9570  H  HB3  . LEU A 1 51  ? 2.458   2.467   -10.042 1.00 10.00 ? 51  LEU A HB3  5  
ATOM   9571  H  HG   . LEU A 1 51  ? 1.446   1.385   -8.141  1.00 10.00 ? 51  LEU A HG   5  
ATOM   9572  H  HD11 . LEU A 1 51  ? 3.439   0.898   -6.741  1.00 10.00 ? 51  LEU A HD11 5  
ATOM   9573  H  HD12 . LEU A 1 51  ? 3.730   2.637   -6.516  1.00 10.00 ? 51  LEU A HD12 5  
ATOM   9574  H  HD13 . LEU A 1 51  ? 2.290   1.870   -5.815  1.00 10.00 ? 51  LEU A HD13 5  
ATOM   9575  H  HD21 . LEU A 1 51  ? 2.080   4.313   -7.586  1.00 10.00 ? 51  LEU A HD21 5  
ATOM   9576  H  HD22 . LEU A 1 51  ? 0.817   3.690   -8.671  1.00 10.00 ? 51  LEU A HD22 5  
ATOM   9577  H  HD23 . LEU A 1 51  ? 0.714   3.386   -6.931  1.00 10.00 ? 51  LEU A HD23 5  
ATOM   9578  N  N    . THR A 1 52  ? 3.875   -0.196  -11.502 1.00 10.00 ? 52  THR A N    5  
ATOM   9579  C  CA   . THR A 1 52  ? 4.209   -0.533  -12.874 1.00 10.00 ? 52  THR A CA   5  
ATOM   9580  C  C    . THR A 1 52  ? 2.912   -0.844  -13.622 1.00 10.00 ? 52  THR A C    5  
ATOM   9581  O  O    . THR A 1 52  ? 2.525   -2.006  -13.731 1.00 10.00 ? 52  THR A O    5  
ATOM   9582  C  CB   . THR A 1 52  ? 5.176   -1.726  -12.830 1.00 10.00 ? 52  THR A CB   5  
ATOM   9583  O  OG1  . THR A 1 52  ? 6.152   -1.542  -11.820 1.00 10.00 ? 52  THR A OG1  5  
ATOM   9584  C  CG2  . THR A 1 52  ? 5.872   -1.941  -14.175 1.00 10.00 ? 52  THR A CG2  5  
ATOM   9585  H  H    . THR A 1 52  ? 3.535   -0.922  -10.895 1.00 10.00 ? 52  THR A H    5  
ATOM   9586  H  HA   . THR A 1 52  ? 4.712   0.299   -13.369 1.00 10.00 ? 52  THR A HA   5  
ATOM   9587  H  HB   . THR A 1 52  ? 4.623   -2.629  -12.561 1.00 10.00 ? 52  THR A HB   5  
ATOM   9588  H  HG1  . THR A 1 52  ? 6.482   -0.631  -11.808 1.00 10.00 ? 52  THR A HG1  5  
ATOM   9589  H  HG21 . THR A 1 52  ? 5.130   -2.137  -14.950 1.00 10.00 ? 52  THR A HG21 5  
ATOM   9590  H  HG22 . THR A 1 52  ? 6.452   -1.057  -14.443 1.00 10.00 ? 52  THR A HG22 5  
ATOM   9591  H  HG23 . THR A 1 52  ? 6.541   -2.799  -14.100 1.00 10.00 ? 52  THR A HG23 5  
ATOM   9592  N  N    . ASN A 1 53  ? 2.197   0.182   -14.096 1.00 10.00 ? 53  ASN A N    5  
ATOM   9593  C  CA   . ASN A 1 53  ? 0.844   -0.027  -14.600 1.00 10.00 ? 53  ASN A CA   5  
ATOM   9594  C  C    . ASN A 1 53  ? 0.886   -0.518  -16.042 1.00 10.00 ? 53  ASN A C    5  
ATOM   9595  O  O    . ASN A 1 53  ? 1.655   0.004   -16.847 1.00 10.00 ? 53  ASN A O    5  
ATOM   9596  C  CB   . ASN A 1 53  ? 0.047   1.280   -14.518 1.00 10.00 ? 53  ASN A CB   5  
ATOM   9597  C  CG   . ASN A 1 53  ? -1.451  1.058   -14.362 1.00 10.00 ? 53  ASN A CG   5  
ATOM   9598  O  OD1  . ASN A 1 53  ? -1.950  -0.058  -14.482 1.00 10.00 ? 53  ASN A OD1  5  
ATOM   9599  N  ND2  . ASN A 1 53  ? -2.162  2.111   -13.976 1.00 10.00 ? 53  ASN A ND2  5  
ATOM   9600  H  H    . ASN A 1 53  ? 2.542   1.137   -14.029 1.00 10.00 ? 53  ASN A H    5  
ATOM   9601  H  HA   . ASN A 1 53  ? 0.361   -0.779  -13.978 1.00 10.00 ? 53  ASN A HA   5  
ATOM   9602  H  HB2  . ASN A 1 53  ? 0.368   1.860   -13.656 1.00 10.00 ? 53  ASN A HB2  5  
ATOM   9603  H  HB3  . ASN A 1 53  ? 0.247   1.869   -15.402 1.00 10.00 ? 53  ASN A HB3  5  
ATOM   9604  H  HD21 . ASN A 1 53  ? -1.817  3.058   -14.126 1.00 10.00 ? 53  ASN A HD21 5  
ATOM   9605  H  HD22 . ASN A 1 53  ? -3.091  1.981   -13.620 1.00 10.00 ? 53  ASN A HD22 5  
ATOM   9606  N  N    . LYS A 1 54  ? 0.054   -1.503  -16.389 1.00 10.00 ? 54  LYS A N    5  
ATOM   9607  C  CA   . LYS A 1 54  ? -0.131  -1.932  -17.769 1.00 10.00 ? 54  LYS A CA   5  
ATOM   9608  C  C    . LYS A 1 54  ? -1.634  -1.930  -18.038 1.00 10.00 ? 54  LYS A C    5  
ATOM   9609  O  O    . LYS A 1 54  ? -2.211  -2.922  -18.483 1.00 10.00 ? 54  LYS A O    5  
ATOM   9610  C  CB   . LYS A 1 54  ? 0.492   -3.322  -17.951 1.00 10.00 ? 54  LYS A CB   5  
ATOM   9611  C  CG   . LYS A 1 54  ? 2.027   -3.338  -17.861 1.00 10.00 ? 54  LYS A CG   5  
ATOM   9612  C  CD   . LYS A 1 54  ? 2.721   -2.936  -19.171 1.00 10.00 ? 54  LYS A CD   5  
ATOM   9613  C  CE   . LYS A 1 54  ? 2.620   -4.050  -20.229 1.00 10.00 ? 54  LYS A CE   5  
ATOM   9614  N  NZ   . LYS A 1 54  ? 3.375   -3.731  -21.457 1.00 10.00 ? 54  LYS A NZ   5  
ATOM   9615  H  H    . LYS A 1 54  ? -0.593  -1.889  -15.704 1.00 10.00 ? 54  LYS A H    5  
ATOM   9616  H  HA   . LYS A 1 54  ? 0.322   -1.238  -18.478 1.00 10.00 ? 54  LYS A HA   5  
ATOM   9617  H  HB2  . LYS A 1 54  ? 0.108   -3.928  -17.140 1.00 10.00 ? 54  LYS A HB2  5  
ATOM   9618  H  HB3  . LYS A 1 54  ? 0.161   -3.765  -18.889 1.00 10.00 ? 54  LYS A HB3  5  
ATOM   9619  H  HG2  . LYS A 1 54  ? 2.347   -2.668  -17.062 1.00 10.00 ? 54  LYS A HG2  5  
ATOM   9620  H  HG3  . LYS A 1 54  ? 2.348   -4.343  -17.582 1.00 10.00 ? 54  LYS A HG3  5  
ATOM   9621  H  HD2  . LYS A 1 54  ? 2.287   -2.004  -19.537 1.00 10.00 ? 54  LYS A HD2  5  
ATOM   9622  H  HD3  . LYS A 1 54  ? 3.772   -2.754  -18.936 1.00 10.00 ? 54  LYS A HD3  5  
ATOM   9623  H  HE2  . LYS A 1 54  ? 3.014   -4.979  -19.809 1.00 10.00 ? 54  LYS A HE2  5  
ATOM   9624  H  HE3  . LYS A 1 54  ? 1.577   -4.215  -20.504 1.00 10.00 ? 54  LYS A HE3  5  
ATOM   9625  H  HZ1  . LYS A 1 54  ? 3.287   -4.493  -22.116 1.00 10.00 ? 54  LYS A HZ1  5  
ATOM   9626  H  HZ2  . LYS A 1 54  ? 3.009   -2.891  -21.883 1.00 10.00 ? 54  LYS A HZ2  5  
ATOM   9627  H  HZ3  . LYS A 1 54  ? 4.354   -3.599  -21.243 1.00 10.00 ? 54  LYS A HZ3  5  
ATOM   9628  N  N    . SER A 1 55  ? -2.240  -0.771  -17.778 1.00 10.00 ? 55  SER A N    5  
ATOM   9629  C  CA   . SER A 1 55  ? -3.602  -0.414  -18.117 1.00 10.00 ? 55  SER A CA   5  
ATOM   9630  C  C    . SER A 1 55  ? -3.642  1.111   -18.122 1.00 10.00 ? 55  SER A C    5  
ATOM   9631  O  O    . SER A 1 55  ? -3.219  1.741   -17.154 1.00 10.00 ? 55  SER A O    5  
ATOM   9632  C  CB   . SER A 1 55  ? -4.600  -0.920  -17.071 1.00 10.00 ? 55  SER A CB   5  
ATOM   9633  O  OG   . SER A 1 55  ? -4.389  -2.273  -16.721 1.00 10.00 ? 55  SER A OG   5  
ATOM   9634  H  H    . SER A 1 55  ? -1.696  -0.036  -17.346 1.00 10.00 ? 55  SER A H    5  
ATOM   9635  H  HA   . SER A 1 55  ? -3.854  -0.821  -19.098 1.00 10.00 ? 55  SER A HA   5  
ATOM   9636  H  HB2  . SER A 1 55  ? -4.509  -0.284  -16.195 1.00 10.00 ? 55  SER A HB2  5  
ATOM   9637  H  HB3  . SER A 1 55  ? -5.611  -0.810  -17.461 1.00 10.00 ? 55  SER A HB3  5  
ATOM   9638  H  HG   . SER A 1 55  ? -3.479  -2.377  -16.413 1.00 10.00 ? 55  SER A HG   5  
ATOM   9639  N  N    . ASP A 1 56  ? -4.153  1.705   -19.193 1.00 10.00 ? 56  ASP A N    5  
ATOM   9640  C  CA   . ASP A 1 56  ? -4.309  3.145   -19.324 1.00 10.00 ? 56  ASP A CA   5  
ATOM   9641  C  C    . ASP A 1 56  ? -5.513  3.621   -18.506 1.00 10.00 ? 56  ASP A C    5  
ATOM   9642  O  O    . ASP A 1 56  ? -6.475  4.156   -19.052 1.00 10.00 ? 56  ASP A O    5  
ATOM   9643  C  CB   . ASP A 1 56  ? -4.390  3.529   -20.811 1.00 10.00 ? 56  ASP A CB   5  
ATOM   9644  C  CG   . ASP A 1 56  ? -3.013  3.562   -21.451 1.00 10.00 ? 56  ASP A CG   5  
ATOM   9645  O  OD1  . ASP A 1 56  ? -2.226  4.456   -21.077 1.00 10.00 ? 56  ASP A OD1  5  
ATOM   9646  O  OD2  . ASP A 1 56  ? -2.710  2.687   -22.291 1.00 10.00 ? 56  ASP A OD2  5  
ATOM   9647  H  H    . ASP A 1 56  ? -4.442  1.116   -19.950 1.00 10.00 ? 56  ASP A H    5  
ATOM   9648  H  HA   . ASP A 1 56  ? -3.433  3.636   -18.909 1.00 10.00 ? 56  ASP A HA   5  
ATOM   9649  H  HB2  . ASP A 1 56  ? -5.047  2.848   -21.352 1.00 10.00 ? 56  ASP A HB2  5  
ATOM   9650  H  HB3  . ASP A 1 56  ? -4.797  4.536   -20.900 1.00 10.00 ? 56  ASP A HB3  5  
ATOM   9651  N  N    . GLN A 1 57  ? -5.457  3.422   -17.184 1.00 10.00 ? 57  GLN A N    5  
ATOM   9652  C  CA   . GLN A 1 57  ? -6.478  3.829   -16.224 1.00 10.00 ? 57  GLN A CA   5  
ATOM   9653  C  C    . GLN A 1 57  ? -5.785  4.499   -15.025 1.00 10.00 ? 57  GLN A C    5  
ATOM   9654  O  O    . GLN A 1 57  ? -4.762  3.991   -14.574 1.00 10.00 ? 57  GLN A O    5  
ATOM   9655  C  CB   . GLN A 1 57  ? -7.256  2.583   -15.780 1.00 10.00 ? 57  GLN A CB   5  
ATOM   9656  C  CG   . GLN A 1 57  ? -8.185  2.055   -16.886 1.00 10.00 ? 57  GLN A CG   5  
ATOM   9657  C  CD   . GLN A 1 57  ? -8.180  0.532   -16.967 1.00 10.00 ? 57  GLN A CD   5  
ATOM   9658  O  OE1  . GLN A 1 57  ? -8.179  -0.155  -15.952 1.00 10.00 ? 57  GLN A OE1  5  
ATOM   9659  N  NE2  . GLN A 1 57  ? -8.152  -0.015  -18.180 1.00 10.00 ? 57  GLN A NE2  5  
ATOM   9660  H  H    . GLN A 1 57  ? -4.617  2.993   -16.803 1.00 10.00 ? 57  GLN A H    5  
ATOM   9661  H  HA   . GLN A 1 57  ? -7.171  4.520   -16.701 1.00 10.00 ? 57  GLN A HA   5  
ATOM   9662  H  HB2  . GLN A 1 57  ? -6.531  1.818   -15.494 1.00 10.00 ? 57  GLN A HB2  5  
ATOM   9663  H  HB3  . GLN A 1 57  ? -7.868  2.822   -14.909 1.00 10.00 ? 57  GLN A HB3  5  
ATOM   9664  H  HG2  . GLN A 1 57  ? -9.203  2.395   -16.693 1.00 10.00 ? 57  GLN A HG2  5  
ATOM   9665  H  HG3  . GLN A 1 57  ? -7.885  2.448   -17.855 1.00 10.00 ? 57  GLN A HG3  5  
ATOM   9666  H  HE21 . GLN A 1 57  ? -8.165  0.565   -19.006 1.00 10.00 ? 57  GLN A HE21 5  
ATOM   9667  H  HE22 . GLN A 1 57  ? -8.158  -1.020  -18.256 1.00 10.00 ? 57  GLN A HE22 5  
ATOM   9668  N  N    . PRO A 1 58  ? -6.292  5.634   -14.512 1.00 10.00 ? 58  PRO A N    5  
ATOM   9669  C  CA   . PRO A 1 58  ? -5.672  6.369   -13.414 1.00 10.00 ? 58  PRO A CA   5  
ATOM   9670  C  C    . PRO A 1 58  ? -5.965  5.700   -12.064 1.00 10.00 ? 58  PRO A C    5  
ATOM   9671  O  O    . PRO A 1 58  ? -7.046  5.883   -11.509 1.00 10.00 ? 58  PRO A O    5  
ATOM   9672  C  CB   . PRO A 1 58  ? -6.282  7.773   -13.496 1.00 10.00 ? 58  PRO A CB   5  
ATOM   9673  C  CG   . PRO A 1 58  ? -7.679  7.523   -14.065 1.00 10.00 ? 58  PRO A CG   5  
ATOM   9674  C  CD   . PRO A 1 58  ? -7.453  6.351   -15.020 1.00 10.00 ? 58  PRO A CD   5  
ATOM   9675  H  HA   . PRO A 1 58  ? -4.594  6.437   -13.550 1.00 10.00 ? 58  PRO A HA   5  
ATOM   9676  H  HB2  . PRO A 1 58  ? -6.309  8.277   -12.529 1.00 10.00 ? 58  PRO A HB2  5  
ATOM   9677  H  HB3  . PRO A 1 58  ? -5.725  8.375   -14.212 1.00 10.00 ? 58  PRO A HB3  5  
ATOM   9678  H  HG2  . PRO A 1 58  ? -8.356  7.218   -13.266 1.00 10.00 ? 58  PRO A HG2  5  
ATOM   9679  H  HG3  . PRO A 1 58  ? -8.080  8.400   -14.576 1.00 10.00 ? 58  PRO A HG3  5  
ATOM   9680  H  HD2  . PRO A 1 58  ? -8.342  5.718   -15.051 1.00 10.00 ? 58  PRO A HD2  5  
ATOM   9681  H  HD3  . PRO A 1 58  ? -7.232  6.740   -16.015 1.00 10.00 ? 58  PRO A HD3  5  
ATOM   9682  N  N    . ILE A 1 59  ? -5.007  4.936   -11.524 1.00 10.00 ? 59  ILE A N    5  
ATOM   9683  C  CA   . ILE A 1 59  ? -5.168  4.249   -10.233 1.00 10.00 ? 59  ILE A CA   5  
ATOM   9684  C  C    . ILE A 1 59  ? -4.258  4.908   -9.193  1.00 10.00 ? 59  ILE A C    5  
ATOM   9685  O  O    . ILE A 1 59  ? -3.083  4.574   -9.072  1.00 10.00 ? 59  ILE A O    5  
ATOM   9686  C  CB   . ILE A 1 59  ? -4.965  2.717   -10.327 1.00 10.00 ? 59  ILE A CB   5  
ATOM   9687  C  CG1  . ILE A 1 59  ? -6.126  1.981   -11.025 1.00 10.00 ? 59  ILE A CG1  5  
ATOM   9688  C  CG2  . ILE A 1 59  ? -4.900  2.091   -8.920  1.00 10.00 ? 59  ILE A CG2  5  
ATOM   9689  C  CD1  . ILE A 1 59  ? -6.202  2.218   -12.528 1.00 10.00 ? 59  ILE A CD1  5  
ATOM   9690  H  H    . ILE A 1 59  ? -4.112  4.927   -12.002 1.00 10.00 ? 59  ILE A H    5  
ATOM   9691  H  HA   . ILE A 1 59  ? -6.184  4.385   -9.866  1.00 10.00 ? 59  ILE A HA   5  
ATOM   9692  H  HB   . ILE A 1 59  ? -4.035  2.504   -10.854 1.00 10.00 ? 59  ILE A HB   5  
ATOM   9693  H  HG12 . ILE A 1 59  ? -5.987  0.907   -10.900 1.00 10.00 ? 59  ILE A HG12 5  
ATOM   9694  H  HG13 . ILE A 1 59  ? -7.077  2.258   -10.568 1.00 10.00 ? 59  ILE A HG13 5  
ATOM   9695  H  HG21 . ILE A 1 59  ? -4.864  1.006   -8.997  1.00 10.00 ? 59  ILE A HG21 5  
ATOM   9696  H  HG22 . ILE A 1 59  ? -4.011  2.402   -8.374  1.00 10.00 ? 59  ILE A HG22 5  
ATOM   9697  H  HG23 . ILE A 1 59  ? -5.785  2.371   -8.348  1.00 10.00 ? 59  ILE A HG23 5  
ATOM   9698  H  HD11 . ILE A 1 59  ? -5.213  2.094   -12.967 1.00 10.00 ? 59  ILE A HD11 5  
ATOM   9699  H  HD12 . ILE A 1 59  ? -6.885  1.492   -12.969 1.00 10.00 ? 59  ILE A HD12 5  
ATOM   9700  H  HD13 . ILE A 1 59  ? -6.585  3.216   -12.723 1.00 10.00 ? 59  ILE A HD13 5  
ATOM   9701  N  N    . LYS A 1 60  ? -4.824  5.832   -8.416  1.00 10.00 ? 60  LYS A N    5  
ATOM   9702  C  CA   . LYS A 1 60  ? -4.107  6.577   -7.393  1.00 10.00 ? 60  LYS A CA   5  
ATOM   9703  C  C    . LYS A 1 60  ? -4.012  5.761   -6.098  1.00 10.00 ? 60  LYS A C    5  
ATOM   9704  O  O    . LYS A 1 60  ? -5.034  5.424   -5.505  1.00 10.00 ? 60  LYS A O    5  
ATOM   9705  C  CB   . LYS A 1 60  ? -4.786  7.941   -7.204  1.00 10.00 ? 60  LYS A CB   5  
ATOM   9706  C  CG   . LYS A 1 60  ? -6.261  7.928   -6.768  1.00 10.00 ? 60  LYS A CG   5  
ATOM   9707  C  CD   . LYS A 1 60  ? -6.820  9.352   -6.915  1.00 10.00 ? 60  LYS A CD   5  
ATOM   9708  C  CE   . LYS A 1 60  ? -8.249  9.455   -6.367  1.00 10.00 ? 60  LYS A CE   5  
ATOM   9709  N  NZ   . LYS A 1 60  ? -8.811  10.809  -6.560  1.00 10.00 ? 60  LYS A NZ   5  
ATOM   9710  H  H    . LYS A 1 60  ? -5.798  6.036   -8.568  1.00 10.00 ? 60  LYS A H    5  
ATOM   9711  H  HA   . LYS A 1 60  ? -3.096  6.778   -7.752  1.00 10.00 ? 60  LYS A HA   5  
ATOM   9712  H  HB2  . LYS A 1 60  ? -4.198  8.518   -6.493  1.00 10.00 ? 60  LYS A HB2  5  
ATOM   9713  H  HB3  . LYS A 1 60  ? -4.740  8.441   -8.167  1.00 10.00 ? 60  LYS A HB3  5  
ATOM   9714  H  HG2  . LYS A 1 60  ? -6.845  7.260   -7.401  1.00 10.00 ? 60  LYS A HG2  5  
ATOM   9715  H  HG3  . LYS A 1 60  ? -6.344  7.578   -5.739  1.00 10.00 ? 60  LYS A HG3  5  
ATOM   9716  H  HD2  . LYS A 1 60  ? -6.168  10.055  -6.395  1.00 10.00 ? 60  LYS A HD2  5  
ATOM   9717  H  HD3  . LYS A 1 60  ? -6.810  9.612   -7.977  1.00 10.00 ? 60  LYS A HD3  5  
ATOM   9718  H  HE2  . LYS A 1 60  ? -8.885  8.730   -6.880  1.00 10.00 ? 60  LYS A HE2  5  
ATOM   9719  H  HE3  . LYS A 1 60  ? -8.245  9.218   -5.300  1.00 10.00 ? 60  LYS A HE3  5  
ATOM   9720  H  HZ1  . LYS A 1 60  ? -9.745  10.853  -6.175  1.00 10.00 ? 60  LYS A HZ1  5  
ATOM   9721  H  HZ2  . LYS A 1 60  ? -8.235  11.499  -6.096  1.00 10.00 ? 60  LYS A HZ2  5  
ATOM   9722  H  HZ3  . LYS A 1 60  ? -8.856  11.031  -7.545  1.00 10.00 ? 60  LYS A HZ3  5  
ATOM   9723  N  N    . LEU A 1 61  ? -2.789  5.428   -5.671  1.00 10.00 ? 61  LEU A N    5  
ATOM   9724  C  CA   . LEU A 1 61  ? -2.499  4.563   -4.545  1.00 10.00 ? 61  LEU A CA   5  
ATOM   9725  C  C    . LEU A 1 61  ? -2.430  5.430   -3.295  1.00 10.00 ? 61  LEU A C    5  
ATOM   9726  O  O    . LEU A 1 61  ? -1.651  6.378   -3.257  1.00 10.00 ? 61  LEU A O    5  
ATOM   9727  C  CB   . LEU A 1 61  ? -1.191  3.823   -4.861  1.00 10.00 ? 61  LEU A CB   5  
ATOM   9728  C  CG   . LEU A 1 61  ? -0.464  3.100   -3.717  1.00 10.00 ? 61  LEU A CG   5  
ATOM   9729  C  CD1  . LEU A 1 61  ? 0.252   4.092   -2.796  1.00 10.00 ? 61  LEU A CD1  5  
ATOM   9730  C  CD2  . LEU A 1 61  ? -1.364  2.140   -2.935  1.00 10.00 ? 61  LEU A CD2  5  
ATOM   9731  H  H    . LEU A 1 61  ? -1.970  5.828   -6.099  1.00 10.00 ? 61  LEU A H    5  
ATOM   9732  H  HA   . LEU A 1 61  ? -3.281  3.819   -4.444  1.00 10.00 ? 61  LEU A HA   5  
ATOM   9733  H  HB2  . LEU A 1 61  ? -1.420  3.081   -5.626  1.00 10.00 ? 61  LEU A HB2  5  
ATOM   9734  H  HB3  . LEU A 1 61  ? -0.487  4.536   -5.288  1.00 10.00 ? 61  LEU A HB3  5  
ATOM   9735  H  HG   . LEU A 1 61  ? 0.317   2.502   -4.189  1.00 10.00 ? 61  LEU A HG   5  
ATOM   9736  H  HD11 . LEU A 1 61  ? 1.116   3.610   -2.339  1.00 10.00 ? 61  LEU A HD11 5  
ATOM   9737  H  HD12 . LEU A 1 61  ? 0.582   4.950   -3.387  1.00 10.00 ? 61  LEU A HD12 5  
ATOM   9738  H  HD13 . LEU A 1 61  ? -0.407  4.436   -2.002  1.00 10.00 ? 61  LEU A HD13 5  
ATOM   9739  H  HD21 . LEU A 1 61  ? -0.761  1.620   -2.192  1.00 10.00 ? 61  LEU A HD21 5  
ATOM   9740  H  HD22 . LEU A 1 61  ? -2.161  2.674   -2.422  1.00 10.00 ? 61  LEU A HD22 5  
ATOM   9741  H  HD23 . LEU A 1 61  ? -1.802  1.409   -3.616  1.00 10.00 ? 61  LEU A HD23 5  
ATOM   9742  N  N    . VAL A 1 62  ? -3.244  5.119   -2.282  1.00 10.00 ? 62  VAL A N    5  
ATOM   9743  C  CA   . VAL A 1 62  ? -3.258  5.864   -1.031  1.00 10.00 ? 62  VAL A CA   5  
ATOM   9744  C  C    . VAL A 1 62  ? -3.495  4.921   0.149   1.00 10.00 ? 62  VAL A C    5  
ATOM   9745  O  O    . VAL A 1 62  ? -4.395  5.116   0.959   1.00 10.00 ? 62  VAL A O    5  
ATOM   9746  C  CB   . VAL A 1 62  ? -4.268  7.021   -1.151  1.00 10.00 ? 62  VAL A CB   5  
ATOM   9747  C  CG1  . VAL A 1 62  ? -5.707  6.595   -1.471  1.00 10.00 ? 62  VAL A CG1  5  
ATOM   9748  C  CG2  . VAL A 1 62  ? -4.213  7.996   0.026   1.00 10.00 ? 62  VAL A CG2  5  
ATOM   9749  H  H    . VAL A 1 62  ? -3.868  4.333   -2.374  1.00 10.00 ? 62  VAL A H    5  
ATOM   9750  H  HA   . VAL A 1 62  ? -2.275  6.308   -0.873  1.00 10.00 ? 62  VAL A HA   5  
ATOM   9751  H  HB   . VAL A 1 62  ? -3.937  7.598   -2.002  1.00 10.00 ? 62  VAL A HB   5  
ATOM   9752  H  HG11 . VAL A 1 62  ? -5.728  6.027   -2.400  1.00 10.00 ? 62  VAL A HG11 5  
ATOM   9753  H  HG12 . VAL A 1 62  ? -6.125  5.996   -0.664  1.00 10.00 ? 62  VAL A HG12 5  
ATOM   9754  H  HG13 . VAL A 1 62  ? -6.318  7.489   -1.600  1.00 10.00 ? 62  VAL A HG13 5  
ATOM   9755  H  HG21 . VAL A 1 62  ? -3.174  8.151   0.307   1.00 10.00 ? 62  VAL A HG21 5  
ATOM   9756  H  HG22 . VAL A 1 62  ? -4.631  8.955   -0.283  1.00 10.00 ? 62  VAL A HG22 5  
ATOM   9757  H  HG23 . VAL A 1 62  ? -4.767  7.617   0.884   1.00 10.00 ? 62  VAL A HG23 5  
ATOM   9758  N  N    . GLY A 1 63  ? -2.648  3.898   0.272   1.00 10.00 ? 63  GLY A N    5  
ATOM   9759  C  CA   . GLY A 1 63  ? -2.512  3.159   1.516   1.00 10.00 ? 63  GLY A CA   5  
ATOM   9760  C  C    . GLY A 1 63  ? -1.192  2.398   1.513   1.00 10.00 ? 63  GLY A C    5  
ATOM   9761  O  O    . GLY A 1 63  ? -0.742  1.981   0.449   1.00 10.00 ? 63  GLY A O    5  
ATOM   9762  H  H    . GLY A 1 63  ? -1.938  3.740   -0.434  1.00 10.00 ? 63  GLY A H    5  
ATOM   9763  H  HA2  . GLY A 1 63  ? -2.504  3.871   2.346   1.00 10.00 ? 63  GLY A HA2  5  
ATOM   9764  H  HA3  . GLY A 1 63  ? -3.344  2.466   1.636   1.00 10.00 ? 63  GLY A HA3  5  
ATOM   9765  N  N    . ALA A 1 64  ? -0.586  2.212   2.688   1.00 10.00 ? 64  ALA A N    5  
ATOM   9766  C  CA   . ALA A 1 64  ? 0.577   1.354   2.882   1.00 10.00 ? 64  ALA A CA   5  
ATOM   9767  C  C    . ALA A 1 64  ? 0.644   0.928   4.353   1.00 10.00 ? 64  ALA A C    5  
ATOM   9768  O  O    . ALA A 1 64  ? 1.439   1.470   5.113   1.00 10.00 ? 64  ALA A O    5  
ATOM   9769  C  CB   . ALA A 1 64  ? 1.845   2.095   2.438   1.00 10.00 ? 64  ALA A CB   5  
ATOM   9770  H  H    . ALA A 1 64  ? -0.980  2.649   3.507   1.00 10.00 ? 64  ALA A H    5  
ATOM   9771  H  HA   . ALA A 1 64  ? 0.475   0.455   2.271   1.00 10.00 ? 64  ALA A HA   5  
ATOM   9772  H  HB1  . ALA A 1 64  ? 2.713   1.450   2.574   1.00 10.00 ? 64  ALA A HB1  5  
ATOM   9773  H  HB2  . ALA A 1 64  ? 1.774   2.361   1.383   1.00 10.00 ? 64  ALA A HB2  5  
ATOM   9774  H  HB3  . ALA A 1 64  ? 1.979   3.004   3.024   1.00 10.00 ? 64  ALA A HB3  5  
ATOM   9775  N  N    . ALA A 1 65  ? -0.206  -0.013  4.773   1.00 10.00 ? 65  ALA A N    5  
ATOM   9776  C  CA   . ALA A 1 65  ? -0.230  -0.525  6.140   1.00 10.00 ? 65  ALA A CA   5  
ATOM   9777  C  C    . ALA A 1 65  ? 0.539   -1.845  6.209   1.00 10.00 ? 65  ALA A C    5  
ATOM   9778  O  O    . ALA A 1 65  ? 0.700   -2.521  5.197   1.00 10.00 ? 65  ALA A O    5  
ATOM   9779  C  CB   . ALA A 1 65  ? -1.681  -0.717  6.586   1.00 10.00 ? 65  ALA A CB   5  
ATOM   9780  H  H    . ALA A 1 65  ? -0.779  -0.508  4.096   1.00 10.00 ? 65  ALA A H    5  
ATOM   9781  H  HA   . ALA A 1 65  ? 0.234   0.190   6.822   1.00 10.00 ? 65  ALA A HA   5  
ATOM   9782  H  HB1  . ALA A 1 65  ? -1.707  -1.068  7.618   1.00 10.00 ? 65  ALA A HB1  5  
ATOM   9783  H  HB2  . ALA A 1 65  ? -2.216  0.231   6.522   1.00 10.00 ? 65  ALA A HB2  5  
ATOM   9784  H  HB3  . ALA A 1 65  ? -2.176  -1.451  5.949   1.00 10.00 ? 65  ALA A HB3  5  
ATOM   9785  N  N    . THR A 1 66  ? 1.016   -2.224  7.397   1.00 10.00 ? 66  THR A N    5  
ATOM   9786  C  CA   . THR A 1 66  ? 1.736   -3.471  7.631   1.00 10.00 ? 66  THR A CA   5  
ATOM   9787  C  C    . THR A 1 66  ? 1.936   -3.602  9.146   1.00 10.00 ? 66  THR A C    5  
ATOM   9788  O  O    . THR A 1 66  ? 2.148   -2.576  9.799   1.00 10.00 ? 66  THR A O    5  
ATOM   9789  C  CB   . THR A 1 66  ? 3.079   -3.464  6.870   1.00 10.00 ? 66  THR A CB   5  
ATOM   9790  O  OG1  . THR A 1 66  ? 3.837   -4.615  7.168   1.00 10.00 ? 66  THR A OG1  5  
ATOM   9791  C  CG2  . THR A 1 66  ? 3.921   -2.217  7.136   1.00 10.00 ? 66  THR A CG2  5  
ATOM   9792  H  H    . THR A 1 66  ? 0.902   -1.624  8.203   1.00 10.00 ? 66  THR A H    5  
ATOM   9793  H  HA   . THR A 1 66  ? 1.122   -4.290  7.256   1.00 10.00 ? 66  THR A HA   5  
ATOM   9794  H  HB   . THR A 1 66  ? 2.897   -3.465  5.802   1.00 10.00 ? 66  THR A HB   5  
ATOM   9795  H  HG1  . THR A 1 66  ? 3.451   -5.366  6.694   1.00 10.00 ? 66  THR A HG1  5  
ATOM   9796  H  HG21 . THR A 1 66  ? 4.134   -2.128  8.192   1.00 10.00 ? 66  THR A HG21 5  
ATOM   9797  H  HG22 . THR A 1 66  ? 4.860   -2.293  6.587   1.00 10.00 ? 66  THR A HG22 5  
ATOM   9798  H  HG23 . THR A 1 66  ? 3.386   -1.328  6.805   1.00 10.00 ? 66  THR A HG23 5  
ATOM   9799  N  N    . PRO A 1 67  ? 1.864   -4.807  9.739   1.00 10.00 ? 67  PRO A N    5  
ATOM   9800  C  CA   . PRO A 1 67  ? 2.090   -5.011  11.166  1.00 10.00 ? 67  PRO A CA   5  
ATOM   9801  C  C    . PRO A 1 67  ? 3.594   -4.942  11.469  1.00 10.00 ? 67  PRO A C    5  
ATOM   9802  O  O    . PRO A 1 67  ? 4.197   -5.907  11.929  1.00 10.00 ? 67  PRO A O    5  
ATOM   9803  C  CB   . PRO A 1 67  ? 1.480   -6.386  11.462  1.00 10.00 ? 67  PRO A CB   5  
ATOM   9804  C  CG   . PRO A 1 67  ? 1.719   -7.147  10.158  1.00 10.00 ? 67  PRO A CG   5  
ATOM   9805  C  CD   . PRO A 1 67  ? 1.522   -6.066  9.094   1.00 10.00 ? 67  PRO A CD   5  
ATOM   9806  H  HA   . PRO A 1 67  ? 1.569   -4.256  11.756  1.00 10.00 ? 67  PRO A HA   5  
ATOM   9807  H  HB2  . PRO A 1 67  ? 1.923   -6.884  12.325  1.00 10.00 ? 67  PRO A HB2  5  
ATOM   9808  H  HB3  . PRO A 1 67  ? 0.405   -6.276  11.614  1.00 10.00 ? 67  PRO A HB3  5  
ATOM   9809  H  HG2  . PRO A 1 67  ? 2.750   -7.503  10.132  1.00 10.00 ? 67  PRO A HG2  5  
ATOM   9810  H  HG3  . PRO A 1 67  ? 1.030   -7.984  10.032  1.00 10.00 ? 67  PRO A HG3  5  
ATOM   9811  H  HD2  . PRO A 1 67  ? 2.159   -6.279  8.238   1.00 10.00 ? 67  PRO A HD2  5  
ATOM   9812  H  HD3  . PRO A 1 67  ? 0.476   -6.044  8.786   1.00 10.00 ? 67  PRO A HD3  5  
ATOM   9813  N  N    . LEU A 1 68  ? 4.204   -3.790  11.184  1.00 10.00 ? 68  LEU A N    5  
ATOM   9814  C  CA   . LEU A 1 68  ? 5.647   -3.624  11.090  1.00 10.00 ? 68  LEU A CA   5  
ATOM   9815  C  C    . LEU A 1 68  ? 5.983   -2.148  11.333  1.00 10.00 ? 68  LEU A C    5  
ATOM   9816  O  O    . LEU A 1 68  ? 6.772   -1.820  12.221  1.00 10.00 ? 68  LEU A O    5  
ATOM   9817  C  CB   . LEU A 1 68  ? 6.078   -4.131  9.699   1.00 10.00 ? 68  LEU A CB   5  
ATOM   9818  C  CG   . LEU A 1 68  ? 7.520   -4.631  9.551   1.00 10.00 ? 68  LEU A CG   5  
ATOM   9819  C  CD1  . LEU A 1 68  ? 8.542   -3.498  9.574   1.00 10.00 ? 68  LEU A CD1  5  
ATOM   9820  C  CD2  . LEU A 1 68  ? 7.901   -5.701  10.581  1.00 10.00 ? 68  LEU A CD2  5  
ATOM   9821  H  H    . LEU A 1 68  ? 3.625   -3.052  10.808  1.00 10.00 ? 68  LEU A H    5  
ATOM   9822  H  HA   . LEU A 1 68  ? 6.113   -4.222  11.872  1.00 10.00 ? 68  LEU A HA   5  
ATOM   9823  H  HB2  . LEU A 1 68  ? 5.450   -4.983  9.436   1.00 10.00 ? 68  LEU A HB2  5  
ATOM   9824  H  HB3  . LEU A 1 68  ? 5.899   -3.365  8.945   1.00 10.00 ? 68  LEU A HB3  5  
ATOM   9825  H  HG   . LEU A 1 68  ? 7.553   -5.088  8.564   1.00 10.00 ? 68  LEU A HG   5  
ATOM   9826  H  HD11 . LEU A 1 68  ? 9.524   -3.889  9.305   1.00 10.00 ? 68  LEU A HD11 5  
ATOM   9827  H  HD12 . LEU A 1 68  ? 8.261   -2.728  8.855   1.00 10.00 ? 68  LEU A HD12 5  
ATOM   9828  H  HD13 . LEU A 1 68  ? 8.585   -3.080  10.577  1.00 10.00 ? 68  LEU A HD13 5  
ATOM   9829  H  HD21 . LEU A 1 68  ? 8.075   -5.255  11.559  1.00 10.00 ? 68  LEU A HD21 5  
ATOM   9830  H  HD22 . LEU A 1 68  ? 7.104   -6.440  10.662  1.00 10.00 ? 68  LEU A HD22 5  
ATOM   9831  H  HD23 . LEU A 1 68  ? 8.818   -6.198  10.260  1.00 10.00 ? 68  LEU A HD23 5  
ATOM   9832  N  N    . ALA A 1 69  ? 5.307   -1.262  10.593  1.00 10.00 ? 69  ALA A N    5  
ATOM   9833  C  CA   . ALA A 1 69  ? 5.279   0.181   10.782  1.00 10.00 ? 69  ALA A CA   5  
ATOM   9834  C  C    . ALA A 1 69  ? 4.044   0.574   11.590  1.00 10.00 ? 69  ALA A C    5  
ATOM   9835  O  O    . ALA A 1 69  ? 3.166   -0.259  11.821  1.00 10.00 ? 69  ALA A O    5  
ATOM   9836  C  CB   . ALA A 1 69  ? 5.275   0.848   9.410   1.00 10.00 ? 69  ALA A CB   5  
ATOM   9837  H  H    . ALA A 1 69  ? 4.651   -1.621  9.922   1.00 10.00 ? 69  ALA A H    5  
ATOM   9838  H  HA   . ALA A 1 69  ? 6.158   0.520   11.318  1.00 10.00 ? 69  ALA A HA   5  
ATOM   9839  H  HB1  . ALA A 1 69  ? 5.278   1.931   9.514   1.00 10.00 ? 69  ALA A HB1  5  
ATOM   9840  H  HB2  . ALA A 1 69  ? 6.175   0.534   8.884   1.00 10.00 ? 69  ALA A HB2  5  
ATOM   9841  H  HB3  . ALA A 1 69  ? 4.395   0.545   8.841   1.00 10.00 ? 69  ALA A HB3  5  
ATOM   9842  N  N    . THR A 1 70  ? 3.979   1.825   12.053  1.00 10.00 ? 70  THR A N    5  
ATOM   9843  C  CA   . THR A 1 70  ? 2.868   2.325   12.868  1.00 10.00 ? 70  THR A CA   5  
ATOM   9844  C  C    . THR A 1 70  ? 2.380   3.703   12.400  1.00 10.00 ? 70  THR A C    5  
ATOM   9845  O  O    . THR A 1 70  ? 1.443   4.252   12.975  1.00 10.00 ? 70  THR A O    5  
ATOM   9846  C  CB   . THR A 1 70  ? 3.292   2.334   14.350  1.00 10.00 ? 70  THR A CB   5  
ATOM   9847  O  OG1  . THR A 1 70  ? 3.965   1.126   14.665  1.00 10.00 ? 70  THR A OG1  5  
ATOM   9848  C  CG2  . THR A 1 70  ? 2.118   2.456   15.328  1.00 10.00 ? 70  THR A CG2  5  
ATOM   9849  H  H    . THR A 1 70  ? 4.785   2.428   11.911  1.00 10.00 ? 70  THR A H    5  
ATOM   9850  H  HA   . THR A 1 70  ? 2.010   1.660   12.765  1.00 10.00 ? 70  THR A HA   5  
ATOM   9851  H  HB   . THR A 1 70  ? 3.975   3.172   14.511  1.00 10.00 ? 70  THR A HB   5  
ATOM   9852  H  HG1  . THR A 1 70  ? 4.881   1.243   14.368  1.00 10.00 ? 70  THR A HG1  5  
ATOM   9853  H  HG21 . THR A 1 70  ? 1.351   1.715   15.107  1.00 10.00 ? 70  THR A HG21 5  
ATOM   9854  H  HG22 . THR A 1 70  ? 2.478   2.303   16.347  1.00 10.00 ? 70  THR A HG22 5  
ATOM   9855  H  HG23 . THR A 1 70  ? 1.676   3.450   15.278  1.00 10.00 ? 70  THR A HG23 5  
ATOM   9856  N  N    . SER A 1 71  ? 3.007   4.303   11.387  1.00 10.00 ? 71  SER A N    5  
ATOM   9857  C  CA   . SER A 1 71  ? 2.743   5.684   11.015  1.00 10.00 ? 71  SER A CA   5  
ATOM   9858  C  C    . SER A 1 71  ? 3.021   5.884   9.518   1.00 10.00 ? 71  SER A C    5  
ATOM   9859  O  O    . SER A 1 71  ? 4.005   6.524   9.158   1.00 10.00 ? 71  SER A O    5  
ATOM   9860  C  CB   . SER A 1 71  ? 3.622   6.559   11.919  1.00 10.00 ? 71  SER A CB   5  
ATOM   9861  O  OG   . SER A 1 71  ? 3.288   6.348   13.280  1.00 10.00 ? 71  SER A OG   5  
ATOM   9862  H  H    . SER A 1 71  ? 3.835   3.885   10.977  1.00 10.00 ? 71  SER A H    5  
ATOM   9863  H  HA   . SER A 1 71  ? 1.703   5.956   11.198  1.00 10.00 ? 71  SER A HA   5  
ATOM   9864  H  HB2  . SER A 1 71  ? 4.660   6.279   11.780  1.00 10.00 ? 71  SER A HB2  5  
ATOM   9865  H  HB3  . SER A 1 71  ? 3.527   7.614   11.675  1.00 10.00 ? 71  SER A HB3  5  
ATOM   9866  H  HG   . SER A 1 71  ? 2.413   5.939   13.328  1.00 10.00 ? 71  SER A HG   5  
ATOM   9867  N  N    . PRO A 1 72  ? 2.181   5.321   8.634   1.00 10.00 ? 72  PRO A N    5  
ATOM   9868  C  CA   . PRO A 1 72  ? 2.380   5.401   7.196   1.00 10.00 ? 72  PRO A CA   5  
ATOM   9869  C  C    . PRO A 1 72  ? 2.010   6.786   6.660   1.00 10.00 ? 72  PRO A C    5  
ATOM   9870  O  O    . PRO A 1 72  ? 0.921   7.283   6.937   1.00 10.00 ? 72  PRO A O    5  
ATOM   9871  C  CB   . PRO A 1 72  ? 1.494   4.301   6.612   1.00 10.00 ? 72  PRO A CB   5  
ATOM   9872  C  CG   . PRO A 1 72  ? 0.340   4.212   7.610   1.00 10.00 ? 72  PRO A CG   5  
ATOM   9873  C  CD   . PRO A 1 72  ? 1.024   4.495   8.948   1.00 10.00 ? 72  PRO A CD   5  
ATOM   9874  H  HA   . PRO A 1 72  ? 3.415   5.184   6.953   1.00 10.00 ? 72  PRO A HA   5  
ATOM   9875  H  HB2  . PRO A 1 72  ? 1.158   4.519   5.597   1.00 10.00 ? 72  PRO A HB2  5  
ATOM   9876  H  HB3  . PRO A 1 72  ? 2.051   3.365   6.632   1.00 10.00 ? 72  PRO A HB3  5  
ATOM   9877  H  HG2  . PRO A 1 72  ? -0.386  4.999   7.397   1.00 10.00 ? 72  PRO A HG2  5  
ATOM   9878  H  HG3  . PRO A 1 72  ? -0.148  3.237   7.589   1.00 10.00 ? 72  PRO A HG3  5  
ATOM   9879  H  HD2  . PRO A 1 72  ? 0.328   4.996   9.622   1.00 10.00 ? 72  PRO A HD2  5  
ATOM   9880  H  HD3  . PRO A 1 72  ? 1.357   3.553   9.384   1.00 10.00 ? 72  PRO A HD3  5  
ATOM   9881  N  N    . MET A 1 73  ? 2.915   7.401   5.892   1.00 10.00 ? 73  MET A N    5  
ATOM   9882  C  CA   . MET A 1 73  ? 2.749   8.723   5.299   1.00 10.00 ? 73  MET A CA   5  
ATOM   9883  C  C    . MET A 1 73  ? 3.307   8.716   3.873   1.00 10.00 ? 73  MET A C    5  
ATOM   9884  O  O    . MET A 1 73  ? 4.444   8.306   3.651   1.00 10.00 ? 73  MET A O    5  
ATOM   9885  C  CB   . MET A 1 73  ? 3.504   9.749   6.151   1.00 10.00 ? 73  MET A CB   5  
ATOM   9886  C  CG   . MET A 1 73  ? 2.811   10.052  7.484   1.00 10.00 ? 73  MET A CG   5  
ATOM   9887  S  SD   . MET A 1 73  ? 1.257   10.971  7.347   1.00 10.00 ? 73  MET A SD   5  
ATOM   9888  C  CE   . MET A 1 73  ? 0.792   11.048  9.089   1.00 10.00 ? 73  MET A CE   5  
ATOM   9889  H  H    . MET A 1 73  ? 3.817   6.950   5.758   1.00 10.00 ? 73  MET A H    5  
ATOM   9890  H  HA   . MET A 1 73  ? 1.692   8.991   5.258   1.00 10.00 ? 73  MET A HA   5  
ATOM   9891  H  HB2  . MET A 1 73  ? 4.494   9.345   6.357   1.00 10.00 ? 73  MET A HB2  5  
ATOM   9892  H  HB3  . MET A 1 73  ? 3.608   10.683  5.597   1.00 10.00 ? 73  MET A HB3  5  
ATOM   9893  H  HG2  . MET A 1 73  ? 2.622   9.122   8.018   1.00 10.00 ? 73  MET A HG2  5  
ATOM   9894  H  HG3  . MET A 1 73  ? 3.488   10.653  8.089   1.00 10.00 ? 73  MET A HG3  5  
ATOM   9895  H  HE1  . MET A 1 73  ? 1.569   11.566  9.649   1.00 10.00 ? 73  MET A HE1  5  
ATOM   9896  H  HE2  . MET A 1 73  ? -0.149  11.588  9.181   1.00 10.00 ? 73  MET A HE2  5  
ATOM   9897  H  HE3  . MET A 1 73  ? 0.670   10.035  9.473   1.00 10.00 ? 73  MET A HE3  5  
ATOM   9898  N  N    . LEU A 1 74  ? 2.522   9.176   2.900   1.00 10.00 ? 74  LEU A N    5  
ATOM   9899  C  CA   . LEU A 1 74  ? 2.941   9.287   1.506   1.00 10.00 ? 74  LEU A CA   5  
ATOM   9900  C  C    . LEU A 1 74  ? 3.689   10.611  1.295   1.00 10.00 ? 74  LEU A C    5  
ATOM   9901  O  O    . LEU A 1 74  ? 3.272   11.645  1.819   1.00 10.00 ? 74  LEU A O    5  
ATOM   9902  C  CB   . LEU A 1 74  ? 1.695   9.160   0.616   1.00 10.00 ? 74  LEU A CB   5  
ATOM   9903  C  CG   . LEU A 1 74  ? 1.228   7.690   0.569   1.00 10.00 ? 74  LEU A CG   5  
ATOM   9904  C  CD1  . LEU A 1 74  ? -0.277  7.566   0.804   1.00 10.00 ? 74  LEU A CD1  5  
ATOM   9905  C  CD2  . LEU A 1 74  ? 1.579   7.078   -0.791  1.00 10.00 ? 74  LEU A CD2  5  
ATOM   9906  H  H    . LEU A 1 74  ? 1.604   9.518   3.143   1.00 10.00 ? 74  LEU A H    5  
ATOM   9907  H  HA   . LEU A 1 74  ? 3.620   8.470   1.255   1.00 10.00 ? 74  LEU A HA   5  
ATOM   9908  H  HB2  . LEU A 1 74  ? 0.918   9.799   1.033   1.00 10.00 ? 74  LEU A HB2  5  
ATOM   9909  H  HB3  . LEU A 1 74  ? 1.884   9.515   -0.400  1.00 10.00 ? 74  LEU A HB3  5  
ATOM   9910  H  HG   . LEU A 1 74  ? 1.711   7.105   1.355   1.00 10.00 ? 74  LEU A HG   5  
ATOM   9911  H  HD11 . LEU A 1 74  ? -0.556  6.513   0.841   1.00 10.00 ? 74  LEU A HD11 5  
ATOM   9912  H  HD12 . LEU A 1 74  ? -0.550  8.038   1.748   1.00 10.00 ? 74  LEU A HD12 5  
ATOM   9913  H  HD13 . LEU A 1 74  ? -0.806  8.049   -0.013  1.00 10.00 ? 74  LEU A HD13 5  
ATOM   9914  H  HD21 . LEU A 1 74  ? 2.645   7.198   -0.987  1.00 10.00 ? 74  LEU A HD21 5  
ATOM   9915  H  HD22 . LEU A 1 74  ? 1.330   6.017   -0.794  1.00 10.00 ? 74  LEU A HD22 5  
ATOM   9916  H  HD23 . LEU A 1 74  ? 1.018   7.574   -1.584  1.00 10.00 ? 74  LEU A HD23 5  
ATOM   9917  N  N    . MET A 1 75  ? 4.803   10.565  0.553   1.00 10.00 ? 75  MET A N    5  
ATOM   9918  C  CA   . MET A 1 75  ? 5.588   11.718  0.113   1.00 10.00 ? 75  MET A CA   5  
ATOM   9919  C  C    . MET A 1 75  ? 5.315   11.967  -1.377  1.00 10.00 ? 75  MET A C    5  
ATOM   9920  O  O    . MET A 1 75  ? 4.537   11.236  -1.982  1.00 10.00 ? 75  MET A O    5  
ATOM   9921  C  CB   . MET A 1 75  ? 7.091   11.456  0.348   1.00 10.00 ? 75  MET A CB   5  
ATOM   9922  C  CG   . MET A 1 75  ? 7.765   12.598  1.117   1.00 10.00 ? 75  MET A CG   5  
ATOM   9923  S  SD   . MET A 1 75  ? 7.661   12.409  2.912   1.00 10.00 ? 75  MET A SD   5  
ATOM   9924  C  CE   . MET A 1 75  ? 8.437   13.920  3.520   1.00 10.00 ? 75  MET A CE   5  
ATOM   9925  H  H    . MET A 1 75  ? 5.052   9.675   0.133   1.00 10.00 ? 75  MET A H    5  
ATOM   9926  H  HA   . MET A 1 75  ? 5.273   12.598  0.673   1.00 10.00 ? 75  MET A HA   5  
ATOM   9927  H  HB2  . MET A 1 75  ? 7.233   10.533  0.911   1.00 10.00 ? 75  MET A HB2  5  
ATOM   9928  H  HB3  . MET A 1 75  ? 7.595   11.331  -0.611  1.00 10.00 ? 75  MET A HB3  5  
ATOM   9929  H  HG2  . MET A 1 75  ? 8.817   12.614  0.849   1.00 10.00 ? 75  MET A HG2  5  
ATOM   9930  H  HG3  . MET A 1 75  ? 7.338   13.554  0.824   1.00 10.00 ? 75  MET A HG3  5  
ATOM   9931  H  HE1  . MET A 1 75  ? 8.302   13.974  4.599   1.00 10.00 ? 75  MET A HE1  5  
ATOM   9932  H  HE2  . MET A 1 75  ? 9.502   13.911  3.303   1.00 10.00 ? 75  MET A HE2  5  
ATOM   9933  H  HE3  . MET A 1 75  ? 7.969   14.787  3.058   1.00 10.00 ? 75  MET A HE3  5  
ATOM   9934  N  N    . THR A 1 76  ? 5.958   12.982  -1.971  1.00 10.00 ? 76  THR A N    5  
ATOM   9935  C  CA   . THR A 1 76  ? 5.958   13.201  -3.415  1.00 10.00 ? 76  THR A CA   5  
ATOM   9936  C  C    . THR A 1 76  ? 7.157   14.071  -3.805  1.00 10.00 ? 76  THR A C    5  
ATOM   9937  O  O    . THR A 1 76  ? 7.138   15.282  -3.611  1.00 10.00 ? 76  THR A O    5  
ATOM   9938  C  CB   . THR A 1 76  ? 4.596   13.720  -3.891  1.00 10.00 ? 76  THR A CB   5  
ATOM   9939  O  OG1  . THR A 1 76  ? 4.589   13.951  -5.286  1.00 10.00 ? 76  THR A OG1  5  
ATOM   9940  C  CG2  . THR A 1 76  ? 4.100   14.968  -3.150  1.00 10.00 ? 76  THR A CG2  5  
ATOM   9941  H  H    . THR A 1 76  ? 6.573   13.568  -1.426  1.00 10.00 ? 76  THR A H    5  
ATOM   9942  H  HA   . THR A 1 76  ? 6.072   12.242  -3.909  1.00 10.00 ? 76  THR A HA   5  
ATOM   9943  H  HB   . THR A 1 76  ? 3.894   12.908  -3.703  1.00 10.00 ? 76  THR A HB   5  
ATOM   9944  H  HG1  . THR A 1 76  ? 5.459   14.257  -5.576  1.00 10.00 ? 76  THR A HG1  5  
ATOM   9945  H  HG21 . THR A 1 76  ? 3.098   15.207  -3.505  1.00 10.00 ? 76  THR A HG21 5  
ATOM   9946  H  HG22 . THR A 1 76  ? 4.061   14.777  -2.079  1.00 10.00 ? 76  THR A HG22 5  
ATOM   9947  H  HG23 . THR A 1 76  ? 4.756   15.817  -3.333  1.00 10.00 ? 76  THR A HG23 5  
ATOM   9948  N  N    . THR A 1 77  ? 8.229   13.470  -4.320  1.00 10.00 ? 77  THR A N    5  
ATOM   9949  C  CA   . THR A 1 77  ? 9.496   14.162  -4.513  1.00 10.00 ? 77  THR A CA   5  
ATOM   9950  C  C    . THR A 1 77  ? 10.225  13.553  -5.709  1.00 10.00 ? 77  THR A C    5  
ATOM   9951  O  O    . THR A 1 77  ? 11.355  13.099  -5.614  1.00 10.00 ? 77  THR A O    5  
ATOM   9952  C  CB   . THR A 1 77  ? 10.257  14.175  -3.172  1.00 10.00 ? 77  THR A CB   5  
ATOM   9953  O  OG1  . THR A 1 77  ? 11.571  14.685  -3.273  1.00 10.00 ? 77  THR A OG1  5  
ATOM   9954  C  CG2  . THR A 1 77  ? 10.278  12.829  -2.445  1.00 10.00 ? 77  THR A CG2  5  
ATOM   9955  H  H    . THR A 1 77  ? 8.179   12.497  -4.577  1.00 10.00 ? 77  THR A H    5  
ATOM   9956  H  HA   . THR A 1 77  ? 9.320   15.201  -4.777  1.00 10.00 ? 77  THR A HA   5  
ATOM   9957  H  HB   . THR A 1 77  ? 9.709   14.859  -2.531  1.00 10.00 ? 77  THR A HB   5  
ATOM   9958  H  HG1  . THR A 1 77  ? 12.181  14.106  -2.772  1.00 10.00 ? 77  THR A HG1  5  
ATOM   9959  H  HG21 . THR A 1 77  ? 10.684  13.008  -1.452  1.00 10.00 ? 77  THR A HG21 5  
ATOM   9960  H  HG22 . THR A 1 77  ? 9.283   12.404  -2.330  1.00 10.00 ? 77  THR A HG22 5  
ATOM   9961  H  HG23 . THR A 1 77  ? 10.931  12.140  -2.976  1.00 10.00 ? 77  THR A HG23 5  
ATOM   9962  N  N    . THR A 1 78  ? 9.555   13.557  -6.860  1.00 10.00 ? 78  THR A N    5  
ATOM   9963  C  CA   . THR A 1 78  ? 10.089  13.103  -8.138  1.00 10.00 ? 78  THR A CA   5  
ATOM   9964  C  C    . THR A 1 78  ? 9.955   14.227  -9.156  1.00 10.00 ? 78  THR A C    5  
ATOM   9965  O  O    . THR A 1 78  ? 8.978   14.967  -9.136  1.00 10.00 ? 78  THR A O    5  
ATOM   9966  C  CB   . THR A 1 78  ? 9.333   11.854  -8.611  1.00 10.00 ? 78  THR A CB   5  
ATOM   9967  O  OG1  . THR A 1 78  ? 9.791   11.408  -9.877  1.00 10.00 ? 78  THR A OG1  5  
ATOM   9968  C  CG2  . THR A 1 78  ? 7.836   12.116  -8.751  1.00 10.00 ? 78  THR A CG2  5  
ATOM   9969  H  H    . THR A 1 78  ? 8.625   13.965  -6.858  1.00 10.00 ? 78  THR A H    5  
ATOM   9970  H  HA   . THR A 1 78  ? 11.145  12.847  -8.037  1.00 10.00 ? 78  THR A HA   5  
ATOM   9971  H  HB   . THR A 1 78  ? 9.489   11.055  -7.884  1.00 10.00 ? 78  THR A HB   5  
ATOM   9972  H  HG1  . THR A 1 78  ? 10.621  10.938  -9.748  1.00 10.00 ? 78  THR A HG1  5  
ATOM   9973  H  HG21 . THR A 1 78  ? 7.399   12.572  -7.866  1.00 10.00 ? 78  THR A HG21 5  
ATOM   9974  H  HG22 . THR A 1 78  ? 7.636   12.774  -9.594  1.00 10.00 ? 78  THR A HG22 5  
ATOM   9975  H  HG23 . THR A 1 78  ? 7.367   11.151  -8.908  1.00 10.00 ? 78  THR A HG23 5  
ATOM   9976  N  N    . HIS A 1 79  ? 10.914  14.315  -10.078 1.00 10.00 ? 79  HIS A N    5  
ATOM   9977  C  CA   . HIS A 1 79  ? 10.835  15.184  -11.243 1.00 10.00 ? 79  HIS A CA   5  
ATOM   9978  C  C    . HIS A 1 79  ? 10.459  14.319  -12.451 1.00 10.00 ? 79  HIS A C    5  
ATOM   9979  O  O    . HIS A 1 79  ? 11.084  14.414  -13.504 1.00 10.00 ? 79  HIS A O    5  
ATOM   9980  C  CB   . HIS A 1 79  ? 12.182  15.897  -11.436 1.00 10.00 ? 79  HIS A CB   5  
ATOM   9981  C  CG   . HIS A 1 79  ? 12.573  16.798  -10.290 1.00 10.00 ? 79  HIS A CG   5  
ATOM   9982  N  ND1  . HIS A 1 79  ? 12.535  18.192  -10.319 1.00 10.00 ? 79  HIS A ND1  5  
ATOM   9983  C  CD2  . HIS A 1 79  ? 13.056  16.385  -9.079  1.00 10.00 ? 79  HIS A CD2  5  
ATOM   9984  C  CE1  . HIS A 1 79  ? 12.995  18.589  -9.123  1.00 10.00 ? 79  HIS A CE1  5  
ATOM   9985  N  NE2  . HIS A 1 79  ? 13.311  17.528  -8.358  1.00 10.00 ? 79  HIS A NE2  5  
ATOM   9986  H  H    . HIS A 1 79  ? 11.671  13.651  -10.047 1.00 10.00 ? 79  HIS A H    5  
ATOM   9987  H  HA   . HIS A 1 79  ? 10.065  15.948  -11.118 1.00 10.00 ? 79  HIS A HA   5  
ATOM   9988  H  HB2  . HIS A 1 79  ? 12.969  15.155  -11.582 1.00 10.00 ? 79  HIS A HB2  5  
ATOM   9989  H  HB3  . HIS A 1 79  ? 12.126  16.512  -12.335 1.00 10.00 ? 79  HIS A HB3  5  
ATOM   9990  H  HD2  . HIS A 1 79  ? 13.212  15.368  -8.751  1.00 10.00 ? 79  HIS A HD2  5  
ATOM   9991  H  HE1  . HIS A 1 79  ? 13.092  19.620  -8.814  1.00 10.00 ? 79  HIS A HE1  5  
ATOM   9992  H  HE2  . HIS A 1 79  ? 13.672  17.568  -7.415  1.00 10.00 ? 79  HIS A HE2  5  
ATOM   9993  N  N    . SER A 1 80  ? 9.475   13.426  -12.283 1.00 10.00 ? 80  SER A N    5  
ATOM   9994  C  CA   . SER A 1 80  ? 9.083   12.465  -13.309 1.00 10.00 ? 80  SER A CA   5  
ATOM   9995  C  C    . SER A 1 80  ? 7.710   11.859  -13.004 1.00 10.00 ? 80  SER A C    5  
ATOM   9996  O  O    . SER A 1 80  ? 6.854   11.828  -13.883 1.00 10.00 ? 80  SER A O    5  
ATOM   9997  C  CB   . SER A 1 80  ? 10.152  11.368  -13.449 1.00 10.00 ? 80  SER A CB   5  
ATOM   9998  O  OG   . SER A 1 80  ? 9.901   10.546  -14.574 1.00 10.00 ? 80  SER A OG   5  
ATOM   9999  H  H    . SER A 1 80  ? 8.986   13.409  -11.399 1.00 10.00 ? 80  SER A H    5  
ATOM   10000 H  HA   . SER A 1 80  ? 9.011   12.993  -14.262 1.00 10.00 ? 80  SER A HA   5  
ATOM   10001 H  HB2  . SER A 1 80  ? 11.134  11.822  -13.590 1.00 10.00 ? 80  SER A HB2  5  
ATOM   10002 H  HB3  . SER A 1 80  ? 10.180  10.754  -12.548 1.00 10.00 ? 80  SER A HB3  5  
ATOM   10003 H  HG   . SER A 1 80  ? 8.998   10.218  -14.545 1.00 10.00 ? 80  SER A HG   5  
ATOM   10004 N  N    . GLY A 1 81  ? 7.521   11.320  -11.793 1.00 10.00 ? 81  GLY A N    5  
ATOM   10005 C  CA   . GLY A 1 81  ? 6.263   10.686  -11.405 1.00 10.00 ? 81  GLY A CA   5  
ATOM   10006 C  C    . GLY A 1 81  ? 5.247   11.723  -10.915 1.00 10.00 ? 81  GLY A C    5  
ATOM   10007 O  O    . GLY A 1 81  ? 4.742   12.506  -11.716 1.00 10.00 ? 81  GLY A O    5  
ATOM   10008 H  H    . GLY A 1 81  ? 8.275   11.349  -11.111 1.00 10.00 ? 81  GLY A H    5  
ATOM   10009 H  HA2  . GLY A 1 81  ? 5.834   10.150  -12.252 1.00 10.00 ? 81  GLY A HA2  5  
ATOM   10010 H  HA3  . GLY A 1 81  ? 6.472   9.957   -10.627 1.00 10.00 ? 81  GLY A HA3  5  
ATOM   10011 N  N    . GLY A 1 82  ? 4.933   11.732  -9.614  1.00 10.00 ? 82  GLY A N    5  
ATOM   10012 C  CA   . GLY A 1 82  ? 4.137   12.795  -9.011  1.00 10.00 ? 82  GLY A CA   5  
ATOM   10013 C  C    . GLY A 1 82  ? 4.882   14.134  -8.894  1.00 10.00 ? 82  GLY A C    5  
ATOM   10014 O  O    . GLY A 1 82  ? 5.668   14.512  -9.759  1.00 10.00 ? 82  GLY A O    5  
ATOM   10015 H  H    . GLY A 1 82  ? 5.279   11.004  -8.976  1.00 10.00 ? 82  GLY A H    5  
ATOM   10016 H  HA2  . GLY A 1 82  ? 3.224   12.947  -9.588  1.00 10.00 ? 82  GLY A HA2  5  
ATOM   10017 H  HA3  . GLY A 1 82  ? 3.859   12.471  -8.012  1.00 10.00 ? 82  GLY A HA3  5  
ATOM   10018 N  N    . MET A 1 83  ? 4.608   14.876  -7.815  1.00 10.00 ? 83  MET A N    5  
ATOM   10019 C  CA   . MET A 1 83  ? 5.169   16.197  -7.546  1.00 10.00 ? 83  MET A CA   5  
ATOM   10020 C  C    . MET A 1 83  ? 6.624   16.062  -7.072  1.00 10.00 ? 83  MET A C    5  
ATOM   10021 O  O    . MET A 1 83  ? 7.040   14.984  -6.639  1.00 10.00 ? 83  MET A O    5  
ATOM   10022 C  CB   . MET A 1 83  ? 4.260   16.909  -6.524  1.00 10.00 ? 83  MET A CB   5  
ATOM   10023 C  CG   . MET A 1 83  ? 4.461   18.427  -6.425  1.00 10.00 ? 83  MET A CG   5  
ATOM   10024 S  SD   . MET A 1 83  ? 3.311   19.335  -5.348  1.00 10.00 ? 83  MET A SD   5  
ATOM   10025 C  CE   . MET A 1 83  ? 1.715   18.946  -6.100  1.00 10.00 ? 83  MET A CE   5  
ATOM   10026 H  H    . MET A 1 83  ? 4.075   14.446  -7.066  1.00 10.00 ? 83  MET A H    5  
ATOM   10027 H  HA   . MET A 1 83  ? 5.155   16.763  -8.479  1.00 10.00 ? 83  MET A HA   5  
ATOM   10028 H  HB2  . MET A 1 83  ? 3.230   16.729  -6.829  1.00 10.00 ? 83  MET A HB2  5  
ATOM   10029 H  HB3  . MET A 1 83  ? 4.406   16.479  -5.536  1.00 10.00 ? 83  MET A HB3  5  
ATOM   10030 H  HG2  . MET A 1 83  ? 5.456   18.634  -6.036  1.00 10.00 ? 83  MET A HG2  5  
ATOM   10031 H  HG3  . MET A 1 83  ? 4.380   18.857  -7.424  1.00 10.00 ? 83  MET A HG3  5  
ATOM   10032 H  HE1  . MET A 1 83  ? 1.737   19.215  -7.156  1.00 10.00 ? 83  MET A HE1  5  
ATOM   10033 H  HE2  . MET A 1 83  ? 1.495   17.885  -5.993  1.00 10.00 ? 83  MET A HE2  5  
ATOM   10034 H  HE3  . MET A 1 83  ? 0.938   19.522  -5.599  1.00 10.00 ? 83  MET A HE3  5  
ATOM   10035 N  N    . ALA A 1 84  ? 7.381   17.166  -7.123  1.00 10.00 ? 84  ALA A N    5  
ATOM   10036 C  CA   . ALA A 1 84  ? 8.814   17.229  -6.900  1.00 10.00 ? 84  ALA A CA   5  
ATOM   10037 C  C    . ALA A 1 84  ? 9.051   18.027  -5.624  1.00 10.00 ? 84  ALA A C    5  
ATOM   10038 O  O    . ALA A 1 84  ? 9.800   19.001  -5.634  1.00 10.00 ? 84  ALA A O    5  
ATOM   10039 C  CB   . ALA A 1 84  ? 9.465   17.926  -8.102  1.00 10.00 ? 84  ALA A CB   5  
ATOM   10040 H  H    . ALA A 1 84  ? 6.950   18.059  -7.290  1.00 10.00 ? 84  ALA A H    5  
ATOM   10041 H  HA   . ALA A 1 84  ? 9.251   16.238  -6.801  1.00 10.00 ? 84  ALA A HA   5  
ATOM   10042 H  HB1  . ALA A 1 84  ? 9.222   17.412  -9.030  1.00 10.00 ? 84  ALA A HB1  5  
ATOM   10043 H  HB2  . ALA A 1 84  ? 9.115   18.956  -8.179  1.00 10.00 ? 84  ALA A HB2  5  
ATOM   10044 H  HB3  . ALA A 1 84  ? 10.546  17.926  -7.973  1.00 10.00 ? 84  ALA A HB3  5  
ATOM   10045 N  N    . GLY A 1 85  ? 8.348   17.671  -4.546  1.00 10.00 ? 85  GLY A N    5  
ATOM   10046 C  CA   . GLY A 1 85  ? 8.270   18.510  -3.368  1.00 10.00 ? 85  GLY A CA   5  
ATOM   10047 C  C    . GLY A 1 85  ? 8.198   17.657  -2.107  1.00 10.00 ? 85  GLY A C    5  
ATOM   10048 O  O    . GLY A 1 85  ? 7.100   17.281  -1.703  1.00 10.00 ? 85  GLY A O    5  
ATOM   10049 H  H    . GLY A 1 85  ? 7.796   16.816  -4.549  1.00 10.00 ? 85  GLY A H    5  
ATOM   10050 H  HA2  . GLY A 1 85  ? 9.113   19.190  -3.347  1.00 10.00 ? 85  GLY A HA2  5  
ATOM   10051 H  HA3  . GLY A 1 85  ? 7.364   19.110  -3.440  1.00 10.00 ? 85  GLY A HA3  5  
ATOM   10052 N  N    . MET A 1 86  ? 9.338   17.345  -1.480  1.00 10.00 ? 86  MET A N    5  
ATOM   10053 C  CA   . MET A 1 86  ? 9.381   16.486  -0.301  1.00 10.00 ? 86  MET A CA   5  
ATOM   10054 C  C    . MET A 1 86  ? 8.651   17.110  0.892   1.00 10.00 ? 86  MET A C    5  
ATOM   10055 O  O    . MET A 1 86  ? 9.242   17.712  1.784   1.00 10.00 ? 86  MET A O    5  
ATOM   10056 C  CB   . MET A 1 86  ? 10.819  16.078  0.028   1.00 10.00 ? 86  MET A CB   5  
ATOM   10057 C  CG   . MET A 1 86  ? 10.876  15.151  1.247   1.00 10.00 ? 86  MET A CG   5  
ATOM   10058 S  SD   . MET A 1 86  ? 12.336  14.098  1.420   1.00 10.00 ? 86  MET A SD   5  
ATOM   10059 C  CE   . MET A 1 86  ? 13.644  15.343  1.407   1.00 10.00 ? 86  MET A CE   5  
ATOM   10060 H  H    . MET A 1 86  ? 10.215  17.669  -1.863  1.00 10.00 ? 86  MET A H    5  
ATOM   10061 H  HA   . MET A 1 86  ? 8.855   15.564  -0.555  1.00 10.00 ? 86  MET A HA   5  
ATOM   10062 H  HB2  . MET A 1 86  ? 11.228  15.552  -0.829  1.00 10.00 ? 86  MET A HB2  5  
ATOM   10063 H  HB3  . MET A 1 86  ? 11.412  16.964  0.221   1.00 10.00 ? 86  MET A HB3  5  
ATOM   10064 H  HG2  . MET A 1 86  ? 10.794  15.745  2.157   1.00 10.00 ? 86  MET A HG2  5  
ATOM   10065 H  HG3  . MET A 1 86  ? 10.030  14.476  1.186   1.00 10.00 ? 86  MET A HG3  5  
ATOM   10066 H  HE1  . MET A 1 86  ? 13.642  15.856  0.446   1.00 10.00 ? 86  MET A HE1  5  
ATOM   10067 H  HE2  . MET A 1 86  ? 13.483  16.056  2.213   1.00 10.00 ? 86  MET A HE2  5  
ATOM   10068 H  HE3  . MET A 1 86  ? 14.603  14.845  1.539   1.00 10.00 ? 86  MET A HE3  5  
ATOM   10069 N  N    . LYS A 1 87  ? 7.344   16.885  0.899   1.00 10.00 ? 87  LYS A N    5  
ATOM   10070 C  CA   . LYS A 1 87  ? 6.395   17.149  1.961   1.00 10.00 ? 87  LYS A CA   5  
ATOM   10071 C  C    . LYS A 1 87  ? 5.536   15.895  2.106   1.00 10.00 ? 87  LYS A C    5  
ATOM   10072 O  O    . LYS A 1 87  ? 5.412   15.134  1.145   1.00 10.00 ? 87  LYS A O    5  
ATOM   10073 C  CB   . LYS A 1 87  ? 5.548   18.381  1.599   1.00 10.00 ? 87  LYS A CB   5  
ATOM   10074 C  CG   . LYS A 1 87  ? 4.743   18.211  0.292   1.00 10.00 ? 87  LYS A CG   5  
ATOM   10075 C  CD   . LYS A 1 87  ? 4.875   19.450  -0.608  1.00 10.00 ? 87  LYS A CD   5  
ATOM   10076 C  CE   . LYS A 1 87  ? 4.478   19.213  -2.075  1.00 10.00 ? 87  LYS A CE   5  
ATOM   10077 N  NZ   . LYS A 1 87  ? 3.147   18.601  -2.247  1.00 10.00 ? 87  LYS A NZ   5  
ATOM   10078 H  H    . LYS A 1 87  ? 6.988   16.449  0.057   1.00 10.00 ? 87  LYS A H    5  
ATOM   10079 H  HA   . LYS A 1 87  ? 6.938   17.333  2.890   1.00 10.00 ? 87  LYS A HA   5  
ATOM   10080 H  HB2  . LYS A 1 87  ? 4.854   18.588  2.415   1.00 10.00 ? 87  LYS A HB2  5  
ATOM   10081 H  HB3  . LYS A 1 87  ? 6.228   19.230  1.521   1.00 10.00 ? 87  LYS A HB3  5  
ATOM   10082 H  HG2  . LYS A 1 87  ? 5.093   17.340  -0.260  1.00 10.00 ? 87  LYS A HG2  5  
ATOM   10083 H  HG3  . LYS A 1 87  ? 3.698   18.045  0.558   1.00 10.00 ? 87  LYS A HG3  5  
ATOM   10084 H  HD2  . LYS A 1 87  ? 4.299   20.271  -0.177  1.00 10.00 ? 87  LYS A HD2  5  
ATOM   10085 H  HD3  . LYS A 1 87  ? 5.926   19.747  -0.627  1.00 10.00 ? 87  LYS A HD3  5  
ATOM   10086 H  HE2  . LYS A 1 87  ? 4.507   20.170  -2.599  1.00 10.00 ? 87  LYS A HE2  5  
ATOM   10087 H  HE3  . LYS A 1 87  ? 5.203   18.552  -2.549  1.00 10.00 ? 87  LYS A HE3  5  
ATOM   10088 H  HZ1  . LYS A 1 87  ? 3.131   17.687  -1.818  1.00 10.00 ? 87  LYS A HZ1  5  
ATOM   10089 H  HZ2  . LYS A 1 87  ? 2.431   19.184  -1.839  1.00 10.00 ? 87  LYS A HZ2  5  
ATOM   10090 H  HZ3  . LYS A 1 87  ? 2.972   18.499  -3.243  1.00 10.00 ? 87  LYS A HZ3  5  
ATOM   10091 N  N    . MET A 1 88  ? 4.931   15.687  3.275   1.00 10.00 ? 88  MET A N    5  
ATOM   10092 C  CA   . MET A 1 88  ? 3.996   14.587  3.457   1.00 10.00 ? 88  MET A CA   5  
ATOM   10093 C  C    . MET A 1 88  ? 2.660   15.038  2.871   1.00 10.00 ? 88  MET A C    5  
ATOM   10094 O  O    . MET A 1 88  ? 2.330   16.223  2.931   1.00 10.00 ? 88  MET A O    5  
ATOM   10095 C  CB   . MET A 1 88  ? 3.863   14.240  4.945   1.00 10.00 ? 88  MET A CB   5  
ATOM   10096 C  CG   . MET A 1 88  ? 5.181   13.690  5.504   1.00 10.00 ? 88  MET A CG   5  
ATOM   10097 S  SD   . MET A 1 88  ? 5.133   13.052  7.199   1.00 10.00 ? 88  MET A SD   5  
ATOM   10098 C  CE   . MET A 1 88  ? 4.646   14.530  8.115   1.00 10.00 ? 88  MET A CE   5  
ATOM   10099 H  H    . MET A 1 88  ? 5.000   16.379  4.005   1.00 10.00 ? 88  MET A H    5  
ATOM   10100 H  HA   . MET A 1 88  ? 4.352   13.704  2.925   1.00 10.00 ? 88  MET A HA   5  
ATOM   10101 H  HB2  . MET A 1 88  ? 3.561   15.128  5.500   1.00 10.00 ? 88  MET A HB2  5  
ATOM   10102 H  HB3  . MET A 1 88  ? 3.094   13.474  5.061   1.00 10.00 ? 88  MET A HB3  5  
ATOM   10103 H  HG2  . MET A 1 88  ? 5.495   12.858  4.875   1.00 10.00 ? 88  MET A HG2  5  
ATOM   10104 H  HG3  . MET A 1 88  ? 5.943   14.466  5.463   1.00 10.00 ? 88  MET A HG3  5  
ATOM   10105 H  HE1  . MET A 1 88  ? 5.360   15.330  7.923   1.00 10.00 ? 88  MET A HE1  5  
ATOM   10106 H  HE2  . MET A 1 88  ? 3.648   14.840  7.809   1.00 10.00 ? 88  MET A HE2  5  
ATOM   10107 H  HE3  . MET A 1 88  ? 4.638   14.296  9.178   1.00 10.00 ? 88  MET A HE3  5  
ATOM   10108 N  N    . VAL A 1 89  ? 1.928   14.117  2.246   1.00 10.00 ? 89  VAL A N    5  
ATOM   10109 C  CA   . VAL A 1 89  ? 0.728   14.422  1.482   1.00 10.00 ? 89  VAL A CA   5  
ATOM   10110 C  C    . VAL A 1 89  ? -0.316  13.326  1.699   1.00 10.00 ? 89  VAL A C    5  
ATOM   10111 O  O    . VAL A 1 89  ? 0.042   12.241  2.156   1.00 10.00 ? 89  VAL A O    5  
ATOM   10112 C  CB   . VAL A 1 89  ? 1.090   14.541  -0.016  1.00 10.00 ? 89  VAL A CB   5  
ATOM   10113 C  CG1  . VAL A 1 89  ? 1.810   15.859  -0.310  1.00 10.00 ? 89  VAL A CG1  5  
ATOM   10114 C  CG2  . VAL A 1 89  ? 1.959   13.375  -0.511  1.00 10.00 ? 89  VAL A CG2  5  
ATOM   10115 H  H    . VAL A 1 89  ? 2.247   13.149  2.229   1.00 10.00 ? 89  VAL A H    5  
ATOM   10116 H  HA   . VAL A 1 89  ? 0.306   15.360  1.842   1.00 10.00 ? 89  VAL A HA   5  
ATOM   10117 H  HB   . VAL A 1 89  ? 0.176   14.534  -0.608  1.00 10.00 ? 89  VAL A HB   5  
ATOM   10118 H  HG11 . VAL A 1 89  ? 1.913   15.971  -1.389  1.00 10.00 ? 89  VAL A HG11 5  
ATOM   10119 H  HG12 . VAL A 1 89  ? 1.231   16.697  0.079   1.00 10.00 ? 89  VAL A HG12 5  
ATOM   10120 H  HG13 . VAL A 1 89  ? 2.799   15.856  0.148   1.00 10.00 ? 89  VAL A HG13 5  
ATOM   10121 H  HG21 . VAL A 1 89  ? 2.072   13.436  -1.592  1.00 10.00 ? 89  VAL A HG21 5  
ATOM   10122 H  HG22 . VAL A 1 89  ? 2.952   13.421  -0.064  1.00 10.00 ? 89  VAL A HG22 5  
ATOM   10123 H  HG23 . VAL A 1 89  ? 1.496   12.421  -0.263  1.00 10.00 ? 89  VAL A HG23 5  
ATOM   10124 N  N    . PRO A 1 90  ? -1.588  13.574  1.329   1.00 10.00 ? 90  PRO A N    5  
ATOM   10125 C  CA   . PRO A 1 90  ? -2.550  12.514  1.061   1.00 10.00 ? 90  PRO A CA   5  
ATOM   10126 C  C    . PRO A 1 90  ? -1.903  11.404  0.231   1.00 10.00 ? 90  PRO A C    5  
ATOM   10127 O  O    . PRO A 1 90  ? -1.920  10.259  0.665   1.00 10.00 ? 90  PRO A O    5  
ATOM   10128 C  CB   . PRO A 1 90  ? -3.759  13.181  0.395   1.00 10.00 ? 90  PRO A CB   5  
ATOM   10129 C  CG   . PRO A 1 90  ? -3.244  14.546  -0.062  1.00 10.00 ? 90  PRO A CG   5  
ATOM   10130 C  CD   . PRO A 1 90  ? -2.154  14.864  0.956   1.00 10.00 ? 90  PRO A CD   5  
ATOM   10131 H  HA   . PRO A 1 90  ? -2.935  12.054  1.967   1.00 10.00 ? 90  PRO A HA   5  
ATOM   10132 H  HB2  . PRO A 1 90  ? -4.177  12.582  -0.412  1.00 10.00 ? 90  PRO A HB2  5  
ATOM   10133 H  HB3  . PRO A 1 90  ? -4.528  13.343  1.152   1.00 10.00 ? 90  PRO A HB3  5  
ATOM   10134 H  HG2  . PRO A 1 90  ? -2.786  14.462  -1.045  1.00 10.00 ? 90  PRO A HG2  5  
ATOM   10135 H  HG3  . PRO A 1 90  ? -4.031  15.301  -0.079  1.00 10.00 ? 90  PRO A HG3  5  
ATOM   10136 H  HD2  . PRO A 1 90  ? -1.452  15.571  0.518   1.00 10.00 ? 90  PRO A HD2  5  
ATOM   10137 H  HD3  . PRO A 1 90  ? -2.606  15.310  1.843   1.00 10.00 ? 90  PRO A HD3  5  
ATOM   10138 N  N    . TRP A 1 91  ? -1.313  11.751  -0.920  1.00 10.00 ? 91  TRP A N    5  
ATOM   10139 C  CA   . TRP A 1 91  ? -0.676  10.866  -1.882  1.00 10.00 ? 91  TRP A CA   5  
ATOM   10140 C  C    . TRP A 1 91  ? -0.246  11.691  -3.093  1.00 10.00 ? 91  TRP A C    5  
ATOM   10141 O  O    . TRP A 1 91  ? -0.038  12.900  -2.981  1.00 10.00 ? 91  TRP A O    5  
ATOM   10142 C  CB   . TRP A 1 91  ? -1.633  9.752   -2.313  1.00 10.00 ? 91  TRP A CB   5  
ATOM   10143 C  CG   . TRP A 1 91  ? -2.815  10.095  -3.160  1.00 10.00 ? 91  TRP A CG   5  
ATOM   10144 C  CD1  . TRP A 1 91  ? -3.451  9.161   -3.880  1.00 10.00 ? 91  TRP A CD1  5  
ATOM   10145 C  CD2  . TRP A 1 91  ? -3.645  11.294  -3.258  1.00 10.00 ? 91  TRP A CD2  5  
ATOM   10146 N  NE1  . TRP A 1 91  ? -4.728  9.584   -4.141  1.00 10.00 ? 91  TRP A NE1  5  
ATOM   10147 C  CE2  . TRP A 1 91  ? -4.920  10.883  -3.729  1.00 10.00 ? 91  TRP A CE2  5  
ATOM   10148 C  CE3  . TRP A 1 91  ? -3.492  12.672  -2.993  1.00 10.00 ? 91  TRP A CE3  5  
ATOM   10149 C  CZ2  . TRP A 1 91  ? -6.026  11.735  -3.720  1.00 10.00 ? 91  TRP A CZ2  5  
ATOM   10150 C  CZ3  . TRP A 1 91  ? -4.572  13.568  -3.108  1.00 10.00 ? 91  TRP A CZ3  5  
ATOM   10151 C  CH2  . TRP A 1 91  ? -5.855  13.091  -3.413  1.00 10.00 ? 91  TRP A CH2  5  
ATOM   10152 H  H    . TRP A 1 91  ? -1.258  12.721  -1.177  1.00 10.00 ? 91  TRP A H    5  
ATOM   10153 H  HA   . TRP A 1 91  ? 0.204   10.424  -1.427  1.00 10.00 ? 91  TRP A HA   5  
ATOM   10154 H  HB2  . TRP A 1 91  ? -1.081  8.950   -2.797  1.00 10.00 ? 91  TRP A HB2  5  
ATOM   10155 H  HB3  . TRP A 1 91  ? -2.062  9.279   -1.444  1.00 10.00 ? 91  TRP A HB3  5  
ATOM   10156 H  HD1  . TRP A 1 91  ? -3.079  8.160   -3.979  1.00 10.00 ? 91  TRP A HD1  5  
ATOM   10157 H  HE1  . TRP A 1 91  ? -5.402  8.974   -4.567  1.00 10.00 ? 91  TRP A HE1  5  
ATOM   10158 H  HE3  . TRP A 1 91  ? -2.527  13.059  -2.738  1.00 10.00 ? 91  TRP A HE3  5  
ATOM   10159 H  HZ2  . TRP A 1 91  ? -6.998  11.315  -3.848  1.00 10.00 ? 91  TRP A HZ2  5  
ATOM   10160 H  HZ3  . TRP A 1 91  ? -4.421  14.622  -2.925  1.00 10.00 ? 91  TRP A HZ3  5  
ATOM   10161 H  HH2  . TRP A 1 91  ? -6.699  13.765  -3.420  1.00 10.00 ? 91  TRP A HH2  5  
ATOM   10162 N  N    . LEU A 1 92  ? -0.241  11.049  -4.259  1.00 10.00 ? 92  LEU A N    5  
ATOM   10163 C  CA   . LEU A 1 92  ? -0.257  11.655  -5.569  1.00 10.00 ? 92  LEU A CA   5  
ATOM   10164 C  C    . LEU A 1 92  ? -1.072  10.714  -6.461  1.00 10.00 ? 92  LEU A C    5  
ATOM   10165 O  O    . LEU A 1 92  ? -1.259  9.546   -6.118  1.00 10.00 ? 92  LEU A O    5  
ATOM   10166 C  CB   . LEU A 1 92  ? 1.175   11.942  -6.053  1.00 10.00 ? 92  LEU A CB   5  
ATOM   10167 C  CG   . LEU A 1 92  ? 2.085   10.747  -6.400  1.00 10.00 ? 92  LEU A CG   5  
ATOM   10168 C  CD1  . LEU A 1 92  ? 2.139   9.636   -5.345  1.00 10.00 ? 92  LEU A CD1  5  
ATOM   10169 C  CD2  . LEU A 1 92  ? 1.783   10.169  -7.787  1.00 10.00 ? 92  LEU A CD2  5  
ATOM   10170 H  H    . LEU A 1 92  ? -0.517  10.074  -4.272  1.00 10.00 ? 92  LEU A H    5  
ATOM   10171 H  HA   . LEU A 1 92  ? -0.789  12.605  -5.499  1.00 10.00 ? 92  LEU A HA   5  
ATOM   10172 H  HB2  . LEU A 1 92  ? 1.115   12.590  -6.928  1.00 10.00 ? 92  LEU A HB2  5  
ATOM   10173 H  HB3  . LEU A 1 92  ? 1.674   12.514  -5.269  1.00 10.00 ? 92  LEU A HB3  5  
ATOM   10174 H  HG   . LEU A 1 92  ? 3.095   11.153  -6.443  1.00 10.00 ? 92  LEU A HG   5  
ATOM   10175 H  HD11 . LEU A 1 92  ? 2.935   8.939   -5.603  1.00 10.00 ? 92  LEU A HD11 5  
ATOM   10176 H  HD12 . LEU A 1 92  ? 2.363   10.066  -4.368  1.00 10.00 ? 92  LEU A HD12 5  
ATOM   10177 H  HD13 . LEU A 1 92  ? 1.202   9.084   -5.302  1.00 10.00 ? 92  LEU A HD13 5  
ATOM   10178 H  HD21 . LEU A 1 92  ? 2.647   9.598   -8.122  1.00 10.00 ? 92  LEU A HD21 5  
ATOM   10179 H  HD22 . LEU A 1 92  ? 0.918   9.509   -7.756  1.00 10.00 ? 92  LEU A HD22 5  
ATOM   10180 H  HD23 . LEU A 1 92  ? 1.606   10.967  -8.507  1.00 10.00 ? 92  LEU A HD23 5  
ATOM   10181 N  N    . THR A 1 93  ? -1.609  11.227  -7.567  1.00 10.00 ? 93  THR A N    5  
ATOM   10182 C  CA   . THR A 1 93  ? -2.377  10.449  -8.532  1.00 10.00 ? 93  THR A CA   5  
ATOM   10183 C  C    . THR A 1 93  ? -1.454  10.051  -9.677  1.00 10.00 ? 93  THR A C    5  
ATOM   10184 O  O    . THR A 1 93  ? -0.861  10.931  -10.295 1.00 10.00 ? 93  THR A O    5  
ATOM   10185 C  CB   . THR A 1 93  ? -3.569  11.295  -9.008  1.00 10.00 ? 93  THR A CB   5  
ATOM   10186 O  OG1  . THR A 1 93  ? -4.460  11.458  -7.920  1.00 10.00 ? 93  THR A OG1  5  
ATOM   10187 C  CG2  . THR A 1 93  ? -4.331  10.687  -10.192 1.00 10.00 ? 93  THR A CG2  5  
ATOM   10188 H  H    . THR A 1 93  ? -1.375  12.177  -7.809  1.00 10.00 ? 93  THR A H    5  
ATOM   10189 H  HA   . THR A 1 93  ? -2.759  9.540   -8.071  1.00 10.00 ? 93  THR A HA   5  
ATOM   10190 H  HB   . THR A 1 93  ? -3.208  12.277  -9.321  1.00 10.00 ? 93  THR A HB   5  
ATOM   10191 H  HG1  . THR A 1 93  ? -3.956  11.796  -7.174  1.00 10.00 ? 93  THR A HG1  5  
ATOM   10192 H  HG21 . THR A 1 93  ? -3.707  10.693  -11.086 1.00 10.00 ? 93  THR A HG21 5  
ATOM   10193 H  HG22 . THR A 1 93  ? -4.637  9.665   -9.982  1.00 10.00 ? 93  THR A HG22 5  
ATOM   10194 H  HG23 . THR A 1 93  ? -5.219  11.288  -10.390 1.00 10.00 ? 93  THR A HG23 5  
ATOM   10195 N  N    . ILE A 1 94  ? -1.345  8.750   -9.979  1.00 10.00 ? 94  ILE A N    5  
ATOM   10196 C  CA   . ILE A 1 94  ? -0.628  8.301   -11.162 1.00 10.00 ? 94  ILE A CA   5  
ATOM   10197 C  C    . ILE A 1 94  ? -1.677  8.242   -12.272 1.00 10.00 ? 94  ILE A C    5  
ATOM   10198 O  O    . ILE A 1 94  ? -2.709  7.591   -12.094 1.00 10.00 ? 94  ILE A O    5  
ATOM   10199 C  CB   . ILE A 1 94  ? 0.110   6.966   -10.916 1.00 10.00 ? 94  ILE A CB   5  
ATOM   10200 C  CG1  . ILE A 1 94  ? -0.808  5.738   -10.804 1.00 10.00 ? 94  ILE A CG1  5  
ATOM   10201 C  CG2  . ILE A 1 94  ? 0.927   7.081   -9.620  1.00 10.00 ? 94  ILE A CG2  5  
ATOM   10202 C  CD1  . ILE A 1 94  ? -0.965  4.982   -12.127 1.00 10.00 ? 94  ILE A CD1  5  
ATOM   10203 H  H    . ILE A 1 94  ? -1.930  8.060   -9.524  1.00 10.00 ? 94  ILE A H    5  
ATOM   10204 H  HA   . ILE A 1 94  ? 0.150   9.024   -11.402 1.00 10.00 ? 94  ILE A HA   5  
ATOM   10205 H  HB   . ILE A 1 94  ? 0.806   6.801   -11.747 1.00 10.00 ? 94  ILE A HB   5  
ATOM   10206 H  HG12 . ILE A 1 94  ? -0.393  5.031   -10.088 1.00 10.00 ? 94  ILE A HG12 5  
ATOM   10207 H  HG13 . ILE A 1 94  ? -1.779  6.053   -10.433 1.00 10.00 ? 94  ILE A HG13 5  
ATOM   10208 H  HG21 . ILE A 1 94  ? 1.554   7.970   -9.661  1.00 10.00 ? 94  ILE A HG21 5  
ATOM   10209 H  HG22 . ILE A 1 94  ? 0.267   7.145   -8.750  1.00 10.00 ? 94  ILE A HG22 5  
ATOM   10210 H  HG23 . ILE A 1 94  ? 1.569   6.207   -9.508  1.00 10.00 ? 94  ILE A HG23 5  
ATOM   10211 H  HD11 . ILE A 1 94  ? -1.319  5.638   -12.920 1.00 10.00 ? 94  ILE A HD11 5  
ATOM   10212 H  HD12 . ILE A 1 94  ? -0.007  4.554   -12.422 1.00 10.00 ? 94  ILE A HD12 5  
ATOM   10213 H  HD13 . ILE A 1 94  ? -1.685  4.176   -11.987 1.00 10.00 ? 94  ILE A HD13 5  
ATOM   10214 N  N    . PRO A 1 95  ? -1.505  8.966   -13.381 1.00 10.00 ? 95  PRO A N    5  
ATOM   10215 C  CA   . PRO A 1 95  ? -2.466  8.898   -14.453 1.00 10.00 ? 95  PRO A CA   5  
ATOM   10216 C  C    . PRO A 1 95  ? -2.194  7.654   -15.295 1.00 10.00 ? 95  PRO A C    5  
ATOM   10217 O  O    . PRO A 1 95  ? -1.039  7.280   -15.503 1.00 10.00 ? 95  PRO A O    5  
ATOM   10218 C  CB   . PRO A 1 95  ? -2.243  10.162  -15.268 1.00 10.00 ? 95  PRO A CB   5  
ATOM   10219 C  CG   . PRO A 1 95  ? -0.743  10.420  -15.103 1.00 10.00 ? 95  PRO A CG   5  
ATOM   10220 C  CD   . PRO A 1 95  ? -0.452  9.924   -13.682 1.00 10.00 ? 95  PRO A CD   5  
ATOM   10221 H  HA   . PRO A 1 95  ? -3.487  8.895   -14.073 1.00 10.00 ? 95  PRO A HA   5  
ATOM   10222 H  HB2  . PRO A 1 95  ? -2.553  9.980   -16.294 1.00 10.00 ? 95  PRO A HB2  5  
ATOM   10223 H  HB3  . PRO A 1 95  ? -2.809  10.987  -14.832 1.00 10.00 ? 95  PRO A HB3  5  
ATOM   10224 H  HG2  . PRO A 1 95  ? -0.189  9.812   -15.820 1.00 10.00 ? 95  PRO A HG2  5  
ATOM   10225 H  HG3  . PRO A 1 95  ? -0.488  11.473  -15.233 1.00 10.00 ? 95  PRO A HG3  5  
ATOM   10226 H  HD2  . PRO A 1 95  ? 0.538   9.468   -13.642 1.00 10.00 ? 95  PRO A HD2  5  
ATOM   10227 H  HD3  . PRO A 1 95  ? -0.512  10.762  -12.984 1.00 10.00 ? 95  PRO A HD3  5  
ATOM   10228 N  N    . ALA A 1 96  ? -3.265  7.057   -15.820 1.00 10.00 ? 96  ALA A N    5  
ATOM   10229 C  CA   . ALA A 1 96  ? -3.201  6.038   -16.851 1.00 10.00 ? 96  ALA A CA   5  
ATOM   10230 C  C    . ALA A 1 96  ? -2.161  4.946   -16.538 1.00 10.00 ? 96  ALA A C    5  
ATOM   10231 O  O    . ALA A 1 96  ? -1.997  4.517   -15.393 1.00 10.00 ? 96  ALA A O    5  
ATOM   10232 C  CB   . ALA A 1 96  ? -2.992  6.741   -18.202 1.00 10.00 ? 96  ALA A CB   5  
ATOM   10233 H  H    . ALA A 1 96  ? -4.178  7.411   -15.582 1.00 10.00 ? 96  ALA A H    5  
ATOM   10234 H  HA   . ALA A 1 96  ? -4.173  5.569   -16.903 1.00 10.00 ? 96  ALA A HA   5  
ATOM   10235 H  HB1  . ALA A 1 96  ? -1.986  7.158   -18.265 1.00 10.00 ? 96  ALA A HB1  5  
ATOM   10236 H  HB2  . ALA A 1 96  ? -3.155  6.053   -19.031 1.00 10.00 ? 96  ALA A HB2  5  
ATOM   10237 H  HB3  . ALA A 1 96  ? -3.712  7.553   -18.304 1.00 10.00 ? 96  ALA A HB3  5  
ATOM   10238 N  N    . ARG A 1 97  ? -1.420  4.537   -17.565 1.00 10.00 ? 97  ARG A N    5  
ATOM   10239 C  CA   . ARG A 1 97  ? -0.350  3.548   -17.555 1.00 10.00 ? 97  ARG A CA   5  
ATOM   10240 C  C    . ARG A 1 97  ? 0.890   3.957   -16.738 1.00 10.00 ? 97  ARG A C    5  
ATOM   10241 O  O    . ARG A 1 97  ? 2.014   3.629   -17.119 1.00 10.00 ? 97  ARG A O    5  
ATOM   10242 C  CB   . ARG A 1 97  ? 0.061   3.348   -19.013 1.00 10.00 ? 97  ARG A CB   5  
ATOM   10243 C  CG   . ARG A 1 97  ? 0.548   4.692   -19.595 1.00 10.00 ? 97  ARG A CG   5  
ATOM   10244 C  CD   . ARG A 1 97  ? 1.270   4.455   -20.905 1.00 10.00 ? 97  ARG A CD   5  
ATOM   10245 N  NE   . ARG A 1 97  ? 0.295   3.939   -21.877 1.00 10.00 ? 97  ARG A NE   5  
ATOM   10246 C  CZ   . ARG A 1 97  ? 0.544   3.306   -23.027 1.00 10.00 ? 97  ARG A CZ   5  
ATOM   10247 N  NH1  . ARG A 1 97  ? 1.798   3.244   -23.487 1.00 10.00 ? 97  ARG A NH1  5  
ATOM   10248 N  NH2  . ARG A 1 97  ? -0.460  2.738   -23.699 1.00 10.00 ? 97  ARG A NH2  5  
ATOM   10249 H  H    . ARG A 1 97  ? -1.678  4.897   -18.471 1.00 10.00 ? 97  ARG A H    5  
ATOM   10250 H  HA   . ARG A 1 97  ? -0.748  2.607   -17.181 1.00 10.00 ? 97  ARG A HA   5  
ATOM   10251 H  HB2  . ARG A 1 97  ? 0.853   2.599   -19.060 1.00 10.00 ? 97  ARG A HB2  5  
ATOM   10252 H  HB3  . ARG A 1 97  ? -0.790  2.969   -19.579 1.00 10.00 ? 97  ARG A HB3  5  
ATOM   10253 H  HG2  . ARG A 1 97  ? -0.274  5.385   -19.776 1.00 10.00 ? 97  ARG A HG2  5  
ATOM   10254 H  HG3  . ARG A 1 97  ? 1.245   5.180   -18.924 1.00 10.00 ? 97  ARG A HG3  5  
ATOM   10255 H  HD2  . ARG A 1 97  ? 1.676   5.419   -21.210 1.00 10.00 ? 97  ARG A HD2  5  
ATOM   10256 H  HD3  . ARG A 1 97  ? 2.083   3.763   -20.680 1.00 10.00 ? 97  ARG A HD3  5  
ATOM   10257 H  HE   . ARG A 1 97  ? -0.687  4.066   -21.612 1.00 10.00 ? 97  ARG A HE   5  
ATOM   10258 H  HH11 . ARG A 1 97  ? 2.527   3.706   -22.964 1.00 10.00 ? 97  ARG A HH11 5  
ATOM   10259 H  HH12 . ARG A 1 97  ? 2.024   2.786   -24.356 1.00 10.00 ? 97  ARG A HH12 5  
ATOM   10260 H  HH21 . ARG A 1 97  ? -1.391  2.731   -23.258 1.00 10.00 ? 97  ARG A HH21 5  
ATOM   10261 H  HH22 . ARG A 1 97  ? -0.343  2.269   -24.581 1.00 10.00 ? 97  ARG A HH22 5  
ATOM   10262 N  N    . GLY A 1 98  ? 0.727   4.709   -15.654 1.00 10.00 ? 98  GLY A N    5  
ATOM   10263 C  CA   . GLY A 1 98  ? 1.842   5.309   -14.960 1.00 10.00 ? 98  GLY A CA   5  
ATOM   10264 C  C    . GLY A 1 98  ? 2.849   4.279   -14.438 1.00 10.00 ? 98  GLY A C    5  
ATOM   10265 O  O    . GLY A 1 98  ? 2.513   3.131   -14.138 1.00 10.00 ? 98  GLY A O    5  
ATOM   10266 H  H    . GLY A 1 98  ? -0.205  4.965   -15.354 1.00 10.00 ? 98  GLY A H    5  
ATOM   10267 H  HA2  . GLY A 1 98  ? 2.338   6.006   -15.632 1.00 10.00 ? 98  GLY A HA2  5  
ATOM   10268 H  HA3  . GLY A 1 98  ? 1.430   5.900   -14.161 1.00 10.00 ? 98  GLY A HA3  5  
ATOM   10269 N  N    . THR A 1 99  ? 4.106   4.716   -14.358 1.00 10.00 ? 99  THR A N    5  
ATOM   10270 C  CA   . THR A 1 99  ? 5.260   3.885   -14.053 1.00 10.00 ? 99  THR A CA   5  
ATOM   10271 C  C    . THR A 1 99  ? 6.088   4.587   -12.968 1.00 10.00 ? 99  THR A C    5  
ATOM   10272 O  O    . THR A 1 99  ? 7.244   4.965   -13.152 1.00 10.00 ? 99  THR A O    5  
ATOM   10273 C  CB   . THR A 1 99  ? 5.998   3.555   -15.361 1.00 10.00 ? 99  THR A CB   5  
ATOM   10274 O  OG1  . THR A 1 99  ? 7.069   2.663   -15.130 1.00 10.00 ? 99  THR A OG1  5  
ATOM   10275 C  CG2  . THR A 1 99  ? 6.486   4.803   -16.101 1.00 10.00 ? 99  THR A CG2  5  
ATOM   10276 H  H    . THR A 1 99  ? 4.287   5.680   -14.592 1.00 10.00 ? 99  THR A H    5  
ATOM   10277 H  HA   . THR A 1 99  ? 4.933   2.929   -13.657 1.00 10.00 ? 99  THR A HA   5  
ATOM   10278 H  HB   . THR A 1 99  ? 5.287   3.041   -16.013 1.00 10.00 ? 99  THR A HB   5  
ATOM   10279 H  HG1  . THR A 1 99  ? 7.546   2.525   -15.951 1.00 10.00 ? 99  THR A HG1  5  
ATOM   10280 H  HG21 . THR A 1 99  ? 7.235   5.327   -15.512 1.00 10.00 ? 99  THR A HG21 5  
ATOM   10281 H  HG22 . THR A 1 99  ? 6.924   4.512   -17.054 1.00 10.00 ? 99  THR A HG22 5  
ATOM   10282 H  HG23 . THR A 1 99  ? 5.649   5.474   -16.288 1.00 10.00 ? 99  THR A HG23 5  
ATOM   10283 N  N    . LEU A 1 100 ? 5.478   4.787   -11.801 1.00 10.00 ? 100 LEU A N    5  
ATOM   10284 C  CA   . LEU A 1 100 ? 6.100   5.515   -10.717 1.00 10.00 ? 100 LEU A CA   5  
ATOM   10285 C  C    . LEU A 1 100 ? 7.051   4.549   -10.004 1.00 10.00 ? 100 LEU A C    5  
ATOM   10286 O  O    . LEU A 1 100 ? 6.837   3.336   -9.993  1.00 10.00 ? 100 LEU A O    5  
ATOM   10287 C  CB   . LEU A 1 100 ? 4.981   6.041   -9.805  1.00 10.00 ? 100 LEU A CB   5  
ATOM   10288 C  CG   . LEU A 1 100 ? 5.485   6.606   -8.475  1.00 10.00 ? 100 LEU A CG   5  
ATOM   10289 C  CD1  . LEU A 1 100 ? 6.285   7.888   -8.683  1.00 10.00 ? 100 LEU A CD1  5  
ATOM   10290 C  CD2  . LEU A 1 100 ? 4.309   6.887   -7.537  1.00 10.00 ? 100 LEU A CD2  5  
ATOM   10291 H  H    . LEU A 1 100 ? 4.540   4.451   -11.656 1.00 10.00 ? 100 LEU A H    5  
ATOM   10292 H  HA   . LEU A 1 100 ? 6.662   6.358   -11.122 1.00 10.00 ? 100 LEU A HA   5  
ATOM   10293 H  HB2  . LEU A 1 100 ? 4.420   6.812   -10.335 1.00 10.00 ? 100 LEU A HB2  5  
ATOM   10294 H  HB3  . LEU A 1 100 ? 4.299   5.225   -9.579  1.00 10.00 ? 100 LEU A HB3  5  
ATOM   10295 H  HG   . LEU A 1 100 ? 6.115   5.869   -7.993  1.00 10.00 ? 100 LEU A HG   5  
ATOM   10296 H  HD11 . LEU A 1 100 ? 7.084   7.764   -9.410  1.00 10.00 ? 100 LEU A HD11 5  
ATOM   10297 H  HD12 . LEU A 1 100 ? 5.610   8.675   -9.015  1.00 10.00 ? 100 LEU A HD12 5  
ATOM   10298 H  HD13 . LEU A 1 100 ? 6.728   8.164   -7.731  1.00 10.00 ? 100 LEU A HD13 5  
ATOM   10299 H  HD21 . LEU A 1 100 ? 3.794   5.958   -7.297  1.00 10.00 ? 100 LEU A HD21 5  
ATOM   10300 H  HD22 . LEU A 1 100 ? 4.674   7.337   -6.612  1.00 10.00 ? 100 LEU A HD22 5  
ATOM   10301 H  HD23 . LEU A 1 100 ? 3.608   7.568   -8.014  1.00 10.00 ? 100 LEU A HD23 5  
ATOM   10302 N  N    . THR A 1 101 ? 8.143   5.086   -9.456  1.00 10.00 ? 101 THR A N    5  
ATOM   10303 C  CA   . THR A 1 101 ? 9.223   4.318   -8.871  1.00 10.00 ? 101 THR A CA   5  
ATOM   10304 C  C    . THR A 1 101 ? 9.572   5.007   -7.556  1.00 10.00 ? 101 THR A C    5  
ATOM   10305 O  O    . THR A 1 101 ? 10.148  6.094   -7.553  1.00 10.00 ? 101 THR A O    5  
ATOM   10306 C  CB   . THR A 1 101 ? 10.399  4.232   -9.856  1.00 10.00 ? 101 THR A CB   5  
ATOM   10307 O  OG1  . THR A 1 101 ? 9.938   3.768   -11.111 1.00 10.00 ? 101 THR A OG1  5  
ATOM   10308 C  CG2  . THR A 1 101 ? 11.461  3.239   -9.375  1.00 10.00 ? 101 THR A CG2  5  
ATOM   10309 H  H    . THR A 1 101 ? 8.215   6.089   -9.361  1.00 10.00 ? 101 THR A H    5  
ATOM   10310 H  HA   . THR A 1 101 ? 8.898   3.301   -8.663  1.00 10.00 ? 101 THR A HA   5  
ATOM   10311 H  HB   . THR A 1 101 ? 10.850  5.218   -9.984  1.00 10.00 ? 101 THR A HB   5  
ATOM   10312 H  HG1  . THR A 1 101 ? 9.272   4.370   -11.456 1.00 10.00 ? 101 THR A HG1  5  
ATOM   10313 H  HG21 . THR A 1 101 ? 11.046  2.233   -9.344  1.00 10.00 ? 101 THR A HG21 5  
ATOM   10314 H  HG22 . THR A 1 101 ? 12.305  3.250   -10.065 1.00 10.00 ? 101 THR A HG22 5  
ATOM   10315 H  HG23 . THR A 1 101 ? 11.812  3.499   -8.381  1.00 10.00 ? 101 THR A HG23 5  
ATOM   10316 N  N    . LEU A 1 102 ? 9.199   4.365   -6.453  1.00 10.00 ? 102 LEU A N    5  
ATOM   10317 C  CA   . LEU A 1 102 ? 9.336   4.862   -5.100  1.00 10.00 ? 102 LEU A CA   5  
ATOM   10318 C  C    . LEU A 1 102 ? 10.799  4.620   -4.743  1.00 10.00 ? 102 LEU A C    5  
ATOM   10319 O  O    . LEU A 1 102 ? 11.242  3.472   -4.722  1.00 10.00 ? 102 LEU A O    5  
ATOM   10320 C  CB   . LEU A 1 102 ? 8.400   4.060   -4.173  1.00 10.00 ? 102 LEU A CB   5  
ATOM   10321 C  CG   . LEU A 1 102 ? 6.895   4.389   -4.248  1.00 10.00 ? 102 LEU A CG   5  
ATOM   10322 C  CD1  . LEU A 1 102 ? 6.384   4.732   -5.646  1.00 10.00 ? 102 LEU A CD1  5  
ATOM   10323 C  CD2  . LEU A 1 102 ? 6.078   3.201   -3.737  1.00 10.00 ? 102 LEU A CD2  5  
ATOM   10324 H  H    . LEU A 1 102 ? 8.801   3.444   -6.556  1.00 10.00 ? 102 LEU A H    5  
ATOM   10325 H  HA   . LEU A 1 102 ? 9.094   5.921   -5.046  1.00 10.00 ? 102 LEU A HA   5  
ATOM   10326 H  HB2  . LEU A 1 102 ? 8.517   3.004   -4.400  1.00 10.00 ? 102 LEU A HB2  5  
ATOM   10327 H  HB3  . LEU A 1 102 ? 8.719   4.213   -3.140  1.00 10.00 ? 102 LEU A HB3  5  
ATOM   10328 H  HG   . LEU A 1 102 ? 6.686   5.243   -3.608  1.00 10.00 ? 102 LEU A HG   5  
ATOM   10329 H  HD11 . LEU A 1 102 ? 6.568   3.913   -6.341  1.00 10.00 ? 102 LEU A HD11 5  
ATOM   10330 H  HD12 . LEU A 1 102 ? 5.312   4.924   -5.599  1.00 10.00 ? 102 LEU A HD12 5  
ATOM   10331 H  HD13 . LEU A 1 102 ? 6.883   5.636   -5.988  1.00 10.00 ? 102 LEU A HD13 5  
ATOM   10332 H  HD21 . LEU A 1 102 ? 5.062   3.523   -3.504  1.00 10.00 ? 102 LEU A HD21 5  
ATOM   10333 H  HD22 . LEU A 1 102 ? 6.034   2.434   -4.508  1.00 10.00 ? 102 LEU A HD22 5  
ATOM   10334 H  HD23 . LEU A 1 102 ? 6.539   2.780   -2.846  1.00 10.00 ? 102 LEU A HD23 5  
ATOM   10335 N  N    . GLN A 1 103 ? 11.562  5.697   -4.543  1.00 10.00 ? 103 GLN A N    5  
ATOM   10336 C  CA   . GLN A 1 103 ? 13.009  5.682   -4.367  1.00 10.00 ? 103 GLN A CA   5  
ATOM   10337 C  C    . GLN A 1 103 ? 13.392  6.520   -3.148  1.00 10.00 ? 103 GLN A C    5  
ATOM   10338 O  O    . GLN A 1 103 ? 12.606  7.352   -2.695  1.00 10.00 ? 103 GLN A O    5  
ATOM   10339 C  CB   . GLN A 1 103 ? 13.679  6.250   -5.622  1.00 10.00 ? 103 GLN A CB   5  
ATOM   10340 C  CG   . GLN A 1 103 ? 13.511  5.320   -6.826  1.00 10.00 ? 103 GLN A CG   5  
ATOM   10341 C  CD   . GLN A 1 103 ? 13.703  6.085   -8.127  1.00 10.00 ? 103 GLN A CD   5  
ATOM   10342 O  OE1  . GLN A 1 103 ? 14.774  6.060   -8.722  1.00 10.00 ? 103 GLN A OE1  5  
ATOM   10343 N  NE2  . GLN A 1 103 ? 12.664  6.783   -8.573  1.00 10.00 ? 103 GLN A NE2  5  
ATOM   10344 H  H    . GLN A 1 103 ? 11.114  6.608   -4.572  1.00 10.00 ? 103 GLN A H    5  
ATOM   10345 H  HA   . GLN A 1 103 ? 13.365  4.662   -4.210  1.00 10.00 ? 103 GLN A HA   5  
ATOM   10346 H  HB2  . GLN A 1 103 ? 13.226  7.215   -5.846  1.00 10.00 ? 103 GLN A HB2  5  
ATOM   10347 H  HB3  . GLN A 1 103 ? 14.745  6.403   -5.450  1.00 10.00 ? 103 GLN A HB3  5  
ATOM   10348 H  HG2  . GLN A 1 103 ? 14.234  4.506   -6.764  1.00 10.00 ? 103 GLN A HG2  5  
ATOM   10349 H  HG3  . GLN A 1 103 ? 12.513  4.893   -6.829  1.00 10.00 ? 103 GLN A HG3  5  
ATOM   10350 H  HE21 . GLN A 1 103 ? 11.774  6.753   -8.076  1.00 10.00 ? 103 GLN A HE21 5  
ATOM   10351 H  HE22 . GLN A 1 103 ? 12.774  7.327   -9.412  1.00 10.00 ? 103 GLN A HE22 5  
ATOM   10352 N  N    . ARG A 1 104 ? 14.600  6.257   -2.628  1.00 10.00 ? 104 ARG A N    5  
ATOM   10353 C  CA   . ARG A 1 104 ? 15.174  6.808   -1.397  1.00 10.00 ? 104 ARG A CA   5  
ATOM   10354 C  C    . ARG A 1 104 ? 14.584  8.166   -1.000  1.00 10.00 ? 104 ARG A C    5  
ATOM   10355 O  O    . ARG A 1 104 ? 13.913  8.264   0.035   1.00 10.00 ? 104 ARG A O    5  
ATOM   10356 C  CB   . ARG A 1 104 ? 16.717  6.794   -1.422  1.00 10.00 ? 104 ARG A CB   5  
ATOM   10357 C  CG   . ARG A 1 104 ? 17.311  5.858   -0.349  1.00 10.00 ? 104 ARG A CG   5  
ATOM   10358 C  CD   . ARG A 1 104 ? 17.448  6.485   1.051   1.00 10.00 ? 104 ARG A CD   5  
ATOM   10359 N  NE   . ARG A 1 104 ? 16.215  7.122   1.537   1.00 10.00 ? 104 ARG A NE   5  
ATOM   10360 C  CZ   . ARG A 1 104 ? 16.183  8.195   2.342   1.00 10.00 ? 104 ARG A CZ   5  
ATOM   10361 N  NH1  . ARG A 1 104 ? 17.214  8.474   3.142   1.00 10.00 ? 104 ARG A NH1  5  
ATOM   10362 N  NH2  . ARG A 1 104 ? 15.114  8.996   2.319   1.00 10.00 ? 104 ARG A NH2  5  
ATOM   10363 H  H    . ARG A 1 104 ? 15.069  5.468   -3.046  1.00 10.00 ? 104 ARG A H    5  
ATOM   10364 H  HA   . ARG A 1 104 ? 14.893  6.098   -0.639  1.00 10.00 ? 104 ARG A HA   5  
ATOM   10365 H  HB2  . ARG A 1 104 ? 17.052  6.437   -2.397  1.00 10.00 ? 104 ARG A HB2  5  
ATOM   10366 H  HB3  . ARG A 1 104 ? 17.122  7.798   -1.281  1.00 10.00 ? 104 ARG A HB3  5  
ATOM   10367 H  HG2  . ARG A 1 104 ? 16.735  4.932   -0.289  1.00 10.00 ? 104 ARG A HG2  5  
ATOM   10368 H  HG3  . ARG A 1 104 ? 18.319  5.581   -0.667  1.00 10.00 ? 104 ARG A HG3  5  
ATOM   10369 H  HD2  . ARG A 1 104 ? 17.730  5.707   1.759   1.00 10.00 ? 104 ARG A HD2  5  
ATOM   10370 H  HD3  . ARG A 1 104 ? 18.260  7.216   1.025   1.00 10.00 ? 104 ARG A HD3  5  
ATOM   10371 H  HE   . ARG A 1 104 ? 15.328  6.706   1.266   1.00 10.00 ? 104 ARG A HE   5  
ATOM   10372 H  HH11 . ARG A 1 104 ? 17.941  7.758   3.273   1.00 10.00 ? 104 ARG A HH11 5  
ATOM   10373 H  HH12 . ARG A 1 104 ? 17.242  9.274   3.751   1.00 10.00 ? 104 ARG A HH12 5  
ATOM   10374 H  HH21 . ARG A 1 104 ? 14.432  8.858   1.572   1.00 10.00 ? 104 ARG A HH21 5  
ATOM   10375 H  HH22 . ARG A 1 104 ? 15.053  9.818   2.899   1.00 10.00 ? 104 ARG A HH22 5  
ATOM   10376 N  N    . ASP A 1 105 ? 14.826  9.180   -1.833  1.00 10.00 ? 105 ASP A N    5  
ATOM   10377 C  CA   . ASP A 1 105 ? 14.097  10.440  -1.852  1.00 10.00 ? 105 ASP A CA   5  
ATOM   10378 C  C    . ASP A 1 105 ? 13.565  10.609  -3.276  1.00 10.00 ? 105 ASP A C    5  
ATOM   10379 O  O    . ASP A 1 105 ? 14.191  11.245  -4.120  1.00 10.00 ? 105 ASP A O    5  
ATOM   10380 C  CB   . ASP A 1 105 ? 15.010  11.595  -1.424  1.00 10.00 ? 105 ASP A CB   5  
ATOM   10381 C  CG   . ASP A 1 105 ? 14.300  12.948  -1.428  1.00 10.00 ? 105 ASP A CG   5  
ATOM   10382 O  OD1  . ASP A 1 105 ? 13.117  13.003  -1.836  1.00 10.00 ? 105 ASP A OD1  5  
ATOM   10383 O  OD2  . ASP A 1 105 ? 14.954  13.912  -0.981  1.00 10.00 ? 105 ASP A OD2  5  
ATOM   10384 H  H    . ASP A 1 105 ? 15.398  8.994   -2.644  1.00 10.00 ? 105 ASP A H    5  
ATOM   10385 H  HA   . ASP A 1 105 ? 13.250  10.405  -1.165  1.00 10.00 ? 105 ASP A HA   5  
ATOM   10386 H  HB2  . ASP A 1 105 ? 15.378  11.411  -0.415  1.00 10.00 ? 105 ASP A HB2  5  
ATOM   10387 H  HB3  . ASP A 1 105 ? 15.862  11.662  -2.101  1.00 10.00 ? 105 ASP A HB3  5  
ATOM   10388 N  N    . GLY A 1 106 ? 12.453  9.933   -3.562  1.00 10.00 ? 106 GLY A N    5  
ATOM   10389 C  CA   . GLY A 1 106 ? 11.848  9.897   -4.873  1.00 10.00 ? 106 GLY A CA   5  
ATOM   10390 C  C    . GLY A 1 106 ? 10.435  9.364   -4.746  1.00 10.00 ? 106 GLY A C    5  
ATOM   10391 O  O    . GLY A 1 106 ? 10.233  8.162   -4.872  1.00 10.00 ? 106 GLY A O    5  
ATOM   10392 H  H    . GLY A 1 106 ? 12.107  9.265   -2.887  1.00 10.00 ? 106 GLY A H    5  
ATOM   10393 H  HA2  . GLY A 1 106 ? 11.818  10.889  -5.298  1.00 10.00 ? 106 GLY A HA2  5  
ATOM   10394 H  HA3  . GLY A 1 106 ? 12.425  9.261   -5.537  1.00 10.00 ? 106 GLY A HA3  5  
ATOM   10395 N  N    . ASP A 1 107 ? 9.490   10.273  -4.472  1.00 10.00 ? 107 ASP A N    5  
ATOM   10396 C  CA   . ASP A 1 107 ? 8.044   10.048  -4.494  1.00 10.00 ? 107 ASP A CA   5  
ATOM   10397 C  C    . ASP A 1 107 ? 7.662   8.700   -3.892  1.00 10.00 ? 107 ASP A C    5  
ATOM   10398 O  O    . ASP A 1 107 ? 7.402   7.720   -4.585  1.00 10.00 ? 107 ASP A O    5  
ATOM   10399 C  CB   . ASP A 1 107 ? 7.551   10.299  -5.921  1.00 10.00 ? 107 ASP A CB   5  
ATOM   10400 C  CG   . ASP A 1 107 ? 6.038   10.296  -6.087  1.00 10.00 ? 107 ASP A CG   5  
ATOM   10401 O  OD1  . ASP A 1 107 ? 5.353   10.142  -5.057  1.00 10.00 ? 107 ASP A OD1  5  
ATOM   10402 O  OD2  . ASP A 1 107 ? 5.601   10.503  -7.243  1.00 10.00 ? 107 ASP A OD2  5  
ATOM   10403 H  H    . ASP A 1 107 ? 9.817   11.223  -4.399  1.00 10.00 ? 107 ASP A H    5  
ATOM   10404 H  HA   . ASP A 1 107 ? 7.588   10.764  -3.821  1.00 10.00 ? 107 ASP A HA   5  
ATOM   10405 H  HB2  . ASP A 1 107 ? 7.899   11.281  -6.214  1.00 10.00 ? 107 ASP A HB2  5  
ATOM   10406 H  HB3  . ASP A 1 107 ? 7.989   9.554   -6.582  1.00 10.00 ? 107 ASP A HB3  5  
ATOM   10407 N  N    . HIS A 1 108 ? 7.749   8.672   -2.560  1.00 10.00 ? 108 HIS A N    5  
ATOM   10408 C  CA   . HIS A 1 108 ? 7.975   7.478   -1.777  1.00 10.00 ? 108 HIS A CA   5  
ATOM   10409 C  C    . HIS A 1 108 ? 6.968   7.381   -0.627  1.00 10.00 ? 108 HIS A C    5  
ATOM   10410 O  O    . HIS A 1 108 ? 6.215   8.316   -0.358  1.00 10.00 ? 108 HIS A O    5  
ATOM   10411 C  CB   . HIS A 1 108 ? 9.423   7.512   -1.273  1.00 10.00 ? 108 HIS A CB   5  
ATOM   10412 C  CG   . HIS A 1 108 ? 9.757   8.699   -0.396  1.00 10.00 ? 108 HIS A CG   5  
ATOM   10413 N  ND1  . HIS A 1 108 ? 10.184  9.941   -0.816  1.00 10.00 ? 108 HIS A ND1  5  
ATOM   10414 C  CD2  . HIS A 1 108 ? 9.797   8.692   0.972   1.00 10.00 ? 108 HIS A CD2  5  
ATOM   10415 C  CE1  . HIS A 1 108 ? 10.533  10.633  0.282   1.00 10.00 ? 108 HIS A CE1  5  
ATOM   10416 N  NE2  . HIS A 1 108 ? 10.270  9.939   1.406   1.00 10.00 ? 108 HIS A NE2  5  
ATOM   10417 H  H    . HIS A 1 108 ? 7.799   9.547   -2.067  1.00 10.00 ? 108 HIS A H    5  
ATOM   10418 H  HA   . HIS A 1 108 ? 7.875   6.605   -2.424  1.00 10.00 ? 108 HIS A HA   5  
ATOM   10419 H  HB2  . HIS A 1 108 ? 9.637   6.592   -0.728  1.00 10.00 ? 108 HIS A HB2  5  
ATOM   10420 H  HB3  . HIS A 1 108 ? 10.081  7.535   -2.141  1.00 10.00 ? 108 HIS A HB3  5  
ATOM   10421 H  HD1  . HIS A 1 108 ? 10.189  10.308  -1.760  1.00 10.00 ? 108 HIS A HD1  5  
ATOM   10422 H  HD2  . HIS A 1 108 ? 9.535   7.857   1.603   1.00 10.00 ? 108 HIS A HD2  5  
ATOM   10423 H  HE1  . HIS A 1 108 ? 10.934  11.634  0.274   1.00 10.00 ? 108 HIS A HE1  5  
ATOM   10424 N  N    . VAL A 1 109 ? 6.983   6.241   0.062   1.00 10.00 ? 109 VAL A N    5  
ATOM   10425 C  CA   . VAL A 1 109 ? 6.041   5.869   1.110   1.00 10.00 ? 109 VAL A CA   5  
ATOM   10426 C  C    . VAL A 1 109 ? 6.803   5.723   2.424   1.00 10.00 ? 109 VAL A C    5  
ATOM   10427 O  O    . VAL A 1 109 ? 7.548   4.758   2.592   1.00 10.00 ? 109 VAL A O    5  
ATOM   10428 C  CB   . VAL A 1 109 ? 5.336   4.550   0.735   1.00 10.00 ? 109 VAL A CB   5  
ATOM   10429 C  CG1  . VAL A 1 109 ? 4.071   4.831   -0.071  1.00 10.00 ? 109 VAL A CG1  5  
ATOM   10430 C  CG2  . VAL A 1 109 ? 6.227   3.621   -0.097  1.00 10.00 ? 109 VAL A CG2  5  
ATOM   10431 H  H    . VAL A 1 109 ? 7.674   5.547   -0.188  1.00 10.00 ? 109 VAL A H    5  
ATOM   10432 H  HA   . VAL A 1 109 ? 5.281   6.640   1.243   1.00 10.00 ? 109 VAL A HA   5  
ATOM   10433 H  HB   . VAL A 1 109 ? 5.036   4.030   1.647   1.00 10.00 ? 109 VAL A HB   5  
ATOM   10434 H  HG11 . VAL A 1 109 ? 3.599   3.890   -0.351  1.00 10.00 ? 109 VAL A HG11 5  
ATOM   10435 H  HG12 . VAL A 1 109 ? 3.379   5.404   0.544   1.00 10.00 ? 109 VAL A HG12 5  
ATOM   10436 H  HG13 . VAL A 1 109 ? 4.324   5.393   -0.970  1.00 10.00 ? 109 VAL A HG13 5  
ATOM   10437 H  HG21 . VAL A 1 109 ? 5.726   2.665   -0.250  1.00 10.00 ? 109 VAL A HG21 5  
ATOM   10438 H  HG22 . VAL A 1 109 ? 6.427   4.074   -1.068  1.00 10.00 ? 109 VAL A HG22 5  
ATOM   10439 H  HG23 . VAL A 1 109 ? 7.171   3.452   0.414   1.00 10.00 ? 109 VAL A HG23 5  
ATOM   10440 N  N    . MET A 1 110 ? 6.614   6.666   3.351   1.00 10.00 ? 110 MET A N    5  
ATOM   10441 C  CA   . MET A 1 110 ? 7.225   6.627   4.666   1.00 10.00 ? 110 MET A CA   5  
ATOM   10442 C  C    . MET A 1 110 ? 6.398   5.748   5.590   1.00 10.00 ? 110 MET A C    5  
ATOM   10443 O  O    . MET A 1 110 ? 5.443   6.201   6.215   1.00 10.00 ? 110 MET A O    5  
ATOM   10444 C  CB   . MET A 1 110 ? 7.377   8.024   5.271   1.00 10.00 ? 110 MET A CB   5  
ATOM   10445 C  CG   . MET A 1 110 ? 8.194   8.940   4.369   1.00 10.00 ? 110 MET A CG   5  
ATOM   10446 S  SD   . MET A 1 110 ? 8.997   10.313  5.228   1.00 10.00 ? 110 MET A SD   5  
ATOM   10447 C  CE   . MET A 1 110 ? 10.385  9.453   6.008   1.00 10.00 ? 110 MET A CE   5  
ATOM   10448 H  H    . MET A 1 110 ? 5.923   7.390   3.189   1.00 10.00 ? 110 MET A H    5  
ATOM   10449 H  HA   . MET A 1 110 ? 8.224   6.212   4.584   1.00 10.00 ? 110 MET A HA   5  
ATOM   10450 H  HB2  . MET A 1 110 ? 6.405   8.483   5.445   1.00 10.00 ? 110 MET A HB2  5  
ATOM   10451 H  HB3  . MET A 1 110 ? 7.881   7.916   6.232   1.00 10.00 ? 110 MET A HB3  5  
ATOM   10452 H  HG2  . MET A 1 110 ? 8.972   8.365   3.873   1.00 10.00 ? 110 MET A HG2  5  
ATOM   10453 H  HG3  . MET A 1 110 ? 7.520   9.343   3.613   1.00 10.00 ? 110 MET A HG3  5  
ATOM   10454 H  HE1  . MET A 1 110 ? 10.987  10.175  6.560   1.00 10.00 ? 110 MET A HE1  5  
ATOM   10455 H  HE2  . MET A 1 110 ? 10.011  8.702   6.703   1.00 10.00 ? 110 MET A HE2  5  
ATOM   10456 H  HE3  . MET A 1 110 ? 11.000  8.968   5.251   1.00 10.00 ? 110 MET A HE3  5  
ATOM   10457 N  N    . LEU A 1 111 ? 6.809   4.493   5.715   1.00 10.00 ? 111 LEU A N    5  
ATOM   10458 C  CA   . LEU A 1 111 ? 6.257   3.546   6.661   1.00 10.00 ? 111 LEU A CA   5  
ATOM   10459 C  C    . LEU A 1 111 ? 6.904   3.841   8.008   1.00 10.00 ? 111 LEU A C    5  
ATOM   10460 O  O    . LEU A 1 111 ? 7.732   3.078   8.500   1.00 10.00 ? 111 LEU A O    5  
ATOM   10461 C  CB   . LEU A 1 111 ? 6.599   2.146   6.154   1.00 10.00 ? 111 LEU A CB   5  
ATOM   10462 C  CG   . LEU A 1 111 ? 5.738   1.812   4.931   1.00 10.00 ? 111 LEU A CG   5  
ATOM   10463 C  CD1  . LEU A 1 111 ? 6.587   1.049   3.923   1.00 10.00 ? 111 LEU A CD1  5  
ATOM   10464 C  CD2  . LEU A 1 111 ? 4.536   0.976   5.367   1.00 10.00 ? 111 LEU A CD2  5  
ATOM   10465 H  H    . LEU A 1 111 ? 7.571   4.187   5.135   1.00 10.00 ? 111 LEU A H    5  
ATOM   10466 H  HA   . LEU A 1 111 ? 5.175   3.646   6.749   1.00 10.00 ? 111 LEU A HA   5  
ATOM   10467 H  HB2  . LEU A 1 111 ? 7.661   2.116   5.902   1.00 10.00 ? 111 LEU A HB2  5  
ATOM   10468 H  HB3  . LEU A 1 111 ? 6.425   1.405   6.927   1.00 10.00 ? 111 LEU A HB3  5  
ATOM   10469 H  HG   . LEU A 1 111 ? 5.380   2.720   4.442   1.00 10.00 ? 111 LEU A HG   5  
ATOM   10470 H  HD11 . LEU A 1 111 ? 5.994   0.826   3.037   1.00 10.00 ? 111 LEU A HD11 5  
ATOM   10471 H  HD12 . LEU A 1 111 ? 7.433   1.681   3.651   1.00 10.00 ? 111 LEU A HD12 5  
ATOM   10472 H  HD13 . LEU A 1 111 ? 6.950   0.122   4.366   1.00 10.00 ? 111 LEU A HD13 5  
ATOM   10473 H  HD21 . LEU A 1 111 ? 3.937   1.538   6.085   1.00 10.00 ? 111 LEU A HD21 5  
ATOM   10474 H  HD22 . LEU A 1 111 ? 3.923   0.726   4.502   1.00 10.00 ? 111 LEU A HD22 5  
ATOM   10475 H  HD23 . LEU A 1 111 ? 4.888   0.057   5.831   1.00 10.00 ? 111 LEU A HD23 5  
ATOM   10476 N  N    . MET A 1 112 ? 6.534   4.979   8.592   1.00 10.00 ? 112 MET A N    5  
ATOM   10477 C  CA   . MET A 1 112 ? 7.231   5.520   9.741   1.00 10.00 ? 112 MET A CA   5  
ATOM   10478 C  C    . MET A 1 112 ? 6.733   4.764   10.978  1.00 10.00 ? 112 MET A C    5  
ATOM   10479 O  O    . MET A 1 112 ? 5.718   4.055   10.951  1.00 10.00 ? 112 MET A O    5  
ATOM   10480 C  CB   . MET A 1 112 ? 6.974   7.044   9.788   1.00 10.00 ? 112 MET A CB   5  
ATOM   10481 C  CG   . MET A 1 112 ? 8.119   7.928   10.308  1.00 10.00 ? 112 MET A CG   5  
ATOM   10482 S  SD   . MET A 1 112 ? 8.478   7.950   12.086  1.00 10.00 ? 112 MET A SD   5  
ATOM   10483 C  CE   . MET A 1 112 ? 6.925   8.561   12.774  1.00 10.00 ? 112 MET A CE   5  
ATOM   10484 H  H    . MET A 1 112 ? 5.805   5.547   8.166   1.00 10.00 ? 112 MET A H    5  
ATOM   10485 H  HA   . MET A 1 112 ? 8.301   5.346   9.614   1.00 10.00 ? 112 MET A HA   5  
ATOM   10486 H  HB2  . MET A 1 112 ? 6.805   7.382   8.764   1.00 10.00 ? 112 MET A HB2  5  
ATOM   10487 H  HB3  . MET A 1 112 ? 6.073   7.266   10.351  1.00 10.00 ? 112 MET A HB3  5  
ATOM   10488 H  HG2  . MET A 1 112 ? 9.034   7.663   9.782   1.00 10.00 ? 112 MET A HG2  5  
ATOM   10489 H  HG3  . MET A 1 112 ? 7.885   8.958   10.042  1.00 10.00 ? 112 MET A HG3  5  
ATOM   10490 H  HE1  . MET A 1 112 ? 6.678   9.516   12.312  1.00 10.00 ? 112 MET A HE1  5  
ATOM   10491 H  HE2  . MET A 1 112 ? 6.130   7.843   12.598  1.00 10.00 ? 112 MET A HE2  5  
ATOM   10492 H  HE3  . MET A 1 112 ? 7.052   8.699   13.846  1.00 10.00 ? 112 MET A HE3  5  
ATOM   10493 N  N    . GLY A 1 113 ? 7.461   4.892   12.080  1.00 10.00 ? 113 GLY A N    5  
ATOM   10494 C  CA   . GLY A 1 113 ? 7.043   4.319   13.339  1.00 10.00 ? 113 GLY A CA   5  
ATOM   10495 C  C    . GLY A 1 113 ? 7.240   2.805   13.324  1.00 10.00 ? 113 GLY A C    5  
ATOM   10496 O  O    . GLY A 1 113 ? 6.333   2.075   13.719  1.00 10.00 ? 113 GLY A O    5  
ATOM   10497 H  H    . GLY A 1 113 ? 8.305   5.443   12.049  1.00 10.00 ? 113 GLY A H    5  
ATOM   10498 H  HA2  . GLY A 1 113 ? 7.598   4.795   14.142  1.00 10.00 ? 113 GLY A HA2  5  
ATOM   10499 H  HA3  . GLY A 1 113 ? 5.987   4.540   13.502  1.00 10.00 ? 113 GLY A HA3  5  
ATOM   10500 N  N    . LEU A 1 114 ? 8.400   2.311   12.872  1.00 10.00 ? 114 LEU A N    5  
ATOM   10501 C  CA   . LEU A 1 114 ? 8.691   0.882   12.961  1.00 10.00 ? 114 LEU A CA   5  
ATOM   10502 C  C    . LEU A 1 114 ? 8.545   0.437   14.413  1.00 10.00 ? 114 LEU A C    5  
ATOM   10503 O  O    . LEU A 1 114 ? 9.069   1.108   15.309  1.00 10.00 ? 114 LEU A O    5  
ATOM   10504 C  CB   . LEU A 1 114 ? 10.074  0.525   12.404  1.00 10.00 ? 114 LEU A CB   5  
ATOM   10505 C  CG   . LEU A 1 114 ? 10.259  0.817   10.906  1.00 10.00 ? 114 LEU A CG   5  
ATOM   10506 C  CD1  . LEU A 1 114 ? 11.707  0.484   10.519  1.00 10.00 ? 114 LEU A CD1  5  
ATOM   10507 C  CD2  . LEU A 1 114 ? 9.302   -0.009  10.043  1.00 10.00 ? 114 LEU A CD2  5  
ATOM   10508 H  H    . LEU A 1 114 ? 9.103   2.933   12.499  1.00 10.00 ? 114 LEU A H    5  
ATOM   10509 H  HA   . LEU A 1 114 ? 7.963   0.327   12.388  1.00 10.00 ? 114 LEU A HA   5  
ATOM   10510 H  HB2  . LEU A 1 114 ? 10.843  1.046   12.966  1.00 10.00 ? 114 LEU A HB2  5  
ATOM   10511 H  HB3  . LEU A 1 114 ? 10.216  -0.541  12.565  1.00 10.00 ? 114 LEU A HB3  5  
ATOM   10512 H  HG   . LEU A 1 114 ? 10.066  1.871   10.715  1.00 10.00 ? 114 LEU A HG   5  
ATOM   10513 H  HD11 . LEU A 1 114 ? 11.904  -0.576  10.664  1.00 10.00 ? 114 LEU A HD11 5  
ATOM   10514 H  HD12 . LEU A 1 114 ? 11.900  0.727   9.478   1.00 10.00 ? 114 LEU A HD12 5  
ATOM   10515 H  HD13 . LEU A 1 114 ? 12.393  1.064   11.132  1.00 10.00 ? 114 LEU A HD13 5  
ATOM   10516 H  HD21 . LEU A 1 114 ? 9.397   -1.055  10.314  1.00 10.00 ? 114 LEU A HD21 5  
ATOM   10517 H  HD22 . LEU A 1 114 ? 8.275   0.318   10.188  1.00 10.00 ? 114 LEU A HD22 5  
ATOM   10518 H  HD23 . LEU A 1 114 ? 9.544   0.100   8.987   1.00 10.00 ? 114 LEU A HD23 5  
ATOM   10519 N  N    . LYS A 1 115 ? 7.796   -0.649  14.647  1.00 10.00 ? 115 LYS A N    5  
ATOM   10520 C  CA   . LYS A 1 115 ? 7.534   -1.135  15.994  1.00 10.00 ? 115 LYS A CA   5  
ATOM   10521 C  C    . LYS A 1 115 ? 8.860   -1.338  16.731  1.00 10.00 ? 115 LYS A C    5  
ATOM   10522 O  O    . LYS A 1 115 ? 9.155   -0.572  17.646  1.00 10.00 ? 115 LYS A O    5  
ATOM   10523 C  CB   . LYS A 1 115 ? 6.691   -2.423  15.991  1.00 10.00 ? 115 LYS A CB   5  
ATOM   10524 C  CG   . LYS A 1 115 ? 5.170   -2.197  15.893  1.00 10.00 ? 115 LYS A CG   5  
ATOM   10525 C  CD   . LYS A 1 115 ? 4.626   -2.292  14.461  1.00 10.00 ? 115 LYS A CD   5  
ATOM   10526 C  CE   . LYS A 1 115 ? 3.089   -2.345  14.447  1.00 10.00 ? 115 LYS A CE   5  
ATOM   10527 N  NZ   . LYS A 1 115 ? 2.482   -1.009  14.290  1.00 10.00 ? 115 LYS A NZ   5  
ATOM   10528 H  H    . LYS A 1 115 ? 7.381   -1.131  13.852  1.00 10.00 ? 115 LYS A H    5  
ATOM   10529 H  HA   . LYS A 1 115 ? 6.984   -0.363  16.534  1.00 10.00 ? 115 LYS A HA   5  
ATOM   10530 H  HB2  . LYS A 1 115 ? 7.034   -3.111  15.217  1.00 10.00 ? 115 LYS A HB2  5  
ATOM   10531 H  HB3  . LYS A 1 115 ? 6.857   -2.905  16.956  1.00 10.00 ? 115 LYS A HB3  5  
ATOM   10532 H  HG2  . LYS A 1 115 ? 4.708   -2.997  16.475  1.00 10.00 ? 115 LYS A HG2  5  
ATOM   10533 H  HG3  . LYS A 1 115 ? 4.891   -1.246  16.349  1.00 10.00 ? 115 LYS A HG3  5  
ATOM   10534 H  HD2  . LYS A 1 115 ? 4.985   -1.450  13.868  1.00 10.00 ? 115 LYS A HD2  5  
ATOM   10535 H  HD3  . LYS A 1 115 ? 4.999   -3.217  14.015  1.00 10.00 ? 115 LYS A HD3  5  
ATOM   10536 H  HE2  . LYS A 1 115 ? 2.763   -2.952  13.601  1.00 10.00 ? 115 LYS A HE2  5  
ATOM   10537 H  HE3  . LYS A 1 115 ? 2.718   -2.815  15.359  1.00 10.00 ? 115 LYS A HE3  5  
ATOM   10538 H  HZ1  . LYS A 1 115 ? 2.562   -0.732  13.315  1.00 10.00 ? 115 LYS A HZ1  5  
ATOM   10539 H  HZ2  . LYS A 1 115 ? 1.507   -1.011  14.545  1.00 10.00 ? 115 LYS A HZ2  5  
ATOM   10540 H  HZ3  . LYS A 1 115 ? 2.985   -0.295  14.815  1.00 10.00 ? 115 LYS A HZ3  5  
ATOM   10541 N  N    . ARG A 1 116 ? 9.645   -2.338  16.312  1.00 10.00 ? 116 ARG A N    5  
ATOM   10542 C  CA   . ARG A 1 116 ? 10.974  -2.651  16.847  1.00 10.00 ? 116 ARG A CA   5  
ATOM   10543 C  C    . ARG A 1 116 ? 11.565  -3.946  16.263  1.00 10.00 ? 116 ARG A C    5  
ATOM   10544 O  O    . ARG A 1 116 ? 12.621  -3.879  15.638  1.00 10.00 ? 116 ARG A O    5  
ATOM   10545 C  CB   . ARG A 1 116 ? 11.020  -2.674  18.393  1.00 10.00 ? 116 ARG A CB   5  
ATOM   10546 C  CG   . ARG A 1 116 ? 11.846  -1.506  18.952  1.00 10.00 ? 116 ARG A CG   5  
ATOM   10547 C  CD   . ARG A 1 116 ? 11.774  -1.483  20.484  1.00 10.00 ? 116 ARG A CD   5  
ATOM   10548 N  NE   . ARG A 1 116 ? 12.611  -0.406  21.038  1.00 10.00 ? 116 ARG A NE   5  
ATOM   10549 C  CZ   . ARG A 1 116 ? 12.689  -0.086  22.341  1.00 10.00 ? 116 ARG A CZ   5  
ATOM   10550 N  NH1  . ARG A 1 116 ? 11.968  -0.768  23.239  1.00 10.00 ? 116 ARG A NH1  5  
ATOM   10551 N  NH2  . ARG A 1 116 ? 13.484  0.913   22.740  1.00 10.00 ? 116 ARG A NH2  5  
ATOM   10552 H  H    . ARG A 1 116 ? 9.337   -2.839  15.490  1.00 10.00 ? 116 ARG A H    5  
ATOM   10553 H  HA   . ARG A 1 116 ? 11.626  -1.845  16.506  1.00 10.00 ? 116 ARG A HA   5  
ATOM   10554 H  HB2  . ARG A 1 116 ? 10.015  -2.656  18.815  1.00 10.00 ? 116 ARG A HB2  5  
ATOM   10555 H  HB3  . ARG A 1 116 ? 11.503  -3.591  18.733  1.00 10.00 ? 116 ARG A HB3  5  
ATOM   10556 H  HG2  . ARG A 1 116 ? 12.884  -1.629  18.634  1.00 10.00 ? 116 ARG A HG2  5  
ATOM   10557 H  HG3  . ARG A 1 116 ? 11.470  -0.560  18.562  1.00 10.00 ? 116 ARG A HG3  5  
ATOM   10558 H  HD2  . ARG A 1 116 ? 10.731  -1.330  20.770  1.00 10.00 ? 116 ARG A HD2  5  
ATOM   10559 H  HD3  . ARG A 1 116 ? 12.120  -2.447  20.866  1.00 10.00 ? 116 ARG A HD3  5  
ATOM   10560 H  HE   . ARG A 1 116 ? 13.169  0.110   20.373  1.00 10.00 ? 116 ARG A HE   5  
ATOM   10561 H  HH11 . ARG A 1 116 ? 11.382  -1.528  22.927  1.00 10.00 ? 116 ARG A HH11 5  
ATOM   10562 H  HH12 . ARG A 1 116 ? 12.001  -0.555  24.225  1.00 10.00 ? 116 ARG A HH12 5  
ATOM   10563 H  HH21 . ARG A 1 116 ? 14.041  1.428   22.072  1.00 10.00 ? 116 ARG A HH21 5  
ATOM   10564 H  HH22 . ARG A 1 116 ? 13.558  1.168   23.714  1.00 10.00 ? 116 ARG A HH22 5  
ATOM   10565 N  N    . PRO A 1 117 ? 10.961  -5.128  16.489  1.00 10.00 ? 117 PRO A N    5  
ATOM   10566 C  CA   . PRO A 1 117 ? 11.663  -6.407  16.368  1.00 10.00 ? 117 PRO A CA   5  
ATOM   10567 C  C    . PRO A 1 117 ? 11.725  -6.916  14.919  1.00 10.00 ? 117 PRO A C    5  
ATOM   10568 O  O    . PRO A 1 117 ? 11.412  -8.078  14.645  1.00 10.00 ? 117 PRO A O    5  
ATOM   10569 C  CB   . PRO A 1 117 ? 10.889  -7.351  17.297  1.00 10.00 ? 117 PRO A CB   5  
ATOM   10570 C  CG   . PRO A 1 117 ? 9.455   -6.845  17.161  1.00 10.00 ? 117 PRO A CG   5  
ATOM   10571 C  CD   . PRO A 1 117 ? 9.649   -5.330  17.091  1.00 10.00 ? 117 PRO A CD   5  
ATOM   10572 H  HA   . PRO A 1 117 ? 12.686  -6.317  16.736  1.00 10.00 ? 117 PRO A HA   5  
ATOM   10573 H  HB2  . PRO A 1 117 ? 10.988  -8.407  17.043  1.00 10.00 ? 117 PRO A HB2  5  
ATOM   10574 H  HB3  . PRO A 1 117 ? 11.222  -7.195  18.324  1.00 10.00 ? 117 PRO A HB3  5  
ATOM   10575 H  HG2  . PRO A 1 117 ? 9.029   -7.207  16.224  1.00 10.00 ? 117 PRO A HG2  5  
ATOM   10576 H  HG3  . PRO A 1 117 ? 8.826   -7.145  18.000  1.00 10.00 ? 117 PRO A HG3  5  
ATOM   10577 H  HD2  . PRO A 1 117 ? 8.853   -4.886  16.494  1.00 10.00 ? 117 PRO A HD2  5  
ATOM   10578 H  HD3  . PRO A 1 117 ? 9.626   -4.929  18.103  1.00 10.00 ? 117 PRO A HD3  5  
ATOM   10579 N  N    . LEU A 1 118 ? 12.154  -6.055  13.996  1.00 10.00 ? 118 LEU A N    5  
ATOM   10580 C  CA   . LEU A 1 118 ? 12.285  -6.370  12.581  1.00 10.00 ? 118 LEU A CA   5  
ATOM   10581 C  C    . LEU A 1 118 ? 13.736  -6.668  12.233  1.00 10.00 ? 118 LEU A C    5  
ATOM   10582 O  O    . LEU A 1 118 ? 14.650  -6.280  12.960  1.00 10.00 ? 118 LEU A O    5  
ATOM   10583 C  CB   . LEU A 1 118 ? 11.721  -5.229  11.742  1.00 10.00 ? 118 LEU A CB   5  
ATOM   10584 C  CG   . LEU A 1 118 ? 12.523  -3.932  11.929  1.00 10.00 ? 118 LEU A CG   5  
ATOM   10585 C  CD1  . LEU A 1 118 ? 13.238  -3.581  10.624  1.00 10.00 ? 118 LEU A CD1  5  
ATOM   10586 C  CD2  . LEU A 1 118 ? 11.589  -2.807  12.373  1.00 10.00 ? 118 LEU A CD2  5  
ATOM   10587 H  H    . LEU A 1 118 ? 12.518  -5.156  14.302  1.00 10.00 ? 118 LEU A H    5  
ATOM   10588 H  HA   . LEU A 1 118 ? 11.716  -7.258  12.322  1.00 10.00 ? 118 LEU A HA   5  
ATOM   10589 H  HB2  . LEU A 1 118 ? 11.748  -5.544  10.700  1.00 10.00 ? 118 LEU A HB2  5  
ATOM   10590 H  HB3  . LEU A 1 118 ? 10.676  -5.079  12.015  1.00 10.00 ? 118 LEU A HB3  5  
ATOM   10591 H  HG   . LEU A 1 118 ? 13.281  -4.044  12.704  1.00 10.00 ? 118 LEU A HG   5  
ATOM   10592 H  HD11 . LEU A 1 118 ? 12.509  -3.306  9.863   1.00 10.00 ? 118 LEU A HD11 5  
ATOM   10593 H  HD12 . LEU A 1 118 ? 13.919  -2.752  10.787  1.00 10.00 ? 118 LEU A HD12 5  
ATOM   10594 H  HD13 . LEU A 1 118 ? 13.821  -4.434  10.279  1.00 10.00 ? 118 LEU A HD13 5  
ATOM   10595 H  HD21 . LEU A 1 118 ? 11.070  -3.095  13.288  1.00 10.00 ? 118 LEU A HD21 5  
ATOM   10596 H  HD22 . LEU A 1 118 ? 12.168  -1.908  12.574  1.00 10.00 ? 118 LEU A HD22 5  
ATOM   10597 H  HD23 . LEU A 1 118 ? 10.856  -2.611  11.592  1.00 10.00 ? 118 LEU A HD23 5  
ATOM   10598 N  N    . LYS A 1 119 ? 13.931  -7.408  11.145  1.00 10.00 ? 119 LYS A N    5  
ATOM   10599 C  CA   . LYS A 1 119 ? 15.223  -7.922  10.732  1.00 10.00 ? 119 LYS A CA   5  
ATOM   10600 C  C    . LYS A 1 119 ? 15.596  -7.252  9.416   1.00 10.00 ? 119 LYS A C    5  
ATOM   10601 O  O    . LYS A 1 119 ? 14.784  -6.565  8.799   1.00 10.00 ? 119 LYS A O    5  
ATOM   10602 C  CB   . LYS A 1 119 ? 15.162  -9.454  10.548  1.00 10.00 ? 119 LYS A CB   5  
ATOM   10603 C  CG   . LYS A 1 119 ? 14.951  -10.315 11.808  1.00 10.00 ? 119 LYS A CG   5  
ATOM   10604 C  CD   . LYS A 1 119 ? 13.704  -9.901  12.603  1.00 10.00 ? 119 LYS A CD   5  
ATOM   10605 C  CE   . LYS A 1 119 ? 12.930  -11.010 13.320  1.00 10.00 ? 119 LYS A CE   5  
ATOM   10606 N  NZ   . LYS A 1 119 ? 11.539  -10.567 13.567  1.00 10.00 ? 119 LYS A NZ   5  
ATOM   10607 H  H    . LYS A 1 119 ? 13.110  -7.673  10.590  1.00 10.00 ? 119 LYS A H    5  
ATOM   10608 H  HA   . LYS A 1 119 ? 15.992  -7.658  11.458  1.00 10.00 ? 119 LYS A HA   5  
ATOM   10609 H  HB2  . LYS A 1 119 ? 14.363  -9.683  9.843   1.00 10.00 ? 119 LYS A HB2  5  
ATOM   10610 H  HB3  . LYS A 1 119 ? 16.095  -9.793  10.096  1.00 10.00 ? 119 LYS A HB3  5  
ATOM   10611 H  HG2  . LYS A 1 119 ? 14.841  -11.339 11.445  1.00 10.00 ? 119 LYS A HG2  5  
ATOM   10612 H  HG3  . LYS A 1 119 ? 15.837  -10.262 12.441  1.00 10.00 ? 119 LYS A HG3  5  
ATOM   10613 H  HD2  . LYS A 1 119 ? 13.968  -9.119  13.317  1.00 10.00 ? 119 LYS A HD2  5  
ATOM   10614 H  HD3  . LYS A 1 119 ? 13.007  -9.500  11.884  1.00 10.00 ? 119 LYS A HD3  5  
ATOM   10615 H  HE2  . LYS A 1 119 ? 12.889  -11.897 12.686  1.00 10.00 ? 119 LYS A HE2  5  
ATOM   10616 H  HE3  . LYS A 1 119 ? 13.427  -11.263 14.258  1.00 10.00 ? 119 LYS A HE3  5  
ATOM   10617 H  HZ1  . LYS A 1 119 ? 11.079  -10.412 12.667  1.00 10.00 ? 119 LYS A HZ1  5  
ATOM   10618 H  HZ2  . LYS A 1 119 ? 11.011  -11.257 14.076  1.00 10.00 ? 119 LYS A HZ2  5  
ATOM   10619 H  HZ3  . LYS A 1 119 ? 11.515  -9.678  14.063  1.00 10.00 ? 119 LYS A HZ3  5  
ATOM   10620 N  N    . VAL A 1 120 ? 16.831  -7.487  8.981   1.00 10.00 ? 120 VAL A N    5  
ATOM   10621 C  CA   . VAL A 1 120 ? 17.251  -7.227  7.621   1.00 10.00 ? 120 VAL A CA   5  
ATOM   10622 C  C    . VAL A 1 120 ? 17.107  -8.551  6.868   1.00 10.00 ? 120 VAL A C    5  
ATOM   10623 O  O    . VAL A 1 120 ? 17.577  -9.581  7.347   1.00 10.00 ? 120 VAL A O    5  
ATOM   10624 C  CB   . VAL A 1 120 ? 18.680  -6.645  7.605   1.00 10.00 ? 120 VAL A CB   5  
ATOM   10625 C  CG1  . VAL A 1 120 ? 19.721  -7.519  8.322   1.00 10.00 ? 120 VAL A CG1  5  
ATOM   10626 C  CG2  . VAL A 1 120 ? 19.161  -6.377  6.173   1.00 10.00 ? 120 VAL A CG2  5  
ATOM   10627 H  H    . VAL A 1 120 ? 17.400  -8.129  9.509   1.00 10.00 ? 120 VAL A H    5  
ATOM   10628 H  HA   . VAL A 1 120 ? 16.569  -6.488  7.203   1.00 10.00 ? 120 VAL A HA   5  
ATOM   10629 H  HB   . VAL A 1 120 ? 18.646  -5.686  8.125   1.00 10.00 ? 120 VAL A HB   5  
ATOM   10630 H  HG11 . VAL A 1 120 ? 19.437  -7.688  9.360   1.00 10.00 ? 120 VAL A HG11 5  
ATOM   10631 H  HG12 . VAL A 1 120 ? 19.834  -8.479  7.818   1.00 10.00 ? 120 VAL A HG12 5  
ATOM   10632 H  HG13 . VAL A 1 120 ? 20.685  -7.010  8.313   1.00 10.00 ? 120 VAL A HG13 5  
ATOM   10633 H  HG21 . VAL A 1 120 ? 18.462  -5.718  5.663   1.00 10.00 ? 120 VAL A HG21 5  
ATOM   10634 H  HG22 . VAL A 1 120 ? 20.138  -5.893  6.199   1.00 10.00 ? 120 VAL A HG22 5  
ATOM   10635 H  HG23 . VAL A 1 120 ? 19.246  -7.310  5.616   1.00 10.00 ? 120 VAL A HG23 5  
ATOM   10636 N  N    . GLY A 1 121 ? 16.417  -8.547  5.728   1.00 10.00 ? 121 GLY A N    5  
ATOM   10637 C  CA   . GLY A 1 121 ? 16.112  -9.759  4.991   1.00 10.00 ? 121 GLY A CA   5  
ATOM   10638 C  C    . GLY A 1 121 ? 14.945  -10.516 5.618   1.00 10.00 ? 121 GLY A C    5  
ATOM   10639 O  O    . GLY A 1 121 ? 14.897  -11.740 5.542   1.00 10.00 ? 121 GLY A O    5  
ATOM   10640 H  H    . GLY A 1 121 ? 15.933  -7.701  5.443   1.00 10.00 ? 121 GLY A H    5  
ATOM   10641 H  HA2  . GLY A 1 121 ? 15.810  -9.477  3.988   1.00 10.00 ? 121 GLY A HA2  5  
ATOM   10642 H  HA3  . GLY A 1 121 ? 16.988  -10.406 4.928   1.00 10.00 ? 121 GLY A HA3  5  
ATOM   10643 N  N    . GLU A 1 122 ? 13.984  -9.789  6.201   1.00 10.00 ? 122 GLU A N    5  
ATOM   10644 C  CA   . GLU A 1 122 ? 12.721  -10.373 6.615   1.00 10.00 ? 122 GLU A CA   5  
ATOM   10645 C  C    . GLU A 1 122 ? 11.779  -10.385 5.418   1.00 10.00 ? 122 GLU A C    5  
ATOM   10646 O  O    . GLU A 1 122 ? 12.136  -10.033 4.291   1.00 10.00 ? 122 GLU A O    5  
ATOM   10647 C  CB   . GLU A 1 122 ? 12.118  -9.565  7.775   1.00 10.00 ? 122 GLU A CB   5  
ATOM   10648 C  CG   . GLU A 1 122 ? 11.538  -10.413 8.917   1.00 10.00 ? 122 GLU A CG   5  
ATOM   10649 C  CD   . GLU A 1 122 ? 11.203  -9.562  10.136  1.00 10.00 ? 122 GLU A CD   5  
ATOM   10650 O  OE1  . GLU A 1 122 ? 11.583  -8.370  10.136  1.00 10.00 ? 122 GLU A OE1  5  
ATOM   10651 O  OE2  . GLU A 1 122 ? 10.669  -10.138 11.110  1.00 10.00 ? 122 GLU A OE2  5  
ATOM   10652 H  H    . GLU A 1 122 ? 14.052  -8.783  6.200   1.00 10.00 ? 122 GLU A H    5  
ATOM   10653 H  HA   . GLU A 1 122 ? 12.880  -11.401 6.948   1.00 10.00 ? 122 GLU A HA   5  
ATOM   10654 H  HB2  . GLU A 1 122 ? 12.909  -8.963  8.196   1.00 10.00 ? 122 GLU A HB2  5  
ATOM   10655 H  HB3  . GLU A 1 122 ? 11.345  -8.881  7.427   1.00 10.00 ? 122 GLU A HB3  5  
ATOM   10656 H  HG2  . GLU A 1 122 ? 10.633  -10.932 8.609   1.00 10.00 ? 122 GLU A HG2  5  
ATOM   10657 H  HG3  . GLU A 1 122 ? 12.275  -11.152 9.229   1.00 10.00 ? 122 GLU A HG3  5  
ATOM   10658 N  N    . THR A 1 123 ? 10.542  -10.754 5.702   1.00 10.00 ? 123 THR A N    5  
ATOM   10659 C  CA   . THR A 1 123 ? 9.402   -10.692 4.800   1.00 10.00 ? 123 THR A CA   5  
ATOM   10660 C  C    . THR A 1 123 ? 8.144   -10.620 5.656   1.00 10.00 ? 123 THR A C    5  
ATOM   10661 O  O    . THR A 1 123 ? 7.951   -11.463 6.528   1.00 10.00 ? 123 THR A O    5  
ATOM   10662 C  CB   . THR A 1 123 ? 9.389   -11.876 3.819   1.00 10.00 ? 123 THR A CB   5  
ATOM   10663 O  OG1  . THR A 1 123 ? 10.483  -11.775 2.927   1.00 10.00 ? 123 THR A OG1  5  
ATOM   10664 C  CG2  . THR A 1 123 ? 8.118   -11.890 2.960   1.00 10.00 ? 123 THR A CG2  5  
ATOM   10665 H  H    . THR A 1 123 ? 10.379  -10.888 6.691   1.00 10.00 ? 123 THR A H    5  
ATOM   10666 H  HA   . THR A 1 123 ? 9.475   -9.780  4.223   1.00 10.00 ? 123 THR A HA   5  
ATOM   10667 H  HB   . THR A 1 123 ? 9.458   -12.811 4.379   1.00 10.00 ? 123 THR A HB   5  
ATOM   10668 H  HG1  . THR A 1 123 ? 11.238  -11.400 3.395   1.00 10.00 ? 123 THR A HG1  5  
ATOM   10669 H  HG21 . THR A 1 123 ? 8.004   -10.936 2.443   1.00 10.00 ? 123 THR A HG21 5  
ATOM   10670 H  HG22 . THR A 1 123 ? 8.193   -12.685 2.217   1.00 10.00 ? 123 THR A HG22 5  
ATOM   10671 H  HG23 . THR A 1 123 ? 7.237   -12.075 3.573   1.00 10.00 ? 123 THR A HG23 5  
ATOM   10672 N  N    . VAL A 1 124 ? 7.320   -9.595  5.431   1.00 10.00 ? 124 VAL A N    5  
ATOM   10673 C  CA   . VAL A 1 124 ? 6.094   -9.341  6.167   1.00 10.00 ? 124 VAL A CA   5  
ATOM   10674 C  C    . VAL A 1 124 ? 5.044   -8.899  5.146   1.00 10.00 ? 124 VAL A C    5  
ATOM   10675 O  O    . VAL A 1 124 ? 5.386   -8.367  4.090   1.00 10.00 ? 124 VAL A O    5  
ATOM   10676 C  CB   . VAL A 1 124 ? 6.352   -8.276  7.254   1.00 10.00 ? 124 VAL A CB   5  
ATOM   10677 C  CG1  . VAL A 1 124 ? 5.105   -8.034  8.116   1.00 10.00 ? 124 VAL A CG1  5  
ATOM   10678 C  CG2  . VAL A 1 124 ? 7.502   -8.703  8.179   1.00 10.00 ? 124 VAL A CG2  5  
ATOM   10679 H  H    . VAL A 1 124 ? 7.527   -8.944  4.677   1.00 10.00 ? 124 VAL A H    5  
ATOM   10680 H  HA   . VAL A 1 124 ? 5.750   -10.262 6.641   1.00 10.00 ? 124 VAL A HA   5  
ATOM   10681 H  HB   . VAL A 1 124 ? 6.630   -7.335  6.776   1.00 10.00 ? 124 VAL A HB   5  
ATOM   10682 H  HG11 . VAL A 1 124 ? 4.312   -7.583  7.522   1.00 10.00 ? 124 VAL A HG11 5  
ATOM   10683 H  HG12 . VAL A 1 124 ? 4.753   -8.975  8.540   1.00 10.00 ? 124 VAL A HG12 5  
ATOM   10684 H  HG13 . VAL A 1 124 ? 5.345   -7.350  8.929   1.00 10.00 ? 124 VAL A HG13 5  
ATOM   10685 H  HG21 . VAL A 1 124 ? 8.446   -8.734  7.638   1.00 10.00 ? 124 VAL A HG21 5  
ATOM   10686 H  HG22 . VAL A 1 124 ? 7.612   -7.986  8.990   1.00 10.00 ? 124 VAL A HG22 5  
ATOM   10687 H  HG23 . VAL A 1 124 ? 7.297   -9.685  8.606   1.00 10.00 ? 124 VAL A HG23 5  
ATOM   10688 N  N    . ASN A 1 125 ? 3.765   -9.141  5.432   1.00 10.00 ? 125 ASN A N    5  
ATOM   10689 C  CA   . ASN A 1 125 ? 2.695   -8.688  4.554   1.00 10.00 ? 125 ASN A CA   5  
ATOM   10690 C  C    . ASN A 1 125 ? 2.579   -7.170  4.649   1.00 10.00 ? 125 ASN A C    5  
ATOM   10691 O  O    . ASN A 1 125 ? 2.521   -6.619  5.750   1.00 10.00 ? 125 ASN A O    5  
ATOM   10692 C  CB   . ASN A 1 125 ? 1.359   -9.339  4.935   1.00 10.00 ? 125 ASN A CB   5  
ATOM   10693 C  CG   . ASN A 1 125 ? 1.362   -10.840 4.667   1.00 10.00 ? 125 ASN A CG   5  
ATOM   10694 O  OD1  . ASN A 1 125 ? 1.466   -11.273 3.525   1.00 10.00 ? 125 ASN A OD1  5  
ATOM   10695 N  ND2  . ASN A 1 125 ? 1.257   -11.656 5.713   1.00 10.00 ? 125 ASN A ND2  5  
ATOM   10696 H  H    . ASN A 1 125 ? 3.528   -9.563  6.316   1.00 10.00 ? 125 ASN A H    5  
ATOM   10697 H  HA   . ASN A 1 125 ? 2.929   -8.971  3.525   1.00 10.00 ? 125 ASN A HA   5  
ATOM   10698 H  HB2  . ASN A 1 125 ? 1.134   -9.135  5.983   1.00 10.00 ? 125 ASN A HB2  5  
ATOM   10699 H  HB3  . ASN A 1 125 ? 0.571   -8.897  4.323   1.00 10.00 ? 125 ASN A HB3  5  
ATOM   10700 H  HD21 . ASN A 1 125 ? 1.152   -11.294 6.648   1.00 10.00 ? 125 ASN A HD21 5  
ATOM   10701 H  HD22 . ASN A 1 125 ? 1.262   -12.649 5.541   1.00 10.00 ? 125 ASN A HD22 5  
ATOM   10702 N  N    . ILE A 1 126 ? 2.510   -6.497  3.503   1.00 10.00 ? 126 ILE A N    5  
ATOM   10703 C  CA   . ILE A 1 126 ? 1.900   -5.186  3.402   1.00 10.00 ? 126 ILE A CA   5  
ATOM   10704 C  C    . ILE A 1 126 ? 0.413   -5.428  3.159   1.00 10.00 ? 126 ILE A C    5  
ATOM   10705 O  O    . ILE A 1 126 ? 0.044   -6.450  2.582   1.00 10.00 ? 126 ILE A O    5  
ATOM   10706 C  CB   . ILE A 1 126 ? 2.587   -4.358  2.285   1.00 10.00 ? 126 ILE A CB   5  
ATOM   10707 C  CG1  . ILE A 1 126 ? 3.287   -3.133  2.895   1.00 10.00 ? 126 ILE A CG1  5  
ATOM   10708 C  CG2  . ILE A 1 126 ? 1.642   -3.922  1.154   1.00 10.00 ? 126 ILE A CG2  5  
ATOM   10709 C  CD1  . ILE A 1 126 ? 4.015   -2.292  1.844   1.00 10.00 ? 126 ILE A CD1  5  
ATOM   10710 H  H    . ILE A 1 126 ? 2.529   -7.014  2.630   1.00 10.00 ? 126 ILE A H    5  
ATOM   10711 H  HA   . ILE A 1 126 ? 1.989   -4.668  4.348   1.00 10.00 ? 126 ILE A HA   5  
ATOM   10712 H  HB   . ILE A 1 126 ? 3.364   -4.970  1.824   1.00 10.00 ? 126 ILE A HB   5  
ATOM   10713 H  HG12 . ILE A 1 126 ? 2.559   -2.498  3.399   1.00 10.00 ? 126 ILE A HG12 5  
ATOM   10714 H  HG13 . ILE A 1 126 ? 4.021   -3.480  3.623   1.00 10.00 ? 126 ILE A HG13 5  
ATOM   10715 H  HG21 . ILE A 1 126 ? 0.939   -3.168  1.509   1.00 10.00 ? 126 ILE A HG21 5  
ATOM   10716 H  HG22 . ILE A 1 126 ? 2.217   -3.508  0.327   1.00 10.00 ? 126 ILE A HG22 5  
ATOM   10717 H  HG23 . ILE A 1 126 ? 1.096   -4.778  0.765   1.00 10.00 ? 126 ILE A HG23 5  
ATOM   10718 H  HD11 . ILE A 1 126 ? 3.298   -1.768  1.209   1.00 10.00 ? 126 ILE A HD11 5  
ATOM   10719 H  HD12 . ILE A 1 126 ? 4.643   -1.557  2.348   1.00 10.00 ? 126 ILE A HD12 5  
ATOM   10720 H  HD13 . ILE A 1 126 ? 4.637   -2.936  1.225   1.00 10.00 ? 126 ILE A HD13 5  
ATOM   10721 N  N    . THR A 1 127 ? -0.424  -4.469  3.548   1.00 10.00 ? 127 THR A N    5  
ATOM   10722 C  CA   . THR A 1 127 ? -1.754  -4.330  2.995   1.00 10.00 ? 127 THR A CA   5  
ATOM   10723 C  C    . THR A 1 127 ? -1.908  -2.874  2.578   1.00 10.00 ? 127 THR A C    5  
ATOM   10724 O  O    . THR A 1 127 ? -1.625  -1.970  3.364   1.00 10.00 ? 127 THR A O    5  
ATOM   10725 C  CB   . THR A 1 127 ? -2.843  -4.771  3.983   1.00 10.00 ? 127 THR A CB   5  
ATOM   10726 O  OG1  . THR A 1 127 ? -2.473  -5.979  4.619   1.00 10.00 ? 127 THR A OG1  5  
ATOM   10727 C  CG2  . THR A 1 127 ? -4.158  -5.001  3.226   1.00 10.00 ? 127 THR A CG2  5  
ATOM   10728 H  H    . THR A 1 127 ? -0.058  -3.664  4.044   1.00 10.00 ? 127 THR A H    5  
ATOM   10729 H  HA   . THR A 1 127 ? -1.817  -4.957  2.113   1.00 10.00 ? 127 THR A HA   5  
ATOM   10730 H  HB   . THR A 1 127 ? -2.979  -3.998  4.741   1.00 10.00 ? 127 THR A HB   5  
ATOM   10731 H  HG1  . THR A 1 127 ? -3.162  -6.234  5.235   1.00 10.00 ? 127 THR A HG1  5  
ATOM   10732 H  HG21 . THR A 1 127 ? -4.042  -5.827  2.521   1.00 10.00 ? 127 THR A HG21 5  
ATOM   10733 H  HG22 . THR A 1 127 ? -4.956  -5.244  3.926   1.00 10.00 ? 127 THR A HG22 5  
ATOM   10734 H  HG23 . THR A 1 127 ? -4.440  -4.111  2.661   1.00 10.00 ? 127 THR A HG23 5  
ATOM   10735 N  N    . LEU A 1 128 ? -2.326  -2.645  1.337   1.00 10.00 ? 128 LEU A N    5  
ATOM   10736 C  CA   . LEU A 1 128 ? -2.659  -1.329  0.829   1.00 10.00 ? 128 LEU A CA   5  
ATOM   10737 C  C    . LEU A 1 128 ? -4.151  -1.300  0.520   1.00 10.00 ? 128 LEU A C    5  
ATOM   10738 O  O    . LEU A 1 128 ? -4.781  -2.348  0.372   1.00 10.00 ? 128 LEU A O    5  
ATOM   10739 C  CB   . LEU A 1 128 ? -1.743  -0.922  -0.336  1.00 10.00 ? 128 LEU A CB   5  
ATOM   10740 C  CG   . LEU A 1 128 ? -1.389  -2.010  -1.363  1.00 10.00 ? 128 LEU A CG   5  
ATOM   10741 C  CD1  . LEU A 1 128 ? -2.570  -2.294  -2.286  1.00 10.00 ? 128 LEU A CD1  5  
ATOM   10742 C  CD2  . LEU A 1 128 ? -0.211  -1.529  -2.216  1.00 10.00 ? 128 LEU A CD2  5  
ATOM   10743 H  H    . LEU A 1 128 ? -2.630  -3.440  0.781   1.00 10.00 ? 128 LEU A H    5  
ATOM   10744 H  HA   . LEU A 1 128 ? -2.503  -0.581  1.608   1.00 10.00 ? 128 LEU A HA   5  
ATOM   10745 H  HB2  . LEU A 1 128 ? -2.191  -0.073  -0.854  1.00 10.00 ? 128 LEU A HB2  5  
ATOM   10746 H  HB3  . LEU A 1 128 ? -0.805  -0.597  0.115   1.00 10.00 ? 128 LEU A HB3  5  
ATOM   10747 H  HG   . LEU A 1 128 ? -1.079  -2.930  -0.867  1.00 10.00 ? 128 LEU A HG   5  
ATOM   10748 H  HD11 . LEU A 1 128 ? -2.256  -2.976  -3.075  1.00 10.00 ? 128 LEU A HD11 5  
ATOM   10749 H  HD12 . LEU A 1 128 ? -3.375  -2.749  -1.717  1.00 10.00 ? 128 LEU A HD12 5  
ATOM   10750 H  HD13 . LEU A 1 128 ? -2.921  -1.365  -2.734  1.00 10.00 ? 128 LEU A HD13 5  
ATOM   10751 H  HD21 . LEU A 1 128 ? 0.073   -2.303  -2.928  1.00 10.00 ? 128 LEU A HD21 5  
ATOM   10752 H  HD22 . LEU A 1 128 ? -0.494  -0.630  -2.762  1.00 10.00 ? 128 LEU A HD22 5  
ATOM   10753 H  HD23 . LEU A 1 128 ? 0.645   -1.307  -1.578  1.00 10.00 ? 128 LEU A HD23 5  
ATOM   10754 N  N    . LYS A 1 129 ? -4.711  -0.090  0.520   1.00 10.00 ? 129 LYS A N    5  
ATOM   10755 C  CA   . LYS A 1 129 ? -6.142  0.160   0.476   1.00 10.00 ? 129 LYS A CA   5  
ATOM   10756 C  C    . LYS A 1 129 ? -6.341  1.462   -0.290  1.00 10.00 ? 129 LYS A C    5  
ATOM   10757 O  O    . LYS A 1 129 ? -6.706  2.491   0.271   1.00 10.00 ? 129 LYS A O    5  
ATOM   10758 C  CB   . LYS A 1 129 ? -6.706  0.162   1.911   1.00 10.00 ? 129 LYS A CB   5  
ATOM   10759 C  CG   . LYS A 1 129 ? -8.201  -0.186  2.002   1.00 10.00 ? 129 LYS A CG   5  
ATOM   10760 C  CD   . LYS A 1 129 ? -9.129  0.961   1.585   1.00 10.00 ? 129 LYS A CD   5  
ATOM   10761 C  CE   . LYS A 1 129 ? -10.595 0.515   1.691   1.00 10.00 ? 129 LYS A CE   5  
ATOM   10762 N  NZ   . LYS A 1 129 ? -11.548 1.601   1.387   1.00 10.00 ? 129 LYS A NZ   5  
ATOM   10763 H  H    . LYS A 1 129 ? -4.103  0.711   0.600   1.00 10.00 ? 129 LYS A H    5  
ATOM   10764 H  HA   . LYS A 1 129 ? -6.637  -0.628  -0.083  1.00 10.00 ? 129 LYS A HA   5  
ATOM   10765 H  HB2  . LYS A 1 129 ? -6.188  -0.622  2.466   1.00 10.00 ? 129 LYS A HB2  5  
ATOM   10766 H  HB3  . LYS A 1 129 ? -6.500  1.110   2.409   1.00 10.00 ? 129 LYS A HB3  5  
ATOM   10767 H  HG2  . LYS A 1 129 ? -8.403  -1.066  1.389   1.00 10.00 ? 129 LYS A HG2  5  
ATOM   10768 H  HG3  . LYS A 1 129 ? -8.417  -0.441  3.041   1.00 10.00 ? 129 LYS A HG3  5  
ATOM   10769 H  HD2  . LYS A 1 129 ? -8.941  1.830   2.220   1.00 10.00 ? 129 LYS A HD2  5  
ATOM   10770 H  HD3  . LYS A 1 129 ? -8.923  1.228   0.550   1.00 10.00 ? 129 LYS A HD3  5  
ATOM   10771 H  HE2  . LYS A 1 129 ? -10.765 -0.284  0.965   1.00 10.00 ? 129 LYS A HE2  5  
ATOM   10772 H  HE3  . LYS A 1 129 ? -10.809 0.128   2.689   1.00 10.00 ? 129 LYS A HE3  5  
ATOM   10773 H  HZ1  . LYS A 1 129 ? -12.445 1.191   1.116   1.00 10.00 ? 129 LYS A HZ1  5  
ATOM   10774 H  HZ2  . LYS A 1 129 ? -11.680 2.258   2.137   1.00 10.00 ? 129 LYS A HZ2  5  
ATOM   10775 H  HZ3  . LYS A 1 129 ? -11.281 2.109   0.545   1.00 10.00 ? 129 LYS A HZ3  5  
ATOM   10776 N  N    . ALA A 1 130 ? -6.071  1.418   -1.595  1.00 10.00 ? 130 ALA A N    5  
ATOM   10777 C  CA   . ALA A 1 130 ? -6.151  2.604   -2.423  1.00 10.00 ? 130 ALA A CA   5  
ATOM   10778 C  C    . ALA A 1 130 ? -7.598  2.845   -2.787  1.00 10.00 ? 130 ALA A C    5  
ATOM   10779 O  O    . ALA A 1 130 ? -8.191  2.029   -3.491  1.00 10.00 ? 130 ALA A O    5  
ATOM   10780 C  CB   . ALA A 1 130 ? -5.397  2.414   -3.725  1.00 10.00 ? 130 ALA A CB   5  
ATOM   10781 H  H    . ALA A 1 130 ? -5.783  0.531   -1.996  1.00 10.00 ? 130 ALA A H    5  
ATOM   10782 H  HA   . ALA A 1 130 ? -5.729  3.460   -1.893  1.00 10.00 ? 130 ALA A HA   5  
ATOM   10783 H  HB1  . ALA A 1 130 ? -5.449  3.370   -4.239  1.00 10.00 ? 130 ALA A HB1  5  
ATOM   10784 H  HB2  . ALA A 1 130 ? -4.370  2.111   -3.533  1.00 10.00 ? 130 ALA A HB2  5  
ATOM   10785 H  HB3  . ALA A 1 130 ? -5.907  1.681   -4.347  1.00 10.00 ? 130 ALA A HB3  5  
ATOM   10786 N  N    . THR A 1 131 ? -8.135  3.981   -2.356  1.00 10.00 ? 131 THR A N    5  
ATOM   10787 C  CA   . THR A 1 131 ? -9.551  4.301   -2.360  1.00 10.00 ? 131 THR A CA   5  
ATOM   10788 C  C    . THR A 1 131 ? -10.365 3.073   -1.932  1.00 10.00 ? 131 THR A C    5  
ATOM   10789 O  O    . THR A 1 131 ? -10.401 2.745   -0.748  1.00 10.00 ? 131 THR A O    5  
ATOM   10790 C  CB   . THR A 1 131 ? -9.948  4.902   -3.720  1.00 10.00 ? 131 THR A CB   5  
ATOM   10791 O  OG1  . THR A 1 131 ? -9.723  3.993   -4.783  1.00 10.00 ? 131 THR A OG1  5  
ATOM   10792 C  CG2  . THR A 1 131 ? -9.163  6.186   -4.009  1.00 10.00 ? 131 THR A CG2  5  
ATOM   10793 H  H    . THR A 1 131 ? -7.513  4.639   -1.925  1.00 10.00 ? 131 THR A H    5  
ATOM   10794 H  HA   . THR A 1 131 ? -9.719  5.062   -1.597  1.00 10.00 ? 131 THR A HA   5  
ATOM   10795 H  HB   . THR A 1 131 ? -11.007 5.152   -3.680  1.00 10.00 ? 131 THR A HB   5  
ATOM   10796 H  HG1  . THR A 1 131 ? -8.876  3.552   -4.651  1.00 10.00 ? 131 THR A HG1  5  
ATOM   10797 H  HG21 . THR A 1 131 ? -8.099  5.973   -4.113  1.00 10.00 ? 131 THR A HG21 5  
ATOM   10798 H  HG22 . THR A 1 131 ? -9.527  6.622   -4.940  1.00 10.00 ? 131 THR A HG22 5  
ATOM   10799 H  HG23 . THR A 1 131 ? -9.312  6.901   -3.200  1.00 10.00 ? 131 THR A HG23 5  
ATOM   10800 N  N    . ASP A 1 132 ? -10.922 2.368   -2.915  1.00 10.00 ? 132 ASP A N    5  
ATOM   10801 C  CA   . ASP A 1 132 ? -11.582 1.068   -2.808  1.00 10.00 ? 132 ASP A CA   5  
ATOM   10802 C  C    . ASP A 1 132 ? -11.365 0.333   -4.135  1.00 10.00 ? 132 ASP A C    5  
ATOM   10803 O  O    . ASP A 1 132 ? -12.270 -0.271  -4.704  1.00 10.00 ? 132 ASP A O    5  
ATOM   10804 C  CB   . ASP A 1 132 ? -13.071 1.231   -2.450  1.00 10.00 ? 132 ASP A CB   5  
ATOM   10805 C  CG   . ASP A 1 132 ? -13.253 1.445   -0.960  1.00 10.00 ? 132 ASP A CG   5  
ATOM   10806 O  OD1  . ASP A 1 132 ? -13.225 0.445   -0.209  1.00 10.00 ? 132 ASP A OD1  5  
ATOM   10807 O  OD2  . ASP A 1 132 ? -13.257 2.611   -0.515  1.00 10.00 ? 132 ASP A OD2  5  
ATOM   10808 H  H    . ASP A 1 132 ? -10.642 2.684   -3.839  1.00 10.00 ? 132 ASP A H    5  
ATOM   10809 H  HA   . ASP A 1 132 ? -11.094 0.476   -2.032  1.00 10.00 ? 132 ASP A HA   5  
ATOM   10810 H  HB2  . ASP A 1 132 ? -13.512 2.058   -3.008  1.00 10.00 ? 132 ASP A HB2  5  
ATOM   10811 H  HB3  . ASP A 1 132 ? -13.614 0.318   -2.698  1.00 10.00 ? 132 ASP A HB3  5  
ATOM   10812 N  N    . GLY A 1 133 ? -10.132 0.429   -4.637  1.00 10.00 ? 133 GLY A N    5  
ATOM   10813 C  CA   . GLY A 1 133 ? -9.698  -0.039  -5.940  1.00 10.00 ? 133 GLY A CA   5  
ATOM   10814 C  C    . GLY A 1 133 ? -8.525  -1.001  -5.789  1.00 10.00 ? 133 GLY A C    5  
ATOM   10815 O  O    . GLY A 1 133 ? -8.525  -2.071  -6.402  1.00 10.00 ? 133 GLY A O    5  
ATOM   10816 H  H    . GLY A 1 133 ? -9.462  0.936   -4.077  1.00 10.00 ? 133 GLY A H    5  
ATOM   10817 H  HA2  . GLY A 1 133 ? -10.509 -0.538  -6.472  1.00 10.00 ? 133 GLY A HA2  5  
ATOM   10818 H  HA3  . GLY A 1 133 ? -9.375  0.821   -6.527  1.00 10.00 ? 133 GLY A HA3  5  
ATOM   10819 N  N    . ARG A 1 134 ? -7.506  -0.635  -4.998  1.00 10.00 ? 134 ARG A N    5  
ATOM   10820 C  CA   . ARG A 1 134 ? -6.414  -1.539  -4.629  1.00 10.00 ? 134 ARG A CA   5  
ATOM   10821 C  C    . ARG A 1 134 ? -6.469  -1.781  -3.124  1.00 10.00 ? 134 ARG A C    5  
ATOM   10822 O  O    . ARG A 1 134 ? -5.632  -1.277  -2.379  1.00 10.00 ? 134 ARG A O    5  
ATOM   10823 C  CB   . ARG A 1 134 ? -5.027  -1.028  -5.070  1.00 10.00 ? 134 ARG A CB   5  
ATOM   10824 C  CG   . ARG A 1 134 ? -4.860  -0.665  -6.556  1.00 10.00 ? 134 ARG A CG   5  
ATOM   10825 C  CD   . ARG A 1 134 ? -4.819  -1.881  -7.495  1.00 10.00 ? 134 ARG A CD   5  
ATOM   10826 N  NE   . ARG A 1 134 ? -6.141  -2.509  -7.586  1.00 10.00 ? 134 ARG A NE   5  
ATOM   10827 C  CZ   . ARG A 1 134 ? -6.446  -3.730  -8.040  1.00 10.00 ? 134 ARG A CZ   5  
ATOM   10828 N  NH1  . ARG A 1 134 ? -5.520  -4.482  -8.642  1.00 10.00 ? 134 ARG A NH1  5  
ATOM   10829 N  NH2  . ARG A 1 134 ? -7.694  -4.170  -7.864  1.00 10.00 ? 134 ARG A NH2  5  
ATOM   10830 H  H    . ARG A 1 134 ? -7.579  0.245   -4.495  1.00 10.00 ? 134 ARG A H    5  
ATOM   10831 H  HA   . ARG A 1 134 ? -6.548  -2.522  -5.077  1.00 10.00 ? 134 ARG A HA   5  
ATOM   10832 H  HB2  . ARG A 1 134 ? -4.767  -0.149  -4.486  1.00 10.00 ? 134 ARG A HB2  5  
ATOM   10833 H  HB3  . ARG A 1 134 ? -4.295  -1.796  -4.816  1.00 10.00 ? 134 ARG A HB3  5  
ATOM   10834 H  HG2  . ARG A 1 134 ? -5.647  0.026   -6.860  1.00 10.00 ? 134 ARG A HG2  5  
ATOM   10835 H  HG3  . ARG A 1 134 ? -3.905  -0.145  -6.655  1.00 10.00 ? 134 ARG A HG3  5  
ATOM   10836 H  HD2  . ARG A 1 134 ? -4.520  -1.538  -8.488  1.00 10.00 ? 134 ARG A HD2  5  
ATOM   10837 H  HD3  . ARG A 1 134 ? -4.072  -2.585  -7.125  1.00 10.00 ? 134 ARG A HD3  5  
ATOM   10838 H  HE   . ARG A 1 134 ? -6.910  -1.996  -7.167  1.00 10.00 ? 134 ARG A HE   5  
ATOM   10839 H  HH11 . ARG A 1 134 ? -4.594  -4.106  -8.776  1.00 10.00 ? 134 ARG A HH11 5  
ATOM   10840 H  HH12 . ARG A 1 134 ? -5.727  -5.413  -8.970  1.00 10.00 ? 134 ARG A HH12 5  
ATOM   10841 H  HH21 . ARG A 1 134 ? -8.334  -3.558  -7.349  1.00 10.00 ? 134 ARG A HH21 5  
ATOM   10842 H  HH22 . ARG A 1 134 ? -8.015  -5.072  -8.181  1.00 10.00 ? 134 ARG A HH22 5  
ATOM   10843 N  N    . THR A 1 135 ? -7.457  -2.568  -2.704  1.00 10.00 ? 135 THR A N    5  
ATOM   10844 C  CA   . THR A 1 135 ? -7.474  -3.255  -1.424  1.00 10.00 ? 135 THR A CA   5  
ATOM   10845 C  C    . THR A 1 135 ? -6.733  -4.570  -1.650  1.00 10.00 ? 135 THR A C    5  
ATOM   10846 O  O    . THR A 1 135 ? -7.285  -5.471  -2.277  1.00 10.00 ? 135 THR A O    5  
ATOM   10847 C  CB   . THR A 1 135 ? -8.930  -3.455  -0.978  1.00 10.00 ? 135 THR A CB   5  
ATOM   10848 O  OG1  . THR A 1 135 ? -9.569  -2.192  -0.927  1.00 10.00 ? 135 THR A OG1  5  
ATOM   10849 C  CG2  . THR A 1 135 ? -9.013  -4.109  0.405   1.00 10.00 ? 135 THR A CG2  5  
ATOM   10850 H  H    . THR A 1 135 ? -8.126  -2.883  -3.385  1.00 10.00 ? 135 THR A H    5  
ATOM   10851 H  HA   . THR A 1 135 ? -6.965  -2.672  -0.666  1.00 10.00 ? 135 THR A HA   5  
ATOM   10852 H  HB   . THR A 1 135 ? -9.451  -4.087  -1.701  1.00 10.00 ? 135 THR A HB   5  
ATOM   10853 H  HG1  . THR A 1 135 ? -10.517 -2.326  -0.837  1.00 10.00 ? 135 THR A HG1  5  
ATOM   10854 H  HG21 . THR A 1 135 ? -8.585  -5.112  0.371   1.00 10.00 ? 135 THR A HG21 5  
ATOM   10855 H  HG22 . THR A 1 135 ? -8.467  -3.514  1.137   1.00 10.00 ? 135 THR A HG22 5  
ATOM   10856 H  HG23 . THR A 1 135 ? -10.056 -4.187  0.714   1.00 10.00 ? 135 THR A HG23 5  
ATOM   10857 N  N    . LEU A 1 136 ? -5.464  -4.650  -1.239  1.00 10.00 ? 136 LEU A N    5  
ATOM   10858 C  CA   . LEU A 1 136 ? -4.562  -5.717  -1.664  1.00 10.00 ? 136 LEU A CA   5  
ATOM   10859 C  C    . LEU A 1 136 ? -3.453  -5.922  -0.636  1.00 10.00 ? 136 LEU A C    5  
ATOM   10860 O  O    . LEU A 1 136 ? -3.246  -5.067  0.219   1.00 10.00 ? 136 LEU A O    5  
ATOM   10861 C  CB   . LEU A 1 136 ? -3.969  -5.364  -3.036  1.00 10.00 ? 136 LEU A CB   5  
ATOM   10862 C  CG   . LEU A 1 136 ? -4.546  -6.201  -4.187  1.00 10.00 ? 136 LEU A CG   5  
ATOM   10863 C  CD1  . LEU A 1 136 ? -4.137  -5.557  -5.514  1.00 10.00 ? 136 LEU A CD1  5  
ATOM   10864 C  CD2  . LEU A 1 136 ? -4.030  -7.644  -4.147  1.00 10.00 ? 136 LEU A CD2  5  
ATOM   10865 H  H    . LEU A 1 136 ? -5.071  -3.899  -0.673  1.00 10.00 ? 136 LEU A H    5  
ATOM   10866 H  HA   . LEU A 1 136 ? -5.121  -6.652  -1.720  1.00 10.00 ? 136 LEU A HA   5  
ATOM   10867 H  HB2  . LEU A 1 136 ? -4.181  -4.315  -3.236  1.00 10.00 ? 136 LEU A HB2  5  
ATOM   10868 H  HB3  . LEU A 1 136 ? -2.886  -5.486  -3.009  1.00 10.00 ? 136 LEU A HB3  5  
ATOM   10869 H  HG   . LEU A 1 136 ? -5.635  -6.207  -4.135  1.00 10.00 ? 136 LEU A HG   5  
ATOM   10870 H  HD11 . LEU A 1 136 ? -4.517  -6.149  -6.346  1.00 10.00 ? 136 LEU A HD11 5  
ATOM   10871 H  HD12 . LEU A 1 136 ? -4.548  -4.549  -5.578  1.00 10.00 ? 136 LEU A HD12 5  
ATOM   10872 H  HD13 . LEU A 1 136 ? -3.050  -5.508  -5.570  1.00 10.00 ? 136 LEU A HD13 5  
ATOM   10873 H  HD21 . LEU A 1 136 ? -4.401  -8.191  -5.014  1.00 10.00 ? 136 LEU A HD21 5  
ATOM   10874 H  HD22 . LEU A 1 136 ? -2.939  -7.656  -4.162  1.00 10.00 ? 136 LEU A HD22 5  
ATOM   10875 H  HD23 . LEU A 1 136 ? -4.381  -8.151  -3.250  1.00 10.00 ? 136 LEU A HD23 5  
ATOM   10876 N  N    . ASN A 1 137 ? -2.756  -7.059  -0.730  1.00 10.00 ? 137 ASN A N    5  
ATOM   10877 C  CA   . ASN A 1 137 ? -1.969  -7.688  0.323   1.00 10.00 ? 137 ASN A CA   5  
ATOM   10878 C  C    . ASN A 1 137 ? -0.600  -8.077  -0.226  1.00 10.00 ? 137 ASN A C    5  
ATOM   10879 O  O    . ASN A 1 137 ? -0.267  -9.253  -0.350  1.00 10.00 ? 137 ASN A O    5  
ATOM   10880 C  CB   . ASN A 1 137 ? -2.716  -8.921  0.853   1.00 10.00 ? 137 ASN A CB   5  
ATOM   10881 C  CG   . ASN A 1 137 ? -2.989  -9.984  -0.215  1.00 10.00 ? 137 ASN A CG   5  
ATOM   10882 O  OD1  . ASN A 1 137 ? -3.220  -9.664  -1.380  1.00 10.00 ? 137 ASN A OD1  5  
ATOM   10883 N  ND2  . ASN A 1 137 ? -2.989  -11.257 0.168   1.00 10.00 ? 137 ASN A ND2  5  
ATOM   10884 H  H    . ASN A 1 137 ? -2.886  -7.648  -1.543  1.00 10.00 ? 137 ASN A H    5  
ATOM   10885 H  HA   . ASN A 1 137 ? -1.842  -7.001  1.153   1.00 10.00 ? 137 ASN A HA   5  
ATOM   10886 H  HB2  . ASN A 1 137 ? -2.127  -9.357  1.661   1.00 10.00 ? 137 ASN A HB2  5  
ATOM   10887 H  HB3  . ASN A 1 137 ? -3.667  -8.590  1.259   1.00 10.00 ? 137 ASN A HB3  5  
ATOM   10888 H  HD21 . ASN A 1 137 ? -2.772  -11.505 1.121   1.00 10.00 ? 137 ASN A HD21 5  
ATOM   10889 H  HD22 . ASN A 1 137 ? -3.155  -11.967 -0.528  1.00 10.00 ? 137 ASN A HD22 5  
ATOM   10890 N  N    . VAL A 1 138 ? 0.192   -7.077  -0.597  1.00 10.00 ? 138 VAL A N    5  
ATOM   10891 C  CA   . VAL A 1 138 ? 1.442   -7.297  -1.303  1.00 10.00 ? 138 VAL A CA   5  
ATOM   10892 C  C    . VAL A 1 138 ? 2.526   -7.662  -0.284  1.00 10.00 ? 138 VAL A C    5  
ATOM   10893 O  O    . VAL A 1 138 ? 2.481   -7.202  0.852   1.00 10.00 ? 138 VAL A O    5  
ATOM   10894 C  CB   . VAL A 1 138 ? 1.797   -6.015  -2.077  1.00 10.00 ? 138 VAL A CB   5  
ATOM   10895 C  CG1  . VAL A 1 138 ? 3.083   -6.164  -2.901  1.00 10.00 ? 138 VAL A CG1  5  
ATOM   10896 C  CG2  . VAL A 1 138 ? 0.662   -5.552  -2.995  1.00 10.00 ? 138 VAL A CG2  5  
ATOM   10897 H  H    . VAL A 1 138 ? -0.098  -6.133  -0.397  1.00 10.00 ? 138 VAL A H    5  
ATOM   10898 H  HA   . VAL A 1 138 ? 1.295   -8.123  -1.998  1.00 10.00 ? 138 VAL A HA   5  
ATOM   10899 H  HB   . VAL A 1 138 ? 1.926   -5.223  -1.348  1.00 10.00 ? 138 VAL A HB   5  
ATOM   10900 H  HG11 . VAL A 1 138 ? 2.990   -7.002  -3.593  1.00 10.00 ? 138 VAL A HG11 5  
ATOM   10901 H  HG12 . VAL A 1 138 ? 3.267   -5.253  -3.472  1.00 10.00 ? 138 VAL A HG12 5  
ATOM   10902 H  HG13 . VAL A 1 138 ? 3.939   -6.327  -2.248  1.00 10.00 ? 138 VAL A HG13 5  
ATOM   10903 H  HG21 . VAL A 1 138 ? -0.217  -5.292  -2.406  1.00 10.00 ? 138 VAL A HG21 5  
ATOM   10904 H  HG22 . VAL A 1 138 ? 0.983   -4.657  -3.529  1.00 10.00 ? 138 VAL A HG22 5  
ATOM   10905 H  HG23 . VAL A 1 138 ? 0.411   -6.336  -3.710  1.00 10.00 ? 138 VAL A HG23 5  
ATOM   10906 N  N    . ALA A 1 139 ? 3.517   -8.473  -0.662  1.00 10.00 ? 139 ALA A N    5  
ATOM   10907 C  CA   . ALA A 1 139 ? 4.578   -8.862  0.256   1.00 10.00 ? 139 ALA A CA   5  
ATOM   10908 C  C    . ALA A 1 139 ? 5.635   -7.758  0.317   1.00 10.00 ? 139 ALA A C    5  
ATOM   10909 O  O    . ALA A 1 139 ? 6.005   -7.199  -0.718  1.00 10.00 ? 139 ALA A O    5  
ATOM   10910 C  CB   . ALA A 1 139 ? 5.200   -10.182 -0.209  1.00 10.00 ? 139 ALA A CB   5  
ATOM   10911 H  H    . ALA A 1 139 ? 3.552   -8.819  -1.608  1.00 10.00 ? 139 ALA A H    5  
ATOM   10912 H  HA   . ALA A 1 139 ? 4.162   -9.027  1.252   1.00 10.00 ? 139 ALA A HA   5  
ATOM   10913 H  HB1  . ALA A 1 139 ? 4.436   -10.960 -0.239  1.00 10.00 ? 139 ALA A HB1  5  
ATOM   10914 H  HB2  . ALA A 1 139 ? 5.634   -10.063 -1.203  1.00 10.00 ? 139 ALA A HB2  5  
ATOM   10915 H  HB3  . ALA A 1 139 ? 5.984   -10.482 0.488   1.00 10.00 ? 139 ALA A HB3  5  
ATOM   10916 N  N    . ALA A 1 140 ? 6.112   -7.451  1.528   1.00 10.00 ? 140 ALA A N    5  
ATOM   10917 C  CA   . ALA A 1 140 ? 7.187   -6.507  1.782   1.00 10.00 ? 140 ALA A CA   5  
ATOM   10918 C  C    . ALA A 1 140 ? 8.392   -7.242  2.362   1.00 10.00 ? 140 ALA A C    5  
ATOM   10919 O  O    . ALA A 1 140 ? 8.276   -7.829  3.436   1.00 10.00 ? 140 ALA A O    5  
ATOM   10920 C  CB   . ALA A 1 140 ? 6.706   -5.425  2.752   1.00 10.00 ? 140 ALA A CB   5  
ATOM   10921 H  H    . ALA A 1 140 ? 5.737   -7.923  2.346   1.00 10.00 ? 140 ALA A H    5  
ATOM   10922 H  HA   . ALA A 1 140 ? 7.477   -6.020  0.861   1.00 10.00 ? 140 ALA A HA   5  
ATOM   10923 H  HB1  . ALA A 1 140 ? 7.512   -4.709  2.920   1.00 10.00 ? 140 ALA A HB1  5  
ATOM   10924 H  HB2  . ALA A 1 140 ? 5.846   -4.907  2.333   1.00 10.00 ? 140 ALA A HB2  5  
ATOM   10925 H  HB3  . ALA A 1 140 ? 6.422   -5.872  3.706   1.00 10.00 ? 140 ALA A HB3  5  
ATOM   10926 N  N    . THR A 1 141 ? 9.551   -7.187  1.696   1.00 10.00 ? 141 THR A N    5  
ATOM   10927 C  CA   . THR A 1 141 ? 10.801  -7.601  2.330   1.00 10.00 ? 141 THR A CA   5  
ATOM   10928 C  C    . THR A 1 141 ? 11.326  -6.418  3.135   1.00 10.00 ? 141 THR A C    5  
ATOM   10929 O  O    . THR A 1 141 ? 11.091  -5.266  2.777   1.00 10.00 ? 141 THR A O    5  
ATOM   10930 C  CB   . THR A 1 141 ? 11.829  -8.160  1.330   1.00 10.00 ? 141 THR A CB   5  
ATOM   10931 O  OG1  . THR A 1 141 ? 12.921  -8.748  2.009   1.00 10.00 ? 141 THR A OG1  5  
ATOM   10932 C  CG2  . THR A 1 141 ? 12.422  -7.081  0.432   1.00 10.00 ? 141 THR A CG2  5  
ATOM   10933 H  H    . THR A 1 141 ? 9.587   -6.621  0.853   1.00 10.00 ? 141 THR A H    5  
ATOM   10934 H  HA   . THR A 1 141 ? 10.591  -8.413  3.018   1.00 10.00 ? 141 THR A HA   5  
ATOM   10935 H  HB   . THR A 1 141 ? 11.343  -8.923  0.718   1.00 10.00 ? 141 THR A HB   5  
ATOM   10936 H  HG1  . THR A 1 141 ? 12.591  -9.393  2.651   1.00 10.00 ? 141 THR A HG1  5  
ATOM   10937 H  HG21 . THR A 1 141 ? 13.026  -6.397  1.033   1.00 10.00 ? 141 THR A HG21 5  
ATOM   10938 H  HG22 . THR A 1 141 ? 13.057  -7.549  -0.318  1.00 10.00 ? 141 THR A HG22 5  
ATOM   10939 H  HG23 . THR A 1 141 ? 11.615  -6.545  -0.056  1.00 10.00 ? 141 THR A HG23 5  
ATOM   10940 N  N    . VAL A 1 142 ? 12.013  -6.692  4.238   1.00 10.00 ? 142 VAL A N    5  
ATOM   10941 C  CA   . VAL A 1 142 ? 12.446  -5.672  5.174   1.00 10.00 ? 142 VAL A CA   5  
ATOM   10942 C  C    . VAL A 1 142 ? 13.970  -5.640  5.079   1.00 10.00 ? 142 VAL A C    5  
ATOM   10943 O  O    . VAL A 1 142 ? 14.612  -6.533  5.619   1.00 10.00 ? 142 VAL A O    5  
ATOM   10944 C  CB   . VAL A 1 142 ? 11.947  -6.075  6.575   1.00 10.00 ? 142 VAL A CB   5  
ATOM   10945 C  CG1  . VAL A 1 142 ? 12.185  -4.977  7.609   1.00 10.00 ? 142 VAL A CG1  5  
ATOM   10946 C  CG2  . VAL A 1 142 ? 10.449  -6.414  6.595   1.00 10.00 ? 142 VAL A CG2  5  
ATOM   10947 H  H    . VAL A 1 142 ? 12.242  -7.654  4.449   1.00 10.00 ? 142 VAL A H    5  
ATOM   10948 H  HA   . VAL A 1 142 ? 12.030  -4.692  4.923   1.00 10.00 ? 142 VAL A HA   5  
ATOM   10949 H  HB   . VAL A 1 142 ? 12.492  -6.959  6.903   1.00 10.00 ? 142 VAL A HB   5  
ATOM   10950 H  HG11 . VAL A 1 142 ? 13.235  -4.715  7.648   1.00 10.00 ? 142 VAL A HG11 5  
ATOM   10951 H  HG12 . VAL A 1 142 ? 11.597  -4.092  7.386   1.00 10.00 ? 142 VAL A HG12 5  
ATOM   10952 H  HG13 . VAL A 1 142 ? 11.888  -5.359  8.580   1.00 10.00 ? 142 VAL A HG13 5  
ATOM   10953 H  HG21 . VAL A 1 142 ? 9.865   -5.564  6.245   1.00 10.00 ? 142 VAL A HG21 5  
ATOM   10954 H  HG22 . VAL A 1 142 ? 10.233  -7.279  5.970   1.00 10.00 ? 142 VAL A HG22 5  
ATOM   10955 H  HG23 . VAL A 1 142 ? 10.149  -6.653  7.616   1.00 10.00 ? 142 VAL A HG23 5  
ATOM   10956 N  N    . LYS A 1 143 ? 14.561  -4.687  4.347   1.00 10.00 ? 143 LYS A N    5  
ATOM   10957 C  CA   . LYS A 1 143 ? 16.007  -4.572  4.186   1.00 10.00 ? 143 LYS A CA   5  
ATOM   10958 C  C    . LYS A 1 143 ? 16.402  -3.137  3.812   1.00 10.00 ? 143 LYS A C    5  
ATOM   10959 O  O    . LYS A 1 143 ? 15.857  -2.588  2.858   1.00 10.00 ? 143 LYS A O    5  
ATOM   10960 C  CB   . LYS A 1 143 ? 16.514  -5.596  3.154   1.00 10.00 ? 143 LYS A CB   5  
ATOM   10961 C  CG   . LYS A 1 143 ? 16.033  -5.309  1.724   1.00 10.00 ? 143 LYS A CG   5  
ATOM   10962 C  CD   . LYS A 1 143 ? 16.316  -6.506  0.810   1.00 10.00 ? 143 LYS A CD   5  
ATOM   10963 C  CE   . LYS A 1 143 ? 16.035  -6.120  -0.650  1.00 10.00 ? 143 LYS A CE   5  
ATOM   10964 N  NZ   . LYS A 1 143 ? 16.251  -7.249  -1.577  1.00 10.00 ? 143 LYS A NZ   5  
ATOM   10965 H  H    . LYS A 1 143 ? 13.986  -3.955  3.939   1.00 10.00 ? 143 LYS A H    5  
ATOM   10966 H  HA   . LYS A 1 143 ? 16.466  -4.812  5.144   1.00 10.00 ? 143 LYS A HA   5  
ATOM   10967 H  HB2  . LYS A 1 143 ? 17.606  -5.591  3.161   1.00 10.00 ? 143 LYS A HB2  5  
ATOM   10968 H  HB3  . LYS A 1 143 ? 16.178  -6.590  3.450   1.00 10.00 ? 143 LYS A HB3  5  
ATOM   10969 H  HG2  . LYS A 1 143 ? 14.964  -5.095  1.730   1.00 10.00 ? 143 LYS A HG2  5  
ATOM   10970 H  HG3  . LYS A 1 143 ? 16.560  -4.434  1.337   1.00 10.00 ? 143 LYS A HG3  5  
ATOM   10971 H  HD2  . LYS A 1 143 ? 17.363  -6.793  0.923   1.00 10.00 ? 143 LYS A HD2  5  
ATOM   10972 H  HD3  . LYS A 1 143 ? 15.680  -7.340  1.120   1.00 10.00 ? 143 LYS A HD3  5  
ATOM   10973 H  HE2  . LYS A 1 143 ? 15.006  -5.770  -0.743  1.00 10.00 ? 143 LYS A HE2  5  
ATOM   10974 H  HE3  . LYS A 1 143 ? 16.700  -5.303  -0.938  1.00 10.00 ? 143 LYS A HE3  5  
ATOM   10975 H  HZ1  . LYS A 1 143 ? 16.057  -6.951  -2.523  1.00 10.00 ? 143 LYS A HZ1  5  
ATOM   10976 H  HZ2  . LYS A 1 143 ? 17.211  -7.562  -1.526  1.00 10.00 ? 143 LYS A HZ2  5  
ATOM   10977 H  HZ3  . LYS A 1 143 ? 15.638  -8.018  -1.342  1.00 10.00 ? 143 LYS A HZ3  5  
ATOM   10978 N  N    . LYS A 1 144 ? 17.330  -2.517  4.553   1.00 10.00 ? 144 LYS A N    5  
ATOM   10979 C  CA   . LYS A 1 144 ? 17.905  -1.227  4.189   1.00 10.00 ? 144 LYS A CA   5  
ATOM   10980 C  C    . LYS A 1 144 ? 18.565  -1.279  2.804   1.00 10.00 ? 144 LYS A C    5  
ATOM   10981 O  O    . LYS A 1 144 ? 19.700  -1.726  2.655   1.00 10.00 ? 144 LYS A O    5  
ATOM   10982 C  CB   . LYS A 1 144 ? 18.834  -0.685  5.288   1.00 10.00 ? 144 LYS A CB   5  
ATOM   10983 C  CG   . LYS A 1 144 ? 19.905  -1.640  5.831   1.00 10.00 ? 144 LYS A CG   5  
ATOM   10984 C  CD   . LYS A 1 144 ? 20.847  -0.869  6.776   1.00 10.00 ? 144 LYS A CD   5  
ATOM   10985 C  CE   . LYS A 1 144 ? 20.907  -1.475  8.185   1.00 10.00 ? 144 LYS A CE   5  
ATOM   10986 N  NZ   . LYS A 1 144 ? 19.654  -1.280  8.947   1.00 10.00 ? 144 LYS A NZ   5  
ATOM   10987 H  H    . LYS A 1 144 ? 17.689  -2.965  5.378   1.00 10.00 ? 144 LYS A H    5  
ATOM   10988 H  HA   . LYS A 1 144 ? 17.104  -0.496  4.121   1.00 10.00 ? 144 LYS A HA   5  
ATOM   10989 H  HB2  . LYS A 1 144 ? 19.355  0.173   4.871   1.00 10.00 ? 144 LYS A HB2  5  
ATOM   10990 H  HB3  . LYS A 1 144 ? 18.220  -0.334  6.115   1.00 10.00 ? 144 LYS A HB3  5  
ATOM   10991 H  HG2  . LYS A 1 144 ? 19.445  -2.487  6.338   1.00 10.00 ? 144 LYS A HG2  5  
ATOM   10992 H  HG3  . LYS A 1 144 ? 20.499  -2.020  4.997   1.00 10.00 ? 144 LYS A HG3  5  
ATOM   10993 H  HD2  . LYS A 1 144 ? 21.850  -0.894  6.337   1.00 10.00 ? 144 LYS A HD2  5  
ATOM   10994 H  HD3  . LYS A 1 144 ? 20.565  0.184   6.840   1.00 10.00 ? 144 LYS A HD3  5  
ATOM   10995 H  HE2  . LYS A 1 144 ? 21.122  -2.542  8.100   1.00 10.00 ? 144 LYS A HE2  5  
ATOM   10996 H  HE3  . LYS A 1 144 ? 21.725  -1.007  8.736   1.00 10.00 ? 144 LYS A HE3  5  
ATOM   10997 H  HZ1  . LYS A 1 144 ? 19.637  -1.865  9.768   1.00 10.00 ? 144 LYS A HZ1  5  
ATOM   10998 H  HZ2  . LYS A 1 144 ? 19.523  -0.324  9.275   1.00 10.00 ? 144 LYS A HZ2  5  
ATOM   10999 H  HZ3  . LYS A 1 144 ? 18.819  -1.471  8.397   1.00 10.00 ? 144 LYS A HZ3  5  
ATOM   11000 N  N    . ASN A 1 145 ? 17.840  -0.819  1.783   1.00 10.00 ? 145 ASN A N    5  
ATOM   11001 C  CA   . ASN A 1 145 ? 18.334  -0.746  0.415   1.00 10.00 ? 145 ASN A CA   5  
ATOM   11002 C  C    . ASN A 1 145 ? 19.360  0.381   0.290   1.00 10.00 ? 145 ASN A C    5  
ATOM   11003 O  O    . ASN A 1 145 ? 19.044  1.433   -0.260  1.00 10.00 ? 145 ASN A O    5  
ATOM   11004 C  CB   . ASN A 1 145 ? 17.175  -0.502  -0.562  1.00 10.00 ? 145 ASN A CB   5  
ATOM   11005 C  CG   . ASN A 1 145 ? 16.112  -1.592  -0.540  1.00 10.00 ? 145 ASN A CG   5  
ATOM   11006 O  OD1  . ASN A 1 145 ? 16.383  -2.754  -0.833  1.00 10.00 ? 145 ASN A OD1  5  
ATOM   11007 N  ND2  . ASN A 1 145 ? 14.882  -1.207  -0.224  1.00 10.00 ? 145 ASN A ND2  5  
ATOM   11008 H  H    . ASN A 1 145 ? 16.881  -0.560  1.965   1.00 10.00 ? 145 ASN A H    5  
ATOM   11009 H  HA   . ASN A 1 145 ? 18.810  -1.691  0.146   1.00 10.00 ? 145 ASN A HA   5  
ATOM   11010 H  HB2  . ASN A 1 145 ? 16.710  0.458   -0.336  1.00 10.00 ? 145 ASN A HB2  5  
ATOM   11011 H  HB3  . ASN A 1 145 ? 17.576  -0.451  -1.575  1.00 10.00 ? 145 ASN A HB3  5  
ATOM   11012 H  HD21 . ASN A 1 145 ? 14.688  -0.247  0.002   1.00 10.00 ? 145 ASN A HD21 5  
ATOM   11013 H  HD22 . ASN A 1 145 ? 14.112  -1.852  -0.379  1.00 10.00 ? 145 ASN A HD22 5  
ATOM   11014 N  N    . ILE A 1 146