data_1XC5
# 
_entry.id   1XC5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1XC5         
RCSB  RCSB030191   
WWPDB D_1000030191 
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.db_id          6286 
_pdbx_database_related.details        '1H and 15N chemical shift assignment' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1XC5 
_pdbx_database_status.recvd_initial_deposition_date   2004-09-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Codina, A.'      1 
'Love, J.D.'      2 
'Li, Y.'          3 
'Lazar, M.A.'     4 
'Neuhaus, D.'     5 
'Schwabe, J.W.R.' 6 
# 
_citation.id                        primary 
_citation.title                     
'Structural insights into the interaction and activation of histone deacetylase 3 by nuclear receptor corepressors' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            102 
_citation.page_first                6009 
_citation.page_last                 6014 
_citation.year                      2005 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15837933 
_citation.pdbx_database_id_DOI      10.1073/pnas.0500299102 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Codina, A.'      1 
primary 'Love, J.D.'      2 
primary 'Li, Y.'          3 
primary 'Lazar, M.A.'     4 
primary 'Neuhaus, D.'     5 
primary 'Schwabe, J.W.R.' 6 
# 
_cell.entry_id           1XC5 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1XC5 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Nuclear receptor corepressor 2' 
_entity.formula_weight             8578.959 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'Deacetylase Activation Domain (residues 410-480)' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;SMRT, N-CoR2, Silencing mediator of retinoic acid and thyroid hormone receptor, SMRTe, Thyroid-, retinoic-acid-receptor-associated corepressor, T3 receptor- associating factor, TRAC, CTG repeat protein 26, SMAP270
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GSMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKKNENYK 
_entity_poly.pdbx_seq_one_letter_code_can   GSMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKKNENYK 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  MET n 
1 4  ASN n 
1 5  GLY n 
1 6  LEU n 
1 7  MET n 
1 8  ALA n 
1 9  ASP n 
1 10 PRO n 
1 11 MET n 
1 12 LYS n 
1 13 VAL n 
1 14 TYR n 
1 15 LYS n 
1 16 ASP n 
1 17 ARG n 
1 18 GLN n 
1 19 VAL n 
1 20 MET n 
1 21 ASN n 
1 22 MET n 
1 23 TRP n 
1 24 SER n 
1 25 GLU n 
1 26 GLN n 
1 27 GLU n 
1 28 LYS n 
1 29 GLU n 
1 30 THR n 
1 31 PHE n 
1 32 ARG n 
1 33 GLU n 
1 34 LYS n 
1 35 PHE n 
1 36 MET n 
1 37 GLN n 
1 38 HIS n 
1 39 PRO n 
1 40 LYS n 
1 41 ASN n 
1 42 PHE n 
1 43 GLY n 
1 44 LEU n 
1 45 ILE n 
1 46 ALA n 
1 47 SER n 
1 48 PHE n 
1 49 LEU n 
1 50 GLU n 
1 51 ARG n 
1 52 LYS n 
1 53 THR n 
1 54 VAL n 
1 55 ALA n 
1 56 GLU n 
1 57 CYS n 
1 58 VAL n 
1 59 LEU n 
1 60 TYR n 
1 61 TYR n 
1 62 TYR n 
1 63 LEU n 
1 64 THR n 
1 65 LYS n 
1 66 LYS n 
1 67 ASN n 
1 68 GLU n 
1 69 ASN n 
1 70 TYR n 
1 71 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX-4T-1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NCOR2_HUMAN 
_struct_ref.pdbx_db_accession          Q9Y618 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   MNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKKNENYK 
_struct_ref.pdbx_align_begin           412 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1XC5 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 71 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9Y618 
_struct_ref_seq.db_align_beg                  412 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  480 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       412 
_struct_ref_seq.pdbx_auth_seq_align_end       480 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1XC5 GLY A 1 ? UNP Q9Y618 ? ? 'CLONING ARTIFACT' 410 1 
1 1XC5 SER A 2 ? UNP Q9Y618 ? ? 'CLONING ARTIFACT' 411 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 2 1 DQF-COSY               
2 2 1 DQ-correlation         
3 1 1 '2D TOCSY'             
4 1 1 '2D NOESY'             
5 3 1 3D_15N-separated_TOCSY 
6 3 1 3D_15N-separated_NOESY 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         290 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  6.8 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '0.35 M' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '1-2mM DAD, 50mM NaCl, 50mM phosphate buffer NA'       '93% H2O/7% D2O' 
2 '1-2mM DAD, 50mM NaCl, 50mM phosphate buffer NA'       '100% D2O'       
3 '1-2mM DAD U-15N, 50mM NaCl, 50mM phosphate buffer NA' '93% H2O/7% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Bruker Avance 800 
2 ? Bruker DMX    600 
3 ? Bruker DRX    500 
# 
_pdbx_nmr_refine.entry_id           1XC5 
_pdbx_nmr_refine.method             'Simulated annealing protocol' 
_pdbx_nmr_refine.details            'supplied with the program CNS' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1XC5 
_pdbx_nmr_details.text       
'This structure was determined using a combination of standard 2D homonuclear techniques and 3D 15N TOCSY-HSQC and 15N NOESY-HSQC' 
# 
_pdbx_nmr_ensemble.entry_id                                      1XC5 
_pdbx_nmr_ensemble.conformers_calculated_total_number            50 
_pdbx_nmr_ensemble.conformers_submitted_total_number             28 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1XC5 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XWINNMR ?       processing           'Bruker GmbH, Karlsruhe, Germany'                                                      1 
NMRPipe 02/2000 processing           'Frank Delaglio Stephan Grzesiek, Guang Zhu, Geerten W. Vuister, John Pfeifer, Ad Bax' 2 
SPARKY  3.106   'data analysis'      'T.D. Goddard, D.G. Kneller'                                                           3 
CNS     1.1     'structure solution' ?                                                                                      4 
CNS     1.1     refinement           ?                                                                                      5 
# 
_exptl.entry_id          1XC5 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1XC5 
_struct.title                     'Solution Structure of the SMRT Deacetylase Activation Domain' 
_struct.pdbx_descriptor           'Nuclear receptor corepressor 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1XC5 
_struct_keywords.pdbx_keywords   'TRANSCRIPTION COREPRESSOR' 
_struct_keywords.text            'four-helix structure, three-helix triangle, TRANSCRIPTION COREPRESSOR' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 27 ? HIS A 38 ? GLU A 436 HIS A 447 1 ? 12 
HELX_P HELX_P2 2 LEU A 44 ? LEU A 49 ? LEU A 453 LEU A 458 1 ? 6  
HELX_P HELX_P3 3 THR A 53 ? LYS A 65 ? THR A 462 LYS A 474 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1XC5 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1XC5 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . ASN A 1 4  ? 13.609  6.401   13.534  1.00 10.00 ? 413 ASN A N    1  
ATOM 2     C CA   . ASN A 1 4  ? 13.382  5.540   14.689  1.00 10.00 ? 413 ASN A CA   1  
ATOM 3     C C    . ASN A 1 4  ? 13.696  4.085   14.353  1.00 10.00 ? 413 ASN A C    1  
ATOM 4     O O    . ASN A 1 4  ? 14.120  3.772   13.241  1.00 10.00 ? 413 ASN A O    1  
ATOM 5     C CB   . ASN A 1 4  ? 11.934  5.664   15.166  1.00 10.00 ? 413 ASN A CB   1  
ATOM 6     C CG   . ASN A 1 4  ? 11.759  6.754   16.206  1.00 10.00 ? 413 ASN A CG   1  
ATOM 7     O OD1  . ASN A 1 4  ? 11.652  7.934   15.873  1.00 10.00 ? 413 ASN A OD1  1  
ATOM 8     N ND2  . ASN A 1 4  ? 11.730  6.363   17.474  1.00 10.00 ? 413 ASN A ND2  1  
ATOM 9     H H    . ASN A 1 4  ? 13.559  6.017   12.634  1.00 10.00 ? 413 ASN A H    1  
ATOM 10    H HA   . ASN A 1 4  ? 14.041  5.865   15.480  1.00 10.00 ? 413 ASN A HA   1  
ATOM 11    H HB2  . ASN A 1 4  ? 11.301  5.894   14.322  1.00 10.00 ? 413 ASN A HB2  1  
ATOM 12    H HB3  . ASN A 1 4  ? 11.622  4.725   15.600  1.00 10.00 ? 413 ASN A HB3  1  
ATOM 13    H HD21 . ASN A 1 4  ? 11.822  5.406   17.666  1.00 10.00 ? 413 ASN A HD21 1  
ATOM 14    H HD22 . ASN A 1 4  ? 11.618  7.047   18.167  1.00 10.00 ? 413 ASN A HD22 1  
ATOM 15    N N    . GLY A 1 5  ? 13.484  3.201   15.322  1.00 10.00 ? 414 GLY A N    1  
ATOM 16    C CA   . GLY A 1 5  ? 13.749  1.790   15.110  1.00 10.00 ? 414 GLY A CA   1  
ATOM 17    C C    . GLY A 1 5  ? 13.756  1.000   16.403  1.00 10.00 ? 414 GLY A C    1  
ATOM 18    O O    . GLY A 1 5  ? 14.705  0.269   16.687  1.00 10.00 ? 414 GLY A O    1  
ATOM 19    H H    . GLY A 1 5  ? 13.144  3.509   16.189  1.00 10.00 ? 414 GLY A H    1  
ATOM 20    H HA2  . GLY A 1 5  ? 12.989  1.387   14.458  1.00 10.00 ? 414 GLY A HA2  1  
ATOM 21    H HA3  . GLY A 1 5  ? 14.712  1.685   14.631  1.00 10.00 ? 414 GLY A HA3  1  
ATOM 22    N N    . LEU A 1 6  ? 12.695  1.146   17.189  1.00 10.00 ? 415 LEU A N    1  
ATOM 23    C CA   . LEU A 1 6  ? 12.582  0.440   18.460  1.00 10.00 ? 415 LEU A CA   1  
ATOM 24    C C    . LEU A 1 6  ? 11.217  -0.229  18.592  1.00 10.00 ? 415 LEU A C    1  
ATOM 25    O O    . LEU A 1 6  ? 11.117  -1.455  18.621  1.00 10.00 ? 415 LEU A O    1  
ATOM 26    C CB   . LEU A 1 6  ? 12.804  1.406   19.626  1.00 10.00 ? 415 LEU A CB   1  
ATOM 27    C CG   . LEU A 1 6  ? 13.384  0.772   20.891  1.00 10.00 ? 415 LEU A CG   1  
ATOM 28    C CD1  . LEU A 1 6  ? 14.902  0.718   20.813  1.00 10.00 ? 415 LEU A CD1  1  
ATOM 29    C CD2  . LEU A 1 6  ? 12.939  1.543   22.124  1.00 10.00 ? 415 LEU A CD2  1  
ATOM 30    H H    . LEU A 1 6  ? 11.970  1.743   16.908  1.00 10.00 ? 415 LEU A H    1  
ATOM 31    H HA   . LEU A 1 6  ? 13.347  -0.321  18.485  1.00 10.00 ? 415 LEU A HA   1  
ATOM 32    H HB2  . LEU A 1 6  ? 13.476  2.185   19.297  1.00 10.00 ? 415 LEU A HB2  1  
ATOM 33    H HB3  . LEU A 1 6  ? 11.855  1.856   19.878  1.00 10.00 ? 415 LEU A HB3  1  
ATOM 34    H HG   . LEU A 1 6  ? 13.018  -0.241  20.978  1.00 10.00 ? 415 LEU A HG   1  
ATOM 35    H HD11 . LEU A 1 6  ? 15.290  1.714   20.659  1.00 10.00 ? 415 LEU A HD11 1  
ATOM 36    H HD12 . LEU A 1 6  ? 15.197  0.085   19.989  1.00 10.00 ? 415 LEU A HD12 1  
ATOM 37    H HD13 . LEU A 1 6  ? 15.295  0.316   21.734  1.00 10.00 ? 415 LEU A HD13 1  
ATOM 38    H HD21 . LEU A 1 6  ? 13.684  1.444   22.899  1.00 10.00 ? 415 LEU A HD21 1  
ATOM 39    H HD22 . LEU A 1 6  ? 11.998  1.146   22.477  1.00 10.00 ? 415 LEU A HD22 1  
ATOM 40    H HD23 . LEU A 1 6  ? 12.817  2.586   21.872  1.00 10.00 ? 415 LEU A HD23 1  
ATOM 41    N N    . MET A 1 7  ? 10.170  0.585   18.670  1.00 10.00 ? 416 MET A N    1  
ATOM 42    C CA   . MET A 1 7  ? 8.810   0.073   18.798  1.00 10.00 ? 416 MET A CA   1  
ATOM 43    C C    . MET A 1 7  ? 7.963   0.469   17.593  1.00 10.00 ? 416 MET A C    1  
ATOM 44    O O    . MET A 1 7  ? 7.211   1.442   17.644  1.00 10.00 ? 416 MET A O    1  
ATOM 45    C CB   . MET A 1 7  ? 8.165   0.595   20.084  1.00 10.00 ? 416 MET A CB   1  
ATOM 46    C CG   . MET A 1 7  ? 8.536   -0.209  21.320  1.00 10.00 ? 416 MET A CG   1  
ATOM 47    S SD   . MET A 1 7  ? 7.968   0.565   22.846  1.00 10.00 ? 416 MET A SD   1  
ATOM 48    C CE   . MET A 1 7  ? 9.529   1.022   23.595  1.00 10.00 ? 416 MET A CE   1  
ATOM 49    H H    . MET A 1 7  ? 10.314  1.554   18.641  1.00 10.00 ? 416 MET A H    1  
ATOM 50    H HA   . MET A 1 7  ? 8.865   -1.005  18.846  1.00 10.00 ? 416 MET A HA   1  
ATOM 51    H HB2  . MET A 1 7  ? 8.476   1.617   20.239  1.00 10.00 ? 416 MET A HB2  1  
ATOM 52    H HB3  . MET A 1 7  ? 7.092   0.567   19.971  1.00 10.00 ? 416 MET A HB3  1  
ATOM 53    H HG2  . MET A 1 7  ? 8.089   -1.189  21.243  1.00 10.00 ? 416 MET A HG2  1  
ATOM 54    H HG3  . MET A 1 7  ? 9.610   -0.307  21.360  1.00 10.00 ? 416 MET A HG3  1  
ATOM 55    H HE1  . MET A 1 7  ? 10.310  0.374   23.224  1.00 10.00 ? 416 MET A HE1  1  
ATOM 56    H HE2  . MET A 1 7  ? 9.458   0.921   24.668  1.00 10.00 ? 416 MET A HE2  1  
ATOM 57    H HE3  . MET A 1 7  ? 9.762   2.046   23.345  1.00 10.00 ? 416 MET A HE3  1  
ATOM 58    N N    . ALA A 1 8  ? 8.091   -0.291  16.511  1.00 10.00 ? 417 ALA A N    1  
ATOM 59    C CA   . ALA A 1 8  ? 7.338   -0.019  15.293  1.00 10.00 ? 417 ALA A CA   1  
ATOM 60    C C    . ALA A 1 8  ? 7.573   -1.104  14.248  1.00 10.00 ? 417 ALA A C    1  
ATOM 61    O O    . ALA A 1 8  ? 8.440   -0.969  13.384  1.00 10.00 ? 417 ALA A O    1  
ATOM 62    C CB   . ALA A 1 8  ? 7.713   1.345   14.734  1.00 10.00 ? 417 ALA A CB   1  
ATOM 63    H H    . ALA A 1 8  ? 8.707   -1.053  16.532  1.00 10.00 ? 417 ALA A H    1  
ATOM 64    H HA   . ALA A 1 8  ? 6.288   -0.001  15.548  1.00 10.00 ? 417 ALA A HA   1  
ATOM 65    H HB1  . ALA A 1 8  ? 7.148   2.111   15.244  1.00 10.00 ? 417 ALA A HB1  1  
ATOM 66    H HB2  . ALA A 1 8  ? 7.489   1.376   13.678  1.00 10.00 ? 417 ALA A HB2  1  
ATOM 67    H HB3  . ALA A 1 8  ? 8.769   1.517   14.884  1.00 10.00 ? 417 ALA A HB3  1  
ATOM 68    N N    . ASP A 1 9  ? 6.797   -2.179  14.333  1.00 10.00 ? 418 ASP A N    1  
ATOM 69    C CA   . ASP A 1 9  ? 6.921   -3.288  13.394  1.00 10.00 ? 418 ASP A CA   1  
ATOM 70    C C    . ASP A 1 9  ? 5.759   -3.295  12.403  1.00 10.00 ? 418 ASP A C    1  
ATOM 71    O O    . ASP A 1 9  ? 4.652   -2.868  12.730  1.00 10.00 ? 418 ASP A O    1  
ATOM 72    C CB   . ASP A 1 9  ? 6.972   -4.618  14.147  1.00 10.00 ? 418 ASP A CB   1  
ATOM 73    C CG   . ASP A 1 9  ? 8.209   -4.744  15.015  1.00 10.00 ? 418 ASP A CG   1  
ATOM 74    O OD1  . ASP A 1 9  ? 8.289   -4.036  16.041  1.00 10.00 ? 418 ASP A OD1  1  
ATOM 75    O OD2  . ASP A 1 9  ? 9.099   -5.549  14.668  1.00 10.00 ? 418 ASP A OD2  1  
ATOM 76    H H    . ASP A 1 9  ? 6.124   -2.228  15.044  1.00 10.00 ? 418 ASP A H    1  
ATOM 77    H HA   . ASP A 1 9  ? 7.843   -3.158  12.848  1.00 10.00 ? 418 ASP A HA   1  
ATOM 78    H HB2  . ASP A 1 9  ? 6.102   -4.700  14.781  1.00 10.00 ? 418 ASP A HB2  1  
ATOM 79    H HB3  . ASP A 1 9  ? 6.971   -5.429  13.434  1.00 10.00 ? 418 ASP A HB3  1  
ATOM 80    N N    . PRO A 1 10 ? 5.998   -3.784  11.174  1.00 10.00 ? 419 PRO A N    1  
ATOM 81    C CA   . PRO A 1 10 ? 4.965   -3.845  10.135  1.00 10.00 ? 419 PRO A CA   1  
ATOM 82    C C    . PRO A 1 10 ? 3.900   -4.893  10.439  1.00 10.00 ? 419 PRO A C    1  
ATOM 83    O O    . PRO A 1 10 ? 4.195   -5.948  11.000  1.00 10.00 ? 419 PRO A O    1  
ATOM 84    C CB   . PRO A 1 10 ? 5.749   -4.228  8.878   1.00 10.00 ? 419 PRO A CB   1  
ATOM 85    C CG   . PRO A 1 10 ? 6.946   -4.954  9.385   1.00 10.00 ? 419 PRO A CG   1  
ATOM 86    C CD   . PRO A 1 10 ? 7.291   -4.315  10.702  1.00 10.00 ? 419 PRO A CD   1  
ATOM 87    H HA   . PRO A 1 10 ? 4.493   -2.885  9.990   1.00 10.00 ? 419 PRO A HA   1  
ATOM 88    H HB2  . PRO A 1 10 ? 5.139   -4.860  8.249   1.00 10.00 ? 419 PRO A HB2  1  
ATOM 89    H HB3  . PRO A 1 10 ? 6.028   -3.335  8.339   1.00 10.00 ? 419 PRO A HB3  1  
ATOM 90    H HG2  . PRO A 1 10 ? 6.710   -5.999  9.525   1.00 10.00 ? 419 PRO A HG2  1  
ATOM 91    H HG3  . PRO A 1 10 ? 7.764   -4.844  8.689   1.00 10.00 ? 419 PRO A HG3  1  
ATOM 92    H HD2  . PRO A 1 10 ? 7.679   -5.053  11.389  1.00 10.00 ? 419 PRO A HD2  1  
ATOM 93    H HD3  . PRO A 1 10 ? 8.005   -3.518  10.559  1.00 10.00 ? 419 PRO A HD3  1  
ATOM 94    N N    . MET A 1 11 ? 2.660   -4.593  10.068  1.00 10.00 ? 420 MET A N    1  
ATOM 95    C CA   . MET A 1 11 ? 1.549   -5.504  10.302  1.00 10.00 ? 420 MET A CA   1  
ATOM 96    C C    . MET A 1 11 ? 0.686   -5.626  9.057   1.00 10.00 ? 420 MET A C    1  
ATOM 97    O O    . MET A 1 11 ? 0.873   -6.542  8.260   1.00 10.00 ? 420 MET A O    1  
ATOM 98    C CB   . MET A 1 11 ? 0.711   -5.014  11.486  1.00 10.00 ? 420 MET A CB   1  
ATOM 99    C CG   . MET A 1 11 ? 0.862   -5.868  12.735  1.00 10.00 ? 420 MET A CG   1  
ATOM 100   S SD   . MET A 1 11 ? 2.236   -5.339  13.776  1.00 10.00 ? 420 MET A SD   1  
ATOM 101   C CE   . MET A 1 11 ? 2.500   -6.810  14.762  1.00 10.00 ? 420 MET A CE   1  
ATOM 102   H H    . MET A 1 11 ? 2.484   -3.735  9.627   1.00 10.00 ? 420 MET A H    1  
ATOM 103   H HA   . MET A 1 11 ? 1.954   -6.481  10.532  1.00 10.00 ? 420 MET A HA   1  
ATOM 104   H HB2  . MET A 1 11 ? 1.010   -4.004  11.726  1.00 10.00 ? 420 MET A HB2  1  
ATOM 105   H HB3  . MET A 1 11 ? -0.330  -5.011  11.201  1.00 10.00 ? 420 MET A HB3  1  
ATOM 106   H HG2  . MET A 1 11 ? -0.050  -5.805  13.310  1.00 10.00 ? 420 MET A HG2  1  
ATOM 107   H HG3  . MET A 1 11 ? 1.028   -6.892  12.437  1.00 10.00 ? 420 MET A HG3  1  
ATOM 108   H HE1  . MET A 1 11 ? 3.551   -7.058  14.764  1.00 10.00 ? 420 MET A HE1  1  
ATOM 109   H HE2  . MET A 1 11 ? 1.937   -7.631  14.342  1.00 10.00 ? 420 MET A HE2  1  
ATOM 110   H HE3  . MET A 1 11 ? 2.171   -6.629  15.774  1.00 10.00 ? 420 MET A HE3  1  
ATOM 111   N N    . LYS A 1 12 ? -0.255  -4.698  8.890   1.00 10.00 ? 421 LYS A N    1  
ATOM 112   C CA   . LYS A 1 12 ? -1.140  -4.715  7.730   1.00 10.00 ? 421 LYS A CA   1  
ATOM 113   C C    . LYS A 1 12 ? -0.332  -4.903  6.460   1.00 10.00 ? 421 LYS A C    1  
ATOM 114   O O    . LYS A 1 12 ? 0.199   -3.948  5.894   1.00 10.00 ? 421 LYS A O    1  
ATOM 115   C CB   . LYS A 1 12 ? -1.965  -3.436  7.660   1.00 10.00 ? 421 LYS A CB   1  
ATOM 116   C CG   . LYS A 1 12 ? -2.712  -3.262  6.349   1.00 10.00 ? 421 LYS A CG   1  
ATOM 117   C CD   . LYS A 1 12 ? -4.130  -3.799  6.431   1.00 10.00 ? 421 LYS A CD   1  
ATOM 118   C CE   . LYS A 1 12 ? -4.938  -3.091  7.506   1.00 10.00 ? 421 LYS A CE   1  
ATOM 119   N NZ   . LYS A 1 12 ? -5.060  -3.913  8.742   1.00 10.00 ? 421 LYS A NZ   1  
ATOM 120   H H    . LYS A 1 12 ? -0.348  -3.988  9.556   1.00 10.00 ? 421 LYS A H    1  
ATOM 121   H HA   . LYS A 1 12 ? -1.808  -5.554  7.838   1.00 10.00 ? 421 LYS A HA   1  
ATOM 122   H HB2  . LYS A 1 12 ? -2.686  -3.451  8.462   1.00 10.00 ? 421 LYS A HB2  1  
ATOM 123   H HB3  . LYS A 1 12 ? -1.308  -2.592  7.793   1.00 10.00 ? 421 LYS A HB3  1  
ATOM 124   H HG2  . LYS A 1 12 ? -2.751  -2.213  6.111   1.00 10.00 ? 421 LYS A HG2  1  
ATOM 125   H HG3  . LYS A 1 12 ? -2.184  -3.794  5.568   1.00 10.00 ? 421 LYS A HG3  1  
ATOM 126   H HD2  . LYS A 1 12 ? -4.611  -3.651  5.477   1.00 10.00 ? 421 LYS A HD2  1  
ATOM 127   H HD3  . LYS A 1 12 ? -4.091  -4.855  6.656   1.00 10.00 ? 421 LYS A HD3  1  
ATOM 128   H HE2  . LYS A 1 12 ? -4.450  -2.159  7.752   1.00 10.00 ? 421 LYS A HE2  1  
ATOM 129   H HE3  . LYS A 1 12 ? -5.926  -2.887  7.121   1.00 10.00 ? 421 LYS A HE3  1  
ATOM 130   H HZ1  . LYS A 1 12 ? -5.967  -4.421  8.745   1.00 10.00 ? 421 LYS A HZ1  1  
ATOM 131   H HZ2  . LYS A 1 12 ? -5.015  -3.303  9.583   1.00 10.00 ? 421 LYS A HZ2  1  
ATOM 132   H HZ3  . LYS A 1 12 ? -4.286  -4.606  8.788   1.00 10.00 ? 421 LYS A HZ3  1  
ATOM 133   N N    . VAL A 1 13 ? -0.228  -6.152  6.043   1.00 10.00 ? 422 VAL A N    1  
ATOM 134   C CA   . VAL A 1 13 ? 0.535   -6.513  4.868   1.00 10.00 ? 422 VAL A CA   1  
ATOM 135   C C    . VAL A 1 13 ? 0.493   -8.021  4.678   1.00 10.00 ? 422 VAL A C    1  
ATOM 136   O O    . VAL A 1 13 ? 0.306   -8.527  3.572   1.00 10.00 ? 422 VAL A O    1  
ATOM 137   C CB   . VAL A 1 13 ? 1.987   -6.031  5.027   1.00 10.00 ? 422 VAL A CB   1  
ATOM 138   C CG1  . VAL A 1 13 ? 2.825   -7.025  5.823   1.00 10.00 ? 422 VAL A CG1  1  
ATOM 139   C CG2  . VAL A 1 13 ? 2.610   -5.745  3.672   1.00 10.00 ? 422 VAL A CG2  1  
ATOM 140   H H    . VAL A 1 13 ? -0.664  -6.857  6.557   1.00 10.00 ? 422 VAL A H    1  
ATOM 141   H HA   . VAL A 1 13 ? 0.094   -6.028  4.013   1.00 10.00 ? 422 VAL A HA   1  
ATOM 142   H HB   . VAL A 1 13 ? 1.954   -5.112  5.590   1.00 10.00 ? 422 VAL A HB   1  
ATOM 143   H HG11 . VAL A 1 13 ? 2.888   -7.958  5.284   1.00 10.00 ? 422 VAL A HG11 1  
ATOM 144   H HG12 . VAL A 1 13 ? 2.361   -7.196  6.785   1.00 10.00 ? 422 VAL A HG12 1  
ATOM 145   H HG13 . VAL A 1 13 ? 3.817   -6.624  5.969   1.00 10.00 ? 422 VAL A HG13 1  
ATOM 146   H HG21 . VAL A 1 13 ? 3.636   -5.444  3.806   1.00 10.00 ? 422 VAL A HG21 1  
ATOM 147   H HG22 . VAL A 1 13 ? 2.063   -4.952  3.184   1.00 10.00 ? 422 VAL A HG22 1  
ATOM 148   H HG23 . VAL A 1 13 ? 2.573   -6.636  3.063   1.00 10.00 ? 422 VAL A HG23 1  
ATOM 149   N N    . TYR A 1 14 ? 0.645   -8.723  5.793   1.00 10.00 ? 423 TYR A N    1  
ATOM 150   C CA   . TYR A 1 14 ? 0.604   -10.180 5.822   1.00 10.00 ? 423 TYR A CA   1  
ATOM 151   C C    . TYR A 1 14 ? -0.585  -10.712 5.019   1.00 10.00 ? 423 TYR A C    1  
ATOM 152   O O    . TYR A 1 14 ? -0.564  -11.851 4.552   1.00 10.00 ? 423 TYR A O    1  
ATOM 153   C CB   . TYR A 1 14 ? 0.532   -10.695 7.276   1.00 10.00 ? 423 TYR A CB   1  
ATOM 154   C CG   . TYR A 1 14 ? 0.012   -9.694  8.294   1.00 10.00 ? 423 TYR A CG   1  
ATOM 155   C CD1  . TYR A 1 14 ? -0.892  -8.701  7.942   1.00 10.00 ? 423 TYR A CD1  1  
ATOM 156   C CD2  . TYR A 1 14 ? 0.445   -9.738  9.613   1.00 10.00 ? 423 TYR A CD2  1  
ATOM 157   C CE1  . TYR A 1 14 ? -1.344  -7.787  8.858   1.00 10.00 ? 423 TYR A CE1  1  
ATOM 158   C CE2  . TYR A 1 14 ? -0.008  -8.824  10.544  1.00 10.00 ? 423 TYR A CE2  1  
ATOM 159   C CZ   . TYR A 1 14 ? -0.900  -7.847  10.161  1.00 10.00 ? 423 TYR A CZ   1  
ATOM 160   O OH   . TYR A 1 14 ? -1.357  -6.936  11.084  1.00 10.00 ? 423 TYR A OH   1  
ATOM 161   H H    . TYR A 1 14 ? 0.779   -8.238  6.630   1.00 10.00 ? 423 TYR A H    1  
ATOM 162   H HA   . TYR A 1 14 ? 1.514   -10.543 5.368   1.00 10.00 ? 423 TYR A HA   1  
ATOM 163   H HB2  . TYR A 1 14 ? -0.112  -11.557 7.311   1.00 10.00 ? 423 TYR A HB2  1  
ATOM 164   H HB3  . TYR A 1 14 ? 1.525   -10.984 7.589   1.00 10.00 ? 423 TYR A HB3  1  
ATOM 165   H HD1  . TYR A 1 14 ? -1.247  -8.647  6.927   1.00 10.00 ? 423 TYR A HD1  1  
ATOM 166   H HD2  . TYR A 1 14 ? 1.149   -10.502 9.909   1.00 10.00 ? 423 TYR A HD2  1  
ATOM 167   H HE1  . TYR A 1 14 ? -2.023  -7.016  8.543   1.00 10.00 ? 423 TYR A HE1  1  
ATOM 168   H HE2  . TYR A 1 14 ? 0.343   -8.873  11.562  1.00 10.00 ? 423 TYR A HE2  1  
ATOM 169   H HH   . TYR A 1 14 ? -2.304  -7.043  11.198  1.00 10.00 ? 423 TYR A HH   1  
ATOM 170   N N    . LYS A 1 15 ? -1.615  -9.882  4.850   1.00 10.00 ? 424 LYS A N    1  
ATOM 171   C CA   . LYS A 1 15 ? -2.793  -10.278 4.090   1.00 10.00 ? 424 LYS A CA   1  
ATOM 172   C C    . LYS A 1 15 ? -2.710  -9.744  2.664   1.00 10.00 ? 424 LYS A C    1  
ATOM 173   O O    . LYS A 1 15 ? -3.292  -10.312 1.740   1.00 10.00 ? 424 LYS A O    1  
ATOM 174   C CB   . LYS A 1 15 ? -4.064  -9.764  4.770   1.00 10.00 ? 424 LYS A CB   1  
ATOM 175   C CG   . LYS A 1 15 ? -4.362  -10.443 6.096   1.00 10.00 ? 424 LYS A CG   1  
ATOM 176   C CD   . LYS A 1 15 ? -5.848  -10.417 6.414   1.00 10.00 ? 424 LYS A CD   1  
ATOM 177   C CE   . LYS A 1 15 ? -6.280  -11.668 7.161   1.00 10.00 ? 424 LYS A CE   1  
ATOM 178   N NZ   . LYS A 1 15 ? -6.840  -12.698 6.243   1.00 10.00 ? 424 LYS A NZ   1  
ATOM 179   H H    . LYS A 1 15 ? -1.579  -8.978  5.234   1.00 10.00 ? 424 LYS A H    1  
ATOM 180   H HA   . LYS A 1 15 ? -2.821  -11.357 4.058   1.00 10.00 ? 424 LYS A HA   1  
ATOM 181   H HB2  . LYS A 1 15 ? -3.959  -8.704  4.948   1.00 10.00 ? 424 LYS A HB2  1  
ATOM 182   H HB3  . LYS A 1 15 ? -4.903  -9.928  4.110   1.00 10.00 ? 424 LYS A HB3  1  
ATOM 183   H HG2  . LYS A 1 15 ? -4.033  -11.471 6.046   1.00 10.00 ? 424 LYS A HG2  1  
ATOM 184   H HG3  . LYS A 1 15 ? -3.825  -9.930  6.881   1.00 10.00 ? 424 LYS A HG3  1  
ATOM 185   H HD2  . LYS A 1 15 ? -6.060  -9.553  7.027   1.00 10.00 ? 424 LYS A HD2  1  
ATOM 186   H HD3  . LYS A 1 15 ? -6.403  -10.350 5.490   1.00 10.00 ? 424 LYS A HD3  1  
ATOM 187   H HE2  . LYS A 1 15 ? -5.423  -12.082 7.670   1.00 10.00 ? 424 LYS A HE2  1  
ATOM 188   H HE3  . LYS A 1 15 ? -7.033  -11.397 7.887   1.00 10.00 ? 424 LYS A HE3  1  
ATOM 189   H HZ1  . LYS A 1 15 ? -6.071  -13.247 5.809   1.00 10.00 ? 424 LYS A HZ1  1  
ATOM 190   H HZ2  . LYS A 1 15 ? -7.393  -12.242 5.489   1.00 10.00 ? 424 LYS A HZ2  1  
ATOM 191   H HZ3  . LYS A 1 15 ? -7.462  -13.345 6.768   1.00 10.00 ? 424 LYS A HZ3  1  
ATOM 192   N N    . ASP A 1 16 ? -1.981  -8.645  2.497   1.00 10.00 ? 425 ASP A N    1  
ATOM 193   C CA   . ASP A 1 16 ? -1.812  -8.023  1.189   1.00 10.00 ? 425 ASP A CA   1  
ATOM 194   C C    . ASP A 1 16 ? -0.433  -8.322  0.606   1.00 10.00 ? 425 ASP A C    1  
ATOM 195   O O    . ASP A 1 16 ? 0.075   -7.567  -0.222  1.00 10.00 ? 425 ASP A O    1  
ATOM 196   C CB   . ASP A 1 16 ? -2.016  -6.511  1.297   1.00 10.00 ? 425 ASP A CB   1  
ATOM 197   C CG   . ASP A 1 16 ? -3.483  -6.126  1.295   1.00 10.00 ? 425 ASP A CG   1  
ATOM 198   O OD1  . ASP A 1 16 ? -4.276  -6.811  0.616   1.00 10.00 ? 425 ASP A OD1  1  
ATOM 199   O OD2  . ASP A 1 16 ? -3.838  -5.139  1.973   1.00 10.00 ? 425 ASP A OD2  1  
ATOM 200   H H    . ASP A 1 16 ? -1.544  -8.240  3.277   1.00 10.00 ? 425 ASP A H    1  
ATOM 201   H HA   . ASP A 1 16 ? -2.562  -8.431  0.528   1.00 10.00 ? 425 ASP A HA   1  
ATOM 202   H HB2  . ASP A 1 16 ? -1.573  -6.160  2.217   1.00 10.00 ? 425 ASP A HB2  1  
ATOM 203   H HB3  . ASP A 1 16 ? -1.533  -6.028  0.462   1.00 10.00 ? 425 ASP A HB3  1  
ATOM 204   N N    . ARG A 1 17 ? 0.166   -9.431  1.032   1.00 10.00 ? 426 ARG A N    1  
ATOM 205   C CA   . ARG A 1 17 ? 1.482   -9.823  0.535   1.00 10.00 ? 426 ARG A CA   1  
ATOM 206   C C    . ARG A 1 17 ? 1.413   -10.178 -0.945  1.00 10.00 ? 426 ARG A C    1  
ATOM 207   O O    . ARG A 1 17 ? 2.422   -10.141 -1.649  1.00 10.00 ? 426 ARG A O    1  
ATOM 208   C CB   . ARG A 1 17 ? 2.029   -11.005 1.337   1.00 10.00 ? 426 ARG A CB   1  
ATOM 209   C CG   . ARG A 1 17 ? 3.484   -11.324 1.036   1.00 10.00 ? 426 ARG A CG   1  
ATOM 210   C CD   . ARG A 1 17 ? 3.872   -12.699 1.555   1.00 10.00 ? 426 ARG A CD   1  
ATOM 211   N NE   . ARG A 1 17 ? 4.849   -13.355 0.690   1.00 10.00 ? 426 ARG A NE   1  
ATOM 212   C CZ   . ARG A 1 17 ? 6.128   -12.996 0.610   1.00 10.00 ? 426 ARG A CZ   1  
ATOM 213   N NH1  . ARG A 1 17 ? 6.589   -11.988 1.340   1.00 10.00 ? 426 ARG A NH1  1  
ATOM 214   N NH2  . ARG A 1 17 ? 6.950   -13.647 -0.202  1.00 10.00 ? 426 ARG A NH2  1  
ATOM 215   H H    . ARG A 1 17 ? -0.288  -10.001 1.688   1.00 10.00 ? 426 ARG A H    1  
ATOM 216   H HA   . ARG A 1 17 ? 2.144   -8.977  0.652   1.00 10.00 ? 426 ARG A HA   1  
ATOM 217   H HB2  . ARG A 1 17 ? 1.943   -10.781 2.391   1.00 10.00 ? 426 ARG A HB2  1  
ATOM 218   H HB3  . ARG A 1 17 ? 1.437   -11.881 1.115   1.00 10.00 ? 426 ARG A HB3  1  
ATOM 219   H HG2  . ARG A 1 17 ? 3.634   -11.299 -0.033  1.00 10.00 ? 426 ARG A HG2  1  
ATOM 220   H HG3  . ARG A 1 17 ? 4.110   -10.580 1.506   1.00 10.00 ? 426 ARG A HG3  1  
ATOM 221   H HD2  . ARG A 1 17 ? 4.296   -12.590 2.542   1.00 10.00 ? 426 ARG A HD2  1  
ATOM 222   H HD3  . ARG A 1 17 ? 2.985   -13.312 1.611   1.00 10.00 ? 426 ARG A HD3  1  
ATOM 223   H HE   . ARG A 1 17 ? 4.535   -14.103 0.139   1.00 10.00 ? 426 ARG A HE   1  
ATOM 224   H HH11 . ARG A 1 17 ? 5.975   -11.493 1.955   1.00 10.00 ? 426 ARG A HH11 1  
ATOM 225   H HH12 . ARG A 1 17 ? 7.551   -11.723 1.275   1.00 10.00 ? 426 ARG A HH12 1  
ATOM 226   H HH21 . ARG A 1 17 ? 6.608   -14.408 -0.755  1.00 10.00 ? 426 ARG A HH21 1  
ATOM 227   H HH22 . ARG A 1 17 ? 7.911   -13.377 -0.263  1.00 10.00 ? 426 ARG A HH22 1  
ATOM 228   N N    . GLN A 1 18 ? 0.212   -10.496 -1.417  1.00 10.00 ? 427 GLN A N    1  
ATOM 229   C CA   . GLN A 1 18 ? 0.009   -10.827 -2.822  1.00 10.00 ? 427 GLN A CA   1  
ATOM 230   C C    . GLN A 1 18 ? -0.545  -9.616  -3.557  1.00 10.00 ? 427 GLN A C    1  
ATOM 231   O O    . GLN A 1 18 ? -1.247  -9.739  -4.560  1.00 10.00 ? 427 GLN A O    1  
ATOM 232   C CB   . GLN A 1 18 ? -0.928  -12.034 -2.983  1.00 10.00 ? 427 GLN A CB   1  
ATOM 233   C CG   . GLN A 1 18 ? -1.791  -12.325 -1.761  1.00 10.00 ? 427 GLN A CG   1  
ATOM 234   C CD   . GLN A 1 18 ? -0.997  -12.925 -0.614  1.00 10.00 ? 427 GLN A CD   1  
ATOM 235   O OE1  . GLN A 1 18 ? -0.333  -13.949 -0.773  1.00 10.00 ? 427 GLN A OE1  1  
ATOM 236   N NE2  . GLN A 1 18 ? -1.064  -12.287 0.551   1.00 10.00 ? 427 GLN A NE2  1  
ATOM 237   H H    . GLN A 1 18 ? -0.557  -10.487 -0.812  1.00 10.00 ? 427 GLN A H    1  
ATOM 238   H HA   . GLN A 1 18 ? 0.973   -11.064 -3.245  1.00 10.00 ? 427 GLN A HA   1  
ATOM 239   H HB2  . GLN A 1 18 ? -1.585  -11.854 -3.821  1.00 10.00 ? 427 GLN A HB2  1  
ATOM 240   H HB3  . GLN A 1 18 ? -0.331  -12.910 -3.190  1.00 10.00 ? 427 GLN A HB3  1  
ATOM 241   H HG2  . GLN A 1 18 ? -2.238  -11.402 -1.424  1.00 10.00 ? 427 GLN A HG2  1  
ATOM 242   H HG3  . GLN A 1 18 ? -2.569  -13.019 -2.043  1.00 10.00 ? 427 GLN A HG3  1  
ATOM 243   H HE21 . GLN A 1 18 ? -1.615  -11.478 0.604   1.00 10.00 ? 427 GLN A HE21 1  
ATOM 244   H HE22 . GLN A 1 18 ? -0.559  -12.651 1.309   1.00 10.00 ? 427 GLN A HE22 1  
ATOM 245   N N    . VAL A 1 19 ? -0.203  -8.445  -3.038  1.00 10.00 ? 428 VAL A N    1  
ATOM 246   C CA   . VAL A 1 19 ? -0.629  -7.181  -3.611  1.00 10.00 ? 428 VAL A CA   1  
ATOM 247   C C    . VAL A 1 19 ? 0.529   -6.521  -4.340  1.00 10.00 ? 428 VAL A C    1  
ATOM 248   O O    . VAL A 1 19 ? 0.332   -5.828  -5.338  1.00 10.00 ? 428 VAL A O    1  
ATOM 249   C CB   . VAL A 1 19 ? -1.159  -6.232  -2.525  1.00 10.00 ? 428 VAL A CB   1  
ATOM 250   C CG1  . VAL A 1 19 ? -1.553  -4.887  -3.117  1.00 10.00 ? 428 VAL A CG1  1  
ATOM 251   C CG2  . VAL A 1 19 ? -2.332  -6.867  -1.795  1.00 10.00 ? 428 VAL A CG2  1  
ATOM 252   H H    . VAL A 1 19 ? 0.366   -8.433  -2.243  1.00 10.00 ? 428 VAL A H    1  
ATOM 253   H HA   . VAL A 1 19 ? -1.423  -7.377  -4.315  1.00 10.00 ? 428 VAL A HA   1  
ATOM 254   H HB   . VAL A 1 19 ? -0.367  -6.065  -1.810  1.00 10.00 ? 428 VAL A HB   1  
ATOM 255   H HG11 . VAL A 1 19 ? -1.152  -4.099  -2.501  1.00 10.00 ? 428 VAL A HG11 1  
ATOM 256   H HG12 . VAL A 1 19 ? -2.628  -4.807  -3.147  1.00 10.00 ? 428 VAL A HG12 1  
ATOM 257   H HG13 . VAL A 1 19 ? -1.156  -4.798  -4.120  1.00 10.00 ? 428 VAL A HG13 1  
ATOM 258   H HG21 . VAL A 1 19 ? -2.000  -7.762  -1.290  1.00 10.00 ? 428 VAL A HG21 1  
ATOM 259   H HG22 . VAL A 1 19 ? -3.104  -7.121  -2.506  1.00 10.00 ? 428 VAL A HG22 1  
ATOM 260   H HG23 . VAL A 1 19 ? -2.725  -6.170  -1.071  1.00 10.00 ? 428 VAL A HG23 1  
ATOM 261   N N    . MET A 1 20 ? 1.742   -6.752  -3.844  1.00 10.00 ? 429 MET A N    1  
ATOM 262   C CA   . MET A 1 20 ? 2.938   -6.188  -4.465  1.00 10.00 ? 429 MET A CA   1  
ATOM 263   C C    . MET A 1 20 ? 2.895   -6.373  -5.982  1.00 10.00 ? 429 MET A C    1  
ATOM 264   O O    . MET A 1 20 ? 3.488   -5.598  -6.731  1.00 10.00 ? 429 MET A O    1  
ATOM 265   C CB   . MET A 1 20 ? 4.197   -6.847  -3.897  1.00 10.00 ? 429 MET A CB   1  
ATOM 266   C CG   . MET A 1 20 ? 4.131   -8.365  -3.869  1.00 10.00 ? 429 MET A CG   1  
ATOM 267   S SD   . MET A 1 20 ? 5.021   -9.074  -2.470  1.00 10.00 ? 429 MET A SD   1  
ATOM 268   C CE   . MET A 1 20 ? 5.789   -10.496 -3.243  1.00 10.00 ? 429 MET A CE   1  
ATOM 269   H H    . MET A 1 20 ? 1.836   -7.323  -3.047  1.00 10.00 ? 429 MET A H    1  
ATOM 270   H HA   . MET A 1 20 ? 2.961   -5.132  -4.243  1.00 10.00 ? 429 MET A HA   1  
ATOM 271   H HB2  . MET A 1 20 ? 5.044   -6.557  -4.500  1.00 10.00 ? 429 MET A HB2  1  
ATOM 272   H HB3  . MET A 1 20 ? 4.349   -6.496  -2.887  1.00 10.00 ? 429 MET A HB3  1  
ATOM 273   H HG2  . MET A 1 20 ? 3.095   -8.666  -3.807  1.00 10.00 ? 429 MET A HG2  1  
ATOM 274   H HG3  . MET A 1 20 ? 4.561   -8.748  -4.783  1.00 10.00 ? 429 MET A HG3  1  
ATOM 275   H HE1  . MET A 1 20 ? 5.826   -10.348 -4.312  1.00 10.00 ? 429 MET A HE1  1  
ATOM 276   H HE2  . MET A 1 20 ? 5.212   -11.381 -3.021  1.00 10.00 ? 429 MET A HE2  1  
ATOM 277   H HE3  . MET A 1 20 ? 6.792   -10.615 -2.861  1.00 10.00 ? 429 MET A HE3  1  
ATOM 278   N N    . ASN A 1 21 ? 2.181   -7.408  -6.424  1.00 10.00 ? 430 ASN A N    1  
ATOM 279   C CA   . ASN A 1 21 ? 2.050   -7.701  -7.845  1.00 10.00 ? 430 ASN A CA   1  
ATOM 280   C C    . ASN A 1 21 ? 0.583   -7.850  -8.244  1.00 10.00 ? 430 ASN A C    1  
ATOM 281   O O    . ASN A 1 21 ? 0.266   -8.511  -9.232  1.00 10.00 ? 430 ASN A O    1  
ATOM 282   C CB   . ASN A 1 21 ? 2.813   -8.982  -8.183  1.00 10.00 ? 430 ASN A CB   1  
ATOM 283   C CG   . ASN A 1 21 ? 4.269   -8.720  -8.513  1.00 10.00 ? 430 ASN A CG   1  
ATOM 284   O OD1  . ASN A 1 21 ? 4.583   -7.945  -9.417  1.00 10.00 ? 430 ASN A OD1  1  
ATOM 285   N ND2  . ASN A 1 21 ? 5.168   -9.367  -7.780  1.00 10.00 ? 430 ASN A ND2  1  
ATOM 286   H H    . ASN A 1 21 ? 1.732   -7.990  -5.778  1.00 10.00 ? 430 ASN A H    1  
ATOM 287   H HA   . ASN A 1 21 ? 2.478   -6.877  -8.395  1.00 10.00 ? 430 ASN A HA   1  
ATOM 288   H HB2  . ASN A 1 21 ? 2.769   -9.653  -7.335  1.00 10.00 ? 430 ASN A HB2  1  
ATOM 289   H HB3  . ASN A 1 21 ? 2.347   -9.456  -9.035  1.00 10.00 ? 430 ASN A HB3  1  
ATOM 290   H HD21 . ASN A 1 21 ? 4.845   -9.969  -7.077  1.00 10.00 ? 430 ASN A HD21 1  
ATOM 291   H HD22 . ASN A 1 21 ? 6.117   -9.216  -7.972  1.00 10.00 ? 430 ASN A HD22 1  
ATOM 292   N N    . MET A 1 22 ? -0.308  -7.228  -7.474  1.00 10.00 ? 431 MET A N    1  
ATOM 293   C CA   . MET A 1 22 ? -1.742  -7.289  -7.751  1.00 10.00 ? 431 MET A CA   1  
ATOM 294   C C    . MET A 1 22 ? -2.549  -6.685  -6.610  1.00 10.00 ? 431 MET A C    1  
ATOM 295   O O    . MET A 1 22 ? -2.990  -7.396  -5.708  1.00 10.00 ? 431 MET A O    1  
ATOM 296   C CB   . MET A 1 22 ? -2.195  -8.733  -7.971  1.00 10.00 ? 431 MET A CB   1  
ATOM 297   C CG   . MET A 1 22 ? -2.398  -9.094  -9.434  1.00 10.00 ? 431 MET A CG   1  
ATOM 298   S SD   . MET A 1 22 ? -3.918  -10.022 -9.719  1.00 10.00 ? 431 MET A SD   1  
ATOM 299   C CE   . MET A 1 22 ? -3.516  -10.871 -11.244 1.00 10.00 ? 431 MET A CE   1  
ATOM 300   H H    . MET A 1 22 ? 0.005   -6.714  -6.704  1.00 10.00 ? 431 MET A H    1  
ATOM 301   H HA   . MET A 1 22 ? -1.930  -6.722  -8.650  1.00 10.00 ? 431 MET A HA   1  
ATOM 302   H HB2  . MET A 1 22 ? -1.453  -9.398  -7.556  1.00 10.00 ? 431 MET A HB2  1  
ATOM 303   H HB3  . MET A 1 22 ? -3.133  -8.883  -7.450  1.00 10.00 ? 431 MET A HB3  1  
ATOM 304   H HG2  . MET A 1 22 ? -2.436  -8.184  -10.013 1.00 10.00 ? 431 MET A HG2  1  
ATOM 305   H HG3  . MET A 1 22 ? -1.561  -9.692  -9.762  1.00 10.00 ? 431 MET A HG3  1  
ATOM 306   H HE1  . MET A 1 22 ? -3.131  -10.160 -11.960 1.00 10.00 ? 431 MET A HE1  1  
ATOM 307   H HE2  . MET A 1 22 ? -4.405  -11.337 -11.642 1.00 10.00 ? 431 MET A HE2  1  
ATOM 308   H HE3  . MET A 1 22 ? -2.769  -11.626 -11.049 1.00 10.00 ? 431 MET A HE3  1  
ATOM 309   N N    . TRP A 1 23 ? -2.769  -5.380  -6.667  1.00 10.00 ? 432 TRP A N    1  
ATOM 310   C CA   . TRP A 1 23 ? -3.553  -4.707  -5.644  1.00 10.00 ? 432 TRP A CA   1  
ATOM 311   C C    . TRP A 1 23 ? -5.021  -4.709  -6.051  1.00 10.00 ? 432 TRP A C    1  
ATOM 312   O O    . TRP A 1 23 ? -5.454  -3.888  -6.860  1.00 10.00 ? 432 TRP A O    1  
ATOM 313   C CB   . TRP A 1 23 ? -3.080  -3.264  -5.411  1.00 10.00 ? 432 TRP A CB   1  
ATOM 314   C CG   . TRP A 1 23 ? -1.616  -3.005  -5.653  1.00 10.00 ? 432 TRP A CG   1  
ATOM 315   C CD1  . TRP A 1 23 ? -0.919  -3.223  -6.801  1.00 10.00 ? 432 TRP A CD1  1  
ATOM 316   C CD2  . TRP A 1 23 ? -0.672  -2.447  -4.722  1.00 10.00 ? 432 TRP A CD2  1  
ATOM 317   N NE1  . TRP A 1 23 ? 0.377   -2.809  -6.652  1.00 10.00 ? 432 TRP A NE1  1  
ATOM 318   C CE2  . TRP A 1 23 ? 0.558   -2.338  -5.390  1.00 10.00 ? 432 TRP A CE2  1  
ATOM 319   C CE3  . TRP A 1 23 ? -0.746  -2.021  -3.397  1.00 10.00 ? 432 TRP A CE3  1  
ATOM 320   C CZ2  . TRP A 1 23 ? 1.699   -1.818  -4.782  1.00 10.00 ? 432 TRP A CZ2  1  
ATOM 321   C CZ3  . TRP A 1 23 ? 0.385   -1.510  -2.790  1.00 10.00 ? 432 TRP A CZ3  1  
ATOM 322   C CH2  . TRP A 1 23 ? 1.593   -1.409  -3.484  1.00 10.00 ? 432 TRP A CH2  1  
ATOM 323   H H    . TRP A 1 23 ? -2.422  -4.870  -7.423  1.00 10.00 ? 432 TRP A H    1  
ATOM 324   H HA   . TRP A 1 23 ? -3.451  -5.267  -4.727  1.00 10.00 ? 432 TRP A HA   1  
ATOM 325   H HB2  . TRP A 1 23 ? -3.634  -2.610  -6.066  1.00 10.00 ? 432 TRP A HB2  1  
ATOM 326   H HB3  . TRP A 1 23 ? -3.295  -2.994  -4.393  1.00 10.00 ? 432 TRP A HB3  1  
ATOM 327   H HD1  . TRP A 1 23 ? -1.338  -3.649  -7.696  1.00 10.00 ? 432 TRP A HD1  1  
ATOM 328   H HE1  . TRP A 1 23 ? 1.057   -2.847  -7.334  1.00 10.00 ? 432 TRP A HE1  1  
ATOM 329   H HE3  . TRP A 1 23 ? -1.657  -2.094  -2.847  1.00 10.00 ? 432 TRP A HE3  1  
ATOM 330   H HZ2  . TRP A 1 23 ? 2.637   -1.726  -5.308  1.00 10.00 ? 432 TRP A HZ2  1  
ATOM 331   H HZ3  . TRP A 1 23 ? 0.341   -1.176  -1.763  1.00 10.00 ? 432 TRP A HZ3  1  
ATOM 332   H HH2  . TRP A 1 23 ? 2.452   -1.003  -2.973  1.00 10.00 ? 432 TRP A HH2  1  
ATOM 333   N N    . SER A 1 24 ? -5.777  -5.651  -5.501  1.00 10.00 ? 433 SER A N    1  
ATOM 334   C CA   . SER A 1 24 ? -7.196  -5.778  -5.824  1.00 10.00 ? 433 SER A CA   1  
ATOM 335   C C    . SER A 1 24 ? -8.009  -4.637  -5.222  1.00 10.00 ? 433 SER A C    1  
ATOM 336   O O    . SER A 1 24 ? -7.507  -3.863  -4.408  1.00 10.00 ? 433 SER A O    1  
ATOM 337   C CB   . SER A 1 24 ? -7.738  -7.122  -5.335  1.00 10.00 ? 433 SER A CB   1  
ATOM 338   O OG   . SER A 1 24 ? -8.592  -7.711  -6.301  1.00 10.00 ? 433 SER A OG   1  
ATOM 339   H H    . SER A 1 24 ? -5.367  -6.283  -4.872  1.00 10.00 ? 433 SER A H    1  
ATOM 340   H HA   . SER A 1 24 ? -7.291  -5.736  -6.898  1.00 10.00 ? 433 SER A HA   1  
ATOM 341   H HB2  . SER A 1 24 ? -6.913  -7.793  -5.147  1.00 10.00 ? 433 SER A HB2  1  
ATOM 342   H HB3  . SER A 1 24 ? -8.296  -6.974  -4.422  1.00 10.00 ? 433 SER A HB3  1  
ATOM 343   H HG   . SER A 1 24 ? -8.401  -8.649  -6.368  1.00 10.00 ? 433 SER A HG   1  
ATOM 344   N N    . GLU A 1 25 ? -9.271  -4.540  -5.634  1.00 10.00 ? 434 GLU A N    1  
ATOM 345   C CA   . GLU A 1 25 ? -10.163 -3.495  -5.144  1.00 10.00 ? 434 GLU A CA   1  
ATOM 346   C C    . GLU A 1 25 ? -10.231 -3.499  -3.620  1.00 10.00 ? 434 GLU A C    1  
ATOM 347   O O    . GLU A 1 25 ? -10.306 -2.444  -2.991  1.00 10.00 ? 434 GLU A O    1  
ATOM 348   C CB   . GLU A 1 25 ? -11.565 -3.680  -5.727  1.00 10.00 ? 434 GLU A CB   1  
ATOM 349   C CG   . GLU A 1 25 ? -12.283 -2.371  -6.012  1.00 10.00 ? 434 GLU A CG   1  
ATOM 350   C CD   . GLU A 1 25 ? -13.450 -2.542  -6.965  1.00 10.00 ? 434 GLU A CD   1  
ATOM 351   O OE1  . GLU A 1 25 ? -14.089 -3.614  -6.935  1.00 10.00 ? 434 GLU A OE1  1  
ATOM 352   O OE2  . GLU A 1 25 ? -13.725 -1.602  -7.741  1.00 10.00 ? 434 GLU A OE2  1  
ATOM 353   H H    . GLU A 1 25 ? -9.609  -5.188  -6.286  1.00 10.00 ? 434 GLU A H    1  
ATOM 354   H HA   . GLU A 1 25 ? -9.771  -2.544  -5.471  1.00 10.00 ? 434 GLU A HA   1  
ATOM 355   H HB2  . GLU A 1 25 ? -11.488 -4.232  -6.652  1.00 10.00 ? 434 GLU A HB2  1  
ATOM 356   H HB3  . GLU A 1 25 ? -12.162 -4.248  -5.029  1.00 10.00 ? 434 GLU A HB3  1  
ATOM 357   H HG2  . GLU A 1 25 ? -12.655 -1.969  -5.082  1.00 10.00 ? 434 GLU A HG2  1  
ATOM 358   H HG3  . GLU A 1 25 ? -11.580 -1.677  -6.448  1.00 10.00 ? 434 GLU A HG3  1  
ATOM 359   N N    . GLN A 1 26 ? -10.204 -4.690  -3.033  1.00 10.00 ? 435 GLN A N    1  
ATOM 360   C CA   . GLN A 1 26 ? -10.261 -4.823  -1.582  1.00 10.00 ? 435 GLN A CA   1  
ATOM 361   C C    . GLN A 1 26 ? -8.905  -4.529  -0.962  1.00 10.00 ? 435 GLN A C    1  
ATOM 362   O O    . GLN A 1 26 ? -8.820  -3.936  0.114   1.00 10.00 ? 435 GLN A O    1  
ATOM 363   C CB   . GLN A 1 26 ? -10.733 -6.225  -1.189  1.00 10.00 ? 435 GLN A CB   1  
ATOM 364   C CG   . GLN A 1 26 ? -11.786 -6.227  -0.093  1.00 10.00 ? 435 GLN A CG   1  
ATOM 365   C CD   . GLN A 1 26 ? -13.185 -6.000  -0.630  1.00 10.00 ? 435 GLN A CD   1  
ATOM 366   O OE1  . GLN A 1 26 ? -13.942 -6.947  -0.844  1.00 10.00 ? 435 GLN A OE1  1  
ATOM 367   N NE2  . GLN A 1 26 ? -13.537 -4.738  -0.851  1.00 10.00 ? 435 GLN A NE2  1  
ATOM 368   H H    . GLN A 1 26 ? -10.142 -5.497  -3.586  1.00 10.00 ? 435 GLN A H    1  
ATOM 369   H HA   . GLN A 1 26 ? -10.968 -4.095  -1.214  1.00 10.00 ? 435 GLN A HA   1  
ATOM 370   H HB2  . GLN A 1 26 ? -11.150 -6.708  -2.060  1.00 10.00 ? 435 GLN A HB2  1  
ATOM 371   H HB3  . GLN A 1 26 ? -9.883  -6.795  -0.844  1.00 10.00 ? 435 GLN A HB3  1  
ATOM 372   H HG2  . GLN A 1 26 ? -11.761 -7.182  0.410   1.00 10.00 ? 435 GLN A HG2  1  
ATOM 373   H HG3  . GLN A 1 26 ? -11.555 -5.442  0.612   1.00 10.00 ? 435 GLN A HG3  1  
ATOM 374   H HE21 . GLN A 1 26 ? -12.883 -4.035  -0.658  1.00 10.00 ? 435 GLN A HE21 1  
ATOM 375   H HE22 . GLN A 1 26 ? -14.436 -4.562  -1.198  1.00 10.00 ? 435 GLN A HE22 1  
ATOM 376   N N    . GLU A 1 27 ? -7.843  -4.928  -1.651  1.00 10.00 ? 436 GLU A N    1  
ATOM 377   C CA   . GLU A 1 27 ? -6.500  -4.681  -1.166  1.00 10.00 ? 436 GLU A CA   1  
ATOM 378   C C    . GLU A 1 27 ? -6.215  -3.191  -1.237  1.00 10.00 ? 436 GLU A C    1  
ATOM 379   O O    . GLU A 1 27 ? -5.848  -2.571  -0.239  1.00 10.00 ? 436 GLU A O    1  
ATOM 380   C CB   . GLU A 1 27 ? -5.480  -5.490  -1.974  1.00 10.00 ? 436 GLU A CB   1  
ATOM 381   C CG   . GLU A 1 27 ? -5.993  -6.845  -2.439  1.00 10.00 ? 436 GLU A CG   1  
ATOM 382   C CD   . GLU A 1 27 ? -6.570  -7.671  -1.306  1.00 10.00 ? 436 GLU A CD   1  
ATOM 383   O OE1  . GLU A 1 27 ? -7.728  -7.414  -0.914  1.00 10.00 ? 436 GLU A OE1  1  
ATOM 384   O OE2  . GLU A 1 27 ? -5.865  -8.575  -0.812  1.00 10.00 ? 436 GLU A OE2  1  
ATOM 385   H H    . GLU A 1 27 ? -7.965  -5.379  -2.509  1.00 10.00 ? 436 GLU A H    1  
ATOM 386   H HA   . GLU A 1 27 ? -6.458  -4.980  -0.134  1.00 10.00 ? 436 GLU A HA   1  
ATOM 387   H HB2  . GLU A 1 27 ? -5.189  -4.921  -2.843  1.00 10.00 ? 436 GLU A HB2  1  
ATOM 388   H HB3  . GLU A 1 27 ? -4.611  -5.660  -1.358  1.00 10.00 ? 436 GLU A HB3  1  
ATOM 389   H HG2  . GLU A 1 27 ? -6.762  -6.689  -3.178  1.00 10.00 ? 436 GLU A HG2  1  
ATOM 390   H HG3  . GLU A 1 27 ? -5.174  -7.392  -2.883  1.00 10.00 ? 436 GLU A HG3  1  
ATOM 391   N N    . LYS A 1 28 ? -6.429  -2.608  -2.415  1.00 10.00 ? 437 LYS A N    1  
ATOM 392   C CA   . LYS A 1 28 ? -6.241  -1.173  -2.610  1.00 10.00 ? 437 LYS A CA   1  
ATOM 393   C C    . LYS A 1 28 ? -6.938  -0.394  -1.503  1.00 10.00 ? 437 LYS A C    1  
ATOM 394   O O    . LYS A 1 28 ? -6.610  0.757   -1.240  1.00 10.00 ? 437 LYS A O    1  
ATOM 395   C CB   . LYS A 1 28 ? -6.792  -0.750  -3.973  1.00 10.00 ? 437 LYS A CB   1  
ATOM 396   C CG   . LYS A 1 28 ? -5.984  -1.283  -5.145  1.00 10.00 ? 437 LYS A CG   1  
ATOM 397   C CD   . LYS A 1 28 ? -6.538  -0.795  -6.473  1.00 10.00 ? 437 LYS A CD   1  
ATOM 398   C CE   . LYS A 1 28 ? -7.574  -1.757  -7.032  1.00 10.00 ? 437 LYS A CE   1  
ATOM 399   N NZ   . LYS A 1 28 ? -8.710  -1.039  -7.674  1.00 10.00 ? 437 LYS A NZ   1  
ATOM 400   H H    . LYS A 1 28 ? -6.745  -3.150  -3.162  1.00 10.00 ? 437 LYS A H    1  
ATOM 401   H HA   . LYS A 1 28 ? -5.191  -0.954  -2.575  1.00 10.00 ? 437 LYS A HA   1  
ATOM 402   H HB2  . LYS A 1 28 ? -7.805  -1.112  -4.067  1.00 10.00 ? 437 LYS A HB2  1  
ATOM 403   H HB3  . LYS A 1 28 ? -6.797  0.328   -4.027  1.00 10.00 ? 437 LYS A HB3  1  
ATOM 404   H HG2  . LYS A 1 28 ? -4.962  -0.946  -5.048  1.00 10.00 ? 437 LYS A HG2  1  
ATOM 405   H HG3  . LYS A 1 28 ? -6.011  -2.362  -5.128  1.00 10.00 ? 437 LYS A HG3  1  
ATOM 406   H HD2  . LYS A 1 28 ? -7.000  0.170   -6.327  1.00 10.00 ? 437 LYS A HD2  1  
ATOM 407   H HD3  . LYS A 1 28 ? -5.726  -0.705  -7.179  1.00 10.00 ? 437 LYS A HD3  1  
ATOM 408   H HE2  . LYS A 1 28 ? -7.100  -2.390  -7.766  1.00 10.00 ? 437 LYS A HE2  1  
ATOM 409   H HE3  . LYS A 1 28 ? -7.954  -2.365  -6.225  1.00 10.00 ? 437 LYS A HE3  1  
ATOM 410   H HZ1  . LYS A 1 28 ? -9.283  -0.557  -6.952  1.00 10.00 ? 437 LYS A HZ1  1  
ATOM 411   H HZ2  . LYS A 1 28 ? -9.314  -1.711  -8.188  1.00 10.00 ? 437 LYS A HZ2  1  
ATOM 412   H HZ3  . LYS A 1 28 ? -8.351  -0.330  -8.346  1.00 10.00 ? 437 LYS A HZ3  1  
ATOM 413   N N    . GLU A 1 29 ? -7.900  -1.036  -0.852  1.00 10.00 ? 438 GLU A N    1  
ATOM 414   C CA   . GLU A 1 29 ? -8.641  -0.400  0.226   1.00 10.00 ? 438 GLU A CA   1  
ATOM 415   C C    . GLU A 1 29 ? -7.730  -0.027  1.389   1.00 10.00 ? 438 GLU A C    1  
ATOM 416   O O    . GLU A 1 29 ? -7.987  0.945   2.098   1.00 10.00 ? 438 GLU A O    1  
ATOM 417   C CB   . GLU A 1 29 ? -9.747  -1.330  0.720   1.00 10.00 ? 438 GLU A CB   1  
ATOM 418   C CG   . GLU A 1 29 ? -11.006 -0.601  1.160   1.00 10.00 ? 438 GLU A CG   1  
ATOM 419   C CD   . GLU A 1 29 ? -12.093 -1.547  1.630   1.00 10.00 ? 438 GLU A CD   1  
ATOM 420   O OE1  . GLU A 1 29 ? -12.287 -2.597  0.982   1.00 10.00 ? 438 GLU A OE1  1  
ATOM 421   O OE2  . GLU A 1 29 ? -12.752 -1.238  2.646   1.00 10.00 ? 438 GLU A OE2  1  
ATOM 422   H H    . GLU A 1 29 ? -8.115  -1.963  -1.101  1.00 10.00 ? 438 GLU A H    1  
ATOM 423   H HA   . GLU A 1 29 ? -9.087  0.500   -0.166  1.00 10.00 ? 438 GLU A HA   1  
ATOM 424   H HB2  . GLU A 1 29 ? -10.009 -2.011  -0.074  1.00 10.00 ? 438 GLU A HB2  1  
ATOM 425   H HB3  . GLU A 1 29 ? -9.372  -1.896  1.560   1.00 10.00 ? 438 GLU A HB3  1  
ATOM 426   H HG2  . GLU A 1 29 ? -10.756 0.066   1.972   1.00 10.00 ? 438 GLU A HG2  1  
ATOM 427   H HG3  . GLU A 1 29 ? -11.384 -0.026  0.327   1.00 10.00 ? 438 GLU A HG3  1  
ATOM 428   N N    . THR A 1 30 ? -6.674  -0.806  1.595   1.00 10.00 ? 439 THR A N    1  
ATOM 429   C CA   . THR A 1 30 ? -5.750  -0.543  2.692   1.00 10.00 ? 439 THR A CA   1  
ATOM 430   C C    . THR A 1 30 ? -4.700  0.494   2.305   1.00 10.00 ? 439 THR A C    1  
ATOM 431   O O    . THR A 1 30 ? -4.522  1.498   2.996   1.00 10.00 ? 439 THR A O    1  
ATOM 432   C CB   . THR A 1 30 ? -5.073  -1.845  3.131   1.00 10.00 ? 439 THR A CB   1  
ATOM 433   O OG1  . THR A 1 30 ? -6.023  -2.738  3.684   1.00 10.00 ? 439 THR A OG1  1  
ATOM 434   C CG2  . THR A 1 30 ? -3.978  -1.649  4.161   1.00 10.00 ? 439 THR A CG2  1  
ATOM 435   H H    . THR A 1 30 ? -6.519  -1.581  1.005   1.00 10.00 ? 439 THR A H    1  
ATOM 436   H HA   . THR A 1 30 ? -6.325  -0.152  3.516   1.00 10.00 ? 439 THR A HA   1  
ATOM 437   H HB   . THR A 1 30 ? -4.631  -2.318  2.264   1.00 10.00 ? 439 THR A HB   1  
ATOM 438   H HG1  . THR A 1 30 ? -6.578  -2.267  4.311   1.00 10.00 ? 439 THR A HG1  1  
ATOM 439   H HG21 . THR A 1 30 ? -4.408  -1.662  5.151   1.00 10.00 ? 439 THR A HG21 1  
ATOM 440   H HG22 . THR A 1 30 ? -3.487  -0.701  3.996   1.00 10.00 ? 439 THR A HG22 1  
ATOM 441   H HG23 . THR A 1 30 ? -3.254  -2.446  4.075   1.00 10.00 ? 439 THR A HG23 1  
ATOM 442   N N    . PHE A 1 31 ? -4.004  0.241   1.210   1.00 10.00 ? 440 PHE A N    1  
ATOM 443   C CA   . PHE A 1 31 ? -2.964  1.147   0.739   1.00 10.00 ? 440 PHE A CA   1  
ATOM 444   C C    . PHE A 1 31 ? -3.563  2.468   0.281   1.00 10.00 ? 440 PHE A C    1  
ATOM 445   O O    . PHE A 1 31 ? -2.964  3.528   0.463   1.00 10.00 ? 440 PHE A O    1  
ATOM 446   C CB   . PHE A 1 31 ? -2.175  0.507   -0.405  1.00 10.00 ? 440 PHE A CB   1  
ATOM 447   C CG   . PHE A 1 31 ? -2.557  -0.906  -0.668  1.00 10.00 ? 440 PHE A CG   1  
ATOM 448   C CD1  . PHE A 1 31 ? -2.245  -1.914  0.226   1.00 10.00 ? 440 PHE A CD1  1  
ATOM 449   C CD2  . PHE A 1 31 ? -3.255  -1.217  -1.806  1.00 10.00 ? 440 PHE A CD2  1  
ATOM 450   C CE1  . PHE A 1 31 ? -2.631  -3.209  -0.024  1.00 10.00 ? 440 PHE A CE1  1  
ATOM 451   C CE2  . PHE A 1 31 ? -3.639  -2.507  -2.063  1.00 10.00 ? 440 PHE A CE2  1  
ATOM 452   C CZ   . PHE A 1 31 ? -3.329  -3.497  -1.175  1.00 10.00 ? 440 PHE A CZ   1  
ATOM 453   H H    . PHE A 1 31 ? -4.189  -0.577  0.705   1.00 10.00 ? 440 PHE A H    1  
ATOM 454   H HA   . PHE A 1 31 ? -2.293  1.338   1.564   1.00 10.00 ? 440 PHE A HA   1  
ATOM 455   H HB2  . PHE A 1 31 ? -2.361  1.058   -1.313  1.00 10.00 ? 440 PHE A HB2  1  
ATOM 456   H HB3  . PHE A 1 31 ? -1.123  0.532   -0.175  1.00 10.00 ? 440 PHE A HB3  1  
ATOM 457   H HD1  . PHE A 1 31 ? -1.703  -1.679  1.125   1.00 10.00 ? 440 PHE A HD1  1  
ATOM 458   H HD2  . PHE A 1 31 ? -3.498  -0.436  -2.502  1.00 10.00 ? 440 PHE A HD2  1  
ATOM 459   H HE1  . PHE A 1 31 ? -2.385  -3.994  0.675   1.00 10.00 ? 440 PHE A HE1  1  
ATOM 460   H HE2  . PHE A 1 31 ? -4.190  -2.744  -2.962  1.00 10.00 ? 440 PHE A HE2  1  
ATOM 461   H HZ   . PHE A 1 31 ? -3.640  -4.488  -1.379  1.00 10.00 ? 440 PHE A HZ   1  
ATOM 462   N N    . ARG A 1 32 ? -4.751  2.404   -0.312  1.00 10.00 ? 441 ARG A N    1  
ATOM 463   C CA   . ARG A 1 32 ? -5.415  3.608   -0.785  1.00 10.00 ? 441 ARG A CA   1  
ATOM 464   C C    . ARG A 1 32 ? -5.926  4.429   0.395   1.00 10.00 ? 441 ARG A C    1  
ATOM 465   O O    . ARG A 1 32 ? -5.995  5.655   0.327   1.00 10.00 ? 441 ARG A O    1  
ATOM 466   C CB   . ARG A 1 32 ? -6.587  3.264   -1.706  1.00 10.00 ? 441 ARG A CB   1  
ATOM 467   C CG   . ARG A 1 32 ? -7.141  4.463   -2.458  1.00 10.00 ? 441 ARG A CG   1  
ATOM 468   C CD   . ARG A 1 32 ? -7.941  4.035   -3.677  1.00 10.00 ? 441 ARG A CD   1  
ATOM 469   N NE   . ARG A 1 32 ? -8.070  5.113   -4.655  1.00 10.00 ? 441 ARG A NE   1  
ATOM 470   C CZ   . ARG A 1 32 ? -8.934  5.096   -5.667  1.00 10.00 ? 441 ARG A CZ   1  
ATOM 471   N NH1  . ARG A 1 32 ? -9.745  4.060   -5.840  1.00 10.00 ? 441 ARG A NH1  1  
ATOM 472   N NH2  . ARG A 1 32 ? -8.986  6.118   -6.510  1.00 10.00 ? 441 ARG A NH2  1  
ATOM 473   H H    . ARG A 1 32 ? -5.189  1.533   -0.429  1.00 10.00 ? 441 ARG A H    1  
ATOM 474   H HA   . ARG A 1 32 ? -4.687  4.186   -1.341  1.00 10.00 ? 441 ARG A HA   1  
ATOM 475   H HB2  . ARG A 1 32 ? -6.261  2.532   -2.428  1.00 10.00 ? 441 ARG A HB2  1  
ATOM 476   H HB3  . ARG A 1 32 ? -7.384  2.841   -1.112  1.00 10.00 ? 441 ARG A HB3  1  
ATOM 477   H HG2  . ARG A 1 32 ? -7.784  5.025   -1.797  1.00 10.00 ? 441 ARG A HG2  1  
ATOM 478   H HG3  . ARG A 1 32 ? -6.319  5.086   -2.779  1.00 10.00 ? 441 ARG A HG3  1  
ATOM 479   H HD2  . ARG A 1 32 ? -7.443  3.198   -4.143  1.00 10.00 ? 441 ARG A HD2  1  
ATOM 480   H HD3  . ARG A 1 32 ? -8.927  3.732   -3.356  1.00 10.00 ? 441 ARG A HD3  1  
ATOM 481   H HE   . ARG A 1 32 ? -7.483  5.890   -4.551  1.00 10.00 ? 441 ARG A HE   1  
ATOM 482   H HH11 . ARG A 1 32 ? -9.711  3.286   -5.207  1.00 10.00 ? 441 ARG A HH11 1  
ATOM 483   H HH12 . ARG A 1 32 ? -10.392 4.053   -6.602  1.00 10.00 ? 441 ARG A HH12 1  
ATOM 484   H HH21 . ARG A 1 32 ? -8.377  6.901   -6.385  1.00 10.00 ? 441 ARG A HH21 1  
ATOM 485   H HH22 . ARG A 1 32 ? -9.635  6.106   -7.272  1.00 10.00 ? 441 ARG A HH22 1  
ATOM 486   N N    . GLU A 1 33 ? -6.296  3.738   1.476   1.00 10.00 ? 442 GLU A N    1  
ATOM 487   C CA   . GLU A 1 33 ? -6.817  4.401   2.668   1.00 10.00 ? 442 GLU A CA   1  
ATOM 488   C C    . GLU A 1 33 ? -5.734  5.194   3.388   1.00 10.00 ? 442 GLU A C    1  
ATOM 489   O O    . GLU A 1 33 ? -5.962  6.325   3.811   1.00 10.00 ? 442 GLU A O    1  
ATOM 490   C CB   . GLU A 1 33 ? -7.432  3.374   3.622   1.00 10.00 ? 442 GLU A CB   1  
ATOM 491   C CG   . GLU A 1 33 ? -7.973  3.982   4.907   1.00 10.00 ? 442 GLU A CG   1  
ATOM 492   C CD   . GLU A 1 33 ? -8.771  2.990   5.730   1.00 10.00 ? 442 GLU A CD   1  
ATOM 493   O OE1  . GLU A 1 33 ? -9.240  1.984   5.157   1.00 10.00 ? 442 GLU A OE1  1  
ATOM 494   O OE2  . GLU A 1 33 ? -8.926  3.218   6.948   1.00 10.00 ? 442 GLU A OE2  1  
ATOM 495   H H    . GLU A 1 33 ? -6.225  2.758   1.468   1.00 10.00 ? 442 GLU A H    1  
ATOM 496   H HA   . GLU A 1 33 ? -7.586  5.084   2.351   1.00 10.00 ? 442 GLU A HA   1  
ATOM 497   H HB2  . GLU A 1 33 ? -8.246  2.876   3.118   1.00 10.00 ? 442 GLU A HB2  1  
ATOM 498   H HB3  . GLU A 1 33 ? -6.680  2.645   3.883   1.00 10.00 ? 442 GLU A HB3  1  
ATOM 499   H HG2  . GLU A 1 33 ? -7.142  4.333   5.501   1.00 10.00 ? 442 GLU A HG2  1  
ATOM 500   H HG3  . GLU A 1 33 ? -8.612  4.815   4.655   1.00 10.00 ? 442 GLU A HG3  1  
ATOM 501   N N    . LYS A 1 34 ? -4.557  4.599   3.526   1.00 10.00 ? 443 LYS A N    1  
ATOM 502   C CA   . LYS A 1 34 ? -3.450  5.262   4.198   1.00 10.00 ? 443 LYS A CA   1  
ATOM 503   C C    . LYS A 1 34 ? -2.944  6.426   3.360   1.00 10.00 ? 443 LYS A C    1  
ATOM 504   O O    . LYS A 1 34 ? -2.686  7.513   3.875   1.00 10.00 ? 443 LYS A O    1  
ATOM 505   C CB   . LYS A 1 34 ? -2.321  4.270   4.468   1.00 10.00 ? 443 LYS A CB   1  
ATOM 506   C CG   . LYS A 1 34 ? -2.261  3.796   5.910   1.00 10.00 ? 443 LYS A CG   1  
ATOM 507   C CD   . LYS A 1 34 ? -3.025  2.495   6.102   1.00 10.00 ? 443 LYS A CD   1  
ATOM 508   C CE   . LYS A 1 34 ? -4.427  2.745   6.632   1.00 10.00 ? 443 LYS A CE   1  
ATOM 509   N NZ   . LYS A 1 34 ? -4.410  3.221   8.043   1.00 10.00 ? 443 LYS A NZ   1  
ATOM 510   H H    . LYS A 1 34 ? -4.429  3.697   3.166   1.00 10.00 ? 443 LYS A H    1  
ATOM 511   H HA   . LYS A 1 34 ? -3.816  5.644   5.140   1.00 10.00 ? 443 LYS A HA   1  
ATOM 512   H HB2  . LYS A 1 34 ? -2.461  3.407   3.834   1.00 10.00 ? 443 LYS A HB2  1  
ATOM 513   H HB3  . LYS A 1 34 ? -1.378  4.737   4.225   1.00 10.00 ? 443 LYS A HB3  1  
ATOM 514   H HG2  . LYS A 1 34 ? -1.229  3.639   6.185   1.00 10.00 ? 443 LYS A HG2  1  
ATOM 515   H HG3  . LYS A 1 34 ? -2.694  4.554   6.546   1.00 10.00 ? 443 LYS A HG3  1  
ATOM 516   H HD2  . LYS A 1 34 ? -3.096  1.988   5.151   1.00 10.00 ? 443 LYS A HD2  1  
ATOM 517   H HD3  . LYS A 1 34 ? -2.488  1.875   6.804   1.00 10.00 ? 443 LYS A HD3  1  
ATOM 518   H HE2  . LYS A 1 34 ? -4.903  3.493   6.016   1.00 10.00 ? 443 LYS A HE2  1  
ATOM 519   H HE3  . LYS A 1 34 ? -4.988  1.824   6.578   1.00 10.00 ? 443 LYS A HE3  1  
ATOM 520   H HZ1  . LYS A 1 34 ? -3.540  3.759   8.229   1.00 10.00 ? 443 LYS A HZ1  1  
ATOM 521   H HZ2  . LYS A 1 34 ? -4.448  2.411   8.694   1.00 10.00 ? 443 LYS A HZ2  1  
ATOM 522   H HZ3  . LYS A 1 34 ? -5.230  3.834   8.224   1.00 10.00 ? 443 LYS A HZ3  1  
ATOM 523   N N    . PHE A 1 35 ? -2.828  6.201   2.059   1.00 10.00 ? 444 PHE A N    1  
ATOM 524   C CA   . PHE A 1 35 ? -2.380  7.241   1.156   1.00 10.00 ? 444 PHE A CA   1  
ATOM 525   C C    . PHE A 1 35 ? -3.453  8.312   1.052   1.00 10.00 ? 444 PHE A C    1  
ATOM 526   O O    . PHE A 1 35 ? -3.159  9.486   0.825   1.00 10.00 ? 444 PHE A O    1  
ATOM 527   C CB   . PHE A 1 35 ? -2.057  6.652   -0.214  1.00 10.00 ? 444 PHE A CB   1  
ATOM 528   C CG   . PHE A 1 35 ? -1.614  7.673   -1.220  1.00 10.00 ? 444 PHE A CG   1  
ATOM 529   C CD1  . PHE A 1 35 ? -2.542  8.394   -1.953  1.00 10.00 ? 444 PHE A CD1  1  
ATOM 530   C CD2  . PHE A 1 35 ? -0.268  7.910   -1.430  1.00 10.00 ? 444 PHE A CD2  1  
ATOM 531   C CE1  . PHE A 1 35 ? -2.133  9.335   -2.880  1.00 10.00 ? 444 PHE A CE1  1  
ATOM 532   C CE2  . PHE A 1 35 ? 0.149   8.849   -2.354  1.00 10.00 ? 444 PHE A CE2  1  
ATOM 533   C CZ   . PHE A 1 35 ? -0.785  9.562   -3.080  1.00 10.00 ? 444 PHE A CZ   1  
ATOM 534   H H    . PHE A 1 35 ? -3.071  5.327   1.698   1.00 10.00 ? 444 PHE A H    1  
ATOM 535   H HA   . PHE A 1 35 ? -1.486  7.682   1.574   1.00 10.00 ? 444 PHE A HA   1  
ATOM 536   H HB2  . PHE A 1 35 ? -1.258  5.932   -0.101  1.00 10.00 ? 444 PHE A HB2  1  
ATOM 537   H HB3  . PHE A 1 35 ? -2.933  6.154   -0.602  1.00 10.00 ? 444 PHE A HB3  1  
ATOM 538   H HD1  . PHE A 1 35 ? -3.596  8.216   -1.796  1.00 10.00 ? 444 PHE A HD1  1  
ATOM 539   H HD2  . PHE A 1 35 ? 0.460   7.352   -0.861  1.00 10.00 ? 444 PHE A HD2  1  
ATOM 540   H HE1  . PHE A 1 35 ? -2.866  9.890   -3.446  1.00 10.00 ? 444 PHE A HE1  1  
ATOM 541   H HE2  . PHE A 1 35 ? 1.203   9.025   -2.508  1.00 10.00 ? 444 PHE A HE2  1  
ATOM 542   H HZ   . PHE A 1 35 ? -0.462  10.297  -3.803  1.00 10.00 ? 444 PHE A HZ   1  
ATOM 543   N N    . MET A 1 36 ? -4.702  7.900   1.261   1.00 10.00 ? 445 MET A N    1  
ATOM 544   C CA   . MET A 1 36 ? -5.818  8.826   1.232   1.00 10.00 ? 445 MET A CA   1  
ATOM 545   C C    . MET A 1 36 ? -5.861  9.590   2.548   1.00 10.00 ? 445 MET A C    1  
ATOM 546   O O    . MET A 1 36 ? -6.112  10.795  2.580   1.00 10.00 ? 445 MET A O    1  
ATOM 547   C CB   . MET A 1 36 ? -7.139  8.086   1.005   1.00 10.00 ? 445 MET A CB   1  
ATOM 548   C CG   . MET A 1 36 ? -7.445  7.824   -0.461  1.00 10.00 ? 445 MET A CG   1  
ATOM 549   S SD   . MET A 1 36 ? -8.221  9.235   -1.271  1.00 10.00 ? 445 MET A SD   1  
ATOM 550   C CE   . MET A 1 36 ? -9.192  8.411   -2.531  1.00 10.00 ? 445 MET A CE   1  
ATOM 551   H H    . MET A 1 36 ? -4.869  6.956   1.464   1.00 10.00 ? 445 MET A H    1  
ATOM 552   H HA   . MET A 1 36 ? -5.650  9.518   0.425   1.00 10.00 ? 445 MET A HA   1  
ATOM 553   H HB2  . MET A 1 36 ? -7.100  7.138   1.519   1.00 10.00 ? 445 MET A HB2  1  
ATOM 554   H HB3  . MET A 1 36 ? -7.943  8.677   1.418   1.00 10.00 ? 445 MET A HB3  1  
ATOM 555   H HG2  . MET A 1 36 ? -6.522  7.597   -0.973  1.00 10.00 ? 445 MET A HG2  1  
ATOM 556   H HG3  . MET A 1 36 ? -8.111  6.976   -0.529  1.00 10.00 ? 445 MET A HG3  1  
ATOM 557   H HE1  . MET A 1 36 ? -9.082  8.934   -3.469  1.00 10.00 ? 445 MET A HE1  1  
ATOM 558   H HE2  . MET A 1 36 ? -10.232 8.408   -2.239  1.00 10.00 ? 445 MET A HE2  1  
ATOM 559   H HE3  . MET A 1 36 ? -8.846  7.394   -2.643  1.00 10.00 ? 445 MET A HE3  1  
ATOM 560   N N    . GLN A 1 37 ? -5.580  8.870   3.632   1.00 10.00 ? 446 GLN A N    1  
ATOM 561   C CA   . GLN A 1 37 ? -5.546  9.458   4.963   1.00 10.00 ? 446 GLN A CA   1  
ATOM 562   C C    . GLN A 1 37 ? -4.347  10.387  5.073   1.00 10.00 ? 446 GLN A C    1  
ATOM 563   O O    . GLN A 1 37 ? -4.406  11.437  5.711   1.00 10.00 ? 446 GLN A O    1  
ATOM 564   C CB   . GLN A 1 37 ? -5.447  8.359   6.024   1.00 10.00 ? 446 GLN A CB   1  
ATOM 565   C CG   . GLN A 1 37 ? -6.004  8.765   7.378   1.00 10.00 ? 446 GLN A CG   1  
ATOM 566   C CD   . GLN A 1 37 ? -6.671  7.610   8.101   1.00 10.00 ? 446 GLN A CD   1  
ATOM 567   O OE1  . GLN A 1 37 ? -6.369  7.332   9.262   1.00 10.00 ? 446 GLN A OE1  1  
ATOM 568   N NE2  . GLN A 1 37 ? -7.583  6.931   7.416   1.00 10.00 ? 446 GLN A NE2  1  
ATOM 569   H H    . GLN A 1 37 ? -5.368  7.919   3.528   1.00 10.00 ? 446 GLN A H    1  
ATOM 570   H HA   . GLN A 1 37 ? -6.454  10.024  5.111   1.00 10.00 ? 446 GLN A HA   1  
ATOM 571   H HB2  . GLN A 1 37 ? -5.992  7.494   5.680   1.00 10.00 ? 446 GLN A HB2  1  
ATOM 572   H HB3  . GLN A 1 37 ? -4.405  8.090   6.151   1.00 10.00 ? 446 GLN A HB3  1  
ATOM 573   H HG2  . GLN A 1 37 ? -5.195  9.134   7.991   1.00 10.00 ? 446 GLN A HG2  1  
ATOM 574   H HG3  . GLN A 1 37 ? -6.733  9.549   7.234   1.00 10.00 ? 446 GLN A HG3  1  
ATOM 575   H HE21 . GLN A 1 37 ? -7.774  7.209   6.496   1.00 10.00 ? 446 GLN A HE21 1  
ATOM 576   H HE22 . GLN A 1 37 ? -8.028  6.178   7.858   1.00 10.00 ? 446 GLN A HE22 1  
ATOM 577   N N    . HIS A 1 38 ? -3.261  9.980   4.426   1.00 10.00 ? 447 HIS A N    1  
ATOM 578   C CA   . HIS A 1 38 ? -2.029  10.748  4.414   1.00 10.00 ? 447 HIS A CA   1  
ATOM 579   C C    . HIS A 1 38 ? -1.848  11.417  3.051   1.00 10.00 ? 447 HIS A C    1  
ATOM 580   O O    . HIS A 1 38 ? -1.093  10.932  2.208   1.00 10.00 ? 447 HIS A O    1  
ATOM 581   C CB   . HIS A 1 38 ? -0.844  9.830   4.725   1.00 10.00 ? 447 HIS A CB   1  
ATOM 582   C CG   . HIS A 1 38 ? -0.967  9.124   6.043   1.00 10.00 ? 447 HIS A CG   1  
ATOM 583   N ND1  . HIS A 1 38 ? -0.640  9.719   7.244   1.00 10.00 ? 447 HIS A ND1  1  
ATOM 584   C CD2  . HIS A 1 38 ? -1.391  7.870   6.353   1.00 10.00 ? 447 HIS A CD2  1  
ATOM 585   C CE1  . HIS A 1 38 ? -0.853  8.866   8.230   1.00 10.00 ? 447 HIS A CE1  1  
ATOM 586   N NE2  . HIS A 1 38 ? -1.310  7.740   7.716   1.00 10.00 ? 447 HIS A NE2  1  
ATOM 587   H H    . HIS A 1 38 ? -3.294  9.133   3.934   1.00 10.00 ? 447 HIS A H    1  
ATOM 588   H HA   . HIS A 1 38 ? -2.099  11.510  5.176   1.00 10.00 ? 447 HIS A HA   1  
ATOM 589   H HB2  . HIS A 1 38 ? -0.767  9.079   3.953   1.00 10.00 ? 447 HIS A HB2  1  
ATOM 590   H HB3  . HIS A 1 38 ? 0.063   10.416  4.743   1.00 10.00 ? 447 HIS A HB3  1  
ATOM 591   H HD1  . HIS A 1 38 ? -0.300  10.631  7.356   1.00 10.00 ? 447 HIS A HD1  1  
ATOM 592   H HD2  . HIS A 1 38 ? -1.722  7.108   5.658   1.00 10.00 ? 447 HIS A HD2  1  
ATOM 593   H HE1  . HIS A 1 38 ? -0.674  9.053   9.277   1.00 10.00 ? 447 HIS A HE1  1  
ATOM 594   H HE2  . HIS A 1 38 ? -1.644  6.979   8.235   1.00 10.00 ? 447 HIS A HE2  1  
ATOM 595   N N    . PRO A 1 39 ? -2.559  12.537  2.812   1.00 10.00 ? 448 PRO A N    1  
ATOM 596   C CA   . PRO A 1 39 ? -2.503  13.274  1.548   1.00 10.00 ? 448 PRO A CA   1  
ATOM 597   C C    . PRO A 1 39 ? -1.093  13.380  0.977   1.00 10.00 ? 448 PRO A C    1  
ATOM 598   O O    . PRO A 1 39 ? -0.235  14.065  1.534   1.00 10.00 ? 448 PRO A O    1  
ATOM 599   C CB   . PRO A 1 39 ? -3.045  14.669  1.909   1.00 10.00 ? 448 PRO A CB   1  
ATOM 600   C CG   . PRO A 1 39 ? -3.383  14.624  3.369   1.00 10.00 ? 448 PRO A CG   1  
ATOM 601   C CD   . PRO A 1 39 ? -3.488  13.175  3.747   1.00 10.00 ? 448 PRO A CD   1  
ATOM 602   H HA   . PRO A 1 39 ? -3.148  12.823  0.808   1.00 10.00 ? 448 PRO A HA   1  
ATOM 603   H HB2  . PRO A 1 39 ? -2.287  15.411  1.708   1.00 10.00 ? 448 PRO A HB2  1  
ATOM 604   H HB3  . PRO A 1 39 ? -3.921  14.877  1.313   1.00 10.00 ? 448 PRO A HB3  1  
ATOM 605   H HG2  . PRO A 1 39 ? -2.600  15.101  3.940   1.00 10.00 ? 448 PRO A HG2  1  
ATOM 606   H HG3  . PRO A 1 39 ? -4.326  15.124  3.540   1.00 10.00 ? 448 PRO A HG3  1  
ATOM 607   H HD2  . PRO A 1 39 ? -3.176  13.027  4.769   1.00 10.00 ? 448 PRO A HD2  1  
ATOM 608   H HD3  . PRO A 1 39 ? -4.495  12.814  3.598   1.00 10.00 ? 448 PRO A HD3  1  
ATOM 609   N N    . LYS A 1 40 ? -0.867  12.698  -0.146  1.00 10.00 ? 449 LYS A N    1  
ATOM 610   C CA   . LYS A 1 40 ? 0.433   12.709  -0.814  1.00 10.00 ? 449 LYS A CA   1  
ATOM 611   C C    . LYS A 1 40 ? 1.572   12.558  0.188   1.00 10.00 ? 449 LYS A C    1  
ATOM 612   O O    . LYS A 1 40 ? 2.209   13.539  0.570   1.00 10.00 ? 449 LYS A O    1  
ATOM 613   C CB   . LYS A 1 40 ? 0.608   14.005  -1.608  1.00 10.00 ? 449 LYS A CB   1  
ATOM 614   C CG   . LYS A 1 40 ? 1.440   13.838  -2.869  1.00 10.00 ? 449 LYS A CG   1  
ATOM 615   C CD   . LYS A 1 40 ? 0.582   13.418  -4.051  1.00 10.00 ? 449 LYS A CD   1  
ATOM 616   C CE   . LYS A 1 40 ? 1.227   13.803  -5.373  1.00 10.00 ? 449 LYS A CE   1  
ATOM 617   N NZ   . LYS A 1 40 ? 0.985   15.232  -5.714  1.00 10.00 ? 449 LYS A NZ   1  
ATOM 618   H H    . LYS A 1 40 ? -1.598  12.177  -0.540  1.00 10.00 ? 449 LYS A H    1  
ATOM 619   H HA   . LYS A 1 40 ? 0.459   11.875  -1.498  1.00 10.00 ? 449 LYS A HA   1  
ATOM 620   H HB2  . LYS A 1 40 ? -0.366  14.375  -1.892  1.00 10.00 ? 449 LYS A HB2  1  
ATOM 621   H HB3  . LYS A 1 40 ? 1.091   14.737  -0.978  1.00 10.00 ? 449 LYS A HB3  1  
ATOM 622   H HG2  . LYS A 1 40 ? 1.918   14.778  -3.101  1.00 10.00 ? 449 LYS A HG2  1  
ATOM 623   H HG3  . LYS A 1 40 ? 2.192   13.082  -2.695  1.00 10.00 ? 449 LYS A HG3  1  
ATOM 624   H HD2  . LYS A 1 40 ? 0.449   12.347  -4.026  1.00 10.00 ? 449 LYS A HD2  1  
ATOM 625   H HD3  . LYS A 1 40 ? -0.380  13.904  -3.975  1.00 10.00 ? 449 LYS A HD3  1  
ATOM 626   H HE2  . LYS A 1 40 ? 2.291   13.634  -5.302  1.00 10.00 ? 449 LYS A HE2  1  
ATOM 627   H HE3  . LYS A 1 40 ? 0.816   13.180  -6.154  1.00 10.00 ? 449 LYS A HE3  1  
ATOM 628   H HZ1  . LYS A 1 40 ? -0.011  15.373  -5.976  1.00 10.00 ? 449 LYS A HZ1  1  
ATOM 629   H HZ2  . LYS A 1 40 ? 1.586   15.515  -6.514  1.00 10.00 ? 449 LYS A HZ2  1  
ATOM 630   H HZ3  . LYS A 1 40 ? 1.208   15.837  -4.898  1.00 10.00 ? 449 LYS A HZ3  1  
ATOM 631   N N    . ASN A 1 41 ? 1.823   11.325  0.613   1.00 10.00 ? 450 ASN A N    1  
ATOM 632   C CA   . ASN A 1 41 ? 2.885   11.058  1.573   1.00 10.00 ? 450 ASN A CA   1  
ATOM 633   C C    . ASN A 1 41 ? 3.842   9.990   1.060   1.00 10.00 ? 450 ASN A C    1  
ATOM 634   O O    . ASN A 1 41 ? 5.059   10.175  1.085   1.00 10.00 ? 450 ASN A O    1  
ATOM 635   C CB   . ASN A 1 41 ? 2.295   10.629  2.920   1.00 10.00 ? 450 ASN A CB   1  
ATOM 636   C CG   . ASN A 1 41 ? 1.424   9.392   2.809   1.00 10.00 ? 450 ASN A CG   1  
ATOM 637   O OD1  . ASN A 1 41 ? 0.682   9.227   1.841   1.00 10.00 ? 450 ASN A OD1  1  
ATOM 638   N ND2  . ASN A 1 41 ? 1.509   8.514   3.803   1.00 10.00 ? 450 ASN A ND2  1  
ATOM 639   H H    . ASN A 1 41 ? 1.281   10.580  0.276   1.00 10.00 ? 450 ASN A H    1  
ATOM 640   H HA   . ASN A 1 41 ? 3.436   11.971  1.712   1.00 10.00 ? 450 ASN A HA   1  
ATOM 641   H HB2  . ASN A 1 41 ? 3.100   10.417  3.607   1.00 10.00 ? 450 ASN A HB2  1  
ATOM 642   H HB3  . ASN A 1 41 ? 1.695   11.436  3.315   1.00 10.00 ? 450 ASN A HB3  1  
ATOM 643   H HD21 . ASN A 1 41 ? 2.120   8.708   4.545   1.00 10.00 ? 450 ASN A HD21 1  
ATOM 644   H HD22 . ASN A 1 41 ? 0.956   7.706   3.755   1.00 10.00 ? 450 ASN A HD22 1  
ATOM 645   N N    . PHE A 1 42 ? 3.288   8.866   0.612   1.00 10.00 ? 451 PHE A N    1  
ATOM 646   C CA   . PHE A 1 42 ? 4.095   7.755   0.112   1.00 10.00 ? 451 PHE A CA   1  
ATOM 647   C C    . PHE A 1 42 ? 5.289   7.519   1.026   1.00 10.00 ? 451 PHE A C    1  
ATOM 648   O O    . PHE A 1 42 ? 6.439   7.472   0.593   1.00 10.00 ? 451 PHE A O    1  
ATOM 649   C CB   . PHE A 1 42 ? 4.541   8.003   -1.332  1.00 10.00 ? 451 PHE A CB   1  
ATOM 650   C CG   . PHE A 1 42 ? 3.905   7.060   -2.318  1.00 10.00 ? 451 PHE A CG   1  
ATOM 651   C CD1  . PHE A 1 42 ? 2.612   6.607   -2.117  1.00 10.00 ? 451 PHE A CD1  1  
ATOM 652   C CD2  . PHE A 1 42 ? 4.592   6.630   -3.444  1.00 10.00 ? 451 PHE A CD2  1  
ATOM 653   C CE1  . PHE A 1 42 ? 2.012   5.747   -3.014  1.00 10.00 ? 451 PHE A CE1  1  
ATOM 654   C CE2  . PHE A 1 42 ? 3.997   5.766   -4.347  1.00 10.00 ? 451 PHE A CE2  1  
ATOM 655   C CZ   . PHE A 1 42 ? 2.705   5.325   -4.131  1.00 10.00 ? 451 PHE A CZ   1  
ATOM 656   H H    . PHE A 1 42 ? 2.312   8.777   0.631   1.00 10.00 ? 451 PHE A H    1  
ATOM 657   H HA   . PHE A 1 42 ? 3.474   6.872   0.137   1.00 10.00 ? 451 PHE A HA   1  
ATOM 658   H HB2  . PHE A 1 42 ? 4.271   9.009   -1.616  1.00 10.00 ? 451 PHE A HB2  1  
ATOM 659   H HB3  . PHE A 1 42 ? 5.612   7.888   -1.401  1.00 10.00 ? 451 PHE A HB3  1  
ATOM 660   H HD1  . PHE A 1 42 ? 2.072   6.933   -1.242  1.00 10.00 ? 451 PHE A HD1  1  
ATOM 661   H HD2  . PHE A 1 42 ? 5.602   6.971   -3.612  1.00 10.00 ? 451 PHE A HD2  1  
ATOM 662   H HE1  . PHE A 1 42 ? 1.002   5.405   -2.842  1.00 10.00 ? 451 PHE A HE1  1  
ATOM 663   H HE2  . PHE A 1 42 ? 4.542   5.438   -5.219  1.00 10.00 ? 451 PHE A HE2  1  
ATOM 664   H HZ   . PHE A 1 42 ? 2.238   4.652   -4.835  1.00 10.00 ? 451 PHE A HZ   1  
ATOM 665   N N    . GLY A 1 43 ? 4.977   7.369   2.303   1.00 10.00 ? 452 GLY A N    1  
ATOM 666   C CA   . GLY A 1 43 ? 5.978   7.131   3.321   1.00 10.00 ? 452 GLY A CA   1  
ATOM 667   C C    . GLY A 1 43 ? 5.412   6.250   4.406   1.00 10.00 ? 452 GLY A C    1  
ATOM 668   O O    . GLY A 1 43 ? 5.986   5.218   4.750   1.00 10.00 ? 452 GLY A O    1  
ATOM 669   H H    . GLY A 1 43 ? 4.032   7.414   2.562   1.00 10.00 ? 452 GLY A H    1  
ATOM 670   H HA2  . GLY A 1 43 ? 6.834   6.645   2.873   1.00 10.00 ? 452 GLY A HA2  1  
ATOM 671   H HA3  . GLY A 1 43 ? 6.284   8.072   3.751   1.00 10.00 ? 452 GLY A HA3  1  
ATOM 672   N N    . LEU A 1 44 ? 4.245   6.642   4.911   1.00 10.00 ? 453 LEU A N    1  
ATOM 673   C CA   . LEU A 1 44 ? 3.557   5.863   5.923   1.00 10.00 ? 453 LEU A CA   1  
ATOM 674   C C    . LEU A 1 44 ? 2.785   4.754   5.234   1.00 10.00 ? 453 LEU A C    1  
ATOM 675   O O    . LEU A 1 44 ? 2.736   3.620   5.709   1.00 10.00 ? 453 LEU A O    1  
ATOM 676   C CB   . LEU A 1 44 ? 2.596   6.733   6.738   1.00 10.00 ? 453 LEU A CB   1  
ATOM 677   C CG   . LEU A 1 44 ? 1.627   5.952   7.632   1.00 10.00 ? 453 LEU A CG   1  
ATOM 678   C CD1  . LEU A 1 44 ? 1.205   6.793   8.826   1.00 10.00 ? 453 LEU A CD1  1  
ATOM 679   C CD2  . LEU A 1 44 ? 0.411   5.489   6.834   1.00 10.00 ? 453 LEU A CD2  1  
ATOM 680   H H    . LEU A 1 44 ? 3.824   7.457   4.565   1.00 10.00 ? 453 LEU A H    1  
ATOM 681   H HA   . LEU A 1 44 ? 4.296   5.430   6.579   1.00 10.00 ? 453 LEU A HA   1  
ATOM 682   H HB2  . LEU A 1 44 ? 3.181   7.393   7.362   1.00 10.00 ? 453 LEU A HB2  1  
ATOM 683   H HB3  . LEU A 1 44 ? 2.016   7.332   6.053   1.00 10.00 ? 453 LEU A HB3  1  
ATOM 684   H HG   . LEU A 1 44 ? 2.130   5.077   8.010   1.00 10.00 ? 453 LEU A HG   1  
ATOM 685   H HD11 . LEU A 1 44 ? 1.811   6.532   9.681   1.00 10.00 ? 453 LEU A HD11 1  
ATOM 686   H HD12 . LEU A 1 44 ? 0.166   6.603   9.052   1.00 10.00 ? 453 LEU A HD12 1  
ATOM 687   H HD13 . LEU A 1 44 ? 1.339   7.839   8.595   1.00 10.00 ? 453 LEU A HD13 1  
ATOM 688   H HD21 . LEU A 1 44 ? 0.545   4.457   6.535   1.00 10.00 ? 453 LEU A HD21 1  
ATOM 689   H HD22 . LEU A 1 44 ? 0.302   6.103   5.953   1.00 10.00 ? 453 LEU A HD22 1  
ATOM 690   H HD23 . LEU A 1 44 ? -0.476  5.573   7.444   1.00 10.00 ? 453 LEU A HD23 1  
ATOM 691   N N    . ILE A 1 45 ? 2.194   5.097   4.092   1.00 10.00 ? 454 ILE A N    1  
ATOM 692   C CA   . ILE A 1 45 ? 1.436   4.143   3.313   1.00 10.00 ? 454 ILE A CA   1  
ATOM 693   C C    . ILE A 1 45 ? 2.323   2.975   2.906   1.00 10.00 ? 454 ILE A C    1  
ATOM 694   O O    . ILE A 1 45 ? 1.910   1.818   2.954   1.00 10.00 ? 454 ILE A O    1  
ATOM 695   C CB   . ILE A 1 45 ? 0.854   4.801   2.049   1.00 10.00 ? 454 ILE A CB   1  
ATOM 696   C CG1  . ILE A 1 45 ? -0.143  3.846   1.383   1.00 10.00 ? 454 ILE A CG1  1  
ATOM 697   C CG2  . ILE A 1 45 ? 1.977   5.200   1.098   1.00 10.00 ? 454 ILE A CG2  1  
ATOM 698   C CD1  . ILE A 1 45 ? -0.022  3.774   -0.126  1.00 10.00 ? 454 ILE A CD1  1  
ATOM 699   H H    . ILE A 1 45 ? 2.281   6.016   3.759   1.00 10.00 ? 454 ILE A H    1  
ATOM 700   H HA   . ILE A 1 45 ? 0.622   3.779   3.920   1.00 10.00 ? 454 ILE A HA   1  
ATOM 701   H HB   . ILE A 1 45 ? 0.338   5.703   2.345   1.00 10.00 ? 454 ILE A HB   1  
ATOM 702   H HG12 . ILE A 1 45 ? 0.013   2.850   1.775   1.00 10.00 ? 454 ILE A HG12 1  
ATOM 703   H HG13 . ILE A 1 45 ? -1.149  4.166   1.621   1.00 10.00 ? 454 ILE A HG13 1  
ATOM 704   H HG21 . ILE A 1 45 ? 2.707   5.791   1.631   1.00 10.00 ? 454 ILE A HG21 1  
ATOM 705   H HG22 . ILE A 1 45 ? 1.569   5.781   0.284   1.00 10.00 ? 454 ILE A HG22 1  
ATOM 706   H HG23 . ILE A 1 45 ? 2.449   4.312   0.705   1.00 10.00 ? 454 ILE A HG23 1  
ATOM 707   H HD11 . ILE A 1 45 ? -0.963  3.454   -0.548  1.00 10.00 ? 454 ILE A HD11 1  
ATOM 708   H HD12 . ILE A 1 45 ? 0.750   3.068   -0.390  1.00 10.00 ? 454 ILE A HD12 1  
ATOM 709   H HD13 . ILE A 1 45 ? 0.234   4.749   -0.514  1.00 10.00 ? 454 ILE A HD13 1  
ATOM 710   N N    . ALA A 1 46 ? 3.552   3.299   2.514   1.00 10.00 ? 455 ALA A N    1  
ATOM 711   C CA   . ALA A 1 46 ? 4.521   2.294   2.104   1.00 10.00 ? 455 ALA A CA   1  
ATOM 712   C C    . ALA A 1 46 ? 5.385   1.850   3.282   1.00 10.00 ? 455 ALA A C    1  
ATOM 713   O O    . ALA A 1 46 ? 6.428   1.224   3.096   1.00 10.00 ? 455 ALA A O    1  
ATOM 714   C CB   . ALA A 1 46 ? 5.395   2.835   0.983   1.00 10.00 ? 455 ALA A CB   1  
ATOM 715   H H    . ALA A 1 46 ? 3.815   4.243   2.508   1.00 10.00 ? 455 ALA A H    1  
ATOM 716   H HA   . ALA A 1 46 ? 3.980   1.443   1.724   1.00 10.00 ? 455 ALA A HA   1  
ATOM 717   H HB1  . ALA A 1 46 ? 5.381   3.915   1.006   1.00 10.00 ? 455 ALA A HB1  1  
ATOM 718   H HB2  . ALA A 1 46 ? 5.017   2.490   0.032   1.00 10.00 ? 455 ALA A HB2  1  
ATOM 719   H HB3  . ALA A 1 46 ? 6.409   2.486   1.116   1.00 10.00 ? 455 ALA A HB3  1  
ATOM 720   N N    . SER A 1 47 ? 4.949   2.184   4.496   1.00 10.00 ? 456 SER A N    1  
ATOM 721   C CA   . SER A 1 47 ? 5.691   1.823   5.697   1.00 10.00 ? 456 SER A CA   1  
ATOM 722   C C    . SER A 1 47 ? 4.897   0.863   6.578   1.00 10.00 ? 456 SER A C    1  
ATOM 723   O O    . SER A 1 47 ? 5.479   0.095   7.344   1.00 10.00 ? 456 SER A O    1  
ATOM 724   C CB   . SER A 1 47 ? 6.056   3.076   6.493   1.00 10.00 ? 456 SER A CB   1  
ATOM 725   O OG   . SER A 1 47 ? 6.466   2.745   7.808   1.00 10.00 ? 456 SER A OG   1  
ATOM 726   H H    . SER A 1 47 ? 4.115   2.687   4.585   1.00 10.00 ? 456 SER A H    1  
ATOM 727   H HA   . SER A 1 47 ? 6.602   1.332   5.386   1.00 10.00 ? 456 SER A HA   1  
ATOM 728   H HB2  . SER A 1 47 ? 6.864   3.593   5.998   1.00 10.00 ? 456 SER A HB2  1  
ATOM 729   H HB3  . SER A 1 47 ? 5.195   3.725   6.551   1.00 10.00 ? 456 SER A HB3  1  
ATOM 730   H HG   . SER A 1 47 ? 5.698   2.706   8.383   1.00 10.00 ? 456 SER A HG   1  
ATOM 731   N N    . PHE A 1 48 ? 3.569   0.901   6.473   1.00 10.00 ? 457 PHE A N    1  
ATOM 732   C CA   . PHE A 1 48 ? 2.734   0.015   7.277   1.00 10.00 ? 457 PHE A CA   1  
ATOM 733   C C    . PHE A 1 48 ? 2.581   -1.342  6.592   1.00 10.00 ? 457 PHE A C    1  
ATOM 734   O O    . PHE A 1 48 ? 2.398   -2.365  7.253   1.00 10.00 ? 457 PHE A O    1  
ATOM 735   C CB   . PHE A 1 48 ? 1.362   0.649   7.544   1.00 10.00 ? 457 PHE A CB   1  
ATOM 736   C CG   . PHE A 1 48 ? 0.424   0.587   6.375   1.00 10.00 ? 457 PHE A CG   1  
ATOM 737   C CD1  . PHE A 1 48 ? -0.243  -0.590  6.067   1.00 10.00 ? 457 PHE A CD1  1  
ATOM 738   C CD2  . PHE A 1 48 ? 0.216   1.702   5.578   1.00 10.00 ? 457 PHE A CD2  1  
ATOM 739   C CE1  . PHE A 1 48 ? -1.099  -0.652  4.988   1.00 10.00 ? 457 PHE A CE1  1  
ATOM 740   C CE2  . PHE A 1 48 ? -0.639  1.643   4.498   1.00 10.00 ? 457 PHE A CE2  1  
ATOM 741   C CZ   . PHE A 1 48 ? -1.295  0.469   4.202   1.00 10.00 ? 457 PHE A CZ   1  
ATOM 742   H H    . PHE A 1 48 ? 3.146   1.529   5.843   1.00 10.00 ? 457 PHE A H    1  
ATOM 743   H HA   . PHE A 1 48 ? 3.237   -0.135  8.221   1.00 10.00 ? 457 PHE A HA   1  
ATOM 744   H HB2  . PHE A 1 48 ? 0.893   0.137   8.370   1.00 10.00 ? 457 PHE A HB2  1  
ATOM 745   H HB3  . PHE A 1 48 ? 1.501   1.688   7.805   1.00 10.00 ? 457 PHE A HB3  1  
ATOM 746   H HD1  . PHE A 1 48 ? -0.092  -1.466  6.684   1.00 10.00 ? 457 PHE A HD1  1  
ATOM 747   H HD2  . PHE A 1 48 ? 0.725   2.629   5.809   1.00 10.00 ? 457 PHE A HD2  1  
ATOM 748   H HE1  . PHE A 1 48 ? -1.609  -1.577  4.756   1.00 10.00 ? 457 PHE A HE1  1  
ATOM 749   H HE2  . PHE A 1 48 ? -0.791  2.514   3.883   1.00 10.00 ? 457 PHE A HE2  1  
ATOM 750   H HZ   . PHE A 1 48 ? -1.963  0.430   3.360   1.00 10.00 ? 457 PHE A HZ   1  
ATOM 751   N N    . LEU A 1 49 ? 2.670   -1.342  5.265   1.00 10.00 ? 458 LEU A N    1  
ATOM 752   C CA   . LEU A 1 49 ? 2.558   -2.572  4.489   1.00 10.00 ? 458 LEU A CA   1  
ATOM 753   C C    . LEU A 1 49 ? 3.926   -2.988  3.954   1.00 10.00 ? 458 LEU A C    1  
ATOM 754   O O    . LEU A 1 49 ? 4.052   -3.408  2.808   1.00 10.00 ? 458 LEU A O    1  
ATOM 755   C CB   . LEU A 1 49 ? 1.559   -2.400  3.339   1.00 10.00 ? 458 LEU A CB   1  
ATOM 756   C CG   . LEU A 1 49 ? 1.475   -0.989  2.759   1.00 10.00 ? 458 LEU A CG   1  
ATOM 757   C CD1  . LEU A 1 49 ? 2.827   -0.571  2.210   1.00 10.00 ? 458 LEU A CD1  1  
ATOM 758   C CD2  . LEU A 1 49 ? 0.409   -0.913  1.673   1.00 10.00 ? 458 LEU A CD2  1  
ATOM 759   H H    . LEU A 1 49 ? 2.826   -0.496  4.797   1.00 10.00 ? 458 LEU A H    1  
ATOM 760   H HA   . LEU A 1 49 ? 2.200   -3.344  5.150   1.00 10.00 ? 458 LEU A HA   1  
ATOM 761   H HB2  . LEU A 1 49 ? 1.837   -3.077  2.545   1.00 10.00 ? 458 LEU A HB2  1  
ATOM 762   H HB3  . LEU A 1 49 ? 0.579   -2.676  3.697   1.00 10.00 ? 458 LEU A HB3  1  
ATOM 763   H HG   . LEU A 1 49 ? 1.206   -0.298  3.545   1.00 10.00 ? 458 LEU A HG   1  
ATOM 764   H HD11 . LEU A 1 49 ? 3.390   -1.450  1.933   1.00 10.00 ? 458 LEU A HD11 1  
ATOM 765   H HD12 . LEU A 1 49 ? 3.368   -0.020  2.964   1.00 10.00 ? 458 LEU A HD12 1  
ATOM 766   H HD13 . LEU A 1 49 ? 2.683   0.053   1.341   1.00 10.00 ? 458 LEU A HD13 1  
ATOM 767   H HD21 . LEU A 1 49 ? -0.510  -0.523  2.090   1.00 10.00 ? 458 LEU A HD21 1  
ATOM 768   H HD22 . LEU A 1 49 ? 0.230   -1.901  1.275   1.00 10.00 ? 458 LEU A HD22 1  
ATOM 769   H HD23 . LEU A 1 49 ? 0.747   -0.262  0.880   1.00 10.00 ? 458 LEU A HD23 1  
ATOM 770   N N    . GLU A 1 50 ? 4.936   -2.856  4.821   1.00 10.00 ? 459 GLU A N    1  
ATOM 771   C CA   . GLU A 1 50 ? 6.342   -3.195  4.529   1.00 10.00 ? 459 GLU A CA   1  
ATOM 772   C C    . GLU A 1 50 ? 6.577   -3.723  3.113   1.00 10.00 ? 459 GLU A C    1  
ATOM 773   O O    . GLU A 1 50 ? 7.273   -3.092  2.317   1.00 10.00 ? 459 GLU A O    1  
ATOM 774   C CB   . GLU A 1 50 ? 6.845   -4.225  5.542   1.00 10.00 ? 459 GLU A CB   1  
ATOM 775   C CG   . GLU A 1 50 ? 8.326   -4.540  5.405   1.00 10.00 ? 459 GLU A CG   1  
ATOM 776   C CD   . GLU A 1 50 ? 9.178   -3.783  6.405   1.00 10.00 ? 459 GLU A CD   1  
ATOM 777   O OE1  . GLU A 1 50 ? 9.099   -2.536  6.428   1.00 10.00 ? 459 GLU A OE1  1  
ATOM 778   O OE2  . GLU A 1 50 ? 9.924   -4.436  7.164   1.00 10.00 ? 459 GLU A OE2  1  
ATOM 779   H H    . GLU A 1 50 ? 4.726   -2.511  5.711   1.00 10.00 ? 459 GLU A H    1  
ATOM 780   H HA   . GLU A 1 50 ? 6.921   -2.293  4.653   1.00 10.00 ? 459 GLU A HA   1  
ATOM 781   H HB2  . GLU A 1 50 ? 6.670   -3.848  6.538   1.00 10.00 ? 459 GLU A HB2  1  
ATOM 782   H HB3  . GLU A 1 50 ? 6.291   -5.143  5.411   1.00 10.00 ? 459 GLU A HB3  1  
ATOM 783   H HG2  . GLU A 1 50 ? 8.472   -5.599  5.561   1.00 10.00 ? 459 GLU A HG2  1  
ATOM 784   H HG3  . GLU A 1 50 ? 8.646   -4.276  4.408   1.00 10.00 ? 459 GLU A HG3  1  
ATOM 785   N N    . ARG A 1 51 ? 6.006   -4.888  2.810   1.00 10.00 ? 460 ARG A N    1  
ATOM 786   C CA   . ARG A 1 51 ? 6.158   -5.515  1.496   1.00 10.00 ? 460 ARG A CA   1  
ATOM 787   C C    . ARG A 1 51 ? 6.066   -4.487  0.375   1.00 10.00 ? 460 ARG A C    1  
ATOM 788   O O    . ARG A 1 51 ? 6.668   -4.652  -0.687  1.00 10.00 ? 460 ARG A O    1  
ATOM 789   C CB   . ARG A 1 51 ? 5.094   -6.596  1.299   1.00 10.00 ? 460 ARG A CB   1  
ATOM 790   C CG   . ARG A 1 51 ? 5.510   -7.962  1.819   1.00 10.00 ? 460 ARG A CG   1  
ATOM 791   C CD   . ARG A 1 51 ? 5.850   -7.914  3.300   1.00 10.00 ? 460 ARG A CD   1  
ATOM 792   N NE   . ARG A 1 51 ? 6.232   -9.226  3.817   1.00 10.00 ? 460 ARG A NE   1  
ATOM 793   C CZ   . ARG A 1 51 ? 5.363   -10.193 4.101   1.00 10.00 ? 460 ARG A CZ   1  
ATOM 794   N NH1  . ARG A 1 51 ? 4.062   -10.000 3.920   1.00 10.00 ? 460 ARG A NH1  1  
ATOM 795   N NH2  . ARG A 1 51 ? 5.795   -11.357 4.566   1.00 10.00 ? 460 ARG A NH2  1  
ATOM 796   H H    . ARG A 1 51 ? 5.471   -5.340  3.488   1.00 10.00 ? 460 ARG A H    1  
ATOM 797   H HA   . ARG A 1 51 ? 7.134   -5.977  1.463   1.00 10.00 ? 460 ARG A HA   1  
ATOM 798   H HB2  . ARG A 1 51 ? 4.194   -6.297  1.816   1.00 10.00 ? 460 ARG A HB2  1  
ATOM 799   H HB3  . ARG A 1 51 ? 4.879   -6.686  0.245   1.00 10.00 ? 460 ARG A HB3  1  
ATOM 800   H HG2  . ARG A 1 51 ? 4.698   -8.657  1.669   1.00 10.00 ? 460 ARG A HG2  1  
ATOM 801   H HG3  . ARG A 1 51 ? 6.379   -8.296  1.270   1.00 10.00 ? 460 ARG A HG3  1  
ATOM 802   H HD2  . ARG A 1 51 ? 6.671   -7.228  3.446   1.00 10.00 ? 460 ARG A HD2  1  
ATOM 803   H HD3  . ARG A 1 51 ? 4.986   -7.561  3.843   1.00 10.00 ? 460 ARG A HD3  1  
ATOM 804   H HE   . ARG A 1 51 ? 7.187   -9.396  3.960   1.00 10.00 ? 460 ARG A HE   1  
ATOM 805   H HH11 . ARG A 1 51 ? 3.730   -9.125  3.569   1.00 10.00 ? 460 ARG A HH11 1  
ATOM 806   H HH12 . ARG A 1 51 ? 3.414   -10.730 4.135   1.00 10.00 ? 460 ARG A HH12 1  
ATOM 807   H HH21 . ARG A 1 51 ? 6.773   -11.508 4.704   1.00 10.00 ? 460 ARG A HH21 1  
ATOM 808   H HH22 . ARG A 1 51 ? 5.141   -12.084 4.780   1.00 10.00 ? 460 ARG A HH22 1  
ATOM 809   N N    . LYS A 1 52 ? 5.315   -3.423  0.623   1.00 10.00 ? 461 LYS A N    1  
ATOM 810   C CA   . LYS A 1 52 ? 5.148   -2.360  -0.362  1.00 10.00 ? 461 LYS A CA   1  
ATOM 811   C C    . LYS A 1 52 ? 5.919   -1.114  0.056   1.00 10.00 ? 461 LYS A C    1  
ATOM 812   O O    . LYS A 1 52 ? 5.463   -0.344  0.902   1.00 10.00 ? 461 LYS A O    1  
ATOM 813   C CB   . LYS A 1 52 ? 3.669   -2.005  -0.562  1.00 10.00 ? 461 LYS A CB   1  
ATOM 814   C CG   . LYS A 1 52 ? 2.690   -3.068  -0.084  1.00 10.00 ? 461 LYS A CG   1  
ATOM 815   C CD   . LYS A 1 52 ? 2.326   -4.021  -1.210  1.00 10.00 ? 461 LYS A CD   1  
ATOM 816   C CE   . LYS A 1 52 ? 2.938   -5.395  -1.001  1.00 10.00 ? 461 LYS A CE   1  
ATOM 817   N NZ   . LYS A 1 52 ? 2.374   -6.080  0.195   1.00 10.00 ? 461 LYS A NZ   1  
ATOM 818   H H    . LYS A 1 52 ? 4.864   -3.350  1.493   1.00 10.00 ? 461 LYS A H    1  
ATOM 819   H HA   . LYS A 1 52 ? 5.551   -2.716  -1.299  1.00 10.00 ? 461 LYS A HA   1  
ATOM 820   H HB2  . LYS A 1 52 ? 3.458   -1.091  -0.033  1.00 10.00 ? 461 LYS A HB2  1  
ATOM 821   H HB3  . LYS A 1 52 ? 3.498   -1.842  -1.615  1.00 10.00 ? 461 LYS A HB3  1  
ATOM 822   H HG2  . LYS A 1 52 ? 3.135   -3.627  0.725   1.00 10.00 ? 461 LYS A HG2  1  
ATOM 823   H HG3  . LYS A 1 52 ? 1.792   -2.581  0.266   1.00 10.00 ? 461 LYS A HG3  1  
ATOM 824   H HD2  . LYS A 1 52 ? 1.253   -4.120  -1.254  1.00 10.00 ? 461 LYS A HD2  1  
ATOM 825   H HD3  . LYS A 1 52 ? 2.691   -3.614  -2.143  1.00 10.00 ? 461 LYS A HD3  1  
ATOM 826   H HE2  . LYS A 1 52 ? 2.742   -5.997  -1.875  1.00 10.00 ? 461 LYS A HE2  1  
ATOM 827   H HE3  . LYS A 1 52 ? 4.005   -5.284  -0.874  1.00 10.00 ? 461 LYS A HE3  1  
ATOM 828   H HZ1  . LYS A 1 52 ? 1.351   -6.224  0.075   1.00 10.00 ? 461 LYS A HZ1  1  
ATOM 829   H HZ2  . LYS A 1 52 ? 2.534   -5.503  1.046   1.00 10.00 ? 461 LYS A HZ2  1  
ATOM 830   H HZ3  . LYS A 1 52 ? 2.831   -7.005  0.327   1.00 10.00 ? 461 LYS A HZ3  1  
ATOM 831   N N    . THR A 1 53 ? 7.084   -0.918  -0.546  1.00 10.00 ? 462 THR A N    1  
ATOM 832   C CA   . THR A 1 53 ? 7.915   0.240   -0.240  1.00 10.00 ? 462 THR A CA   1  
ATOM 833   C C    . THR A 1 53 ? 7.386   1.479   -0.952  1.00 10.00 ? 462 THR A C    1  
ATOM 834   O O    . THR A 1 53 ? 6.484   1.388   -1.783  1.00 10.00 ? 462 THR A O    1  
ATOM 835   C CB   . THR A 1 53 ? 9.368   -0.020  -0.647  1.00 10.00 ? 462 THR A CB   1  
ATOM 836   O OG1  . THR A 1 53 ? 9.581   -1.397  -0.904  1.00 10.00 ? 462 THR A OG1  1  
ATOM 837   C CG2  . THR A 1 53 ? 10.369  0.410   0.404   1.00 10.00 ? 462 THR A CG2  1  
ATOM 838   H H    . THR A 1 53 ? 7.390   -1.566  -1.215  1.00 10.00 ? 462 THR A H    1  
ATOM 839   H HA   . THR A 1 53 ? 7.873   0.406   0.827   1.00 10.00 ? 462 THR A HA   1  
ATOM 840   H HB   . THR A 1 53 ? 9.582   0.531   -1.552  1.00 10.00 ? 462 THR A HB   1  
ATOM 841   H HG1  . THR A 1 53 ? 9.574   -1.551  -1.851  1.00 10.00 ? 462 THR A HG1  1  
ATOM 842   H HG21 . THR A 1 53 ? 10.196  -0.144  1.314   1.00 10.00 ? 462 THR A HG21 1  
ATOM 843   H HG22 . THR A 1 53 ? 10.256  1.466   0.598   1.00 10.00 ? 462 THR A HG22 1  
ATOM 844   H HG23 . THR A 1 53 ? 11.370  0.215   0.048   1.00 10.00 ? 462 THR A HG23 1  
ATOM 845   N N    . VAL A 1 54 ? 7.951   2.637   -0.627  1.00 10.00 ? 463 VAL A N    1  
ATOM 846   C CA   . VAL A 1 54 ? 7.528   3.887   -1.245  1.00 10.00 ? 463 VAL A CA   1  
ATOM 847   C C    . VAL A 1 54 ? 7.734   3.840   -2.756  1.00 10.00 ? 463 VAL A C    1  
ATOM 848   O O    . VAL A 1 54 ? 6.797   4.051   -3.526  1.00 10.00 ? 463 VAL A O    1  
ATOM 849   C CB   . VAL A 1 54 ? 8.290   5.093   -0.656  1.00 10.00 ? 463 VAL A CB   1  
ATOM 850   C CG1  . VAL A 1 54 ? 7.935   6.376   -1.396  1.00 10.00 ? 463 VAL A CG1  1  
ATOM 851   C CG2  . VAL A 1 54 ? 7.995   5.232   0.831   1.00 10.00 ? 463 VAL A CG2  1  
ATOM 852   H H    . VAL A 1 54 ? 8.668   2.650   0.041   1.00 10.00 ? 463 VAL A H    1  
ATOM 853   H HA   . VAL A 1 54 ? 6.475   4.018   -1.041  1.00 10.00 ? 463 VAL A HA   1  
ATOM 854   H HB   . VAL A 1 54 ? 9.349   4.917   -0.775  1.00 10.00 ? 463 VAL A HB   1  
ATOM 855   H HG11 . VAL A 1 54 ? 8.187   7.227   -0.781  1.00 10.00 ? 463 VAL A HG11 1  
ATOM 856   H HG12 . VAL A 1 54 ? 6.877   6.386   -1.610  1.00 10.00 ? 463 VAL A HG12 1  
ATOM 857   H HG13 . VAL A 1 54 ? 8.491   6.423   -2.321  1.00 10.00 ? 463 VAL A HG13 1  
ATOM 858   H HG21 . VAL A 1 54 ? 8.501   6.104   1.219   1.00 10.00 ? 463 VAL A HG21 1  
ATOM 859   H HG22 . VAL A 1 54 ? 8.345   4.353   1.351   1.00 10.00 ? 463 VAL A HG22 1  
ATOM 860   H HG23 . VAL A 1 54 ? 6.930   5.339   0.980   1.00 10.00 ? 463 VAL A HG23 1  
ATOM 861   N N    . ALA A 1 55 ? 8.962   3.554   -3.173  1.00 10.00 ? 464 ALA A N    1  
ATOM 862   C CA   . ALA A 1 55 ? 9.284   3.471   -4.592  1.00 10.00 ? 464 ALA A CA   1  
ATOM 863   C C    . ALA A 1 55 ? 8.611   2.260   -5.231  1.00 10.00 ? 464 ALA A C    1  
ATOM 864   O O    . ALA A 1 55 ? 8.358   2.242   -6.436  1.00 10.00 ? 464 ALA A O    1  
ATOM 865   C CB   . ALA A 1 55 ? 10.791  3.407   -4.789  1.00 10.00 ? 464 ALA A CB   1  
ATOM 866   H H    . ALA A 1 55 ? 9.666   3.390   -2.512  1.00 10.00 ? 464 ALA A H    1  
ATOM 867   H HA   . ALA A 1 55 ? 8.918   4.368   -5.071  1.00 10.00 ? 464 ALA A HA   1  
ATOM 868   H HB1  . ALA A 1 55 ? 11.051  3.878   -5.726  1.00 10.00 ? 464 ALA A HB1  1  
ATOM 869   H HB2  . ALA A 1 55 ? 11.109  2.375   -4.803  1.00 10.00 ? 464 ALA A HB2  1  
ATOM 870   H HB3  . ALA A 1 55 ? 11.282  3.924   -3.978  1.00 10.00 ? 464 ALA A HB3  1  
ATOM 871   N N    . GLU A 1 56 ? 8.323   1.250   -4.415  1.00 10.00 ? 465 GLU A N    1  
ATOM 872   C CA   . GLU A 1 56 ? 7.678   0.035   -4.898  1.00 10.00 ? 465 GLU A CA   1  
ATOM 873   C C    . GLU A 1 56 ? 6.155   0.151   -4.835  1.00 10.00 ? 465 GLU A C    1  
ATOM 874   O O    . GLU A 1 56 ? 5.440   -0.705  -5.356  1.00 10.00 ? 465 GLU A O    1  
ATOM 875   C CB   . GLU A 1 56 ? 8.143   -1.172  -4.081  1.00 10.00 ? 465 GLU A CB   1  
ATOM 876   C CG   . GLU A 1 56 ? 7.538   -2.488  -4.541  1.00 10.00 ? 465 GLU A CG   1  
ATOM 877   C CD   . GLU A 1 56 ? 8.484   -3.659  -4.359  1.00 10.00 ? 465 GLU A CD   1  
ATOM 878   O OE1  . GLU A 1 56 ? 9.079   -3.777  -3.268  1.00 10.00 ? 465 GLU A OE1  1  
ATOM 879   O OE2  . GLU A 1 56 ? 8.628   -4.459  -5.308  1.00 10.00 ? 465 GLU A OE2  1  
ATOM 880   H H    . GLU A 1 56 ? 8.548   1.324   -3.464  1.00 10.00 ? 465 GLU A H    1  
ATOM 881   H HA   . GLU A 1 56 ? 7.972   -0.107  -5.927  1.00 10.00 ? 465 GLU A HA   1  
ATOM 882   H HB2  . GLU A 1 56 ? 9.217   -1.249  -4.154  1.00 10.00 ? 465 GLU A HB2  1  
ATOM 883   H HB3  . GLU A 1 56 ? 7.871   -1.017  -3.047  1.00 10.00 ? 465 GLU A HB3  1  
ATOM 884   H HG2  . GLU A 1 56 ? 6.642   -2.678  -3.969  1.00 10.00 ? 465 GLU A HG2  1  
ATOM 885   H HG3  . GLU A 1 56 ? 7.286   -2.407  -5.588  1.00 10.00 ? 465 GLU A HG3  1  
ATOM 886   N N    . CYS A 1 57 ? 5.660   1.213   -4.201  1.00 10.00 ? 466 CYS A N    1  
ATOM 887   C CA   . CYS A 1 57 ? 4.224   1.429   -4.087  1.00 10.00 ? 466 CYS A CA   1  
ATOM 888   C C    . CYS A 1 57 ? 3.667   1.991   -5.387  1.00 10.00 ? 466 CYS A C    1  
ATOM 889   O O    . CYS A 1 57 ? 2.487   1.826   -5.690  1.00 10.00 ? 466 CYS A O    1  
ATOM 890   C CB   . CYS A 1 57 ? 3.912   2.378   -2.928  1.00 10.00 ? 466 CYS A CB   1  
ATOM 891   S SG   . CYS A 1 57 ? 2.146   2.596   -2.611  1.00 10.00 ? 466 CYS A SG   1  
ATOM 892   H H    . CYS A 1 57 ? 6.272   1.869   -3.810  1.00 10.00 ? 466 CYS A H    1  
ATOM 893   H HA   . CYS A 1 57 ? 3.758   0.471   -3.896  1.00 10.00 ? 466 CYS A HA   1  
ATOM 894   H HB2  . CYS A 1 57 ? 4.361   1.992   -2.025  1.00 10.00 ? 466 CYS A HB2  1  
ATOM 895   H HB3  . CYS A 1 57 ? 4.331   3.350   -3.145  1.00 10.00 ? 466 CYS A HB3  1  
ATOM 896   H HG   . CYS A 1 57 ? 1.829   1.817   -2.148  1.00 10.00 ? 466 CYS A HG   1  
ATOM 897   N N    . VAL A 1 58 ? 4.530   2.638   -6.168  1.00 10.00 ? 467 VAL A N    1  
ATOM 898   C CA   . VAL A 1 58 ? 4.121   3.199   -7.450  1.00 10.00 ? 467 VAL A CA   1  
ATOM 899   C C    . VAL A 1 58 ? 3.379   2.150   -8.276  1.00 10.00 ? 467 VAL A C    1  
ATOM 900   O O    . VAL A 1 58 ? 2.572   2.480   -9.143  1.00 10.00 ? 467 VAL A O    1  
ATOM 901   C CB   . VAL A 1 58 ? 5.337   3.713   -8.248  1.00 10.00 ? 467 VAL A CB   1  
ATOM 902   C CG1  . VAL A 1 58 ? 6.307   2.578   -8.538  1.00 10.00 ? 467 VAL A CG1  1  
ATOM 903   C CG2  . VAL A 1 58 ? 4.888   4.383   -9.538  1.00 10.00 ? 467 VAL A CG2  1  
ATOM 904   H H    . VAL A 1 58 ? 5.463   2.726   -5.884  1.00 10.00 ? 467 VAL A H    1  
ATOM 905   H HA   . VAL A 1 58 ? 3.460   4.032   -7.257  1.00 10.00 ? 467 VAL A HA   1  
ATOM 906   H HB   . VAL A 1 58 ? 5.851   4.448   -7.647  1.00 10.00 ? 467 VAL A HB   1  
ATOM 907   H HG11 . VAL A 1 58 ? 7.304   2.977   -8.655  1.00 10.00 ? 467 VAL A HG11 1  
ATOM 908   H HG12 . VAL A 1 58 ? 6.012   2.075   -9.448  1.00 10.00 ? 467 VAL A HG12 1  
ATOM 909   H HG13 . VAL A 1 58 ? 6.295   1.875   -7.718  1.00 10.00 ? 467 VAL A HG13 1  
ATOM 910   H HG21 . VAL A 1 58 ? 4.218   3.724   -10.071 1.00 10.00 ? 467 VAL A HG21 1  
ATOM 911   H HG22 . VAL A 1 58 ? 5.750   4.595   -10.152 1.00 10.00 ? 467 VAL A HG22 1  
ATOM 912   H HG23 . VAL A 1 58 ? 4.376   5.305   -9.305  1.00 10.00 ? 467 VAL A HG23 1  
ATOM 913   N N    . LEU A 1 59 ? 3.660   0.881   -7.982  1.00 10.00 ? 468 LEU A N    1  
ATOM 914   C CA   . LEU A 1 59 ? 3.032   -0.240  -8.671  1.00 10.00 ? 468 LEU A CA   1  
ATOM 915   C C    . LEU A 1 59 ? 1.572   -0.421  -8.253  1.00 10.00 ? 468 LEU A C    1  
ATOM 916   O O    . LEU A 1 59 ? 0.909   -1.362  -8.679  1.00 10.00 ? 468 LEU A O    1  
ATOM 917   C CB   . LEU A 1 59 ? 3.813   -1.515  -8.374  1.00 10.00 ? 468 LEU A CB   1  
ATOM 918   C CG   . LEU A 1 59 ? 4.589   -2.094  -9.558  1.00 10.00 ? 468 LEU A CG   1  
ATOM 919   C CD1  . LEU A 1 59 ? 5.790   -1.222  -9.888  1.00 10.00 ? 468 LEU A CD1  1  
ATOM 920   C CD2  . LEU A 1 59 ? 5.030   -3.519  -9.259  1.00 10.00 ? 468 LEU A CD2  1  
ATOM 921   H H    . LEU A 1 59 ? 4.310   0.691   -7.277  1.00 10.00 ? 468 LEU A H    1  
ATOM 922   H HA   . LEU A 1 59 ? 3.069   -0.042  -9.729  1.00 10.00 ? 468 LEU A HA   1  
ATOM 923   H HB2  . LEU A 1 59 ? 4.514   -1.297  -7.579  1.00 10.00 ? 468 LEU A HB2  1  
ATOM 924   H HB3  . LEU A 1 59 ? 3.119   -2.263  -8.024  1.00 10.00 ? 468 LEU A HB3  1  
ATOM 925   H HG   . LEU A 1 59 ? 3.945   -2.117  -10.425 1.00 10.00 ? 468 LEU A HG   1  
ATOM 926   H HD11 . LEU A 1 59 ? 6.522   -1.303  -9.098  1.00 10.00 ? 468 LEU A HD11 1  
ATOM 927   H HD12 . LEU A 1 59 ? 5.473   -0.193  -9.980  1.00 10.00 ? 468 LEU A HD12 1  
ATOM 928   H HD13 . LEU A 1 59 ? 6.227   -1.548  -10.820 1.00 10.00 ? 468 LEU A HD13 1  
ATOM 929   H HD21 . LEU A 1 59 ? 5.318   -3.597  -8.221  1.00 10.00 ? 468 LEU A HD21 1  
ATOM 930   H HD22 . LEU A 1 59 ? 5.871   -3.775  -9.886  1.00 10.00 ? 468 LEU A HD22 1  
ATOM 931   H HD23 . LEU A 1 59 ? 4.213   -4.198  -9.458  1.00 10.00 ? 468 LEU A HD23 1  
ATOM 932   N N    . TYR A 1 60 ? 1.079   0.477   -7.416  1.00 10.00 ? 469 TYR A N    1  
ATOM 933   C CA   . TYR A 1 60 ? -0.298  0.414   -6.949  1.00 10.00 ? 469 TYR A CA   1  
ATOM 934   C C    . TYR A 1 60 ? -1.154  1.447   -7.680  1.00 10.00 ? 469 TYR A C    1  
ATOM 935   O O    . TYR A 1 60 ? -2.338  1.226   -7.929  1.00 10.00 ? 469 TYR A O    1  
ATOM 936   C CB   . TYR A 1 60 ? -0.355  0.665   -5.430  1.00 10.00 ? 469 TYR A CB   1  
ATOM 937   C CG   . TYR A 1 60 ? -1.589  1.408   -4.975  1.00 10.00 ? 469 TYR A CG   1  
ATOM 938   C CD1  . TYR A 1 60 ? -1.682  2.775   -5.171  1.00 10.00 ? 469 TYR A CD1  1  
ATOM 939   C CD2  . TYR A 1 60 ? -2.662  0.752   -4.372  1.00 10.00 ? 469 TYR A CD2  1  
ATOM 940   C CE1  . TYR A 1 60 ? -2.795  3.481   -4.789  1.00 10.00 ? 469 TYR A CE1  1  
ATOM 941   C CE2  . TYR A 1 60 ? -3.787  1.459   -3.980  1.00 10.00 ? 469 TYR A CE2  1  
ATOM 942   C CZ   . TYR A 1 60 ? -3.847  2.823   -4.194  1.00 10.00 ? 469 TYR A CZ   1  
ATOM 943   O OH   . TYR A 1 60 ? -4.962  3.530   -3.817  1.00 10.00 ? 469 TYR A OH   1  
ATOM 944   H H    . TYR A 1 60 ? 1.653   1.196   -7.103  1.00 10.00 ? 469 TYR A H    1  
ATOM 945   H HA   . TYR A 1 60 ? -0.680  -0.573  -7.160  1.00 10.00 ? 469 TYR A HA   1  
ATOM 946   H HB2  . TYR A 1 60 ? -0.331  -0.270  -4.914  1.00 10.00 ? 469 TYR A HB2  1  
ATOM 947   H HB3  . TYR A 1 60 ? 0.504   1.249   -5.139  1.00 10.00 ? 469 TYR A HB3  1  
ATOM 948   H HD1  . TYR A 1 60 ? -0.859  3.290   -5.635  1.00 10.00 ? 469 TYR A HD1  1  
ATOM 949   H HD2  . TYR A 1 60 ? -2.609  -0.325  -4.198  1.00 10.00 ? 469 TYR A HD2  1  
ATOM 950   H HE1  . TYR A 1 60 ? -2.836  4.545   -4.957  1.00 10.00 ? 469 TYR A HE1  1  
ATOM 951   H HE2  . TYR A 1 60 ? -4.612  0.943   -3.513  1.00 10.00 ? 469 TYR A HE2  1  
ATOM 952   H HH   . TYR A 1 60 ? -5.254  4.081   -4.546  1.00 10.00 ? 469 TYR A HH   1  
ATOM 953   N N    . TYR A 1 61 ? -0.548  2.590   -7.985  1.00 10.00 ? 470 TYR A N    1  
ATOM 954   C CA   . TYR A 1 61 ? -1.255  3.685   -8.646  1.00 10.00 ? 470 TYR A CA   1  
ATOM 955   C C    . TYR A 1 61 ? -1.399  3.477   -10.157 1.00 10.00 ? 470 TYR A C    1  
ATOM 956   O O    . TYR A 1 61 ? -2.488  3.646   -10.704 1.00 10.00 ? 470 TYR A O    1  
ATOM 957   C CB   . TYR A 1 61 ? -0.551  5.019   -8.348  1.00 10.00 ? 470 TYR A CB   1  
ATOM 958   C CG   . TYR A 1 61 ? 0.204   5.608   -9.521  1.00 10.00 ? 470 TYR A CG   1  
ATOM 959   C CD1  . TYR A 1 61 ? -0.424  6.469   -10.412 1.00 10.00 ? 470 TYR A CD1  1  
ATOM 960   C CD2  . TYR A 1 61 ? 1.540   5.302   -9.736  1.00 10.00 ? 470 TYR A CD2  1  
ATOM 961   C CE1  . TYR A 1 61 ? 0.260   7.007   -11.485 1.00 10.00 ? 470 TYR A CE1  1  
ATOM 962   C CE2  . TYR A 1 61 ? 2.231   5.836   -10.806 1.00 10.00 ? 470 TYR A CE2  1  
ATOM 963   C CZ   . TYR A 1 61 ? 1.587   6.688   -11.678 1.00 10.00 ? 470 TYR A CZ   1  
ATOM 964   O OH   . TYR A 1 61 ? 2.272   7.221   -12.746 1.00 10.00 ? 470 TYR A OH   1  
ATOM 965   H H    . TYR A 1 61 ? 0.393   2.711   -7.732  1.00 10.00 ? 470 TYR A H    1  
ATOM 966   H HA   . TYR A 1 61 ? -2.246  3.725   -8.220  1.00 10.00 ? 470 TYR A HA   1  
ATOM 967   H HB2  . TYR A 1 61 ? -1.290  5.742   -8.037  1.00 10.00 ? 470 TYR A HB2  1  
ATOM 968   H HB3  . TYR A 1 61 ? 0.154   4.869   -7.542  1.00 10.00 ? 470 TYR A HB3  1  
ATOM 969   H HD1  . TYR A 1 61 ? -1.464  6.718   -10.258 1.00 10.00 ? 470 TYR A HD1  1  
ATOM 970   H HD2  . TYR A 1 61 ? 2.042   4.635   -9.051  1.00 10.00 ? 470 TYR A HD2  1  
ATOM 971   H HE1  . TYR A 1 61 ? -0.246  7.675   -12.167 1.00 10.00 ? 470 TYR A HE1  1  
ATOM 972   H HE2  . TYR A 1 61 ? 3.269   5.584   -10.957 1.00 10.00 ? 470 TYR A HE2  1  
ATOM 973   H HH   . TYR A 1 61 ? 2.336   6.567   -13.445 1.00 10.00 ? 470 TYR A HH   1  
ATOM 974   N N    . TYR A 1 62 ? -0.306  3.140   -10.838 1.00 10.00 ? 471 TYR A N    1  
ATOM 975   C CA   . TYR A 1 62 ? -0.360  2.952   -12.287 1.00 10.00 ? 471 TYR A CA   1  
ATOM 976   C C    . TYR A 1 62 ? -1.070  1.654   -12.669 1.00 10.00 ? 471 TYR A C    1  
ATOM 977   O O    . TYR A 1 62 ? -1.312  1.399   -13.848 1.00 10.00 ? 471 TYR A O    1  
ATOM 978   C CB   . TYR A 1 62 ? 1.047   3.026   -12.902 1.00 10.00 ? 471 TYR A CB   1  
ATOM 979   C CG   . TYR A 1 62 ? 1.765   1.697   -13.020 1.00 10.00 ? 471 TYR A CG   1  
ATOM 980   C CD1  . TYR A 1 62 ? 1.550   0.862   -14.110 1.00 10.00 ? 471 TYR A CD1  1  
ATOM 981   C CD2  . TYR A 1 62 ? 2.666   1.287   -12.048 1.00 10.00 ? 471 TYR A CD2  1  
ATOM 982   C CE1  . TYR A 1 62 ? 2.213   -0.346  -14.225 1.00 10.00 ? 471 TYR A CE1  1  
ATOM 983   C CE2  . TYR A 1 62 ? 3.331   0.082   -12.154 1.00 10.00 ? 471 TYR A CE2  1  
ATOM 984   C CZ   . TYR A 1 62 ? 3.101   -0.732  -13.243 1.00 10.00 ? 471 TYR A CZ   1  
ATOM 985   O OH   . TYR A 1 62 ? 3.764   -1.933  -13.353 1.00 10.00 ? 471 TYR A OH   1  
ATOM 986   H H    . TYR A 1 62 ? 0.548   3.033   -10.366 1.00 10.00 ? 471 TYR A H    1  
ATOM 987   H HA   . TYR A 1 62 ? -0.947  3.770   -12.684 1.00 10.00 ? 471 TYR A HA   1  
ATOM 988   H HB2  . TYR A 1 62 ? 0.972   3.443   -13.894 1.00 10.00 ? 471 TYR A HB2  1  
ATOM 989   H HB3  . TYR A 1 62 ? 1.658   3.677   -12.294 1.00 10.00 ? 471 TYR A HB3  1  
ATOM 990   H HD1  . TYR A 1 62 ? 0.852   1.167   -14.876 1.00 10.00 ? 471 TYR A HD1  1  
ATOM 991   H HD2  . TYR A 1 62 ? 2.844   1.925   -11.197 1.00 10.00 ? 471 TYR A HD2  1  
ATOM 992   H HE1  . TYR A 1 62 ? 2.032   -0.981  -15.079 1.00 10.00 ? 471 TYR A HE1  1  
ATOM 993   H HE2  . TYR A 1 62 ? 4.025   -0.219  -11.382 1.00 10.00 ? 471 TYR A HE2  1  
ATOM 994   H HH   . TYR A 1 62 ? 4.710   -1.774  -13.398 1.00 10.00 ? 471 TYR A HH   1  
ATOM 995   N N    . LEU A 1 63 ? -1.429  0.852   -11.673 1.00 10.00 ? 472 LEU A N    1  
ATOM 996   C CA   . LEU A 1 63 ? -2.141  -0.394  -11.921 1.00 10.00 ? 472 LEU A CA   1  
ATOM 997   C C    . LEU A 1 63 ? -3.637  -0.159  -11.793 1.00 10.00 ? 472 LEU A C    1  
ATOM 998   O O    . LEU A 1 63 ? -4.441  -0.745  -12.518 1.00 10.00 ? 472 LEU A O    1  
ATOM 999   C CB   . LEU A 1 63 ? -1.689  -1.472  -10.940 1.00 10.00 ? 472 LEU A CB   1  
ATOM 1000  C CG   . LEU A 1 63 ? -0.353  -2.115  -11.288 1.00 10.00 ? 472 LEU A CG   1  
ATOM 1001  C CD1  . LEU A 1 63 ? 0.754   -1.073  -11.269 1.00 10.00 ? 472 LEU A CD1  1  
ATOM 1002  C CD2  . LEU A 1 63 ? -0.041  -3.257  -10.333 1.00 10.00 ? 472 LEU A CD2  1  
ATOM 1003  H H    . LEU A 1 63 ? -1.230  1.111   -10.750 1.00 10.00 ? 472 LEU A H    1  
ATOM 1004  H HA   . LEU A 1 63 ? -1.919  -0.712  -12.929 1.00 10.00 ? 472 LEU A HA   1  
ATOM 1005  H HB2  . LEU A 1 63 ? -1.612  -1.029  -9.958  1.00 10.00 ? 472 LEU A HB2  1  
ATOM 1006  H HB3  . LEU A 1 63 ? -2.441  -2.246  -10.912 1.00 10.00 ? 472 LEU A HB3  1  
ATOM 1007  H HG   . LEU A 1 63 ? -0.412  -2.517  -12.286 1.00 10.00 ? 472 LEU A HG   1  
ATOM 1008  H HD11 . LEU A 1 63 ? 0.532   -0.323  -10.523 1.00 10.00 ? 472 LEU A HD11 1  
ATOM 1009  H HD12 . LEU A 1 63 ? 0.822   -0.605  -12.238 1.00 10.00 ? 472 LEU A HD12 1  
ATOM 1010  H HD13 . LEU A 1 63 ? 1.694   -1.550  -11.031 1.00 10.00 ? 472 LEU A HD13 1  
ATOM 1011  H HD21 . LEU A 1 63 ? 1.029   -3.393  -10.271 1.00 10.00 ? 472 LEU A HD21 1  
ATOM 1012  H HD22 . LEU A 1 63 ? -0.499  -4.166  -10.696 1.00 10.00 ? 472 LEU A HD22 1  
ATOM 1013  H HD23 . LEU A 1 63 ? -0.431  -3.024  -9.353  1.00 10.00 ? 472 LEU A HD23 1  
ATOM 1014  N N    . THR A 1 64 ? -3.992  0.722   -10.868 1.00 10.00 ? 473 THR A N    1  
ATOM 1015  C CA   . THR A 1 64 ? -5.384  1.075   -10.630 1.00 10.00 ? 473 THR A CA   1  
ATOM 1016  C C    . THR A 1 64 ? -6.006  1.677   -11.880 1.00 10.00 ? 473 THR A C    1  
ATOM 1017  O O    . THR A 1 64 ? -7.172  1.427   -12.185 1.00 10.00 ? 473 THR A O    1  
ATOM 1018  C CB   . THR A 1 64 ? -5.487  2.066   -9.470  1.00 10.00 ? 473 THR A CB   1  
ATOM 1019  O OG1  . THR A 1 64 ? -4.685  3.207   -9.717  1.00 10.00 ? 473 THR A OG1  1  
ATOM 1020  C CG2  . THR A 1 64 ? -5.057  1.485   -8.140  1.00 10.00 ? 473 THR A CG2  1  
ATOM 1021  H H    . THR A 1 64 ? -3.293  1.155   -10.337 1.00 10.00 ? 473 THR A H    1  
ATOM 1022  H HA   . THR A 1 64 ? -5.922  0.180   -10.375 1.00 10.00 ? 473 THR A HA   1  
ATOM 1023  H HB   . THR A 1 64 ? -6.514  2.388   -9.375  1.00 10.00 ? 473 THR A HB   1  
ATOM 1024  H HG1  . THR A 1 64 ? -4.770  3.822   -8.985  1.00 10.00 ? 473 THR A HG1  1  
ATOM 1025  H HG21 . THR A 1 64 ? -4.344  2.147   -7.671  1.00 10.00 ? 473 THR A HG21 1  
ATOM 1026  H HG22 . THR A 1 64 ? -4.601  0.519   -8.299  1.00 10.00 ? 473 THR A HG22 1  
ATOM 1027  H HG23 . THR A 1 64 ? -5.920  1.375   -7.501  1.00 10.00 ? 473 THR A HG23 1  
ATOM 1028  N N    . LYS A 1 65 ? -5.228  2.479   -12.598 1.00 10.00 ? 474 LYS A N    1  
ATOM 1029  C CA   . LYS A 1 65 ? -5.722  3.119   -13.810 1.00 10.00 ? 474 LYS A CA   1  
ATOM 1030  C C    . LYS A 1 65 ? -5.275  2.362   -15.057 1.00 10.00 ? 474 LYS A C    1  
ATOM 1031  O O    . LYS A 1 65 ? -5.343  2.885   -16.169 1.00 10.00 ? 474 LYS A O    1  
ATOM 1032  C CB   . LYS A 1 65 ? -5.262  4.580   -13.886 1.00 10.00 ? 474 LYS A CB   1  
ATOM 1033  C CG   . LYS A 1 65 ? -4.994  5.232   -12.534 1.00 10.00 ? 474 LYS A CG   1  
ATOM 1034  C CD   . LYS A 1 65 ? -3.722  6.065   -12.560 1.00 10.00 ? 474 LYS A CD   1  
ATOM 1035  C CE   . LYS A 1 65 ? -3.790  7.215   -11.567 1.00 10.00 ? 474 LYS A CE   1  
ATOM 1036  N NZ   . LYS A 1 65 ? -4.740  8.273   -12.006 1.00 10.00 ? 474 LYS A NZ   1  
ATOM 1037  H H    . LYS A 1 65 ? -4.304  2.649   -12.306 1.00 10.00 ? 474 LYS A H    1  
ATOM 1038  H HA   . LYS A 1 65 ? -6.804  3.095   -13.772 1.00 10.00 ? 474 LYS A HA   1  
ATOM 1039  H HB2  . LYS A 1 65 ? -4.356  4.628   -14.468 1.00 10.00 ? 474 LYS A HB2  1  
ATOM 1040  H HB3  . LYS A 1 65 ? -6.029  5.153   -14.385 1.00 10.00 ? 474 LYS A HB3  1  
ATOM 1041  H HG2  . LYS A 1 65 ? -5.825  5.873   -12.284 1.00 10.00 ? 474 LYS A HG2  1  
ATOM 1042  H HG3  . LYS A 1 65 ? -4.893  4.464   -11.782 1.00 10.00 ? 474 LYS A HG3  1  
ATOM 1043  H HD2  . LYS A 1 65 ? -2.884  5.434   -12.307 1.00 10.00 ? 474 LYS A HD2  1  
ATOM 1044  H HD3  . LYS A 1 65 ? -3.587  6.467   -13.553 1.00 10.00 ? 474 LYS A HD3  1  
ATOM 1045  H HE2  . LYS A 1 65 ? -4.111  6.829   -10.611 1.00 10.00 ? 474 LYS A HE2  1  
ATOM 1046  H HE3  . LYS A 1 65 ? -2.804  7.645   -11.468 1.00 10.00 ? 474 LYS A HE3  1  
ATOM 1047  H HZ1  . LYS A 1 65 ? -5.192  8.714   -11.180 1.00 10.00 ? 474 LYS A HZ1  1  
ATOM 1048  H HZ2  . LYS A 1 65 ? -5.478  7.863   -12.613 1.00 10.00 ? 474 LYS A HZ2  1  
ATOM 1049  H HZ3  . LYS A 1 65 ? -4.234  9.007   -12.543 1.00 10.00 ? 474 LYS A HZ3  1  
ATOM 1050  N N    . LYS A 1 66 ? -4.841  1.118   -14.869 1.00 10.00 ? 475 LYS A N    1  
ATOM 1051  C CA   . LYS A 1 66 ? -4.413  0.283   -15.983 1.00 10.00 ? 475 LYS A CA   1  
ATOM 1052  C C    . LYS A 1 66 ? -5.549  -0.647  -16.388 1.00 10.00 ? 475 LYS A C    1  
ATOM 1053  O O    . LYS A 1 66 ? -5.326  -1.790  -16.788 1.00 10.00 ? 475 LYS A O    1  
ATOM 1054  C CB   . LYS A 1 66 ? -3.175  -0.531  -15.602 1.00 10.00 ? 475 LYS A CB   1  
ATOM 1055  C CG   . LYS A 1 66 ? -2.628  -1.378  -16.739 1.00 10.00 ? 475 LYS A CG   1  
ATOM 1056  C CD   . LYS A 1 66 ? -1.119  -1.532  -16.643 1.00 10.00 ? 475 LYS A CD   1  
ATOM 1057  C CE   . LYS A 1 66 ? -0.466  -1.485  -18.015 1.00 10.00 ? 475 LYS A CE   1  
ATOM 1058  N NZ   . LYS A 1 66 ? -0.948  -2.581  -18.899 1.00 10.00 ? 475 LYS A NZ   1  
ATOM 1059  H H    . LYS A 1 66 ? -4.827  0.747   -13.963 1.00 10.00 ? 475 LYS A H    1  
ATOM 1060  H HA   . LYS A 1 66 ? -4.173  0.929   -16.815 1.00 10.00 ? 475 LYS A HA   1  
ATOM 1061  H HB2  . LYS A 1 66 ? -2.398  0.146   -15.282 1.00 10.00 ? 475 LYS A HB2  1  
ATOM 1062  H HB3  . LYS A 1 66 ? -3.428  -1.188  -14.782 1.00 10.00 ? 475 LYS A HB3  1  
ATOM 1063  H HG2  . LYS A 1 66 ? -3.083  -2.356  -16.698 1.00 10.00 ? 475 LYS A HG2  1  
ATOM 1064  H HG3  . LYS A 1 66 ? -2.874  -0.904  -17.678 1.00 10.00 ? 475 LYS A HG3  1  
ATOM 1065  H HD2  . LYS A 1 66 ? -0.722  -0.730  -16.039 1.00 10.00 ? 475 LYS A HD2  1  
ATOM 1066  H HD3  . LYS A 1 66 ? -0.893  -2.481  -16.179 1.00 10.00 ? 475 LYS A HD3  1  
ATOM 1067  H HE2  . LYS A 1 66 ? -0.695  -0.536  -18.476 1.00 10.00 ? 475 LYS A HE2  1  
ATOM 1068  H HE3  . LYS A 1 66 ? 0.604   -1.576  -17.893 1.00 10.00 ? 475 LYS A HE3  1  
ATOM 1069  H HZ1  . LYS A 1 66 ? -0.975  -2.258  -19.887 1.00 10.00 ? 475 LYS A HZ1  1  
ATOM 1070  H HZ2  . LYS A 1 66 ? -1.905  -2.874  -18.616 1.00 10.00 ? 475 LYS A HZ2  1  
ATOM 1071  H HZ3  . LYS A 1 66 ? -0.313  -3.402  -18.830 1.00 10.00 ? 475 LYS A HZ3  1  
ATOM 1072  N N    . ASN A 1 67 ? -6.772  -0.142  -16.266 1.00 10.00 ? 476 ASN A N    1  
ATOM 1073  C CA   . ASN A 1 67 ? -7.962  -0.910  -16.601 1.00 10.00 ? 476 ASN A CA   1  
ATOM 1074  C C    . ASN A 1 67 ? -9.221  -0.064  -16.420 1.00 10.00 ? 476 ASN A C    1  
ATOM 1075  O O    . ASN A 1 67 ? -10.217 -0.265  -17.114 1.00 10.00 ? 476 ASN A O    1  
ATOM 1076  C CB   . ASN A 1 67 ? -8.045  -2.162  -15.725 1.00 10.00 ? 476 ASN A CB   1  
ATOM 1077  C CG   . ASN A 1 67 ? -9.236  -3.033  -16.072 1.00 10.00 ? 476 ASN A CG   1  
ATOM 1078  O OD1  . ASN A 1 67 ? -10.280 -2.965  -15.423 1.00 10.00 ? 476 ASN A OD1  1  
ATOM 1079  N ND2  . ASN A 1 67 ? -9.086  -3.860  -17.100 1.00 10.00 ? 476 ASN A ND2  1  
ATOM 1080  H H    . ASN A 1 67 ? -6.875  0.772   -15.937 1.00 10.00 ? 476 ASN A H    1  
ATOM 1081  H HA   . ASN A 1 67 ? -7.886  -1.208  -17.636 1.00 10.00 ? 476 ASN A HA   1  
ATOM 1082  H HB2  . ASN A 1 67 ? -7.146  -2.745  -15.856 1.00 10.00 ? 476 ASN A HB2  1  
ATOM 1083  H HB3  . ASN A 1 67 ? -8.128  -1.864  -14.689 1.00 10.00 ? 476 ASN A HB3  1  
ATOM 1084  H HD21 . ASN A 1 67 ? -8.226  -3.861  -17.571 1.00 10.00 ? 476 ASN A HD21 1  
ATOM 1085  H HD22 . ASN A 1 67 ? -9.840  -4.435  -17.346 1.00 10.00 ? 476 ASN A HD22 1  
ATOM 1086  N N    . GLU A 1 68 ? -9.173  0.884   -15.483 1.00 10.00 ? 477 GLU A N    1  
ATOM 1087  C CA   . GLU A 1 68 ? -10.315 1.751   -15.221 1.00 10.00 ? 477 GLU A CA   1  
ATOM 1088  C C    . GLU A 1 68 ? -10.131 3.112   -15.885 1.00 10.00 ? 477 GLU A C    1  
ATOM 1089  O O    . GLU A 1 68 ? -11.103 3.762   -16.269 1.00 10.00 ? 477 GLU A O    1  
ATOM 1090  C CB   . GLU A 1 68 ? -10.512 1.929   -13.714 1.00 10.00 ? 477 GLU A CB   1  
ATOM 1091  C CG   . GLU A 1 68 ? -11.937 2.286   -13.325 1.00 10.00 ? 477 GLU A CG   1  
ATOM 1092  C CD   . GLU A 1 68 ? -12.770 1.067   -12.979 1.00 10.00 ? 477 GLU A CD   1  
ATOM 1093  O OE1  . GLU A 1 68 ? -12.193 0.074   -12.489 1.00 10.00 ? 477 GLU A OE1  1  
ATOM 1094  O OE2  . GLU A 1 68 ? -13.999 1.107   -13.198 1.00 10.00 ? 477 GLU A OE2  1  
ATOM 1095  H H    . GLU A 1 68 ? -8.353  1.003   -14.956 1.00 10.00 ? 477 GLU A H    1  
ATOM 1096  H HA   . GLU A 1 68 ? -11.192 1.278   -15.636 1.00 10.00 ? 477 GLU A HA   1  
ATOM 1097  H HB2  . GLU A 1 68 ? -10.246 1.008   -13.217 1.00 10.00 ? 477 GLU A HB2  1  
ATOM 1098  H HB3  . GLU A 1 68 ? -9.859  2.716   -13.368 1.00 10.00 ? 477 GLU A HB3  1  
ATOM 1099  H HG2  . GLU A 1 68 ? -11.909 2.939   -12.465 1.00 10.00 ? 477 GLU A HG2  1  
ATOM 1100  H HG3  . GLU A 1 68 ? -12.404 2.801   -14.152 1.00 10.00 ? 477 GLU A HG3  1  
ATOM 1101  N N    . ASN A 1 69 ? -8.878  3.539   -16.015 1.00 10.00 ? 478 ASN A N    1  
ATOM 1102  C CA   . ASN A 1 69 ? -8.570  4.824   -16.631 1.00 10.00 ? 478 ASN A CA   1  
ATOM 1103  C C    . ASN A 1 69 ? -9.262  5.961   -15.885 1.00 10.00 ? 478 ASN A C    1  
ATOM 1104  O O    . ASN A 1 69 ? -9.951  6.786   -16.485 1.00 10.00 ? 478 ASN A O    1  
ATOM 1105  C CB   . ASN A 1 69 ? -8.996  4.825   -18.101 1.00 10.00 ? 478 ASN A CB   1  
ATOM 1106  C CG   . ASN A 1 69 ? -8.197  3.843   -18.935 1.00 10.00 ? 478 ASN A CG   1  
ATOM 1107  O OD1  . ASN A 1 69 ? -7.384  4.237   -19.771 1.00 10.00 ? 478 ASN A OD1  1  
ATOM 1108  N ND2  . ASN A 1 69 ? -8.426  2.554   -18.712 1.00 10.00 ? 478 ASN A ND2  1  
ATOM 1109  H H    . ASN A 1 69 ? -8.145  2.977   -15.689 1.00 10.00 ? 478 ASN A H    1  
ATOM 1110  H HA   . ASN A 1 69 ? -7.501  4.971   -16.575 1.00 10.00 ? 478 ASN A HA   1  
ATOM 1111  H HB2  . ASN A 1 69 ? -10.040 4.558   -18.167 1.00 10.00 ? 478 ASN A HB2  1  
ATOM 1112  H HB3  . ASN A 1 69 ? -8.856  5.815   -18.510 1.00 10.00 ? 478 ASN A HB3  1  
ATOM 1113  H HD21 . ASN A 1 69 ? -9.089  2.312   -18.031 1.00 10.00 ? 478 ASN A HD21 1  
ATOM 1114  H HD22 . ASN A 1 69 ? -7.924  1.897   -19.238 1.00 10.00 ? 478 ASN A HD22 1  
ATOM 1115  N N    . TYR A 1 70 ? -9.076  5.994   -14.569 1.00 10.00 ? 479 TYR A N    1  
ATOM 1116  C CA   . TYR A 1 70 ? -9.684  7.024   -13.736 1.00 10.00 ? 479 TYR A CA   1  
ATOM 1117  C C    . TYR A 1 70 ? -8.696  8.151   -13.453 1.00 10.00 ? 479 TYR A C    1  
ATOM 1118  O O    . TYR A 1 70 ? -8.675  8.712   -12.358 1.00 10.00 ? 479 TYR A O    1  
ATOM 1119  C CB   . TYR A 1 70 ? -10.181 6.415   -12.421 1.00 10.00 ? 479 TYR A CB   1  
ATOM 1120  C CG   . TYR A 1 70 ? -9.069  6.045   -11.463 1.00 10.00 ? 479 TYR A CG   1  
ATOM 1121  C CD1  . TYR A 1 70 ? -8.323  4.886   -11.645 1.00 10.00 ? 479 TYR A CD1  1  
ATOM 1122  C CD2  . TYR A 1 70 ? -8.764  6.858   -10.380 1.00 10.00 ? 479 TYR A CD2  1  
ATOM 1123  C CE1  . TYR A 1 70 ? -7.304  4.550   -10.773 1.00 10.00 ? 479 TYR A CE1  1  
ATOM 1124  C CE2  . TYR A 1 70 ? -7.747  6.530   -9.506  1.00 10.00 ? 479 TYR A CE2  1  
ATOM 1125  C CZ   . TYR A 1 70 ? -7.020  5.376   -9.705  1.00 10.00 ? 479 TYR A CZ   1  
ATOM 1126  O OH   . TYR A 1 70 ? -6.008  5.048   -8.833  1.00 10.00 ? 479 TYR A OH   1  
ATOM 1127  H H    . TYR A 1 70 ? -8.519  5.307   -14.149 1.00 10.00 ? 479 TYR A H    1  
ATOM 1128  H HA   . TYR A 1 70 ? -10.525 7.430   -14.276 1.00 10.00 ? 479 TYR A HA   1  
ATOM 1129  H HB2  . TYR A 1 70 ? -10.823 7.126   -11.924 1.00 10.00 ? 479 TYR A HB2  1  
ATOM 1130  H HB3  . TYR A 1 70 ? -10.745 5.520   -12.639 1.00 10.00 ? 479 TYR A HB3  1  
ATOM 1131  H HD1  . TYR A 1 70 ? -8.548  4.242   -12.482 1.00 10.00 ? 479 TYR A HD1  1  
ATOM 1132  H HD2  . TYR A 1 70 ? -9.334  7.762   -10.225 1.00 10.00 ? 479 TYR A HD2  1  
ATOM 1133  H HE1  . TYR A 1 70 ? -6.733  3.645   -10.932 1.00 10.00 ? 479 TYR A HE1  1  
ATOM 1134  H HE2  . TYR A 1 70 ? -7.525  7.177   -8.671  1.00 10.00 ? 479 TYR A HE2  1  
ATOM 1135  H HH   . TYR A 1 70 ? -6.305  5.186   -7.931  1.00 10.00 ? 479 TYR A HH   1  
ATOM 1136  N N    . LYS A 1 71 ? -7.879  8.475   -14.446 1.00 10.00 ? 480 LYS A N    1  
ATOM 1137  C CA   . LYS A 1 71 ? -6.888  9.534   -14.302 1.00 10.00 ? 480 LYS A CA   1  
ATOM 1138  C C    . LYS A 1 71 ? -7.532  10.908  -14.454 1.00 10.00 ? 480 LYS A C    1  
ATOM 1139  O O    . LYS A 1 71 ? -7.098  11.846  -13.752 1.00 10.00 ? 480 LYS A O    1  
ATOM 1140  C CB   . LYS A 1 71 ? -5.773  9.362   -15.336 1.00 10.00 ? 480 LYS A CB   1  
ATOM 1141  C CG   . LYS A 1 71 ? -6.249  9.504   -16.772 1.00 10.00 ? 480 LYS A CG   1  
ATOM 1142  C CD   . LYS A 1 71 ? -5.208  8.996   -17.757 1.00 10.00 ? 480 LYS A CD   1  
ATOM 1143  C CE   . LYS A 1 71 ? -5.802  8.797   -19.142 1.00 10.00 ? 480 LYS A CE   1  
ATOM 1144  N NZ   . LYS A 1 71 ? -6.804  7.696   -19.164 1.00 10.00 ? 480 LYS A NZ   1  
ATOM 1145  O OXT  . LYS A 1 71 ? -8.465  11.035  -15.274 1.00 10.00 ? 480 LYS A OXT  1  
ATOM 1146  H H    . LYS A 1 71 ? -7.946  7.992   -15.295 1.00 10.00 ? 480 LYS A H    1  
ATOM 1147  H HA   . LYS A 1 71 ? -6.463  9.456   -13.311 1.00 10.00 ? 480 LYS A HA   1  
ATOM 1148  H HB2  . LYS A 1 71 ? -5.013  10.108  -15.156 1.00 10.00 ? 480 LYS A HB2  1  
ATOM 1149  H HB3  . LYS A 1 71 ? -5.338  8.381   -15.219 1.00 10.00 ? 480 LYS A HB3  1  
ATOM 1150  H HG2  . LYS A 1 71 ? -7.158  8.935   -16.899 1.00 10.00 ? 480 LYS A HG2  1  
ATOM 1151  H HG3  . LYS A 1 71 ? -6.445  10.547  -16.975 1.00 10.00 ? 480 LYS A HG3  1  
ATOM 1152  H HD2  . LYS A 1 71 ? -4.406  9.715   -17.820 1.00 10.00 ? 480 LYS A HD2  1  
ATOM 1153  H HD3  . LYS A 1 71 ? -4.822  8.052   -17.401 1.00 10.00 ? 480 LYS A HD3  1  
ATOM 1154  H HE2  . LYS A 1 71 ? -6.282  9.715   -19.449 1.00 10.00 ? 480 LYS A HE2  1  
ATOM 1155  H HE3  . LYS A 1 71 ? -5.005  8.561   -19.831 1.00 10.00 ? 480 LYS A HE3  1  
ATOM 1156  H HZ1  . LYS A 1 71 ? -7.628  7.950   -18.581 1.00 10.00 ? 480 LYS A HZ1  1  
ATOM 1157  H HZ2  . LYS A 1 71 ? -6.384  6.823   -18.788 1.00 10.00 ? 480 LYS A HZ2  1  
ATOM 1158  H HZ3  . LYS A 1 71 ? -7.123  7.522   -20.139 1.00 10.00 ? 480 LYS A HZ3  1  
ATOM 1159  N N    . ASN A 1 4  ? 17.135  -3.309  20.445  1.00 10.00 ? 413 ASN A N    2  
ATOM 1160  C CA   . ASN A 1 4  ? 16.266  -3.594  21.580  1.00 10.00 ? 413 ASN A CA   2  
ATOM 1161  C C    . ASN A 1 4  ? 15.182  -2.531  21.718  1.00 10.00 ? 413 ASN A C    2  
ATOM 1162  O O    . ASN A 1 4  ? 15.332  -1.411  21.229  1.00 10.00 ? 413 ASN A O    2  
ATOM 1163  C CB   . ASN A 1 4  ? 17.087  -3.672  22.870  1.00 10.00 ? 413 ASN A CB   2  
ATOM 1164  C CG   . ASN A 1 4  ? 16.575  -4.739  23.817  1.00 10.00 ? 413 ASN A CG   2  
ATOM 1165  O OD1  . ASN A 1 4  ? 17.129  -5.835  23.894  1.00 10.00 ? 413 ASN A OD1  2  
ATOM 1166  N ND2  . ASN A 1 4  ? 15.510  -4.422  24.546  1.00 10.00 ? 413 ASN A ND2  2  
ATOM 1167  H H    . ASN A 1 4  ? 17.420  -2.385  20.282  1.00 10.00 ? 413 ASN A H    2  
ATOM 1168  H HA   . ASN A 1 4  ? 15.797  -4.550  21.405  1.00 10.00 ? 413 ASN A HA   2  
ATOM 1169  H HB2  . ASN A 1 4  ? 18.113  -3.899  22.623  1.00 10.00 ? 413 ASN A HB2  2  
ATOM 1170  H HB3  . ASN A 1 4  ? 17.045  -2.717  23.373  1.00 10.00 ? 413 ASN A HB3  2  
ATOM 1171  H HD21 . ASN A 1 4  ? 15.121  -3.531  24.432  1.00 10.00 ? 413 ASN A HD21 2  
ATOM 1172  H HD22 . ASN A 1 4  ? 15.158  -5.094  25.167  1.00 10.00 ? 413 ASN A HD22 2  
ATOM 1173  N N    . GLY A 1 5  ? 14.090  -2.889  22.384  1.00 10.00 ? 414 GLY A N    2  
ATOM 1174  C CA   . GLY A 1 5  ? 12.996  -1.954  22.574  1.00 10.00 ? 414 GLY A CA   2  
ATOM 1175  C C    . GLY A 1 5  ? 11.644  -2.579  22.292  1.00 10.00 ? 414 GLY A C    2  
ATOM 1176  O O    . GLY A 1 5  ? 11.206  -3.477  23.011  1.00 10.00 ? 414 GLY A O    2  
ATOM 1177  H H    . GLY A 1 5  ? 14.026  -3.796  22.751  1.00 10.00 ? 414 GLY A H    2  
ATOM 1178  H HA2  . GLY A 1 5  ? 13.012  -1.601  23.595  1.00 10.00 ? 414 GLY A HA2  2  
ATOM 1179  H HA3  . GLY A 1 5  ? 13.137  -1.113  21.911  1.00 10.00 ? 414 GLY A HA3  2  
ATOM 1180  N N    . LEU A 1 6  ? 10.981  -2.102  21.244  1.00 10.00 ? 415 LEU A N    2  
ATOM 1181  C CA   . LEU A 1 6  ? 9.670   -2.619  20.868  1.00 10.00 ? 415 LEU A CA   2  
ATOM 1182  C C    . LEU A 1 6  ? 9.754   -3.431  19.580  1.00 10.00 ? 415 LEU A C    2  
ATOM 1183  O O    . LEU A 1 6  ? 9.546   -4.644  19.584  1.00 10.00 ? 415 LEU A O    2  
ATOM 1184  C CB   . LEU A 1 6  ? 8.676   -1.470  20.696  1.00 10.00 ? 415 LEU A CB   2  
ATOM 1185  C CG   . LEU A 1 6  ? 7.233   -1.798  21.086  1.00 10.00 ? 415 LEU A CG   2  
ATOM 1186  C CD1  . LEU A 1 6  ? 6.722   -2.986  20.286  1.00 10.00 ? 415 LEU A CD1  2  
ATOM 1187  C CD2  . LEU A 1 6  ? 7.136   -2.075  22.579  1.00 10.00 ? 415 LEU A CD2  2  
ATOM 1188  H H    . LEU A 1 6  ? 11.383  -1.385  20.709  1.00 10.00 ? 415 LEU A H    2  
ATOM 1189  H HA   . LEU A 1 6  ? 9.328   -3.264  21.664  1.00 10.00 ? 415 LEU A HA   2  
ATOM 1190  H HB2  . LEU A 1 6  ? 9.010   -0.639  21.300  1.00 10.00 ? 415 LEU A HB2  2  
ATOM 1191  H HB3  . LEU A 1 6  ? 8.684   -1.166  19.660  1.00 10.00 ? 415 LEU A HB3  2  
ATOM 1192  H HG   . LEU A 1 6  ? 6.604   -0.949  20.861  1.00 10.00 ? 415 LEU A HG   2  
ATOM 1193  H HD11 . LEU A 1 6  ? 5.750   -3.278  20.657  1.00 10.00 ? 415 LEU A HD11 2  
ATOM 1194  H HD12 . LEU A 1 6  ? 7.409   -3.813  20.390  1.00 10.00 ? 415 LEU A HD12 2  
ATOM 1195  H HD13 . LEU A 1 6  ? 6.642   -2.712  19.245  1.00 10.00 ? 415 LEU A HD13 2  
ATOM 1196  H HD21 . LEU A 1 6  ? 7.932   -1.560  23.093  1.00 10.00 ? 415 LEU A HD21 2  
ATOM 1197  H HD22 . LEU A 1 6  ? 7.222   -3.137  22.753  1.00 10.00 ? 415 LEU A HD22 2  
ATOM 1198  H HD23 . LEU A 1 6  ? 6.183   -1.727  22.948  1.00 10.00 ? 415 LEU A HD23 2  
ATOM 1199  N N    . MET A 1 7  ? 10.060  -2.754  18.478  1.00 10.00 ? 416 MET A N    2  
ATOM 1200  C CA   . MET A 1 7  ? 10.171  -3.412  17.182  1.00 10.00 ? 416 MET A CA   2  
ATOM 1201  C C    . MET A 1 7  ? 8.854   -4.075  16.793  1.00 10.00 ? 416 MET A C    2  
ATOM 1202  O O    . MET A 1 7  ? 7.861   -3.974  17.514  1.00 10.00 ? 416 MET A O    2  
ATOM 1203  C CB   . MET A 1 7  ? 11.291  -4.454  17.211  1.00 10.00 ? 416 MET A CB   2  
ATOM 1204  C CG   . MET A 1 7  ? 12.653  -3.895  16.835  1.00 10.00 ? 416 MET A CG   2  
ATOM 1205  S SD   . MET A 1 7  ? 14.007  -4.745  17.668  1.00 10.00 ? 416 MET A SD   2  
ATOM 1206  C CE   . MET A 1 7  ? 13.666  -6.445  17.221  1.00 10.00 ? 416 MET A CE   2  
ATOM 1207  H H    . MET A 1 7  ? 10.214  -1.787  18.539  1.00 10.00 ? 416 MET A H    2  
ATOM 1208  H HA   . MET A 1 7  ? 10.412  -2.659  16.447  1.00 10.00 ? 416 MET A HA   2  
ATOM 1209  H HB2  . MET A 1 7  ? 11.358  -4.868  18.206  1.00 10.00 ? 416 MET A HB2  2  
ATOM 1210  H HB3  . MET A 1 7  ? 11.048  -5.246  16.518  1.00 10.00 ? 416 MET A HB3  2  
ATOM 1211  H HG2  . MET A 1 7  ? 12.786  -3.995  15.768  1.00 10.00 ? 416 MET A HG2  2  
ATOM 1212  H HG3  . MET A 1 7  ? 12.684  -2.849  17.104  1.00 10.00 ? 416 MET A HG3  2  
ATOM 1213  H HE1  . MET A 1 7  ? 13.050  -6.901  17.982  1.00 10.00 ? 416 MET A HE1  2  
ATOM 1214  H HE2  . MET A 1 7  ? 14.595  -6.989  17.137  1.00 10.00 ? 416 MET A HE2  2  
ATOM 1215  H HE3  . MET A 1 7  ? 13.147  -6.471  16.274  1.00 10.00 ? 416 MET A HE3  2  
ATOM 1216  N N    . ALA A 1 8  ? 8.853   -4.754  15.650  1.00 10.00 ? 417 ALA A N    2  
ATOM 1217  C CA   . ALA A 1 8  ? 7.658   -5.434  15.166  1.00 10.00 ? 417 ALA A CA   2  
ATOM 1218  C C    . ALA A 1 8  ? 6.520   -4.445  14.933  1.00 10.00 ? 417 ALA A C    2  
ATOM 1219  O O    . ALA A 1 8  ? 5.394   -4.657  15.385  1.00 10.00 ? 417 ALA A O    2  
ATOM 1220  C CB   . ALA A 1 8  ? 7.231   -6.513  16.150  1.00 10.00 ? 417 ALA A CB   2  
ATOM 1221  H H    . ALA A 1 8  ? 9.676   -4.798  15.120  1.00 10.00 ? 417 ALA A H    2  
ATOM 1222  H HA   . ALA A 1 8  ? 7.903   -5.911  14.228  1.00 10.00 ? 417 ALA A HA   2  
ATOM 1223  H HB1  . ALA A 1 8  ? 6.673   -6.064  16.957  1.00 10.00 ? 417 ALA A HB1  2  
ATOM 1224  H HB2  . ALA A 1 8  ? 8.108   -7.005  16.547  1.00 10.00 ? 417 ALA A HB2  2  
ATOM 1225  H HB3  . ALA A 1 8  ? 6.611   -7.237  15.644  1.00 10.00 ? 417 ALA A HB3  2  
ATOM 1226  N N    . ASP A 1 9  ? 6.821   -3.362  14.225  1.00 10.00 ? 418 ASP A N    2  
ATOM 1227  C CA   . ASP A 1 9  ? 5.823   -2.339  13.931  1.00 10.00 ? 418 ASP A CA   2  
ATOM 1228  C C    . ASP A 1 9  ? 4.968   -2.739  12.729  1.00 10.00 ? 418 ASP A C    2  
ATOM 1229  O O    . ASP A 1 9  ? 3.740   -2.742  12.805  1.00 10.00 ? 418 ASP A O    2  
ATOM 1230  C CB   . ASP A 1 9  ? 6.502   -0.993  13.669  1.00 10.00 ? 418 ASP A CB   2  
ATOM 1231  C CG   . ASP A 1 9  ? 5.867   0.138   14.455  1.00 10.00 ? 418 ASP A CG   2  
ATOM 1232  O OD1  . ASP A 1 9  ? 5.551   -0.072  15.646  1.00 10.00 ? 418 ASP A OD1  2  
ATOM 1233  O OD2  . ASP A 1 9  ? 5.686   1.231   13.881  1.00 10.00 ? 418 ASP A OD2  2  
ATOM 1234  H H    . ASP A 1 9  ? 7.735   -3.247  13.891  1.00 10.00 ? 418 ASP A H    2  
ATOM 1235  H HA   . ASP A 1 9  ? 5.183   -2.245  14.795  1.00 10.00 ? 418 ASP A HA   2  
ATOM 1236  H HB2  . ASP A 1 9  ? 7.542   -1.061  13.949  1.00 10.00 ? 418 ASP A HB2  2  
ATOM 1237  H HB3  . ASP A 1 9  ? 6.432   -0.758  12.616  1.00 10.00 ? 418 ASP A HB3  2  
ATOM 1238  N N    . PRO A 1 10 ? 5.609   -3.084  11.597  1.00 10.00 ? 419 PRO A N    2  
ATOM 1239  C CA   . PRO A 1 10 ? 4.897   -3.486  10.379  1.00 10.00 ? 419 PRO A CA   2  
ATOM 1240  C C    . PRO A 1 10 ? 3.882   -4.593  10.642  1.00 10.00 ? 419 PRO A C    2  
ATOM 1241  O O    . PRO A 1 10 ? 4.230   -5.659  11.151  1.00 10.00 ? 419 PRO A O    2  
ATOM 1242  C CB   . PRO A 1 10 ? 6.014   -3.991  9.464   1.00 10.00 ? 419 PRO A CB   2  
ATOM 1243  C CG   . PRO A 1 10 ? 7.238   -3.283  9.932   1.00 10.00 ? 419 PRO A CG   2  
ATOM 1244  C CD   . PRO A 1 10 ? 7.073   -3.110  11.416  1.00 10.00 ? 419 PRO A CD   2  
ATOM 1245  H HA   . PRO A 1 10 ? 4.400   -2.646  9.917   1.00 10.00 ? 419 PRO A HA   2  
ATOM 1246  H HB2  . PRO A 1 10 ? 6.112   -5.061  9.567   1.00 10.00 ? 419 PRO A HB2  2  
ATOM 1247  H HB3  . PRO A 1 10 ? 5.783   -3.742  8.439   1.00 10.00 ? 419 PRO A HB3  2  
ATOM 1248  H HG2  . PRO A 1 10 ? 8.112   -3.880  9.719   1.00 10.00 ? 419 PRO A HG2  2  
ATOM 1249  H HG3  . PRO A 1 10 ? 7.313   -2.320  9.448   1.00 10.00 ? 419 PRO A HG3  2  
ATOM 1250  H HD2  . PRO A 1 10 ? 7.512   -3.944  11.944  1.00 10.00 ? 419 PRO A HD2  2  
ATOM 1251  H HD3  . PRO A 1 10 ? 7.518   -2.181  11.739  1.00 10.00 ? 419 PRO A HD3  2  
ATOM 1252  N N    . MET A 1 11 ? 2.627   -4.335  10.291  1.00 10.00 ? 420 MET A N    2  
ATOM 1253  C CA   . MET A 1 11 ? 1.563   -5.309  10.489  1.00 10.00 ? 420 MET A CA   2  
ATOM 1254  C C    . MET A 1 11 ? 0.746   -5.484  9.217   1.00 10.00 ? 420 MET A C    2  
ATOM 1255  O O    . MET A 1 11 ? 0.988   -6.409  8.450   1.00 10.00 ? 420 MET A O    2  
ATOM 1256  C CB   . MET A 1 11 ? 0.659   -4.882  11.648  1.00 10.00 ? 420 MET A CB   2  
ATOM 1257  C CG   . MET A 1 11 ? -0.504  -5.827  11.898  1.00 10.00 ? 420 MET A CG   2  
ATOM 1258  S SD   . MET A 1 11 ? 0.031   -7.446  12.487  1.00 10.00 ? 420 MET A SD   2  
ATOM 1259  C CE   . MET A 1 11 ? -1.083  -7.689  13.869  1.00 10.00 ? 420 MET A CE   2  
ATOM 1260  H H    . MET A 1 11 ? 2.411   -3.467  9.889   1.00 10.00 ? 420 MET A H    2  
ATOM 1261  H HA   . MET A 1 11 ? 2.017   -6.260  10.728  1.00 10.00 ? 420 MET A HA   2  
ATOM 1262  H HB2  . MET A 1 11 ? 1.251   -4.828  12.549  1.00 10.00 ? 420 MET A HB2  2  
ATOM 1263  H HB3  . MET A 1 11 ? 0.259   -3.900  11.433  1.00 10.00 ? 420 MET A HB3  2  
ATOM 1264  H HG2  . MET A 1 11 ? -1.155  -5.389  12.640  1.00 10.00 ? 420 MET A HG2  2  
ATOM 1265  H HG3  . MET A 1 11 ? -1.050  -5.958  10.975  1.00 10.00 ? 420 MET A HG3  2  
ATOM 1266  H HE1  . MET A 1 11 ? -1.805  -8.451  13.619  1.00 10.00 ? 420 MET A HE1  2  
ATOM 1267  H HE2  . MET A 1 11 ? -1.596  -6.764  14.084  1.00 10.00 ? 420 MET A HE2  2  
ATOM 1268  H HE3  . MET A 1 11 ? -0.518  -7.998  14.735  1.00 10.00 ? 420 MET A HE3  2  
ATOM 1269  N N    . LYS A 1 12 ? -0.219  -4.597  8.995   1.00 10.00 ? 421 LYS A N    2  
ATOM 1270  C CA   . LYS A 1 12 ? -1.061  -4.683  7.806   1.00 10.00 ? 421 LYS A CA   2  
ATOM 1271  C C    . LYS A 1 12 ? -0.232  -4.896  6.558   1.00 10.00 ? 421 LYS A C    2  
ATOM 1272  O O    . LYS A 1 12 ? 0.391   -3.968  6.047   1.00 10.00 ? 421 LYS A O    2  
ATOM 1273  C CB   . LYS A 1 12 ? -1.919  -3.443  7.634   1.00 10.00 ? 421 LYS A CB   2  
ATOM 1274  C CG   . LYS A 1 12 ? -3.182  -3.714  6.840   1.00 10.00 ? 421 LYS A CG   2  
ATOM 1275  C CD   . LYS A 1 12 ? -2.889  -4.350  5.489   1.00 10.00 ? 421 LYS A CD   2  
ATOM 1276  C CE   . LYS A 1 12 ? -4.167  -4.592  4.705   1.00 10.00 ? 421 LYS A CE   2  
ATOM 1277  N NZ   . LYS A 1 12 ? -3.944  -4.524  3.234   1.00 10.00 ? 421 LYS A NZ   2  
ATOM 1278  H H    . LYS A 1 12 ? -0.367  -3.877  9.639   1.00 10.00 ? 421 LYS A H    2  
ATOM 1279  H HA   . LYS A 1 12 ? -1.712  -5.533  7.928   1.00 10.00 ? 421 LYS A HA   2  
ATOM 1280  H HB2  . LYS A 1 12 ? -2.199  -3.070  8.608   1.00 10.00 ? 421 LYS A HB2  2  
ATOM 1281  H HB3  . LYS A 1 12 ? -1.348  -2.691  7.116   1.00 10.00 ? 421 LYS A HB3  2  
ATOM 1282  H HG2  . LYS A 1 12 ? -3.805  -4.391  7.403   1.00 10.00 ? 421 LYS A HG2  2  
ATOM 1283  H HG3  . LYS A 1 12 ? -3.694  -2.779  6.682   1.00 10.00 ? 421 LYS A HG3  2  
ATOM 1284  H HD2  . LYS A 1 12 ? -2.246  -3.696  4.921   1.00 10.00 ? 421 LYS A HD2  2  
ATOM 1285  H HD3  . LYS A 1 12 ? -2.395  -5.297  5.647   1.00 10.00 ? 421 LYS A HD3  2  
ATOM 1286  H HE2  . LYS A 1 12 ? -4.548  -5.572  4.955   1.00 10.00 ? 421 LYS A HE2  2  
ATOM 1287  H HE3  . LYS A 1 12 ? -4.893  -3.844  4.986   1.00 10.00 ? 421 LYS A HE3  2  
ATOM 1288  H HZ1  . LYS A 1 12 ? -3.152  -3.882  3.022   1.00 10.00 ? 421 LYS A HZ1  2  
ATOM 1289  H HZ2  . LYS A 1 12 ? -4.798  -4.171  2.758   1.00 10.00 ? 421 LYS A HZ2  2  
ATOM 1290  H HZ3  . LYS A 1 12 ? -3.720  -5.468  2.863   1.00 10.00 ? 421 LYS A HZ3  2  
ATOM 1291  N N    . VAL A 1 13 ? -0.244  -6.126  6.074   1.00 10.00 ? 422 VAL A N    2  
ATOM 1292  C CA   . VAL A 1 13 ? 0.494   -6.493  4.882   1.00 10.00 ? 422 VAL A CA   2  
ATOM 1293  C C    . VAL A 1 13 ? 0.365   -7.988  4.636   1.00 10.00 ? 422 VAL A C    2  
ATOM 1294  O O    . VAL A 1 13 ? 0.114   -8.439  3.522   1.00 10.00 ? 422 VAL A O    2  
ATOM 1295  C CB   . VAL A 1 13 ? 1.971   -6.083  5.016   1.00 10.00 ? 422 VAL A CB   2  
ATOM 1296  C CG1  . VAL A 1 13 ? 2.752   -7.079  5.863   1.00 10.00 ? 422 VAL A CG1  2  
ATOM 1297  C CG2  . VAL A 1 13 ? 2.605   -5.915  3.644   1.00 10.00 ? 422 VAL A CG2  2  
ATOM 1298  H H    . VAL A 1 13 ? -0.773  -6.811  6.532   1.00 10.00 ? 422 VAL A H    2  
ATOM 1299  H HA   . VAL A 1 13 ? 0.060   -5.960  4.060   1.00 10.00 ? 422 VAL A HA   2  
ATOM 1300  H HB   . VAL A 1 13 ? 1.993   -5.130  5.520   1.00 10.00 ? 422 VAL A HB   2  
ATOM 1301  H HG11 . VAL A 1 13 ? 3.771   -6.736  5.975   1.00 10.00 ? 422 VAL A HG11 2  
ATOM 1302  H HG12 . VAL A 1 13 ? 2.749   -8.045  5.380   1.00 10.00 ? 422 VAL A HG12 2  
ATOM 1303  H HG13 . VAL A 1 13 ? 2.292   -7.162  6.836   1.00 10.00 ? 422 VAL A HG13 2  
ATOM 1304  H HG21 . VAL A 1 13 ? 2.088   -6.540  2.930   1.00 10.00 ? 422 VAL A HG21 2  
ATOM 1305  H HG22 . VAL A 1 13 ? 3.643   -6.206  3.691   1.00 10.00 ? 422 VAL A HG22 2  
ATOM 1306  H HG23 . VAL A 1 13 ? 2.532   -4.882  3.339   1.00 10.00 ? 422 VAL A HG23 2  
ATOM 1307  N N    . TYR A 1 14 ? 0.513   -8.734  5.716   1.00 10.00 ? 423 TYR A N    2  
ATOM 1308  C CA   . TYR A 1 14 ? 0.386   -10.185 5.718   1.00 10.00 ? 423 TYR A CA   2  
ATOM 1309  C C    . TYR A 1 14 ? -0.851  -10.618 4.931   1.00 10.00 ? 423 TYR A C    2  
ATOM 1310  O O    . TYR A 1 14 ? -0.872  -11.691 4.329   1.00 10.00 ? 423 TYR A O    2  
ATOM 1311  C CB   . TYR A 1 14 ? 0.267   -10.661 7.173   1.00 10.00 ? 423 TYR A CB   2  
ATOM 1312  C CG   . TYR A 1 14 ? -0.804  -9.915  7.943   1.00 10.00 ? 423 TYR A CG   2  
ATOM 1313  C CD1  . TYR A 1 14 ? -0.684  -8.554  8.155   1.00 10.00 ? 423 TYR A CD1  2  
ATOM 1314  C CD2  . TYR A 1 14 ? -1.932  -10.556 8.438   1.00 10.00 ? 423 TYR A CD2  2  
ATOM 1315  C CE1  . TYR A 1 14 ? -1.635  -7.842  8.826   1.00 10.00 ? 423 TYR A CE1  2  
ATOM 1316  C CE2  . TYR A 1 14 ? -2.906  -9.846  9.122   1.00 10.00 ? 423 TYR A CE2  2  
ATOM 1317  C CZ   . TYR A 1 14 ? -2.752  -8.486  9.312   1.00 10.00 ? 423 TYR A CZ   2  
ATOM 1318  O OH   . TYR A 1 14 ? -3.715  -7.774  9.990   1.00 10.00 ? 423 TYR A OH   2  
ATOM 1319  H H    . TYR A 1 14 ? 0.699   -8.286  6.557   1.00 10.00 ? 423 TYR A H    2  
ATOM 1320  H HA   . TYR A 1 14 ? 1.267   -10.611 5.267   1.00 10.00 ? 423 TYR A HA   2  
ATOM 1321  H HB2  . TYR A 1 14 ? 0.027   -11.713 7.192   1.00 10.00 ? 423 TYR A HB2  2  
ATOM 1322  H HB3  . TYR A 1 14 ? 1.211   -10.495 7.680   1.00 10.00 ? 423 TYR A HB3  2  
ATOM 1323  H HD1  . TYR A 1 14 ? 0.181   -8.043  7.782   1.00 10.00 ? 423 TYR A HD1  2  
ATOM 1324  H HD2  . TYR A 1 14 ? -2.046  -11.618 8.284   1.00 10.00 ? 423 TYR A HD2  2  
ATOM 1325  H HE1  . TYR A 1 14 ? -1.498  -6.779  8.955   1.00 10.00 ? 423 TYR A HE1  2  
ATOM 1326  H HE2  . TYR A 1 14 ? -3.778  -10.356 9.501   1.00 10.00 ? 423 TYR A HE2  2  
ATOM 1327  H HH   . TYR A 1 14 ? -4.508  -7.714  9.453   1.00 10.00 ? 423 TYR A HH   2  
ATOM 1328  N N    . LYS A 1 15 ? -1.885  -9.773  4.946   1.00 10.00 ? 424 LYS A N    2  
ATOM 1329  C CA   . LYS A 1 15 ? -3.126  -10.072 4.237   1.00 10.00 ? 424 LYS A CA   2  
ATOM 1330  C C    . LYS A 1 15 ? -3.107  -9.515  2.815   1.00 10.00 ? 424 LYS A C    2  
ATOM 1331  O O    . LYS A 1 15 ? -4.133  -9.488  2.136   1.00 10.00 ? 424 LYS A O    2  
ATOM 1332  C CB   . LYS A 1 15 ? -4.316  -9.491  4.999   1.00 10.00 ? 424 LYS A CB   2  
ATOM 1333  C CG   . LYS A 1 15 ? -4.802  -10.375 6.136   1.00 10.00 ? 424 LYS A CG   2  
ATOM 1334  C CD   . LYS A 1 15 ? -6.240  -10.057 6.511   1.00 10.00 ? 424 LYS A CD   2  
ATOM 1335  C CE   . LYS A 1 15 ? -7.199  -10.403 5.384   1.00 10.00 ? 424 LYS A CE   2  
ATOM 1336  N NZ   . LYS A 1 15 ? -8.544  -10.786 5.896   1.00 10.00 ? 424 LYS A NZ   2  
ATOM 1337  H H    . LYS A 1 15 ? -1.811  -8.928  5.450   1.00 10.00 ? 424 LYS A H    2  
ATOM 1338  H HA   . LYS A 1 15 ? -3.231  -11.145 4.190   1.00 10.00 ? 424 LYS A HA   2  
ATOM 1339  H HB2  . LYS A 1 15 ? -4.028  -8.535  5.410   1.00 10.00 ? 424 LYS A HB2  2  
ATOM 1340  H HB3  . LYS A 1 15 ? -5.132  -9.345  4.309   1.00 10.00 ? 424 LYS A HB3  2  
ATOM 1341  H HG2  . LYS A 1 15 ? -4.741  -11.408 5.827   1.00 10.00 ? 424 LYS A HG2  2  
ATOM 1342  H HG3  . LYS A 1 15 ? -4.171  -10.216 6.998   1.00 10.00 ? 424 LYS A HG3  2  
ATOM 1343  H HD2  . LYS A 1 15 ? -6.509  -10.629 7.386   1.00 10.00 ? 424 LYS A HD2  2  
ATOM 1344  H HD3  . LYS A 1 15 ? -6.320  -9.002  6.729   1.00 10.00 ? 424 LYS A HD3  2  
ATOM 1345  H HE2  . LYS A 1 15 ? -7.302  -9.543  4.739   1.00 10.00 ? 424 LYS A HE2  2  
ATOM 1346  H HE3  . LYS A 1 15 ? -6.789  -11.227 4.819   1.00 10.00 ? 424 LYS A HE3  2  
ATOM 1347  H HZ1  . LYS A 1 15 ? -9.258  -10.670 5.149   1.00 10.00 ? 424 LYS A HZ1  2  
ATOM 1348  H HZ2  . LYS A 1 15 ? -8.804  -10.186 6.704   1.00 10.00 ? 424 LYS A HZ2  2  
ATOM 1349  H HZ3  . LYS A 1 15 ? -8.539  -11.780 6.204   1.00 10.00 ? 424 LYS A HZ3  2  
ATOM 1350  N N    . ASP A 1 16 ? -1.938  -9.065  2.372   1.00 10.00 ? 425 ASP A N    2  
ATOM 1351  C CA   . ASP A 1 16 ? -1.789  -8.503  1.035   1.00 10.00 ? 425 ASP A CA   2  
ATOM 1352  C C    . ASP A 1 16 ? -0.366  -8.681  0.516   1.00 10.00 ? 425 ASP A C    2  
ATOM 1353  O O    . ASP A 1 16 ? 0.165   -7.813  -0.175  1.00 10.00 ? 425 ASP A O    2  
ATOM 1354  C CB   . ASP A 1 16 ? -2.157  -7.021  1.043   1.00 10.00 ? 425 ASP A CB   2  
ATOM 1355  C CG   . ASP A 1 16 ? -1.476  -6.260  2.161   1.00 10.00 ? 425 ASP A CG   2  
ATOM 1356  O OD1  . ASP A 1 16 ? -2.006  -6.269  3.293   1.00 10.00 ? 425 ASP A OD1  2  
ATOM 1357  O OD2  . ASP A 1 16 ? -0.414  -5.655  1.906   1.00 10.00 ? 425 ASP A OD2  2  
ATOM 1358  H H    . ASP A 1 16 ? -1.159  -9.109  2.960   1.00 10.00 ? 425 ASP A H    2  
ATOM 1359  H HA   . ASP A 1 16 ? -2.463  -9.028  0.376   1.00 10.00 ? 425 ASP A HA   2  
ATOM 1360  H HB2  . ASP A 1 16 ? -1.863  -6.578  0.104   1.00 10.00 ? 425 ASP A HB2  2  
ATOM 1361  H HB3  . ASP A 1 16 ? -3.225  -6.924  1.164   1.00 10.00 ? 425 ASP A HB3  2  
ATOM 1362  N N    . ARG A 1 17 ? 0.243   -9.814  0.839   1.00 10.00 ? 426 ARG A N    2  
ATOM 1363  C CA   . ARG A 1 17 ? 1.600   -10.102 0.385   1.00 10.00 ? 426 ARG A CA   2  
ATOM 1364  C C    . ARG A 1 17 ? 1.602   -10.441 -1.101  1.00 10.00 ? 426 ARG A C    2  
ATOM 1365  O O    . ARG A 1 17 ? 2.642   -10.395 -1.758  1.00 10.00 ? 426 ARG A O    2  
ATOM 1366  C CB   . ARG A 1 17 ? 2.204   -11.252 1.192   1.00 10.00 ? 426 ARG A CB   2  
ATOM 1367  C CG   . ARG A 1 17 ? 3.688   -11.460 0.937   1.00 10.00 ? 426 ARG A CG   2  
ATOM 1368  C CD   . ARG A 1 17 ? 3.928   -12.530 -0.117  1.00 10.00 ? 426 ARG A CD   2  
ATOM 1369  N NE   . ARG A 1 17 ? 5.089   -13.358 0.200   1.00 10.00 ? 426 ARG A NE   2  
ATOM 1370  C CZ   . ARG A 1 17 ? 5.320   -14.550 -0.345  1.00 10.00 ? 426 ARG A CZ   2  
ATOM 1371  N NH1  . ARG A 1 17 ? 4.472   -15.058 -1.232  1.00 10.00 ? 426 ARG A NH1  2  
ATOM 1372  N NH2  . ARG A 1 17 ? 6.401   -15.238 -0.002  1.00 10.00 ? 426 ARG A NH2  2  
ATOM 1373  H H    . ARG A 1 17 ? -0.232  -10.474 1.384   1.00 10.00 ? 426 ARG A H    2  
ATOM 1374  H HA   . ARG A 1 17 ? 2.195   -9.211  0.534   1.00 10.00 ? 426 ARG A HA   2  
ATOM 1375  H HB2  . ARG A 1 17 ? 2.066   -11.052 2.244   1.00 10.00 ? 426 ARG A HB2  2  
ATOM 1376  H HB3  . ARG A 1 17 ? 1.686   -12.166 0.938   1.00 10.00 ? 426 ARG A HB3  2  
ATOM 1377  H HG2  . ARG A 1 17 ? 4.118   -10.530 0.595   1.00 10.00 ? 426 ARG A HG2  2  
ATOM 1378  H HG3  . ARG A 1 17 ? 4.163   -11.762 1.859   1.00 10.00 ? 426 ARG A HG3  2  
ATOM 1379  H HD2  . ARG A 1 17 ? 3.054   -13.162 -0.176  1.00 10.00 ? 426 ARG A HD2  2  
ATOM 1380  H HD3  . ARG A 1 17 ? 4.090   -12.049 -1.070  1.00 10.00 ? 426 ARG A HD3  2  
ATOM 1381  H HE   . ARG A 1 17 ? 5.731   -13.007 0.852   1.00 10.00 ? 426 ARG A HE   2  
ATOM 1382  H HH11 . ARG A 1 17 ? 3.656   -14.545 -1.495  1.00 10.00 ? 426 ARG A HH11 2  
ATOM 1383  H HH12 . ARG A 1 17 ? 4.651   -15.954 -1.638  1.00 10.00 ? 426 ARG A HH12 2  
ATOM 1384  H HH21 . ARG A 1 17 ? 7.042   -14.861 0.665   1.00 10.00 ? 426 ARG A HH21 2  
ATOM 1385  H HH22 . ARG A 1 17 ? 6.574   -16.134 -0.411  1.00 10.00 ? 426 ARG A HH22 2  
ATOM 1386  N N    . GLN A 1 18 ? 0.424   -10.758 -1.629  1.00 10.00 ? 427 GLN A N    2  
ATOM 1387  C CA   . GLN A 1 18 ? 0.280   -11.078 -3.043  1.00 10.00 ? 427 GLN A CA   2  
ATOM 1388  C C    . GLN A 1 18 ? -0.330  -9.893  -3.776  1.00 10.00 ? 427 GLN A C    2  
ATOM 1389  O O    . GLN A 1 18 ? -0.976  -10.041 -4.813  1.00 10.00 ? 427 GLN A O    2  
ATOM 1390  C CB   . GLN A 1 18 ? -0.575  -12.339 -3.241  1.00 10.00 ? 427 GLN A CB   2  
ATOM 1391  C CG   . GLN A 1 18 ? -1.469  -12.682 -2.056  1.00 10.00 ? 427 GLN A CG   2  
ATOM 1392  C CD   . GLN A 1 18 ? -0.690  -13.211 -0.864  1.00 10.00 ? 427 GLN A CD   2  
ATOM 1393  O OE1  . GLN A 1 18 ? 0.045   -14.192 -0.975  1.00 10.00 ? 427 GLN A OE1  2  
ATOM 1394  N NE2  . GLN A 1 18 ? -0.850  -12.561 0.286   1.00 10.00 ? 427 GLN A NE2  2  
ATOM 1395  H H    . GLN A 1 18 ? -0.371  -10.756 -1.059  1.00 10.00 ? 427 GLN A H    2  
ATOM 1396  H HA   . GLN A 1 18 ? 1.267   -11.247 -3.444  1.00 10.00 ? 427 GLN A HA   2  
ATOM 1397  H HB2  . GLN A 1 18 ? -1.204  -12.198 -4.107  1.00 10.00 ? 427 GLN A HB2  2  
ATOM 1398  H HB3  . GLN A 1 18 ? 0.082   -13.177 -3.421  1.00 10.00 ? 427 GLN A HB3  2  
ATOM 1399  H HG2  . GLN A 1 18 ? -1.998  -11.791 -1.751  1.00 10.00 ? 427 GLN A HG2  2  
ATOM 1400  H HG3  . GLN A 1 18 ? -2.181  -13.434 -2.365  1.00 10.00 ? 427 GLN A HG3  2  
ATOM 1401  H HE21 . GLN A 1 18 ? -1.453  -11.788 0.300   1.00 10.00 ? 427 GLN A HE21 2  
ATOM 1402  H HE22 . GLN A 1 18 ? -0.355  -12.877 1.073   1.00 10.00 ? 427 GLN A HE22 2  
ATOM 1403  N N    . VAL A 1 19 ? -0.095  -8.714  -3.218  1.00 10.00 ? 428 VAL A N    2  
ATOM 1404  C CA   . VAL A 1 19 ? -0.584  -7.468  -3.785  1.00 10.00 ? 428 VAL A CA   2  
ATOM 1405  C C    . VAL A 1 19 ? 0.554   -6.725  -4.452  1.00 10.00 ? 428 VAL A C    2  
ATOM 1406  O O    . VAL A 1 19 ? 0.354   -6.030  -5.446  1.00 10.00 ? 428 VAL A O    2  
ATOM 1407  C CB   . VAL A 1 19 ? -1.217  -6.577  -2.708  1.00 10.00 ? 428 VAL A CB   2  
ATOM 1408  C CG1  . VAL A 1 19 ? -1.234  -5.118  -3.141  1.00 10.00 ? 428 VAL A CG1  2  
ATOM 1409  C CG2  . VAL A 1 19 ? -2.620  -7.064  -2.387  1.00 10.00 ? 428 VAL A CG2  2  
ATOM 1410  H H    . VAL A 1 19 ? 0.439   -8.682  -2.398  1.00 10.00 ? 428 VAL A H    2  
ATOM 1411  H HA   . VAL A 1 19 ? -1.333  -7.702  -4.525  1.00 10.00 ? 428 VAL A HA   2  
ATOM 1412  H HB   . VAL A 1 19 ? -0.616  -6.657  -1.819  1.00 10.00 ? 428 VAL A HB   2  
ATOM 1413  H HG11 . VAL A 1 19 ? -0.386  -4.608  -2.712  1.00 10.00 ? 428 VAL A HG11 2  
ATOM 1414  H HG12 . VAL A 1 19 ? -2.146  -4.651  -2.803  1.00 10.00 ? 428 VAL A HG12 2  
ATOM 1415  H HG13 . VAL A 1 19 ? -1.180  -5.062  -4.217  1.00 10.00 ? 428 VAL A HG13 2  
ATOM 1416  H HG21 . VAL A 1 19 ? -2.921  -7.805  -3.112  1.00 10.00 ? 428 VAL A HG21 2  
ATOM 1417  H HG22 . VAL A 1 19 ? -3.306  -6.231  -2.420  1.00 10.00 ? 428 VAL A HG22 2  
ATOM 1418  H HG23 . VAL A 1 19 ? -2.633  -7.502  -1.401  1.00 10.00 ? 428 VAL A HG23 2  
ATOM 1419  N N    . MET A 1 20 ? 1.756   -6.889  -3.911  1.00 10.00 ? 429 MET A N    2  
ATOM 1420  C CA   . MET A 1 20 ? 2.937   -6.243  -4.483  1.00 10.00 ? 429 MET A CA   2  
ATOM 1421  C C    . MET A 1 20 ? 2.911   -6.363  -6.010  1.00 10.00 ? 429 MET A C    2  
ATOM 1422  O O    . MET A 1 20 ? 3.452   -5.518  -6.723  1.00 10.00 ? 429 MET A O    2  
ATOM 1423  C CB   . MET A 1 20 ? 4.214   -6.877  -3.929  1.00 10.00 ? 429 MET A CB   2  
ATOM 1424  C CG   . MET A 1 20 ? 4.176   -8.396  -3.897  1.00 10.00 ? 429 MET A CG   2  
ATOM 1425  S SD   . MET A 1 20 ? 5.750   -9.120  -3.397  1.00 10.00 ? 429 MET A SD   2  
ATOM 1426  C CE   . MET A 1 20 ? 5.688   -10.691 -4.253  1.00 10.00 ? 429 MET A CE   2  
ATOM 1427  H H    . MET A 1 20 ? 1.851   -7.463  -3.116  1.00 10.00 ? 429 MET A H    2  
ATOM 1428  H HA   . MET A 1 20 ? 2.910   -5.198  -4.212  1.00 10.00 ? 429 MET A HA   2  
ATOM 1429  H HB2  . MET A 1 20 ? 5.049   -6.572  -4.543  1.00 10.00 ? 429 MET A HB2  2  
ATOM 1430  H HB3  . MET A 1 20 ? 4.372   -6.521  -2.921  1.00 10.00 ? 429 MET A HB3  2  
ATOM 1431  H HG2  . MET A 1 20 ? 3.415   -8.708  -3.197  1.00 10.00 ? 429 MET A HG2  2  
ATOM 1432  H HG3  . MET A 1 20 ? 3.927   -8.758  -4.884  1.00 10.00 ? 429 MET A HG3  2  
ATOM 1433  H HE1  . MET A 1 20 ? 5.735   -11.495 -3.535  1.00 10.00 ? 429 MET A HE1  2  
ATOM 1434  H HE2  . MET A 1 20 ? 6.525   -10.765 -4.932  1.00 10.00 ? 429 MET A HE2  2  
ATOM 1435  H HE3  . MET A 1 20 ? 4.765   -10.761 -4.812  1.00 10.00 ? 429 MET A HE3  2  
ATOM 1436  N N    . ASN A 1 21 ? 2.258   -7.422  -6.496  1.00 10.00 ? 430 ASN A N    2  
ATOM 1437  C CA   . ASN A 1 21 ? 2.129   -7.669  -7.925  1.00 10.00 ? 430 ASN A CA   2  
ATOM 1438  C C    . ASN A 1 21 ? 0.665   -7.898  -8.304  1.00 10.00 ? 430 ASN A C    2  
ATOM 1439  O O    . ASN A 1 21 ? 0.367   -8.599  -9.271  1.00 10.00 ? 430 ASN A O    2  
ATOM 1440  C CB   . ASN A 1 21 ? 2.965   -8.886  -8.318  1.00 10.00 ? 430 ASN A CB   2  
ATOM 1441  C CG   . ASN A 1 21 ? 4.401   -8.524  -8.643  1.00 10.00 ? 430 ASN A CG   2  
ATOM 1442  O OD1  . ASN A 1 21 ? 4.693   -7.398  -9.046  1.00 10.00 ? 430 ASN A OD1  2  
ATOM 1443  N ND2  . ASN A 1 21 ? 5.306   -9.479  -8.469  1.00 10.00 ? 430 ASN A ND2  2  
ATOM 1444  H H    . ASN A 1 21 ? 1.844   -8.052  -5.872  1.00 10.00 ? 430 ASN A H    2  
ATOM 1445  H HA   . ASN A 1 21 ? 2.494   -6.798  -8.449  1.00 10.00 ? 430 ASN A HA   2  
ATOM 1446  H HB2  . ASN A 1 21 ? 2.967   -9.592  -7.496  1.00 10.00 ? 430 ASN A HB2  2  
ATOM 1447  H HB3  . ASN A 1 21 ? 2.524   -9.354  -9.187  1.00 10.00 ? 430 ASN A HB3  2  
ATOM 1448  H HD21 . ASN A 1 21 ? 5.002   -10.354 -8.146  1.00 10.00 ? 430 ASN A HD21 2  
ATOM 1449  H HD22 . ASN A 1 21 ? 6.243   -9.272  -8.672  1.00 10.00 ? 430 ASN A HD22 2  
ATOM 1450  N N    . MET A 1 22 ? -0.244  -7.299  -7.533  1.00 10.00 ? 431 MET A N    2  
ATOM 1451  C CA   . MET A 1 22 ? -1.682  -7.425  -7.775  1.00 10.00 ? 431 MET A CA   2  
ATOM 1452  C C    . MET A 1 22 ? -2.487  -6.909  -6.586  1.00 10.00 ? 431 MET A C    2  
ATOM 1453  O O    . MET A 1 22 ? -3.013  -7.690  -5.793  1.00 10.00 ? 431 MET A O    2  
ATOM 1454  C CB   . MET A 1 22 ? -2.068  -8.879  -8.037  1.00 10.00 ? 431 MET A CB   2  
ATOM 1455  C CG   . MET A 1 22 ? -2.277  -9.202  -9.508  1.00 10.00 ? 431 MET A CG   2  
ATOM 1456  S SD   . MET A 1 22 ? -1.692  -10.850 -9.946  1.00 10.00 ? 431 MET A SD   2  
ATOM 1457  C CE   . MET A 1 22 ? -3.240  -11.678 -10.297 1.00 10.00 ? 431 MET A CE   2  
ATOM 1458  H H    . MET A 1 22 ? 0.060   -6.753  -6.784  1.00 10.00 ? 431 MET A H    2  
ATOM 1459  H HA   . MET A 1 22 ? -1.925  -6.835  -8.644  1.00 10.00 ? 431 MET A HA   2  
ATOM 1460  H HB2  . MET A 1 22 ? -1.291  -9.519  -7.653  1.00 10.00 ? 431 MET A HB2  2  
ATOM 1461  H HB3  . MET A 1 22 ? -2.991  -9.087  -7.509  1.00 10.00 ? 431 MET A HB3  2  
ATOM 1462  H HG2  . MET A 1 22 ? -3.332  -9.140  -9.730  1.00 10.00 ? 431 MET A HG2  2  
ATOM 1463  H HG3  . MET A 1 22 ? -1.742  -8.475  -10.101 1.00 10.00 ? 431 MET A HG3  2  
ATOM 1464  H HE1  . MET A 1 22 ? -3.527  -11.488 -11.320 1.00 10.00 ? 431 MET A HE1  2  
ATOM 1465  H HE2  . MET A 1 22 ? -4.007  -11.304 -9.633  1.00 10.00 ? 431 MET A HE2  2  
ATOM 1466  H HE3  . MET A 1 22 ? -3.123  -12.741 -10.147 1.00 10.00 ? 431 MET A HE3  2  
ATOM 1467  N N    . TRP A 1 23 ? -2.608  -5.597  -6.485  1.00 10.00 ? 432 TRP A N    2  
ATOM 1468  C CA   . TRP A 1 23 ? -3.378  -4.990  -5.407  1.00 10.00 ? 432 TRP A CA   2  
ATOM 1469  C C    . TRP A 1 23 ? -4.855  -5.070  -5.743  1.00 10.00 ? 432 TRP A C    2  
ATOM 1470  O O    . TRP A 1 23 ? -5.356  -4.338  -6.598  1.00 10.00 ? 432 TRP A O    2  
ATOM 1471  C CB   . TRP A 1 23 ? -2.969  -3.533  -5.160  1.00 10.00 ? 432 TRP A CB   2  
ATOM 1472  C CG   . TRP A 1 23 ? -1.548  -3.184  -5.517  1.00 10.00 ? 432 TRP A CG   2  
ATOM 1473  C CD1  . TRP A 1 23 ? -0.945  -3.311  -6.734  1.00 10.00 ? 432 TRP A CD1  2  
ATOM 1474  C CD2  . TRP A 1 23 ? -0.553  -2.622  -4.642  1.00 10.00 ? 432 TRP A CD2  2  
ATOM 1475  N NE1  . TRP A 1 23 ? 0.338   -2.841  -6.676  1.00 10.00 ? 432 TRP A NE1  2  
ATOM 1476  C CE2  . TRP A 1 23 ? 0.606   -2.420  -5.409  1.00 10.00 ? 432 TRP A CE2  2  
ATOM 1477  C CE3  . TRP A 1 23 ? -0.531  -2.262  -3.293  1.00 10.00 ? 432 TRP A CE3  2  
ATOM 1478  C CZ2  . TRP A 1 23 ? 1.768   -1.873  -4.879  1.00 10.00 ? 432 TRP A CZ2  2  
ATOM 1479  C CZ3  . TRP A 1 23 ? 0.627   -1.723  -2.764  1.00 10.00 ? 432 TRP A CZ3  2  
ATOM 1480  C CH2  . TRP A 1 23 ? 1.762   -1.530  -3.558  1.00 10.00 ? 432 TRP A CH2  2  
ATOM 1481  H H    . TRP A 1 23 ? -2.196  -5.031  -7.159  1.00 10.00 ? 432 TRP A H    2  
ATOM 1482  H HA   . TRP A 1 23 ? -3.214  -5.564  -4.505  1.00 10.00 ? 432 TRP A HA   2  
ATOM 1483  H HB2  . TRP A 1 23 ? -3.615  -2.889  -5.735  1.00 10.00 ? 432 TRP A HB2  2  
ATOM 1484  H HB3  . TRP A 1 23 ? -3.104  -3.314  -4.115  1.00 10.00 ? 432 TRP A HB3  2  
ATOM 1485  H HD1  . TRP A 1 23 ? -1.423  -3.718  -7.612  1.00 10.00 ? 432 TRP A HD1  2  
ATOM 1486  H HE1  . TRP A 1 23 ? 0.959   -2.811  -7.418  1.00 10.00 ? 432 TRP A HE1  2  
ATOM 1487  H HE3  . TRP A 1 23 ? -1.391  -2.407  -2.667  1.00 10.00 ? 432 TRP A HE3  2  
ATOM 1488  H HZ2  . TRP A 1 23 ? 2.647   -1.708  -5.484  1.00 10.00 ? 432 TRP A HZ2  2  
ATOM 1489  H HZ3  . TRP A 1 23 ? 0.660   -1.439  -1.722  1.00 10.00 ? 432 TRP A HZ3  2  
ATOM 1490  H HH2  . TRP A 1 23 ? 2.645   -1.105  -3.104  1.00 10.00 ? 432 TRP A HH2  2  
ATOM 1491  N N    . SER A 1 24 ? -5.538  -5.981  -5.073  1.00 10.00 ? 433 SER A N    2  
ATOM 1492  C CA   . SER A 1 24 ? -6.963  -6.191  -5.298  1.00 10.00 ? 433 SER A CA   2  
ATOM 1493  C C    . SER A 1 24 ? -7.758  -4.932  -4.989  1.00 10.00 ? 433 SER A C    2  
ATOM 1494  O O    . SER A 1 24 ? -7.395  -4.162  -4.101  1.00 10.00 ? 433 SER A O    2  
ATOM 1495  C CB   . SER A 1 24 ? -7.469  -7.353  -4.442  1.00 10.00 ? 433 SER A CB   2  
ATOM 1496  O OG   . SER A 1 24 ? -8.409  -8.140  -5.153  1.00 10.00 ? 433 SER A OG   2  
ATOM 1497  H H    . SER A 1 24 ? -5.067  -6.534  -4.411  1.00 10.00 ? 433 SER A H    2  
ATOM 1498  H HA   . SER A 1 24 ? -7.098  -6.440  -6.341  1.00 10.00 ? 433 SER A HA   2  
ATOM 1499  H HB2  . SER A 1 24 ? -6.637  -7.980  -4.160  1.00 10.00 ? 433 SER A HB2  2  
ATOM 1500  H HB3  . SER A 1 24 ? -7.944  -6.962  -3.554  1.00 10.00 ? 433 SER A HB3  2  
ATOM 1501  H HG   . SER A 1 24 ? -9.048  -7.565  -5.583  1.00 10.00 ? 433 SER A HG   2  
ATOM 1502  N N    . GLU A 1 25 ? -8.854  -4.731  -5.718  1.00 10.00 ? 434 GLU A N    2  
ATOM 1503  C CA   . GLU A 1 25 ? -9.707  -3.567  -5.505  1.00 10.00 ? 434 GLU A CA   2  
ATOM 1504  C C    . GLU A 1 25 ? -10.021 -3.410  -4.021  1.00 10.00 ? 434 GLU A C    2  
ATOM 1505  O O    . GLU A 1 25 ? -10.230 -2.301  -3.529  1.00 10.00 ? 434 GLU A O    2  
ATOM 1506  C CB   . GLU A 1 25 ? -11.005 -3.701  -6.304  1.00 10.00 ? 434 GLU A CB   2  
ATOM 1507  C CG   . GLU A 1 25 ? -11.593 -2.368  -6.736  1.00 10.00 ? 434 GLU A CG   2  
ATOM 1508  C CD   . GLU A 1 25 ? -11.298 -2.042  -8.186  1.00 10.00 ? 434 GLU A CD   2  
ATOM 1509  O OE1  . GLU A 1 25 ? -12.036 -2.533  -9.068  1.00 10.00 ? 434 GLU A OE1  2  
ATOM 1510  O OE2  . GLU A 1 25 ? -10.329 -1.297  -8.443  1.00 10.00 ? 434 GLU A OE2  2  
ATOM 1511  H H    . GLU A 1 25 ? -9.098  -5.385  -6.407  1.00 10.00 ? 434 GLU A H    2  
ATOM 1512  H HA   . GLU A 1 25 ? -9.170  -2.694  -5.843  1.00 10.00 ? 434 GLU A HA   2  
ATOM 1513  H HB2  . GLU A 1 25 ? -10.809 -4.287  -7.191  1.00 10.00 ? 434 GLU A HB2  2  
ATOM 1514  H HB3  . GLU A 1 25 ? -11.735 -4.214  -5.699  1.00 10.00 ? 434 GLU A HB3  2  
ATOM 1515  H HG2  . GLU A 1 25 ? -12.664 -2.402  -6.601  1.00 10.00 ? 434 GLU A HG2  2  
ATOM 1516  H HG3  . GLU A 1 25 ? -11.178 -1.588  -6.115  1.00 10.00 ? 434 GLU A HG3  2  
ATOM 1517  N N    . GLN A 1 26 ? -10.034 -4.535  -3.314  1.00 10.00 ? 435 GLN A N    2  
ATOM 1518  C CA   . GLN A 1 26 ? -10.301 -4.540  -1.885  1.00 10.00 ? 435 GLN A CA   2  
ATOM 1519  C C    . GLN A 1 26 ? -9.016  -4.302  -1.108  1.00 10.00 ? 435 GLN A C    2  
ATOM 1520  O O    . GLN A 1 26 ? -9.030  -3.676  -0.048  1.00 10.00 ? 435 GLN A O    2  
ATOM 1521  C CB   . GLN A 1 26 ? -10.927 -5.870  -1.466  1.00 10.00 ? 435 GLN A CB   2  
ATOM 1522  C CG   . GLN A 1 26 ? -12.447 -5.844  -1.415  1.00 10.00 ? 435 GLN A CG   2  
ATOM 1523  C CD   . GLN A 1 26 ? -13.066 -5.247  -2.664  1.00 10.00 ? 435 GLN A CD   2  
ATOM 1524  O OE1  . GLN A 1 26 ? -13.391 -5.960  -3.612  1.00 10.00 ? 435 GLN A OE1  2  
ATOM 1525  N NE2  . GLN A 1 26 ? -13.231 -3.928  -2.669  1.00 10.00 ? 435 GLN A NE2  2  
ATOM 1526  H H    . GLN A 1 26 ? -9.849  -5.385  -3.765  1.00 10.00 ? 435 GLN A H    2  
ATOM 1527  H HA   . GLN A 1 26 ? -10.991 -3.738  -1.671  1.00 10.00 ? 435 GLN A HA   2  
ATOM 1528  H HB2  . GLN A 1 26 ? -10.625 -6.632  -2.171  1.00 10.00 ? 435 GLN A HB2  2  
ATOM 1529  H HB3  . GLN A 1 26 ? -10.560 -6.136  -0.486  1.00 10.00 ? 435 GLN A HB3  2  
ATOM 1530  H HG2  . GLN A 1 26 ? -12.809 -6.855  -1.302  1.00 10.00 ? 435 GLN A HG2  2  
ATOM 1531  H HG3  . GLN A 1 26 ? -12.754 -5.256  -0.562  1.00 10.00 ? 435 GLN A HG3  2  
ATOM 1532  H HE21 . GLN A 1 26 ? -12.950 -3.423  -1.878  1.00 10.00 ? 435 GLN A HE21 2  
ATOM 1533  H HE22 . GLN A 1 26 ? -13.628 -3.515  -3.463  1.00 10.00 ? 435 GLN A HE22 2  
ATOM 1534  N N    . GLU A 1 27 ? -7.902  -4.789  -1.645  1.00 10.00 ? 436 GLU A N    2  
ATOM 1535  C CA   . GLU A 1 27 ? -6.621  -4.608  -1.003  1.00 10.00 ? 436 GLU A CA   2  
ATOM 1536  C C    . GLU A 1 27 ? -6.200  -3.151  -1.119  1.00 10.00 ? 436 GLU A C    2  
ATOM 1537  O O    . GLU A 1 27 ? -5.719  -2.557  -0.154  1.00 10.00 ? 436 GLU A O    2  
ATOM 1538  C CB   . GLU A 1 27 ? -5.602  -5.559  -1.621  1.00 10.00 ? 436 GLU A CB   2  
ATOM 1539  C CG   . GLU A 1 27 ? -4.938  -6.467  -0.597  1.00 10.00 ? 436 GLU A CG   2  
ATOM 1540  C CD   . GLU A 1 27 ? -5.063  -7.937  -0.950  1.00 10.00 ? 436 GLU A CD   2  
ATOM 1541  O OE1  . GLU A 1 27 ? -5.081  -8.258  -2.156  1.00 10.00 ? 436 GLU A OE1  2  
ATOM 1542  O OE2  . GLU A 1 27 ? -5.144  -8.766  -0.020  1.00 10.00 ? 436 GLU A OE2  2  
ATOM 1543  H H    . GLU A 1 27 ? -7.938  -5.270  -2.501  1.00 10.00 ? 436 GLU A H    2  
ATOM 1544  H HA   . GLU A 1 27 ? -6.735  -4.842  0.043   1.00 10.00 ? 436 GLU A HA   2  
ATOM 1545  H HB2  . GLU A 1 27 ? -6.106  -6.180  -2.348  1.00 10.00 ? 436 GLU A HB2  2  
ATOM 1546  H HB3  . GLU A 1 27 ? -4.840  -4.987  -2.122  1.00 10.00 ? 436 GLU A HB3  2  
ATOM 1547  H HG2  . GLU A 1 27 ? -3.892  -6.215  -0.532  1.00 10.00 ? 436 GLU A HG2  2  
ATOM 1548  H HG3  . GLU A 1 27 ? -5.405  -6.303  0.363   1.00 10.00 ? 436 GLU A HG3  2  
ATOM 1549  N N    . LYS A 1 28 ? -6.442  -2.562  -2.288  1.00 10.00 ? 437 LYS A N    2  
ATOM 1550  C CA   . LYS A 1 28 ? -6.145  -1.149  -2.509  1.00 10.00 ? 437 LYS A CA   2  
ATOM 1551  C C    . LYS A 1 28 ? -6.854  -0.308  -1.457  1.00 10.00 ? 437 LYS A C    2  
ATOM 1552  O O    . LYS A 1 28 ? -6.507  0.844   -1.230  1.00 10.00 ? 437 LYS A O    2  
ATOM 1553  C CB   . LYS A 1 28 ? -6.596  -0.727  -3.911  1.00 10.00 ? 437 LYS A CB   2  
ATOM 1554  C CG   . LYS A 1 28 ? -5.474  -0.167  -4.768  1.00 10.00 ? 437 LYS A CG   2  
ATOM 1555  C CD   . LYS A 1 28 ? -5.879  -0.082  -6.230  1.00 10.00 ? 437 LYS A CD   2  
ATOM 1556  C CE   . LYS A 1 28 ? -5.460  -1.324  -6.998  1.00 10.00 ? 437 LYS A CE   2  
ATOM 1557  N NZ   . LYS A 1 28 ? -5.795  -1.223  -8.445  1.00 10.00 ? 437 LYS A NZ   2  
ATOM 1558  H H    . LYS A 1 28 ? -6.864  -3.076  -3.003  1.00 10.00 ? 437 LYS A H    2  
ATOM 1559  H HA   . LYS A 1 28 ? -5.085  -0.995  -2.417  1.00 10.00 ? 437 LYS A HA   2  
ATOM 1560  H HB2  . LYS A 1 28 ? -7.010  -1.587  -4.417  1.00 10.00 ? 437 LYS A HB2  2  
ATOM 1561  H HB3  . LYS A 1 28 ? -7.362  0.029   -3.820  1.00 10.00 ? 437 LYS A HB3  2  
ATOM 1562  H HG2  . LYS A 1 28 ? -5.225  0.823   -4.417  1.00 10.00 ? 437 LYS A HG2  2  
ATOM 1563  H HG3  . LYS A 1 28 ? -4.611  -0.810  -4.680  1.00 10.00 ? 437 LYS A HG3  2  
ATOM 1564  H HD2  . LYS A 1 28 ? -6.952  0.022   -6.291  1.00 10.00 ? 437 LYS A HD2  2  
ATOM 1565  H HD3  . LYS A 1 28 ? -5.406  0.782   -6.675  1.00 10.00 ? 437 LYS A HD3  2  
ATOM 1566  H HE2  . LYS A 1 28 ? -4.393  -1.454  -6.894  1.00 10.00 ? 437 LYS A HE2  2  
ATOM 1567  H HE3  . LYS A 1 28 ? -5.969  -2.179  -6.578  1.00 10.00 ? 437 LYS A HE3  2  
ATOM 1568  H HZ1  . LYS A 1 28 ? -5.111  -1.767  -9.009  1.00 10.00 ? 437 LYS A HZ1  2  
ATOM 1569  H HZ2  . LYS A 1 28 ? -5.768  -0.229  -8.750  1.00 10.00 ? 437 LYS A HZ2  2  
ATOM 1570  H HZ3  . LYS A 1 28 ? -6.749  -1.601  -8.618  1.00 10.00 ? 437 LYS A HZ3  2  
ATOM 1571  N N    . GLU A 1 29 ? -7.848  -0.906  -0.812  1.00 10.00 ? 438 GLU A N    2  
ATOM 1572  C CA   . GLU A 1 29 ? -8.613  -0.221  0.219   1.00 10.00 ? 438 GLU A CA   2  
ATOM 1573  C C    . GLU A 1 29 ? -7.741  0.142   1.414   1.00 10.00 ? 438 GLU A C    2  
ATOM 1574  O O    . GLU A 1 29 ? -8.000  1.127   2.102   1.00 10.00 ? 438 GLU A O    2  
ATOM 1575  C CB   . GLU A 1 29 ? -9.773  -1.101  0.680   1.00 10.00 ? 438 GLU A CB   2  
ATOM 1576  C CG   . GLU A 1 29 ? -10.963 -0.316  1.207   1.00 10.00 ? 438 GLU A CG   2  
ATOM 1577  C CD   . GLU A 1 29 ? -11.880 0.166   0.100   1.00 10.00 ? 438 GLU A CD   2  
ATOM 1578  O OE1  . GLU A 1 29 ? -11.385 0.832   -0.833  1.00 10.00 ? 438 GLU A OE1  2  
ATOM 1579  O OE2  . GLU A 1 29 ? -13.093 -0.125  0.164   1.00 10.00 ? 438 GLU A OE2  2  
ATOM 1580  H H    . GLU A 1 29 ? -8.072  -1.837  -1.035  1.00 10.00 ? 438 GLU A H    2  
ATOM 1581  H HA   . GLU A 1 29 ? -9.009  0.686   -0.209  1.00 10.00 ? 438 GLU A HA   2  
ATOM 1582  H HB2  . GLU A 1 29 ? -10.104 -1.704  -0.152  1.00 10.00 ? 438 GLU A HB2  2  
ATOM 1583  H HB3  . GLU A 1 29 ? -9.420  -1.751  1.467   1.00 10.00 ? 438 GLU A HB3  2  
ATOM 1584  H HG2  . GLU A 1 29 ? -11.530 -0.949  1.872   1.00 10.00 ? 438 GLU A HG2  2  
ATOM 1585  H HG3  . GLU A 1 29 ? -10.599 0.543   1.752   1.00 10.00 ? 438 GLU A HG3  2  
ATOM 1586  N N    . THR A 1 30 ? -6.716  -0.663  1.668   1.00 10.00 ? 439 THR A N    2  
ATOM 1587  C CA   . THR A 1 30 ? -5.827  -0.414  2.796   1.00 10.00 ? 439 THR A CA   2  
ATOM 1588  C C    . THR A 1 30 ? -4.736  0.586   2.430   1.00 10.00 ? 439 THR A C    2  
ATOM 1589  O O    . THR A 1 30 ? -4.553  1.596   3.110   1.00 10.00 ? 439 THR A O    2  
ATOM 1590  C CB   . THR A 1 30 ? -5.210  -1.732  3.277   1.00 10.00 ? 439 THR A CB   2  
ATOM 1591  O OG1  . THR A 1 30 ? -6.212  -2.578  3.812   1.00 10.00 ? 439 THR A OG1  2  
ATOM 1592  C CG2  . THR A 1 30 ? -4.140  -1.557  4.342   1.00 10.00 ? 439 THR A CG2  2  
ATOM 1593  H H    . THR A 1 30 ? -6.559  -1.444  1.092   1.00 10.00 ? 439 THR A H    2  
ATOM 1594  H HA   . THR A 1 30 ? -6.420  0.006   3.594   1.00 10.00 ? 439 THR A HA   2  
ATOM 1595  H HB   . THR A 1 30 ? -4.761  -2.236  2.431   1.00 10.00 ? 439 THR A HB   2  
ATOM 1596  H HG1  . THR A 1 30 ? -6.672  -2.121  4.520   1.00 10.00 ? 439 THR A HG1  2  
ATOM 1597  H HG21 . THR A 1 30 ? -3.360  -2.288  4.189   1.00 10.00 ? 439 THR A HG21 2  
ATOM 1598  H HG22 . THR A 1 30 ? -4.578  -1.698  5.318   1.00 10.00 ? 439 THR A HG22 2  
ATOM 1599  H HG23 . THR A 1 30 ? -3.719  -0.565  4.277   1.00 10.00 ? 439 THR A HG23 2  
ATOM 1600  N N    . PHE A 1 31 ? -4.014  0.299   1.358   1.00 10.00 ? 440 PHE A N    2  
ATOM 1601  C CA   . PHE A 1 31 ? -2.940  1.176   0.909   1.00 10.00 ? 440 PHE A CA   2  
ATOM 1602  C C    . PHE A 1 31 ? -3.505  2.495   0.401   1.00 10.00 ? 440 PHE A C    2  
ATOM 1603  O O    . PHE A 1 31 ? -2.916  3.553   0.613   1.00 10.00 ? 440 PHE A O    2  
ATOM 1604  C CB   . PHE A 1 31 ? -2.114  0.505   -0.192  1.00 10.00 ? 440 PHE A CB   2  
ATOM 1605  C CG   . PHE A 1 31 ? -2.513  -0.901  -0.466  1.00 10.00 ? 440 PHE A CG   2  
ATOM 1606  C CD1  . PHE A 1 31 ? -2.273  -1.912  0.446   1.00 10.00 ? 440 PHE A CD1  2  
ATOM 1607  C CD2  . PHE A 1 31 ? -3.154  -1.197  -1.639  1.00 10.00 ? 440 PHE A CD2  2  
ATOM 1608  C CE1  . PHE A 1 31 ? -2.672  -3.199  0.173   1.00 10.00 ? 440 PHE A CE1  2  
ATOM 1609  C CE2  . PHE A 1 31 ? -3.557  -2.473  -1.916  1.00 10.00 ? 440 PHE A CE2  2  
ATOM 1610  C CZ   . PHE A 1 31 ? -3.315  -3.472  -1.015  1.00 10.00 ? 440 PHE A CZ   2  
ATOM 1611  H H    . PHE A 1 31 ? -4.205  -0.520  0.856   1.00 10.00 ? 440 PHE A H    2  
ATOM 1612  H HA   . PHE A 1 31 ? -2.300  1.376   1.756   1.00 10.00 ? 440 PHE A HA   2  
ATOM 1613  H HB2  . PHE A 1 31 ? -2.248  1.050   -1.113  1.00 10.00 ? 440 PHE A HB2  2  
ATOM 1614  H HB3  . PHE A 1 31 ? -1.073  0.509   0.084   1.00 10.00 ? 440 PHE A HB3  2  
ATOM 1615  H HD1  . PHE A 1 31 ? -1.774  -1.688  1.373   1.00 10.00 ? 440 PHE A HD1  2  
ATOM 1616  H HD2  . PHE A 1 31 ? -3.343  -0.411  -2.346  1.00 10.00 ? 440 PHE A HD2  2  
ATOM 1617  H HE1  . PHE A 1 31 ? -2.483  -3.990  0.882   1.00 10.00 ? 440 PHE A HE1  2  
ATOM 1618  H HE2  . PHE A 1 31 ? -4.067  -2.690  -2.843  1.00 10.00 ? 440 PHE A HE2  2  
ATOM 1619  H HZ   . PHE A 1 31 ? -3.640  -4.456  -1.234  1.00 10.00 ? 440 PHE A HZ   2  
ATOM 1620  N N    . ARG A 1 32 ? -4.652  2.434   -0.270  1.00 10.00 ? 441 ARG A N    2  
ATOM 1621  C CA   . ARG A 1 32 ? -5.272  3.640   -0.792  1.00 10.00 ? 441 ARG A CA   2  
ATOM 1622  C C    . ARG A 1 32 ? -5.866  4.469   0.343   1.00 10.00 ? 441 ARG A C    2  
ATOM 1623  O O    . ARG A 1 32 ? -5.973  5.691   0.239   1.00 10.00 ? 441 ARG A O    2  
ATOM 1624  C CB   . ARG A 1 32 ? -6.359  3.310   -1.817  1.00 10.00 ? 441 ARG A CB   2  
ATOM 1625  C CG   . ARG A 1 32 ? -6.801  4.511   -2.639  1.00 10.00 ? 441 ARG A CG   2  
ATOM 1626  C CD   . ARG A 1 32 ? -8.128  4.250   -3.334  1.00 10.00 ? 441 ARG A CD   2  
ATOM 1627  N NE   . ARG A 1 32 ? -7.978  3.371   -4.491  1.00 10.00 ? 441 ARG A NE   2  
ATOM 1628  C CZ   . ARG A 1 32 ? -8.989  2.734   -5.075  1.00 10.00 ? 441 ARG A CZ   2  
ATOM 1629  N NH1  . ARG A 1 32 ? -10.227 2.876   -4.614  1.00 10.00 ? 441 ARG A NH1  2  
ATOM 1630  N NH2  . ARG A 1 32 ? -8.765  1.953   -6.123  1.00 10.00 ? 441 ARG A NH2  2  
ATOM 1631  H H    . ARG A 1 32 ? -5.087  1.565   -0.411  1.00 10.00 ? 441 ARG A H    2  
ATOM 1632  H HA   . ARG A 1 32 ? -4.498  4.211   -1.278  1.00 10.00 ? 441 ARG A HA   2  
ATOM 1633  H HB2  . ARG A 1 32 ? -5.982  2.558   -2.494  1.00 10.00 ? 441 ARG A HB2  2  
ATOM 1634  H HB3  . ARG A 1 32 ? -7.221  2.919   -1.299  1.00 10.00 ? 441 ARG A HB3  2  
ATOM 1635  H HG2  . ARG A 1 32 ? -6.911  5.362   -1.984  1.00 10.00 ? 441 ARG A HG2  2  
ATOM 1636  H HG3  . ARG A 1 32 ? -6.049  4.721   -3.385  1.00 10.00 ? 441 ARG A HG3  2  
ATOM 1637  H HD2  . ARG A 1 32 ? -8.804  3.789   -2.630  1.00 10.00 ? 441 ARG A HD2  2  
ATOM 1638  H HD3  . ARG A 1 32 ? -8.540  5.193   -3.661  1.00 10.00 ? 441 ARG A HD3  2  
ATOM 1639  H HE   . ARG A 1 32 ? -7.075  3.248   -4.852  1.00 10.00 ? 441 ARG A HE   2  
ATOM 1640  H HH11 . ARG A 1 32 ? -10.403 3.463   -3.824  1.00 10.00 ? 441 ARG A HH11 2  
ATOM 1641  H HH12 . ARG A 1 32 ? -10.983 2.394   -5.058  1.00 10.00 ? 441 ARG A HH12 2  
ATOM 1642  H HH21 . ARG A 1 32 ? -7.836  1.843   -6.475  1.00 10.00 ? 441 ARG A HH21 2  
ATOM 1643  H HH22 . ARG A 1 32 ? -9.526  1.474   -6.562  1.00 10.00 ? 441 ARG A HH22 2  
ATOM 1644  N N    . GLU A 1 33 ? -6.249  3.797   1.429   1.00 10.00 ? 442 GLU A N    2  
ATOM 1645  C CA   . GLU A 1 33 ? -6.830  4.480   2.579   1.00 10.00 ? 442 GLU A CA   2  
ATOM 1646  C C    . GLU A 1 33 ? -5.765  5.256   3.343   1.00 10.00 ? 442 GLU A C    2  
ATOM 1647  O O    . GLU A 1 33 ? -6.016  6.363   3.817   1.00 10.00 ? 442 GLU A O    2  
ATOM 1648  C CB   . GLU A 1 33 ? -7.521  3.477   3.508   1.00 10.00 ? 442 GLU A CB   2  
ATOM 1649  C CG   . GLU A 1 33 ? -8.009  4.086   4.814   1.00 10.00 ? 442 GLU A CG   2  
ATOM 1650  C CD   . GLU A 1 33 ? -8.888  5.302   4.599   1.00 10.00 ? 442 GLU A CD   2  
ATOM 1651  O OE1  . GLU A 1 33 ? -10.095 5.122   4.333   1.00 10.00 ? 442 GLU A OE1  2  
ATOM 1652  O OE2  . GLU A 1 33 ? -8.369  6.434   4.695   1.00 10.00 ? 442 GLU A OE2  2  
ATOM 1653  H H    . GLU A 1 33 ? -6.139  2.822   1.457   1.00 10.00 ? 442 GLU A H    2  
ATOM 1654  H HA   . GLU A 1 33 ? -7.564  5.177   2.209   1.00 10.00 ? 442 GLU A HA   2  
ATOM 1655  H HB2  . GLU A 1 33 ? -8.374  3.061   2.994   1.00 10.00 ? 442 GLU A HB2  2  
ATOM 1656  H HB3  . GLU A 1 33 ? -6.828  2.683   3.742   1.00 10.00 ? 442 GLU A HB3  2  
ATOM 1657  H HG2  . GLU A 1 33 ? -8.576  3.342   5.353   1.00 10.00 ? 442 GLU A HG2  2  
ATOM 1658  H HG3  . GLU A 1 33 ? -7.151  4.379   5.402   1.00 10.00 ? 442 GLU A HG3  2  
ATOM 1659  N N    . LYS A 1 34 ? -4.575  4.677   3.454   1.00 10.00 ? 443 LYS A N    2  
ATOM 1660  C CA   . LYS A 1 34 ? -3.481  5.331   4.157   1.00 10.00 ? 443 LYS A CA   2  
ATOM 1661  C C    . LYS A 1 34 ? -2.947  6.489   3.328   1.00 10.00 ? 443 LYS A C    2  
ATOM 1662  O O    . LYS A 1 34 ? -2.716  7.582   3.842   1.00 10.00 ? 443 LYS A O    2  
ATOM 1663  C CB   . LYS A 1 34 ? -2.366  4.330   4.456   1.00 10.00 ? 443 LYS A CB   2  
ATOM 1664  C CG   . LYS A 1 34 ? -2.295  3.924   5.919   1.00 10.00 ? 443 LYS A CG   2  
ATOM 1665  C CD   . LYS A 1 34 ? -3.183  2.725   6.209   1.00 10.00 ? 443 LYS A CD   2  
ATOM 1666  C CE   . LYS A 1 34 ? -3.898  2.869   7.543   1.00 10.00 ? 443 LYS A CE   2  
ATOM 1667  N NZ   . LYS A 1 34 ? -3.136  2.232   8.652   1.00 10.00 ? 443 LYS A NZ   2  
ATOM 1668  H H    . LYS A 1 34 ? -4.427  3.799   3.048   1.00 10.00 ? 443 LYS A H    2  
ATOM 1669  H HA   . LYS A 1 34 ? -3.868  5.718   5.087   1.00 10.00 ? 443 LYS A HA   2  
ATOM 1670  H HB2  . LYS A 1 34 ? -2.530  3.441   3.866   1.00 10.00 ? 443 LYS A HB2  2  
ATOM 1671  H HB3  . LYS A 1 34 ? -1.418  4.767   4.179   1.00 10.00 ? 443 LYS A HB3  2  
ATOM 1672  H HG2  . LYS A 1 34 ? -1.275  3.671   6.163   1.00 10.00 ? 443 LYS A HG2  2  
ATOM 1673  H HG3  . LYS A 1 34 ? -2.617  4.755   6.529   1.00 10.00 ? 443 LYS A HG3  2  
ATOM 1674  H HD2  . LYS A 1 34 ? -3.922  2.637   5.426   1.00 10.00 ? 443 LYS A HD2  2  
ATOM 1675  H HD3  . LYS A 1 34 ? -2.573  1.834   6.232   1.00 10.00 ? 443 LYS A HD3  2  
ATOM 1676  H HE2  . LYS A 1 34 ? -4.018  3.920   7.760   1.00 10.00 ? 443 LYS A HE2  2  
ATOM 1677  H HE3  . LYS A 1 34 ? -4.869  2.404   7.469   1.00 10.00 ? 443 LYS A HE3  2  
ATOM 1678  H HZ1  . LYS A 1 34 ? -3.301  2.747   9.541   1.00 10.00 ? 443 LYS A HZ1  2  
ATOM 1679  H HZ2  . LYS A 1 34 ? -2.118  2.244   8.441   1.00 10.00 ? 443 LYS A HZ2  2  
ATOM 1680  H HZ3  . LYS A 1 34 ? -3.443  1.246   8.775   1.00 10.00 ? 443 LYS A HZ3  2  
ATOM 1681  N N    . PHE A 1 35 ? -2.786  6.254   2.034   1.00 10.00 ? 444 PHE A N    2  
ATOM 1682  C CA   . PHE A 1 35 ? -2.316  7.289   1.136   1.00 10.00 ? 444 PHE A CA   2  
ATOM 1683  C C    . PHE A 1 35 ? -3.384  8.363   1.015   1.00 10.00 ? 444 PHE A C    2  
ATOM 1684  O O    . PHE A 1 35 ? -3.085  9.533   0.779   1.00 10.00 ? 444 PHE A O    2  
ATOM 1685  C CB   . PHE A 1 35 ? -1.977  6.697   -0.231  1.00 10.00 ? 444 PHE A CB   2  
ATOM 1686  C CG   . PHE A 1 35 ? -1.404  7.695   -1.193  1.00 10.00 ? 444 PHE A CG   2  
ATOM 1687  C CD1  . PHE A 1 35 ? -2.208  8.660   -1.776  1.00 10.00 ? 444 PHE A CD1  2  
ATOM 1688  C CD2  . PHE A 1 35 ? -0.058  7.665   -1.513  1.00 10.00 ? 444 PHE A CD2  2  
ATOM 1689  C CE1  . PHE A 1 35 ? -1.679  9.578   -2.664  1.00 10.00 ? 444 PHE A CE1  2  
ATOM 1690  C CE2  . PHE A 1 35 ? 0.478   8.581   -2.398  1.00 10.00 ? 444 PHE A CE2  2  
ATOM 1691  C CZ   . PHE A 1 35 ? -0.334  9.538   -2.975  1.00 10.00 ? 444 PHE A CZ   2  
ATOM 1692  H H    . PHE A 1 35 ? -3.017  5.376   1.671   1.00 10.00 ? 444 PHE A H    2  
ATOM 1693  H HA   . PHE A 1 35 ? -1.426  7.725   1.567   1.00 10.00 ? 444 PHE A HA   2  
ATOM 1694  H HB2  . PHE A 1 35 ? -1.249  5.911   -0.097  1.00 10.00 ? 444 PHE A HB2  2  
ATOM 1695  H HB3  . PHE A 1 35 ? -2.873  6.283   -0.669  1.00 10.00 ? 444 PHE A HB3  2  
ATOM 1696  H HD1  . PHE A 1 35 ? -3.260  8.691   -1.534  1.00 10.00 ? 444 PHE A HD1  2  
ATOM 1697  H HD2  . PHE A 1 35 ? 0.575   6.916   -1.062  1.00 10.00 ? 444 PHE A HD2  2  
ATOM 1698  H HE1  . PHE A 1 35 ? -2.316  10.326  -3.113  1.00 10.00 ? 444 PHE A HE1  2  
ATOM 1699  H HE2  . PHE A 1 35 ? 1.530   8.547   -2.639  1.00 10.00 ? 444 PHE A HE2  2  
ATOM 1700  H HZ   . PHE A 1 35 ? 0.083   10.255  -3.667  1.00 10.00 ? 444 PHE A HZ   2  
ATOM 1701  N N    . MET A 1 36 ? -4.636  7.954   1.219   1.00 10.00 ? 445 MET A N    2  
ATOM 1702  C CA   . MET A 1 36 ? -5.753  8.877   1.174   1.00 10.00 ? 445 MET A CA   2  
ATOM 1703  C C    . MET A 1 36 ? -5.819  9.633   2.494   1.00 10.00 ? 445 MET A C    2  
ATOM 1704  O O    . MET A 1 36 ? -6.067  10.838  2.528   1.00 10.00 ? 445 MET A O    2  
ATOM 1705  C CB   . MET A 1 36 ? -7.064  8.131   0.918   1.00 10.00 ? 445 MET A CB   2  
ATOM 1706  C CG   . MET A 1 36 ? -8.289  9.031   0.927   1.00 10.00 ? 445 MET A CG   2  
ATOM 1707  S SD   . MET A 1 36 ? -9.593  8.438   -0.168  1.00 10.00 ? 445 MET A SD   2  
ATOM 1708  C CE   . MET A 1 36 ? -10.979 8.367   0.964   1.00 10.00 ? 445 MET A CE   2  
ATOM 1709  H H    . MET A 1 36 ? -4.804  7.012   1.428   1.00 10.00 ? 445 MET A H    2  
ATOM 1710  H HA   . MET A 1 36 ? -5.571  9.572   0.374   1.00 10.00 ? 445 MET A HA   2  
ATOM 1711  H HB2  . MET A 1 36 ? -7.007  7.646   -0.045  1.00 10.00 ? 445 MET A HB2  2  
ATOM 1712  H HB3  . MET A 1 36 ? -7.192  7.377   1.683   1.00 10.00 ? 445 MET A HB3  2  
ATOM 1713  H HG2  . MET A 1 36 ? -8.678  9.078   1.933   1.00 10.00 ? 445 MET A HG2  2  
ATOM 1714  H HG3  . MET A 1 36 ? -7.993  10.020  0.610   1.00 10.00 ? 445 MET A HG3  2  
ATOM 1715  H HE1  . MET A 1 36 ? -11.612 7.531   0.705   1.00 10.00 ? 445 MET A HE1  2  
ATOM 1716  H HE2  . MET A 1 36 ? -11.547 9.283   0.896   1.00 10.00 ? 445 MET A HE2  2  
ATOM 1717  H HE3  . MET A 1 36 ? -10.614 8.243   1.972   1.00 10.00 ? 445 MET A HE3  2  
ATOM 1718  N N    . GLN A 1 37 ? -5.560  8.908   3.581   1.00 10.00 ? 446 GLN A N    2  
ATOM 1719  C CA   . GLN A 1 37 ? -5.548  9.492   4.914   1.00 10.00 ? 446 GLN A CA   2  
ATOM 1720  C C    . GLN A 1 37 ? -4.360  10.433  5.038   1.00 10.00 ? 446 GLN A C    2  
ATOM 1721  O O    . GLN A 1 37 ? -4.438  11.486  5.672   1.00 10.00 ? 446 GLN A O    2  
ATOM 1722  C CB   . GLN A 1 37 ? -5.446  8.393   5.974   1.00 10.00 ? 446 GLN A CB   2  
ATOM 1723  C CG   . GLN A 1 37 ? -5.999  8.797   7.331   1.00 10.00 ? 446 GLN A CG   2  
ATOM 1724  C CD   . GLN A 1 37 ? -6.760  7.672   8.005   1.00 10.00 ? 446 GLN A CD   2  
ATOM 1725  O OE1  . GLN A 1 37 ? -6.520  7.354   9.170   1.00 10.00 ? 446 GLN A OE1  2  
ATOM 1726  N NE2  . GLN A 1 37 ? -7.686  7.061   7.273   1.00 10.00 ? 446 GLN A NE2  2  
ATOM 1727  H H    . GLN A 1 37 ? -5.345  7.957   3.476   1.00 10.00 ? 446 GLN A H    2  
ATOM 1728  H HA   . GLN A 1 37 ? -6.463  10.048  5.055   1.00 10.00 ? 446 GLN A HA   2  
ATOM 1729  H HB2  . GLN A 1 37 ? -5.993  7.528   5.632   1.00 10.00 ? 446 GLN A HB2  2  
ATOM 1730  H HB3  . GLN A 1 37 ? -4.403  8.122   6.098   1.00 10.00 ? 446 GLN A HB3  2  
ATOM 1731  H HG2  . GLN A 1 37 ? -5.178  9.087   7.969   1.00 10.00 ? 446 GLN A HG2  2  
ATOM 1732  H HG3  . GLN A 1 37 ? -6.666  9.636   7.198   1.00 10.00 ? 446 GLN A HG3  2  
ATOM 1733  H HE21 . GLN A 1 37 ? -7.824  7.367   6.352   1.00 10.00 ? 446 GLN A HE21 2  
ATOM 1734  H HE22 . GLN A 1 37 ? -8.191  6.329   7.682   1.00 10.00 ? 446 GLN A HE22 2  
ATOM 1735  N N    . HIS A 1 38 ? -3.262  10.032  4.410   1.00 10.00 ? 447 HIS A N    2  
ATOM 1736  C CA   . HIS A 1 38 ? -2.036  10.811  4.411   1.00 10.00 ? 447 HIS A CA   2  
ATOM 1737  C C    . HIS A 1 38 ? -1.847  11.482  3.050   1.00 10.00 ? 447 HIS A C    2  
ATOM 1738  O O    . HIS A 1 38 ? -1.090  10.997  2.209   1.00 10.00 ? 447 HIS A O    2  
ATOM 1739  C CB   . HIS A 1 38 ? -0.848  9.898   4.731   1.00 10.00 ? 447 HIS A CB   2  
ATOM 1740  C CG   . HIS A 1 38 ? -0.991  9.167   6.033   1.00 10.00 ? 447 HIS A CG   2  
ATOM 1741  N ND1  . HIS A 1 38 ? -0.697  9.744   7.251   1.00 10.00 ? 447 HIS A ND1  2  
ATOM 1742  C CD2  . HIS A 1 38 ? -1.406  7.902   6.312   1.00 10.00 ? 447 HIS A CD2  2  
ATOM 1743  C CE1  . HIS A 1 38 ? -0.922  8.871   8.216   1.00 10.00 ? 447 HIS A CE1  2  
ATOM 1744  N NE2  . HIS A 1 38 ? -1.354  7.749   7.673   1.00 10.00 ? 447 HIS A NE2  2  
ATOM 1745  H H    . HIS A 1 38 ? -3.281  9.184   3.921   1.00 10.00 ? 447 HIS A H    2  
ATOM 1746  H HA   . HIS A 1 38 ? -2.117  11.569  5.174   1.00 10.00 ? 447 HIS A HA   2  
ATOM 1747  H HB2  . HIS A 1 38 ? -0.748  9.162   3.947   1.00 10.00 ? 447 HIS A HB2  2  
ATOM 1748  H HB3  . HIS A 1 38 ? 0.052   10.493  4.779   1.00 10.00 ? 447 HIS A HB3  2  
ATOM 1749  H HD1  . HIS A 1 38 ? -0.371  10.658  7.387   1.00 10.00 ? 447 HIS A HD1  2  
ATOM 1750  H HD2  . HIS A 1 38 ? -1.711  7.148   5.597   1.00 10.00 ? 447 HIS A HD2  2  
ATOM 1751  H HE1  . HIS A 1 38 ? -0.765  9.041   9.271   1.00 10.00 ? 447 HIS A HE1  2  
ATOM 1752  H HE2  . HIS A 1 38 ? -1.699  6.979   8.172   1.00 10.00 ? 447 HIS A HE2  2  
ATOM 1753  N N    . PRO A 1 39 ? -2.555  12.605  2.811   1.00 10.00 ? 448 PRO A N    2  
ATOM 1754  C CA   . PRO A 1 39 ? -2.496  13.347  1.551   1.00 10.00 ? 448 PRO A CA   2  
ATOM 1755  C C    . PRO A 1 39 ? -1.094  13.405  0.951   1.00 10.00 ? 448 PRO A C    2  
ATOM 1756  O O    . PRO A 1 39 ? -0.214  14.094  1.467   1.00 10.00 ? 448 PRO A O    2  
ATOM 1757  C CB   . PRO A 1 39 ? -2.976  14.758  1.934   1.00 10.00 ? 448 PRO A CB   2  
ATOM 1758  C CG   . PRO A 1 39 ? -3.366  14.696  3.382   1.00 10.00 ? 448 PRO A CG   2  
ATOM 1759  C CD   . PRO A 1 39 ? -3.487  13.243  3.743   1.00 10.00 ? 448 PRO A CD   2  
ATOM 1760  H HA   . PRO A 1 39 ? -3.172  12.927  0.822   1.00 10.00 ? 448 PRO A HA   2  
ATOM 1761  H HB2  . PRO A 1 39 ? -2.174  15.465  1.778   1.00 10.00 ? 448 PRO A HB2  2  
ATOM 1762  H HB3  . PRO A 1 39 ? -3.819  15.029  1.315   1.00 10.00 ? 448 PRO A HB3  2  
ATOM 1763  H HG2  . PRO A 1 39 ? -2.604  15.166  3.985   1.00 10.00 ? 448 PRO A HG2  2  
ATOM 1764  H HG3  . PRO A 1 39 ? -4.313  15.195  3.525   1.00 10.00 ? 448 PRO A HG3  2  
ATOM 1765  H HD2  . PRO A 1 39 ? -3.185  13.081  4.767   1.00 10.00 ? 448 PRO A HD2  2  
ATOM 1766  H HD3  . PRO A 1 39 ? -4.495  12.893  3.582   1.00 10.00 ? 448 PRO A HD3  2  
ATOM 1767  N N    . LYS A 1 40 ? -0.902  12.677  -0.149  1.00 10.00 ? 449 LYS A N    2  
ATOM 1768  C CA   . LYS A 1 40 ? 0.386   12.638  -0.840  1.00 10.00 ? 449 LYS A CA   2  
ATOM 1769  C C    . LYS A 1 40 ? 1.538   12.500  0.149   1.00 10.00 ? 449 LYS A C    2  
ATOM 1770  O O    . LYS A 1 40 ? 2.151   13.493  0.543   1.00 10.00 ? 449 LYS A O    2  
ATOM 1771  C CB   . LYS A 1 40 ? 0.572   13.900  -1.684  1.00 10.00 ? 449 LYS A CB   2  
ATOM 1772  C CG   . LYS A 1 40 ? 1.430   13.684  -2.920  1.00 10.00 ? 449 LYS A CG   2  
ATOM 1773  C CD   . LYS A 1 40 ? 1.388   14.890  -3.844  1.00 10.00 ? 449 LYS A CD   2  
ATOM 1774  C CE   . LYS A 1 40 ? 1.441   14.474  -5.305  1.00 10.00 ? 449 LYS A CE   2  
ATOM 1775  N NZ   . LYS A 1 40 ? 0.147   13.899  -5.766  1.00 10.00 ? 449 LYS A NZ   2  
ATOM 1776  H H    . LYS A 1 40 ? -1.649  12.156  -0.509  1.00 10.00 ? 449 LYS A H    2  
ATOM 1777  H HA   . LYS A 1 40 ? 0.384   11.778  -1.493  1.00 10.00 ? 449 LYS A HA   2  
ATOM 1778  H HB2  . LYS A 1 40 ? -0.398  14.253  -2.002  1.00 10.00 ? 449 LYS A HB2  2  
ATOM 1779  H HB3  . LYS A 1 40 ? 1.040   14.660  -1.075  1.00 10.00 ? 449 LYS A HB3  2  
ATOM 1780  H HG2  . LYS A 1 40 ? 2.451   13.515  -2.613  1.00 10.00 ? 449 LYS A HG2  2  
ATOM 1781  H HG3  . LYS A 1 40 ? 1.063   12.820  -3.453  1.00 10.00 ? 449 LYS A HG3  2  
ATOM 1782  H HD2  . LYS A 1 40 ? 0.472   15.435  -3.668  1.00 10.00 ? 449 LYS A HD2  2  
ATOM 1783  H HD3  . LYS A 1 40 ? 2.234   15.527  -3.629  1.00 10.00 ? 449 LYS A HD3  2  
ATOM 1784  H HE2  . LYS A 1 40 ? 1.672   15.342  -5.905  1.00 10.00 ? 449 LYS A HE2  2  
ATOM 1785  H HE3  . LYS A 1 40 ? 2.218   13.735  -5.427  1.00 10.00 ? 449 LYS A HE3  2  
ATOM 1786  H HZ1  . LYS A 1 40 ? -0.027  14.159  -6.758  1.00 10.00 ? 449 LYS A HZ1  2  
ATOM 1787  H HZ2  . LYS A 1 40 ? -0.634  14.261  -5.182  1.00 10.00 ? 449 LYS A HZ2  2  
ATOM 1788  H HZ3  . LYS A 1 40 ? 0.169   12.862  -5.690  1.00 10.00 ? 449 LYS A HZ3  2  
ATOM 1789  N N    . ASN A 1 41 ? 1.827   11.267  0.550   1.00 10.00 ? 450 ASN A N    2  
ATOM 1790  C CA   . ASN A 1 41 ? 2.905   11.016  1.496   1.00 10.00 ? 450 ASN A CA   2  
ATOM 1791  C C    . ASN A 1 41 ? 3.863   9.951   0.981   1.00 10.00 ? 450 ASN A C    2  
ATOM 1792  O O    . ASN A 1 41 ? 5.078   10.149  0.977   1.00 10.00 ? 450 ASN A O    2  
ATOM 1793  C CB   . ASN A 1 41 ? 2.337   10.594  2.855   1.00 10.00 ? 450 ASN A CB   2  
ATOM 1794  C CG   . ASN A 1 41 ? 1.419   9.392   2.756   1.00 10.00 ? 450 ASN A CG   2  
ATOM 1795  O OD1  . ASN A 1 41 ? 0.649   9.262   1.804   1.00 10.00 ? 450 ASN A OD1  2  
ATOM 1796  N ND2  . ASN A 1 41 ? 1.495   8.503   3.740   1.00 10.00 ? 450 ASN A ND2  2  
ATOM 1797  H H    . ASN A 1 41 ? 1.305   10.515  0.206   1.00 10.00 ? 450 ASN A H    2  
ATOM 1798  H HA   . ASN A 1 41 ? 3.452   11.934  1.620   1.00 10.00 ? 450 ASN A HA   2  
ATOM 1799  H HB2  . ASN A 1 41 ? 3.152   10.346  3.517   1.00 10.00 ? 450 ASN A HB2  2  
ATOM 1800  H HB3  . ASN A 1 41 ? 1.777   11.418  3.274   1.00 10.00 ? 450 ASN A HB3  2  
ATOM 1801  H HD21 . ASN A 1 41 ? 2.131   8.670   4.468   1.00 10.00 ? 450 ASN A HD21 2  
ATOM 1802  H HD22 . ASN A 1 41 ? 0.912   7.716   3.700   1.00 10.00 ? 450 ASN A HD22 2  
ATOM 1803  N N    . PHE A 1 42 ? 3.315   8.813   0.563   1.00 10.00 ? 451 PHE A N    2  
ATOM 1804  C CA   . PHE A 1 42 ? 4.129   7.706   0.068   1.00 10.00 ? 451 PHE A CA   2  
ATOM 1805  C C    . PHE A 1 42 ? 5.312   7.473   1.000   1.00 10.00 ? 451 PHE A C    2  
ATOM 1806  O O    . PHE A 1 42 ? 6.468   7.432   0.582   1.00 10.00 ? 451 PHE A O    2  
ATOM 1807  C CB   . PHE A 1 42 ? 4.598   7.969   -1.369  1.00 10.00 ? 451 PHE A CB   2  
ATOM 1808  C CG   . PHE A 1 42 ? 4.090   6.955   -2.363  1.00 10.00 ? 451 PHE A CG   2  
ATOM 1809  C CD1  . PHE A 1 42 ? 2.848   6.364   -2.192  1.00 10.00 ? 451 PHE A CD1  2  
ATOM 1810  C CD2  . PHE A 1 42 ? 4.847   6.598   -3.470  1.00 10.00 ? 451 PHE A CD2  2  
ATOM 1811  C CE1  . PHE A 1 42 ? 2.371   5.441   -3.100  1.00 10.00 ? 451 PHE A CE1  2  
ATOM 1812  C CE2  . PHE A 1 42 ? 4.373   5.676   -4.384  1.00 10.00 ? 451 PHE A CE2  2  
ATOM 1813  C CZ   . PHE A 1 42 ? 3.133   5.096   -4.199  1.00 10.00 ? 451 PHE A CZ   2  
ATOM 1814  H H    . PHE A 1 42 ? 2.342   8.710   0.604   1.00 10.00 ? 451 PHE A H    2  
ATOM 1815  H HA   . PHE A 1 42 ? 3.513   6.821   0.079   1.00 10.00 ? 451 PHE A HA   2  
ATOM 1816  H HB2  . PHE A 1 42 ? 4.244   8.939   -1.680  1.00 10.00 ? 451 PHE A HB2  2  
ATOM 1817  H HB3  . PHE A 1 42 ? 5.677   7.956   -1.401  1.00 10.00 ? 451 PHE A HB3  2  
ATOM 1818  H HD1  . PHE A 1 42 ? 2.254   6.629   -1.332  1.00 10.00 ? 451 PHE A HD1  2  
ATOM 1819  H HD2  . PHE A 1 42 ? 5.817   7.046   -3.617  1.00 10.00 ? 451 PHE A HD2  2  
ATOM 1820  H HE1  . PHE A 1 42 ? 1.400   4.990   -2.952  1.00 10.00 ? 451 PHE A HE1  2  
ATOM 1821  H HE2  . PHE A 1 42 ? 4.972   5.408   -5.241  1.00 10.00 ? 451 PHE A HE2  2  
ATOM 1822  H HZ   . PHE A 1 42 ? 2.761   4.376   -4.912  1.00 10.00 ? 451 PHE A HZ   2  
ATOM 1823  N N    . GLY A 1 43 ? 4.982   7.322   2.273   1.00 10.00 ? 452 GLY A N    2  
ATOM 1824  C CA   . GLY A 1 43 ? 5.972   7.088   3.304   1.00 10.00 ? 452 GLY A CA   2  
ATOM 1825  C C    . GLY A 1 43 ? 5.391   6.222   4.394   1.00 10.00 ? 452 GLY A C    2  
ATOM 1826  O O    . GLY A 1 43 ? 5.954   5.183   4.743   1.00 10.00 ? 452 GLY A O    2  
ATOM 1827  H H    . GLY A 1 43 ? 4.035   7.365   2.519   1.00 10.00 ? 452 GLY A H    2  
ATOM 1828  H HA2  . GLY A 1 43 ? 6.830   6.595   2.870   1.00 10.00 ? 452 GLY A HA2  2  
ATOM 1829  H HA3  . GLY A 1 43 ? 6.278   8.033   3.728   1.00 10.00 ? 452 GLY A HA3  2  
ATOM 1830  N N    . LEU A 1 44 ? 4.232   6.631   4.899   1.00 10.00 ? 453 LEU A N    2  
ATOM 1831  C CA   . LEU A 1 44 ? 3.535   5.865   5.918   1.00 10.00 ? 453 LEU A CA   2  
ATOM 1832  C C    . LEU A 1 44 ? 2.784   4.733   5.243   1.00 10.00 ? 453 LEU A C    2  
ATOM 1833  O O    . LEU A 1 44 ? 2.726   3.613   5.750   1.00 10.00 ? 453 LEU A O    2  
ATOM 1834  C CB   . LEU A 1 44 ? 2.555   6.741   6.702   1.00 10.00 ? 453 LEU A CB   2  
ATOM 1835  C CG   . LEU A 1 44 ? 1.583   5.967   7.599   1.00 10.00 ? 453 LEU A CG   2  
ATOM 1836  C CD1  . LEU A 1 44 ? 1.155   6.818   8.784   1.00 10.00 ? 453 LEU A CD1  2  
ATOM 1837  C CD2  . LEU A 1 44 ? 0.372   5.496   6.799   1.00 10.00 ? 453 LEU A CD2  2  
ATOM 1838  H H    . LEU A 1 44 ? 3.820   7.450   4.552   1.00 10.00 ? 453 LEU A H    2  
ATOM 1839  H HA   . LEU A 1 44 ? 4.270   5.453   6.592   1.00 10.00 ? 453 LEU A HA   2  
ATOM 1840  H HB2  . LEU A 1 44 ? 3.124   7.420   7.321   1.00 10.00 ? 453 LEU A HB2  2  
ATOM 1841  H HB3  . LEU A 1 44 ? 1.977   7.319   5.998   1.00 10.00 ? 453 LEU A HB3  2  
ATOM 1842  H HG   . LEU A 1 44 ? 2.085   5.096   7.987   1.00 10.00 ? 453 LEU A HG   2  
ATOM 1843  H HD11 . LEU A 1 44 ? 0.119   6.621   9.013   1.00 10.00 ? 453 LEU A HD11 2  
ATOM 1844  H HD12 . LEU A 1 44 ? 1.281   7.862   8.541   1.00 10.00 ? 453 LEU A HD12 2  
ATOM 1845  H HD13 . LEU A 1 44 ? 1.765   6.572   9.641   1.00 10.00 ? 453 LEU A HD13 2  
ATOM 1846  H HD21 . LEU A 1 44 ? 0.261   6.108   5.916   1.00 10.00 ? 453 LEU A HD21 2  
ATOM 1847  H HD22 . LEU A 1 44 ? -0.518  5.577   7.407   1.00 10.00 ? 453 LEU A HD22 2  
ATOM 1848  H HD23 . LEU A 1 44 ? 0.510   4.464   6.505   1.00 10.00 ? 453 LEU A HD23 2  
ATOM 1849  N N    . ILE A 1 45 ? 2.221   5.040   4.076   1.00 10.00 ? 454 ILE A N    2  
ATOM 1850  C CA   . ILE A 1 45 ? 1.486   4.059   3.306   1.00 10.00 ? 454 ILE A CA   2  
ATOM 1851  C C    . ILE A 1 45 ? 2.390   2.886   2.955   1.00 10.00 ? 454 ILE A C    2  
ATOM 1852  O O    . ILE A 1 45 ? 1.977   1.730   3.010   1.00 10.00 ? 454 ILE A O    2  
ATOM 1853  C CB   . ILE A 1 45 ? 0.931   4.679   2.012   1.00 10.00 ? 454 ILE A CB   2  
ATOM 1854  C CG1  . ILE A 1 45 ? -0.045  3.702   1.350   1.00 10.00 ? 454 ILE A CG1  2  
ATOM 1855  C CG2  . ILE A 1 45 ? 2.074   5.056   1.074   1.00 10.00 ? 454 ILE A CG2  2  
ATOM 1856  C CD1  . ILE A 1 45 ? -0.027  3.736   -0.166  1.00 10.00 ? 454 ILE A CD1  2  
ATOM 1857  H H    . ILE A 1 45 ? 2.315   5.949   3.718   1.00 10.00 ? 454 ILE A H    2  
ATOM 1858  H HA   . ILE A 1 45 ? 0.659   3.707   3.904   1.00 10.00 ? 454 ILE A HA   2  
ATOM 1859  H HB   . ILE A 1 45 ? 0.403   5.586   2.271   1.00 10.00 ? 454 ILE A HB   2  
ATOM 1860  H HG12 . ILE A 1 45 ? 0.203   2.698   1.663   1.00 10.00 ? 454 ILE A HG12 2  
ATOM 1861  H HG13 . ILE A 1 45 ? -1.051  3.936   1.676   1.00 10.00 ? 454 ILE A HG13 2  
ATOM 1862  H HG21 . ILE A 1 45 ? 1.677   5.587   0.221   1.00 10.00 ? 454 ILE A HG21 2  
ATOM 1863  H HG22 . ILE A 1 45 ? 2.575   4.161   0.739   1.00 10.00 ? 454 ILE A HG22 2  
ATOM 1864  H HG23 . ILE A 1 45 ? 2.776   5.688   1.598   1.00 10.00 ? 454 ILE A HG23 2  
ATOM 1865  H HD11 . ILE A 1 45 ? 0.250   4.725   -0.500  1.00 10.00 ? 454 ILE A HD11 2  
ATOM 1866  H HD12 . ILE A 1 45 ? -1.006  3.488   -0.545  1.00 10.00 ? 454 ILE A HD12 2  
ATOM 1867  H HD13 . ILE A 1 45 ? 0.694   3.019   -0.533  1.00 10.00 ? 454 ILE A HD13 2  
ATOM 1868  N N    . ALA A 1 46 ? 3.632   3.206   2.602   1.00 10.00 ? 455 ALA A N    2  
ATOM 1869  C CA   . ALA A 1 46 ? 4.619   2.196   2.249   1.00 10.00 ? 455 ALA A CA   2  
ATOM 1870  C C    . ALA A 1 46 ? 5.434   1.772   3.468   1.00 10.00 ? 455 ALA A C    2  
ATOM 1871  O O    . ALA A 1 46 ? 6.475   1.128   3.335   1.00 10.00 ? 455 ALA A O    2  
ATOM 1872  C CB   . ALA A 1 46 ? 5.540   2.722   1.159   1.00 10.00 ? 455 ALA A CB   2  
ATOM 1873  H H    . ALA A 1 46 ? 3.893   4.150   2.589   1.00 10.00 ? 455 ALA A H    2  
ATOM 1874  H HA   . ALA A 1 46 ? 4.095   1.338   1.860   1.00 10.00 ? 455 ALA A HA   2  
ATOM 1875  H HB1  . ALA A 1 46 ? 5.767   3.760   1.350   1.00 10.00 ? 455 ALA A HB1  2  
ATOM 1876  H HB2  . ALA A 1 46 ? 5.053   2.631   0.200   1.00 10.00 ? 455 ALA A HB2  2  
ATOM 1877  H HB3  . ALA A 1 46 ? 6.456   2.150   1.154   1.00 10.00 ? 455 ALA A HB3  2  
ATOM 1878  N N    . SER A 1 47 ? 4.961   2.143   4.657   1.00 10.00 ? 456 SER A N    2  
ATOM 1879  C CA   . SER A 1 47 ? 5.655   1.803   5.892   1.00 10.00 ? 456 SER A CA   2  
ATOM 1880  C C    . SER A 1 47 ? 4.828   0.854   6.753   1.00 10.00 ? 456 SER A C    2  
ATOM 1881  O O    . SER A 1 47 ? 5.380   0.084   7.538   1.00 10.00 ? 456 SER A O    2  
ATOM 1882  C CB   . SER A 1 47 ? 5.983   3.072   6.682   1.00 10.00 ? 456 SER A CB   2  
ATOM 1883  O OG   . SER A 1 47 ? 7.297   3.522   6.403   1.00 10.00 ? 456 SER A OG   2  
ATOM 1884  H H    . SER A 1 47 ? 4.130   2.659   4.703   1.00 10.00 ? 456 SER A H    2  
ATOM 1885  H HA   . SER A 1 47 ? 6.579   1.312   5.626   1.00 10.00 ? 456 SER A HA   2  
ATOM 1886  H HB2  . SER A 1 47 ? 5.286   3.849   6.413   1.00 10.00 ? 456 SER A HB2  2  
ATOM 1887  H HB3  . SER A 1 47 ? 5.902   2.866   7.740   1.00 10.00 ? 456 SER A HB3  2  
ATOM 1888  H HG   . SER A 1 47 ? 7.932   2.895   6.756   1.00 10.00 ? 456 SER A HG   2  
ATOM 1889  N N    . PHE A 1 48 ? 3.504   0.903   6.606   1.00 10.00 ? 457 PHE A N    2  
ATOM 1890  C CA   . PHE A 1 48 ? 2.635   0.028   7.385   1.00 10.00 ? 457 PHE A CA   2  
ATOM 1891  C C    . PHE A 1 48 ? 2.473   -1.325  6.693   1.00 10.00 ? 457 PHE A C    2  
ATOM 1892  O O    . PHE A 1 48 ? 2.162   -2.328  7.334   1.00 10.00 ? 457 PHE A O    2  
ATOM 1893  C CB   . PHE A 1 48 ? 1.271   0.687   7.630   1.00 10.00 ? 457 PHE A CB   2  
ATOM 1894  C CG   . PHE A 1 48 ? 0.328   0.600   6.465   1.00 10.00 ? 457 PHE A CG   2  
ATOM 1895  C CD1  . PHE A 1 48 ? -0.349  -0.581  6.192   1.00 10.00 ? 457 PHE A CD1  2  
ATOM 1896  C CD2  . PHE A 1 48 ? 0.124   1.693   5.637   1.00 10.00 ? 457 PHE A CD2  2  
ATOM 1897  C CE1  . PHE A 1 48 ? -1.206  -0.670  5.120   1.00 10.00 ? 457 PHE A CE1  2  
ATOM 1898  C CE2  . PHE A 1 48 ? -0.735  1.609   4.564   1.00 10.00 ? 457 PHE A CE2  2  
ATOM 1899  C CZ   . PHE A 1 48 ? -1.400  0.430   4.302   1.00 10.00 ? 457 PHE A CZ   2  
ATOM 1900  H H    . PHE A 1 48 ? 3.107   1.531   5.960   1.00 10.00 ? 457 PHE A H    2  
ATOM 1901  H HA   . PHE A 1 48 ? 3.116   -0.137  8.339   1.00 10.00 ? 457 PHE A HA   2  
ATOM 1902  H HB2  . PHE A 1 48 ? 0.796   0.209   8.474   1.00 10.00 ? 457 PHE A HB2  2  
ATOM 1903  H HB3  . PHE A 1 48 ? 1.422   1.733   7.857   1.00 10.00 ? 457 PHE A HB3  2  
ATOM 1904  H HD1  . PHE A 1 48 ? -0.207  -1.438  6.832   1.00 10.00 ? 457 PHE A HD1  2  
ATOM 1905  H HD2  . PHE A 1 48 ? 0.640   2.622   5.841   1.00 10.00 ? 457 PHE A HD2  2  
ATOM 1906  H HE1  . PHE A 1 48 ? -1.720  -1.602  4.921   1.00 10.00 ? 457 PHE A HE1  2  
ATOM 1907  H HE2  . PHE A 1 48 ? -0.883  2.465   3.924   1.00 10.00 ? 457 PHE A HE2  2  
ATOM 1908  H HZ   . PHE A 1 48 ? -2.071  0.370   3.464   1.00 10.00 ? 457 PHE A HZ   2  
ATOM 1909  N N    . LEU A 1 49 ? 2.701   -1.346  5.380   1.00 10.00 ? 458 LEU A N    2  
ATOM 1910  C CA   . LEU A 1 49 ? 2.596   -2.578  4.604   1.00 10.00 ? 458 LEU A CA   2  
ATOM 1911  C C    . LEU A 1 49 ? 3.960   -2.968  4.038   1.00 10.00 ? 458 LEU A C    2  
ATOM 1912  O O    . LEU A 1 49 ? 4.075   -3.338  2.875   1.00 10.00 ? 458 LEU A O    2  
ATOM 1913  C CB   . LEU A 1 49 ? 1.568   -2.423  3.477   1.00 10.00 ? 458 LEU A CB   2  
ATOM 1914  C CG   . LEU A 1 49 ? 1.497   -1.030  2.852   1.00 10.00 ? 458 LEU A CG   2  
ATOM 1915  C CD1  . LEU A 1 49 ? 2.843   -0.658  2.261   1.00 10.00 ? 458 LEU A CD1  2  
ATOM 1916  C CD2  . LEU A 1 49 ? 0.407   -0.971  1.789   1.00 10.00 ? 458 LEU A CD2  2  
ATOM 1917  H H    . LEU A 1 49 ? 2.955   -0.517  4.925   1.00 10.00 ? 458 LEU A H    2  
ATOM 1918  H HA   . LEU A 1 49 ? 2.270   -3.356  5.271   1.00 10.00 ? 458 LEU A HA   2  
ATOM 1919  H HB2  . LEU A 1 49 ? 1.809   -3.132  2.699   1.00 10.00 ? 458 LEU A HB2  2  
ATOM 1920  H HB3  . LEU A 1 49 ? 0.593   -2.665  3.873   1.00 10.00 ? 458 LEU A HB3  2  
ATOM 1921  H HG   . LEU A 1 49 ? 1.258   -0.309  3.620   1.00 10.00 ? 458 LEU A HG   2  
ATOM 1922  H HD11 . LEU A 1 49 ? 3.337   -1.546  1.902   1.00 10.00 ? 458 LEU A HD11 2  
ATOM 1923  H HD12 . LEU A 1 49 ? 3.452   -0.189  3.021   1.00 10.00 ? 458 LEU A HD12 2  
ATOM 1924  H HD13 . LEU A 1 49 ? 2.698   0.030   1.441   1.00 10.00 ? 458 LEU A HD13 2  
ATOM 1925  H HD21 . LEU A 1 49 ? -0.488  -0.530  2.208   1.00 10.00 ? 458 LEU A HD21 2  
ATOM 1926  H HD22 . LEU A 1 49 ? 0.185   -1.970  1.443   1.00 10.00 ? 458 LEU A HD22 2  
ATOM 1927  H HD23 . LEU A 1 49 ? 0.746   -0.372  0.957   1.00 10.00 ? 458 LEU A HD23 2  
ATOM 1928  N N    . GLU A 1 50 ? 4.976   -2.871  4.900   1.00 10.00 ? 459 GLU A N    2  
ATOM 1929  C CA   . GLU A 1 50 ? 6.380   -3.193  4.579   1.00 10.00 ? 459 GLU A CA   2  
ATOM 1930  C C    . GLU A 1 50 ? 6.582   -3.784  3.183   1.00 10.00 ? 459 GLU A C    2  
ATOM 1931  O O    . GLU A 1 50 ? 7.321   -3.227  2.371   1.00 10.00 ? 459 GLU A O    2  
ATOM 1932  C CB   . GLU A 1 50 ? 6.938   -4.160  5.624   1.00 10.00 ? 459 GLU A CB   2  
ATOM 1933  C CG   . GLU A 1 50 ? 8.436   -4.024  5.839   1.00 10.00 ? 459 GLU A CG   2  
ATOM 1934  C CD   . GLU A 1 50 ? 8.827   -4.130  7.300   1.00 10.00 ? 459 GLU A CD   2  
ATOM 1935  O OE1  . GLU A 1 50 ? 8.688   -5.231  7.873   1.00 10.00 ? 459 GLU A OE1  2  
ATOM 1936  O OE2  . GLU A 1 50 ? 9.271   -3.112  7.871   1.00 10.00 ? 459 GLU A OE2  2  
ATOM 1937  H H    . GLU A 1 50 ? 4.773   -2.563  5.804   1.00 10.00 ? 459 GLU A H    2  
ATOM 1938  H HA   . GLU A 1 50 ? 6.940   -2.273  4.640   1.00 10.00 ? 459 GLU A HA   2  
ATOM 1939  H HB2  . GLU A 1 50 ? 6.442   -3.979  6.566   1.00 10.00 ? 459 GLU A HB2  2  
ATOM 1940  H HB3  . GLU A 1 50 ? 6.731   -5.172  5.307   1.00 10.00 ? 459 GLU A HB3  2  
ATOM 1941  H HG2  . GLU A 1 50 ? 8.938   -4.807  5.291   1.00 10.00 ? 459 GLU A HG2  2  
ATOM 1942  H HG3  . GLU A 1 50 ? 8.755   -3.062  5.465   1.00 10.00 ? 459 GLU A HG3  2  
ATOM 1943  N N    . ARG A 1 51 ? 5.934   -4.917  2.911   1.00 10.00 ? 460 ARG A N    2  
ATOM 1944  C CA   . ARG A 1 51 ? 6.054   -5.586  1.614   1.00 10.00 ? 460 ARG A CA   2  
ATOM 1945  C C    . ARG A 1 51 ? 5.997   -4.584  0.466   1.00 10.00 ? 460 ARG A C    2  
ATOM 1946  O O    . ARG A 1 51 ? 6.581   -4.801  -0.595  1.00 10.00 ? 460 ARG A O    2  
ATOM 1947  C CB   . ARG A 1 51 ? 4.947   -6.630  1.449   1.00 10.00 ? 460 ARG A CB   2  
ATOM 1948  C CG   . ARG A 1 51 ? 5.064   -7.798  2.412   1.00 10.00 ? 460 ARG A CG   2  
ATOM 1949  C CD   . ARG A 1 51 ? 6.156   -8.766  1.986   1.00 10.00 ? 460 ARG A CD   2  
ATOM 1950  N NE   . ARG A 1 51 ? 6.847   -9.352  3.132   1.00 10.00 ? 460 ARG A NE   2  
ATOM 1951  C CZ   . ARG A 1 51 ? 6.276   -10.193 3.991   1.00 10.00 ? 460 ARG A CZ   2  
ATOM 1952  N NH1  . ARG A 1 51 ? 5.006   -10.548 3.838   1.00 10.00 ? 460 ARG A NH1  2  
ATOM 1953  N NH2  . ARG A 1 51 ? 6.976   -10.681 5.006   1.00 10.00 ? 460 ARG A NH2  2  
ATOM 1954  H H    . ARG A 1 51 ? 5.364   -5.312  3.598   1.00 10.00 ? 460 ARG A H    2  
ATOM 1955  H HA   . ARG A 1 51 ? 7.011   -6.085  1.589   1.00 10.00 ? 460 ARG A HA   2  
ATOM 1956  H HB2  . ARG A 1 51 ? 3.992   -6.152  1.608   1.00 10.00 ? 460 ARG A HB2  2  
ATOM 1957  H HB3  . ARG A 1 51 ? 4.982   -7.016  0.441   1.00 10.00 ? 460 ARG A HB3  2  
ATOM 1958  H HG2  . ARG A 1 51 ? 5.297   -7.419  3.397   1.00 10.00 ? 460 ARG A HG2  2  
ATOM 1959  H HG3  . ARG A 1 51 ? 4.120   -8.324  2.441   1.00 10.00 ? 460 ARG A HG3  2  
ATOM 1960  H HD2  . ARG A 1 51 ? 5.710   -9.558  1.403   1.00 10.00 ? 460 ARG A HD2  2  
ATOM 1961  H HD3  . ARG A 1 51 ? 6.874   -8.233  1.379   1.00 10.00 ? 460 ARG A HD3  2  
ATOM 1962  H HE   . ARG A 1 51 ? 7.786   -9.107  3.269   1.00 10.00 ? 460 ARG A HE   2  
ATOM 1963  H HH11 . ARG A 1 51 ? 4.472   -10.184 3.075   1.00 10.00 ? 460 ARG A HH11 2  
ATOM 1964  H HH12 . ARG A 1 51 ? 4.583   -11.181 4.487   1.00 10.00 ? 460 ARG A HH12 2  
ATOM 1965  H HH21 . ARG A 1 51 ? 7.933   -10.417 5.125   1.00 10.00 ? 460 ARG A HH21 2  
ATOM 1966  H HH22 . ARG A 1 51 ? 6.547   -11.313 5.651   1.00 10.00 ? 460 ARG A HH22 2  
ATOM 1967  N N    . LYS A 1 52 ? 5.294   -3.480  0.694   1.00 10.00 ? 461 LYS A N    2  
ATOM 1968  C CA   . LYS A 1 52 ? 5.165   -2.435  -0.314  1.00 10.00 ? 461 LYS A CA   2  
ATOM 1969  C C    . LYS A 1 52 ? 5.987   -1.214  0.078   1.00 10.00 ? 461 LYS A C    2  
ATOM 1970  O O    . LYS A 1 52 ? 5.685   -0.538  1.062   1.00 10.00 ? 461 LYS A O    2  
ATOM 1971  C CB   . LYS A 1 52 ? 3.698   -2.024  -0.511  1.00 10.00 ? 461 LYS A CB   2  
ATOM 1972  C CG   . LYS A 1 52 ? 2.680   -3.030  0.013   1.00 10.00 ? 461 LYS A CG   2  
ATOM 1973  C CD   . LYS A 1 52 ? 2.202   -3.954  -1.094  1.00 10.00 ? 461 LYS A CD   2  
ATOM 1974  C CE   . LYS A 1 52 ? 2.873   -5.314  -1.017  1.00 10.00 ? 461 LYS A CE   2  
ATOM 1975  N NZ   . LYS A 1 52 ? 2.255   -6.181  0.024   1.00 10.00 ? 461 LYS A NZ   2  
ATOM 1976  H H    . LYS A 1 52 ? 4.857   -3.365  1.565   1.00 10.00 ? 461 LYS A H    2  
ATOM 1977  H HA   . LYS A 1 52 ? 5.548   -2.825  -1.244  1.00 10.00 ? 461 LYS A HA   2  
ATOM 1978  H HB2  . LYS A 1 52 ? 3.530   -1.085  -0.010  1.00 10.00 ? 461 LYS A HB2  2  
ATOM 1979  H HB3  . LYS A 1 52 ? 3.521   -1.890  -1.567  1.00 10.00 ? 461 LYS A HB3  2  
ATOM 1980  H HG2  . LYS A 1 52 ? 3.129   -3.621  0.797   1.00 10.00 ? 461 LYS A HG2  2  
ATOM 1981  H HG3  . LYS A 1 52 ? 1.833   -2.491  0.411   1.00 10.00 ? 461 LYS A HG3  2  
ATOM 1982  H HD2  . LYS A 1 52 ? 1.135   -4.084  -1.006  1.00 10.00 ? 461 LYS A HD2  2  
ATOM 1983  H HD3  . LYS A 1 52 ? 2.435   -3.502  -2.049  1.00 10.00 ? 461 LYS A HD3  2  
ATOM 1984  H HE2  . LYS A 1 52 ? 2.782   -5.800  -1.978  1.00 10.00 ? 461 LYS A HE2  2  
ATOM 1985  H HE3  . LYS A 1 52 ? 3.918   -5.174  -0.785  1.00 10.00 ? 461 LYS A HE3  2  
ATOM 1986  H HZ1  . LYS A 1 52 ? 1.302   -6.474  -0.273  1.00 10.00 ? 461 LYS A HZ1  2  
ATOM 1987  H HZ2  . LYS A 1 52 ? 2.181   -5.663  0.922   1.00 10.00 ? 461 LYS A HZ2  2  
ATOM 1988  H HZ3  . LYS A 1 52 ? 2.837   -7.030  0.174   1.00 10.00 ? 461 LYS A HZ3  2  
ATOM 1989  N N    . THR A 1 53 ? 7.025   -0.935  -0.699  1.00 10.00 ? 462 THR A N    2  
ATOM 1990  C CA   . THR A 1 53 ? 7.890   0.209   -0.433  1.00 10.00 ? 462 THR A CA   2  
ATOM 1991  C C    . THR A 1 53 ? 7.327   1.470   -1.079  1.00 10.00 ? 462 THR A C    2  
ATOM 1992  O O    . THR A 1 53 ? 6.369   1.407   -1.849  1.00 10.00 ? 462 THR A O    2  
ATOM 1993  C CB   . THR A 1 53 ? 9.306   -0.060  -0.950  1.00 10.00 ? 462 THR A CB   2  
ATOM 1994  O OG1  . THR A 1 53 ? 9.306   -1.123  -1.887  1.00 10.00 ? 462 THR A OG1  2  
ATOM 1995  C CG2  . THR A 1 53 ? 10.286  -0.414  0.148   1.00 10.00 ? 462 THR A CG2  2  
ATOM 1996  H H    . THR A 1 53 ? 7.212   -1.509  -1.470  1.00 10.00 ? 462 THR A H    2  
ATOM 1997  H HA   . THR A 1 53 ? 7.929   0.354   0.636   1.00 10.00 ? 462 THR A HA   2  
ATOM 1998  H HB   . THR A 1 53 ? 9.673   0.827   -1.446  1.00 10.00 ? 462 THR A HB   2  
ATOM 1999  H HG1  . THR A 1 53 ? 9.147   -1.954  -1.431  1.00 10.00 ? 462 THR A HG1  2  
ATOM 2000  H HG21 . THR A 1 53 ? 11.247  0.024   -0.072  1.00 10.00 ? 462 THR A HG21 2  
ATOM 2001  H HG22 . THR A 1 53 ? 10.386  -1.489  0.208   1.00 10.00 ? 462 THR A HG22 2  
ATOM 2002  H HG23 . THR A 1 53 ? 9.923   -0.033  1.091   1.00 10.00 ? 462 THR A HG23 2  
ATOM 2003  N N    . VAL A 1 54 ? 7.926   2.613   -0.765  1.00 10.00 ? 463 VAL A N    2  
ATOM 2004  C CA   . VAL A 1 54 ? 7.479   3.883   -1.322  1.00 10.00 ? 463 VAL A CA   2  
ATOM 2005  C C    . VAL A 1 54 ? 7.620   3.885   -2.841  1.00 10.00 ? 463 VAL A C    2  
ATOM 2006  O O    . VAL A 1 54 ? 6.649   4.106   -3.565  1.00 10.00 ? 463 VAL A O    2  
ATOM 2007  C CB   . VAL A 1 54 ? 8.271   5.067   -0.727  1.00 10.00 ? 463 VAL A CB   2  
ATOM 2008  C CG1  . VAL A 1 54 ? 7.922   6.368   -1.437  1.00 10.00 ? 463 VAL A CG1  2  
ATOM 2009  C CG2  . VAL A 1 54 ? 8.009   5.183   0.768   1.00 10.00 ? 463 VAL A CG2  2  
ATOM 2010  H H    . VAL A 1 54 ? 8.687   2.602   -0.147  1.00 10.00 ? 463 VAL A H    2  
ATOM 2011  H HA   . VAL A 1 54 ? 6.436   4.008   -1.069  1.00 10.00 ? 463 VAL A HA   2  
ATOM 2012  H HB   . VAL A 1 54 ? 9.325   4.877   -0.871  1.00 10.00 ? 463 VAL A HB   2  
ATOM 2013  H HG11 . VAL A 1 54 ? 8.199   7.205   -0.813  1.00 10.00 ? 463 VAL A HG11 2  
ATOM 2014  H HG12 . VAL A 1 54 ? 6.860   6.399   -1.629  1.00 10.00 ? 463 VAL A HG12 2  
ATOM 2015  H HG13 . VAL A 1 54 ? 8.458   6.423   -2.372  1.00 10.00 ? 463 VAL A HG13 2  
ATOM 2016  H HG21 . VAL A 1 54 ? 6.948   5.303   0.939   1.00 10.00 ? 463 VAL A HG21 2  
ATOM 2017  H HG22 . VAL A 1 54 ? 8.536   6.040   1.160   1.00 10.00 ? 463 VAL A HG22 2  
ATOM 2018  H HG23 . VAL A 1 54 ? 8.355   4.289   1.264   1.00 10.00 ? 463 VAL A HG23 2  
ATOM 2019  N N    . ALA A 1 55 ? 8.834   3.631   -3.318  1.00 10.00 ? 464 ALA A N    2  
ATOM 2020  C CA   . ALA A 1 55 ? 9.098   3.599   -4.751  1.00 10.00 ? 464 ALA A CA   2  
ATOM 2021  C C    . ALA A 1 55 ? 8.428   2.393   -5.404  1.00 10.00 ? 464 ALA A C    2  
ATOM 2022  O O    . ALA A 1 55 ? 8.147   2.401   -6.602  1.00 10.00 ? 464 ALA A O    2  
ATOM 2023  C CB   . ALA A 1 55 ? 10.597  3.576   -5.010  1.00 10.00 ? 464 ALA A CB   2  
ATOM 2024  H H    . ALA A 1 55 ? 9.568   3.458   -2.693  1.00 10.00 ? 464 ALA A H    2  
ATOM 2025  H HA   . ALA A 1 55 ? 8.695   4.502   -5.186  1.00 10.00 ? 464 ALA A HA   2  
ATOM 2026  H HB1  . ALA A 1 55 ? 10.957  4.587   -5.132  1.00 10.00 ? 464 ALA A HB1  2  
ATOM 2027  H HB2  . ALA A 1 55 ? 10.799  3.012   -5.909  1.00 10.00 ? 464 ALA A HB2  2  
ATOM 2028  H HB3  . ALA A 1 55 ? 11.101  3.114   -4.174  1.00 10.00 ? 464 ALA A HB3  2  
ATOM 2029  N N    . GLU A 1 56 ? 8.176   1.358   -4.607  1.00 10.00 ? 465 GLU A N    2  
ATOM 2030  C CA   . GLU A 1 56 ? 7.538   0.145   -5.107  1.00 10.00 ? 465 GLU A CA   2  
ATOM 2031  C C    . GLU A 1 56 ? 6.017   0.225   -4.987  1.00 10.00 ? 465 GLU A C    2  
ATOM 2032  O O    . GLU A 1 56 ? 5.300   -0.595  -5.560  1.00 10.00 ? 465 GLU A O    2  
ATOM 2033  C CB   . GLU A 1 56 ? 8.056   -1.076  -4.348  1.00 10.00 ? 465 GLU A CB   2  
ATOM 2034  C CG   . GLU A 1 56 ? 7.727   -2.397  -5.025  1.00 10.00 ? 465 GLU A CG   2  
ATOM 2035  C CD   . GLU A 1 56 ? 8.220   -3.595  -4.235  1.00 10.00 ? 465 GLU A CD   2  
ATOM 2036  O OE1  . GLU A 1 56 ? 9.428   -3.900  -4.313  1.00 10.00 ? 465 GLU A OE1  2  
ATOM 2037  O OE2  . GLU A 1 56 ? 7.397   -4.227  -3.539  1.00 10.00 ? 465 GLU A OE2  2  
ATOM 2038  H H    . GLU A 1 56 ? 8.424   1.410   -3.661  1.00 10.00 ? 465 GLU A H    2  
ATOM 2039  H HA   . GLU A 1 56 ? 7.798   0.044   -6.151  1.00 10.00 ? 465 GLU A HA   2  
ATOM 2040  H HB2  . GLU A 1 56 ? 9.129   -1.001  -4.256  1.00 10.00 ? 465 GLU A HB2  2  
ATOM 2041  H HB3  . GLU A 1 56 ? 7.619   -1.084  -3.361  1.00 10.00 ? 465 GLU A HB3  2  
ATOM 2042  H HG2  . GLU A 1 56 ? 6.655   -2.475  -5.133  1.00 10.00 ? 465 GLU A HG2  2  
ATOM 2043  H HG3  . GLU A 1 56 ? 8.190   -2.413  -6.000  1.00 10.00 ? 465 GLU A HG3  2  
ATOM 2044  N N    . CYS A 1 57 ? 5.525   1.216   -4.244  1.00 10.00 ? 466 CYS A N    2  
ATOM 2045  C CA   . CYS A 1 57 ? 4.090   1.390   -4.065  1.00 10.00 ? 466 CYS A CA   2  
ATOM 2046  C C    . CYS A 1 57 ? 3.469   2.021   -5.303  1.00 10.00 ? 466 CYS A C    2  
ATOM 2047  O O    . CYS A 1 57 ? 2.273   1.870   -5.555  1.00 10.00 ? 466 CYS A O    2  
ATOM 2048  C CB   . CYS A 1 57 ? 3.803   2.249   -2.832  1.00 10.00 ? 466 CYS A CB   2  
ATOM 2049  S SG   . CYS A 1 57 ? 3.360   1.297   -1.359  1.00 10.00 ? 466 CYS A SG   2  
ATOM 2050  H H    . CYS A 1 57 ? 6.140   1.846   -3.813  1.00 10.00 ? 466 CYS A H    2  
ATOM 2051  H HA   . CYS A 1 57 ? 3.654   0.411   -3.921  1.00 10.00 ? 466 CYS A HA   2  
ATOM 2052  H HB2  . CYS A 1 57 ? 4.680   2.831   -2.594  1.00 10.00 ? 466 CYS A HB2  2  
ATOM 2053  H HB3  . CYS A 1 57 ? 2.982   2.917   -3.049  1.00 10.00 ? 466 CYS A HB3  2  
ATOM 2054  H HG   . CYS A 1 57 ? 2.765   0.594   -1.629  1.00 10.00 ? 466 CYS A HG   2  
ATOM 2055  N N    . VAL A 1 58 ? 4.292   2.712   -6.090  1.00 10.00 ? 467 VAL A N    2  
ATOM 2056  C CA   . VAL A 1 58 ? 3.821   3.343   -7.314  1.00 10.00 ? 467 VAL A CA   2  
ATOM 2057  C C    . VAL A 1 58 ? 3.176   2.308   -8.234  1.00 10.00 ? 467 VAL A C    2  
ATOM 2058  O O    . VAL A 1 58 ? 2.420   2.651   -9.141  1.00 10.00 ? 467 VAL A O    2  
ATOM 2059  C CB   . VAL A 1 58 ? 4.972   4.039   -8.069  1.00 10.00 ? 467 VAL A CB   2  
ATOM 2060  C CG1  . VAL A 1 58 ? 6.071   3.042   -8.405  1.00 10.00 ? 467 VAL A CG1  2  
ATOM 2061  C CG2  . VAL A 1 58 ? 4.456   4.717   -9.330  1.00 10.00 ? 467 VAL A CG2  2  
ATOM 2062  H H    . VAL A 1 58 ? 5.238   2.786   -5.846  1.00 10.00 ? 467 VAL A H    2  
ATOM 2063  H HA   . VAL A 1 58 ? 3.087   4.089   -7.047  1.00 10.00 ? 467 VAL A HA   2  
ATOM 2064  H HB   . VAL A 1 58 ? 5.391   4.798   -7.425  1.00 10.00 ? 467 VAL A HB   2  
ATOM 2065  H HG11 . VAL A 1 58 ? 7.011   3.563   -8.503  1.00 10.00 ? 467 VAL A HG11 2  
ATOM 2066  H HG12 . VAL A 1 58 ? 5.834   2.545   -9.333  1.00 10.00 ? 467 VAL A HG12 2  
ATOM 2067  H HG13 . VAL A 1 58 ? 6.146   2.310   -7.614  1.00 10.00 ? 467 VAL A HG13 2  
ATOM 2068  H HG21 . VAL A 1 58 ? 3.731   5.472   -9.062  1.00 10.00 ? 467 VAL A HG21 2  
ATOM 2069  H HG22 . VAL A 1 58 ? 3.989   3.981   -9.970  1.00 10.00 ? 467 VAL A HG22 2  
ATOM 2070  H HG23 . VAL A 1 58 ? 5.279   5.178   -9.855  1.00 10.00 ? 467 VAL A HG23 2  
ATOM 2071  N N    . LEU A 1 59 ? 3.485   1.036   -7.994  1.00 10.00 ? 468 LEU A N    2  
ATOM 2072  C CA   . LEU A 1 59 ? 2.941   -0.048  -8.796  1.00 10.00 ? 468 LEU A CA   2  
ATOM 2073  C C    . LEU A 1 59 ? 1.446   -0.249  -8.540  1.00 10.00 ? 468 LEU A C    2  
ATOM 2074  O O    . LEU A 1 59 ? 0.819   -1.105  -9.159  1.00 10.00 ? 468 LEU A O    2  
ATOM 2075  C CB   . LEU A 1 59 ? 3.705   -1.344  -8.511  1.00 10.00 ? 468 LEU A CB   2  
ATOM 2076  C CG   . LEU A 1 59 ? 4.365   -1.988  -9.730  1.00 10.00 ? 468 LEU A CG   2  
ATOM 2077  C CD1  . LEU A 1 59 ? 5.437   -1.074  -10.303 1.00 10.00 ? 468 LEU A CD1  2  
ATOM 2078  C CD2  . LEU A 1 59 ? 4.957   -3.341  -9.362  1.00 10.00 ? 468 LEU A CD2  2  
ATOM 2079  H H    . LEU A 1 59 ? 4.097   0.821   -7.261  1.00 10.00 ? 468 LEU A H    2  
ATOM 2080  H HA   . LEU A 1 59 ? 3.075   0.217   -9.833  1.00 10.00 ? 468 LEU A HA   2  
ATOM 2081  H HB2  . LEU A 1 59 ? 4.475   -1.126  -7.782  1.00 10.00 ? 468 LEU A HB2  2  
ATOM 2082  H HB3  . LEU A 1 59 ? 3.019   -2.058  -8.080  1.00 10.00 ? 468 LEU A HB3  2  
ATOM 2083  H HG   . LEU A 1 59 ? 3.618   -2.145  -10.494 1.00 10.00 ? 468 LEU A HG   2  
ATOM 2084  H HD11 . LEU A 1 59 ? 6.146   -0.821  -9.528  1.00 10.00 ? 468 LEU A HD11 2  
ATOM 2085  H HD12 . LEU A 1 59 ? 4.977   -0.171  -10.678 1.00 10.00 ? 468 LEU A HD12 2  
ATOM 2086  H HD13 . LEU A 1 59 ? 5.949   -1.579  -11.109 1.00 10.00 ? 468 LEU A HD13 2  
ATOM 2087  H HD21 . LEU A 1 59 ? 5.780   -3.565  -10.024 1.00 10.00 ? 468 LEU A HD21 2  
ATOM 2088  H HD22 . LEU A 1 59 ? 4.199   -4.104  -9.459  1.00 10.00 ? 468 LEU A HD22 2  
ATOM 2089  H HD23 . LEU A 1 59 ? 5.312   -3.313  -8.343  1.00 10.00 ? 468 LEU A HD23 2  
ATOM 2090  N N    . TYR A 1 60 ? 0.881   0.539   -7.630  1.00 10.00 ? 469 TYR A N    2  
ATOM 2091  C CA   . TYR A 1 60 ? -0.538  0.443   -7.312  1.00 10.00 ? 469 TYR A CA   2  
ATOM 2092  C C    . TYR A 1 60 ? -1.273  1.733   -7.685  1.00 10.00 ? 469 TYR A C    2  
ATOM 2093  O O    . TYR A 1 60 ? -2.498  1.745   -7.793  1.00 10.00 ? 469 TYR A O    2  
ATOM 2094  C CB   . TYR A 1 60 ? -0.727  0.107   -5.818  1.00 10.00 ? 469 TYR A CB   2  
ATOM 2095  C CG   . TYR A 1 60 ? -1.447  1.150   -4.985  1.00 10.00 ? 469 TYR A CG   2  
ATOM 2096  C CD1  . TYR A 1 60 ? -1.079  2.485   -5.039  1.00 10.00 ? 469 TYR A CD1  2  
ATOM 2097  C CD2  . TYR A 1 60 ? -2.499  0.794   -4.144  1.00 10.00 ? 469 TYR A CD2  2  
ATOM 2098  C CE1  . TYR A 1 60 ? -1.731  3.438   -4.290  1.00 10.00 ? 469 TYR A CE1  2  
ATOM 2099  C CE2  . TYR A 1 60 ? -3.155  1.743   -3.389  1.00 10.00 ? 469 TYR A CE2  2  
ATOM 2100  C CZ   . TYR A 1 60 ? -2.768  3.065   -3.469  1.00 10.00 ? 469 TYR A CZ   2  
ATOM 2101  O OH   . TYR A 1 60 ? -3.417  4.018   -2.729  1.00 10.00 ? 469 TYR A OH   2  
ATOM 2102  H H    . TYR A 1 60 ? 1.425   1.195   -7.162  1.00 10.00 ? 469 TYR A H    2  
ATOM 2103  H HA   . TYR A 1 60 ? -0.946  -0.366  -7.900  1.00 10.00 ? 469 TYR A HA   2  
ATOM 2104  H HB2  . TYR A 1 60 ? -1.295  -0.800  -5.745  1.00 10.00 ? 469 TYR A HB2  2  
ATOM 2105  H HB3  . TYR A 1 60 ? 0.245   -0.048  -5.375  1.00 10.00 ? 469 TYR A HB3  2  
ATOM 2106  H HD1  . TYR A 1 60 ? -0.268  2.775   -5.682  1.00 10.00 ? 469 TYR A HD1  2  
ATOM 2107  H HD2  . TYR A 1 60 ? -2.799  -0.247  -4.073  1.00 10.00 ? 469 TYR A HD2  2  
ATOM 2108  H HE1  . TYR A 1 60 ? -1.426  4.473   -4.348  1.00 10.00 ? 469 TYR A HE1  2  
ATOM 2109  H HE2  . TYR A 1 60 ? -3.969  1.443   -2.743  1.00 10.00 ? 469 TYR A HE2  2  
ATOM 2110  H HH   . TYR A 1 60 ? -2.774  4.534   -2.236  1.00 10.00 ? 469 TYR A HH   2  
ATOM 2111  N N    . TYR A 1 61 ? -0.521  2.823   -7.854  1.00 10.00 ? 470 TYR A N    2  
ATOM 2112  C CA   . TYR A 1 61 ? -1.113  4.114   -8.182  1.00 10.00 ? 470 TYR A CA   2  
ATOM 2113  C C    . TYR A 1 61 ? -1.366  4.258   -9.679  1.00 10.00 ? 470 TYR A C    2  
ATOM 2114  O O    . TYR A 1 61 ? -2.294  4.956   -10.088 1.00 10.00 ? 470 TYR A O    2  
ATOM 2115  C CB   . TYR A 1 61 ? -0.223  5.253   -7.653  1.00 10.00 ? 470 TYR A CB   2  
ATOM 2116  C CG   . TYR A 1 61 ? 0.440   6.099   -8.722  1.00 10.00 ? 470 TYR A CG   2  
ATOM 2117  C CD1  . TYR A 1 61 ? 1.308   5.530   -9.643  1.00 10.00 ? 470 TYR A CD1  2  
ATOM 2118  C CD2  . TYR A 1 61 ? 0.199   7.464   -8.805  1.00 10.00 ? 470 TYR A CD2  2  
ATOM 2119  C CE1  . TYR A 1 61 ? 1.918   6.294   -10.617 1.00 10.00 ? 470 TYR A CE1  2  
ATOM 2120  C CE2  . TYR A 1 61 ? 0.805   8.237   -9.778  1.00 10.00 ? 470 TYR A CE2  2  
ATOM 2121  C CZ   . TYR A 1 61 ? 1.664   7.647   -10.681 1.00 10.00 ? 470 TYR A CZ   2  
ATOM 2122  O OH   . TYR A 1 61 ? 2.269   8.412   -11.651 1.00 10.00 ? 470 TYR A OH   2  
ATOM 2123  H H    . TYR A 1 61 ? 0.450   2.762   -7.739  1.00 10.00 ? 470 TYR A H    2  
ATOM 2124  H HA   . TYR A 1 61 ? -2.066  4.165   -7.674  1.00 10.00 ? 470 TYR A HA   2  
ATOM 2125  H HB2  . TYR A 1 61 ? -0.825  5.912   -7.046  1.00 10.00 ? 470 TYR A HB2  2  
ATOM 2126  H HB3  . TYR A 1 61 ? 0.557   4.828   -7.038  1.00 10.00 ? 470 TYR A HB3  2  
ATOM 2127  H HD1  . TYR A 1 61 ? 1.503   4.472   -9.592  1.00 10.00 ? 470 TYR A HD1  2  
ATOM 2128  H HD2  . TYR A 1 61 ? -0.474  7.923   -8.095  1.00 10.00 ? 470 TYR A HD2  2  
ATOM 2129  H HE1  . TYR A 1 61 ? 2.589   5.829   -11.322 1.00 10.00 ? 470 TYR A HE1  2  
ATOM 2130  H HE2  . TYR A 1 61 ? 0.605   9.297   -9.827  1.00 10.00 ? 470 TYR A HE2  2  
ATOM 2131  H HH   . TYR A 1 61 ? 1.643   9.058   -11.987 1.00 10.00 ? 470 TYR A HH   2  
ATOM 2132  N N    . TYR A 1 62 ? -0.551  3.598   -10.500 1.00 10.00 ? 471 TYR A N    2  
ATOM 2133  C CA   . TYR A 1 62 ? -0.732  3.682   -11.945 1.00 10.00 ? 471 TYR A CA   2  
ATOM 2134  C C    . TYR A 1 62 ? -1.874  2.774   -12.406 1.00 10.00 ? 471 TYR A C    2  
ATOM 2135  O O    . TYR A 1 62 ? -2.221  2.749   -13.586 1.00 10.00 ? 471 TYR A O    2  
ATOM 2136  C CB   . TYR A 1 62 ? 0.576   3.358   -12.683 1.00 10.00 ? 471 TYR A CB   2  
ATOM 2137  C CG   . TYR A 1 62 ? 0.874   1.882   -12.835 1.00 10.00 ? 471 TYR A CG   2  
ATOM 2138  C CD1  . TYR A 1 62 ? 0.198   1.110   -13.772 1.00 10.00 ? 471 TYR A CD1  2  
ATOM 2139  C CD2  . TYR A 1 62 ? 1.836   1.263   -12.046 1.00 10.00 ? 471 TYR A CD2  2  
ATOM 2140  C CE1  . TYR A 1 62 ? 0.472   -0.237  -13.918 1.00 10.00 ? 471 TYR A CE1  2  
ATOM 2141  C CE2  . TYR A 1 62 ? 2.116   -0.084  -12.188 1.00 10.00 ? 471 TYR A CE2  2  
ATOM 2142  C CZ   . TYR A 1 62 ? 1.430   -0.829  -13.124 1.00 10.00 ? 471 TYR A CZ   2  
ATOM 2143  O OH   . TYR A 1 62 ? 1.705   -2.169  -13.268 1.00 10.00 ? 471 TYR A OH   2  
ATOM 2144  H H    . TYR A 1 62 ? 0.176   3.048   -10.131 1.00 10.00 ? 471 TYR A H    2  
ATOM 2145  H HA   . TYR A 1 62 ? -1.010  4.702   -12.170 1.00 10.00 ? 471 TYR A HA   2  
ATOM 2146  H HB2  . TYR A 1 62 ? 0.531   3.784   -13.674 1.00 10.00 ? 471 TYR A HB2  2  
ATOM 2147  H HB3  . TYR A 1 62 ? 1.399   3.807   -12.147 1.00 10.00 ? 471 TYR A HB3  2  
ATOM 2148  H HD1  . TYR A 1 62 ? -0.551  1.575   -14.394 1.00 10.00 ? 471 TYR A HD1  2  
ATOM 2149  H HD2  . TYR A 1 62 ? 2.372   1.850   -11.312 1.00 10.00 ? 471 TYR A HD2  2  
ATOM 2150  H HE1  . TYR A 1 62 ? -0.066  -0.821  -14.652 1.00 10.00 ? 471 TYR A HE1  2  
ATOM 2151  H HE2  . TYR A 1 62 ? 2.867   -0.548  -11.568 1.00 10.00 ? 471 TYR A HE2  2  
ATOM 2152  H HH   . TYR A 1 62 ? 1.252   -2.664  -12.582 1.00 10.00 ? 471 TYR A HH   2  
ATOM 2153  N N    . LEU A 1 63 ? -2.468  2.046   -11.461 1.00 10.00 ? 472 LEU A N    2  
ATOM 2154  C CA   . LEU A 1 63 ? -3.583  1.159   -11.761 1.00 10.00 ? 472 LEU A CA   2  
ATOM 2155  C C    . LEU A 1 63 ? -4.892  1.798   -11.315 1.00 10.00 ? 472 LEU A C    2  
ATOM 2156  O O    . LEU A 1 63 ? -5.942  1.580   -11.919 1.00 10.00 ? 472 LEU A O    2  
ATOM 2157  C CB   . LEU A 1 63 ? -3.398  -0.189  -11.061 1.00 10.00 ? 472 LEU A CB   2  
ATOM 2158  C CG   . LEU A 1 63 ? -2.162  -0.979  -11.489 1.00 10.00 ? 472 LEU A CG   2  
ATOM 2159  C CD1  . LEU A 1 63 ? -0.896  -0.303  -10.988 1.00 10.00 ? 472 LEU A CD1  2  
ATOM 2160  C CD2  . LEU A 1 63 ? -2.241  -2.409  -10.976 1.00 10.00 ? 472 LEU A CD2  2  
ATOM 2161  H H    . LEU A 1 63 ? -2.158  2.119   -10.535 1.00 10.00 ? 472 LEU A H    2  
ATOM 2162  H HA   . LEU A 1 63 ? -3.611  1.005   -12.830 1.00 10.00 ? 472 LEU A HA   2  
ATOM 2163  H HB2  . LEU A 1 63 ? -3.337  -0.012  -9.997  1.00 10.00 ? 472 LEU A HB2  2  
ATOM 2164  H HB3  . LEU A 1 63 ? -4.270  -0.795  -11.258 1.00 10.00 ? 472 LEU A HB3  2  
ATOM 2165  H HG   . LEU A 1 63 ? -2.118  -1.011  -12.568 1.00 10.00 ? 472 LEU A HG   2  
ATOM 2166  H HD11 . LEU A 1 63 ? -0.995  -0.084  -9.933  1.00 10.00 ? 472 LEU A HD11 2  
ATOM 2167  H HD12 . LEU A 1 63 ? -0.740  0.614   -11.531 1.00 10.00 ? 472 LEU A HD12 2  
ATOM 2168  H HD13 . LEU A 1 63 ? -0.054  -0.960  -11.141 1.00 10.00 ? 472 LEU A HD13 2  
ATOM 2169  H HD21 . LEU A 1 63 ? -1.686  -2.493  -10.054 1.00 10.00 ? 472 LEU A HD21 2  
ATOM 2170  H HD22 . LEU A 1 63 ? -1.821  -3.079  -11.712 1.00 10.00 ? 472 LEU A HD22 2  
ATOM 2171  H HD23 . LEU A 1 63 ? -3.274  -2.672  -10.800 1.00 10.00 ? 472 LEU A HD23 2  
ATOM 2172  N N    . THR A 1 64 ? -4.816  2.594   -10.251 1.00 10.00 ? 473 THR A N    2  
ATOM 2173  C CA   . THR A 1 64 ? -5.990  3.275   -9.717  1.00 10.00 ? 473 THR A CA   2  
ATOM 2174  C C    . THR A 1 64 ? -6.184  4.643   -10.363 1.00 10.00 ? 473 THR A C    2  
ATOM 2175  O O    . THR A 1 64 ? -7.193  5.306   -10.125 1.00 10.00 ? 473 THR A O    2  
ATOM 2176  C CB   . THR A 1 64 ? -5.892  3.407   -8.191  1.00 10.00 ? 473 THR A CB   2  
ATOM 2177  O OG1  . THR A 1 64 ? -6.854  4.328   -7.707  1.00 10.00 ? 473 THR A OG1  2  
ATOM 2178  C CG2  . THR A 1 64 ? -4.535  3.861   -7.696  1.00 10.00 ? 473 THR A CG2  2  
ATOM 2179  H H    . THR A 1 64 ? -3.948  2.727   -9.817  1.00 10.00 ? 473 THR A H    2  
ATOM 2180  H HA   . THR A 1 64 ? -6.847  2.675   -9.950  1.00 10.00 ? 473 THR A HA   2  
ATOM 2181  H HB   . THR A 1 64 ? -6.098  2.443   -7.748  1.00 10.00 ? 473 THR A HB   2  
ATOM 2182  H HG1  . THR A 1 64 ? -7.450  3.880   -7.102  1.00 10.00 ? 473 THR A HG1  2  
ATOM 2183  H HG21 . THR A 1 64 ? -3.919  4.145   -8.535  1.00 10.00 ? 473 THR A HG21 2  
ATOM 2184  H HG22 . THR A 1 64 ? -4.060  3.055   -7.155  1.00 10.00 ? 473 THR A HG22 2  
ATOM 2185  H HG23 . THR A 1 64 ? -4.659  4.709   -7.038  1.00 10.00 ? 473 THR A HG23 2  
ATOM 2186  N N    . LYS A 1 65 ? -5.224  5.071   -11.182 1.00 10.00 ? 474 LYS A N    2  
ATOM 2187  C CA   . LYS A 1 65 ? -5.321  6.365   -11.848 1.00 10.00 ? 474 LYS A CA   2  
ATOM 2188  C C    . LYS A 1 65 ? -5.438  6.197   -13.360 1.00 10.00 ? 474 LYS A C    2  
ATOM 2189  O O    . LYS A 1 65 ? -6.121  6.972   -14.028 1.00 10.00 ? 474 LYS A O    2  
ATOM 2190  C CB   . LYS A 1 65 ? -4.109  7.235   -11.506 1.00 10.00 ? 474 LYS A CB   2  
ATOM 2191  C CG   . LYS A 1 65 ? -2.816  6.769   -12.156 1.00 10.00 ? 474 LYS A CG   2  
ATOM 2192  C CD   . LYS A 1 65 ? -1.598  7.320   -11.432 1.00 10.00 ? 474 LYS A CD   2  
ATOM 2193  C CE   . LYS A 1 65 ? -1.405  8.802   -11.717 1.00 10.00 ? 474 LYS A CE   2  
ATOM 2194  N NZ   . LYS A 1 65 ? -1.902  9.652   -10.600 1.00 10.00 ? 474 LYS A NZ   2  
ATOM 2195  H H    . LYS A 1 65 ? -4.436  4.507   -11.341 1.00 10.00 ? 474 LYS A H    2  
ATOM 2196  H HA   . LYS A 1 65 ? -6.215  6.852   -11.489 1.00 10.00 ? 474 LYS A HA   2  
ATOM 2197  H HB2  . LYS A 1 65 ? -4.304  8.247   -11.832 1.00 10.00 ? 474 LYS A HB2  2  
ATOM 2198  H HB3  . LYS A 1 65 ? -3.969  7.232   -10.435 1.00 10.00 ? 474 LYS A HB3  2  
ATOM 2199  H HG2  . LYS A 1 65 ? -2.780  5.690   -12.129 1.00 10.00 ? 474 LYS A HG2  2  
ATOM 2200  H HG3  . LYS A 1 65 ? -2.797  7.107   -13.182 1.00 10.00 ? 474 LYS A HG3  2  
ATOM 2201  H HD2  . LYS A 1 65 ? -1.730  7.184   -10.369 1.00 10.00 ? 474 LYS A HD2  2  
ATOM 2202  H HD3  . LYS A 1 65 ? -0.722  6.782   -11.760 1.00 10.00 ? 474 LYS A HD3  2  
ATOM 2203  H HE2  . LYS A 1 65 ? -0.351  8.993   -11.862 1.00 10.00 ? 474 LYS A HE2  2  
ATOM 2204  H HE3  . LYS A 1 65 ? -1.943  9.056   -12.619 1.00 10.00 ? 474 LYS A HE3  2  
ATOM 2205  H HZ1  . LYS A 1 65 ? -1.285  10.482  -10.482 1.00 10.00 ? 474 LYS A HZ1  2  
ATOM 2206  H HZ2  . LYS A 1 65 ? -1.909  9.110   -9.713  1.00 10.00 ? 474 LYS A HZ2  2  
ATOM 2207  H HZ3  . LYS A 1 65 ? -2.868  9.978   -10.802 1.00 10.00 ? 474 LYS A HZ3  2  
ATOM 2208  N N    . LYS A 1 66 ? -4.771  5.181   -13.893 1.00 10.00 ? 475 LYS A N    2  
ATOM 2209  C CA   . LYS A 1 66 ? -4.806  4.916   -15.325 1.00 10.00 ? 475 LYS A CA   2  
ATOM 2210  C C    . LYS A 1 66 ? -6.233  4.644   -15.797 1.00 10.00 ? 475 LYS A C    2  
ATOM 2211  O O    . LYS A 1 66 ? -6.534  4.759   -16.984 1.00 10.00 ? 475 LYS A O    2  
ATOM 2212  C CB   . LYS A 1 66 ? -3.909  3.727   -15.668 1.00 10.00 ? 475 LYS A CB   2  
ATOM 2213  C CG   . LYS A 1 66 ? -3.874  3.398   -17.152 1.00 10.00 ? 475 LYS A CG   2  
ATOM 2214  C CD   . LYS A 1 66 ? -3.301  4.547   -17.965 1.00 10.00 ? 475 LYS A CD   2  
ATOM 2215  C CE   . LYS A 1 66 ? -3.217  4.198   -19.442 1.00 10.00 ? 475 LYS A CE   2  
ATOM 2216  N NZ   . LYS A 1 66 ? -2.380  2.989   -19.679 1.00 10.00 ? 475 LYS A NZ   2  
ATOM 2217  H H    . LYS A 1 66 ? -4.243  4.595   -13.311 1.00 10.00 ? 475 LYS A H    2  
ATOM 2218  H HA   . LYS A 1 66 ? -4.435  5.794   -15.832 1.00 10.00 ? 475 LYS A HA   2  
ATOM 2219  H HB2  . LYS A 1 66 ? -2.900  3.947   -15.348 1.00 10.00 ? 475 LYS A HB2  2  
ATOM 2220  H HB3  . LYS A 1 66 ? -4.263  2.857   -15.137 1.00 10.00 ? 475 LYS A HB3  2  
ATOM 2221  H HG2  . LYS A 1 66 ? -3.259  2.523   -17.303 1.00 10.00 ? 475 LYS A HG2  2  
ATOM 2222  H HG3  . LYS A 1 66 ? -4.881  3.196   -17.489 1.00 10.00 ? 475 LYS A HG3  2  
ATOM 2223  H HD2  . LYS A 1 66 ? -3.938  5.412   -17.846 1.00 10.00 ? 475 LYS A HD2  2  
ATOM 2224  H HD3  . LYS A 1 66 ? -2.310  4.774   -17.600 1.00 10.00 ? 475 LYS A HD3  2  
ATOM 2225  H HE2  . LYS A 1 66 ? -4.214  4.011   -19.812 1.00 10.00 ? 475 LYS A HE2  2  
ATOM 2226  H HE3  . LYS A 1 66 ? -2.786  5.034   -19.973 1.00 10.00 ? 475 LYS A HE3  2  
ATOM 2227  H HZ1  . LYS A 1 66 ? -1.667  2.894   -18.927 1.00 10.00 ? 475 LYS A HZ1  2  
ATOM 2228  H HZ2  . LYS A 1 66 ? -1.891  3.067   -20.595 1.00 10.00 ? 475 LYS A HZ2  2  
ATOM 2229  H HZ3  . LYS A 1 66 ? -2.975  2.137   -19.689 1.00 10.00 ? 475 LYS A HZ3  2  
ATOM 2230  N N    . ASN A 1 67 ? -7.109  4.275   -14.863 1.00 10.00 ? 476 ASN A N    2  
ATOM 2231  C CA   . ASN A 1 67 ? -8.499  3.980   -15.200 1.00 10.00 ? 476 ASN A CA   2  
ATOM 2232  C C    . ASN A 1 67 ? -9.483  4.766   -14.329 1.00 10.00 ? 476 ASN A C    2  
ATOM 2233  O O    . ASN A 1 67 ? -10.678 4.798   -14.618 1.00 10.00 ? 476 ASN A O    2  
ATOM 2234  C CB   . ASN A 1 67 ? -8.767  2.481   -15.055 1.00 10.00 ? 476 ASN A CB   2  
ATOM 2235  C CG   . ASN A 1 67 ? -8.028  1.659   -16.092 1.00 10.00 ? 476 ASN A CG   2  
ATOM 2236  O OD1  . ASN A 1 67 ? -7.158  0.853   -15.758 1.00 10.00 ? 476 ASN A OD1  2  
ATOM 2237  N ND2  . ASN A 1 67 ? -8.371  1.858   -17.360 1.00 10.00 ? 476 ASN A ND2  2  
ATOM 2238  H H    . ASN A 1 67 ? -6.814  4.191   -13.934 1.00 10.00 ? 476 ASN A H    2  
ATOM 2239  H HA   . ASN A 1 67 ? -8.652  4.260   -16.230 1.00 10.00 ? 476 ASN A HA   2  
ATOM 2240  H HB2  . ASN A 1 67 ? -8.450  2.158   -14.074 1.00 10.00 ? 476 ASN A HB2  2  
ATOM 2241  H HB3  . ASN A 1 67 ? -9.826  2.299   -15.164 1.00 10.00 ? 476 ASN A HB3  2  
ATOM 2242  H HD21 . ASN A 1 67 ? -9.072  2.516   -17.551 1.00 10.00 ? 476 ASN A HD21 2  
ATOM 2243  H HD22 . ASN A 1 67 ? -7.909  1.340   -18.051 1.00 10.00 ? 476 ASN A HD22 2  
ATOM 2244  N N    . GLU A 1 68 ? -8.988  5.395   -13.263 1.00 10.00 ? 477 GLU A N    2  
ATOM 2245  C CA   . GLU A 1 68 ? -9.854  6.163   -12.372 1.00 10.00 ? 477 GLU A CA   2  
ATOM 2246  C C    . GLU A 1 68 ? -9.490  7.647   -12.387 1.00 10.00 ? 477 GLU A C    2  
ATOM 2247  O O    . GLU A 1 68 ? -10.341 8.504   -12.151 1.00 10.00 ? 477 GLU A O    2  
ATOM 2248  C CB   . GLU A 1 68 ? -9.767  5.617   -10.945 1.00 10.00 ? 477 GLU A CB   2  
ATOM 2249  C CG   . GLU A 1 68 ? -11.121 5.427   -10.283 1.00 10.00 ? 477 GLU A CG   2  
ATOM 2250  C CD   . GLU A 1 68 ? -11.655 4.016   -10.443 1.00 10.00 ? 477 GLU A CD   2  
ATOM 2251  O OE1  . GLU A 1 68 ? -11.445 3.421   -11.521 1.00 10.00 ? 477 GLU A OE1  2  
ATOM 2252  O OE2  . GLU A 1 68 ? -12.284 3.508   -9.491  1.00 10.00 ? 477 GLU A OE2  2  
ATOM 2253  H H    . GLU A 1 68 ? -8.028  5.340   -13.067 1.00 10.00 ? 477 GLU A H    2  
ATOM 2254  H HA   . GLU A 1 68 ? -10.869 6.054   -12.724 1.00 10.00 ? 477 GLU A HA   2  
ATOM 2255  H HB2  . GLU A 1 68 ? -9.264  4.662   -10.969 1.00 10.00 ? 477 GLU A HB2  2  
ATOM 2256  H HB3  . GLU A 1 68 ? -9.189  6.303   -10.343 1.00 10.00 ? 477 GLU A HB3  2  
ATOM 2257  H HG2  . GLU A 1 68 ? -11.027 5.641   -9.229  1.00 10.00 ? 477 GLU A HG2  2  
ATOM 2258  H HG3  . GLU A 1 68 ? -11.825 6.115   -10.729 1.00 10.00 ? 477 GLU A HG3  2  
ATOM 2259  N N    . ASN A 1 69 ? -8.225  7.941   -12.662 1.00 10.00 ? 478 ASN A N    2  
ATOM 2260  C CA   . ASN A 1 69 ? -7.751  9.320   -12.703 1.00 10.00 ? 478 ASN A CA   2  
ATOM 2261  C C    . ASN A 1 69 ? -7.868  9.976   -11.331 1.00 10.00 ? 478 ASN A C    2  
ATOM 2262  O O    . ASN A 1 69 ? -8.928  9.947   -10.706 1.00 10.00 ? 478 ASN A O    2  
ATOM 2263  C CB   . ASN A 1 69 ? -8.544  10.124  -13.735 1.00 10.00 ? 478 ASN A CB   2  
ATOM 2264  C CG   . ASN A 1 69 ? -7.797  11.358  -14.204 1.00 10.00 ? 478 ASN A CG   2  
ATOM 2265  O OD1  . ASN A 1 69 ? -7.121  12.023  -13.420 1.00 10.00 ? 478 ASN A OD1  2  
ATOM 2266  N ND2  . ASN A 1 69 ? -7.916  11.668  -15.490 1.00 10.00 ? 478 ASN A ND2  2  
ATOM 2267  H H    . ASN A 1 69 ? -7.594  7.215   -12.839 1.00 10.00 ? 478 ASN A H    2  
ATOM 2268  H HA   . ASN A 1 69 ? -6.712  9.303   -12.993 1.00 10.00 ? 478 ASN A HA   2  
ATOM 2269  H HB2  . ASN A 1 69 ? -8.744  9.500   -14.593 1.00 10.00 ? 478 ASN A HB2  2  
ATOM 2270  H HB3  . ASN A 1 69 ? -9.480  10.437  -13.297 1.00 10.00 ? 478 ASN A HB3  2  
ATOM 2271  H HD21 . ASN A 1 69 ? -8.471  11.093  -16.056 1.00 10.00 ? 478 ASN A HD21 2  
ATOM 2272  H HD22 . ASN A 1 69 ? -7.443  12.460  -15.820 1.00 10.00 ? 478 ASN A HD22 2  
ATOM 2273  N N    . TYR A 1 70 ? -6.773  10.571  -10.872 1.00 10.00 ? 479 TYR A N    2  
ATOM 2274  C CA   . TYR A 1 70 ? -6.748  11.239  -9.580  1.00 10.00 ? 479 TYR A CA   2  
ATOM 2275  C C    . TYR A 1 70 ? -5.393  11.896  -9.343  1.00 10.00 ? 479 TYR A C    2  
ATOM 2276  O O    . TYR A 1 70 ? -4.346  11.297  -9.587  1.00 10.00 ? 479 TYR A O    2  
ATOM 2277  C CB   . TYR A 1 70 ? -7.072  10.251  -8.451  1.00 10.00 ? 479 TYR A CB   2  
ATOM 2278  C CG   . TYR A 1 70 ? -6.030  9.170   -8.251  1.00 10.00 ? 479 TYR A CG   2  
ATOM 2279  C CD1  . TYR A 1 70 ? -4.782  9.470   -7.719  1.00 10.00 ? 479 TYR A CD1  2  
ATOM 2280  C CD2  . TYR A 1 70 ? -6.300  7.848   -8.583  1.00 10.00 ? 479 TYR A CD2  2  
ATOM 2281  C CE1  . TYR A 1 70 ? -3.831  8.487   -7.529  1.00 10.00 ? 479 TYR A CE1  2  
ATOM 2282  C CE2  . TYR A 1 70 ? -5.355  6.856   -8.394  1.00 10.00 ? 479 TYR A CE2  2  
ATOM 2283  C CZ   . TYR A 1 70 ? -4.121  7.183   -7.867  1.00 10.00 ? 479 TYR A CZ   2  
ATOM 2284  O OH   . TYR A 1 70 ? -3.174  6.203   -7.679  1.00 10.00 ? 479 TYR A OH   2  
ATOM 2285  H H    . TYR A 1 70 ? -5.960  10.565  -11.417 1.00 10.00 ? 479 TYR A H    2  
ATOM 2286  H HA   . TYR A 1 70 ? -7.505  12.009  -9.596  1.00 10.00 ? 479 TYR A HA   2  
ATOM 2287  H HB2  . TYR A 1 70 ? -7.161  10.796  -7.524  1.00 10.00 ? 479 TYR A HB2  2  
ATOM 2288  H HB3  . TYR A 1 70 ? -8.014  9.769   -8.668  1.00 10.00 ? 479 TYR A HB3  2  
ATOM 2289  H HD1  . TYR A 1 70 ? -4.558  10.492  -7.453  1.00 10.00 ? 479 TYR A HD1  2  
ATOM 2290  H HD2  . TYR A 1 70 ? -7.265  7.596   -8.998  1.00 10.00 ? 479 TYR A HD2  2  
ATOM 2291  H HE1  . TYR A 1 70 ? -2.866  8.741   -7.117  1.00 10.00 ? 479 TYR A HE1  2  
ATOM 2292  H HE2  . TYR A 1 70 ? -5.584  5.832   -8.657  1.00 10.00 ? 479 TYR A HE2  2  
ATOM 2293  H HH   . TYR A 1 70 ? -2.859  6.231   -6.772  1.00 10.00 ? 479 TYR A HH   2  
ATOM 2294  N N    . LYS A 1 71 ? -5.424  13.137  -8.876  1.00 10.00 ? 480 LYS A N    2  
ATOM 2295  C CA   . LYS A 1 71 ? -4.202  13.887  -8.611  1.00 10.00 ? 480 LYS A CA   2  
ATOM 2296  C C    . LYS A 1 71 ? -4.207  14.451  -7.193  1.00 10.00 ? 480 LYS A C    2  
ATOM 2297  O O    . LYS A 1 71 ? -3.129  14.480  -6.565  1.00 10.00 ? 480 LYS A O    2  
ATOM 2298  C CB   . LYS A 1 71 ? -4.044  15.022  -9.624  1.00 10.00 ? 480 LYS A CB   2  
ATOM 2299  C CG   . LYS A 1 71 ? -2.607  15.481  -9.802  1.00 10.00 ? 480 LYS A CG   2  
ATOM 2300  C CD   . LYS A 1 71 ? -2.517  16.681  -10.732 1.00 10.00 ? 480 LYS A CD   2  
ATOM 2301  C CE   . LYS A 1 71 ? -2.721  16.277  -12.184 1.00 10.00 ? 480 LYS A CE   2  
ATOM 2302  N NZ   . LYS A 1 71 ? -2.489  17.416  -13.115 1.00 10.00 ? 480 LYS A NZ   2  
ATOM 2303  O OXT  . LYS A 1 71 ? -5.290  14.861  -6.724  1.00 10.00 ? 480 LYS A OXT  2  
ATOM 2304  H H    . LYS A 1 71 ? -6.291  13.560  -8.713  1.00 10.00 ? 480 LYS A H    2  
ATOM 2305  H HA   . LYS A 1 71 ? -3.368  13.207  -8.711  1.00 10.00 ? 480 LYS A HA   2  
ATOM 2306  H HB2  . LYS A 1 71 ? -4.415  14.687  -10.581 1.00 10.00 ? 480 LYS A HB2  2  
ATOM 2307  H HB3  . LYS A 1 71 ? -4.632  15.866  -9.295  1.00 10.00 ? 480 LYS A HB3  2  
ATOM 2308  H HG2  . LYS A 1 71 ? -2.204  15.755  -8.839  1.00 10.00 ? 480 LYS A HG2  2  
ATOM 2309  H HG3  . LYS A 1 71 ? -2.029  14.670  -10.220 1.00 10.00 ? 480 LYS A HG3  2  
ATOM 2310  H HD2  . LYS A 1 71 ? -3.280  17.395  -10.457 1.00 10.00 ? 480 LYS A HD2  2  
ATOM 2311  H HD3  . LYS A 1 71 ? -1.542  17.134  -10.627 1.00 10.00 ? 480 LYS A HD3  2  
ATOM 2312  H HE2  . LYS A 1 71 ? -2.031  15.482  -12.423 1.00 10.00 ? 480 LYS A HE2  2  
ATOM 2313  H HE3  . LYS A 1 71 ? -3.734  15.923  -12.306 1.00 10.00 ? 480 LYS A HE3  2  
ATOM 2314  H HZ1  . LYS A 1 71 ? -1.856  18.114  -12.675 1.00 10.00 ? 480 LYS A HZ1  2  
ATOM 2315  H HZ2  . LYS A 1 71 ? -3.391  17.879  -13.345 1.00 10.00 ? 480 LYS A HZ2  2  
ATOM 2316  H HZ3  . LYS A 1 71 ? -2.055  17.074  -13.995 1.00 10.00 ? 480 LYS A HZ3  2  
ATOM 2317  N N    . ASN A 1 4  ? 8.155   12.552  21.524  1.00 10.00 ? 413 ASN A N    3  
ATOM 2318  C CA   . ASN A 1 4  ? 7.618   11.339  20.916  1.00 10.00 ? 413 ASN A CA   3  
ATOM 2319  C C    . ASN A 1 4  ? 6.123   11.480  20.652  1.00 10.00 ? 413 ASN A C    3  
ATOM 2320  O O    . ASN A 1 4  ? 5.441   12.278  21.293  1.00 10.00 ? 413 ASN A O    3  
ATOM 2321  C CB   . ASN A 1 4  ? 7.877   10.134  21.821  1.00 10.00 ? 413 ASN A CB   3  
ATOM 2322  C CG   . ASN A 1 4  ? 9.330   10.029  22.243  1.00 10.00 ? 413 ASN A CG   3  
ATOM 2323  O OD1  . ASN A 1 4  ? 10.232  10.435  21.512  1.00 10.00 ? 413 ASN A OD1  3  
ATOM 2324  N ND2  . ASN A 1 4  ? 9.562   9.480   23.431  1.00 10.00 ? 413 ASN A ND2  3  
ATOM 2325  H H    . ASN A 1 4  ? 8.855   13.052  21.054  1.00 10.00 ? 413 ASN A H    3  
ATOM 2326  H HA   . ASN A 1 4  ? 8.125   11.188  19.976  1.00 10.00 ? 413 ASN A HA   3  
ATOM 2327  H HB2  . ASN A 1 4  ? 7.268   10.220  22.709  1.00 10.00 ? 413 ASN A HB2  3  
ATOM 2328  H HB3  . ASN A 1 4  ? 7.608   9.231   21.292  1.00 10.00 ? 413 ASN A HB3  3  
ATOM 2329  H HD21 . ASN A 1 4  ? 8.794   9.178   23.959  1.00 10.00 ? 413 ASN A HD21 3  
ATOM 2330  H HD22 . ASN A 1 4  ? 10.492  9.400   23.729  1.00 10.00 ? 413 ASN A HD22 3  
ATOM 2331  N N    . GLY A 1 5  ? 5.619   10.698  19.702  1.00 10.00 ? 414 GLY A N    3  
ATOM 2332  C CA   . GLY A 1 5  ? 4.208   10.750  19.369  1.00 10.00 ? 414 GLY A CA   3  
ATOM 2333  C C    . GLY A 1 5  ? 3.881   9.981   18.105  1.00 10.00 ? 414 GLY A C    3  
ATOM 2334  O O    . GLY A 1 5  ? 3.084   10.434  17.283  1.00 10.00 ? 414 GLY A O    3  
ATOM 2335  H H    . GLY A 1 5  ? 6.211   10.081  19.224  1.00 10.00 ? 414 GLY A H    3  
ATOM 2336  H HA2  . GLY A 1 5  ? 3.640   10.334  20.188  1.00 10.00 ? 414 GLY A HA2  3  
ATOM 2337  H HA3  . GLY A 1 5  ? 3.919   11.782  19.235  1.00 10.00 ? 414 GLY A HA3  3  
ATOM 2338  N N    . LEU A 1 6  ? 4.497   8.815   17.948  1.00 10.00 ? 415 LEU A N    3  
ATOM 2339  C CA   . LEU A 1 6  ? 4.268   7.981   16.774  1.00 10.00 ? 415 LEU A CA   3  
ATOM 2340  C C    . LEU A 1 6  ? 4.504   6.508   17.098  1.00 10.00 ? 415 LEU A C    3  
ATOM 2341  O O    . LEU A 1 6  ? 5.606   5.992   16.918  1.00 10.00 ? 415 LEU A O    3  
ATOM 2342  C CB   . LEU A 1 6  ? 5.182   8.415   15.627  1.00 10.00 ? 415 LEU A CB   3  
ATOM 2343  C CG   . LEU A 1 6  ? 4.917   9.819   15.083  1.00 10.00 ? 415 LEU A CG   3  
ATOM 2344  C CD1  . LEU A 1 6  ? 5.722   10.852  15.855  1.00 10.00 ? 415 LEU A CD1  3  
ATOM 2345  C CD2  . LEU A 1 6  ? 5.244   9.886   13.599  1.00 10.00 ? 415 LEU A CD2  3  
ATOM 2346  H H    . LEU A 1 6  ? 5.122   8.508   18.638  1.00 10.00 ? 415 LEU A H    3  
ATOM 2347  H HA   . LEU A 1 6  ? 3.240   8.110   16.472  1.00 10.00 ? 415 LEU A HA   3  
ATOM 2348  H HB2  . LEU A 1 6  ? 6.205   8.372   15.975  1.00 10.00 ? 415 LEU A HB2  3  
ATOM 2349  H HB3  . LEU A 1 6  ? 5.066   7.711   14.816  1.00 10.00 ? 415 LEU A HB3  3  
ATOM 2350  H HG   . LEU A 1 6  ? 3.869   10.054  15.206  1.00 10.00 ? 415 LEU A HG   3  
ATOM 2351  H HD11 . LEU A 1 6  ? 5.977   10.457  16.828  1.00 10.00 ? 415 LEU A HD11 3  
ATOM 2352  H HD12 . LEU A 1 6  ? 5.136   11.751  15.974  1.00 10.00 ? 415 LEU A HD12 3  
ATOM 2353  H HD13 . LEU A 1 6  ? 6.628   11.082  15.313  1.00 10.00 ? 415 LEU A HD13 3  
ATOM 2354  H HD21 . LEU A 1 6  ? 6.280   10.166  13.471  1.00 10.00 ? 415 LEU A HD21 3  
ATOM 2355  H HD22 . LEU A 1 6  ? 4.611   10.620  13.123  1.00 10.00 ? 415 LEU A HD22 3  
ATOM 2356  H HD23 . LEU A 1 6  ? 5.075   8.919   13.150  1.00 10.00 ? 415 LEU A HD23 3  
ATOM 2357  N N    . MET A 1 7  ? 3.461   5.839   17.577  1.00 10.00 ? 416 MET A N    3  
ATOM 2358  C CA   . MET A 1 7  ? 3.554   4.427   17.927  1.00 10.00 ? 416 MET A CA   3  
ATOM 2359  C C    . MET A 1 7  ? 3.454   3.550   16.682  1.00 10.00 ? 416 MET A C    3  
ATOM 2360  O O    . MET A 1 7  ? 2.446   3.569   15.977  1.00 10.00 ? 416 MET A O    3  
ATOM 2361  C CB   . MET A 1 7  ? 2.452   4.051   18.919  1.00 10.00 ? 416 MET A CB   3  
ATOM 2362  C CG   . MET A 1 7  ? 1.064   4.495   18.484  1.00 10.00 ? 416 MET A CG   3  
ATOM 2363  S SD   . MET A 1 7  ? 0.511   5.984   19.338  1.00 10.00 ? 416 MET A SD   3  
ATOM 2364  C CE   . MET A 1 7  ? -1.263  5.740   19.327  1.00 10.00 ? 416 MET A CE   3  
ATOM 2365  H H    . MET A 1 7  ? 2.608   6.307   17.700  1.00 10.00 ? 416 MET A H    3  
ATOM 2366  H HA   . MET A 1 7  ? 4.515   4.263   18.392  1.00 10.00 ? 416 MET A HA   3  
ATOM 2367  H HB2  . MET A 1 7  ? 2.442   2.977   19.037  1.00 10.00 ? 416 MET A HB2  3  
ATOM 2368  H HB3  . MET A 1 7  ? 2.670   4.508   19.873  1.00 10.00 ? 416 MET A HB3  3  
ATOM 2369  H HG2  . MET A 1 7  ? 1.082   4.692   17.423  1.00 10.00 ? 416 MET A HG2  3  
ATOM 2370  H HG3  . MET A 1 7  ? 0.366   3.698   18.690  1.00 10.00 ? 416 MET A HG3  3  
ATOM 2371  H HE1  . MET A 1 7  ? -1.536  5.120   18.486  1.00 10.00 ? 416 MET A HE1  3  
ATOM 2372  H HE2  . MET A 1 7  ? -1.757  6.697   19.242  1.00 10.00 ? 416 MET A HE2  3  
ATOM 2373  H HE3  . MET A 1 7  ? -1.567  5.259   20.244  1.00 10.00 ? 416 MET A HE3  3  
ATOM 2374  N N    . ALA A 1 8  ? 4.508   2.784   16.419  1.00 10.00 ? 417 ALA A N    3  
ATOM 2375  C CA   . ALA A 1 8  ? 4.538   1.900   15.260  1.00 10.00 ? 417 ALA A CA   3  
ATOM 2376  C C    . ALA A 1 8  ? 3.841   0.578   15.558  1.00 10.00 ? 417 ALA A C    3  
ATOM 2377  O O    . ALA A 1 8  ? 3.685   0.195   16.717  1.00 10.00 ? 417 ALA A O    3  
ATOM 2378  C CB   . ALA A 1 8  ? 5.975   1.654   14.823  1.00 10.00 ? 417 ALA A CB   3  
ATOM 2379  H H    . ALA A 1 8  ? 5.282   2.813   17.019  1.00 10.00 ? 417 ALA A H    3  
ATOM 2380  H HA   . ALA A 1 8  ? 4.021   2.395   14.451  1.00 10.00 ? 417 ALA A HA   3  
ATOM 2381  H HB1  . ALA A 1 8  ? 5.994   0.883   14.066  1.00 10.00 ? 417 ALA A HB1  3  
ATOM 2382  H HB2  . ALA A 1 8  ? 6.561   1.338   15.674  1.00 10.00 ? 417 ALA A HB2  3  
ATOM 2383  H HB3  . ALA A 1 8  ? 6.390   2.566   14.419  1.00 10.00 ? 417 ALA A HB3  3  
ATOM 2384  N N    . ASP A 1 9  ? 3.421   -0.114  14.505  1.00 10.00 ? 418 ASP A N    3  
ATOM 2385  C CA   . ASP A 1 9  ? 2.739   -1.395  14.654  1.00 10.00 ? 418 ASP A CA   3  
ATOM 2386  C C    . ASP A 1 9  ? 2.475   -2.033  13.292  1.00 10.00 ? 418 ASP A C    3  
ATOM 2387  O O    . ASP A 1 9  ? 1.410   -1.841  12.704  1.00 10.00 ? 418 ASP A O    3  
ATOM 2388  C CB   . ASP A 1 9  ? 1.420   -1.208  15.407  1.00 10.00 ? 418 ASP A CB   3  
ATOM 2389  C CG   . ASP A 1 9  ? 0.553   -0.124  14.798  1.00 10.00 ? 418 ASP A CG   3  
ATOM 2390  O OD1  . ASP A 1 9  ? 0.897   1.067   14.950  1.00 10.00 ? 418 ASP A OD1  3  
ATOM 2391  O OD2  . ASP A 1 9  ? -0.469  -0.466  14.166  1.00 10.00 ? 418 ASP A OD2  3  
ATOM 2392  H H    . ASP A 1 9  ? 3.574   0.244   13.605  1.00 10.00 ? 418 ASP A H    3  
ATOM 2393  H HA   . ASP A 1 9  ? 3.381   -2.047  15.225  1.00 10.00 ? 418 ASP A HA   3  
ATOM 2394  H HB2  . ASP A 1 9  ? 0.869   -2.136  15.389  1.00 10.00 ? 418 ASP A HB2  3  
ATOM 2395  H HB3  . ASP A 1 9  ? 1.634   -0.941  16.431  1.00 10.00 ? 418 ASP A HB3  3  
ATOM 2396  N N    . PRO A 1 10 ? 3.445   -2.804  12.772  1.00 10.00 ? 419 PRO A N    3  
ATOM 2397  C CA   . PRO A 1 10 ? 3.311   -3.472  11.473  1.00 10.00 ? 419 PRO A CA   3  
ATOM 2398  C C    . PRO A 1 10 ? 2.286   -4.601  11.505  1.00 10.00 ? 419 PRO A C    3  
ATOM 2399  O O    . PRO A 1 10 ? 2.535   -5.663  12.079  1.00 10.00 ? 419 PRO A O    3  
ATOM 2400  C CB   . PRO A 1 10 ? 4.713   -4.029  11.213  1.00 10.00 ? 419 PRO A CB   3  
ATOM 2401  C CG   . PRO A 1 10 ? 5.312   -4.195  12.565  1.00 10.00 ? 419 PRO A CG   3  
ATOM 2402  C CD   . PRO A 1 10 ? 4.746   -3.086  13.408  1.00 10.00 ? 419 PRO A CD   3  
ATOM 2403  H HA   . PRO A 1 10 ? 3.048   -2.771  10.694  1.00 10.00 ? 419 PRO A HA   3  
ATOM 2404  H HB2  . PRO A 1 10 ? 4.636   -4.974  10.695  1.00 10.00 ? 419 PRO A HB2  3  
ATOM 2405  H HB3  . PRO A 1 10 ? 5.276   -3.328  10.615  1.00 10.00 ? 419 PRO A HB3  3  
ATOM 2406  H HG2  . PRO A 1 10 ? 5.036   -5.156  12.974  1.00 10.00 ? 419 PRO A HG2  3  
ATOM 2407  H HG3  . PRO A 1 10 ? 6.387   -4.107  12.504  1.00 10.00 ? 419 PRO A HG3  3  
ATOM 2408  H HD2  . PRO A 1 10 ? 4.612   -3.418  14.427  1.00 10.00 ? 419 PRO A HD2  3  
ATOM 2409  H HD3  . PRO A 1 10 ? 5.387   -2.218  13.373  1.00 10.00 ? 419 PRO A HD3  3  
ATOM 2410  N N    . MET A 1 11 ? 1.134   -4.366  10.887  1.00 10.00 ? 420 MET A N    3  
ATOM 2411  C CA   . MET A 1 11 ? 0.072   -5.361  10.843  1.00 10.00 ? 420 MET A CA   3  
ATOM 2412  C C    . MET A 1 11 ? -0.383  -5.596  9.412   1.00 10.00 ? 420 MET A C    3  
ATOM 2413  O O    . MET A 1 11 ? 0.085   -6.521  8.757   1.00 10.00 ? 420 MET A O    3  
ATOM 2414  C CB   . MET A 1 11 ? -1.107  -4.911  11.707  1.00 10.00 ? 420 MET A CB   3  
ATOM 2415  C CG   . MET A 1 11 ? -2.266  -5.895  11.722  1.00 10.00 ? 420 MET A CG   3  
ATOM 2416  S SD   . MET A 1 11 ? -2.272  -6.940  13.192  1.00 10.00 ? 420 MET A SD   3  
ATOM 2417  C CE   . MET A 1 11 ? -2.920  -8.468  12.519  1.00 10.00 ? 420 MET A CE   3  
ATOM 2418  H H    . MET A 1 11 ? 0.994   -3.501  10.446  1.00 10.00 ? 420 MET A H    3  
ATOM 2419  H HA   . MET A 1 11 ? 0.463   -6.290  11.232  1.00 10.00 ? 420 MET A HA   3  
ATOM 2420  H HB2  . MET A 1 11 ? -0.764  -4.776  12.723  1.00 10.00 ? 420 MET A HB2  3  
ATOM 2421  H HB3  . MET A 1 11 ? -1.472  -3.964  11.332  1.00 10.00 ? 420 MET A HB3  3  
ATOM 2422  H HG2  . MET A 1 11 ? -3.192  -5.342  11.689  1.00 10.00 ? 420 MET A HG2  3  
ATOM 2423  H HG3  . MET A 1 11 ? -2.194  -6.527  10.848  1.00 10.00 ? 420 MET A HG3  3  
ATOM 2424  H HE1  . MET A 1 11 ? -3.016  -8.377  11.447  1.00 10.00 ? 420 MET A HE1  3  
ATOM 2425  H HE2  . MET A 1 11 ? -3.889  -8.669  12.951  1.00 10.00 ? 420 MET A HE2  3  
ATOM 2426  H HE3  . MET A 1 11 ? -2.246  -9.279  12.752  1.00 10.00 ? 420 MET A HE3  3  
ATOM 2427  N N    . LYS A 1 12 ? -1.287  -4.756  8.923   1.00 10.00 ? 421 LYS A N    3  
ATOM 2428  C CA   . LYS A 1 12 ? -1.788  -4.889  7.561   1.00 10.00 ? 421 LYS A CA   3  
ATOM 2429  C C    . LYS A 1 12 ? -0.637  -5.050  6.578   1.00 10.00 ? 421 LYS A C    3  
ATOM 2430  O O    . LYS A 1 12 ? 0.000   -4.072  6.188   1.00 10.00 ? 421 LYS A O    3  
ATOM 2431  C CB   . LYS A 1 12 ? -2.637  -3.684  7.178   1.00 10.00 ? 421 LYS A CB   3  
ATOM 2432  C CG   . LYS A 1 12 ? -3.123  -3.737  5.739   1.00 10.00 ? 421 LYS A CG   3  
ATOM 2433  C CD   . LYS A 1 12 ? -4.464  -4.438  5.605   1.00 10.00 ? 421 LYS A CD   3  
ATOM 2434  C CE   . LYS A 1 12 ? -5.508  -3.874  6.560   1.00 10.00 ? 421 LYS A CE   3  
ATOM 2435  N NZ   . LYS A 1 12 ? -6.804  -3.614  5.874   1.00 10.00 ? 421 LYS A NZ   3  
ATOM 2436  H H    . LYS A 1 12 ? -1.618  -4.029  9.488   1.00 10.00 ? 421 LYS A H    3  
ATOM 2437  H HA   . LYS A 1 12 ? -2.403  -5.773  7.519   1.00 10.00 ? 421 LYS A HA   3  
ATOM 2438  H HB2  . LYS A 1 12 ? -3.496  -3.639  7.831   1.00 10.00 ? 421 LYS A HB2  3  
ATOM 2439  H HB3  . LYS A 1 12 ? -2.050  -2.787  7.304   1.00 10.00 ? 421 LYS A HB3  3  
ATOM 2440  H HG2  . LYS A 1 12 ? -3.219  -2.735  5.366   1.00 10.00 ? 421 LYS A HG2  3  
ATOM 2441  H HG3  . LYS A 1 12 ? -2.392  -4.277  5.150   1.00 10.00 ? 421 LYS A HG3  3  
ATOM 2442  H HD2  . LYS A 1 12 ? -4.813  -4.311  4.593   1.00 10.00 ? 421 LYS A HD2  3  
ATOM 2443  H HD3  . LYS A 1 12 ? -4.328  -5.489  5.813   1.00 10.00 ? 421 LYS A HD3  3  
ATOM 2444  H HE2  . LYS A 1 12 ? -5.670  -4.584  7.356   1.00 10.00 ? 421 LYS A HE2  3  
ATOM 2445  H HE3  . LYS A 1 12 ? -5.137  -2.948  6.974   1.00 10.00 ? 421 LYS A HE3  3  
ATOM 2446  H HZ1  . LYS A 1 12 ? -7.449  -4.418  6.013   1.00 10.00 ? 421 LYS A HZ1  3  
ATOM 2447  H HZ2  . LYS A 1 12 ? -6.649  -3.481  4.854   1.00 10.00 ? 421 LYS A HZ2  3  
ATOM 2448  H HZ3  . LYS A 1 12 ? -7.247  -2.755  6.260   1.00 10.00 ? 421 LYS A HZ3  3  
ATOM 2449  N N    . VAL A 1 13 ? -0.378  -6.293  6.190   1.00 10.00 ? 422 VAL A N    3  
ATOM 2450  C CA   . VAL A 1 13 ? 0.700   -6.595  5.262   1.00 10.00 ? 422 VAL A CA   3  
ATOM 2451  C C    . VAL A 1 13 ? 0.794   -8.101  5.024   1.00 10.00 ? 422 VAL A C    3  
ATOM 2452  O O    . VAL A 1 13 ? 0.887   -8.565  3.890   1.00 10.00 ? 422 VAL A O    3  
ATOM 2453  C CB   . VAL A 1 13 ? 2.034   -6.045  5.801   1.00 10.00 ? 422 VAL A CB   3  
ATOM 2454  C CG1  . VAL A 1 13 ? 2.623   -6.946  6.879   1.00 10.00 ? 422 VAL A CG1  3  
ATOM 2455  C CG2  . VAL A 1 13 ? 3.027   -5.836  4.670   1.00 10.00 ? 422 VAL A CG2  3  
ATOM 2456  H H    . VAL A 1 13 ? -0.922  -7.023  6.540   1.00 10.00 ? 422 VAL A H    3  
ATOM 2457  H HA   . VAL A 1 13 ? 0.477   -6.106  4.331   1.00 10.00 ? 422 VAL A HA   3  
ATOM 2458  H HB   . VAL A 1 13 ? 1.825   -5.087  6.252   1.00 10.00 ? 422 VAL A HB   3  
ATOM 2459  H HG11 . VAL A 1 13 ? 1.905   -7.067  7.677   1.00 10.00 ? 422 VAL A HG11 3  
ATOM 2460  H HG12 . VAL A 1 13 ? 3.524   -6.500  7.269   1.00 10.00 ? 422 VAL A HG12 3  
ATOM 2461  H HG13 . VAL A 1 13 ? 2.854   -7.912  6.454   1.00 10.00 ? 422 VAL A HG13 3  
ATOM 2462  H HG21 . VAL A 1 13 ? 2.637   -5.105  3.978   1.00 10.00 ? 422 VAL A HG21 3  
ATOM 2463  H HG22 . VAL A 1 13 ? 3.186   -6.772  4.155   1.00 10.00 ? 422 VAL A HG22 3  
ATOM 2464  H HG23 . VAL A 1 13 ? 3.962   -5.484  5.077   1.00 10.00 ? 422 VAL A HG23 3  
ATOM 2465  N N    . TYR A 1 14 ? 0.743   -8.843  6.121   1.00 10.00 ? 423 TYR A N    3  
ATOM 2466  C CA   . TYR A 1 14 ? 0.783   -10.303 6.115   1.00 10.00 ? 423 TYR A CA   3  
ATOM 2467  C C    . TYR A 1 14 ? 0.008   -10.879 4.929   1.00 10.00 ? 423 TYR A C    3  
ATOM 2468  O O    . TYR A 1 14 ? 0.370   -11.923 4.388   1.00 10.00 ? 423 TYR A O    3  
ATOM 2469  C CB   . TYR A 1 14 ? 0.176   -10.818 7.428   1.00 10.00 ? 423 TYR A CB   3  
ATOM 2470  C CG   . TYR A 1 14 ? -1.148  -10.161 7.759   1.00 10.00 ? 423 TYR A CG   3  
ATOM 2471  C CD1  . TYR A 1 14 ? -1.203  -8.806  8.027   1.00 10.00 ? 423 TYR A CD1  3  
ATOM 2472  C CD2  . TYR A 1 14 ? -2.335  -10.881 7.790   1.00 10.00 ? 423 TYR A CD2  3  
ATOM 2473  C CE1  . TYR A 1 14 ? -2.380  -8.174  8.313   1.00 10.00 ? 423 TYR A CE1  3  
ATOM 2474  C CE2  . TYR A 1 14 ? -3.536  -10.254 8.079   1.00 10.00 ? 423 TYR A CE2  3  
ATOM 2475  C CZ   . TYR A 1 14 ? -3.553  -8.897  8.338   1.00 10.00 ? 423 TYR A CZ   3  
ATOM 2476  O OH   . TYR A 1 14 ? -4.743  -8.268  8.627   1.00 10.00 ? 423 TYR A OH   3  
ATOM 2477  H H    . TYR A 1 14 ? 0.661   -8.389  6.977   1.00 10.00 ? 423 TYR A H    3  
ATOM 2478  H HA   . TYR A 1 14 ? 1.811   -10.617 6.049   1.00 10.00 ? 423 TYR A HA   3  
ATOM 2479  H HB2  . TYR A 1 14 ? 0.018   -11.883 7.360   1.00 10.00 ? 423 TYR A HB2  3  
ATOM 2480  H HB3  . TYR A 1 14 ? 0.861   -10.604 8.241   1.00 10.00 ? 423 TYR A HB3  3  
ATOM 2481  H HD1  . TYR A 1 14 ? -0.294  -8.236  8.011   1.00 10.00 ? 423 TYR A HD1  3  
ATOM 2482  H HD2  . TYR A 1 14 ? -2.314  -11.941 7.584   1.00 10.00 ? 423 TYR A HD2  3  
ATOM 2483  H HE1  . TYR A 1 14 ? -2.374  -7.110  8.506   1.00 10.00 ? 423 TYR A HE1  3  
ATOM 2484  H HE2  . TYR A 1 14 ? -4.452  -10.826 8.099   1.00 10.00 ? 423 TYR A HE2  3  
ATOM 2485  H HH   . TYR A 1 14 ? -5.390  -8.479  7.949   1.00 10.00 ? 423 TYR A HH   3  
ATOM 2486  N N    . LYS A 1 15 ? -1.057  -10.188 4.532   1.00 10.00 ? 424 LYS A N    3  
ATOM 2487  C CA   . LYS A 1 15 ? -1.878  -10.632 3.410   1.00 10.00 ? 424 LYS A CA   3  
ATOM 2488  C C    . LYS A 1 15 ? -1.602  -9.793  2.165   1.00 10.00 ? 424 LYS A C    3  
ATOM 2489  O O    . LYS A 1 15 ? -1.844  -10.233 1.042   1.00 10.00 ? 424 LYS A O    3  
ATOM 2490  C CB   . LYS A 1 15 ? -3.361  -10.551 3.775   1.00 10.00 ? 424 LYS A CB   3  
ATOM 2491  C CG   . LYS A 1 15 ? -4.202  -11.656 3.156   1.00 10.00 ? 424 LYS A CG   3  
ATOM 2492  C CD   . LYS A 1 15 ? -4.847  -11.203 1.856   1.00 10.00 ? 424 LYS A CD   3  
ATOM 2493  C CE   . LYS A 1 15 ? -5.334  -12.386 1.035   1.00 10.00 ? 424 LYS A CE   3  
ATOM 2494  N NZ   . LYS A 1 15 ? -5.303  -12.098 -0.426  1.00 10.00 ? 424 LYS A NZ   3  
ATOM 2495  H H    . LYS A 1 15 ? -1.296  -9.359  5.002   1.00 10.00 ? 424 LYS A H    3  
ATOM 2496  H HA   . LYS A 1 15 ? -1.624  -11.660 3.201   1.00 10.00 ? 424 LYS A HA   3  
ATOM 2497  H HB2  . LYS A 1 15 ? -3.460  -10.611 4.849   1.00 10.00 ? 424 LYS A HB2  3  
ATOM 2498  H HB3  . LYS A 1 15 ? -3.751  -9.600  3.438   1.00 10.00 ? 424 LYS A HB3  3  
ATOM 2499  H HG2  . LYS A 1 15 ? -3.567  -12.506 2.953   1.00 10.00 ? 424 LYS A HG2  3  
ATOM 2500  H HG3  . LYS A 1 15 ? -4.976  -11.940 3.854   1.00 10.00 ? 424 LYS A HG3  3  
ATOM 2501  H HD2  . LYS A 1 15 ? -5.690  -10.568 2.087   1.00 10.00 ? 424 LYS A HD2  3  
ATOM 2502  H HD3  . LYS A 1 15 ? -4.123  -10.649 1.280   1.00 10.00 ? 424 LYS A HD3  3  
ATOM 2503  H HE2  . LYS A 1 15 ? -4.698  -13.235 1.238   1.00 10.00 ? 424 LYS A HE2  3  
ATOM 2504  H HE3  . LYS A 1 15 ? -6.348  -12.619 1.326   1.00 10.00 ? 424 LYS A HE3  3  
ATOM 2505  H HZ1  . LYS A 1 15 ? -4.461  -11.535 -0.661  1.00 10.00 ? 424 LYS A HZ1  3  
ATOM 2506  H HZ2  . LYS A 1 15 ? -6.152  -11.564 -0.702  1.00 10.00 ? 424 LYS A HZ2  3  
ATOM 2507  H HZ3  . LYS A 1 15 ? -5.276  -12.987 -0.966  1.00 10.00 ? 424 LYS A HZ3  3  
ATOM 2508  N N    . ASP A 1 16 ? -1.098  -8.581  2.374   1.00 10.00 ? 425 ASP A N    3  
ATOM 2509  C CA   . ASP A 1 16 ? -0.792  -7.679  1.271   1.00 10.00 ? 425 ASP A CA   3  
ATOM 2510  C C    . ASP A 1 16 ? 0.426   -8.149  0.476   1.00 10.00 ? 425 ASP A C    3  
ATOM 2511  O O    . ASP A 1 16 ? 0.686   -7.650  -0.618  1.00 10.00 ? 425 ASP A O    3  
ATOM 2512  C CB   . ASP A 1 16 ? -0.548  -6.263  1.795   1.00 10.00 ? 425 ASP A CB   3  
ATOM 2513  C CG   . ASP A 1 16 ? -1.671  -5.771  2.688   1.00 10.00 ? 425 ASP A CG   3  
ATOM 2514  O OD1  . ASP A 1 16 ? -2.600  -6.557  2.965   1.00 10.00 ? 425 ASP A OD1  3  
ATOM 2515  O OD2  . ASP A 1 16 ? -1.619  -4.597  3.111   1.00 10.00 ? 425 ASP A OD2  3  
ATOM 2516  H H    . ASP A 1 16 ? -0.931  -8.285  3.291   1.00 10.00 ? 425 ASP A H    3  
ATOM 2517  H HA   . ASP A 1 16 ? -1.648  -7.664  0.616   1.00 10.00 ? 425 ASP A HA   3  
ATOM 2518  H HB2  . ASP A 1 16 ? 0.370   -6.249  2.363   1.00 10.00 ? 425 ASP A HB2  3  
ATOM 2519  H HB3  . ASP A 1 16 ? -0.458  -5.587  0.958   1.00 10.00 ? 425 ASP A HB3  3  
ATOM 2520  N N    . ARG A 1 17 ? 1.173   -9.107  1.022   1.00 10.00 ? 426 ARG A N    3  
ATOM 2521  C CA   . ARG A 1 17 ? 2.360   -9.624  0.341   1.00 10.00 ? 426 ARG A CA   3  
ATOM 2522  C C    . ARG A 1 17 ? 2.031   -10.028 -1.093  1.00 10.00 ? 426 ARG A C    3  
ATOM 2523  O O    . ARG A 1 17 ? 2.896   -10.009 -1.967  1.00 10.00 ? 426 ARG A O    3  
ATOM 2524  C CB   . ARG A 1 17 ? 2.944   -10.814 1.109   1.00 10.00 ? 426 ARG A CB   3  
ATOM 2525  C CG   . ARG A 1 17 ? 4.405   -10.634 1.488   1.00 10.00 ? 426 ARG A CG   3  
ATOM 2526  C CD   . ARG A 1 17 ? 5.305   -11.623 0.761   1.00 10.00 ? 426 ARG A CD   3  
ATOM 2527  N NE   . ARG A 1 17 ? 6.010   -12.505 1.689   1.00 10.00 ? 426 ARG A NE   3  
ATOM 2528  C CZ   . ARG A 1 17 ? 5.446   -13.548 2.293   1.00 10.00 ? 426 ARG A CZ   3  
ATOM 2529  N NH1  . ARG A 1 17 ? 4.171   -13.843 2.072   1.00 10.00 ? 426 ARG A NH1  3  
ATOM 2530  N NH2  . ARG A 1 17 ? 6.159   -14.298 3.122   1.00 10.00 ? 426 ARG A NH2  3  
ATOM 2531  H H    . ARG A 1 17 ? 0.925   -9.472  1.897   1.00 10.00 ? 426 ARG A H    3  
ATOM 2532  H HA   . ARG A 1 17 ? 3.093   -8.831  0.310   1.00 10.00 ? 426 ARG A HA   3  
ATOM 2533  H HB2  . ARG A 1 17 ? 2.374   -10.956 2.016   1.00 10.00 ? 426 ARG A HB2  3  
ATOM 2534  H HB3  . ARG A 1 17 ? 2.857   -11.701 0.499   1.00 10.00 ? 426 ARG A HB3  3  
ATOM 2535  H HG2  . ARG A 1 17 ? 4.712   -9.631  1.230   1.00 10.00 ? 426 ARG A HG2  3  
ATOM 2536  H HG3  . ARG A 1 17 ? 4.510   -10.780 2.553   1.00 10.00 ? 426 ARG A HG3  3  
ATOM 2537  H HD2  . ARG A 1 17 ? 4.700   -12.224 0.099   1.00 10.00 ? 426 ARG A HD2  3  
ATOM 2538  H HD3  . ARG A 1 17 ? 6.031   -11.071 0.183   1.00 10.00 ? 426 ARG A HD3  3  
ATOM 2539  H HE   . ARG A 1 17 ? 6.953   -12.310 1.871   1.00 10.00 ? 426 ARG A HE   3  
ATOM 2540  H HH11 . ARG A 1 17 ? 3.627   -13.282 1.447   1.00 10.00 ? 426 ARG A HH11 3  
ATOM 2541  H HH12 . ARG A 1 17 ? 3.753   -14.629 2.529   1.00 10.00 ? 426 ARG A HH12 3  
ATOM 2542  H HH21 . ARG A 1 17 ? 7.120   -14.081 3.292   1.00 10.00 ? 426 ARG A HH21 3  
ATOM 2543  H HH22 . ARG A 1 17 ? 5.735   -15.082 3.577   1.00 10.00 ? 426 ARG A HH22 3  
ATOM 2544  N N    . GLN A 1 18 ? 0.769   -10.372 -1.330  1.00 10.00 ? 427 GLN A N    3  
ATOM 2545  C CA   . GLN A 1 18 ? 0.321   -10.753 -2.663  1.00 10.00 ? 427 GLN A CA   3  
ATOM 2546  C C    . GLN A 1 18 ? -0.316  -9.557  -3.356  1.00 10.00 ? 427 GLN A C    3  
ATOM 2547  O O    . GLN A 1 18 ? -1.232  -9.700  -4.165  1.00 10.00 ? 427 GLN A O    3  
ATOM 2548  C CB   . GLN A 1 18 ? -0.672  -11.916 -2.583  1.00 10.00 ? 427 GLN A CB   3  
ATOM 2549  C CG   . GLN A 1 18 ? -0.301  -12.967 -1.546  1.00 10.00 ? 427 GLN A CG   3  
ATOM 2550  C CD   . GLN A 1 18 ? -0.785  -12.614 -0.153  1.00 10.00 ? 427 GLN A CD   3  
ATOM 2551  O OE1  . GLN A 1 18 ? -1.988  -12.516 0.093   1.00 10.00 ? 427 GLN A OE1  3  
ATOM 2552  N NE2  . GLN A 1 18 ? 0.152   -12.421 0.771   1.00 10.00 ? 427 GLN A NE2  3  
ATOM 2553  H H    . GLN A 1 18 ? 0.121   -10.353 -0.596  1.00 10.00 ? 427 GLN A H    3  
ATOM 2554  H HA   . GLN A 1 18 ? 1.186   -11.057 -3.232  1.00 10.00 ? 427 GLN A HA   3  
ATOM 2555  H HB2  . GLN A 1 18 ? -1.647  -11.524 -2.333  1.00 10.00 ? 427 GLN A HB2  3  
ATOM 2556  H HB3  . GLN A 1 18 ? -0.725  -12.396 -3.549  1.00 10.00 ? 427 GLN A HB3  3  
ATOM 2557  H HG2  . GLN A 1 18 ? -0.743  -13.910 -1.835  1.00 10.00 ? 427 GLN A HG2  3  
ATOM 2558  H HG3  . GLN A 1 18 ? 0.774   -13.068 -1.524  1.00 10.00 ? 427 GLN A HG3  3  
ATOM 2559  H HE21 . GLN A 1 18 ? 1.089   -12.518 0.503   1.00 10.00 ? 427 GLN A HE21 3  
ATOM 2560  H HE22 . GLN A 1 18 ? -0.131  -12.189 1.682   1.00 10.00 ? 427 GLN A HE22 3  
ATOM 2561  N N    . VAL A 1 19 ? 0.192   -8.377  -3.025  1.00 10.00 ? 428 VAL A N    3  
ATOM 2562  C CA   . VAL A 1 19 ? -0.295  -7.133  -3.599  1.00 10.00 ? 428 VAL A CA   3  
ATOM 2563  C C    . VAL A 1 19 ? 0.764   -6.509  -4.488  1.00 10.00 ? 428 VAL A C    3  
ATOM 2564  O O    . VAL A 1 19 ? 0.447   -5.871  -5.493  1.00 10.00 ? 428 VAL A O    3  
ATOM 2565  C CB   . VAL A 1 19 ? -0.694  -6.128  -2.506  1.00 10.00 ? 428 VAL A CB   3  
ATOM 2566  C CG1  . VAL A 1 19 ? -1.142  -4.809  -3.116  1.00 10.00 ? 428 VAL A CG1  3  
ATOM 2567  C CG2  . VAL A 1 19 ? -1.783  -6.708  -1.624  1.00 10.00 ? 428 VAL A CG2  3  
ATOM 2568  H H    . VAL A 1 19 ? 0.924   -8.344  -2.379  1.00 10.00 ? 428 VAL A H    3  
ATOM 2569  H HA   . VAL A 1 19 ? -1.167  -7.356  -4.194  1.00 10.00 ? 428 VAL A HA   3  
ATOM 2570  H HB   . VAL A 1 19 ? 0.172   -5.936  -1.891  1.00 10.00 ? 428 VAL A HB   3  
ATOM 2571  H HG11 . VAL A 1 19 ? -0.560  -4.009  -2.687  1.00 10.00 ? 428 VAL A HG11 3  
ATOM 2572  H HG12 . VAL A 1 19 ? -2.187  -4.647  -2.900  1.00 10.00 ? 428 VAL A HG12 3  
ATOM 2573  H HG13 . VAL A 1 19 ? -0.993  -4.830  -4.188  1.00 10.00 ? 428 VAL A HG13 3  
ATOM 2574  H HG21 . VAL A 1 19 ? -2.742  -6.570  -2.101  1.00 10.00 ? 428 VAL A HG21 3  
ATOM 2575  H HG22 . VAL A 1 19 ? -1.780  -6.203  -0.670  1.00 10.00 ? 428 VAL A HG22 3  
ATOM 2576  H HG23 . VAL A 1 19 ? -1.603  -7.763  -1.475  1.00 10.00 ? 428 VAL A HG23 3  
ATOM 2577  N N    . MET A 1 20 ? 2.030   -6.707  -4.127  1.00 10.00 ? 429 MET A N    3  
ATOM 2578  C CA   . MET A 1 20 ? 3.137   -6.173  -4.914  1.00 10.00 ? 429 MET A CA   3  
ATOM 2579  C C    . MET A 1 20 ? 2.920   -6.456  -6.400  1.00 10.00 ? 429 MET A C    3  
ATOM 2580  O O    . MET A 1 20 ? 3.423   -5.735  -7.263  1.00 10.00 ? 429 MET A O    3  
ATOM 2581  C CB   . MET A 1 20 ? 4.463   -6.781  -4.452  1.00 10.00 ? 429 MET A CB   3  
ATOM 2582  C CG   . MET A 1 20 ? 5.630   -5.809  -4.505  1.00 10.00 ? 429 MET A CG   3  
ATOM 2583  S SD   . MET A 1 20 ? 7.181   -6.609  -4.957  1.00 10.00 ? 429 MET A SD   3  
ATOM 2584  C CE   . MET A 1 20 ? 7.132   -8.058  -3.905  1.00 10.00 ? 429 MET A CE   3  
ATOM 2585  H H    . MET A 1 20 ? 2.224   -7.234  -3.319  1.00 10.00 ? 429 MET A H    3  
ATOM 2586  H HA   . MET A 1 20 ? 3.166   -5.103  -4.763  1.00 10.00 ? 429 MET A HA   3  
ATOM 2587  H HB2  . MET A 1 20 ? 4.352   -7.123  -3.433  1.00 10.00 ? 429 MET A HB2  3  
ATOM 2588  H HB3  . MET A 1 20 ? 4.696   -7.626  -5.082  1.00 10.00 ? 429 MET A HB3  3  
ATOM 2589  H HG2  . MET A 1 20 ? 5.410   -5.044  -5.236  1.00 10.00 ? 429 MET A HG2  3  
ATOM 2590  H HG3  . MET A 1 20 ? 5.745   -5.352  -3.533  1.00 10.00 ? 429 MET A HG3  3  
ATOM 2591  H HE1  . MET A 1 20 ? 8.108   -8.518  -3.879  1.00 10.00 ? 429 MET A HE1  3  
ATOM 2592  H HE2  . MET A 1 20 ? 6.412   -8.763  -4.295  1.00 10.00 ? 429 MET A HE2  3  
ATOM 2593  H HE3  . MET A 1 20 ? 6.844   -7.768  -2.905  1.00 10.00 ? 429 MET A HE3  3  
ATOM 2594  N N    . ASN A 1 21 ? 2.161   -7.513  -6.686  1.00 10.00 ? 430 ASN A N    3  
ATOM 2595  C CA   . ASN A 1 21 ? 1.863   -7.900  -8.056  1.00 10.00 ? 430 ASN A CA   3  
ATOM 2596  C C    . ASN A 1 21 ? 0.362   -8.100  -8.258  1.00 10.00 ? 430 ASN A C    3  
ATOM 2597  O O    . ASN A 1 21 ? -0.057  -8.842  -9.145  1.00 10.00 ? 430 ASN A O    3  
ATOM 2598  C CB   . ASN A 1 21 ? 2.609   -9.188  -8.403  1.00 10.00 ? 430 ASN A CB   3  
ATOM 2599  C CG   . ASN A 1 21 ? 4.032   -8.931  -8.859  1.00 10.00 ? 430 ASN A CG   3  
ATOM 2600  O OD1  . ASN A 1 21 ? 4.327   -8.958  -10.053 1.00 10.00 ? 430 ASN A OD1  3  
ATOM 2601  N ND2  . ASN A 1 21 ? 4.922   -8.678  -7.906  1.00 10.00 ? 430 ASN A ND2  3  
ATOM 2602  H H    . ASN A 1 21 ? 1.789   -8.046  -5.954  1.00 10.00 ? 430 ASN A H    3  
ATOM 2603  H HA   . ASN A 1 21 ? 2.199   -7.107  -8.707  1.00 10.00 ? 430 ASN A HA   3  
ATOM 2604  H HB2  . ASN A 1 21 ? 2.640   -9.824  -7.526  1.00 10.00 ? 430 ASN A HB2  3  
ATOM 2605  H HB3  . ASN A 1 21 ? 2.082   -9.700  -9.194  1.00 10.00 ? 430 ASN A HB3  3  
ATOM 2606  H HD21 . ASN A 1 21 ? 4.615   -8.672  -6.976  1.00 10.00 ? 430 ASN A HD21 3  
ATOM 2607  H HD22 . ASN A 1 21 ? 5.849   -8.507  -8.173  1.00 10.00 ? 430 ASN A HD22 3  
ATOM 2608  N N    . MET A 1 22 ? -0.443  -7.434  -7.432  1.00 10.00 ? 431 MET A N    3  
ATOM 2609  C CA   . MET A 1 22 ? -1.898  -7.541  -7.525  1.00 10.00 ? 431 MET A CA   3  
ATOM 2610  C C    . MET A 1 22 ? -2.581  -6.886  -6.330  1.00 10.00 ? 431 MET A C    3  
ATOM 2611  O O    . MET A 1 22 ? -2.907  -7.554  -5.349  1.00 10.00 ? 431 MET A O    3  
ATOM 2612  C CB   . MET A 1 22 ? -2.331  -9.004  -7.612  1.00 10.00 ? 431 MET A CB   3  
ATOM 2613  C CG   . MET A 1 22 ? -2.717  -9.446  -9.013  1.00 10.00 ? 431 MET A CG   3  
ATOM 2614  S SD   . MET A 1 22 ? -4.497  -9.382  -9.295  1.00 10.00 ? 431 MET A SD   3  
ATOM 2615  C CE   . MET A 1 22 ? -4.947  -11.091 -9.002  1.00 10.00 ? 431 MET A CE   3  
ATOM 2616  H H    . MET A 1 22 ? -0.052  -6.855  -6.747  1.00 10.00 ? 431 MET A H    3  
ATOM 2617  H HA   . MET A 1 22 ? -2.209  -7.031  -8.425  1.00 10.00 ? 431 MET A HA   3  
ATOM 2618  H HB2  . MET A 1 22 ? -1.518  -9.626  -7.270  1.00 10.00 ? 431 MET A HB2  3  
ATOM 2619  H HB3  . MET A 1 22 ? -3.183  -9.150  -6.962  1.00 10.00 ? 431 MET A HB3  3  
ATOM 2620  H HG2  . MET A 1 22 ? -2.232  -8.798  -9.728  1.00 10.00 ? 431 MET A HG2  3  
ATOM 2621  H HG3  . MET A 1 22 ? -2.379  -10.460 -9.163  1.00 10.00 ? 431 MET A HG3  3  
ATOM 2622  H HE1  . MET A 1 22 ? -4.098  -11.728 -9.204  1.00 10.00 ? 431 MET A HE1  3  
ATOM 2623  H HE2  . MET A 1 22 ? -5.765  -11.365 -9.651  1.00 10.00 ? 431 MET A HE2  3  
ATOM 2624  H HE3  . MET A 1 22 ? -5.250  -11.212 -7.972  1.00 10.00 ? 431 MET A HE3  3  
ATOM 2625  N N    . TRP A 1 23 ? -2.826  -5.590  -6.432  1.00 10.00 ? 432 TRP A N    3  
ATOM 2626  C CA   . TRP A 1 23 ? -3.501  -4.858  -5.370  1.00 10.00 ? 432 TRP A CA   3  
ATOM 2627  C C    . TRP A 1 23 ? -5.004  -5.007  -5.547  1.00 10.00 ? 432 TRP A C    3  
ATOM 2628  O O    . TRP A 1 23 ? -5.621  -4.318  -6.360  1.00 10.00 ? 432 TRP A O    3  
ATOM 2629  C CB   . TRP A 1 23 ? -3.107  -3.378  -5.375  1.00 10.00 ? 432 TRP A CB   3  
ATOM 2630  C CG   . TRP A 1 23 ? -1.678  -3.106  -5.765  1.00 10.00 ? 432 TRP A CG   3  
ATOM 2631  C CD1  . TRP A 1 23 ? -1.085  -3.390  -6.957  1.00 10.00 ? 432 TRP A CD1  3  
ATOM 2632  C CD2  . TRP A 1 23 ? -0.665  -2.478  -4.965  1.00 10.00 ? 432 TRP A CD2  3  
ATOM 2633  N NE1  . TRP A 1 23 ? 0.211   -2.950  -6.959  1.00 10.00 ? 432 TRP A NE1  3  
ATOM 2634  C CE2  . TRP A 1 23 ? 0.496   -2.397  -5.750  1.00 10.00 ? 432 TRP A CE2  3  
ATOM 2635  C CE3  . TRP A 1 23 ? -0.628  -1.968  -3.672  1.00 10.00 ? 432 TRP A CE3  3  
ATOM 2636  C CZ2  . TRP A 1 23 ? 1.675   -1.825  -5.286  1.00 10.00 ? 432 TRP A CZ2  3  
ATOM 2637  C CZ3  . TRP A 1 23 ? 0.542   -1.407  -3.202  1.00 10.00 ? 432 TRP A CZ3  3  
ATOM 2638  C CH2  . TRP A 1 23 ? 1.681   -1.335  -4.010  1.00 10.00 ? 432 TRP A CH2  3  
ATOM 2639  H H    . TRP A 1 23 ? -2.572  -5.123  -7.250  1.00 10.00 ? 432 TRP A H    3  
ATOM 2640  H HA   . TRP A 1 23 ? -3.226  -5.301  -4.423  1.00 10.00 ? 432 TRP A HA   3  
ATOM 2641  H HB2  . TRP A 1 23 ? -3.740  -2.852  -6.072  1.00 10.00 ? 432 TRP A HB2  3  
ATOM 2642  H HB3  . TRP A 1 23 ? -3.262  -2.972  -4.388  1.00 10.00 ? 432 TRP A HB3  3  
ATOM 2643  H HD1  . TRP A 1 23 ? -1.579  -3.875  -7.778  1.00 10.00 ? 432 TRP A HD1  3  
ATOM 2644  H HE1  . TRP A 1 23 ? 0.830   -3.022  -7.700  1.00 10.00 ? 432 TRP A HE1  3  
ATOM 2645  H HE3  . TRP A 1 23 ? -1.489  -2.017  -3.043  1.00 10.00 ? 432 TRP A HE3  3  
ATOM 2646  H HZ2  . TRP A 1 23 ? 2.550   -1.742  -5.909  1.00 10.00 ? 432 TRP A HZ2  3  
ATOM 2647  H HZ3  . TRP A 1 23 ? 0.584   -1.010  -2.199  1.00 10.00 ? 432 TRP A HZ3  3  
ATOM 2648  H HH2  . TRP A 1 23 ? 2.574   -0.892  -3.602  1.00 10.00 ? 432 TRP A HH2  3  
ATOM 2649  N N    . SER A 1 24 ? -5.573  -5.934  -4.795  1.00 10.00 ? 433 SER A N    3  
ATOM 2650  C CA   . SER A 1 24 ? -7.003  -6.216  -4.873  1.00 10.00 ? 433 SER A CA   3  
ATOM 2651  C C    . SER A 1 24 ? -7.833  -5.003  -4.473  1.00 10.00 ? 433 SER A C    3  
ATOM 2652  O O    . SER A 1 24 ? -7.409  -4.191  -3.650  1.00 10.00 ? 433 SER A O    3  
ATOM 2653  C CB   . SER A 1 24 ? -7.358  -7.412  -3.984  1.00 10.00 ? 433 SER A CB   3  
ATOM 2654  O OG   . SER A 1 24 ? -7.754  -6.994  -2.688  1.00 10.00 ? 433 SER A OG   3  
ATOM 2655  H H    . SER A 1 24 ? -5.012  -6.453  -4.179  1.00 10.00 ? 433 SER A H    3  
ATOM 2656  H HA   . SER A 1 24 ? -7.232  -6.465  -5.897  1.00 10.00 ? 433 SER A HA   3  
ATOM 2657  H HB2  . SER A 1 24 ? -8.169  -7.963  -4.434  1.00 10.00 ? 433 SER A HB2  3  
ATOM 2658  H HB3  . SER A 1 24 ? -6.494  -8.056  -3.892  1.00 10.00 ? 433 SER A HB3  3  
ATOM 2659  H HG   . SER A 1 24 ? -7.908  -7.765  -2.136  1.00 10.00 ? 433 SER A HG   3  
ATOM 2660  N N    . GLU A 1 25 ? -9.027  -4.892  -5.051  1.00 10.00 ? 434 GLU A N    3  
ATOM 2661  C CA   . GLU A 1 25 ? -9.924  -3.783  -4.743  1.00 10.00 ? 434 GLU A CA   3  
ATOM 2662  C C    . GLU A 1 25 ? -10.060 -3.618  -3.233  1.00 10.00 ? 434 GLU A C    3  
ATOM 2663  O O    . GLU A 1 25 ? -10.281 -2.515  -2.733  1.00 10.00 ? 434 GLU A O    3  
ATOM 2664  C CB   . GLU A 1 25 ? -11.299 -4.019  -5.372  1.00 10.00 ? 434 GLU A CB   3  
ATOM 2665  C CG   . GLU A 1 25 ? -12.019 -2.737  -5.755  1.00 10.00 ? 434 GLU A CG   3  
ATOM 2666  C CD   . GLU A 1 25 ? -13.402 -2.993  -6.322  1.00 10.00 ? 434 GLU A CD   3  
ATOM 2667  O OE1  . GLU A 1 25 ? -14.252 -3.538  -5.588  1.00 10.00 ? 434 GLU A OE1  3  
ATOM 2668  O OE2  . GLU A 1 25 ? -13.635 -2.647  -7.499  1.00 10.00 ? 434 GLU A OE2  3  
ATOM 2669  H H    . GLU A 1 25 ? -9.313  -5.575  -5.692  1.00 10.00 ? 434 GLU A H    3  
ATOM 2670  H HA   . GLU A 1 25 ? -9.495  -2.883  -5.157  1.00 10.00 ? 434 GLU A HA   3  
ATOM 2671  H HB2  . GLU A 1 25 ? -11.177 -4.618  -6.261  1.00 10.00 ? 434 GLU A HB2  3  
ATOM 2672  H HB3  . GLU A 1 25 ? -11.917 -4.556  -4.667  1.00 10.00 ? 434 GLU A HB3  3  
ATOM 2673  H HG2  . GLU A 1 25 ? -12.117 -2.116  -4.878  1.00 10.00 ? 434 GLU A HG2  3  
ATOM 2674  H HG3  . GLU A 1 25 ? -11.432 -2.218  -6.498  1.00 10.00 ? 434 GLU A HG3  3  
ATOM 2675  N N    . GLN A 1 26 ? -9.913  -4.727  -2.514  1.00 10.00 ? 435 GLN A N    3  
ATOM 2676  C CA   . GLN A 1 26 ? -10.002 -4.716  -1.063  1.00 10.00 ? 435 GLN A CA   3  
ATOM 2677  C C    . GLN A 1 26 ? -8.640  -4.422  -0.449  1.00 10.00 ? 435 GLN A C    3  
ATOM 2678  O O    . GLN A 1 26 ? -8.549  -3.827  0.625   1.00 10.00 ? 435 GLN A O    3  
ATOM 2679  C CB   . GLN A 1 26 ? -10.529 -6.058  -0.550  1.00 10.00 ? 435 GLN A CB   3  
ATOM 2680  C CG   . GLN A 1 26 ? -11.895 -6.427  -1.105  1.00 10.00 ? 435 GLN A CG   3  
ATOM 2681  C CD   . GLN A 1 26 ? -12.954 -5.391  -0.781  1.00 10.00 ? 435 GLN A CD   3  
ATOM 2682  O OE1  . GLN A 1 26 ? -13.615 -5.464  0.254   1.00 10.00 ? 435 GLN A OE1  3  
ATOM 2683  N NE2  . GLN A 1 26 ? -13.122 -4.419  -1.670  1.00 10.00 ? 435 GLN A NE2  3  
ATOM 2684  H H    . GLN A 1 26 ? -9.729  -5.573  -2.973  1.00 10.00 ? 435 GLN A H    3  
ATOM 2685  H HA   . GLN A 1 26 ? -10.689 -3.934  -0.778  1.00 10.00 ? 435 GLN A HA   3  
ATOM 2686  H HB2  . GLN A 1 26 ? -9.830  -6.834  -0.828  1.00 10.00 ? 435 GLN A HB2  3  
ATOM 2687  H HB3  . GLN A 1 26 ? -10.600 -6.016  0.526   1.00 10.00 ? 435 GLN A HB3  3  
ATOM 2688  H HG2  . GLN A 1 26 ? -11.822 -6.520  -2.178  1.00 10.00 ? 435 GLN A HG2  3  
ATOM 2689  H HG3  . GLN A 1 26 ? -12.197 -7.374  -0.682  1.00 10.00 ? 435 GLN A HG3  3  
ATOM 2690  H HE21 . GLN A 1 26 ? -12.561 -4.424  -2.474  1.00 10.00 ? 435 GLN A HE21 3  
ATOM 2691  H HE22 . GLN A 1 26 ? -13.800 -3.736  -1.487  1.00 10.00 ? 435 GLN A HE22 3  
ATOM 2692  N N    . GLU A 1 27 ? -7.579  -4.829  -1.143  1.00 10.00 ? 436 GLU A N    3  
ATOM 2693  C CA   . GLU A 1 27 ? -6.232  -4.594  -0.673  1.00 10.00 ? 436 GLU A CA   3  
ATOM 2694  C C    . GLU A 1 27 ? -5.866  -3.139  -0.896  1.00 10.00 ? 436 GLU A C    3  
ATOM 2695  O O    . GLU A 1 27 ? -5.545  -2.419  0.049   1.00 10.00 ? 436 GLU A O    3  
ATOM 2696  C CB   . GLU A 1 27 ? -5.271  -5.545  -1.390  1.00 10.00 ? 436 GLU A CB   3  
ATOM 2697  C CG   . GLU A 1 27 ? -4.654  -6.584  -0.467  1.00 10.00 ? 436 GLU A CG   3  
ATOM 2698  C CD   . GLU A 1 27 ? -4.519  -7.942  -1.124  1.00 10.00 ? 436 GLU A CD   3  
ATOM 2699  O OE1  . GLU A 1 27 ? -4.472  -7.997  -2.371  1.00 10.00 ? 436 GLU A OE1  3  
ATOM 2700  O OE2  . GLU A 1 27 ? -4.460  -8.954  -0.392  1.00 10.00 ? 436 GLU A OE2  3  
ATOM 2701  H H    . GLU A 1 27 ? -7.704  -5.288  -2.000  1.00 10.00 ? 436 GLU A H    3  
ATOM 2702  H HA   . GLU A 1 27 ? -6.209  -4.789  0.384   1.00 10.00 ? 436 GLU A HA   3  
ATOM 2703  H HB2  . GLU A 1 27 ? -5.814  -6.065  -2.165  1.00 10.00 ? 436 GLU A HB2  3  
ATOM 2704  H HB3  . GLU A 1 27 ? -4.479  -4.973  -1.844  1.00 10.00 ? 436 GLU A HB3  3  
ATOM 2705  H HG2  . GLU A 1 27 ? -3.676  -6.246  -0.165  1.00 10.00 ? 436 GLU A HG2  3  
ATOM 2706  H HG3  . GLU A 1 27 ? -5.282  -6.684  0.407   1.00 10.00 ? 436 GLU A HG3  3  
ATOM 2707  N N    . LYS A 1 28 ? -5.973  -2.691  -2.139  1.00 10.00 ? 437 LYS A N    3  
ATOM 2708  C CA   . LYS A 1 28 ? -5.710  -1.294  -2.466  1.00 10.00 ? 437 LYS A CA   3  
ATOM 2709  C C    . LYS A 1 28 ? -6.589  -0.407  -1.594  1.00 10.00 ? 437 LYS A C    3  
ATOM 2710  O O    . LYS A 1 28 ? -6.306  0.770   -1.397  1.00 10.00 ? 437 LYS A O    3  
ATOM 2711  C CB   . LYS A 1 28 ? -6.001  -1.031  -3.946  1.00 10.00 ? 437 LYS A CB   3  
ATOM 2712  C CG   . LYS A 1 28 ? -5.079  -0.001  -4.575  1.00 10.00 ? 437 LYS A CG   3  
ATOM 2713  C CD   . LYS A 1 28 ? -5.779  0.772   -5.680  1.00 10.00 ? 437 LYS A CD   3  
ATOM 2714  C CE   . LYS A 1 28 ? -6.227  -0.147  -6.805  1.00 10.00 ? 437 LYS A CE   3  
ATOM 2715  N NZ   . LYS A 1 28 ? -7.537  -0.790  -6.510  1.00 10.00 ? 437 LYS A NZ   3  
ATOM 2716  H H    . LYS A 1 28 ? -6.275  -3.302  -2.841  1.00 10.00 ? 437 LYS A H    3  
ATOM 2717  H HA   . LYS A 1 28 ? -4.674  -1.072  -2.257  1.00 10.00 ? 437 LYS A HA   3  
ATOM 2718  H HB2  . LYS A 1 28 ? -5.895  -1.957  -4.491  1.00 10.00 ? 437 LYS A HB2  3  
ATOM 2719  H HB3  . LYS A 1 28 ? -7.018  -0.680  -4.043  1.00 10.00 ? 437 LYS A HB3  3  
ATOM 2720  H HG2  . LYS A 1 28 ? -4.757  0.693   -3.813  1.00 10.00 ? 437 LYS A HG2  3  
ATOM 2721  H HG3  . LYS A 1 28 ? -4.220  -0.507  -4.990  1.00 10.00 ? 437 LYS A HG3  3  
ATOM 2722  H HD2  . LYS A 1 28 ? -6.646  1.267   -5.268  1.00 10.00 ? 437 LYS A HD2  3  
ATOM 2723  H HD3  . LYS A 1 28 ? -5.097  1.509   -6.078  1.00 10.00 ? 437 LYS A HD3  3  
ATOM 2724  H HE2  . LYS A 1 28 ? -6.316  0.432   -7.712  1.00 10.00 ? 437 LYS A HE2  3  
ATOM 2725  H HE3  . LYS A 1 28 ? -5.481  -0.915  -6.943  1.00 10.00 ? 437 LYS A HE3  3  
ATOM 2726  H HZ1  . LYS A 1 28 ? -8.012  -1.057  -7.396  1.00 10.00 ? 437 LYS A HZ1  3  
ATOM 2727  H HZ2  . LYS A 1 28 ? -8.148  -0.132  -5.988  1.00 10.00 ? 437 LYS A HZ2  3  
ATOM 2728  H HZ3  . LYS A 1 28 ? -7.394  -1.644  -5.934  1.00 10.00 ? 437 LYS A HZ3  3  
ATOM 2729  N N    . GLU A 1 29 ? -7.655  -0.999  -1.061  1.00 10.00 ? 438 GLU A N    3  
ATOM 2730  C CA   . GLU A 1 29 ? -8.578  -0.284  -0.198  1.00 10.00 ? 438 GLU A CA   3  
ATOM 2731  C C    . GLU A 1 29 ? -7.892  0.174   1.079   1.00 10.00 ? 438 GLU A C    3  
ATOM 2732  O O    . GLU A 1 29 ? -8.357  1.103   1.732   1.00 10.00 ? 438 GLU A O    3  
ATOM 2733  C CB   . GLU A 1 29 ? -9.772  -1.172  0.146   1.00 10.00 ? 438 GLU A CB   3  
ATOM 2734  C CG   . GLU A 1 29 ? -11.089 -0.418  0.227   1.00 10.00 ? 438 GLU A CG   3  
ATOM 2735  C CD   . GLU A 1 29 ? -11.537 -0.180  1.656   1.00 10.00 ? 438 GLU A CD   3  
ATOM 2736  O OE1  . GLU A 1 29 ? -10.684 -0.248  2.565   1.00 10.00 ? 438 GLU A OE1  3  
ATOM 2737  O OE2  . GLU A 1 29 ? -12.742 0.076   1.866   1.00 10.00 ? 438 GLU A OE2  3  
ATOM 2738  H H    . GLU A 1 29 ? -7.818  -1.948  -1.248  1.00 10.00 ? 438 GLU A H    3  
ATOM 2739  H HA   . GLU A 1 29 ? -8.928  0.586   -0.732  1.00 10.00 ? 438 GLU A HA   3  
ATOM 2740  H HB2  . GLU A 1 29 ? -9.865  -1.937  -0.609  1.00 10.00 ? 438 GLU A HB2  3  
ATOM 2741  H HB3  . GLU A 1 29 ? -9.590  -1.641  1.101   1.00 10.00 ? 438 GLU A HB3  3  
ATOM 2742  H HG2  . GLU A 1 29 ? -10.973 0.538   -0.261  1.00 10.00 ? 438 GLU A HG2  3  
ATOM 2743  H HG3  . GLU A 1 29 ? -11.850 -0.992  -0.282  1.00 10.00 ? 438 GLU A HG3  3  
ATOM 2744  N N    . THR A 1 30 ? -6.792  -0.481  1.447   1.00 10.00 ? 439 THR A N    3  
ATOM 2745  C CA   . THR A 1 30 ? -6.078  -0.107  2.664   1.00 10.00 ? 439 THR A CA   3  
ATOM 2746  C C    . THR A 1 30 ? -4.927  0.852   2.371   1.00 10.00 ? 439 THR A C    3  
ATOM 2747  O O    . THR A 1 30 ? -4.741  1.839   3.083   1.00 10.00 ? 439 THR A O    3  
ATOM 2748  C CB   . THR A 1 30 ? -5.550  -1.347  3.384   1.00 10.00 ? 439 THR A CB   3  
ATOM 2749  O OG1  . THR A 1 30 ? -6.606  -2.241  3.686   1.00 10.00 ? 439 THR A OG1  3  
ATOM 2750  C CG2  . THR A 1 30 ? -4.838  -1.020  4.681   1.00 10.00 ? 439 THR A CG2  3  
ATOM 2751  H H    . THR A 1 30 ? -6.462  -1.231  0.899   1.00 10.00 ? 439 THR A H    3  
ATOM 2752  H HA   . THR A 1 30 ? -6.781  0.397   3.308   1.00 10.00 ? 439 THR A HA   3  
ATOM 2753  H HB   . THR A 1 30 ? -4.847  -1.854  2.740   1.00 10.00 ? 439 THR A HB   3  
ATOM 2754  H HG1  . THR A 1 30 ? -7.329  -1.758  4.091   1.00 10.00 ? 439 THR A HG1  3  
ATOM 2755  H HG21 . THR A 1 30 ? -5.155  -1.709  5.449   1.00 10.00 ? 439 THR A HG21 3  
ATOM 2756  H HG22 . THR A 1 30 ? -5.080  -0.011  4.980   1.00 10.00 ? 439 THR A HG22 3  
ATOM 2757  H HG23 . THR A 1 30 ? -3.772  -1.106  4.539   1.00 10.00 ? 439 THR A HG23 3  
ATOM 2758  N N    . PHE A 1 31 ? -4.156  0.563   1.330   1.00 10.00 ? 440 PHE A N    3  
ATOM 2759  C CA   . PHE A 1 31 ? -3.031  1.406   0.966   1.00 10.00 ? 440 PHE A CA   3  
ATOM 2760  C C    . PHE A 1 31 ? -3.514  2.643   0.216   1.00 10.00 ? 440 PHE A C    3  
ATOM 2761  O O    . PHE A 1 31 ? -2.918  3.715   0.317   1.00 10.00 ? 440 PHE A O    3  
ATOM 2762  C CB   . PHE A 1 31 ? -2.024  0.622   0.117   1.00 10.00 ? 440 PHE A CB   3  
ATOM 2763  C CG   . PHE A 1 31 ? -2.392  -0.810  -0.100  1.00 10.00 ? 440 PHE A CG   3  
ATOM 2764  C CD1  . PHE A 1 31 ? -2.497  -1.699  0.956   1.00 10.00 ? 440 PHE A CD1  3  
ATOM 2765  C CD2  . PHE A 1 31 ? -2.653  -1.258  -1.370  1.00 10.00 ? 440 PHE A CD2  3  
ATOM 2766  C CE1  . PHE A 1 31 ? -2.851  -3.009  0.727   1.00 10.00 ? 440 PHE A CE1  3  
ATOM 2767  C CE2  . PHE A 1 31 ? -3.010  -2.558  -1.602  1.00 10.00 ? 440 PHE A CE2  3  
ATOM 2768  C CZ   . PHE A 1 31 ? -3.106  -3.428  -0.561  1.00 10.00 ? 440 PHE A CZ   3  
ATOM 2769  H H    . PHE A 1 31 ? -4.344  -0.233  0.794   1.00 10.00 ? 440 PHE A H    3  
ATOM 2770  H HA   . PHE A 1 31 ? -2.548  1.723   1.880   1.00 10.00 ? 440 PHE A HA   3  
ATOM 2771  H HB2  . PHE A 1 31 ? -1.957  1.078   -0.855  1.00 10.00 ? 440 PHE A HB2  3  
ATOM 2772  H HB3  . PHE A 1 31 ? -1.058  0.648   0.593   1.00 10.00 ? 440 PHE A HB3  3  
ATOM 2773  H HD1  . PHE A 1 31 ? -2.297  -1.361  1.961   1.00 10.00 ? 440 PHE A HD1  3  
ATOM 2774  H HD2  . PHE A 1 31 ? -2.573  -0.578  -2.191  1.00 10.00 ? 440 PHE A HD2  3  
ATOM 2775  H HE1  . PHE A 1 31 ? -2.929  -3.705  1.549   1.00 10.00 ? 440 PHE A HE1  3  
ATOM 2776  H HE2  . PHE A 1 31 ? -3.217  -2.898  -2.607  1.00 10.00 ? 440 PHE A HE2  3  
ATOM 2777  H HZ   . PHE A 1 31 ? -3.390  -4.424  -0.757  1.00 10.00 ? 440 PHE A HZ   3  
ATOM 2778  N N    . ARG A 1 32 ? -4.610  2.492   -0.526  1.00 10.00 ? 441 ARG A N    3  
ATOM 2779  C CA   . ARG A 1 32 ? -5.177  3.606   -1.277  1.00 10.00 ? 441 ARG A CA   3  
ATOM 2780  C C    . ARG A 1 32 ? -6.011  4.497   -0.361  1.00 10.00 ? 441 ARG A C    3  
ATOM 2781  O O    . ARG A 1 32 ? -6.187  5.685   -0.632  1.00 10.00 ? 441 ARG A O    3  
ATOM 2782  C CB   . ARG A 1 32 ? -6.040  3.102   -2.436  1.00 10.00 ? 441 ARG A CB   3  
ATOM 2783  C CG   . ARG A 1 32 ? -6.278  4.146   -3.514  1.00 10.00 ? 441 ARG A CG   3  
ATOM 2784  C CD   . ARG A 1 32 ? -7.477  5.021   -3.186  1.00 10.00 ? 441 ARG A CD   3  
ATOM 2785  N NE   . ARG A 1 32 ? -8.234  5.384   -4.383  1.00 10.00 ? 441 ARG A NE   3  
ATOM 2786  C CZ   . ARG A 1 32 ? -9.356  6.099   -4.362  1.00 10.00 ? 441 ARG A CZ   3  
ATOM 2787  N NH1  . ARG A 1 32 ? -9.856  6.529   -3.210  1.00 10.00 ? 441 ARG A NH1  3  
ATOM 2788  N NH2  . ARG A 1 32 ? -9.981  6.384   -5.496  1.00 10.00 ? 441 ARG A NH2  3  
ATOM 2789  H H    . ARG A 1 32 ? -5.052  1.617   -0.559  1.00 10.00 ? 441 ARG A H    3  
ATOM 2790  H HA   . ARG A 1 32 ? -4.360  4.182   -1.678  1.00 10.00 ? 441 ARG A HA   3  
ATOM 2791  H HB2  . ARG A 1 32 ? -5.551  2.253   -2.889  1.00 10.00 ? 441 ARG A HB2  3  
ATOM 2792  H HB3  . ARG A 1 32 ? -6.998  2.791   -2.048  1.00 10.00 ? 441 ARG A HB3  3  
ATOM 2793  H HG2  . ARG A 1 32 ? -5.402  4.771   -3.596  1.00 10.00 ? 441 ARG A HG2  3  
ATOM 2794  H HG3  . ARG A 1 32 ? -6.455  3.645   -4.454  1.00 10.00 ? 441 ARG A HG3  3  
ATOM 2795  H HD2  . ARG A 1 32 ? -8.127  4.483   -2.513  1.00 10.00 ? 441 ARG A HD2  3  
ATOM 2796  H HD3  . ARG A 1 32 ? -7.128  5.923   -2.706  1.00 10.00 ? 441 ARG A HD3  3  
ATOM 2797  H HE   . ARG A 1 32 ? -7.887  5.077   -5.248  1.00 10.00 ? 441 ARG A HE   3  
ATOM 2798  H HH11 . ARG A 1 32 ? -9.389  6.317   -2.352  1.00 10.00 ? 441 ARG A HH11 3  
ATOM 2799  H HH12 . ARG A 1 32 ? -10.698 7.066   -3.202  1.00 10.00 ? 441 ARG A HH12 3  
ATOM 2800  H HH21 . ARG A 1 32 ? -9.609  6.063   -6.368  1.00 10.00 ? 441 ARG A HH21 3  
ATOM 2801  H HH22 . ARG A 1 32 ? -10.824 6.921   -5.482  1.00 10.00 ? 441 ARG A HH22 3  
ATOM 2802  N N    . GLU A 1 33 ? -6.520  3.919   0.728   1.00 10.00 ? 442 GLU A N    3  
ATOM 2803  C CA   . GLU A 1 33 ? -7.331  4.673   1.676   1.00 10.00 ? 442 GLU A CA   3  
ATOM 2804  C C    . GLU A 1 33 ? -6.452  5.438   2.654   1.00 10.00 ? 442 GLU A C    3  
ATOM 2805  O O    . GLU A 1 33 ? -6.756  6.575   3.011   1.00 10.00 ? 442 GLU A O    3  
ATOM 2806  C CB   . GLU A 1 33 ? -8.274  3.746   2.439   1.00 10.00 ? 442 GLU A CB   3  
ATOM 2807  C CG   . GLU A 1 33 ? -9.596  3.504   1.730   1.00 10.00 ? 442 GLU A CG   3  
ATOM 2808  C CD   . GLU A 1 33 ? -10.573 2.709   2.574   1.00 10.00 ? 442 GLU A CD   3  
ATOM 2809  O OE1  . GLU A 1 33 ? -10.119 1.994   3.494   1.00 10.00 ? 442 GLU A OE1  3  
ATOM 2810  O OE2  . GLU A 1 33 ? -11.792 2.800   2.316   1.00 10.00 ? 442 GLU A OE2  3  
ATOM 2811  H H    . GLU A 1 33 ? -6.347  2.967   0.898   1.00 10.00 ? 442 GLU A H    3  
ATOM 2812  H HA   . GLU A 1 33 ? -7.917  5.382   1.114   1.00 10.00 ? 442 GLU A HA   3  
ATOM 2813  H HB2  . GLU A 1 33 ? -7.784  2.796   2.583   1.00 10.00 ? 442 GLU A HB2  3  
ATOM 2814  H HB3  . GLU A 1 33 ? -8.482  4.181   3.405   1.00 10.00 ? 442 GLU A HB3  3  
ATOM 2815  H HG2  . GLU A 1 33 ? -10.043 4.457   1.494   1.00 10.00 ? 442 GLU A HG2  3  
ATOM 2816  H HG3  . GLU A 1 33 ? -9.406  2.959   0.817   1.00 10.00 ? 442 GLU A HG3  3  
ATOM 2817  N N    . LYS A 1 34 ? -5.357  4.816   3.079   1.00 10.00 ? 443 LYS A N    3  
ATOM 2818  C CA   . LYS A 1 34 ? -4.444  5.460   4.004   1.00 10.00 ? 443 LYS A CA   3  
ATOM 2819  C C    . LYS A 1 34 ? -3.777  6.640   3.321   1.00 10.00 ? 443 LYS A C    3  
ATOM 2820  O O    . LYS A 1 34 ? -3.605  7.701   3.914   1.00 10.00 ? 443 LYS A O    3  
ATOM 2821  C CB   . LYS A 1 34 ? -3.390  4.470   4.502   1.00 10.00 ? 443 LYS A CB   3  
ATOM 2822  C CG   . LYS A 1 34 ? -3.730  3.845   5.846   1.00 10.00 ? 443 LYS A CG   3  
ATOM 2823  C CD   . LYS A 1 34 ? -4.163  2.396   5.698   1.00 10.00 ? 443 LYS A CD   3  
ATOM 2824  C CE   . LYS A 1 34 ? -4.063  1.647   7.017   1.00 10.00 ? 443 LYS A CE   3  
ATOM 2825  N NZ   . LYS A 1 34 ? -4.819  2.331   8.102   1.00 10.00 ? 443 LYS A NZ   3  
ATOM 2826  H H    . LYS A 1 34 ? -5.153  3.916   2.754   1.00 10.00 ? 443 LYS A H    3  
ATOM 2827  H HA   . LYS A 1 34 ? -5.019  5.820   4.844   1.00 10.00 ? 443 LYS A HA   3  
ATOM 2828  H HB2  . LYS A 1 34 ? -3.285  3.677   3.776   1.00 10.00 ? 443 LYS A HB2  3  
ATOM 2829  H HB3  . LYS A 1 34 ? -2.446  4.986   4.598   1.00 10.00 ? 443 LYS A HB3  3  
ATOM 2830  H HG2  . LYS A 1 34 ? -2.858  3.886   6.482   1.00 10.00 ? 443 LYS A HG2  3  
ATOM 2831  H HG3  . LYS A 1 34 ? -4.534  4.407   6.300   1.00 10.00 ? 443 LYS A HG3  3  
ATOM 2832  H HD2  . LYS A 1 34 ? -5.187  2.369   5.356   1.00 10.00 ? 443 LYS A HD2  3  
ATOM 2833  H HD3  . LYS A 1 34 ? -3.526  1.913   4.971   1.00 10.00 ? 443 LYS A HD3  3  
ATOM 2834  H HE2  . LYS A 1 34 ? -4.465  0.654   6.883   1.00 10.00 ? 443 LYS A HE2  3  
ATOM 2835  H HE3  . LYS A 1 34 ? -3.023  1.579   7.300   1.00 10.00 ? 443 LYS A HE3  3  
ATOM 2836  H HZ1  . LYS A 1 34 ? -5.836  2.330   7.886   1.00 10.00 ? 443 LYS A HZ1  3  
ATOM 2837  H HZ2  . LYS A 1 34 ? -4.497  3.315   8.197   1.00 10.00 ? 443 LYS A HZ2  3  
ATOM 2838  H HZ3  . LYS A 1 34 ? -4.667  1.841   9.007   1.00 10.00 ? 443 LYS A HZ3  3  
ATOM 2839  N N    . PHE A 1 35 ? -3.430  6.460   2.052   1.00 10.00 ? 444 PHE A N    3  
ATOM 2840  C CA   . PHE A 1 35 ? -2.809  7.519   1.282   1.00 10.00 ? 444 PHE A CA   3  
ATOM 2841  C C    . PHE A 1 35 ? -3.771  8.686   1.188   1.00 10.00 ? 444 PHE A C    3  
ATOM 2842  O O    . PHE A 1 35 ? -3.360  9.843   1.099   1.00 10.00 ? 444 PHE A O    3  
ATOM 2843  C CB   . PHE A 1 35 ? -2.407  7.005   -0.098  1.00 10.00 ? 444 PHE A CB   3  
ATOM 2844  C CG   . PHE A 1 35 ? -1.675  8.014   -0.933  1.00 10.00 ? 444 PHE A CG   3  
ATOM 2845  C CD1  . PHE A 1 35 ? -2.315  9.150   -1.403  1.00 10.00 ? 444 PHE A CD1  3  
ATOM 2846  C CD2  . PHE A 1 35 ? -0.340  7.823   -1.246  1.00 10.00 ? 444 PHE A CD2  3  
ATOM 2847  C CE1  . PHE A 1 35 ? -1.635  10.076  -2.170  1.00 10.00 ? 444 PHE A CE1  3  
ATOM 2848  C CE2  . PHE A 1 35 ? 0.345   8.745   -2.013  1.00 10.00 ? 444 PHE A CE2  3  
ATOM 2849  C CZ   . PHE A 1 35 ? -0.303  9.874   -2.476  1.00 10.00 ? 444 PHE A CZ   3  
ATOM 2850  H H    . PHE A 1 35 ? -3.620  5.608   1.618   1.00 10.00 ? 444 PHE A H    3  
ATOM 2851  H HA   . PHE A 1 35 ? -1.926  7.843   1.812   1.00 10.00 ? 444 PHE A HA   3  
ATOM 2852  H HB2  . PHE A 1 35 ? -1.754  6.150   0.029   1.00 10.00 ? 444 PHE A HB2  3  
ATOM 2853  H HB3  . PHE A 1 35 ? -3.292  6.701   -0.637  1.00 10.00 ? 444 PHE A HB3  3  
ATOM 2854  H HD1  . PHE A 1 35 ? -3.356  9.309   -1.163  1.00 10.00 ? 444 PHE A HD1  3  
ATOM 2855  H HD2  . PHE A 1 35 ? 0.165   6.938   -0.883  1.00 10.00 ? 444 PHE A HD2  3  
ATOM 2856  H HE1  . PHE A 1 35 ? -2.145  10.957  -2.532  1.00 10.00 ? 444 PHE A HE1  3  
ATOM 2857  H HE2  . PHE A 1 35 ? 1.386   8.583   -2.251  1.00 10.00 ? 444 PHE A HE2  3  
ATOM 2858  H HZ   . PHE A 1 35 ? 0.230   10.596  -3.077  1.00 10.00 ? 444 PHE A HZ   3  
ATOM 2859  N N    . MET A 1 36 ? -5.060  8.375   1.271   1.00 10.00 ? 445 MET A N    3  
ATOM 2860  C CA   . MET A 1 36 ? -6.076  9.401   1.261   1.00 10.00 ? 445 MET A CA   3  
ATOM 2861  C C    . MET A 1 36 ? -5.984  10.166  2.576   1.00 10.00 ? 445 MET A C    3  
ATOM 2862  O O    . MET A 1 36 ? -6.221  11.373  2.637   1.00 10.00 ? 445 MET A O    3  
ATOM 2863  C CB   . MET A 1 36 ? -7.470  8.791   1.085   1.00 10.00 ? 445 MET A CB   3  
ATOM 2864  C CG   . MET A 1 36 ? -8.096  9.089   -0.268  1.00 10.00 ? 445 MET A CG   3  
ATOM 2865  S SD   . MET A 1 36 ? -8.257  10.856  -0.586  1.00 10.00 ? 445 MET A SD   3  
ATOM 2866  C CE   . MET A 1 36 ? -6.813  11.149  -1.605  1.00 10.00 ? 445 MET A CE   3  
ATOM 2867  H H    . MET A 1 36 ? -5.325  7.438   1.385   1.00 10.00 ? 445 MET A H    3  
ATOM 2868  H HA   . MET A 1 36 ? -5.862  10.065  0.442   1.00 10.00 ? 445 MET A HA   3  
ATOM 2869  H HB2  . MET A 1 36 ? -7.398  7.720   1.195   1.00 10.00 ? 445 MET A HB2  3  
ATOM 2870  H HB3  . MET A 1 36 ? -8.122  9.182   1.852   1.00 10.00 ? 445 MET A HB3  3  
ATOM 2871  H HG2  . MET A 1 36 ? -7.478  8.653   -1.040  1.00 10.00 ? 445 MET A HG2  3  
ATOM 2872  H HG3  . MET A 1 36 ? -9.079  8.640   -0.301  1.00 10.00 ? 445 MET A HG3  3  
ATOM 2873  H HE1  . MET A 1 36 ? -6.151  10.299  -1.544  1.00 10.00 ? 445 MET A HE1  3  
ATOM 2874  H HE2  . MET A 1 36 ? -6.299  12.032  -1.254  1.00 10.00 ? 445 MET A HE2  3  
ATOM 2875  H HE3  . MET A 1 36 ? -7.119  11.295  -2.630  1.00 10.00 ? 445 MET A HE3  3  
ATOM 2876  N N    . GLN A 1 37 ? -5.595  9.433   3.620   1.00 10.00 ? 446 GLN A N    3  
ATOM 2877  C CA   . GLN A 1 37 ? -5.410  9.993   4.951   1.00 10.00 ? 446 GLN A CA   3  
ATOM 2878  C C    . GLN A 1 37 ? -4.092  10.744  5.004   1.00 10.00 ? 446 GLN A C    3  
ATOM 2879  O O    . GLN A 1 37 ? -3.968  11.785  5.651   1.00 10.00 ? 446 GLN A O    3  
ATOM 2880  C CB   . GLN A 1 37 ? -5.383  8.869   5.992   1.00 10.00 ? 446 GLN A CB   3  
ATOM 2881  C CG   . GLN A 1 37 ? -6.610  7.973   5.957   1.00 10.00 ? 446 GLN A CG   3  
ATOM 2882  C CD   . GLN A 1 37 ? -7.907  8.755   6.025   1.00 10.00 ? 446 GLN A CD   3  
ATOM 2883  O OE1  . GLN A 1 37 ? -7.989  9.786   6.692   1.00 10.00 ? 446 GLN A OE1  3  
ATOM 2884  N NE2  . GLN A 1 37 ? -8.930  8.266   5.333   1.00 10.00 ? 446 GLN A NE2  3  
ATOM 2885  H H    . GLN A 1 37 ? -5.401  8.484   3.483   1.00 10.00 ? 446 GLN A H    3  
ATOM 2886  H HA   . GLN A 1 37 ? -6.225  10.668  5.162   1.00 10.00 ? 446 GLN A HA   3  
ATOM 2887  H HB2  . GLN A 1 37 ? -4.502  8.252   5.817   1.00 10.00 ? 446 GLN A HB2  3  
ATOM 2888  H HB3  . GLN A 1 37 ? -5.311  9.309   6.976   1.00 10.00 ? 446 GLN A HB3  3  
ATOM 2889  H HG2  . GLN A 1 37 ? -6.598  7.404   5.041   1.00 10.00 ? 446 GLN A HG2  3  
ATOM 2890  H HG3  . GLN A 1 37 ? -6.569  7.297   6.799   1.00 10.00 ? 446 GLN A HG3  3  
ATOM 2891  H HE21 . GLN A 1 37 ? -8.791  7.440   4.824   1.00 10.00 ? 446 GLN A HE21 3  
ATOM 2892  H HE22 . GLN A 1 37 ? -9.781  8.752   5.359   1.00 10.00 ? 446 GLN A HE22 3  
ATOM 2893  N N    . HIS A 1 38 ? -3.104  10.181  4.322   1.00 10.00 ? 447 HIS A N    3  
ATOM 2894  C CA   . HIS A 1 38 ? -1.769  10.747  4.272   1.00 10.00 ? 447 HIS A CA   3  
ATOM 2895  C C    . HIS A 1 38 ? -1.370  11.047  2.829   1.00 10.00 ? 447 HIS A C    3  
ATOM 2896  O O    . HIS A 1 38 ? -0.526  10.362  2.252   1.00 10.00 ? 447 HIS A O    3  
ATOM 2897  C CB   . HIS A 1 38 ? -0.775  9.771   4.908   1.00 10.00 ? 447 HIS A CB   3  
ATOM 2898  C CG   . HIS A 1 38 ? -1.385  8.897   5.968   1.00 10.00 ? 447 HIS A CG   3  
ATOM 2899  N ND1  . HIS A 1 38 ? -1.555  9.312   7.273   1.00 10.00 ? 447 HIS A ND1  3  
ATOM 2900  C CD2  . HIS A 1 38 ? -1.870  7.629   5.915   1.00 10.00 ? 447 HIS A CD2  3  
ATOM 2901  C CE1  . HIS A 1 38 ? -2.111  8.338   7.974   1.00 10.00 ? 447 HIS A CE1  3  
ATOM 2902  N NE2  . HIS A 1 38 ? -2.314  7.311   7.173   1.00 10.00 ? 447 HIS A NE2  3  
ATOM 2903  H H    . HIS A 1 38 ? -3.278  9.344   3.842   1.00 10.00 ? 447 HIS A H    3  
ATOM 2904  H HA   . HIS A 1 38 ? -1.772  11.667  4.837   1.00 10.00 ? 447 HIS A HA   3  
ATOM 2905  H HB2  . HIS A 1 38 ? -0.370  9.128   4.141   1.00 10.00 ? 447 HIS A HB2  3  
ATOM 2906  H HB3  . HIS A 1 38 ? 0.029   10.331  5.363   1.00 10.00 ? 447 HIS A HB3  3  
ATOM 2907  H HD1  . HIS A 1 38 ? -1.304  10.188  7.633   1.00 10.00 ? 447 HIS A HD1  3  
ATOM 2908  H HD2  . HIS A 1 38 ? -1.902  6.982   5.044   1.00 10.00 ? 447 HIS A HD2  3  
ATOM 2909  H HE1  . HIS A 1 38 ? -2.328  8.365   9.029   1.00 10.00 ? 447 HIS A HE1  3  
ATOM 2910  H HE2  . HIS A 1 38 ? -2.783  6.487   7.420   1.00 10.00 ? 447 HIS A HE2  3  
ATOM 2911  N N    . PRO A 1 39 ? -1.985  12.077  2.221   1.00 10.00 ? 448 PRO A N    3  
ATOM 2912  C CA   . PRO A 1 39 ? -1.702  12.462  0.834   1.00 10.00 ? 448 PRO A CA   3  
ATOM 2913  C C    . PRO A 1 39 ? -0.294  13.021  0.655   1.00 10.00 ? 448 PRO A C    3  
ATOM 2914  O O    . PRO A 1 39 ? 0.179   13.815  1.468   1.00 10.00 ? 448 PRO A O    3  
ATOM 2915  C CB   . PRO A 1 39 ? -2.746  13.543  0.540   1.00 10.00 ? 448 PRO A CB   3  
ATOM 2916  C CG   . PRO A 1 39 ? -3.114  14.091  1.875   1.00 10.00 ? 448 PRO A CG   3  
ATOM 2917  C CD   . PRO A 1 39 ? -3.012  12.939  2.836   1.00 10.00 ? 448 PRO A CD   3  
ATOM 2918  H HA   . PRO A 1 39 ? -1.843  11.631  0.159   1.00 10.00 ? 448 PRO A HA   3  
ATOM 2919  H HB2  . PRO A 1 39 ? -2.312  14.303  -0.093  1.00 10.00 ? 448 PRO A HB2  3  
ATOM 2920  H HB3  . PRO A 1 39 ? -3.598  13.100  0.048   1.00 10.00 ? 448 PRO A HB3  3  
ATOM 2921  H HG2  . PRO A 1 39 ? -2.424  14.873  2.154   1.00 10.00 ? 448 PRO A HG2  3  
ATOM 2922  H HG3  . PRO A 1 39 ? -4.125  14.470  1.851   1.00 10.00 ? 448 PRO A HG3  3  
ATOM 2923  H HD2  . PRO A 1 39 ? -2.695  13.284  3.808   1.00 10.00 ? 448 PRO A HD2  3  
ATOM 2924  H HD3  . PRO A 1 39 ? -3.957  12.421  2.906   1.00 10.00 ? 448 PRO A HD3  3  
ATOM 2925  N N    . LYS A 1 40 ? 0.367   12.599  -0.423  1.00 10.00 ? 449 LYS A N    3  
ATOM 2926  C CA   . LYS A 1 40 ? 1.725   13.051  -0.735  1.00 10.00 ? 449 LYS A CA   3  
ATOM 2927  C C    . LYS A 1 40 ? 2.777   12.312  0.093   1.00 10.00 ? 449 LYS A C    3  
ATOM 2928  O O    . LYS A 1 40 ? 3.975   12.475  -0.136  1.00 10.00 ? 449 LYS A O    3  
ATOM 2929  C CB   . LYS A 1 40 ? 1.856   14.561  -0.515  1.00 10.00 ? 449 LYS A CB   3  
ATOM 2930  C CG   . LYS A 1 40 ? 2.964   15.200  -1.336  1.00 10.00 ? 449 LYS A CG   3  
ATOM 2931  C CD   . LYS A 1 40 ? 3.462   16.485  -0.695  1.00 10.00 ? 449 LYS A CD   3  
ATOM 2932  C CE   . LYS A 1 40 ? 4.754   16.964  -1.336  1.00 10.00 ? 449 LYS A CE   3  
ATOM 2933  N NZ   . LYS A 1 40 ? 4.674   16.954  -2.823  1.00 10.00 ? 449 LYS A NZ   3  
ATOM 2934  H H    . LYS A 1 40 ? -0.073  11.968  -1.031  1.00 10.00 ? 449 LYS A H    3  
ATOM 2935  H HA   . LYS A 1 40 ? 1.903   12.839  -1.778  1.00 10.00 ? 449 LYS A HA   3  
ATOM 2936  H HB2  . LYS A 1 40 ? 0.923   15.035  -0.778  1.00 10.00 ? 449 LYS A HB2  3  
ATOM 2937  H HB3  . LYS A 1 40 ? 2.060   14.745  0.530   1.00 10.00 ? 449 LYS A HB3  3  
ATOM 2938  H HG2  . LYS A 1 40 ? 3.788   14.507  -1.414  1.00 10.00 ? 449 LYS A HG2  3  
ATOM 2939  H HG3  . LYS A 1 40 ? 2.585   15.424  -2.322  1.00 10.00 ? 449 LYS A HG3  3  
ATOM 2940  H HD2  . LYS A 1 40 ? 2.709   17.251  -0.813  1.00 10.00 ? 449 LYS A HD2  3  
ATOM 2941  H HD3  . LYS A 1 40 ? 3.636   16.308  0.357   1.00 10.00 ? 449 LYS A HD3  3  
ATOM 2942  H HE2  . LYS A 1 40 ? 4.955   17.972  -1.004  1.00 10.00 ? 449 LYS A HE2  3  
ATOM 2943  H HE3  . LYS A 1 40 ? 5.559   16.315  -1.023  1.00 10.00 ? 449 LYS A HE3  3  
ATOM 2944  H HZ1  . LYS A 1 40 ? 5.315   17.669  -3.221  1.00 10.00 ? 449 LYS A HZ1  3  
ATOM 2945  H HZ2  . LYS A 1 40 ? 3.703   17.165  -3.130  1.00 10.00 ? 449 LYS A HZ2  3  
ATOM 2946  H HZ3  . LYS A 1 40 ? 4.945   16.018  -3.189  1.00 10.00 ? 449 LYS A HZ3  3  
ATOM 2947  N N    . ASN A 1 41 ? 2.335   11.506  1.056   1.00 10.00 ? 450 ASN A N    3  
ATOM 2948  C CA   . ASN A 1 41 ? 3.258   10.761  1.901   1.00 10.00 ? 450 ASN A CA   3  
ATOM 2949  C C    . ASN A 1 41 ? 3.895   9.598   1.146   1.00 10.00 ? 450 ASN A C    3  
ATOM 2950  O O    . ASN A 1 41 ? 5.012   9.710   0.641   1.00 10.00 ? 450 ASN A O    3  
ATOM 2951  C CB   . ASN A 1 41 ? 2.536   10.236  3.144   1.00 10.00 ? 450 ASN A CB   3  
ATOM 2952  C CG   . ASN A 1 41 ? 2.411   11.282  4.230   1.00 10.00 ? 450 ASN A CG   3  
ATOM 2953  O OD1  . ASN A 1 41 ? 2.454   12.483  3.961   1.00 10.00 ? 450 ASN A OD1  3  
ATOM 2954  N ND2  . ASN A 1 41 ? 2.256   10.832  5.468   1.00 10.00 ? 450 ASN A ND2  3  
ATOM 2955  H H    . ASN A 1 41 ? 1.374   11.410  1.206   1.00 10.00 ? 450 ASN A H    3  
ATOM 2956  H HA   . ASN A 1 41 ? 4.037   11.438  2.213   1.00 10.00 ? 450 ASN A HA   3  
ATOM 2957  H HB2  . ASN A 1 41 ? 1.544   9.913   2.868   1.00 10.00 ? 450 ASN A HB2  3  
ATOM 2958  H HB3  . ASN A 1 41 ? 3.085   9.395   3.543   1.00 10.00 ? 450 ASN A HB3  3  
ATOM 2959  H HD21 . ASN A 1 41 ? 2.232   9.859   5.611   1.00 10.00 ? 450 ASN A HD21 3  
ATOM 2960  H HD22 . ASN A 1 41 ? 2.167   11.487  6.187   1.00 10.00 ? 450 ASN A HD22 3  
ATOM 2961  N N    . PHE A 1 42 ? 3.187   8.471   1.100   1.00 10.00 ? 451 PHE A N    3  
ATOM 2962  C CA   . PHE A 1 42 ? 3.683   7.267   0.439   1.00 10.00 ? 451 PHE A CA   3  
ATOM 2963  C C    . PHE A 1 42 ? 4.710   6.555   1.317   1.00 10.00 ? 451 PHE A C    3  
ATOM 2964  O O    . PHE A 1 42 ? 5.125   5.435   1.020   1.00 10.00 ? 451 PHE A O    3  
ATOM 2965  C CB   . PHE A 1 42 ? 4.276   7.592   -0.938  1.00 10.00 ? 451 PHE A CB   3  
ATOM 2966  C CG   . PHE A 1 42 ? 3.734   6.731   -2.050  1.00 10.00 ? 451 PHE A CG   3  
ATOM 2967  C CD1  . PHE A 1 42 ? 2.419   6.298   -2.025  1.00 10.00 ? 451 PHE A CD1  3  
ATOM 2968  C CD2  . PHE A 1 42 ? 4.534   6.362   -3.120  1.00 10.00 ? 451 PHE A CD2  3  
ATOM 2969  C CE1  . PHE A 1 42 ? 1.910   5.514   -3.040  1.00 10.00 ? 451 PHE A CE1  3  
ATOM 2970  C CE2  . PHE A 1 42 ? 4.032   5.575   -4.140  1.00 10.00 ? 451 PHE A CE2  3  
ATOM 2971  C CZ   . PHE A 1 42 ? 2.718   5.152   -4.100  1.00 10.00 ? 451 PHE A CZ   3  
ATOM 2972  H H    . PHE A 1 42 ? 2.313   8.442   1.541   1.00 10.00 ? 451 PHE A H    3  
ATOM 2973  H HA   . PHE A 1 42 ? 2.841   6.606   0.308   1.00 10.00 ? 451 PHE A HA   3  
ATOM 2974  H HB2  . PHE A 1 42 ? 4.052   8.620   -1.181  1.00 10.00 ? 451 PHE A HB2  3  
ATOM 2975  H HB3  . PHE A 1 42 ? 5.346   7.459   -0.904  1.00 10.00 ? 451 PHE A HB3  3  
ATOM 2976  H HD1  . PHE A 1 42 ? 1.790   6.578   -1.198  1.00 10.00 ? 451 PHE A HD1  3  
ATOM 2977  H HD2  . PHE A 1 42 ? 5.562   6.692   -3.153  1.00 10.00 ? 451 PHE A HD2  3  
ATOM 2978  H HE1  . PHE A 1 42 ? 0.882   5.187   -3.004  1.00 10.00 ? 451 PHE A HE1  3  
ATOM 2979  H HE2  . PHE A 1 42 ? 4.666   5.293   -4.967  1.00 10.00 ? 451 PHE A HE2  3  
ATOM 2980  H HZ   . PHE A 1 42 ? 2.322   4.538   -4.897  1.00 10.00 ? 451 PHE A HZ   3  
ATOM 2981  N N    . GLY A 1 43 ? 5.088   7.199   2.421   1.00 10.00 ? 452 GLY A N    3  
ATOM 2982  C CA   . GLY A 1 43 ? 6.026   6.606   3.346   1.00 10.00 ? 452 GLY A CA   3  
ATOM 2983  C C    . GLY A 1 43 ? 5.297   5.889   4.460   1.00 10.00 ? 452 GLY A C    3  
ATOM 2984  O O    . GLY A 1 43 ? 5.774   4.882   4.981   1.00 10.00 ? 452 GLY A O    3  
ATOM 2985  H H    . GLY A 1 43 ? 4.706   8.073   2.622   1.00 10.00 ? 452 GLY A H    3  
ATOM 2986  H HA2  . GLY A 1 43 ? 6.651   5.900   2.815   1.00 10.00 ? 452 GLY A HA2  3  
ATOM 2987  H HA3  . GLY A 1 43 ? 6.646   7.381   3.771   1.00 10.00 ? 452 GLY A HA3  3  
ATOM 2988  N N    . LEU A 1 44 ? 4.117   6.405   4.806   1.00 10.00 ? 453 LEU A N    3  
ATOM 2989  C CA   . LEU A 1 44 ? 3.295   5.802   5.844   1.00 10.00 ? 453 LEU A CA   3  
ATOM 2990  C C    . LEU A 1 44 ? 2.677   4.519   5.330   1.00 10.00 ? 453 LEU A C    3  
ATOM 2991  O O    . LEU A 1 44 ? 2.834   3.455   5.928   1.00 10.00 ? 453 LEU A O    3  
ATOM 2992  C CB   . LEU A 1 44 ? 2.188   6.755   6.295   1.00 10.00 ? 453 LEU A CB   3  
ATOM 2993  C CG   . LEU A 1 44 ? 1.117   6.116   7.184   1.00 10.00 ? 453 LEU A CG   3  
ATOM 2994  C CD1  . LEU A 1 44 ? 0.518   7.148   8.118   1.00 10.00 ? 453 LEU A CD1  3  
ATOM 2995  C CD2  . LEU A 1 44 ? 0.036   5.445   6.337   1.00 10.00 ? 453 LEU A CD2  3  
ATOM 2996  H H    . LEU A 1 44 ? 3.787   7.200   4.338   1.00 10.00 ? 453 LEU A H    3  
ATOM 2997  H HA   . LEU A 1 44 ? 3.930   5.573   6.682   1.00 10.00 ? 453 LEU A HA   3  
ATOM 2998  H HB2  . LEU A 1 44 ? 2.642   7.571   6.838   1.00 10.00 ? 453 LEU A HB2  3  
ATOM 2999  H HB3  . LEU A 1 44 ? 1.704   7.154   5.417   1.00 10.00 ? 453 LEU A HB3  3  
ATOM 3000  H HG   . LEU A 1 44 ? 1.577   5.361   7.796   1.00 10.00 ? 453 LEU A HG   3  
ATOM 3001  H HD11 . LEU A 1 44 ? -0.396  6.760   8.541   1.00 10.00 ? 453 LEU A HD11 3  
ATOM 3002  H HD12 . LEU A 1 44 ? 0.310   8.051   7.568   1.00 10.00 ? 453 LEU A HD12 3  
ATOM 3003  H HD13 . LEU A 1 44 ? 1.218   7.363   8.912   1.00 10.00 ? 453 LEU A HD13 3  
ATOM 3004  H HD21 . LEU A 1 44 ? -0.904  5.462   6.868   1.00 10.00 ? 453 LEU A HD21 3  
ATOM 3005  H HD22 . LEU A 1 44 ? 0.315   4.418   6.138   1.00 10.00 ? 453 LEU A HD22 3  
ATOM 3006  H HD23 . LEU A 1 44 ? -0.070  5.973   5.401   1.00 10.00 ? 453 LEU A HD23 3  
ATOM 3007  N N    . ILE A 1 45 ? 1.977   4.621   4.206   1.00 10.00 ? 454 ILE A N    3  
ATOM 3008  C CA   . ILE A 1 45 ? 1.349   3.463   3.607   1.00 10.00 ? 454 ILE A CA   3  
ATOM 3009  C C    . ILE A 1 45 ? 2.387   2.386   3.360   1.00 10.00 ? 454 ILE A C    3  
ATOM 3010  O O    . ILE A 1 45 ? 2.175   1.223   3.676   1.00 10.00 ? 454 ILE A O    3  
ATOM 3011  C CB   . ILE A 1 45 ? 0.628   3.842   2.304   1.00 10.00 ? 454 ILE A CB   3  
ATOM 3012  C CG1  . ILE A 1 45 ? -0.711  4.459   2.657   1.00 10.00 ? 454 ILE A CG1  3  
ATOM 3013  C CG2  . ILE A 1 45 ? 0.447   2.639   1.384   1.00 10.00 ? 454 ILE A CG2  3  
ATOM 3014  C CD1  . ILE A 1 45 ? -0.661  5.967   2.697   1.00 10.00 ? 454 ILE A CD1  3  
ATOM 3015  H H    . ILE A 1 45 ? 1.892   5.495   3.766   1.00 10.00 ? 454 ILE A H    3  
ATOM 3016  H HA   . ILE A 1 45 ? 0.617   3.088   4.303   1.00 10.00 ? 454 ILE A HA   3  
ATOM 3017  H HB   . ILE A 1 45 ? 1.221   4.583   1.792   1.00 10.00 ? 454 ILE A HB   3  
ATOM 3018  H HG12 . ILE A 1 45 ? -1.450  4.160   1.926   1.00 10.00 ? 454 ILE A HG12 3  
ATOM 3019  H HG13 . ILE A 1 45 ? -1.005  4.106   3.635   1.00 10.00 ? 454 ILE A HG13 3  
ATOM 3020  H HG21 . ILE A 1 45 ? 0.073   1.802   1.955   1.00 10.00 ? 454 ILE A HG21 3  
ATOM 3021  H HG22 . ILE A 1 45 ? 1.397   2.378   0.943   1.00 10.00 ? 454 ILE A HG22 3  
ATOM 3022  H HG23 . ILE A 1 45 ? -0.257  2.886   0.604   1.00 10.00 ? 454 ILE A HG23 3  
ATOM 3023  H HD11 . ILE A 1 45 ? -1.487  6.341   3.276   1.00 10.00 ? 454 ILE A HD11 3  
ATOM 3024  H HD12 . ILE A 1 45 ? -0.719  6.354   1.692   1.00 10.00 ? 454 ILE A HD12 3  
ATOM 3025  H HD13 . ILE A 1 45 ? 0.266   6.283   3.149   1.00 10.00 ? 454 ILE A HD13 3  
ATOM 3026  N N    . ALA A 1 46 ? 3.533   2.802   2.842   1.00 10.00 ? 455 ALA A N    3  
ATOM 3027  C CA   . ALA A 1 46 ? 4.634   1.886   2.596   1.00 10.00 ? 455 ALA A CA   3  
ATOM 3028  C C    . ALA A 1 46 ? 5.292   1.480   3.915   1.00 10.00 ? 455 ALA A C    3  
ATOM 3029  O O    . ALA A 1 46 ? 6.297   0.771   3.926   1.00 10.00 ? 455 ALA A O    3  
ATOM 3030  C CB   . ALA A 1 46 ? 5.656   2.524   1.668   1.00 10.00 ? 455 ALA A CB   3  
ATOM 3031  H H    . ALA A 1 46 ? 3.650   3.755   2.650   1.00 10.00 ? 455 ALA A H    3  
ATOM 3032  H HA   . ALA A 1 46 ? 4.239   1.007   2.112   1.00 10.00 ? 455 ALA A HA   3  
ATOM 3033  H HB1  . ALA A 1 46 ? 5.147   2.981   0.831   1.00 10.00 ? 455 ALA A HB1  3  
ATOM 3034  H HB2  . ALA A 1 46 ? 6.335   1.767   1.305   1.00 10.00 ? 455 ALA A HB2  3  
ATOM 3035  H HB3  . ALA A 1 46 ? 6.211   3.278   2.206   1.00 10.00 ? 455 ALA A HB3  3  
ATOM 3036  N N    . SER A 1 47 ? 4.715   1.940   5.029   1.00 10.00 ? 456 SER A N    3  
ATOM 3037  C CA   . SER A 1 47 ? 5.242   1.629   6.349   1.00 10.00 ? 456 SER A CA   3  
ATOM 3038  C C    . SER A 1 47 ? 4.373   0.594   7.056   1.00 10.00 ? 456 SER A C    3  
ATOM 3039  O O    . SER A 1 47 ? 4.890   -0.278  7.755   1.00 10.00 ? 456 SER A O    3  
ATOM 3040  C CB   . SER A 1 47 ? 5.338   2.901   7.198   1.00 10.00 ? 456 SER A CB   3  
ATOM 3041  O OG   . SER A 1 47 ? 6.688   3.214   7.495   1.00 10.00 ? 456 SER A OG   3  
ATOM 3042  H H    . SER A 1 47 ? 3.916   2.502   4.960   1.00 10.00 ? 456 SER A H    3  
ATOM 3043  H HA   . SER A 1 47 ? 6.232   1.221   6.220   1.00 10.00 ? 456 SER A HA   3  
ATOM 3044  H HB2  . SER A 1 47 ? 4.902   3.726   6.657   1.00 10.00 ? 456 SER A HB2  3  
ATOM 3045  H HB3  . SER A 1 47 ? 4.802   2.755   8.125   1.00 10.00 ? 456 SER A HB3  3  
ATOM 3046  H HG   . SER A 1 47 ? 6.979   2.695   8.248   1.00 10.00 ? 456 SER A HG   3  
ATOM 3047  N N    . PHE A 1 48 ? 3.055   0.680   6.874   1.00 10.00 ? 457 PHE A N    3  
ATOM 3048  C CA   . PHE A 1 48 ? 2.155   -0.274  7.509   1.00 10.00 ? 457 PHE A CA   3  
ATOM 3049  C C    . PHE A 1 48 ? 2.127   -1.587  6.722   1.00 10.00 ? 457 PHE A C    3  
ATOM 3050  O O    . PHE A 1 48 ? 1.817   -2.644  7.270   1.00 10.00 ? 457 PHE A O    3  
ATOM 3051  C CB   . PHE A 1 48 ? 0.746   0.320   7.671   1.00 10.00 ? 457 PHE A CB   3  
ATOM 3052  C CG   . PHE A 1 48 ? -0.100  0.262   6.434   1.00 10.00 ? 457 PHE A CG   3  
ATOM 3053  C CD1  . PHE A 1 48 ? -0.651  -0.939  6.014   1.00 10.00 ? 457 PHE A CD1  3  
ATOM 3054  C CD2  . PHE A 1 48 ? -0.348  1.409   5.692   1.00 10.00 ? 457 PHE A CD2  3  
ATOM 3055  C CE1  . PHE A 1 48 ? -1.428  -0.999  4.878   1.00 10.00 ? 457 PHE A CE1  3  
ATOM 3056  C CE2  . PHE A 1 48 ? -1.125  1.353   4.556   1.00 10.00 ? 457 PHE A CE2  3  
ATOM 3057  C CZ   . PHE A 1 48 ? -1.665  0.153   4.147   1.00 10.00 ? 457 PHE A CZ   3  
ATOM 3058  H H    . PHE A 1 48 ? 2.684   1.392   6.300   1.00 10.00 ? 457 PHE A H    3  
ATOM 3059  H HA   . PHE A 1 48 ? 2.555   -0.483  8.491   1.00 10.00 ? 457 PHE A HA   3  
ATOM 3060  H HB2  . PHE A 1 48 ? 0.227   -0.220  8.448   1.00 10.00 ? 457 PHE A HB2  3  
ATOM 3061  H HB3  . PHE A 1 48 ? 0.837   1.356   7.963   1.00 10.00 ? 457 PHE A HB3  3  
ATOM 3062  H HD1  . PHE A 1 48 ? -0.471  -1.836  6.589   1.00 10.00 ? 457 PHE A HD1  3  
ATOM 3063  H HD2  . PHE A 1 48 ? 0.074   2.356   6.006   1.00 10.00 ? 457 PHE A HD2  3  
ATOM 3064  H HE1  . PHE A 1 48 ? -1.846  -1.947  4.559   1.00 10.00 ? 457 PHE A HE1  3  
ATOM 3065  H HE2  . PHE A 1 48 ? -1.313  2.249   3.986   1.00 10.00 ? 457 PHE A HE2  3  
ATOM 3066  H HZ   . PHE A 1 48 ? -2.271  0.117   3.260   1.00 10.00 ? 457 PHE A HZ   3  
ATOM 3067  N N    . LEU A 1 49 ? 2.485   -1.513  5.439   1.00 10.00 ? 458 LEU A N    3  
ATOM 3068  C CA   . LEU A 1 49 ? 2.537   -2.695  4.583   1.00 10.00 ? 458 LEU A CA   3  
ATOM 3069  C C    . LEU A 1 49 ? 3.938   -2.839  3.990   1.00 10.00 ? 458 LEU A C    3  
ATOM 3070  O O    . LEU A 1 49 ? 4.110   -2.982  2.781   1.00 10.00 ? 458 LEU A O    3  
ATOM 3071  C CB   . LEU A 1 49 ? 1.482   -2.618  3.473   1.00 10.00 ? 458 LEU A CB   3  
ATOM 3072  C CG   . LEU A 1 49 ? 1.313   -1.245  2.823   1.00 10.00 ? 458 LEU A CG   3  
ATOM 3073  C CD1  . LEU A 1 49 ? 2.623   -0.795  2.197   1.00 10.00 ? 458 LEU A CD1  3  
ATOM 3074  C CD2  . LEU A 1 49 ? 0.202   -1.275  1.780   1.00 10.00 ? 458 LEU A CD2  3  
ATOM 3075  H H    . LEU A 1 49 ? 2.744   -0.645  5.065   1.00 10.00 ? 458 LEU A H    3  
ATOM 3076  H HA   . LEU A 1 49 ? 2.334   -3.555  5.201   1.00 10.00 ? 458 LEU A HA   3  
ATOM 3077  H HB2  . LEU A 1 49 ? 1.750   -3.326  2.703   1.00 10.00 ? 458 LEU A HB2  3  
ATOM 3078  H HB3  . LEU A 1 49 ? 0.531   -2.910  3.891   1.00 10.00 ? 458 LEU A HB3  3  
ATOM 3079  H HG   . LEU A 1 49 ? 1.040   -0.529  3.583   1.00 10.00 ? 458 LEU A HG   3  
ATOM 3080  H HD11 . LEU A 1 49 ? 2.464   0.124   1.651   1.00 10.00 ? 458 LEU A HD11 3  
ATOM 3081  H HD12 . LEU A 1 49 ? 2.980   -1.556  1.524   1.00 10.00 ? 458 LEU A HD12 3  
ATOM 3082  H HD13 . LEU A 1 49 ? 3.355   -0.630  2.974   1.00 10.00 ? 458 LEU A HD13 3  
ATOM 3083  H HD21 . LEU A 1 49 ? -0.225  -2.267  1.735   1.00 10.00 ? 458 LEU A HD21 3  
ATOM 3084  H HD22 . LEU A 1 49 ? 0.605   -1.014  0.813   1.00 10.00 ? 458 LEU A HD22 3  
ATOM 3085  H HD23 . LEU A 1 49 ? -0.570  -0.565  2.049   1.00 10.00 ? 458 LEU A HD23 3  
ATOM 3086  N N    . GLU A 1 50 ? 4.930   -2.781  4.879   1.00 10.00 ? 459 GLU A N    3  
ATOM 3087  C CA   . GLU A 1 50 ? 6.354   -2.878  4.527   1.00 10.00 ? 459 GLU A CA   3  
ATOM 3088  C C    . GLU A 1 50 ? 6.607   -3.711  3.273   1.00 10.00 ? 459 GLU A C    3  
ATOM 3089  O O    . GLU A 1 50 ? 7.438   -3.347  2.441   1.00 10.00 ? 459 GLU A O    3  
ATOM 3090  C CB   . GLU A 1 50 ? 7.140   -3.469  5.699   1.00 10.00 ? 459 GLU A CB   3  
ATOM 3091  C CG   . GLU A 1 50 ? 8.535   -2.886  5.852   1.00 10.00 ? 459 GLU A CG   3  
ATOM 3092  C CD   . GLU A 1 50 ? 8.958   -2.757  7.301   1.00 10.00 ? 459 GLU A CD   3  
ATOM 3093  O OE1  . GLU A 1 50 ? 8.847   -3.757  8.044   1.00 10.00 ? 459 GLU A OE1  3  
ATOM 3094  O OE2  . GLU A 1 50 ? 9.400   -1.658  7.695   1.00 10.00 ? 459 GLU A OE2  3  
ATOM 3095  H H    . GLU A 1 50 ? 4.695   -2.653  5.815   1.00 10.00 ? 459 GLU A H    3  
ATOM 3096  H HA   . GLU A 1 50 ? 6.712   -1.877  4.348   1.00 10.00 ? 459 GLU A HA   3  
ATOM 3097  H HB2  . GLU A 1 50 ? 6.594   -3.284  6.613   1.00 10.00 ? 459 GLU A HB2  3  
ATOM 3098  H HB3  . GLU A 1 50 ? 7.231   -4.536  5.556   1.00 10.00 ? 459 GLU A HB3  3  
ATOM 3099  H HG2  . GLU A 1 50 ? 9.238   -3.530  5.343   1.00 10.00 ? 459 GLU A HG2  3  
ATOM 3100  H HG3  . GLU A 1 50 ? 8.553   -1.906  5.398   1.00 10.00 ? 459 GLU A HG3  3  
ATOM 3101  N N    . ARG A 1 51 ? 5.895   -4.826  3.139   1.00 10.00 ? 460 ARG A N    3  
ATOM 3102  C CA   . ARG A 1 51 ? 6.056   -5.701  1.978   1.00 10.00 ? 460 ARG A CA   3  
ATOM 3103  C C    . ARG A 1 51 ? 6.081   -4.887  0.685   1.00 10.00 ? 460 ARG A C    3  
ATOM 3104  O O    . ARG A 1 51 ? 6.681   -5.294  -0.308  1.00 10.00 ? 460 ARG A O    3  
ATOM 3105  C CB   . ARG A 1 51 ? 4.927   -6.730  1.928   1.00 10.00 ? 460 ARG A CB   3  
ATOM 3106  C CG   . ARG A 1 51 ? 5.080   -7.847  2.949   1.00 10.00 ? 460 ARG A CG   3  
ATOM 3107  C CD   . ARG A 1 51 ? 6.387   -8.598  2.761   1.00 10.00 ? 460 ARG A CD   3  
ATOM 3108  N NE   . ARG A 1 51 ? 7.424   -8.131  3.679   1.00 10.00 ? 460 ARG A NE   3  
ATOM 3109  C CZ   . ARG A 1 51 ? 8.671   -8.596  3.690   1.00 10.00 ? 460 ARG A CZ   3  
ATOM 3110  N NH1  . ARG A 1 51 ? 9.040   -9.542  2.834   1.00 10.00 ? 460 ARG A NH1  3  
ATOM 3111  N NH2  . ARG A 1 51 ? 9.551   -8.116  4.558   1.00 10.00 ? 460 ARG A NH2  3  
ATOM 3112  H H    . ARG A 1 51 ? 5.250   -5.067  3.832   1.00 10.00 ? 460 ARG A H    3  
ATOM 3113  H HA   . ARG A 1 51 ? 6.999   -6.217  2.080   1.00 10.00 ? 460 ARG A HA   3  
ATOM 3114  H HB2  . ARG A 1 51 ? 3.989   -6.229  2.113   1.00 10.00 ? 460 ARG A HB2  3  
ATOM 3115  H HB3  . ARG A 1 51 ? 4.902   -7.173  0.944   1.00 10.00 ? 460 ARG A HB3  3  
ATOM 3116  H HG2  . ARG A 1 51 ? 5.060   -7.421  3.940   1.00 10.00 ? 460 ARG A HG2  3  
ATOM 3117  H HG3  . ARG A 1 51 ? 4.257   -8.539  2.836   1.00 10.00 ? 460 ARG A HG3  3  
ATOM 3118  H HD2  . ARG A 1 51 ? 6.213   -9.649  2.937   1.00 10.00 ? 460 ARG A HD2  3  
ATOM 3119  H HD3  . ARG A 1 51 ? 6.728   -8.456  1.747   1.00 10.00 ? 460 ARG A HD3  3  
ATOM 3120  H HE   . ARG A 1 51 ? 7.178   -7.433  4.322   1.00 10.00 ? 460 ARG A HE   3  
ATOM 3121  H HH11 . ARG A 1 51 ? 8.382   -9.908  2.177   1.00 10.00 ? 460 ARG A HH11 3  
ATOM 3122  H HH12 . ARG A 1 51 ? 9.979   -9.888  2.847   1.00 10.00 ? 460 ARG A HH12 3  
ATOM 3123  H HH21 . ARG A 1 51 ? 9.277   -7.404  5.204   1.00 10.00 ? 460 ARG A HH21 3  
ATOM 3124  H HH22 . ARG A 1 51 ? 10.487  -8.467  4.566   1.00 10.00 ? 460 ARG A HH22 3  
ATOM 3125  N N    . LYS A 1 52 ? 5.426   -3.731  0.717   1.00 10.00 ? 461 LYS A N    3  
ATOM 3126  C CA   . LYS A 1 52 ? 5.370   -2.844  -0.436  1.00 10.00 ? 461 LYS A CA   3  
ATOM 3127  C C    . LYS A 1 52 ? 6.281   -1.640  -0.220  1.00 10.00 ? 461 LYS A C    3  
ATOM 3128  O O    . LYS A 1 52 ? 6.237   -0.997  0.829   1.00 10.00 ? 461 LYS A O    3  
ATOM 3129  C CB   . LYS A 1 52 ? 3.932   -2.367  -0.685  1.00 10.00 ? 461 LYS A CB   3  
ATOM 3130  C CG   . LYS A 1 52 ? 2.858   -3.288  -0.119  1.00 10.00 ? 461 LYS A CG   3  
ATOM 3131  C CD   . LYS A 1 52 ? 2.382   -4.288  -1.161  1.00 10.00 ? 461 LYS A CD   3  
ATOM 3132  C CE   . LYS A 1 52 ? 3.406   -5.386  -1.395  1.00 10.00 ? 461 LYS A CE   3  
ATOM 3133  N NZ   . LYS A 1 52 ? 3.089   -6.618  -0.621  1.00 10.00 ? 461 LYS A NZ   3  
ATOM 3134  H H    . LYS A 1 52 ? 4.973   -3.463  1.543   1.00 10.00 ? 461 LYS A H    3  
ATOM 3135  H HA   . LYS A 1 52 ? 5.715   -3.394  -1.298  1.00 10.00 ? 461 LYS A HA   3  
ATOM 3136  H HB2  . LYS A 1 52 ? 3.809   -1.392  -0.239  1.00 10.00 ? 461 LYS A HB2  3  
ATOM 3137  H HB3  . LYS A 1 52 ? 3.776   -2.285  -1.751  1.00 10.00 ? 461 LYS A HB3  3  
ATOM 3138  H HG2  . LYS A 1 52 ? 3.258   -3.825  0.731   1.00 10.00 ? 461 LYS A HG2  3  
ATOM 3139  H HG3  . LYS A 1 52 ? 2.019   -2.689  0.200   1.00 10.00 ? 461 LYS A HG3  3  
ATOM 3140  H HD2  . LYS A 1 52 ? 1.460   -4.736  -0.821  1.00 10.00 ? 461 LYS A HD2  3  
ATOM 3141  H HD3  . LYS A 1 52 ? 2.210   -3.765  -2.090  1.00 10.00 ? 461 LYS A HD3  3  
ATOM 3142  H HE2  . LYS A 1 52 ? 3.422   -5.628  -2.447  1.00 10.00 ? 461 LYS A HE2  3  
ATOM 3143  H HE3  . LYS A 1 52 ? 4.378   -5.024  -1.096  1.00 10.00 ? 461 LYS A HE3  3  
ATOM 3144  H HZ1  . LYS A 1 52 ? 2.991   -6.391  0.389   1.00 10.00 ? 461 LYS A HZ1  3  
ATOM 3145  H HZ2  . LYS A 1 52 ? 3.849   -7.318  -0.736  1.00 10.00 ? 461 LYS A HZ2  3  
ATOM 3146  H HZ3  . LYS A 1 52 ? 2.197   -7.032  -0.960  1.00 10.00 ? 461 LYS A HZ3  3  
ATOM 3147  N N    . THR A 1 53 ? 7.110   -1.339  -1.213  1.00 10.00 ? 462 THR A N    3  
ATOM 3148  C CA   . THR A 1 53 ? 8.032   -0.211  -1.120  1.00 10.00 ? 462 THR A CA   3  
ATOM 3149  C C    . THR A 1 53 ? 7.345   1.089   -1.525  1.00 10.00 ? 462 THR A C    3  
ATOM 3150  O O    . THR A 1 53 ? 6.315   1.074   -2.198  1.00 10.00 ? 462 THR A O    3  
ATOM 3151  C CB   . THR A 1 53 ? 9.265   -0.451  -1.996  1.00 10.00 ? 462 THR A CB   3  
ATOM 3152  O OG1  . THR A 1 53 ? 9.112   -1.627  -2.771  1.00 10.00 ? 462 THR A OG1  3  
ATOM 3153  C CG2  . THR A 1 53 ? 10.545  -0.590  -1.200  1.00 10.00 ? 462 THR A CG2  3  
ATOM 3154  H H    . THR A 1 53 ? 7.103   -1.888  -2.025  1.00 10.00 ? 462 THR A H    3  
ATOM 3155  H HA   . THR A 1 53 ? 8.346   -0.129  -0.091  1.00 10.00 ? 462 THR A HA   3  
ATOM 3156  H HB   . THR A 1 53 ? 9.385   0.387   -2.669  1.00 10.00 ? 462 THR A HB   3  
ATOM 3157  H HG1  . THR A 1 53 ? 9.111   -2.394  -2.194  1.00 10.00 ? 462 THR A HG1  3  
ATOM 3158  H HG21 . THR A 1 53 ? 10.345  -1.142  -0.294  1.00 10.00 ? 462 THR A HG21 3  
ATOM 3159  H HG22 . THR A 1 53 ? 10.921  0.390   -0.950  1.00 10.00 ? 462 THR A HG22 3  
ATOM 3160  H HG23 . THR A 1 53 ? 11.279  -1.119  -1.790  1.00 10.00 ? 462 THR A HG23 3  
ATOM 3161  N N    . VAL A 1 54 ? 7.924   2.212   -1.112  1.00 10.00 ? 463 VAL A N    3  
ATOM 3162  C CA   . VAL A 1 54 ? 7.368   3.521   -1.436  1.00 10.00 ? 463 VAL A CA   3  
ATOM 3163  C C    . VAL A 1 54 ? 7.359   3.748   -2.943  1.00 10.00 ? 463 VAL A C    3  
ATOM 3164  O O    . VAL A 1 54 ? 6.300   3.892   -3.552  1.00 10.00 ? 463 VAL A O    3  
ATOM 3165  C CB   . VAL A 1 54 ? 8.159   4.656   -0.756  1.00 10.00 ? 463 VAL A CB   3  
ATOM 3166  C CG1  . VAL A 1 54 ? 7.459   5.991   -0.958  1.00 10.00 ? 463 VAL A CG1  3  
ATOM 3167  C CG2  . VAL A 1 54 ? 8.346   4.366   0.727   1.00 10.00 ? 463 VAL A CG2  3  
ATOM 3168  H H    . VAL A 1 54 ? 8.746   2.159   -0.581  1.00 10.00 ? 463 VAL A H    3  
ATOM 3169  H HA   . VAL A 1 54 ? 6.351   3.549   -1.071  1.00 10.00 ? 463 VAL A HA   3  
ATOM 3170  H HB   . VAL A 1 54 ? 9.135   4.713   -1.215  1.00 10.00 ? 463 VAL A HB   3  
ATOM 3171  H HG11 . VAL A 1 54 ? 6.772   5.915   -1.788  1.00 10.00 ? 463 VAL A HG11 3  
ATOM 3172  H HG12 . VAL A 1 54 ? 8.193   6.755   -1.168  1.00 10.00 ? 463 VAL A HG12 3  
ATOM 3173  H HG13 . VAL A 1 54 ? 6.913   6.253   -0.063  1.00 10.00 ? 463 VAL A HG13 3  
ATOM 3174  H HG21 . VAL A 1 54 ? 8.136   3.325   0.922   1.00 10.00 ? 463 VAL A HG21 3  
ATOM 3175  H HG22 . VAL A 1 54 ? 7.671   4.982   1.303   1.00 10.00 ? 463 VAL A HG22 3  
ATOM 3176  H HG23 . VAL A 1 54 ? 9.365   4.587   1.011   1.00 10.00 ? 463 VAL A HG23 3  
ATOM 3177  N N    . ALA A 1 55 ? 8.546   3.770   -3.541  1.00 10.00 ? 464 ALA A N    3  
ATOM 3178  C CA   . ALA A 1 55 ? 8.670   3.970   -4.979  1.00 10.00 ? 464 ALA A CA   3  
ATOM 3179  C C    . ALA A 1 55 ? 8.006   2.829   -5.737  1.00 10.00 ? 464 ALA A C    3  
ATOM 3180  O O    . ALA A 1 55 ? 7.469   3.022   -6.827  1.00 10.00 ? 464 ALA A O    3  
ATOM 3181  C CB   . ALA A 1 55 ? 10.134  4.091   -5.373  1.00 10.00 ? 464 ALA A CB   3  
ATOM 3182  H H    . ALA A 1 55 ? 9.356   3.643   -3.003  1.00 10.00 ? 464 ALA A H    3  
ATOM 3183  H HA   . ALA A 1 55 ? 8.173   4.896   -5.233  1.00 10.00 ? 464 ALA A HA   3  
ATOM 3184  H HB1  . ALA A 1 55 ? 10.206  4.439   -6.393  1.00 10.00 ? 464 ALA A HB1  3  
ATOM 3185  H HB2  . ALA A 1 55 ? 10.610  3.124   -5.288  1.00 10.00 ? 464 ALA A HB2  3  
ATOM 3186  H HB3  . ALA A 1 55 ? 10.627  4.792   -4.717  1.00 10.00 ? 464 ALA A HB3  3  
ATOM 3187  N N    . GLU A 1 56 ? 8.038   1.639   -5.146  1.00 10.00 ? 465 GLU A N    3  
ATOM 3188  C CA   . GLU A 1 56 ? 7.429   0.466   -5.760  1.00 10.00 ? 465 GLU A CA   3  
ATOM 3189  C C    . GLU A 1 56 ? 5.910   0.530   -5.646  1.00 10.00 ? 465 GLU A C    3  
ATOM 3190  O O    . GLU A 1 56 ? 5.191   -0.037  -6.468  1.00 10.00 ? 465 GLU A O    3  
ATOM 3191  C CB   . GLU A 1 56 ? 7.949   -0.812  -5.101  1.00 10.00 ? 465 GLU A CB   3  
ATOM 3192  C CG   . GLU A 1 56 ? 7.682   -2.068  -5.913  1.00 10.00 ? 465 GLU A CG   3  
ATOM 3193  C CD   . GLU A 1 56 ? 8.343   -2.032  -7.277  1.00 10.00 ? 465 GLU A CD   3  
ATOM 3194  O OE1  . GLU A 1 56 ? 7.728   -1.492  -8.222  1.00 10.00 ? 465 GLU A OE1  3  
ATOM 3195  O OE2  . GLU A 1 56 ? 9.476   -2.543  -7.402  1.00 10.00 ? 465 GLU A OE2  3  
ATOM 3196  H H    . GLU A 1 56 ? 8.474   1.549   -4.273  1.00 10.00 ? 465 GLU A H    3  
ATOM 3197  H HA   . GLU A 1 56 ? 7.701   0.459   -6.805  1.00 10.00 ? 465 GLU A HA   3  
ATOM 3198  H HB2  . GLU A 1 56 ? 9.016   -0.722  -4.959  1.00 10.00 ? 465 GLU A HB2  3  
ATOM 3199  H HB3  . GLU A 1 56 ? 7.476   -0.925  -4.137  1.00 10.00 ? 465 GLU A HB3  3  
ATOM 3200  H HG2  . GLU A 1 56 ? 8.060   -2.921  -5.370  1.00 10.00 ? 465 GLU A HG2  3  
ATOM 3201  H HG3  . GLU A 1 56 ? 6.615   -2.172  -6.049  1.00 10.00 ? 465 GLU A HG3  3  
ATOM 3202  N N    . CYS A 1 57 ? 5.427   1.231   -4.623  1.00 10.00 ? 466 CYS A N    3  
ATOM 3203  C CA   . CYS A 1 57 ? 3.994   1.374   -4.408  1.00 10.00 ? 466 CYS A CA   3  
ATOM 3204  C C    . CYS A 1 57 ? 3.349   2.090   -5.584  1.00 10.00 ? 466 CYS A C    3  
ATOM 3205  O O    . CYS A 1 57 ? 2.178   1.869   -5.893  1.00 10.00 ? 466 CYS A O    3  
ATOM 3206  C CB   . CYS A 1 57 ? 3.717   2.136   -3.110  1.00 10.00 ? 466 CYS A CB   3  
ATOM 3207  S SG   . CYS A 1 57 ? 1.960   2.351   -2.741  1.00 10.00 ? 466 CYS A SG   3  
ATOM 3208  H H    . CYS A 1 57 ? 6.048   1.664   -4.004  1.00 10.00 ? 466 CYS A H    3  
ATOM 3209  H HA   . CYS A 1 57 ? 3.572   0.383   -4.334  1.00 10.00 ? 466 CYS A HA   3  
ATOM 3210  H HB2  . CYS A 1 57 ? 4.161   1.600   -2.285  1.00 10.00 ? 466 CYS A HB2  3  
ATOM 3211  H HB3  . CYS A 1 57 ? 4.162   3.118   -3.176  1.00 10.00 ? 466 CYS A HB3  3  
ATOM 3212  H HG   . CYS A 1 57 ? 1.748   1.804   -1.981  1.00 10.00 ? 466 CYS A HG   3  
ATOM 3213  N N    . VAL A 1 58 ? 4.127   2.938   -6.254  1.00 10.00 ? 467 VAL A N    3  
ATOM 3214  C CA   . VAL A 1 58 ? 3.632   3.669   -7.414  1.00 10.00 ? 467 VAL A CA   3  
ATOM 3215  C C    . VAL A 1 58 ? 2.949   2.711   -8.387  1.00 10.00 ? 467 VAL A C    3  
ATOM 3216  O O    . VAL A 1 58 ? 2.062   3.101   -9.145  1.00 10.00 ? 467 VAL A O    3  
ATOM 3217  C CB   . VAL A 1 58 ? 4.782   4.413   -8.137  1.00 10.00 ? 467 VAL A CB   3  
ATOM 3218  C CG1  . VAL A 1 58 ? 4.412   4.740   -9.580  1.00 10.00 ? 467 VAL A CG1  3  
ATOM 3219  C CG2  . VAL A 1 58 ? 5.150   5.680   -7.379  1.00 10.00 ? 467 VAL A CG2  3  
ATOM 3220  H H    . VAL A 1 58 ? 5.056   3.064   -5.970  1.00 10.00 ? 467 VAL A H    3  
ATOM 3221  H HA   . VAL A 1 58 ? 2.913   4.399   -7.070  1.00 10.00 ? 467 VAL A HA   3  
ATOM 3222  H HB   . VAL A 1 58 ? 5.648   3.767   -8.148  1.00 10.00 ? 467 VAL A HB   3  
ATOM 3223  H HG11 . VAL A 1 58 ? 3.514   5.338   -9.594  1.00 10.00 ? 467 VAL A HG11 3  
ATOM 3224  H HG12 . VAL A 1 58 ? 4.242   3.823   -10.128 1.00 10.00 ? 467 VAL A HG12 3  
ATOM 3225  H HG13 . VAL A 1 58 ? 5.219   5.290   -10.043 1.00 10.00 ? 467 VAL A HG13 3  
ATOM 3226  H HG21 . VAL A 1 58 ? 4.263   6.102   -6.931  1.00 10.00 ? 467 VAL A HG21 3  
ATOM 3227  H HG22 . VAL A 1 58 ? 5.582   6.395   -8.063  1.00 10.00 ? 467 VAL A HG22 3  
ATOM 3228  H HG23 . VAL A 1 58 ? 5.866   5.441   -6.607  1.00 10.00 ? 467 VAL A HG23 3  
ATOM 3229  N N    . LEU A 1 59 ? 3.374   1.451   -8.354  1.00 10.00 ? 468 LEU A N    3  
ATOM 3230  C CA   . LEU A 1 59 ? 2.816   0.427   -9.222  1.00 10.00 ? 468 LEU A CA   3  
ATOM 3231  C C    . LEU A 1 59 ? 1.323   0.222   -8.972  1.00 10.00 ? 468 LEU A C    3  
ATOM 3232  O O    . LEU A 1 59 ? 0.655   -0.467  -9.740  1.00 10.00 ? 468 LEU A O    3  
ATOM 3233  C CB   . LEU A 1 59 ? 3.566   -0.892  -9.022  1.00 10.00 ? 468 LEU A CB   3  
ATOM 3234  C CG   . LEU A 1 59 ? 3.926   -1.636  -10.309 1.00 10.00 ? 468 LEU A CG   3  
ATOM 3235  C CD1  . LEU A 1 59 ? 4.940   -0.842  -11.118 1.00 10.00 ? 468 LEU A CD1  3  
ATOM 3236  C CD2  . LEU A 1 59 ? 4.463   -3.023  -9.990  1.00 10.00 ? 468 LEU A CD2  3  
ATOM 3237  H H    . LEU A 1 59 ? 4.086   1.205   -7.728  1.00 10.00 ? 468 LEU A H    3  
ATOM 3238  H HA   . LEU A 1 59 ? 2.952   0.753   -10.242 1.00 10.00 ? 468 LEU A HA   3  
ATOM 3239  H HB2  . LEU A 1 59 ? 4.479   -0.682  -8.482  1.00 10.00 ? 468 LEU A HB2  3  
ATOM 3240  H HB3  . LEU A 1 59 ? 2.953   -1.544  -8.416  1.00 10.00 ? 468 LEU A HB3  3  
ATOM 3241  H HG   . LEU A 1 59 ? 3.037   -1.751  -10.912 1.00 10.00 ? 468 LEU A HG   3  
ATOM 3242  H HD11 . LEU A 1 59 ? 4.756   0.214   -10.991 1.00 10.00 ? 468 LEU A HD11 3  
ATOM 3243  H HD12 . LEU A 1 59 ? 4.850   -1.100  -12.162 1.00 10.00 ? 468 LEU A HD12 3  
ATOM 3244  H HD13 . LEU A 1 59 ? 5.937   -1.077  -10.774 1.00 10.00 ? 468 LEU A HD13 3  
ATOM 3245  H HD21 . LEU A 1 59 ? 3.642   -3.678  -9.736  1.00 10.00 ? 468 LEU A HD21 3  
ATOM 3246  H HD22 . LEU A 1 59 ? 5.146   -2.961  -9.156  1.00 10.00 ? 468 LEU A HD22 3  
ATOM 3247  H HD23 . LEU A 1 59 ? 4.983   -3.415  -10.852 1.00 10.00 ? 468 LEU A HD23 3  
ATOM 3248  N N    . TYR A 1 60 ? 0.801   0.814   -7.895  1.00 10.00 ? 469 TYR A N    3  
ATOM 3249  C CA   . TYR A 1 60 ? -0.613  0.684   -7.563  1.00 10.00 ? 469 TYR A CA   3  
ATOM 3250  C C    . TYR A 1 60 ? -1.350  2.014   -7.724  1.00 10.00 ? 469 TYR A C    3  
ATOM 3251  O O    . TYR A 1 60 ? -2.579  2.052   -7.706  1.00 10.00 ? 469 TYR A O    3  
ATOM 3252  C CB   . TYR A 1 60 ? -0.774  0.123   -6.139  1.00 10.00 ? 469 TYR A CB   3  
ATOM 3253  C CG   . TYR A 1 60 ? -1.252  1.081   -5.066  1.00 10.00 ? 469 TYR A CG   3  
ATOM 3254  C CD1  . TYR A 1 60 ? -0.814  2.398   -5.039  1.00 10.00 ? 469 TYR A CD1  3  
ATOM 3255  C CD2  . TYR A 1 60 ? -2.134  0.662   -4.067  1.00 10.00 ? 469 TYR A CD2  3  
ATOM 3256  C CE1  . TYR A 1 60 ? -1.233  3.274   -4.062  1.00 10.00 ? 469 TYR A CE1  3  
ATOM 3257  C CE2  . TYR A 1 60 ? -2.557  1.539   -3.086  1.00 10.00 ? 469 TYR A CE2  3  
ATOM 3258  C CZ   . TYR A 1 60 ? -2.102  2.841   -3.090  1.00 10.00 ? 469 TYR A CZ   3  
ATOM 3259  O OH   . TYR A 1 60 ? -2.513  3.714   -2.112  1.00 10.00 ? 469 TYR A OH   3  
ATOM 3260  H H    . TYR A 1 60 ? 1.376   1.340   -7.314  1.00 10.00 ? 469 TYR A H    3  
ATOM 3261  H HA   . TYR A 1 60 ? -1.031  -0.029  -8.254  1.00 10.00 ? 469 TYR A HA   3  
ATOM 3262  H HB2  . TYR A 1 60 ? -1.477  -0.689  -6.172  1.00 10.00 ? 469 TYR A HB2  3  
ATOM 3263  H HB3  . TYR A 1 60 ? 0.181   -0.256  -5.824  1.00 10.00 ? 469 TYR A HB3  3  
ATOM 3264  H HD1  . TYR A 1 60 ? -0.133  2.733   -5.798  1.00 10.00 ? 469 TYR A HD1  3  
ATOM 3265  H HD2  . TYR A 1 60 ? -2.486  -0.377  -4.050  1.00 10.00 ? 469 TYR A HD2  3  
ATOM 3266  H HE1  . TYR A 1 60 ? -0.879  4.294   -4.063  1.00 10.00 ? 469 TYR A HE1  3  
ATOM 3267  H HE2  . TYR A 1 60 ? -3.240  1.201   -2.321  1.00 10.00 ? 469 TYR A HE2  3  
ATOM 3268  H HH   . TYR A 1 60 ? -1.778  3.907   -1.527  1.00 10.00 ? 469 TYR A HH   3  
ATOM 3269  N N    . TYR A 1 61 ? -0.594  3.105   -7.860  1.00 10.00 ? 470 TYR A N    3  
ATOM 3270  C CA   . TYR A 1 61 ? -1.189  4.426   -7.994  1.00 10.00 ? 470 TYR A CA   3  
ATOM 3271  C C    . TYR A 1 61 ? -1.319  4.830   -9.459  1.00 10.00 ? 470 TYR A C    3  
ATOM 3272  O O    . TYR A 1 61 ? -2.263  5.528   -9.830  1.00 10.00 ? 470 TYR A O    3  
ATOM 3273  C CB   . TYR A 1 61 ? -0.370  5.461   -7.203  1.00 10.00 ? 470 TYR A CB   3  
ATOM 3274  C CG   . TYR A 1 61 ? 0.276   6.537   -8.051  1.00 10.00 ? 470 TYR A CG   3  
ATOM 3275  C CD1  . TYR A 1 61 ? 1.285   6.223   -8.946  1.00 10.00 ? 470 TYR A CD1  3  
ATOM 3276  C CD2  . TYR A 1 61 ? -0.128  7.863   -7.955  1.00 10.00 ? 470 TYR A CD2  3  
ATOM 3277  C CE1  . TYR A 1 61 ? 1.877   7.194   -9.725  1.00 10.00 ? 470 TYR A CE1  3  
ATOM 3278  C CE2  . TYR A 1 61 ? 0.460   8.844   -8.729  1.00 10.00 ? 470 TYR A CE2  3  
ATOM 3279  C CZ   . TYR A 1 61 ? 1.462   8.504   -9.614  1.00 10.00 ? 470 TYR A CZ   3  
ATOM 3280  O OH   . TYR A 1 61 ? 2.050   9.477   -10.389 1.00 10.00 ? 470 TYR A OH   3  
ATOM 3281  H H    . TYR A 1 61 ? 0.383   3.022   -7.852  1.00 10.00 ? 470 TYR A H    3  
ATOM 3282  H HA   . TYR A 1 61 ? -2.180  4.378   -7.569  1.00 10.00 ? 470 TYR A HA   3  
ATOM 3283  H HB2  . TYR A 1 61 ? -1.018  5.951   -6.493  1.00 10.00 ? 470 TYR A HB2  3  
ATOM 3284  H HB3  . TYR A 1 61 ? 0.415   4.948   -6.667  1.00 10.00 ? 470 TYR A HB3  3  
ATOM 3285  H HD1  . TYR A 1 61 ? 1.608   5.198   -9.032  1.00 10.00 ? 470 TYR A HD1  3  
ATOM 3286  H HD2  . TYR A 1 61 ? -0.913  8.124   -7.261  1.00 10.00 ? 470 TYR A HD2  3  
ATOM 3287  H HE1  . TYR A 1 61 ? 2.660   6.926   -10.415 1.00 10.00 ? 470 TYR A HE1  3  
ATOM 3288  H HE2  . TYR A 1 61 ? 0.134   9.869   -8.641  1.00 10.00 ? 470 TYR A HE2  3  
ATOM 3289  H HH   . TYR A 1 61 ? 1.858   9.310   -11.314 1.00 10.00 ? 470 TYR A HH   3  
ATOM 3290  N N    . TYR A 1 62 ? -0.381  4.391   -10.296 1.00 10.00 ? 471 TYR A N    3  
ATOM 3291  C CA   . TYR A 1 62 ? -0.441  4.728   -11.713 1.00 10.00 ? 471 TYR A CA   3  
ATOM 3292  C C    . TYR A 1 62 ? -1.742  4.213   -12.321 1.00 10.00 ? 471 TYR A C    3  
ATOM 3293  O O    . TYR A 1 62 ? -2.206  4.721   -13.341 1.00 10.00 ? 471 TYR A O    3  
ATOM 3294  C CB   . TYR A 1 62 ? 0.783   4.190   -12.467 1.00 10.00 ? 471 TYR A CB   3  
ATOM 3295  C CG   . TYR A 1 62 ? 0.743   2.709   -12.768 1.00 10.00 ? 471 TYR A CG   3  
ATOM 3296  C CD1  . TYR A 1 62 ? 0.050   2.221   -13.871 1.00 10.00 ? 471 TYR A CD1  3  
ATOM 3297  C CD2  . TYR A 1 62 ? 1.410   1.800   -11.958 1.00 10.00 ? 471 TYR A CD2  3  
ATOM 3298  C CE1  . TYR A 1 62 ? 0.023   0.868   -14.154 1.00 10.00 ? 471 TYR A CE1  3  
ATOM 3299  C CE2  . TYR A 1 62 ? 1.386   0.446   -12.234 1.00 10.00 ? 471 TYR A CE2  3  
ATOM 3300  C CZ   . TYR A 1 62 ? 0.691   -0.014  -13.333 1.00 10.00 ? 471 TYR A CZ   3  
ATOM 3301  O OH   . TYR A 1 62 ? 0.667   -1.361  -13.612 1.00 10.00 ? 471 TYR A OH   3  
ATOM 3302  H H    . TYR A 1 62 ? 0.352   3.830   -9.960  1.00 10.00 ? 471 TYR A H    3  
ATOM 3303  H HA   . TYR A 1 62 ? -0.445  5.807   -11.783 1.00 10.00 ? 471 TYR A HA   3  
ATOM 3304  H HB2  . TYR A 1 62 ? 0.869   4.711   -13.409 1.00 10.00 ? 471 TYR A HB2  3  
ATOM 3305  H HB3  . TYR A 1 62 ? 1.668   4.384   -11.878 1.00 10.00 ? 471 TYR A HB3  3  
ATOM 3306  H HD1  . TYR A 1 62 ? -0.473  2.916   -14.510 1.00 10.00 ? 471 TYR A HD1  3  
ATOM 3307  H HD2  . TYR A 1 62 ? 1.954   2.167   -11.100 1.00 10.00 ? 471 TYR A HD2  3  
ATOM 3308  H HE1  . TYR A 1 62 ? -0.520  0.509   -15.016 1.00 10.00 ? 471 TYR A HE1  3  
ATOM 3309  H HE2  . TYR A 1 62 ? 1.909   -0.245  -11.590 1.00 10.00 ? 471 TYR A HE2  3  
ATOM 3310  H HH   . TYR A 1 62 ? 1.550   -1.725  -13.515 1.00 10.00 ? 471 TYR A HH   3  
ATOM 3311  N N    . LEU A 1 63 ? -2.348  3.224   -11.663 1.00 10.00 ? 472 LEU A N    3  
ATOM 3312  C CA   . LEU A 1 63 ? -3.621  2.675   -12.119 1.00 10.00 ? 472 LEU A CA   3  
ATOM 3313  C C    . LEU A 1 63 ? -4.769  3.450   -11.483 1.00 10.00 ? 472 LEU A C    3  
ATOM 3314  O O    . LEU A 1 63 ? -5.843  3.587   -12.066 1.00 10.00 ? 472 LEU A O    3  
ATOM 3315  C CB   . LEU A 1 63 ? -3.738  1.192   -11.762 1.00 10.00 ? 472 LEU A CB   3  
ATOM 3316  C CG   . LEU A 1 63 ? -2.439  0.398   -11.856 1.00 10.00 ? 472 LEU A CG   3  
ATOM 3317  C CD1  . LEU A 1 63 ? -1.696  0.442   -10.531 1.00 10.00 ? 472 LEU A CD1  3  
ATOM 3318  C CD2  . LEU A 1 63 ? -2.721  -1.039  -12.269 1.00 10.00 ? 472 LEU A CD2  3  
ATOM 3319  H H    . LEU A 1 63 ? -1.943  2.877   -10.836 1.00 10.00 ? 472 LEU A H    3  
ATOM 3320  H HA   . LEU A 1 63 ? -3.670  2.790   -13.191 1.00 10.00 ? 472 LEU A HA   3  
ATOM 3321  H HB2  . LEU A 1 63 ? -4.109  1.117   -10.749 1.00 10.00 ? 472 LEU A HB2  3  
ATOM 3322  H HB3  . LEU A 1 63 ? -4.459  0.741   -12.426 1.00 10.00 ? 472 LEU A HB3  3  
ATOM 3323  H HG   . LEU A 1 63 ? -1.808  0.846   -12.607 1.00 10.00 ? 472 LEU A HG   3  
ATOM 3324  H HD11 . LEU A 1 63 ? -1.504  -0.565  -10.191 1.00 10.00 ? 472 LEU A HD11 3  
ATOM 3325  H HD12 . LEU A 1 63 ? -2.294  0.960   -9.797  1.00 10.00 ? 472 LEU A HD12 3  
ATOM 3326  H HD13 . LEU A 1 63 ? -0.758  0.963   -10.662 1.00 10.00 ? 472 LEU A HD13 3  
ATOM 3327  H HD21 . LEU A 1 63 ? -3.707  -1.324  -11.933 1.00 10.00 ? 472 LEU A HD21 3  
ATOM 3328  H HD22 . LEU A 1 63 ? -1.986  -1.693  -11.823 1.00 10.00 ? 472 LEU A HD22 3  
ATOM 3329  H HD23 . LEU A 1 63 ? -2.670  -1.121  -13.345 1.00 10.00 ? 472 LEU A HD23 3  
ATOM 3330  N N    . THR A 1 64 ? -4.519  3.964   -10.280 1.00 10.00 ? 473 THR A N    3  
ATOM 3331  C CA   . THR A 1 64 ? -5.513  4.738   -9.551  1.00 10.00 ? 473 THR A CA   3  
ATOM 3332  C C    . THR A 1 64 ? -5.703  6.102   -10.201 1.00 10.00 ? 473 THR A C    3  
ATOM 3333  O O    . THR A 1 64 ? -6.812  6.635   -10.240 1.00 10.00 ? 473 THR A O    3  
ATOM 3334  C CB   . THR A 1 64 ? -5.081  4.910   -8.090  1.00 10.00 ? 473 THR A CB   3  
ATOM 3335  O OG1  . THR A 1 64 ? -3.939  5.743   -7.999  1.00 10.00 ? 473 THR A OG1  3  
ATOM 3336  C CG2  . THR A 1 64 ? -4.752  3.602   -7.400  1.00 10.00 ? 473 THR A CG2  3  
ATOM 3337  H H    . THR A 1 64 ? -3.638  3.823   -9.876  1.00 10.00 ? 473 THR A H    3  
ATOM 3338  H HA   . THR A 1 64 ? -6.447  4.204   -9.581  1.00 10.00 ? 473 THR A HA   3  
ATOM 3339  H HB   . THR A 1 64 ? -5.887  5.378   -7.541  1.00 10.00 ? 473 THR A HB   3  
ATOM 3340  H HG1  . THR A 1 64 ? -3.703  5.862   -7.076  1.00 10.00 ? 473 THR A HG1  3  
ATOM 3341  H HG21 . THR A 1 64 ? -3.829  3.706   -6.846  1.00 10.00 ? 473 THR A HG21 3  
ATOM 3342  H HG22 . THR A 1 64 ? -4.640  2.823   -8.140  1.00 10.00 ? 473 THR A HG22 3  
ATOM 3343  H HG23 . THR A 1 64 ? -5.551  3.341   -6.722  1.00 10.00 ? 473 THR A HG23 3  
ATOM 3344  N N    . LYS A 1 65 ? -4.610  6.663   -10.708 1.00 10.00 ? 474 LYS A N    3  
ATOM 3345  C CA   . LYS A 1 65 ? -4.651  7.968   -11.355 1.00 10.00 ? 474 LYS A CA   3  
ATOM 3346  C C    . LYS A 1 65 ? -5.034  7.841   -12.828 1.00 10.00 ? 474 LYS A C    3  
ATOM 3347  O O    . LYS A 1 65 ? -5.535  8.789   -13.430 1.00 10.00 ? 474 LYS A O    3  
ATOM 3348  C CB   . LYS A 1 65 ? -3.297  8.669   -11.220 1.00 10.00 ? 474 LYS A CB   3  
ATOM 3349  C CG   . LYS A 1 65 ? -2.144  7.910   -11.859 1.00 10.00 ? 474 LYS A CG   3  
ATOM 3350  C CD   . LYS A 1 65 ? -2.158  8.050   -13.371 1.00 10.00 ? 474 LYS A CD   3  
ATOM 3351  C CE   . LYS A 1 65 ? -0.770  8.344   -13.919 1.00 10.00 ? 474 LYS A CE   3  
ATOM 3352  N NZ   . LYS A 1 65 ? -0.784  8.533   -15.396 1.00 10.00 ? 474 LYS A NZ   3  
ATOM 3353  H H    . LYS A 1 65 ? -3.755  6.188   -10.642 1.00 10.00 ? 474 LYS A H    3  
ATOM 3354  H HA   . LYS A 1 65 ? -5.403  8.559   -10.854 1.00 10.00 ? 474 LYS A HA   3  
ATOM 3355  H HB2  . LYS A 1 65 ? -3.359  9.640   -11.688 1.00 10.00 ? 474 LYS A HB2  3  
ATOM 3356  H HB3  . LYS A 1 65 ? -3.075  8.798   -10.172 1.00 10.00 ? 474 LYS A HB3  3  
ATOM 3357  H HG2  . LYS A 1 65 ? -1.213  8.302   -11.479 1.00 10.00 ? 474 LYS A HG2  3  
ATOM 3358  H HG3  . LYS A 1 65 ? -2.227  6.864   -11.603 1.00 10.00 ? 474 LYS A HG3  3  
ATOM 3359  H HD2  . LYS A 1 65 ? -2.518  7.129   -13.804 1.00 10.00 ? 474 LYS A HD2  3  
ATOM 3360  H HD3  . LYS A 1 65 ? -2.821  8.861   -13.640 1.00 10.00 ? 474 LYS A HD3  3  
ATOM 3361  H HE2  . LYS A 1 65 ? -0.396  9.244   -13.454 1.00 10.00 ? 474 LYS A HE2  3  
ATOM 3362  H HE3  . LYS A 1 65 ? -0.120  7.517   -13.676 1.00 10.00 ? 474 LYS A HE3  3  
ATOM 3363  H HZ1  . LYS A 1 65 ? 0.155   8.329   -15.791 1.00 10.00 ? 474 LYS A HZ1  3  
ATOM 3364  H HZ2  . LYS A 1 65 ? -1.039  9.514   -15.629 1.00 10.00 ? 474 LYS A HZ2  3  
ATOM 3365  H HZ3  . LYS A 1 65 ? -1.479  7.894   -15.832 1.00 10.00 ? 474 LYS A HZ3  3  
ATOM 3366  N N    . LYS A 1 66 ? -4.795  6.666   -13.403 1.00 10.00 ? 475 LYS A N    3  
ATOM 3367  C CA   . LYS A 1 66 ? -5.118  6.426   -14.805 1.00 10.00 ? 475 LYS A CA   3  
ATOM 3368  C C    . LYS A 1 66 ? -6.604  6.645   -15.071 1.00 10.00 ? 475 LYS A C    3  
ATOM 3369  O O    . LYS A 1 66 ? -7.001  6.993   -16.183 1.00 10.00 ? 475 LYS A O    3  
ATOM 3370  C CB   . LYS A 1 66 ? -4.721  5.003   -15.203 1.00 10.00 ? 475 LYS A CB   3  
ATOM 3371  C CG   . LYS A 1 66 ? -5.002  4.679   -16.662 1.00 10.00 ? 475 LYS A CG   3  
ATOM 3372  C CD   . LYS A 1 66 ? -5.040  3.178   -16.900 1.00 10.00 ? 475 LYS A CD   3  
ATOM 3373  C CE   . LYS A 1 66 ? -3.670  2.640   -17.280 1.00 10.00 ? 475 LYS A CE   3  
ATOM 3374  N NZ   . LYS A 1 66 ? -3.737  1.226   -17.744 1.00 10.00 ? 475 LYS A NZ   3  
ATOM 3375  H H    . LYS A 1 66 ? -4.394  5.946   -12.874 1.00 10.00 ? 475 LYS A H    3  
ATOM 3376  H HA   . LYS A 1 66 ? -4.552  7.127   -15.398 1.00 10.00 ? 475 LYS A HA   3  
ATOM 3377  H HB2  . LYS A 1 66 ? -3.664  4.874   -15.025 1.00 10.00 ? 475 LYS A HB2  3  
ATOM 3378  H HB3  . LYS A 1 66 ? -5.268  4.303   -14.589 1.00 10.00 ? 475 LYS A HB3  3  
ATOM 3379  H HG2  . LYS A 1 66 ? -5.956  5.101   -16.937 1.00 10.00 ? 475 LYS A HG2  3  
ATOM 3380  H HG3  . LYS A 1 66 ? -4.225  5.112   -17.272 1.00 10.00 ? 475 LYS A HG3  3  
ATOM 3381  H HD2  . LYS A 1 66 ? -5.370  2.688   -15.998 1.00 10.00 ? 475 LYS A HD2  3  
ATOM 3382  H HD3  . LYS A 1 66 ? -5.734  2.969   -17.701 1.00 10.00 ? 475 LYS A HD3  3  
ATOM 3383  H HE2  . LYS A 1 66 ? -3.264  3.251   -18.073 1.00 10.00 ? 475 LYS A HE2  3  
ATOM 3384  H HE3  . LYS A 1 66 ? -3.023  2.697   -16.417 1.00 10.00 ? 475 LYS A HE3  3  
ATOM 3385  H HZ1  . LYS A 1 66 ? -3.893  0.592   -16.935 1.00 10.00 ? 475 LYS A HZ1  3  
ATOM 3386  H HZ2  . LYS A 1 66 ? -2.847  0.960   -18.211 1.00 10.00 ? 475 LYS A HZ2  3  
ATOM 3387  H HZ3  . LYS A 1 66 ? -4.520  1.108   -18.419 1.00 10.00 ? 475 LYS A HZ3  3  
ATOM 3388  N N    . ASN A 1 67 ? -7.425  6.432   -14.046 1.00 10.00 ? 476 ASN A N    3  
ATOM 3389  C CA   . ASN A 1 67 ? -8.870  6.602   -14.177 1.00 10.00 ? 476 ASN A CA   3  
ATOM 3390  C C    . ASN A 1 67 ? -9.404  7.668   -13.221 1.00 10.00 ? 476 ASN A C    3  
ATOM 3391  O O    . ASN A 1 67 ? -10.520 8.159   -13.393 1.00 10.00 ? 476 ASN A O    3  
ATOM 3392  C CB   . ASN A 1 67 ? -9.582  5.273   -13.919 1.00 10.00 ? 476 ASN A CB   3  
ATOM 3393  C CG   . ASN A 1 67 ? -10.772 5.067   -14.836 1.00 10.00 ? 476 ASN A CG   3  
ATOM 3394  O OD1  . ASN A 1 67 ? -11.647 5.926   -14.938 1.00 10.00 ? 476 ASN A OD1  3  
ATOM 3395  N ND2  . ASN A 1 67 ? -10.810 3.923   -15.508 1.00 10.00 ? 476 ASN A ND2  3  
ATOM 3396  H H    . ASN A 1 67 ? -7.054  6.150   -13.185 1.00 10.00 ? 476 ASN A H    3  
ATOM 3397  H HA   . ASN A 1 67 ? -9.073  6.913   -15.190 1.00 10.00 ? 476 ASN A HA   3  
ATOM 3398  H HB2  . ASN A 1 67 ? -8.886  4.462   -14.076 1.00 10.00 ? 476 ASN A HB2  3  
ATOM 3399  H HB3  . ASN A 1 67 ? -9.929  5.249   -12.897 1.00 10.00 ? 476 ASN A HB3  3  
ATOM 3400  H HD21 . ASN A 1 67 ? -10.078 3.284   -15.377 1.00 10.00 ? 476 ASN A HD21 3  
ATOM 3401  H HD22 . ASN A 1 67 ? -11.569 3.763   -16.108 1.00 10.00 ? 476 ASN A HD22 3  
ATOM 3402  N N    . GLU A 1 68 ? -8.612  8.025   -12.212 1.00 10.00 ? 477 GLU A N    3  
ATOM 3403  C CA   . GLU A 1 68 ? -9.027  9.031   -11.239 1.00 10.00 ? 477 GLU A CA   3  
ATOM 3404  C C    . GLU A 1 68 ? -8.337  10.368  -11.497 1.00 10.00 ? 477 GLU A C    3  
ATOM 3405  O O    . GLU A 1 68 ? -8.838  11.420  -11.100 1.00 10.00 ? 477 GLU A O    3  
ATOM 3406  C CB   . GLU A 1 68 ? -8.720  8.554   -9.820  1.00 10.00 ? 477 GLU A CB   3  
ATOM 3407  C CG   . GLU A 1 68 ? -9.587  9.208   -8.757  1.00 10.00 ? 477 GLU A CG   3  
ATOM 3408  C CD   . GLU A 1 68 ? -10.785 8.359   -8.379  1.00 10.00 ? 477 GLU A CD   3  
ATOM 3409  O OE1  . GLU A 1 68 ? -11.162 7.474   -9.175  1.00 10.00 ? 477 GLU A OE1  3  
ATOM 3410  O OE2  . GLU A 1 68 ? -11.347 8.579   -7.285  1.00 10.00 ? 477 GLU A OE2  3  
ATOM 3411  H H    . GLU A 1 68 ? -7.732  7.604   -12.117 1.00 10.00 ? 477 GLU A H    3  
ATOM 3412  H HA   . GLU A 1 68 ? -10.093 9.166   -11.340 1.00 10.00 ? 477 GLU A HA   3  
ATOM 3413  H HB2  . GLU A 1 68 ? -8.873  7.485   -9.771  1.00 10.00 ? 477 GLU A HB2  3  
ATOM 3414  H HB3  . GLU A 1 68 ? -7.687  8.771   -9.594  1.00 10.00 ? 477 GLU A HB3  3  
ATOM 3415  H HG2  . GLU A 1 68 ? -8.989  9.372   -7.873  1.00 10.00 ? 477 GLU A HG2  3  
ATOM 3416  H HG3  . GLU A 1 68 ? -9.941  10.156  -9.134  1.00 10.00 ? 477 GLU A HG3  3  
ATOM 3417  N N    . ASN A 1 69 ? -7.188  10.322  -12.162 1.00 10.00 ? 478 ASN A N    3  
ATOM 3418  C CA   . ASN A 1 69 ? -6.434  11.532  -12.466 1.00 10.00 ? 478 ASN A CA   3  
ATOM 3419  C C    . ASN A 1 69 ? -6.034  12.257  -11.185 1.00 10.00 ? 478 ASN A C    3  
ATOM 3420  O O    . ASN A 1 69 ? -6.661  13.242  -10.795 1.00 10.00 ? 478 ASN A O    3  
ATOM 3421  C CB   . ASN A 1 69 ? -7.259  12.464  -13.357 1.00 10.00 ? 478 ASN A CB   3  
ATOM 3422  C CG   . ASN A 1 69 ? -7.346  11.968  -14.787 1.00 10.00 ? 478 ASN A CG   3  
ATOM 3423  O OD1  . ASN A 1 69 ? -6.340  11.595  -15.390 1.00 10.00 ? 478 ASN A OD1  3  
ATOM 3424  N ND2  . ASN A 1 69 ? -8.555  11.961  -15.339 1.00 10.00 ? 478 ASN A ND2  3  
ATOM 3425  H H    . ASN A 1 69 ? -6.837  9.456   -12.453 1.00 10.00 ? 478 ASN A H    3  
ATOM 3426  H HA   . ASN A 1 69 ? -5.538  11.242  -12.995 1.00 10.00 ? 478 ASN A HA   3  
ATOM 3427  H HB2  . ASN A 1 69 ? -8.260  12.537  -12.960 1.00 10.00 ? 478 ASN A HB2  3  
ATOM 3428  H HB3  . ASN A 1 69 ? -6.804  13.444  -13.362 1.00 10.00 ? 478 ASN A HB3  3  
ATOM 3429  H HD21 . ASN A 1 69 ? -9.311  12.272  -14.799 1.00 10.00 ? 478 ASN A HD21 3  
ATOM 3430  H HD22 . ASN A 1 69 ? -8.640  11.645  -16.262 1.00 10.00 ? 478 ASN A HD22 3  
ATOM 3431  N N    . TYR A 1 70 ? -4.989  11.760  -10.531 1.00 10.00 ? 479 TYR A N    3  
ATOM 3432  C CA   . TYR A 1 70 ? -4.508  12.357  -9.293  1.00 10.00 ? 479 TYR A CA   3  
ATOM 3433  C C    . TYR A 1 70 ? -3.090  11.889  -8.974  1.00 10.00 ? 479 TYR A C    3  
ATOM 3434  O O    . TYR A 1 70 ? -2.829  10.690  -8.875  1.00 10.00 ? 479 TYR A O    3  
ATOM 3435  C CB   . TYR A 1 70 ? -5.456  12.013  -8.138  1.00 10.00 ? 479 TYR A CB   3  
ATOM 3436  C CG   . TYR A 1 70 ? -5.209  10.653  -7.518  1.00 10.00 ? 479 TYR A CG   3  
ATOM 3437  C CD1  . TYR A 1 70 ? -5.492  9.483   -8.217  1.00 10.00 ? 479 TYR A CD1  3  
ATOM 3438  C CD2  . TYR A 1 70 ? -4.693  10.541  -6.234  1.00 10.00 ? 479 TYR A CD2  3  
ATOM 3439  C CE1  . TYR A 1 70 ? -5.268  8.242   -7.648  1.00 10.00 ? 479 TYR A CE1  3  
ATOM 3440  C CE2  . TYR A 1 70 ? -4.465  9.305   -5.661  1.00 10.00 ? 479 TYR A CE2  3  
ATOM 3441  C CZ   . TYR A 1 70 ? -4.755  8.159   -6.370  1.00 10.00 ? 479 TYR A CZ   3  
ATOM 3442  O OH   . TYR A 1 70 ? -4.531  6.926   -5.802  1.00 10.00 ? 479 TYR A OH   3  
ATOM 3443  H H    . TYR A 1 70 ? -4.531  10.973  -10.890 1.00 10.00 ? 479 TYR A H    3  
ATOM 3444  H HA   . TYR A 1 70 ? -4.497  13.429  -9.428  1.00 10.00 ? 479 TYR A HA   3  
ATOM 3445  H HB2  . TYR A 1 70 ? -5.343  12.753  -7.360  1.00 10.00 ? 479 TYR A HB2  3  
ATOM 3446  H HB3  . TYR A 1 70 ? -6.473  12.033  -8.501  1.00 10.00 ? 479 TYR A HB3  3  
ATOM 3447  H HD1  . TYR A 1 70 ? -5.890  9.552   -9.219  1.00 10.00 ? 479 TYR A HD1  3  
ATOM 3448  H HD2  . TYR A 1 70 ? -4.467  11.439  -5.679  1.00 10.00 ? 479 TYR A HD2  3  
ATOM 3449  H HE1  . TYR A 1 70 ? -5.498  7.344   -8.202  1.00 10.00 ? 479 TYR A HE1  3  
ATOM 3450  H HE2  . TYR A 1 70 ? -4.063  9.239   -4.662  1.00 10.00 ? 479 TYR A HE2  3  
ATOM 3451  H HH   . TYR A 1 70 ? -5.331  6.624   -5.366  1.00 10.00 ? 479 TYR A HH   3  
ATOM 3452  N N    . LYS A 1 71 ? -2.181  12.842  -8.814  1.00 10.00 ? 480 LYS A N    3  
ATOM 3453  C CA   . LYS A 1 71 ? -0.792  12.528  -8.504  1.00 10.00 ? 480 LYS A CA   3  
ATOM 3454  C C    . LYS A 1 71 ? -0.214  13.540  -7.519  1.00 10.00 ? 480 LYS A C    3  
ATOM 3455  O O    . LYS A 1 71 ? 0.571   13.127  -6.639  1.00 10.00 ? 480 LYS A O    3  
ATOM 3456  C CB   . LYS A 1 71 ? 0.046   12.505  -9.783  1.00 10.00 ? 480 LYS A CB   3  
ATOM 3457  C CG   . LYS A 1 71 ? 1.516   12.199  -9.545  1.00 10.00 ? 480 LYS A CG   3  
ATOM 3458  C CD   . LYS A 1 71 ? 2.300   12.186  -10.846 1.00 10.00 ? 480 LYS A CD   3  
ATOM 3459  C CE   . LYS A 1 71 ? 2.951   13.533  -11.118 1.00 10.00 ? 480 LYS A CE   3  
ATOM 3460  N NZ   . LYS A 1 71 ? 2.924   13.882  -12.566 1.00 10.00 ? 480 LYS A NZ   3  
ATOM 3461  O OXT  . LYS A 1 71 ? -0.550  14.737  -7.636  1.00 10.00 ? 480 LYS A OXT  3  
ATOM 3462  H H    . LYS A 1 71 ? -2.452  13.779  -8.904  1.00 10.00 ? 480 LYS A H    3  
ATOM 3463  H HA   . LYS A 1 71 ? -0.769  11.548  -8.049  1.00 10.00 ? 480 LYS A HA   3  
ATOM 3464  H HB2  . LYS A 1 71 ? -0.353  11.752  -10.447 1.00 10.00 ? 480 LYS A HB2  3  
ATOM 3465  H HB3  . LYS A 1 71 ? -0.026  13.470  -10.264 1.00 10.00 ? 480 LYS A HB3  3  
ATOM 3466  H HG2  . LYS A 1 71 ? 1.929   12.955  -8.894  1.00 10.00 ? 480 LYS A HG2  3  
ATOM 3467  H HG3  . LYS A 1 71 ? 1.600   11.231  -9.073  1.00 10.00 ? 480 LYS A HG3  3  
ATOM 3468  H HD2  . LYS A 1 71 ? 3.071   11.433  -10.784 1.00 10.00 ? 480 LYS A HD2  3  
ATOM 3469  H HD3  . LYS A 1 71 ? 1.628   11.951  -11.658 1.00 10.00 ? 480 LYS A HD3  3  
ATOM 3470  H HE2  . LYS A 1 71 ? 2.419   14.293  -10.565 1.00 10.00 ? 480 LYS A HE2  3  
ATOM 3471  H HE3  . LYS A 1 71 ? 3.977   13.497  -10.784 1.00 10.00 ? 480 LYS A HE3  3  
ATOM 3472  H HZ1  . LYS A 1 71 ? 3.220   14.869  -12.702 1.00 10.00 ? 480 LYS A HZ1  3  
ATOM 3473  H HZ2  . LYS A 1 71 ? 1.962   13.764  -12.944 1.00 10.00 ? 480 LYS A HZ2  3  
ATOM 3474  H HZ3  . LYS A 1 71 ? 3.570   13.261  -13.094 1.00 10.00 ? 480 LYS A HZ3  3  
ATOM 3475  N N    . ASN A 1 4  ? 20.058  -6.211  20.524  1.00 10.00 ? 413 ASN A N    4  
ATOM 3476  C CA   . ASN A 1 4  ? 19.376  -5.739  19.324  1.00 10.00 ? 413 ASN A CA   4  
ATOM 3477  C C    . ASN A 1 4  ? 18.192  -6.637  18.981  1.00 10.00 ? 413 ASN A C    4  
ATOM 3478  O O    . ASN A 1 4  ? 18.305  -7.542  18.154  1.00 10.00 ? 413 ASN A O    4  
ATOM 3479  C CB   . ASN A 1 4  ? 20.350  -5.689  18.146  1.00 10.00 ? 413 ASN A CB   4  
ATOM 3480  C CG   . ASN A 1 4  ? 21.066  -4.355  18.045  1.00 10.00 ? 413 ASN A CG   4  
ATOM 3481  O OD1  . ASN A 1 4  ? 22.207  -4.216  18.485  1.00 10.00 ? 413 ASN A OD1  4  
ATOM 3482  N ND2  . ASN A 1 4  ? 20.398  -3.367  17.462  1.00 10.00 ? 413 ASN A ND2  4  
ATOM 3483  H H    . ASN A 1 4  ? 20.987  -6.515  20.457  1.00 10.00 ? 413 ASN A H    4  
ATOM 3484  H HA   . ASN A 1 4  ? 19.011  -4.742  19.521  1.00 10.00 ? 413 ASN A HA   4  
ATOM 3485  H HB2  . ASN A 1 4  ? 21.090  -6.465  18.264  1.00 10.00 ? 413 ASN A HB2  4  
ATOM 3486  H HB3  . ASN A 1 4  ? 19.805  -5.853  17.228  1.00 10.00 ? 413 ASN A HB3  4  
ATOM 3487  H HD21 . ASN A 1 4  ? 19.492  -3.551  17.134  1.00 10.00 ? 413 ASN A HD21 4  
ATOM 3488  H HD22 . ASN A 1 4  ? 20.837  -2.495  17.383  1.00 10.00 ? 413 ASN A HD22 4  
ATOM 3489  N N    . GLY A 1 5  ? 17.056  -6.382  19.622  1.00 10.00 ? 414 GLY A N    4  
ATOM 3490  C CA   . GLY A 1 5  ? 15.868  -7.176  19.372  1.00 10.00 ? 414 GLY A CA   4  
ATOM 3491  C C    . GLY A 1 5  ? 14.636  -6.321  19.142  1.00 10.00 ? 414 GLY A C    4  
ATOM 3492  O O    . GLY A 1 5  ? 13.751  -6.255  19.995  1.00 10.00 ? 414 GLY A O    4  
ATOM 3493  H H    . GLY A 1 5  ? 17.025  -5.647  20.271  1.00 10.00 ? 414 GLY A H    4  
ATOM 3494  H HA2  . GLY A 1 5  ? 16.035  -7.788  18.498  1.00 10.00 ? 414 GLY A HA2  4  
ATOM 3495  H HA3  . GLY A 1 5  ? 15.693  -7.819  20.222  1.00 10.00 ? 414 GLY A HA3  4  
ATOM 3496  N N    . LEU A 1 6  ? 14.580  -5.667  17.988  1.00 10.00 ? 415 LEU A N    4  
ATOM 3497  C CA   . LEU A 1 6  ? 13.448  -4.811  17.648  1.00 10.00 ? 415 LEU A CA   4  
ATOM 3498  C C    . LEU A 1 6  ? 12.166  -5.628  17.532  1.00 10.00 ? 415 LEU A C    4  
ATOM 3499  O O    . LEU A 1 6  ? 11.075  -5.131  17.813  1.00 10.00 ? 415 LEU A O    4  
ATOM 3500  C CB   . LEU A 1 6  ? 13.717  -4.072  16.336  1.00 10.00 ? 415 LEU A CB   4  
ATOM 3501  C CG   . LEU A 1 6  ? 12.626  -3.087  15.913  1.00 10.00 ? 415 LEU A CG   4  
ATOM 3502  C CD1  . LEU A 1 6  ? 12.577  -1.904  16.867  1.00 10.00 ? 415 LEU A CD1  4  
ATOM 3503  C CD2  . LEU A 1 6  ? 12.860  -2.615  14.486  1.00 10.00 ? 415 LEU A CD2  4  
ATOM 3504  H H    . LEU A 1 6  ? 15.318  -5.760  17.348  1.00 10.00 ? 415 LEU A H    4  
ATOM 3505  H HA   . LEU A 1 6  ? 13.331  -4.089  18.441  1.00 10.00 ? 415 LEU A HA   4  
ATOM 3506  H HB2  . LEU A 1 6  ? 14.644  -3.529  16.436  1.00 10.00 ? 415 LEU A HB2  4  
ATOM 3507  H HB3  . LEU A 1 6  ? 13.831  -4.805  15.551  1.00 10.00 ? 415 LEU A HB3  4  
ATOM 3508  H HG   . LEU A 1 6  ? 11.667  -3.584  15.950  1.00 10.00 ? 415 LEU A HG   4  
ATOM 3509  H HD11 . LEU A 1 6  ? 13.254  -1.136  16.523  1.00 10.00 ? 415 LEU A HD11 4  
ATOM 3510  H HD12 . LEU A 1 6  ? 12.870  -2.226  17.855  1.00 10.00 ? 415 LEU A HD12 4  
ATOM 3511  H HD13 . LEU A 1 6  ? 11.572  -1.509  16.901  1.00 10.00 ? 415 LEU A HD13 4  
ATOM 3512  H HD21 . LEU A 1 6  ? 13.623  -1.850  14.480  1.00 10.00 ? 415 LEU A HD21 4  
ATOM 3513  H HD22 . LEU A 1 6  ? 11.941  -2.209  14.086  1.00 10.00 ? 415 LEU A HD22 4  
ATOM 3514  H HD23 . LEU A 1 6  ? 13.179  -3.448  13.879  1.00 10.00 ? 415 LEU A HD23 4  
ATOM 3515  N N    . MET A 1 7  ? 12.303  -6.883  17.116  1.00 10.00 ? 416 MET A N    4  
ATOM 3516  C CA   . MET A 1 7  ? 11.154  -7.768  16.963  1.00 10.00 ? 416 MET A CA   4  
ATOM 3517  C C    . MET A 1 7  ? 10.169  -7.209  15.942  1.00 10.00 ? 416 MET A C    4  
ATOM 3518  O O    . MET A 1 7  ? 10.312  -6.077  15.481  1.00 10.00 ? 416 MET A O    4  
ATOM 3519  C CB   . MET A 1 7  ? 10.455  -7.967  18.309  1.00 10.00 ? 416 MET A CB   4  
ATOM 3520  C CG   . MET A 1 7  ? 11.270  -8.776  19.305  1.00 10.00 ? 416 MET A CG   4  
ATOM 3521  S SD   . MET A 1 7  ? 10.356  -9.141  20.816  1.00 10.00 ? 416 MET A SD   4  
ATOM 3522  C CE   . MET A 1 7  ? 11.662  -9.026  22.037  1.00 10.00 ? 416 MET A CE   4  
ATOM 3523  H H    . MET A 1 7  ? 13.198  -7.221  16.907  1.00 10.00 ? 416 MET A H    4  
ATOM 3524  H HA   . MET A 1 7  ? 11.516  -8.722  16.611  1.00 10.00 ? 416 MET A HA   4  
ATOM 3525  H HB2  . MET A 1 7  ? 10.252  -6.999  18.743  1.00 10.00 ? 416 MET A HB2  4  
ATOM 3526  H HB3  . MET A 1 7  ? 9.519   -8.480  18.142  1.00 10.00 ? 416 MET A HB3  4  
ATOM 3527  H HG2  . MET A 1 7  ? 11.559  -9.707  18.842  1.00 10.00 ? 416 MET A HG2  4  
ATOM 3528  H HG3  . MET A 1 7  ? 12.156  -8.214  19.563  1.00 10.00 ? 416 MET A HG3  4  
ATOM 3529  H HE1  . MET A 1 7  ? 11.392  -9.605  22.907  1.00 10.00 ? 416 MET A HE1  4  
ATOM 3530  H HE2  . MET A 1 7  ? 11.801  -7.993  22.320  1.00 10.00 ? 416 MET A HE2  4  
ATOM 3531  H HE3  . MET A 1 7  ? 12.581  -9.411  21.619  1.00 10.00 ? 416 MET A HE3  4  
ATOM 3532  N N    . ALA A 1 8  ? 9.167   -8.011  15.594  1.00 10.00 ? 417 ALA A N    4  
ATOM 3533  C CA   . ALA A 1 8  ? 8.158   -7.597  14.628  1.00 10.00 ? 417 ALA A CA   4  
ATOM 3534  C C    . ALA A 1 8  ? 7.414   -6.355  15.109  1.00 10.00 ? 417 ALA A C    4  
ATOM 3535  O O    . ALA A 1 8  ? 7.794   -5.740  16.104  1.00 10.00 ? 417 ALA A O    4  
ATOM 3536  C CB   . ALA A 1 8  ? 7.179   -8.732  14.367  1.00 10.00 ? 417 ALA A CB   4  
ATOM 3537  H H    . ALA A 1 8  ? 9.107   -8.903  15.996  1.00 10.00 ? 417 ALA A H    4  
ATOM 3538  H HA   . ALA A 1 8  ? 8.660   -7.366  13.699  1.00 10.00 ? 417 ALA A HA   4  
ATOM 3539  H HB1  . ALA A 1 8  ? 6.558   -8.485  13.520  1.00 10.00 ? 417 ALA A HB1  4  
ATOM 3540  H HB2  . ALA A 1 8  ? 6.559   -8.879  15.238  1.00 10.00 ? 417 ALA A HB2  4  
ATOM 3541  H HB3  . ALA A 1 8  ? 7.728   -9.639  14.160  1.00 10.00 ? 417 ALA A HB3  4  
ATOM 3542  N N    . ASP A 1 9  ? 6.352   -5.994  14.394  1.00 10.00 ? 418 ASP A N    4  
ATOM 3543  C CA   . ASP A 1 9  ? 5.552   -4.826  14.748  1.00 10.00 ? 418 ASP A CA   4  
ATOM 3544  C C    . ASP A 1 9  ? 4.433   -4.601  13.732  1.00 10.00 ? 418 ASP A C    4  
ATOM 3545  O O    . ASP A 1 9  ? 3.262   -4.510  14.099  1.00 10.00 ? 418 ASP A O    4  
ATOM 3546  C CB   . ASP A 1 9  ? 6.435   -3.578  14.841  1.00 10.00 ? 418 ASP A CB   4  
ATOM 3547  C CG   . ASP A 1 9  ? 6.238   -2.825  16.141  1.00 10.00 ? 418 ASP A CG   4  
ATOM 3548  O OD1  . ASP A 1 9  ? 6.087   -3.483  17.191  1.00 10.00 ? 418 ASP A OD1  4  
ATOM 3549  O OD2  . ASP A 1 9  ? 6.234   -1.575  16.110  1.00 10.00 ? 418 ASP A OD2  4  
ATOM 3550  H H    . ASP A 1 9  ? 6.099   -6.527  13.613  1.00 10.00 ? 418 ASP A H    4  
ATOM 3551  H HA   . ASP A 1 9  ? 5.108   -5.012  15.715  1.00 10.00 ? 418 ASP A HA   4  
ATOM 3552  H HB2  . ASP A 1 9  ? 7.471   -3.872  14.771  1.00 10.00 ? 418 ASP A HB2  4  
ATOM 3553  H HB3  . ASP A 1 9  ? 6.200   -2.913  14.022  1.00 10.00 ? 418 ASP A HB3  4  
ATOM 3554  N N    . PRO A 1 10 ? 4.778   -4.508  12.435  1.00 10.00 ? 419 PRO A N    4  
ATOM 3555  C CA   . PRO A 1 10 ? 3.792   -4.294  11.371  1.00 10.00 ? 419 PRO A CA   4  
ATOM 3556  C C    . PRO A 1 10 ? 2.649   -5.301  11.428  1.00 10.00 ? 419 PRO A C    4  
ATOM 3557  O O    . PRO A 1 10 ? 2.805   -6.403  11.953  1.00 10.00 ? 419 PRO A O    4  
ATOM 3558  C CB   . PRO A 1 10 ? 4.605   -4.479  10.087  1.00 10.00 ? 419 PRO A CB   4  
ATOM 3559  C CG   . PRO A 1 10 ? 6.004   -4.155  10.476  1.00 10.00 ? 419 PRO A CG   4  
ATOM 3560  C CD   . PRO A 1 10 ? 6.153   -4.606  11.902  1.00 10.00 ? 419 PRO A CD   4  
ATOM 3561  H HA   . PRO A 1 10 ? 3.388   -3.292  11.403  1.00 10.00 ? 419 PRO A HA   4  
ATOM 3562  H HB2  . PRO A 1 10 ? 4.514   -5.499  9.745   1.00 10.00 ? 419 PRO A HB2  4  
ATOM 3563  H HB3  . PRO A 1 10 ? 4.241   -3.804  9.327   1.00 10.00 ? 419 PRO A HB3  4  
ATOM 3564  H HG2  . PRO A 1 10 ? 6.695   -4.689  9.840   1.00 10.00 ? 419 PRO A HG2  4  
ATOM 3565  H HG3  . PRO A 1 10 ? 6.170   -3.091  10.401  1.00 10.00 ? 419 PRO A HG3  4  
ATOM 3566  H HD2  . PRO A 1 10 ? 6.510   -5.623  11.940  1.00 10.00 ? 419 PRO A HD2  4  
ATOM 3567  H HD3  . PRO A 1 10 ? 6.821   -3.949  12.438  1.00 10.00 ? 419 PRO A HD3  4  
ATOM 3568  N N    . MET A 1 11 ? 1.500   -4.916  10.882  1.00 10.00 ? 420 MET A N    4  
ATOM 3569  C CA   . MET A 1 11 ? 0.329   -5.780  10.869  1.00 10.00 ? 420 MET A CA   4  
ATOM 3570  C C    . MET A 1 11 ? -0.209  -5.912  9.455   1.00 10.00 ? 420 MET A C    4  
ATOM 3571  O O    . MET A 1 11 ? 0.161   -6.837  8.736   1.00 10.00 ? 420 MET A O    4  
ATOM 3572  C CB   . MET A 1 11 ? -0.747  -5.214  11.794  1.00 10.00 ? 420 MET A CB   4  
ATOM 3573  C CG   . MET A 1 11 ? -0.486  -5.472  13.268  1.00 10.00 ? 420 MET A CG   4  
ATOM 3574  S SD   . MET A 1 11 ? -1.991  -5.426  14.259  1.00 10.00 ? 420 MET A SD   4  
ATOM 3575  C CE   . MET A 1 11 ? -2.913  -6.781  13.539  1.00 10.00 ? 420 MET A CE   4  
ATOM 3576  H H    . MET A 1 11 ? 1.434   -4.026  10.478  1.00 10.00 ? 420 MET A H    4  
ATOM 3577  H HA   . MET A 1 11 ? 0.625   -6.762  11.217  1.00 10.00 ? 420 MET A HA   4  
ATOM 3578  H HB2  . MET A 1 11 ? -0.805  -4.144  11.639  1.00 10.00 ? 420 MET A HB2  4  
ATOM 3579  H HB3  . MET A 1 11 ? -1.697  -5.653  11.533  1.00 10.00 ? 420 MET A HB3  4  
ATOM 3580  H HG2  . MET A 1 11 ? -0.032  -6.447  13.373  1.00 10.00 ? 420 MET A HG2  4  
ATOM 3581  H HG3  . MET A 1 11 ? 0.195   -4.719  13.637  1.00 10.00 ? 420 MET A HG3  4  
ATOM 3582  H HE1  . MET A 1 11 ? -2.225  -7.521  13.155  1.00 10.00 ? 420 MET A HE1  4  
ATOM 3583  H HE2  . MET A 1 11 ? -3.528  -6.410  12.731  1.00 10.00 ? 420 MET A HE2  4  
ATOM 3584  H HE3  . MET A 1 11 ? -3.542  -7.230  14.292  1.00 10.00 ? 420 MET A HE3  4  
ATOM 3585  N N    . LYS A 1 12 ? -1.066  -4.977  9.055   1.00 10.00 ? 421 LYS A N    4  
ATOM 3586  C CA   . LYS A 1 12 ? -1.636  -4.998  7.712   1.00 10.00 ? 421 LYS A CA   4  
ATOM 3587  C C    . LYS A 1 12 ? -0.520  -5.103  6.691   1.00 10.00 ? 421 LYS A C    4  
ATOM 3588  O O    . LYS A 1 12 ? 0.060   -4.102  6.270   1.00 10.00 ? 421 LYS A O    4  
ATOM 3589  C CB   . LYS A 1 12 ? -2.484  -3.760  7.463   1.00 10.00 ? 421 LYS A CB   4  
ATOM 3590  C CG   . LYS A 1 12 ? -3.011  -3.660  6.043   1.00 10.00 ? 421 LYS A CG   4  
ATOM 3591  C CD   . LYS A 1 12 ? -4.408  -4.244  5.917   1.00 10.00 ? 421 LYS A CD   4  
ATOM 3592  C CE   . LYS A 1 12 ? -5.402  -3.519  6.810   1.00 10.00 ? 421 LYS A CE   4  
ATOM 3593  N NZ   . LYS A 1 12 ? -5.738  -4.310  8.027   1.00 10.00 ? 421 LYS A NZ   4  
ATOM 3594  H H    . LYS A 1 12 ? -1.307  -4.254  9.669   1.00 10.00 ? 421 LYS A H    4  
ATOM 3595  H HA   . LYS A 1 12 ? -2.259  -5.872  7.631   1.00 10.00 ? 421 LYS A HA   4  
ATOM 3596  H HB2  . LYS A 1 12 ? -3.325  -3.783  8.137   1.00 10.00 ? 421 LYS A HB2  4  
ATOM 3597  H HB3  . LYS A 1 12 ? -1.889  -2.885  7.669   1.00 10.00 ? 421 LYS A HB3  4  
ATOM 3598  H HG2  . LYS A 1 12 ? -3.044  -2.624  5.759   1.00 10.00 ? 421 LYS A HG2  4  
ATOM 3599  H HG3  . LYS A 1 12 ? -2.346  -4.199  5.382   1.00 10.00 ? 421 LYS A HG3  4  
ATOM 3600  H HD2  . LYS A 1 12 ? -4.728  -4.153  4.891   1.00 10.00 ? 421 LYS A HD2  4  
ATOM 3601  H HD3  . LYS A 1 12 ? -4.377  -5.287  6.197   1.00 10.00 ? 421 LYS A HD3  4  
ATOM 3602  H HE2  . LYS A 1 12 ? -4.973  -2.575  7.114   1.00 10.00 ? 421 LYS A HE2  4  
ATOM 3603  H HE3  . LYS A 1 12 ? -6.305  -3.338  6.247   1.00 10.00 ? 421 LYS A HE3  4  
ATOM 3604  H HZ1  . LYS A 1 12 ? -5.522  -5.316  7.869   1.00 10.00 ? 421 LYS A HZ1  4  
ATOM 3605  H HZ2  . LYS A 1 12 ? -6.750  -4.214  8.246   1.00 10.00 ? 421 LYS A HZ2  4  
ATOM 3606  H HZ3  . LYS A 1 12 ? -5.185  -3.969  8.839   1.00 10.00 ? 421 LYS A HZ3  4  
ATOM 3607  N N    . VAL A 1 13 ? -0.203  -6.334  6.340   1.00 10.00 ? 422 VAL A N    4  
ATOM 3608  C CA   . VAL A 1 13 ? 0.870   -6.619  5.416   1.00 10.00 ? 422 VAL A CA   4  
ATOM 3609  C C    . VAL A 1 13 ? 0.959   -8.119  5.178   1.00 10.00 ? 422 VAL A C    4  
ATOM 3610  O O    . VAL A 1 13 ? 1.111   -8.584  4.048   1.00 10.00 ? 422 VAL A O    4  
ATOM 3611  C CB   . VAL A 1 13 ? 2.189   -6.085  5.998   1.00 10.00 ? 422 VAL A CB   4  
ATOM 3612  C CG1  . VAL A 1 13 ? 2.795   -7.060  7.000   1.00 10.00 ? 422 VAL A CG1  4  
ATOM 3613  C CG2  . VAL A 1 13 ? 3.171   -5.750  4.891   1.00 10.00 ? 422 VAL A CG2  4  
ATOM 3614  H H    . VAL A 1 13 ? -0.689  -7.078  6.741   1.00 10.00 ? 422 VAL A H    4  
ATOM 3615  H HA   . VAL A 1 13 ? 0.666   -6.113  4.486   1.00 10.00 ? 422 VAL A HA   4  
ATOM 3616  H HB   . VAL A 1 13 ? 1.951   -5.177  6.531   1.00 10.00 ? 422 VAL A HB   4  
ATOM 3617  H HG11 . VAL A 1 13 ? 2.079   -7.259  7.786   1.00 10.00 ? 422 VAL A HG11 4  
ATOM 3618  H HG12 . VAL A 1 13 ? 3.688   -6.628  7.428   1.00 10.00 ? 422 VAL A HG12 4  
ATOM 3619  H HG13 . VAL A 1 13 ? 3.047   -7.983  6.499   1.00 10.00 ? 422 VAL A HG13 4  
ATOM 3620  H HG21 . VAL A 1 13 ? 3.739   -4.874  5.166   1.00 10.00 ? 422 VAL A HG21 4  
ATOM 3621  H HG22 . VAL A 1 13 ? 2.630   -5.557  3.976   1.00 10.00 ? 422 VAL A HG22 4  
ATOM 3622  H HG23 . VAL A 1 13 ? 3.843   -6.583  4.742   1.00 10.00 ? 422 VAL A HG23 4  
ATOM 3623  N N    . TYR A 1 14 ? 0.834   -8.863  6.270   1.00 10.00 ? 423 TYR A N    4  
ATOM 3624  C CA   . TYR A 1 14 ? 0.862   -10.323 6.245   1.00 10.00 ? 423 TYR A CA   4  
ATOM 3625  C C    . TYR A 1 14 ? 0.038   -10.874 5.078   1.00 10.00 ? 423 TYR A C    4  
ATOM 3626  O O    . TYR A 1 14 ? 0.300   -11.974 4.591   1.00 10.00 ? 423 TYR A O    4  
ATOM 3627  C CB   . TYR A 1 14 ? 0.350   -10.902 7.582   1.00 10.00 ? 423 TYR A CB   4  
ATOM 3628  C CG   . TYR A 1 14 ? -0.498  -9.957  8.421   1.00 10.00 ? 423 TYR A CG   4  
ATOM 3629  C CD1  . TYR A 1 14 ? -1.301  -8.985  7.838   1.00 10.00 ? 423 TYR A CD1  4  
ATOM 3630  C CD2  . TYR A 1 14 ? -0.470  -10.030 9.808   1.00 10.00 ? 423 TYR A CD2  4  
ATOM 3631  C CE1  . TYR A 1 14 ? -2.046  -8.123  8.602   1.00 10.00 ? 423 TYR A CE1  4  
ATOM 3632  C CE2  . TYR A 1 14 ? -1.222  -9.167  10.583  1.00 10.00 ? 423 TYR A CE2  4  
ATOM 3633  C CZ   . TYR A 1 14 ? -2.008  -8.215  9.975   1.00 10.00 ? 423 TYR A CZ   4  
ATOM 3634  O OH   . TYR A 1 14 ? -2.759  -7.355  10.741  1.00 10.00 ? 423 TYR A OH   4  
ATOM 3635  H H    . TYR A 1 14 ? 0.706   -8.411  7.127   1.00 10.00 ? 423 TYR A H    4  
ATOM 3636  H HA   . TYR A 1 14 ? 1.889   -10.625 6.108   1.00 10.00 ? 423 TYR A HA   4  
ATOM 3637  H HB2  . TYR A 1 14 ? -0.244  -11.778 7.383   1.00 10.00 ? 423 TYR A HB2  4  
ATOM 3638  H HB3  . TYR A 1 14 ? 1.202   -11.184 8.184   1.00 10.00 ? 423 TYR A HB3  4  
ATOM 3639  H HD1  . TYR A 1 14 ? -1.341  -8.904  6.766   1.00 10.00 ? 423 TYR A HD1  4  
ATOM 3640  H HD2  . TYR A 1 14 ? 0.148   -10.776 10.283  1.00 10.00 ? 423 TYR A HD2  4  
ATOM 3641  H HE1  . TYR A 1 14 ? -2.641  -7.369  8.118   1.00 10.00 ? 423 TYR A HE1  4  
ATOM 3642  H HE2  . TYR A 1 14 ? -1.187  -9.240  11.657  1.00 10.00 ? 423 TYR A HE2  4  
ATOM 3643  H HH   . TYR A 1 14 ? -3.682  -7.421  10.486  1.00 10.00 ? 423 TYR A HH   4  
ATOM 3644  N N    . LYS A 1 15 ? -0.947  -10.101 4.623   1.00 10.00 ? 424 LYS A N    4  
ATOM 3645  C CA   . LYS A 1 15 ? -1.789  -10.512 3.506   1.00 10.00 ? 424 LYS A CA   4  
ATOM 3646  C C    . LYS A 1 15 ? -1.479  -9.676  2.264   1.00 10.00 ? 424 LYS A C    4  
ATOM 3647  O O    . LYS A 1 15 ? -1.733  -10.100 1.137   1.00 10.00 ? 424 LYS A O    4  
ATOM 3648  C CB   . LYS A 1 15 ? -3.267  -10.373 3.873   1.00 10.00 ? 424 LYS A CB   4  
ATOM 3649  C CG   . LYS A 1 15 ? -3.815  -11.559 4.650   1.00 10.00 ? 424 LYS A CG   4  
ATOM 3650  C CD   . LYS A 1 15 ? -5.331  -11.630 4.562   1.00 10.00 ? 424 LYS A CD   4  
ATOM 3651  C CE   . LYS A 1 15 ? -5.903  -12.601 5.582   1.00 10.00 ? 424 LYS A CE   4  
ATOM 3652  N NZ   . LYS A 1 15 ? -5.923  -13.998 5.070   1.00 10.00 ? 424 LYS A NZ   4  
ATOM 3653  H H    . LYS A 1 15 ? -1.108  -9.228  5.041   1.00 10.00 ? 424 LYS A H    4  
ATOM 3654  H HA   . LYS A 1 15 ? -1.574  -11.548 3.291   1.00 10.00 ? 424 LYS A HA   4  
ATOM 3655  H HB2  . LYS A 1 15 ? -3.394  -9.485  4.475   1.00 10.00 ? 424 LYS A HB2  4  
ATOM 3656  H HB3  . LYS A 1 15 ? -3.844  -10.267 2.966   1.00 10.00 ? 424 LYS A HB3  4  
ATOM 3657  H HG2  . LYS A 1 15 ? -3.398  -12.468 4.242   1.00 10.00 ? 424 LYS A HG2  4  
ATOM 3658  H HG3  . LYS A 1 15 ? -3.527  -11.463 5.686   1.00 10.00 ? 424 LYS A HG3  4  
ATOM 3659  H HD2  . LYS A 1 15 ? -5.739  -10.647 4.746   1.00 10.00 ? 424 LYS A HD2  4  
ATOM 3660  H HD3  . LYS A 1 15 ? -5.609  -11.958 3.571   1.00 10.00 ? 424 LYS A HD3  4  
ATOM 3661  H HE2  . LYS A 1 15 ? -5.297  -12.563 6.475   1.00 10.00 ? 424 LYS A HE2  4  
ATOM 3662  H HE3  . LYS A 1 15 ? -6.912  -12.299 5.821   1.00 10.00 ? 424 LYS A HE3  4  
ATOM 3663  H HZ1  . LYS A 1 15 ? -6.684  -14.538 5.530   1.00 10.00 ? 424 LYS A HZ1  4  
ATOM 3664  H HZ2  . LYS A 1 15 ? -5.015  -14.465 5.267   1.00 10.00 ? 424 LYS A HZ2  4  
ATOM 3665  H HZ3  . LYS A 1 15 ? -6.085  -13.999 4.042   1.00 10.00 ? 424 LYS A HZ3  4  
ATOM 3666  N N    . ASP A 1 16 ? -0.927  -8.485  2.484   1.00 10.00 ? 425 ASP A N    4  
ATOM 3667  C CA   . ASP A 1 16 ? -0.579  -7.581  1.394   1.00 10.00 ? 425 ASP A CA   4  
ATOM 3668  C C    . ASP A 1 16 ? 0.554   -8.148  0.539   1.00 10.00 ? 425 ASP A C    4  
ATOM 3669  O O    . ASP A 1 16 ? 0.744   -7.731  -0.602  1.00 10.00 ? 425 ASP A O    4  
ATOM 3670  C CB   . ASP A 1 16 ? -0.171  -6.218  1.959   1.00 10.00 ? 425 ASP A CB   4  
ATOM 3671  C CG   . ASP A 1 16 ? 0.156   -5.210  0.875   1.00 10.00 ? 425 ASP A CG   4  
ATOM 3672  O OD1  . ASP A 1 16 ? -0.712  -4.963  0.012   1.00 10.00 ? 425 ASP A OD1  4  
ATOM 3673  O OD2  . ASP A 1 16 ? 1.278   -4.666  0.892   1.00 10.00 ? 425 ASP A OD2  4  
ATOM 3674  H H    . ASP A 1 16 ? -0.752  -8.204  3.405   1.00 10.00 ? 425 ASP A H    4  
ATOM 3675  H HA   . ASP A 1 16 ? -1.453  -7.455  0.775   1.00 10.00 ? 425 ASP A HA   4  
ATOM 3676  H HB2  . ASP A 1 16 ? -0.979  -5.826  2.556   1.00 10.00 ? 425 ASP A HB2  4  
ATOM 3677  H HB3  . ASP A 1 16 ? 0.704   -6.344  2.581   1.00 10.00 ? 425 ASP A HB3  4  
ATOM 3678  N N    . ARG A 1 17 ? 1.310   -9.093  1.093   1.00 10.00 ? 426 ARG A N    4  
ATOM 3679  C CA   . ARG A 1 17 ? 2.426   -9.702  0.371   1.00 10.00 ? 426 ARG A CA   4  
ATOM 3680  C C    . ARG A 1 17 ? 2.009   -10.134 -1.033  1.00 10.00 ? 426 ARG A C    4  
ATOM 3681  O O    . ARG A 1 17 ? 2.829   -10.160 -1.953  1.00 10.00 ? 426 ARG A O    4  
ATOM 3682  C CB   . ARG A 1 17 ? 2.975   -10.898 1.149   1.00 10.00 ? 426 ARG A CB   4  
ATOM 3683  C CG   . ARG A 1 17 ? 4.142   -11.590 0.464   1.00 10.00 ? 426 ARG A CG   4  
ATOM 3684  C CD   . ARG A 1 17 ? 4.878   -12.518 1.417   1.00 10.00 ? 426 ARG A CD   4  
ATOM 3685  N NE   . ARG A 1 17 ? 5.872   -13.336 0.727   1.00 10.00 ? 426 ARG A NE   4  
ATOM 3686  C CZ   . ARG A 1 17 ? 7.063   -12.885 0.339   1.00 10.00 ? 426 ARG A CZ   4  
ATOM 3687  N NH1  . ARG A 1 17 ? 7.411   -11.626 0.570   1.00 10.00 ? 426 ARG A NH1  4  
ATOM 3688  N NH2  . ARG A 1 17 ? 7.908   -13.696 -0.283  1.00 10.00 ? 426 ARG A NH2  4  
ATOM 3689  H H    . ARG A 1 17 ? 1.118   -9.385  2.008   1.00 10.00 ? 426 ARG A H    4  
ATOM 3690  H HA   . ARG A 1 17 ? 3.203   -8.957  0.281   1.00 10.00 ? 426 ARG A HA   4  
ATOM 3691  H HB2  . ARG A 1 17 ? 3.305   -10.560 2.120   1.00 10.00 ? 426 ARG A HB2  4  
ATOM 3692  H HB3  . ARG A 1 17 ? 2.184   -11.620 1.281   1.00 10.00 ? 426 ARG A HB3  4  
ATOM 3693  H HG2  . ARG A 1 17 ? 3.768   -12.167 -0.368  1.00 10.00 ? 426 ARG A HG2  4  
ATOM 3694  H HG3  . ARG A 1 17 ? 4.831   -10.839 0.103   1.00 10.00 ? 426 ARG A HG3  4  
ATOM 3695  H HD2  . ARG A 1 17 ? 5.375   -11.922 2.168   1.00 10.00 ? 426 ARG A HD2  4  
ATOM 3696  H HD3  . ARG A 1 17 ? 4.158   -13.168 1.892   1.00 10.00 ? 426 ARG A HD3  4  
ATOM 3697  H HE   . ARG A 1 17 ? 5.640   -14.270 0.543   1.00 10.00 ? 426 ARG A HE   4  
ATOM 3698  H HH11 . ARG A 1 17 ? 6.778   -11.008 1.039   1.00 10.00 ? 426 ARG A HH11 4  
ATOM 3699  H HH12 . ARG A 1 17 ? 8.307   -11.293 0.277   1.00 10.00 ? 426 ARG A HH12 4  
ATOM 3700  H HH21 . ARG A 1 17 ? 7.651   -14.646 -0.460  1.00 10.00 ? 426 ARG A HH21 4  
ATOM 3701  H HH22 . ARG A 1 17 ? 8.802   -13.358 -0.575  1.00 10.00 ? 426 ARG A HH22 4  
ATOM 3702  N N    . GLN A 1 18 ? 0.731   -10.457 -1.198  1.00 10.00 ? 427 GLN A N    4  
ATOM 3703  C CA   . GLN A 1 18 ? 0.211   -10.869 -2.497  1.00 10.00 ? 427 GLN A CA   4  
ATOM 3704  C C    . GLN A 1 18 ? -0.457  -9.691  -3.194  1.00 10.00 ? 427 GLN A C    4  
ATOM 3705  O O    . GLN A 1 18 ? -1.428  -9.852  -3.933  1.00 10.00 ? 427 GLN A O    4  
ATOM 3706  C CB   . GLN A 1 18 ? -0.782  -12.024 -2.337  1.00 10.00 ? 427 GLN A CB   4  
ATOM 3707  C CG   . GLN A 1 18 ? -0.322  -13.091 -1.355  1.00 10.00 ? 427 GLN A CG   4  
ATOM 3708  C CD   . GLN A 1 18 ? -0.714  -12.776 0.076   1.00 10.00 ? 427 GLN A CD   4  
ATOM 3709  O OE1  . GLN A 1 18 ? -1.863  -12.437 0.357   1.00 10.00 ? 427 GLN A OE1  4  
ATOM 3710  N NE2  . GLN A 1 18 ? 0.244   -12.889 0.991   1.00 10.00 ? 427 GLN A NE2  4  
ATOM 3711  H H    . GLN A 1 18 ? 0.121   -10.407 -0.432  1.00 10.00 ? 427 GLN A H    4  
ATOM 3712  H HA   . GLN A 1 18 ? 1.045   -11.196 -3.101  1.00 10.00 ? 427 GLN A HA   4  
ATOM 3713  H HB2  . GLN A 1 18 ? -1.724  -11.628 -1.990  1.00 10.00 ? 427 GLN A HB2  4  
ATOM 3714  H HB3  . GLN A 1 18 ? -0.930  -12.491 -3.300  1.00 10.00 ? 427 GLN A HB3  4  
ATOM 3715  H HG2  . GLN A 1 18 ? -0.768  -14.033 -1.634  1.00 10.00 ? 427 GLN A HG2  4  
ATOM 3716  H HG3  . GLN A 1 18 ? 0.754   -13.172 -1.409  1.00 10.00 ? 427 GLN A HG3  4  
ATOM 3717  H HE21 . GLN A 1 18 ? 1.136   -13.167 0.694   1.00 10.00 ? 427 GLN A HE21 4  
ATOM 3718  H HE22 . GLN A 1 18 ? 0.021   -12.687 1.925   1.00 10.00 ? 427 GLN A HE22 4  
ATOM 3719  N N    . VAL A 1 19 ? 0.083   -8.506  -2.945  1.00 10.00 ? 428 VAL A N    4  
ATOM 3720  C CA   . VAL A 1 19 ? -0.432  -7.279  -3.533  1.00 10.00 ? 428 VAL A CA   4  
ATOM 3721  C C    . VAL A 1 19 ? 0.620   -6.625  -4.414  1.00 10.00 ? 428 VAL A C    4  
ATOM 3722  O O    . VAL A 1 19 ? 0.293   -6.002  -5.424  1.00 10.00 ? 428 VAL A O    4  
ATOM 3723  C CB   . VAL A 1 19 ? -0.881  -6.290  -2.445  1.00 10.00 ? 428 VAL A CB   4  
ATOM 3724  C CG1  . VAL A 1 19 ? -1.344  -4.975  -3.055  1.00 10.00 ? 428 VAL A CG1  4  
ATOM 3725  C CG2  . VAL A 1 19 ? -1.980  -6.912  -1.601  1.00 10.00 ? 428 VAL A CG2  4  
ATOM 3726  H H    . VAL A 1 19 ? 0.856   -8.457  -2.347  1.00 10.00 ? 428 VAL A H    4  
ATOM 3727  H HA   . VAL A 1 19 ? -1.287  -7.530  -4.140  1.00 10.00 ? 428 VAL A HA   4  
ATOM 3728  H HB   . VAL A 1 19 ? -0.036  -6.087  -1.806  1.00 10.00 ? 428 VAL A HB   4  
ATOM 3729  H HG11 . VAL A 1 19 ? -1.125  -4.964  -4.115  1.00 10.00 ? 428 VAL A HG11 4  
ATOM 3730  H HG12 . VAL A 1 19 ? -0.825  -4.163  -2.573  1.00 10.00 ? 428 VAL A HG12 4  
ATOM 3731  H HG13 . VAL A 1 19 ? -2.406  -4.861  -2.904  1.00 10.00 ? 428 VAL A HG13 4  
ATOM 3732  H HG21 . VAL A 1 19 ? -2.805  -7.189  -2.238  1.00 10.00 ? 428 VAL A HG21 4  
ATOM 3733  H HG22 . VAL A 1 19 ? -2.318  -6.198  -0.864  1.00 10.00 ? 428 VAL A HG22 4  
ATOM 3734  H HG23 . VAL A 1 19 ? -1.598  -7.791  -1.105  1.00 10.00 ? 428 VAL A HG23 4  
ATOM 3735  N N    . MET A 1 20 ? 1.887   -6.784  -4.042  1.00 10.00 ? 429 MET A N    4  
ATOM 3736  C CA   . MET A 1 20 ? 2.983   -6.219  -4.824  1.00 10.00 ? 429 MET A CA   4  
ATOM 3737  C C    . MET A 1 20 ? 2.791   -6.528  -6.309  1.00 10.00 ? 429 MET A C    4  
ATOM 3738  O O    . MET A 1 20 ? 3.271   -5.796  -7.175  1.00 10.00 ? 429 MET A O    4  
ATOM 3739  C CB   . MET A 1 20 ? 4.324   -6.779  -4.343  1.00 10.00 ? 429 MET A CB   4  
ATOM 3740  C CG   . MET A 1 20 ? 5.460   -5.772  -4.408  1.00 10.00 ? 429 MET A CG   4  
ATOM 3741  S SD   . MET A 1 20 ? 7.082   -6.558  -4.478  1.00 10.00 ? 429 MET A SD   4  
ATOM 3742  C CE   . MET A 1 20 ? 7.116   -7.110  -6.182  1.00 10.00 ? 429 MET A CE   4  
ATOM 3743  H H    . MET A 1 20 ? 2.089   -7.301  -3.231  1.00 10.00 ? 429 MET A H    4  
ATOM 3744  H HA   . MET A 1 20 ? 2.975   -5.149  -4.684  1.00 10.00 ? 429 MET A HA   4  
ATOM 3745  H HB2  . MET A 1 20 ? 4.219   -7.106  -3.319  1.00 10.00 ? 429 MET A HB2  4  
ATOM 3746  H HB3  . MET A 1 20 ? 4.587   -7.627  -4.957  1.00 10.00 ? 429 MET A HB3  4  
ATOM 3747  H HG2  . MET A 1 20 ? 5.334   -5.162  -5.290  1.00 10.00 ? 429 MET A HG2  4  
ATOM 3748  H HG3  . MET A 1 20 ? 5.418   -5.145  -3.530  1.00 10.00 ? 429 MET A HG3  4  
ATOM 3749  H HE1  . MET A 1 20 ? 6.135   -7.461  -6.467  1.00 10.00 ? 429 MET A HE1  4  
ATOM 3750  H HE2  . MET A 1 20 ? 7.830   -7.914  -6.286  1.00 10.00 ? 429 MET A HE2  4  
ATOM 3751  H HE3  . MET A 1 20 ? 7.404   -6.288  -6.821  1.00 10.00 ? 429 MET A HE3  4  
ATOM 3752  N N    . ASN A 1 21 ? 2.079   -7.619  -6.589  1.00 10.00 ? 430 ASN A N    4  
ATOM 3753  C CA   . ASN A 1 21 ? 1.811   -8.033  -7.958  1.00 10.00 ? 430 ASN A CA   4  
ATOM 3754  C C    . ASN A 1 21 ? 0.311   -8.214  -8.194  1.00 10.00 ? 430 ASN A C    4  
ATOM 3755  O O    . ASN A 1 21 ? -0.097  -8.932  -9.107  1.00 10.00 ? 430 ASN A O    4  
ATOM 3756  C CB   . ASN A 1 21 ? 2.543   -9.342  -8.258  1.00 10.00 ? 430 ASN A CB   4  
ATOM 3757  C CG   . ASN A 1 21 ? 3.982   -9.117  -8.681  1.00 10.00 ? 430 ASN A CG   4  
ATOM 3758  O OD1  . ASN A 1 21 ? 4.661   -8.231  -8.163  1.00 10.00 ? 430 ASN A OD1  4  
ATOM 3759  N ND2  . ASN A 1 21 ? 4.452   -9.920  -9.627  1.00 10.00 ? 430 ASN A ND2  4  
ATOM 3760  H H    . ASN A 1 21 ? 1.725   -8.160  -5.854  1.00 10.00 ? 430 ASN A H    4  
ATOM 3761  H HA   . ASN A 1 21 ? 2.177   -7.262  -8.618  1.00 10.00 ? 430 ASN A HA   4  
ATOM 3762  H HB2  . ASN A 1 21 ? 2.540   -9.958  -7.368  1.00 10.00 ? 430 ASN A HB2  4  
ATOM 3763  H HB3  . ASN A 1 21 ? 2.028   -9.861  -9.052  1.00 10.00 ? 430 ASN A HB3  4  
ATOM 3764  H HD21 . ASN A 1 21 ? 3.853   -10.604 -9.995  1.00 10.00 ? 430 ASN A HD21 4  
ATOM 3765  H HD22 . ASN A 1 21 ? 5.379   -9.796  -9.920  1.00 10.00 ? 430 ASN A HD22 4  
ATOM 3766  N N    . MET A 1 22 ? -0.506  -7.558  -7.370  1.00 10.00 ? 431 MET A N    4  
ATOM 3767  C CA   . MET A 1 22 ? -1.959  -7.648  -7.496  1.00 10.00 ? 431 MET A CA   4  
ATOM 3768  C C    . MET A 1 22 ? -2.660  -6.972  -6.322  1.00 10.00 ? 431 MET A C    4  
ATOM 3769  O O    . MET A 1 22 ? -3.007  -7.625  -5.338  1.00 10.00 ? 431 MET A O    4  
ATOM 3770  C CB   . MET A 1 22 ? -2.409  -9.107  -7.575  1.00 10.00 ? 431 MET A CB   4  
ATOM 3771  C CG   . MET A 1 22 ? -2.757  -9.564  -8.982  1.00 10.00 ? 431 MET A CG   4  
ATOM 3772  S SD   . MET A 1 22 ? -4.276  -10.533 -9.046  1.00 10.00 ? 431 MET A SD   4  
ATOM 3773  C CE   . MET A 1 22 ? -3.773  -11.884 -10.108 1.00 10.00 ? 431 MET A CE   4  
ATOM 3774  H H    . MET A 1 22 ? -0.123  -6.999  -6.667  1.00 10.00 ? 431 MET A H    4  
ATOM 3775  H HA   . MET A 1 22 ? -2.244  -7.144  -8.407  1.00 10.00 ? 431 MET A HA   4  
ATOM 3776  H HB2  . MET A 1 22 ? -1.616  -9.735  -7.198  1.00 10.00 ? 431 MET A HB2  4  
ATOM 3777  H HB3  . MET A 1 22 ? -3.284  -9.232  -6.951  1.00 10.00 ? 431 MET A HB3  4  
ATOM 3778  H HG2  . MET A 1 22 ? -2.876  -8.693  -9.610  1.00 10.00 ? 431 MET A HG2  4  
ATOM 3779  H HG3  . MET A 1 22 ? -1.944  -10.168 -9.360  1.00 10.00 ? 431 MET A HG3  4  
ATOM 3780  H HE1  . MET A 1 22 ? -2.699  -11.992 -10.069 1.00 10.00 ? 431 MET A HE1  4  
ATOM 3781  H HE2  . MET A 1 22 ? -4.077  -11.675 -11.124 1.00 10.00 ? 431 MET A HE2  4  
ATOM 3782  H HE3  . MET A 1 22 ? -4.238  -12.799 -9.773  1.00 10.00 ? 431 MET A HE3  4  
ATOM 3783  N N    . TRP A 1 23 ? -2.898  -5.675  -6.446  1.00 10.00 ? 432 TRP A N    4  
ATOM 3784  C CA   . TRP A 1 23 ? -3.591  -4.930  -5.403  1.00 10.00 ? 432 TRP A CA   4  
ATOM 3785  C C    . TRP A 1 23 ? -5.088  -4.996  -5.656  1.00 10.00 ? 432 TRP A C    4  
ATOM 3786  O O    . TRP A 1 23 ? -5.628  -4.257  -6.479  1.00 10.00 ? 432 TRP A O    4  
ATOM 3787  C CB   . TRP A 1 23 ? -3.127  -3.470  -5.348  1.00 10.00 ? 432 TRP A CB   4  
ATOM 3788  C CG   . TRP A 1 23 ? -1.684  -3.238  -5.706  1.00 10.00 ? 432 TRP A CG   4  
ATOM 3789  C CD1  . TRP A 1 23 ? -1.076  -3.534  -6.886  1.00 10.00 ? 432 TRP A CD1  4  
ATOM 3790  C CD2  . TRP A 1 23 ? -0.672  -2.637  -4.882  1.00 10.00 ? 432 TRP A CD2  4  
ATOM 3791  N NE1  . TRP A 1 23 ? 0.232   -3.133  -6.857  1.00 10.00 ? 432 TRP A NE1  4  
ATOM 3792  C CE2  . TRP A 1 23 ? 0.508   -2.591  -5.641  1.00 10.00 ? 432 TRP A CE2  4  
ATOM 3793  C CE3  . TRP A 1 23 ? -0.647  -2.131  -3.585  1.00 10.00 ? 432 TRP A CE3  4  
ATOM 3794  C CZ2  . TRP A 1 23 ? 1.692   -2.054  -5.151  1.00 10.00 ? 432 TRP A CZ2  4  
ATOM 3795  C CZ3  . TRP A 1 23 ? 0.531   -1.604  -3.092  1.00 10.00 ? 432 TRP A CZ3  4  
ATOM 3796  C CH2  . TRP A 1 23 ? 1.686   -1.565  -3.875  1.00 10.00 ? 432 TRP A CH2  4  
ATOM 3797  H H    . TRP A 1 23 ? -2.629  -5.219  -7.264  1.00 10.00 ? 432 TRP A H    4  
ATOM 3798  H HA   . TRP A 1 23 ? -3.388  -5.407  -4.454  1.00 10.00 ? 432 TRP A HA   4  
ATOM 3799  H HB2  . TRP A 1 23 ? -3.727  -2.894  -6.033  1.00 10.00 ? 432 TRP A HB2  4  
ATOM 3800  H HB3  . TRP A 1 23 ? -3.283  -3.095  -4.351  1.00 10.00 ? 432 TRP A HB3  4  
ATOM 3801  H HD1  . TRP A 1 23 ? -1.565  -4.004  -7.720  1.00 10.00 ? 432 TRP A HD1  4  
ATOM 3802  H HE1  . TRP A 1 23 ? 0.864   -3.222  -7.586  1.00 10.00 ? 432 TRP A HE1  4  
ATOM 3803  H HE3  . TRP A 1 23 ? -1.520  -2.156  -2.970  1.00 10.00 ? 432 TRP A HE3  4  
ATOM 3804  H HZ2  . TRP A 1 23 ? 2.584   -2.005  -5.753  1.00 10.00 ? 432 TRP A HZ2  4  
ATOM 3805  H HZ3  . TRP A 1 23 ? 0.564   -1.208  -2.086  1.00 10.00 ? 432 TRP A HZ3  4  
ATOM 3806  H HH2  . TRP A 1 23 ? 2.586   -1.148  -3.450  1.00 10.00 ? 432 TRP A HH2  4  
ATOM 3807  N N    . SER A 1 24 ? -5.743  -5.906  -4.955  1.00 10.00 ? 433 SER A N    4  
ATOM 3808  C CA   . SER A 1 24 ? -7.180  -6.109  -5.103  1.00 10.00 ? 433 SER A CA   4  
ATOM 3809  C C    . SER A 1 24 ? -7.959  -4.856  -4.730  1.00 10.00 ? 433 SER A C    4  
ATOM 3810  O O    . SER A 1 24 ? -7.522  -4.067  -3.894  1.00 10.00 ? 433 SER A O    4  
ATOM 3811  C CB   . SER A 1 24 ? -7.640  -7.284  -4.239  1.00 10.00 ? 433 SER A CB   4  
ATOM 3812  O OG   . SER A 1 24 ? -6.568  -8.172  -3.971  1.00 10.00 ? 433 SER A OG   4  
ATOM 3813  H H    . SER A 1 24 ? -5.240  -6.467  -4.326  1.00 10.00 ? 433 SER A H    4  
ATOM 3814  H HA   . SER A 1 24 ? -7.374  -6.342  -6.139  1.00 10.00 ? 433 SER A HA   4  
ATOM 3815  H HB2  . SER A 1 24 ? -8.023  -6.911  -3.301  1.00 10.00 ? 433 SER A HB2  4  
ATOM 3816  H HB3  . SER A 1 24 ? -8.418  -7.825  -4.756  1.00 10.00 ? 433 SER A HB3  4  
ATOM 3817  H HG   . SER A 1 24 ? -6.774  -9.039  -4.326  1.00 10.00 ? 433 SER A HG   4  
ATOM 3818  N N    . GLU A 1 25 ? -9.128  -4.686  -5.346  1.00 10.00 ? 434 GLU A N    4  
ATOM 3819  C CA   . GLU A 1 25 ? -9.977  -3.533  -5.067  1.00 10.00 ? 434 GLU A CA   4  
ATOM 3820  C C    . GLU A 1 25 ? -10.160 -3.364  -3.564  1.00 10.00 ? 434 GLU A C    4  
ATOM 3821  O O    . GLU A 1 25 ? -10.302 -2.250  -3.062  1.00 10.00 ? 434 GLU A O    4  
ATOM 3822  C CB   . GLU A 1 25 ? -11.338 -3.695  -5.746  1.00 10.00 ? 434 GLU A CB   4  
ATOM 3823  C CG   . GLU A 1 25 ? -12.115 -4.910  -5.268  1.00 10.00 ? 434 GLU A CG   4  
ATOM 3824  C CD   . GLU A 1 25 ? -12.823 -5.631  -6.399  1.00 10.00 ? 434 GLU A CD   4  
ATOM 3825  O OE1  . GLU A 1 25 ? -12.247 -5.712  -7.504  1.00 10.00 ? 434 GLU A OE1  4  
ATOM 3826  O OE2  . GLU A 1 25 ? -13.953 -6.115  -6.179  1.00 10.00 ? 434 GLU A OE2  4  
ATOM 3827  H H    . GLU A 1 25 ? -9.428  -5.355  -5.997  1.00 10.00 ? 434 GLU A H    4  
ATOM 3828  H HA   . GLU A 1 25 ? -9.487  -2.654  -5.461  1.00 10.00 ? 434 GLU A HA   4  
ATOM 3829  H HB2  . GLU A 1 25 ? -11.933 -2.814  -5.551  1.00 10.00 ? 434 GLU A HB2  4  
ATOM 3830  H HB3  . GLU A 1 25 ? -11.187 -3.787  -6.812  1.00 10.00 ? 434 GLU A HB3  4  
ATOM 3831  H HG2  . GLU A 1 25 ? -11.429 -5.598  -4.798  1.00 10.00 ? 434 GLU A HG2  4  
ATOM 3832  H HG3  . GLU A 1 25 ? -12.852 -4.589  -4.547  1.00 10.00 ? 434 GLU A HG3  4  
ATOM 3833  N N    . GLN A 1 26 ? -10.137 -4.487  -2.851  1.00 10.00 ? 435 GLN A N    4  
ATOM 3834  C CA   . GLN A 1 26 ? -10.283 -4.478  -1.404  1.00 10.00 ? 435 GLN A CA   4  
ATOM 3835  C C    . GLN A 1 26 ? -8.936  -4.223  -0.740  1.00 10.00 ? 435 GLN A C    4  
ATOM 3836  O O    . GLN A 1 26 ? -8.865  -3.629  0.336   1.00 10.00 ? 435 GLN A O    4  
ATOM 3837  C CB   . GLN A 1 26 ? -10.864 -5.805  -0.918  1.00 10.00 ? 435 GLN A CB   4  
ATOM 3838  C CG   . GLN A 1 26 ? -11.673 -5.684  0.363   1.00 10.00 ? 435 GLN A CG   4  
ATOM 3839  C CD   . GLN A 1 26 ? -13.156 -5.491  0.102   1.00 10.00 ? 435 GLN A CD   4  
ATOM 3840  O OE1  . GLN A 1 26 ? -13.998 -6.050  0.806   1.00 10.00 ? 435 GLN A OE1  4  
ATOM 3841  N NE2  . GLN A 1 26 ? -13.482 -4.699  -0.913  1.00 10.00 ? 435 GLN A NE2  4  
ATOM 3842  H H    . GLN A 1 26 ? -10.008 -5.342  -3.311  1.00 10.00 ? 435 GLN A H    4  
ATOM 3843  H HA   . GLN A 1 26 ? -10.957 -3.677  -1.140  1.00 10.00 ? 435 GLN A HA   4  
ATOM 3844  H HB2  . GLN A 1 26 ? -11.506 -6.208  -1.688  1.00 10.00 ? 435 GLN A HB2  4  
ATOM 3845  H HB3  . GLN A 1 26 ? -10.053 -6.496  -0.741  1.00 10.00 ? 435 GLN A HB3  4  
ATOM 3846  H HG2  . GLN A 1 26 ? -11.540 -6.582  0.945   1.00 10.00 ? 435 GLN A HG2  4  
ATOM 3847  H HG3  . GLN A 1 26 ? -11.308 -4.835  0.923   1.00 10.00 ? 435 GLN A HG3  4  
ATOM 3848  H HE21 . GLN A 1 26 ? -12.761 -4.288  -1.431  1.00 10.00 ? 435 GLN A HE21 4  
ATOM 3849  H HE22 . GLN A 1 26 ? -14.433 -4.557  -1.100  1.00 10.00 ? 435 GLN A HE22 4  
ATOM 3850  N N    . GLU A 1 27 ? -7.867  -4.667  -1.394  1.00 10.00 ? 436 GLU A N    4  
ATOM 3851  C CA   . GLU A 1 27 ? -6.528  -4.477  -0.879  1.00 10.00 ? 436 GLU A CA   4  
ATOM 3852  C C    . GLU A 1 27 ? -6.125  -3.022  -1.038  1.00 10.00 ? 436 GLU A C    4  
ATOM 3853  O O    . GLU A 1 27 ? -5.705  -2.378  -0.077  1.00 10.00 ? 436 GLU A O    4  
ATOM 3854  C CB   . GLU A 1 27 ? -5.573  -5.427  -1.604  1.00 10.00 ? 436 GLU A CB   4  
ATOM 3855  C CG   . GLU A 1 27 ? -4.895  -6.432  -0.683  1.00 10.00 ? 436 GLU A CG   4  
ATOM 3856  C CD   . GLU A 1 27 ? -5.866  -7.106  0.268   1.00 10.00 ? 436 GLU A CD   4  
ATOM 3857  O OE1  . GLU A 1 27 ? -6.881  -7.655  -0.210  1.00 10.00 ? 436 GLU A OE1  4  
ATOM 3858  O OE2  . GLU A 1 27 ? -5.611  -7.085  1.490   1.00 10.00 ? 436 GLU A OE2  4  
ATOM 3859  H H    . GLU A 1 27 ? -7.978  -5.125  -2.253  1.00 10.00 ? 436 GLU A H    4  
ATOM 3860  H HA   . GLU A 1 27 ? -6.538  -4.707  0.172   1.00 10.00 ? 436 GLU A HA   4  
ATOM 3861  H HB2  . GLU A 1 27 ? -6.134  -5.978  -2.345  1.00 10.00 ? 436 GLU A HB2  4  
ATOM 3862  H HB3  . GLU A 1 27 ? -4.813  -4.850  -2.104  1.00 10.00 ? 436 GLU A HB3  4  
ATOM 3863  H HG2  . GLU A 1 27 ? -4.428  -7.194  -1.287  1.00 10.00 ? 436 GLU A HG2  4  
ATOM 3864  H HG3  . GLU A 1 27 ? -4.141  -5.922  -0.103  1.00 10.00 ? 436 GLU A HG3  4  
ATOM 3865  N N    . LYS A 1 28 ? -6.310  -2.486  -2.239  1.00 10.00 ? 437 LYS A N    4  
ATOM 3866  C CA   . LYS A 1 28 ? -6.021  -1.079  -2.495  1.00 10.00 ? 437 LYS A CA   4  
ATOM 3867  C C    . LYS A 1 28 ? -6.797  -0.224  -1.505  1.00 10.00 ? 437 LYS A C    4  
ATOM 3868  O O    . LYS A 1 28 ? -6.469  0.929   -1.268  1.00 10.00 ? 437 LYS A O    4  
ATOM 3869  C CB   . LYS A 1 28 ? -6.414  -0.705  -3.924  1.00 10.00 ? 437 LYS A CB   4  
ATOM 3870  C CG   . LYS A 1 28 ? -5.838  -1.640  -4.976  1.00 10.00 ? 437 LYS A CG   4  
ATOM 3871  C CD   . LYS A 1 28 ? -5.136  -0.868  -6.081  1.00 10.00 ? 437 LYS A CD   4  
ATOM 3872  C CE   . LYS A 1 28 ? -5.569  -1.344  -7.460  1.00 10.00 ? 437 LYS A CE   4  
ATOM 3873  N NZ   . LYS A 1 28 ? -4.404  -1.587  -8.356  1.00 10.00 ? 437 LYS A NZ   4  
ATOM 3874  H H    . LYS A 1 28 ? -6.686  -3.037  -2.954  1.00 10.00 ? 437 LYS A H    4  
ATOM 3875  H HA   . LYS A 1 28 ? -4.967  -0.901  -2.354  1.00 10.00 ? 437 LYS A HA   4  
ATOM 3876  H HB2  . LYS A 1 28 ? -7.491  -0.726  -4.006  1.00 10.00 ? 437 LYS A HB2  4  
ATOM 3877  H HB3  . LYS A 1 28 ? -6.065  0.296   -4.131  1.00 10.00 ? 437 LYS A HB3  4  
ATOM 3878  H HG2  . LYS A 1 28 ? -5.127  -2.300  -4.504  1.00 10.00 ? 437 LYS A HG2  4  
ATOM 3879  H HG3  . LYS A 1 28 ? -6.642  -2.220  -5.406  1.00 10.00 ? 437 LYS A HG3  4  
ATOM 3880  H HD2  . LYS A 1 28 ? -5.375  0.178   -5.983  1.00 10.00 ? 437 LYS A HD2  4  
ATOM 3881  H HD3  . LYS A 1 28 ? -4.069  -1.005  -5.982  1.00 10.00 ? 437 LYS A HD3  4  
ATOM 3882  H HE2  . LYS A 1 28 ? -6.126  -2.263  -7.352  1.00 10.00 ? 437 LYS A HE2  4  
ATOM 3883  H HE3  . LYS A 1 28 ? -6.202  -0.590  -7.904  1.00 10.00 ? 437 LYS A HE3  4  
ATOM 3884  H HZ1  . LYS A 1 28 ? -3.621  -2.007  -7.817  1.00 10.00 ? 437 LYS A HZ1  4  
ATOM 3885  H HZ2  . LYS A 1 28 ? -4.081  -0.691  -8.773  1.00 10.00 ? 437 LYS A HZ2  4  
ATOM 3886  H HZ3  . LYS A 1 28 ? -4.673  -2.237  -9.122  1.00 10.00 ? 437 LYS A HZ3  4  
ATOM 3887  N N    . GLU A 1 29 ? -7.826  -0.818  -0.918  1.00 10.00 ? 438 GLU A N    4  
ATOM 3888  C CA   . GLU A 1 29 ? -8.647  -0.124  0.055   1.00 10.00 ? 438 GLU A CA   4  
ATOM 3889  C C    . GLU A 1 29 ? -7.817  0.306   1.254   1.00 10.00 ? 438 GLU A C    4  
ATOM 3890  O O    . GLU A 1 29 ? -8.166  1.257   1.948   1.00 10.00 ? 438 GLU A O    4  
ATOM 3891  C CB   . GLU A 1 29 ? -9.791  -1.022  0.516   1.00 10.00 ? 438 GLU A CB   4  
ATOM 3892  C CG   . GLU A 1 29 ? -10.993 -0.257  1.045   1.00 10.00 ? 438 GLU A CG   4  
ATOM 3893  C CD   . GLU A 1 29 ? -10.999 -0.151  2.557   1.00 10.00 ? 438 GLU A CD   4  
ATOM 3894  O OE1  . GLU A 1 29 ? -9.902  -0.115  3.153   1.00 10.00 ? 438 GLU A OE1  4  
ATOM 3895  O OE2  . GLU A 1 29 ? -12.101 -0.105  3.145   1.00 10.00 ? 438 GLU A OE2  4  
ATOM 3896  H H    . GLU A 1 29 ? -8.030  -1.751  -1.138  1.00 10.00 ? 438 GLU A H    4  
ATOM 3897  H HA   . GLU A 1 29 ? -9.053  0.755   -0.420  1.00 10.00 ? 438 GLU A HA   4  
ATOM 3898  H HB2  . GLU A 1 29 ? -10.114 -1.631  -0.316  1.00 10.00 ? 438 GLU A HB2  4  
ATOM 3899  H HB3  . GLU A 1 29 ? -9.427  -1.667  1.303   1.00 10.00 ? 438 GLU A HB3  4  
ATOM 3900  H HG2  . GLU A 1 29 ? -10.981 0.740   0.630   1.00 10.00 ? 438 GLU A HG2  4  
ATOM 3901  H HG3  . GLU A 1 29 ? -11.894 -0.764  0.730   1.00 10.00 ? 438 GLU A HG3  4  
ATOM 3902  N N    . THR A 1 30 ? -6.723  -0.402  1.505   1.00 10.00 ? 439 THR A N    4  
ATOM 3903  C CA   . THR A 1 30 ? -5.866  -0.074  2.638   1.00 10.00 ? 439 THR A CA   4  
ATOM 3904  C C    . THR A 1 30 ? -4.741  0.881   2.240   1.00 10.00 ? 439 THR A C    4  
ATOM 3905  O O    . THR A 1 30 ? -4.519  1.895   2.900   1.00 10.00 ? 439 THR A O    4  
ATOM 3906  C CB   . THR A 1 30 ? -5.295  -1.355  3.250   1.00 10.00 ? 439 THR A CB   4  
ATOM 3907  O OG1  . THR A 1 30 ? -6.333  -2.158  3.785   1.00 10.00 ? 439 THR A OG1  4  
ATOM 3908  C CG2  . THR A 1 30 ? -4.295  -1.105  4.358   1.00 10.00 ? 439 THR A CG2  4  
ATOM 3909  H H    . THR A 1 30 ? -6.491  -1.169  0.928   1.00 10.00 ? 439 THR A H    4  
ATOM 3910  H HA   . THR A 1 30 ? -6.482  0.421   3.373   1.00 10.00 ? 439 THR A HA   4  
ATOM 3911  H HB   . THR A 1 30 ? -4.797  -1.920  2.475   1.00 10.00 ? 439 THR A HB   4  
ATOM 3912  H HG1  . THR A 1 30 ? -6.675  -2.736  3.100   1.00 10.00 ? 439 THR A HG1  4  
ATOM 3913  H HG21 . THR A 1 30 ? -4.703  -1.446  5.297   1.00 10.00 ? 439 THR A HG21 4  
ATOM 3914  H HG22 . THR A 1 30 ? -4.079  -0.048  4.422   1.00 10.00 ? 439 THR A HG22 4  
ATOM 3915  H HG23 . THR A 1 30 ? -3.386  -1.645  4.145   1.00 10.00 ? 439 THR A HG23 4  
ATOM 3916  N N    . PHE A 1 31 ? -4.030  0.555   1.168   1.00 10.00 ? 440 PHE A N    4  
ATOM 3917  C CA   . PHE A 1 31 ? -2.932  1.388   0.701   1.00 10.00 ? 440 PHE A CA   4  
ATOM 3918  C C    . PHE A 1 31 ? -3.458  2.621   -0.023  1.00 10.00 ? 440 PHE A C    4  
ATOM 3919  O O    . PHE A 1 31 ? -2.819  3.673   -0.016  1.00 10.00 ? 440 PHE A O    4  
ATOM 3920  C CB   . PHE A 1 31 ? -2.011  0.591   -0.229  1.00 10.00 ? 440 PHE A CB   4  
ATOM 3921  C CG   . PHE A 1 31 ? -2.446  -0.815  -0.452  1.00 10.00 ? 440 PHE A CG   4  
ATOM 3922  C CD1  . PHE A 1 31 ? -2.319  -1.777  0.534   1.00 10.00 ? 440 PHE A CD1  4  
ATOM 3923  C CD2  . PHE A 1 31 ? -3.000  -1.165  -1.656  1.00 10.00 ? 440 PHE A CD2  4  
ATOM 3924  C CE1  . PHE A 1 31 ? -2.740  -3.066  0.302   1.00 10.00 ? 440 PHE A CE1  4  
ATOM 3925  C CE2  . PHE A 1 31 ? -3.422  -2.445  -1.891  1.00 10.00 ? 440 PHE A CE2  4  
ATOM 3926  C CZ   . PHE A 1 31 ? -3.290  -3.390  -0.918  1.00 10.00 ? 440 PHE A CZ   4  
ATOM 3927  H H    . PHE A 1 31 ? -4.245  -0.263  0.680   1.00 10.00 ? 440 PHE A H    4  
ATOM 3928  H HA   . PHE A 1 31 ? -2.368  1.705   1.565   1.00 10.00 ? 440 PHE A HA   4  
ATOM 3929  H HB2  . PHE A 1 31 ? -1.991  1.068   -1.195  1.00 10.00 ? 440 PHE A HB2  4  
ATOM 3930  H HB3  . PHE A 1 31 ? -1.015  0.571   0.183   1.00 10.00 ? 440 PHE A HB3  4  
ATOM 3931  H HD1  . PHE A 1 31 ? -1.894  -1.512  1.488   1.00 10.00 ? 440 PHE A HD1  4  
ATOM 3932  H HD2  . PHE A 1 31 ? -3.102  -0.423  -2.423  1.00 10.00 ? 440 PHE A HD2  4  
ATOM 3933  H HE1  . PHE A 1 31 ? -2.637  -3.818  1.071   1.00 10.00 ? 440 PHE A HE1  4  
ATOM 3934  H HE2  . PHE A 1 31 ? -3.862  -2.705  -2.843  1.00 10.00 ? 440 PHE A HE2  4  
ATOM 3935  H HZ   . PHE A 1 31 ? -3.626  -4.375  -1.110  1.00 10.00 ? 440 PHE A HZ   4  
ATOM 3936  N N    . ARG A 1 32 ? -4.629  2.492   -0.645  1.00 10.00 ? 441 ARG A N    4  
ATOM 3937  C CA   . ARG A 1 32 ? -5.224  3.609   -1.362  1.00 10.00 ? 441 ARG A CA   4  
ATOM 3938  C C    . ARG A 1 32 ? -5.999  4.512   -0.405  1.00 10.00 ? 441 ARG A C    4  
ATOM 3939  O O    . ARG A 1 32 ? -6.221  5.688   -0.696  1.00 10.00 ? 441 ARG A O    4  
ATOM 3940  C CB   . ARG A 1 32 ? -6.148  3.120   -2.480  1.00 10.00 ? 441 ARG A CB   4  
ATOM 3941  C CG   . ARG A 1 32 ? -6.340  4.134   -3.596  1.00 10.00 ? 441 ARG A CG   4  
ATOM 3942  C CD   . ARG A 1 32 ? -7.625  4.927   -3.415  1.00 10.00 ? 441 ARG A CD   4  
ATOM 3943  N NE   . ARG A 1 32 ? -8.808  4.070   -3.462  1.00 10.00 ? 441 ARG A NE   4  
ATOM 3944  C CZ   . ARG A 1 32 ? -9.310  3.563   -4.586  1.00 10.00 ? 441 ARG A CZ   4  
ATOM 3945  N NH1  . ARG A 1 32 ? -8.737  3.823   -5.754  1.00 10.00 ? 441 ARG A NH1  4  
ATOM 3946  N NH2  . ARG A 1 32 ? -10.389 2.793   -4.541  1.00 10.00 ? 441 ARG A NH2  4  
ATOM 3947  H H    . ARG A 1 32 ? -5.102  1.631   -0.615  1.00 10.00 ? 441 ARG A H    4  
ATOM 3948  H HA   . ARG A 1 32 ? -4.419  4.175   -1.804  1.00 10.00 ? 441 ARG A HA   4  
ATOM 3949  H HB2  . ARG A 1 32 ? -5.731  2.221   -2.908  1.00 10.00 ? 441 ARG A HB2  4  
ATOM 3950  H HB3  . ARG A 1 32 ? -7.116  2.894   -2.059  1.00 10.00 ? 441 ARG A HB3  4  
ATOM 3951  H HG2  . ARG A 1 32 ? -5.505  4.818   -3.596  1.00 10.00 ? 441 ARG A HG2  4  
ATOM 3952  H HG3  . ARG A 1 32 ? -6.380  3.611   -4.541  1.00 10.00 ? 441 ARG A HG3  4  
ATOM 3953  H HD2  . ARG A 1 32 ? -7.592  5.426   -2.457  1.00 10.00 ? 441 ARG A HD2  4  
ATOM 3954  H HD3  . ARG A 1 32 ? -7.693  5.663   -4.201  1.00 10.00 ? 441 ARG A HD3  4  
ATOM 3955  H HE   . ARG A 1 32 ? -9.251  3.863   -2.613  1.00 10.00 ? 441 ARG A HE   4  
ATOM 3956  H HH11 . ARG A 1 32 ? -7.923  4.402   -5.796  1.00 10.00 ? 441 ARG A HH11 4  
ATOM 3957  H HH12 . ARG A 1 32 ? -9.119  3.438   -6.594  1.00 10.00 ? 441 ARG A HH12 4  
ATOM 3958  H HH21 . ARG A 1 32 ? -10.825 2.594   -3.663  1.00 10.00 ? 441 ARG A HH21 4  
ATOM 3959  H HH22 . ARG A 1 32 ? -10.766 2.411   -5.385  1.00 10.00 ? 441 ARG A HH22 4  
ATOM 3960  N N    . GLU A 1 33 ? -6.406  3.962   0.742   1.00 10.00 ? 442 GLU A N    4  
ATOM 3961  C CA   . GLU A 1 33 ? -7.150  4.738   1.726   1.00 10.00 ? 442 GLU A CA   4  
ATOM 3962  C C    . GLU A 1 33 ? -6.202  5.468   2.666   1.00 10.00 ? 442 GLU A C    4  
ATOM 3963  O O    . GLU A 1 33 ? -6.498  6.574   3.117   1.00 10.00 ? 442 GLU A O    4  
ATOM 3964  C CB   . GLU A 1 33 ? -8.090  3.840   2.530   1.00 10.00 ? 442 GLU A CB   4  
ATOM 3965  C CG   . GLU A 1 33 ? -8.906  4.590   3.572   1.00 10.00 ? 442 GLU A CG   4  
ATOM 3966  C CD   . GLU A 1 33 ? -10.080 3.781   4.086   1.00 10.00 ? 442 GLU A CD   4  
ATOM 3967  O OE1  . GLU A 1 33 ? -10.923 3.368   3.263   1.00 10.00 ? 442 GLU A OE1  4  
ATOM 3968  O OE2  . GLU A 1 33 ? -10.156 3.560   5.313   1.00 10.00 ? 442 GLU A OE2  4  
ATOM 3969  H H    . GLU A 1 33 ? -6.200  3.018   0.931   1.00 10.00 ? 442 GLU A H    4  
ATOM 3970  H HA   . GLU A 1 33 ? -7.737  5.469   1.192   1.00 10.00 ? 442 GLU A HA   4  
ATOM 3971  H HB2  . GLU A 1 33 ? -8.776  3.358   1.850   1.00 10.00 ? 442 GLU A HB2  4  
ATOM 3972  H HB3  . GLU A 1 33 ? -7.506  3.087   3.037   1.00 10.00 ? 442 GLU A HB3  4  
ATOM 3973  H HG2  . GLU A 1 33 ? -8.264  4.834   4.406   1.00 10.00 ? 442 GLU A HG2  4  
ATOM 3974  H HG3  . GLU A 1 33 ? -9.281  5.501   3.129   1.00 10.00 ? 442 GLU A HG3  4  
ATOM 3975  N N    . LYS A 1 34 ? -5.057  4.855   2.952   1.00 10.00 ? 443 LYS A N    4  
ATOM 3976  C CA   . LYS A 1 34 ? -4.079  5.470   3.828   1.00 10.00 ? 443 LYS A CA   4  
ATOM 3977  C C    . LYS A 1 34 ? -3.351  6.577   3.085   1.00 10.00 ? 443 LYS A C    4  
ATOM 3978  O O    . LYS A 1 34 ? -3.154  7.666   3.614   1.00 10.00 ? 443 LYS A O    4  
ATOM 3979  C CB   . LYS A 1 34 ? -3.082  4.431   4.341   1.00 10.00 ? 443 LYS A CB   4  
ATOM 3980  C CG   . LYS A 1 34 ? -3.488  3.793   5.662   1.00 10.00 ? 443 LYS A CG   4  
ATOM 3981  C CD   . LYS A 1 34 ? -4.902  3.233   5.605   1.00 10.00 ? 443 LYS A CD   4  
ATOM 3982  C CE   . LYS A 1 34 ? -4.975  1.842   6.214   1.00 10.00 ? 443 LYS A CE   4  
ATOM 3983  N NZ   . LYS A 1 34 ? -5.320  1.887   7.662   1.00 10.00 ? 443 LYS A NZ   4  
ATOM 3984  H H    . LYS A 1 34 ? -4.862  3.980   2.558   1.00 10.00 ? 443 LYS A H    4  
ATOM 3985  H HA   . LYS A 1 34 ? -4.606  5.900   4.667   1.00 10.00 ? 443 LYS A HA   4  
ATOM 3986  H HB2  . LYS A 1 34 ? -2.982  3.648   3.604   1.00 10.00 ? 443 LYS A HB2  4  
ATOM 3987  H HB3  . LYS A 1 34 ? -2.124  4.909   4.478   1.00 10.00 ? 443 LYS A HB3  4  
ATOM 3988  H HG2  . LYS A 1 34 ? -2.802  2.991   5.888   1.00 10.00 ? 443 LYS A HG2  4  
ATOM 3989  H HG3  . LYS A 1 34 ? -3.438  4.541   6.440   1.00 10.00 ? 443 LYS A HG3  4  
ATOM 3990  H HD2  . LYS A 1 34 ? -5.561  3.890   6.154   1.00 10.00 ? 443 LYS A HD2  4  
ATOM 3991  H HD3  . LYS A 1 34 ? -5.218  3.182   4.574   1.00 10.00 ? 443 LYS A HD3  4  
ATOM 3992  H HE2  . LYS A 1 34 ? -5.730  1.273   5.692   1.00 10.00 ? 443 LYS A HE2  4  
ATOM 3993  H HE3  . LYS A 1 34 ? -4.016  1.360   6.096   1.00 10.00 ? 443 LYS A HE3  4  
ATOM 3994  H HZ1  . LYS A 1 34 ? -6.071  2.587   7.829   1.00 10.00 ? 443 LYS A HZ1  4  
ATOM 3995  H HZ2  . LYS A 1 34 ? -4.484  2.151   8.221   1.00 10.00 ? 443 LYS A HZ2  4  
ATOM 3996  H HZ3  . LYS A 1 34 ? -5.654  0.953   7.979   1.00 10.00 ? 443 LYS A HZ3  4  
ATOM 3997  N N    . PHE A 1 35 ? -2.979  6.305   1.838   1.00 10.00 ? 444 PHE A N    4  
ATOM 3998  C CA   . PHE A 1 35 ? -2.301  7.294   1.024   1.00 10.00 ? 444 PHE A CA   4  
ATOM 3999  C C    . PHE A 1 35 ? -3.245  8.456   0.788   1.00 10.00 ? 444 PHE A C    4  
ATOM 4000  O O    . PHE A 1 35 ? -2.825  9.608   0.688   1.00 10.00 ? 444 PHE A O    4  
ATOM 4001  C CB   . PHE A 1 35 ? -1.824  6.673   -0.289  1.00 10.00 ? 444 PHE A CB   4  
ATOM 4002  C CG   . PHE A 1 35 ? -1.012  7.605   -1.140  1.00 10.00 ? 444 PHE A CG   4  
ATOM 4003  C CD1  . PHE A 1 35 ? -1.592  8.721   -1.720  1.00 10.00 ? 444 PHE A CD1  4  
ATOM 4004  C CD2  . PHE A 1 35 ? 0.335   7.363   -1.360  1.00 10.00 ? 444 PHE A CD2  4  
ATOM 4005  C CE1  . PHE A 1 35 ? -0.845  9.580   -2.502  1.00 10.00 ? 444 PHE A CE1  4  
ATOM 4006  C CE2  . PHE A 1 35 ? 1.087   8.218   -2.141  1.00 10.00 ? 444 PHE A CE2  4  
ATOM 4007  C CZ   . PHE A 1 35 ? 0.498   9.329   -2.713  1.00 10.00 ? 444 PHE A CZ   4  
ATOM 4008  H H    . PHE A 1 35 ? -3.188  5.434   1.453   1.00 10.00 ? 444 PHE A H    4  
ATOM 4009  H HA   . PHE A 1 35 ? -1.447  7.653   1.579   1.00 10.00 ? 444 PHE A HA   4  
ATOM 4010  H HB2  . PHE A 1 35 ? -1.206  5.814   -0.059  1.00 10.00 ? 444 PHE A HB2  4  
ATOM 4011  H HB3  . PHE A 1 35 ? -2.682  6.352   -0.862  1.00 10.00 ? 444 PHE A HB3  4  
ATOM 4012  H HD1  . PHE A 1 35 ? -2.641  8.919   -1.557  1.00 10.00 ? 444 PHE A HD1  4  
ATOM 4013  H HD2  . PHE A 1 35 ? 0.798   6.491   -0.913  1.00 10.00 ? 444 PHE A HD2  4  
ATOM 4014  H HE1  . PHE A 1 35 ? -1.308  10.448  -2.948  1.00 10.00 ? 444 PHE A HE1  4  
ATOM 4015  H HE2  . PHE A 1 35 ? 2.135   8.020   -2.304  1.00 10.00 ? 444 PHE A HE2  4  
ATOM 4016  H HZ   . PHE A 1 35 ? 1.084   9.998   -3.324  1.00 10.00 ? 444 PHE A HZ   4  
ATOM 4017  N N    . MET A 1 36 ? -4.536  8.145   0.771   1.00 10.00 ? 445 MET A N    4  
ATOM 4018  C CA   . MET A 1 36 ? -5.550  9.165   0.628   1.00 10.00 ? 445 MET A CA   4  
ATOM 4019  C C    . MET A 1 36 ? -5.695  9.871   1.972   1.00 10.00 ? 445 MET A C    4  
ATOM 4020  O O    . MET A 1 36 ? -5.978  11.067  2.046   1.00 10.00 ? 445 MET A O    4  
ATOM 4021  C CB   . MET A 1 36 ? -6.885  8.555   0.193   1.00 10.00 ? 445 MET A CB   4  
ATOM 4022  C CG   . MET A 1 36 ? -7.059  8.484   -1.315  1.00 10.00 ? 445 MET A CG   4  
ATOM 4023  S SD   . MET A 1 36 ? -7.790  9.982   -2.002  1.00 10.00 ? 445 MET A SD   4  
ATOM 4024  C CE   . MET A 1 36 ? -7.608  9.675   -3.757  1.00 10.00 ? 445 MET A CE   4  
ATOM 4025  H H    . MET A 1 36 ? -4.810  7.214   0.904   1.00 10.00 ? 445 MET A H    4  
ATOM 4026  H HA   . MET A 1 36 ? -5.210  9.866   -0.112  1.00 10.00 ? 445 MET A HA   4  
ATOM 4027  H HB2  . MET A 1 36 ? -6.955  7.553   0.590   1.00 10.00 ? 445 MET A HB2  4  
ATOM 4028  H HB3  . MET A 1 36 ? -7.689  9.151   0.598   1.00 10.00 ? 445 MET A HB3  4  
ATOM 4029  H HG2  . MET A 1 36 ? -6.089  8.333   -1.769  1.00 10.00 ? 445 MET A HG2  4  
ATOM 4030  H HG3  . MET A 1 36 ? -7.698  7.646   -1.551  1.00 10.00 ? 445 MET A HG3  4  
ATOM 4031  H HE1  . MET A 1 36 ? -8.436  10.119  -4.288  1.00 10.00 ? 445 MET A HE1  4  
ATOM 4032  H HE2  . MET A 1 36 ? -7.593  8.610   -3.936  1.00 10.00 ? 445 MET A HE2  4  
ATOM 4033  H HE3  . MET A 1 36 ? -6.682  10.111  -4.104  1.00 10.00 ? 445 MET A HE3  4  
ATOM 4034  N N    . GLN A 1 37 ? -5.454  9.098   3.033   1.00 10.00 ? 446 GLN A N    4  
ATOM 4035  C CA   . GLN A 1 37 ? -5.503  9.591   4.401   1.00 10.00 ? 446 GLN A CA   4  
ATOM 4036  C C    . GLN A 1 37 ? -4.319  10.508  4.656   1.00 10.00 ? 446 GLN A C    4  
ATOM 4037  O O    . GLN A 1 37 ? -4.419  11.510  5.363   1.00 10.00 ? 446 GLN A O    4  
ATOM 4038  C CB   . GLN A 1 37 ? -5.429  8.409   5.373   1.00 10.00 ? 446 GLN A CB   4  
ATOM 4039  C CG   . GLN A 1 37 ? -5.867  8.752   6.787   1.00 10.00 ? 446 GLN A CG   4  
ATOM 4040  C CD   . GLN A 1 37 ? -6.561  7.592   7.477   1.00 10.00 ? 446 GLN A CD   4  
ATOM 4041  O OE1  . GLN A 1 37 ? -6.201  7.212   8.591   1.00 10.00 ? 446 GLN A OE1  4  
ATOM 4042  N NE2  . GLN A 1 37 ? -7.563  7.024   6.815   1.00 10.00 ? 446 GLN A NE2  4  
ATOM 4043  H H    . GLN A 1 37 ? -5.213  8.161   2.885   1.00 10.00 ? 446 GLN A H    4  
ATOM 4044  H HA   . GLN A 1 37 ? -6.424  10.130  4.548   1.00 10.00 ? 446 GLN A HA   4  
ATOM 4045  H HB2  . GLN A 1 37 ? -6.064  7.616   5.006   1.00 10.00 ? 446 GLN A HB2  4  
ATOM 4046  H HB3  . GLN A 1 37 ? -4.401  8.048   5.411   1.00 10.00 ? 446 GLN A HB3  4  
ATOM 4047  H HG2  . GLN A 1 37 ? -4.996  9.024   7.365   1.00 10.00 ? 446 GLN A HG2  4  
ATOM 4048  H HG3  . GLN A 1 37 ? -6.549  9.588   6.748   1.00 10.00 ? 446 GLN A HG3  4  
ATOM 4049  H HE21 . GLN A 1 37 ? -7.795  7.380   5.933   1.00 10.00 ? 446 GLN A HE21 4  
ATOM 4050  H HE22 . GLN A 1 37 ? -8.028  6.271   7.236   1.00 10.00 ? 446 GLN A HE22 4  
ATOM 4051  N N    . HIS A 1 38 ? -3.192  10.125  4.077   1.00 10.00 ? 447 HIS A N    4  
ATOM 4052  C CA   . HIS A 1 38 ? -1.949  10.857  4.220   1.00 10.00 ? 447 HIS A CA   4  
ATOM 4053  C C    . HIS A 1 38 ? -1.586  11.553  2.906   1.00 10.00 ? 447 HIS A C    4  
ATOM 4054  O O    . HIS A 1 38 ? -0.998  10.943  2.013   1.00 10.00 ? 447 HIS A O    4  
ATOM 4055  C CB   . HIS A 1 38 ? -0.854  9.877   4.650   1.00 10.00 ? 447 HIS A CB   4  
ATOM 4056  C CG   . HIS A 1 38 ? -1.293  8.983   5.775   1.00 10.00 ? 447 HIS A CG   4  
ATOM 4057  N ND1  . HIS A 1 38 ? -1.465  9.440   7.062   1.00 10.00 ? 447 HIS A ND1  4  
ATOM 4058  C CD2  . HIS A 1 38 ? -1.635  7.663   5.800   1.00 10.00 ? 447 HIS A CD2  4  
ATOM 4059  C CE1  . HIS A 1 38 ? -1.891  8.453   7.828   1.00 10.00 ? 447 HIS A CE1  4  
ATOM 4060  N NE2  . HIS A 1 38 ? -2.004  7.366   7.088   1.00 10.00 ? 447 HIS A NE2  4  
ATOM 4061  H H    . HIS A 1 38 ? -3.194  9.305   3.540   1.00 10.00 ? 447 HIS A H    4  
ATOM 4062  H HA   . HIS A 1 38 ? -2.083  11.597  4.992   1.00 10.00 ? 447 HIS A HA   4  
ATOM 4063  H HB2  . HIS A 1 38 ? -0.588  9.253   3.811   1.00 10.00 ? 447 HIS A HB2  4  
ATOM 4064  H HB3  . HIS A 1 38 ? 0.013   10.430  4.978   1.00 10.00 ? 447 HIS A HB3  4  
ATOM 4065  H HD1  . HIS A 1 38 ? -1.298  10.355  7.371   1.00 10.00 ? 447 HIS A HD1  4  
ATOM 4066  H HD2  . HIS A 1 38 ? -1.622  6.971   4.961   1.00 10.00 ? 447 HIS A HD2  4  
ATOM 4067  H HE1  . HIS A 1 38 ? -2.102  8.520   8.885   1.00 10.00 ? 447 HIS A HE1  4  
ATOM 4068  H HE2  . HIS A 1 38 ? -2.469  6.550   7.365   1.00 10.00 ? 447 HIS A HE2  4  
ATOM 4069  N N    . PRO A 1 39 ? -1.954  12.843  2.764   1.00 10.00 ? 448 PRO A N    4  
ATOM 4070  C CA   . PRO A 1 39 ? -1.690  13.625  1.553   1.00 10.00 ? 448 PRO A CA   4  
ATOM 4071  C C    . PRO A 1 39 ? -0.288  13.411  0.992   1.00 10.00 ? 448 PRO A C    4  
ATOM 4072  O O    . PRO A 1 39 ? 0.681   13.999  1.471   1.00 10.00 ? 448 PRO A O    4  
ATOM 4073  C CB   . PRO A 1 39 ? -1.873  15.085  2.005   1.00 10.00 ? 448 PRO A CB   4  
ATOM 4074  C CG   . PRO A 1 39 ? -2.179  15.034  3.470   1.00 10.00 ? 448 PRO A CG   4  
ATOM 4075  C CD   . PRO A 1 39 ? -2.672  13.646  3.759   1.00 10.00 ? 448 PRO A CD   4  
ATOM 4076  H HA   . PRO A 1 39 ? -2.414  13.400  0.782   1.00 10.00 ? 448 PRO A HA   4  
ATOM 4077  H HB2  . PRO A 1 39 ? -0.962  15.635  1.817   1.00 10.00 ? 448 PRO A HB2  4  
ATOM 4078  H HB3  . PRO A 1 39 ? -2.685  15.532  1.452   1.00 10.00 ? 448 PRO A HB3  4  
ATOM 4079  H HG2  . PRO A 1 39 ? -1.283  15.237  4.038   1.00 10.00 ? 448 PRO A HG2  4  
ATOM 4080  H HG3  . PRO A 1 39 ? -2.944  15.759  3.708   1.00 10.00 ? 448 PRO A HG3  4  
ATOM 4081  H HD2  . PRO A 1 39 ? -2.406  13.354  4.763   1.00 10.00 ? 448 PRO A HD2  4  
ATOM 4082  H HD3  . PRO A 1 39 ? -3.740  13.582  3.612   1.00 10.00 ? 448 PRO A HD3  4  
ATOM 4083  N N    . LYS A 1 40 ? -0.198  12.573  -0.041  1.00 10.00 ? 449 LYS A N    4  
ATOM 4084  C CA   . LYS A 1 40 ? 1.075   12.277  -0.698  1.00 10.00 ? 449 LYS A CA   4  
ATOM 4085  C C    . LYS A 1 40 ? 2.201   12.070  0.312   1.00 10.00 ? 449 LYS A C    4  
ATOM 4086  O O    . LYS A 1 40 ? 2.829   13.028  0.761   1.00 10.00 ? 449 LYS A O    4  
ATOM 4087  C CB   . LYS A 1 40 ? 1.445   13.406  -1.661  1.00 10.00 ? 449 LYS A CB   4  
ATOM 4088  C CG   . LYS A 1 40 ? 0.836   13.251  -3.044  1.00 10.00 ? 449 LYS A CG   4  
ATOM 4089  C CD   . LYS A 1 40 ? 1.148   14.446  -3.928  1.00 10.00 ? 449 LYS A CD   4  
ATOM 4090  C CE   . LYS A 1 40 ? 2.597   14.436  -4.388  1.00 10.00 ? 449 LYS A CE   4  
ATOM 4091  N NZ   . LYS A 1 40 ? 3.109   15.811  -4.643  1.00 10.00 ? 449 LYS A NZ   4  
ATOM 4092  H H    . LYS A 1 40 ? -1.014  12.148  -0.378  1.00 10.00 ? 449 LYS A H    4  
ATOM 4093  H HA   . LYS A 1 40 ? 0.948   11.367  -1.263  1.00 10.00 ? 449 LYS A HA   4  
ATOM 4094  H HB2  . LYS A 1 40 ? 1.106   14.344  -1.245  1.00 10.00 ? 449 LYS A HB2  4  
ATOM 4095  H HB3  . LYS A 1 40 ? 2.520   13.436  -1.766  1.00 10.00 ? 449 LYS A HB3  4  
ATOM 4096  H HG2  . LYS A 1 40 ? 1.236   12.361  -3.505  1.00 10.00 ? 449 LYS A HG2  4  
ATOM 4097  H HG3  . LYS A 1 40 ? -0.236  13.157  -2.946  1.00 10.00 ? 449 LYS A HG3  4  
ATOM 4098  H HD2  . LYS A 1 40 ? 0.505   14.419  -4.796  1.00 10.00 ? 449 LYS A HD2  4  
ATOM 4099  H HD3  . LYS A 1 40 ? 0.963   15.353  -3.370  1.00 10.00 ? 449 LYS A HD3  4  
ATOM 4100  H HE2  . LYS A 1 40 ? 3.201   13.973  -3.623  1.00 10.00 ? 449 LYS A HE2  4  
ATOM 4101  H HE3  . LYS A 1 40 ? 2.667   13.860  -5.300  1.00 10.00 ? 449 LYS A HE3  4  
ATOM 4102  H HZ1  . LYS A 1 40 ? 3.908   15.777  -5.307  1.00 10.00 ? 449 LYS A HZ1  4  
ATOM 4103  H HZ2  . LYS A 1 40 ? 3.430   16.243  -3.754  1.00 10.00 ? 449 LYS A HZ2  4  
ATOM 4104  H HZ3  . LYS A 1 40 ? 2.358   16.403  -5.051  1.00 10.00 ? 449 LYS A HZ3  4  
ATOM 4105  N N    . ASN A 1 41 ? 2.459   10.813  0.656   1.00 10.00 ? 450 ASN A N    4  
ATOM 4106  C CA   . ASN A 1 41 ? 3.515   10.490  1.604   1.00 10.00 ? 450 ASN A CA   4  
ATOM 4107  C C    . ASN A 1 41 ? 4.213   9.191   1.224   1.00 10.00 ? 450 ASN A C    4  
ATOM 4108  O O    . ASN A 1 41 ? 5.433   9.150   1.067   1.00 10.00 ? 450 ASN A O    4  
ATOM 4109  C CB   . ASN A 1 41 ? 2.953   10.382  3.028   1.00 10.00 ? 450 ASN A CB   4  
ATOM 4110  C CG   . ASN A 1 41 ? 1.767   9.440   3.116   1.00 10.00 ? 450 ASN A CG   4  
ATOM 4111  O OD1  . ASN A 1 41 ? 0.926   9.403   2.217   1.00 10.00 ? 450 ASN A OD1  4  
ATOM 4112  N ND2  . ASN A 1 41 ? 1.692   8.667   4.198   1.00 10.00 ? 450 ASN A ND2  4  
ATOM 4113  H H    . ASN A 1 41 ? 1.930   10.089  0.260   1.00 10.00 ? 450 ASN A H    4  
ATOM 4114  H HA   . ASN A 1 41 ? 4.237   11.286  1.575   1.00 10.00 ? 450 ASN A HA   4  
ATOM 4115  H HB2  . ASN A 1 41 ? 3.727   10.018  3.687   1.00 10.00 ? 450 ASN A HB2  4  
ATOM 4116  H HB3  . ASN A 1 41 ? 2.637   11.362  3.358   1.00 10.00 ? 450 ASN A HB3  4  
ATOM 4117  H HD21 . ASN A 1 41 ? 2.397   8.743   4.876   1.00 10.00 ? 450 ASN A HD21 4  
ATOM 4118  H HD22 . ASN A 1 41 ? 0.933   8.052   4.273   1.00 10.00 ? 450 ASN A HD22 4  
ATOM 4119  N N    . PHE A 1 42 ? 3.431   8.126   1.095   1.00 10.00 ? 451 PHE A N    4  
ATOM 4120  C CA   . PHE A 1 42 ? 3.965   6.815   0.753   1.00 10.00 ? 451 PHE A CA   4  
ATOM 4121  C C    . PHE A 1 42 ? 4.918   6.309   1.840   1.00 10.00 ? 451 PHE A C    4  
ATOM 4122  O O    . PHE A 1 42 ? 5.488   5.225   1.719   1.00 10.00 ? 451 PHE A O    4  
ATOM 4123  C CB   . PHE A 1 42 ? 4.684   6.857   -0.600  1.00 10.00 ? 451 PHE A CB   4  
ATOM 4124  C CG   . PHE A 1 42 ? 3.876   6.319   -1.755  1.00 10.00 ? 451 PHE A CG   4  
ATOM 4125  C CD1  . PHE A 1 42 ? 2.883   5.369   -1.557  1.00 10.00 ? 451 PHE A CD1  4  
ATOM 4126  C CD2  . PHE A 1 42 ? 4.114   6.768   -3.045  1.00 10.00 ? 451 PHE A CD2  4  
ATOM 4127  C CE1  . PHE A 1 42 ? 2.147   4.883   -2.618  1.00 10.00 ? 451 PHE A CE1  4  
ATOM 4128  C CE2  . PHE A 1 42 ? 3.381   6.281   -4.110  1.00 10.00 ? 451 PHE A CE2  4  
ATOM 4129  C CZ   . PHE A 1 42 ? 2.397   5.338   -3.896  1.00 10.00 ? 451 PHE A CZ   4  
ATOM 4130  H H    . PHE A 1 42 ? 2.470   8.222   1.243   1.00 10.00 ? 451 PHE A H    4  
ATOM 4131  H HA   . PHE A 1 42 ? 3.133   6.135   0.690   1.00 10.00 ? 451 PHE A HA   4  
ATOM 4132  H HB2  . PHE A 1 42 ? 4.939   7.880   -0.829  1.00 10.00 ? 451 PHE A HB2  4  
ATOM 4133  H HB3  . PHE A 1 42 ? 5.590   6.274   -0.533  1.00 10.00 ? 451 PHE A HB3  4  
ATOM 4134  H HD1  . PHE A 1 42 ? 2.686   5.006   -0.560  1.00 10.00 ? 451 PHE A HD1  4  
ATOM 4135  H HD2  . PHE A 1 42 ? 4.883   7.507   -3.216  1.00 10.00 ? 451 PHE A HD2  4  
ATOM 4136  H HE1  . PHE A 1 42 ? 1.376   4.147   -2.446  1.00 10.00 ? 451 PHE A HE1  4  
ATOM 4137  H HE2  . PHE A 1 42 ? 3.576   6.641   -5.109  1.00 10.00 ? 451 PHE A HE2  4  
ATOM 4138  H HZ   . PHE A 1 42 ? 1.824   4.956   -4.728  1.00 10.00 ? 451 PHE A HZ   4  
ATOM 4139  N N    . GLY A 1 43 ? 5.075   7.090   2.909   1.00 10.00 ? 452 GLY A N    4  
ATOM 4140  C CA   . GLY A 1 43 ? 5.940   6.693   3.998   1.00 10.00 ? 452 GLY A CA   4  
ATOM 4141  C C    . GLY A 1 43 ? 5.182   5.901   5.037   1.00 10.00 ? 452 GLY A C    4  
ATOM 4142  O O    . GLY A 1 43 ? 5.681   4.903   5.554   1.00 10.00 ? 452 GLY A O    4  
ATOM 4143  H H    . GLY A 1 43 ? 4.591   7.932   2.965   1.00 10.00 ? 452 GLY A H    4  
ATOM 4144  H HA2  . GLY A 1 43 ? 6.745   6.086   3.608   1.00 10.00 ? 452 GLY A HA2  4  
ATOM 4145  H HA3  . GLY A 1 43 ? 6.355   7.575   4.461   1.00 10.00 ? 452 GLY A HA3  4  
ATOM 4146  N N    . LEU A 1 44 ? 3.960   6.339   5.329   1.00 10.00 ? 453 LEU A N    4  
ATOM 4147  C CA   . LEU A 1 44 ? 3.122   5.651   6.298   1.00 10.00 ? 453 LEU A CA   4  
ATOM 4148  C C    . LEU A 1 44 ? 2.613   4.349   5.706   1.00 10.00 ? 453 LEU A C    4  
ATOM 4149  O O    . LEU A 1 44 ? 2.705   3.292   6.329   1.00 10.00 ? 453 LEU A O    4  
ATOM 4150  C CB   . LEU A 1 44 ? 1.938   6.519   6.723   1.00 10.00 ? 453 LEU A CB   4  
ATOM 4151  C CG   . LEU A 1 44 ? 0.936   5.809   7.631   1.00 10.00 ? 453 LEU A CG   4  
ATOM 4152  C CD1  . LEU A 1 44 ? 0.349   6.774   8.645   1.00 10.00 ? 453 LEU A CD1  4  
ATOM 4153  C CD2  . LEU A 1 44 ? -0.161  5.147   6.804   1.00 10.00 ? 453 LEU A CD2  4  
ATOM 4154  H H    . LEU A 1 44 ? 3.613   7.134   4.872   1.00 10.00 ? 453 LEU A H    4  
ATOM 4155  H HA   . LEU A 1 44 ? 3.726   5.428   7.160   1.00 10.00 ? 453 LEU A HA   4  
ATOM 4156  H HB2  . LEU A 1 44 ? 2.320   7.385   7.242   1.00 10.00 ? 453 LEU A HB2  4  
ATOM 4157  H HB3  . LEU A 1 44 ? 1.420   6.848   5.836   1.00 10.00 ? 453 LEU A HB3  4  
ATOM 4158  H HG   . LEU A 1 44 ? 1.452   5.037   8.176   1.00 10.00 ? 453 LEU A HG   4  
ATOM 4159  H HD11 . LEU A 1 44 ? -0.688  6.530   8.817   1.00 10.00 ? 453 LEU A HD11 4  
ATOM 4160  H HD12 . LEU A 1 44 ? 0.427   7.783   8.269   1.00 10.00 ? 453 LEU A HD12 4  
ATOM 4161  H HD13 . LEU A 1 44 ? 0.895   6.695   9.574   1.00 10.00 ? 453 LEU A HD13 4  
ATOM 4162  H HD21 . LEU A 1 44 ? -0.246  5.645   5.851   1.00 10.00 ? 453 LEU A HD21 4  
ATOM 4163  H HD22 . LEU A 1 44 ? -1.100  5.214   7.331   1.00 10.00 ? 453 LEU A HD22 4  
ATOM 4164  H HD23 . LEU A 1 44 ? 0.085   4.106   6.644   1.00 10.00 ? 453 LEU A HD23 4  
ATOM 4165  N N    . ILE A 1 45 ? 2.090   4.429   4.489   1.00 10.00 ? 454 ILE A N    4  
ATOM 4166  C CA   . ILE A 1 45 ? 1.588   3.251   3.811   1.00 10.00 ? 454 ILE A CA   4  
ATOM 4167  C C    . ILE A 1 45 ? 2.708   2.245   3.651   1.00 10.00 ? 454 ILE A C    4  
ATOM 4168  O O    . ILE A 1 45 ? 2.643   1.138   4.179   1.00 10.00 ? 454 ILE A O    4  
ATOM 4169  C CB   . ILE A 1 45 ? 0.981   3.621   2.447   1.00 10.00 ? 454 ILE A CB   4  
ATOM 4170  C CG1  . ILE A 1 45 ? -0.381  4.243   2.678   1.00 10.00 ? 454 ILE A CG1  4  
ATOM 4171  C CG2  . ILE A 1 45 ? 0.878   2.410   1.527   1.00 10.00 ? 454 ILE A CG2  4  
ATOM 4172  C CD1  . ILE A 1 45 ? -0.327  5.751   2.684   1.00 10.00 ? 454 ILE A CD1  4  
ATOM 4173  H H    . ILE A 1 45 ? 2.053   5.297   4.034   1.00 10.00 ? 454 ILE A H    4  
ATOM 4174  H HA   . ILE A 1 45 ? 0.815   2.823   4.420   1.00 10.00 ? 454 ILE A HA   4  
ATOM 4175  H HB   . ILE A 1 45 ? 1.618   4.357   1.982   1.00 10.00 ? 454 ILE A HB   4  
ATOM 4176  H HG12 . ILE A 1 45 ? -1.066  3.925   1.901   1.00 10.00 ? 454 ILE A HG12 4  
ATOM 4177  H HG13 . ILE A 1 45 ? -0.750  3.917   3.639   1.00 10.00 ? 454 ILE A HG13 4  
ATOM 4178  H HG21 . ILE A 1 45 ? 0.504   1.565   2.085   1.00 10.00 ? 454 ILE A HG21 4  
ATOM 4179  H HG22 . ILE A 1 45 ? 1.855   2.175   1.130   1.00 10.00 ? 454 ILE A HG22 4  
ATOM 4180  H HG23 . ILE A 1 45 ? 0.203   2.631   0.714   1.00 10.00 ? 454 ILE A HG23 4  
ATOM 4181  H HD11 . ILE A 1 45 ? 0.593   6.076   3.144   1.00 10.00 ? 454 ILE A HD11 4  
ATOM 4182  H HD12 . ILE A 1 45 ? -1.159  6.141   3.241   1.00 10.00 ? 454 ILE A HD12 4  
ATOM 4183  H HD13 . ILE A 1 45 ? -0.365  6.113   1.670   1.00 10.00 ? 454 ILE A HD13 4  
ATOM 4184  N N    . ALA A 1 46 ? 3.762   2.665   2.968   1.00 10.00 ? 455 ALA A N    4  
ATOM 4185  C CA   . ALA A 1 46 ? 4.933   1.824   2.777   1.00 10.00 ? 455 ALA A CA   4  
ATOM 4186  C C    . ALA A 1 46 ? 5.518   1.400   4.125   1.00 10.00 ? 455 ALA A C    4  
ATOM 4187  O O    . ALA A 1 46 ? 6.410   0.554   4.184   1.00 10.00 ? 455 ALA A O    4  
ATOM 4188  C CB   . ALA A 1 46 ? 5.980   2.556   1.953   1.00 10.00 ? 455 ALA A CB   4  
ATOM 4189  H H    . ALA A 1 46 ? 3.761   3.576   2.612   1.00 10.00 ? 455 ALA A H    4  
ATOM 4190  H HA   . ALA A 1 46 ? 4.631   0.944   2.232   1.00 10.00 ? 455 ALA A HA   4  
ATOM 4191  H HB1  . ALA A 1 46 ? 5.506   3.024   1.102   1.00 10.00 ? 455 ALA A HB1  4  
ATOM 4192  H HB2  . ALA A 1 46 ? 6.724   1.853   1.608   1.00 10.00 ? 455 ALA A HB2  4  
ATOM 4193  H HB3  . ALA A 1 46 ? 6.455   3.311   2.561   1.00 10.00 ? 455 ALA A HB3  4  
ATOM 4194  N N    . SER A 1 47 ? 5.012   1.996   5.209   1.00 10.00 ? 456 SER A N    4  
ATOM 4195  C CA   . SER A 1 47 ? 5.491   1.674   6.548   1.00 10.00 ? 456 SER A CA   4  
ATOM 4196  C C    . SER A 1 47 ? 4.615   0.612   7.207   1.00 10.00 ? 456 SER A C    4  
ATOM 4197  O O    . SER A 1 47 ? 5.117   -0.249  7.930   1.00 10.00 ? 456 SER A O    4  
ATOM 4198  C CB   . SER A 1 47 ? 5.537   2.931   7.420   1.00 10.00 ? 456 SER A CB   4  
ATOM 4199  O OG   . SER A 1 47 ? 5.596   2.598   8.796   1.00 10.00 ? 456 SER A OG   4  
ATOM 4200  H H    . SER A 1 47 ? 4.301   2.667   5.106   1.00 10.00 ? 456 SER A H    4  
ATOM 4201  H HA   . SER A 1 47 ? 6.493   1.282   6.450   1.00 10.00 ? 456 SER A HA   4  
ATOM 4202  H HB2  . SER A 1 47 ? 6.413   3.510   7.166   1.00 10.00 ? 456 SER A HB2  4  
ATOM 4203  H HB3  . SER A 1 47 ? 4.652   3.523   7.243   1.00 10.00 ? 456 SER A HB3  4  
ATOM 4204  H HG   . SER A 1 47 ? 6.510   2.618   9.091   1.00 10.00 ? 456 SER A HG   4  
ATOM 4205  N N    . PHE A 1 48 ? 3.307   0.666   6.956   1.00 10.00 ? 457 PHE A N    4  
ATOM 4206  C CA   . PHE A 1 48 ? 2.397   -0.313  7.539   1.00 10.00 ? 457 PHE A CA   4  
ATOM 4207  C C    . PHE A 1 48 ? 2.366   -1.585  6.688   1.00 10.00 ? 457 PHE A C    4  
ATOM 4208  O O    . PHE A 1 48 ? 2.239   -2.690  7.214   1.00 10.00 ? 457 PHE A O    4  
ATOM 4209  C CB   . PHE A 1 48 ? 0.991   0.286   7.723   1.00 10.00 ? 457 PHE A CB   4  
ATOM 4210  C CG   . PHE A 1 48 ? 0.102   0.191   6.515   1.00 10.00 ? 457 PHE A CG   4  
ATOM 4211  C CD1  . PHE A 1 48 ? -0.422  -1.030  6.124   1.00 10.00 ? 457 PHE A CD1  4  
ATOM 4212  C CD2  . PHE A 1 48 ? -0.210  1.322   5.774   1.00 10.00 ? 457 PHE A CD2  4  
ATOM 4213  C CE1  . PHE A 1 48 ? -1.235  -1.123  5.015   1.00 10.00 ? 457 PHE A CE1  4  
ATOM 4214  C CE2  . PHE A 1 48 ? -1.024  1.231   4.665   1.00 10.00 ? 457 PHE A CE2  4  
ATOM 4215  C CZ   . PHE A 1 48 ? -1.535  0.010   4.283   1.00 10.00 ? 457 PHE A CZ   4  
ATOM 4216  H H    . PHE A 1 48 ? 2.951   1.368   6.367   1.00 10.00 ? 457 PHE A H    4  
ATOM 4217  H HA   . PHE A 1 48 ? 2.790   -0.572  8.513   1.00 10.00 ? 457 PHE A HA   4  
ATOM 4218  H HB2  . PHE A 1 48 ? 0.496   -0.227  8.533   1.00 10.00 ? 457 PHE A HB2  4  
ATOM 4219  H HB3  . PHE A 1 48 ? 1.089   1.332   7.980   1.00 10.00 ? 457 PHE A HB3  4  
ATOM 4220  H HD1  . PHE A 1 48 ? -0.194  -1.917  6.699   1.00 10.00 ? 457 PHE A HD1  4  
ATOM 4221  H HD2  . PHE A 1 48 ? 0.191   2.286   6.065   1.00 10.00 ? 457 PHE A HD2  4  
ATOM 4222  H HE1  . PHE A 1 48 ? -1.630  -2.083  4.716   1.00 10.00 ? 457 PHE A HE1  4  
ATOM 4223  H HE2  . PHE A 1 48 ? -1.262  2.117   4.095   1.00 10.00 ? 457 PHE A HE2  4  
ATOM 4224  H HZ   . PHE A 1 48 ? -2.171  -0.056  3.418   1.00 10.00 ? 457 PHE A HZ   4  
ATOM 4225  N N    . LEU A 1 49 ? 2.516   -1.420  5.374   1.00 10.00 ? 458 LEU A N    4  
ATOM 4226  C CA   . LEU A 1 49 ? 2.542   -2.556  4.456   1.00 10.00 ? 458 LEU A CA   4  
ATOM 4227  C C    . LEU A 1 49 ? 3.954   -2.731  3.898   1.00 10.00 ? 458 LEU A C    4  
ATOM 4228  O O    . LEU A 1 49 ? 4.161   -2.805  2.688   1.00 10.00 ? 458 LEU A O    4  
ATOM 4229  C CB   . LEU A 1 49 ? 1.525   -2.373  3.321   1.00 10.00 ? 458 LEU A CB   4  
ATOM 4230  C CG   . LEU A 1 49 ? 1.424   -0.959  2.747   1.00 10.00 ? 458 LEU A CG   4  
ATOM 4231  C CD1  . LEU A 1 49 ? 2.766   -0.523  2.185   1.00 10.00 ? 458 LEU A CD1  4  
ATOM 4232  C CD2  . LEU A 1 49 ? 0.344   -0.890  1.672   1.00 10.00 ? 458 LEU A CD2  4  
ATOM 4233  H H    . LEU A 1 49 ? 2.637   -0.515  5.017   1.00 10.00 ? 458 LEU A H    4  
ATOM 4234  H HA   . LEU A 1 49 ? 2.283   -3.440  5.021   1.00 10.00 ? 458 LEU A HA   4  
ATOM 4235  H HB2  . LEU A 1 49 ? 1.791   -3.045  2.518   1.00 10.00 ? 458 LEU A HB2  4  
ATOM 4236  H HB3  . LEU A 1 49 ? 0.551   -2.655  3.693   1.00 10.00 ? 458 LEU A HB3  4  
ATOM 4237  H HG   . LEU A 1 49 ? 1.153   -0.277  3.538   1.00 10.00 ? 458 LEU A HG   4  
ATOM 4238  H HD11 . LEU A 1 49 ? 3.089   -1.228  1.439   1.00 10.00 ? 458 LEU A HD11 4  
ATOM 4239  H HD12 . LEU A 1 49 ? 3.493   -0.487  2.983   1.00 10.00 ? 458 LEU A HD12 4  
ATOM 4240  H HD13 . LEU A 1 49 ? 2.668   0.456   1.740   1.00 10.00 ? 458 LEU A HD13 4  
ATOM 4241  H HD21 . LEU A 1 49 ? -0.509  -0.336  2.046   1.00 10.00 ? 458 LEU A HD21 4  
ATOM 4242  H HD22 . LEU A 1 49 ? 0.032   -1.889  1.407   1.00 10.00 ? 458 LEU A HD22 4  
ATOM 4243  H HD23 . LEU A 1 49 ? 0.736   -0.393  0.797   1.00 10.00 ? 458 LEU A HD23 4  
ATOM 4244  N N    . GLU A 1 50 ? 4.916   -2.775  4.821   1.00 10.00 ? 459 GLU A N    4  
ATOM 4245  C CA   . GLU A 1 50 ? 6.344   -2.917  4.507   1.00 10.00 ? 459 GLU A CA   4  
ATOM 4246  C C    . GLU A 1 50 ? 6.597   -3.754  3.258   1.00 10.00 ? 459 GLU A C    4  
ATOM 4247  O O    . GLU A 1 50 ? 7.493   -3.446  2.472   1.00 10.00 ? 459 GLU A O    4  
ATOM 4248  C CB   . GLU A 1 50 ? 7.078   -3.538  5.696   1.00 10.00 ? 459 GLU A CB   4  
ATOM 4249  C CG   . GLU A 1 50 ? 8.496   -3.018  5.874   1.00 10.00 ? 459 GLU A CG   4  
ATOM 4250  C CD   . GLU A 1 50 ? 9.416   -4.039  6.513   1.00 10.00 ? 459 GLU A CD   4  
ATOM 4251  O OE1  . GLU A 1 50 ? 9.836   -4.982  5.809   1.00 10.00 ? 459 GLU A OE1  4  
ATOM 4252  O OE2  . GLU A 1 50 ? 9.716   -3.897  7.717   1.00 10.00 ? 459 GLU A OE2  4  
ATOM 4253  H H    . GLU A 1 50 ? 4.655   -2.694  5.754   1.00 10.00 ? 459 GLU A H    4  
ATOM 4254  H HA   . GLU A 1 50 ? 6.739   -1.927  4.340   1.00 10.00 ? 459 GLU A HA   4  
ATOM 4255  H HB2  . GLU A 1 50 ? 6.524   -3.325  6.598   1.00 10.00 ? 459 GLU A HB2  4  
ATOM 4256  H HB3  . GLU A 1 50 ? 7.126   -4.607  5.557   1.00 10.00 ? 459 GLU A HB3  4  
ATOM 4257  H HG2  . GLU A 1 50 ? 8.894   -2.754  4.905   1.00 10.00 ? 459 GLU A HG2  4  
ATOM 4258  H HG3  . GLU A 1 50 ? 8.467   -2.138  6.501   1.00 10.00 ? 459 GLU A HG3  4  
ATOM 4259  N N    . ARG A 1 51 ? 5.810   -4.809  3.073   1.00 10.00 ? 460 ARG A N    4  
ATOM 4260  C CA   . ARG A 1 51 ? 5.959   -5.679  1.908   1.00 10.00 ? 460 ARG A CA   4  
ATOM 4261  C C    . ARG A 1 51 ? 6.106   -4.852  0.633   1.00 10.00 ? 460 ARG A C    4  
ATOM 4262  O O    . ARG A 1 51 ? 6.726   -5.285  -0.338  1.00 10.00 ? 460 ARG A O    4  
ATOM 4263  C CB   . ARG A 1 51 ? 4.759   -6.619  1.789   1.00 10.00 ? 460 ARG A CB   4  
ATOM 4264  C CG   . ARG A 1 51 ? 4.876   -7.868  2.648   1.00 10.00 ? 460 ARG A CG   4  
ATOM 4265  C CD   . ARG A 1 51 ? 5.683   -8.950  1.950   1.00 10.00 ? 460 ARG A CD   4  
ATOM 4266  N NE   . ARG A 1 51 ? 7.113   -8.656  1.955   1.00 10.00 ? 460 ARG A NE   4  
ATOM 4267  C CZ   . ARG A 1 51 ? 7.870   -8.673  3.049   1.00 10.00 ? 460 ARG A CZ   4  
ATOM 4268  N NH1  . ARG A 1 51 ? 7.338   -8.971  4.228   1.00 10.00 ? 460 ARG A NH1  4  
ATOM 4269  N NH2  . ARG A 1 51 ? 9.163   -8.393  2.965   1.00 10.00 ? 460 ARG A NH2  4  
ATOM 4270  H H    . ARG A 1 51 ? 5.113   -5.005  3.729   1.00 10.00 ? 460 ARG A H    4  
ATOM 4271  H HA   . ARG A 1 51 ? 6.855   -6.266  2.046   1.00 10.00 ? 460 ARG A HA   4  
ATOM 4272  H HB2  . ARG A 1 51 ? 3.868   -6.086  2.086   1.00 10.00 ? 460 ARG A HB2  4  
ATOM 4273  H HB3  . ARG A 1 51 ? 4.657   -6.925  0.758   1.00 10.00 ? 460 ARG A HB3  4  
ATOM 4274  H HG2  . ARG A 1 51 ? 5.364   -7.610  3.576   1.00 10.00 ? 460 ARG A HG2  4  
ATOM 4275  H HG3  . ARG A 1 51 ? 3.884   -8.245  2.854   1.00 10.00 ? 460 ARG A HG3  4  
ATOM 4276  H HD2  . ARG A 1 51 ? 5.517   -9.888  2.458   1.00 10.00 ? 460 ARG A HD2  4  
ATOM 4277  H HD3  . ARG A 1 51 ? 5.344   -9.030  0.928   1.00 10.00 ? 460 ARG A HD3  4  
ATOM 4278  H HE   . ARG A 1 51 ? 7.533   -8.432  1.098   1.00 10.00 ? 460 ARG A HE   4  
ATOM 4279  H HH11 . ARG A 1 51 ? 6.363   -9.183  4.299   1.00 10.00 ? 460 ARG A HH11 4  
ATOM 4280  H HH12 . ARG A 1 51 ? 7.912   -8.982  5.047   1.00 10.00 ? 460 ARG A HH12 4  
ATOM 4281  H HH21 . ARG A 1 51 ? 9.570   -8.168  2.079   1.00 10.00 ? 460 ARG A HH21 4  
ATOM 4282  H HH22 . ARG A 1 51 ? 9.733   -8.406  3.787   1.00 10.00 ? 460 ARG A HH22 4  
ATOM 4283  N N    . LYS A 1 52 ? 5.532   -3.653  0.654   1.00 10.00 ? 461 LYS A N    4  
ATOM 4284  C CA   . LYS A 1 52 ? 5.595   -2.745  -0.484  1.00 10.00 ? 461 LYS A CA   4  
ATOM 4285  C C    . LYS A 1 52 ? 6.668   -1.682  -0.252  1.00 10.00 ? 461 LYS A C    4  
ATOM 4286  O O    . LYS A 1 52 ? 7.553   -1.856  0.584   1.00 10.00 ? 461 LYS A O    4  
ATOM 4287  C CB   . LYS A 1 52 ? 4.232   -2.075  -0.706  1.00 10.00 ? 461 LYS A CB   4  
ATOM 4288  C CG   . LYS A 1 52 ? 3.040   -2.915  -0.267  1.00 10.00 ? 461 LYS A CG   4  
ATOM 4289  C CD   . LYS A 1 52 ? 2.557   -3.821  -1.389  1.00 10.00 ? 461 LYS A CD   4  
ATOM 4290  C CE   . LYS A 1 52 ? 3.363   -5.107  -1.455  1.00 10.00 ? 461 LYS A CE   4  
ATOM 4291  N NZ   . LYS A 1 52 ? 2.785   -6.170  -0.588  1.00 10.00 ? 461 LYS A NZ   4  
ATOM 4292  H H    . LYS A 1 52 ? 5.056   -3.367  1.460   1.00 10.00 ? 461 LYS A H    4  
ATOM 4293  H HA   . LYS A 1 52 ? 5.853   -3.322  -1.359  1.00 10.00 ? 461 LYS A HA   4  
ATOM 4294  H HB2  . LYS A 1 52 ? 4.211   -1.147  -0.154  1.00 10.00 ? 461 LYS A HB2  4  
ATOM 4295  H HB3  . LYS A 1 52 ? 4.122   -1.857  -1.758  1.00 10.00 ? 461 LYS A HB3  4  
ATOM 4296  H HG2  . LYS A 1 52 ? 3.325   -3.522  0.582   1.00 10.00 ? 461 LYS A HG2  4  
ATOM 4297  H HG3  . LYS A 1 52 ? 2.235   -2.254  0.021   1.00 10.00 ? 461 LYS A HG3  4  
ATOM 4298  H HD2  . LYS A 1 52 ? 1.519   -4.066  -1.219  1.00 10.00 ? 461 LYS A HD2  4  
ATOM 4299  H HD3  . LYS A 1 52 ? 2.655   -3.296  -2.328  1.00 10.00 ? 461 LYS A HD3  4  
ATOM 4300  H HE2  . LYS A 1 52 ? 3.375   -5.456  -2.477  1.00 10.00 ? 461 LYS A HE2  4  
ATOM 4301  H HE3  . LYS A 1 52 ? 4.373   -4.901  -1.135  1.00 10.00 ? 461 LYS A HE3  4  
ATOM 4302  H HZ1  . LYS A 1 52 ? 1.794   -6.345  -0.850  1.00 10.00 ? 461 LYS A HZ1  4  
ATOM 4303  H HZ2  . LYS A 1 52 ? 2.822   -5.877  0.409   1.00 10.00 ? 461 LYS A HZ2  4  
ATOM 4304  H HZ3  . LYS A 1 52 ? 3.323   -7.053  -0.699  1.00 10.00 ? 461 LYS A HZ3  4  
ATOM 4305  N N    . THR A 1 53 ? 6.584   -0.580  -0.992  1.00 10.00 ? 462 THR A N    4  
ATOM 4306  C CA   . THR A 1 53 ? 7.547   0.509   -0.856  1.00 10.00 ? 462 THR A CA   4  
ATOM 4307  C C    . THR A 1 53 ? 6.974   1.802   -1.425  1.00 10.00 ? 462 THR A C    4  
ATOM 4308  O O    . THR A 1 53 ? 5.937   1.791   -2.082  1.00 10.00 ? 462 THR A O    4  
ATOM 4309  C CB   . THR A 1 53 ? 8.858   0.158   -1.565  1.00 10.00 ? 462 THR A CB   4  
ATOM 4310  O OG1  . THR A 1 53 ? 8.868   -1.202  -1.963  1.00 10.00 ? 462 THR A OG1  4  
ATOM 4311  C CG2  . THR A 1 53 ? 10.082  0.396   -0.709  1.00 10.00 ? 462 THR A CG2  4  
ATOM 4312  H H    . THR A 1 53 ? 5.854   -0.493  -1.640  1.00 10.00 ? 462 THR A H    4  
ATOM 4313  H HA   . THR A 1 53 ? 7.742   0.649   0.197   1.00 10.00 ? 462 THR A HA   4  
ATOM 4314  H HB   . THR A 1 53 ? 8.952   0.771   -2.451  1.00 10.00 ? 462 THR A HB   4  
ATOM 4315  H HG1  . THR A 1 53 ? 8.971   -1.763  -1.191  1.00 10.00 ? 462 THR A HG1  4  
ATOM 4316  H HG21 . THR A 1 53 ? 9.931   1.274   -0.098  1.00 10.00 ? 462 THR A HG21 4  
ATOM 4317  H HG22 . THR A 1 53 ? 10.943  0.542   -1.343  1.00 10.00 ? 462 THR A HG22 4  
ATOM 4318  H HG23 . THR A 1 53 ? 10.248  -0.461  -0.070  1.00 10.00 ? 462 THR A HG23 4  
ATOM 4319  N N    . VAL A 1 54 ? 7.655   2.915   -1.174  1.00 10.00 ? 463 VAL A N    4  
ATOM 4320  C CA   . VAL A 1 54 ? 7.202   4.209   -1.672  1.00 10.00 ? 463 VAL A CA   4  
ATOM 4321  C C    . VAL A 1 54 ? 7.257   4.243   -3.195  1.00 10.00 ? 463 VAL A C    4  
ATOM 4322  O O    . VAL A 1 54 ? 6.228   4.358   -3.861  1.00 10.00 ? 463 VAL A O    4  
ATOM 4323  C CB   . VAL A 1 54 ? 8.047   5.366   -1.094  1.00 10.00 ? 463 VAL A CB   4  
ATOM 4324  C CG1  . VAL A 1 54 ? 7.674   6.693   -1.743  1.00 10.00 ? 463 VAL A CG1  4  
ATOM 4325  C CG2  . VAL A 1 54 ? 7.882   5.442   0.417   1.00 10.00 ? 463 VAL A CG2  4  
ATOM 4326  H H    . VAL A 1 54 ? 8.479   2.865   -0.645  1.00 10.00 ? 463 VAL A H    4  
ATOM 4327  H HA   . VAL A 1 54 ? 6.177   4.343   -1.360  1.00 10.00 ? 463 VAL A HA   4  
ATOM 4328  H HB   . VAL A 1 54 ? 9.087   5.166   -1.310  1.00 10.00 ? 463 VAL A HB   4  
ATOM 4329  H HG11 . VAL A 1 54 ? 8.392   6.931   -2.514  1.00 10.00 ? 463 VAL A HG11 4  
ATOM 4330  H HG12 . VAL A 1 54 ? 7.676   7.473   -0.995  1.00 10.00 ? 463 VAL A HG12 4  
ATOM 4331  H HG13 . VAL A 1 54 ? 6.690   6.615   -2.180  1.00 10.00 ? 463 VAL A HG13 4  
ATOM 4332  H HG21 . VAL A 1 54 ? 7.185   6.230   0.665   1.00 10.00 ? 463 VAL A HG21 4  
ATOM 4333  H HG22 . VAL A 1 54 ? 8.839   5.650   0.874   1.00 10.00 ? 463 VAL A HG22 4  
ATOM 4334  H HG23 . VAL A 1 54 ? 7.505   4.500   0.786   1.00 10.00 ? 463 VAL A HG23 4  
ATOM 4335  N N    . ALA A 1 55 ? 8.462   4.132   -3.741  1.00 10.00 ? 464 ALA A N    4  
ATOM 4336  C CA   . ALA A 1 55 ? 8.644   4.138   -5.186  1.00 10.00 ? 464 ALA A CA   4  
ATOM 4337  C C    . ALA A 1 55 ? 8.122   2.844   -5.809  1.00 10.00 ? 464 ALA A C    4  
ATOM 4338  O O    . ALA A 1 55 ? 8.008   2.735   -7.029  1.00 10.00 ? 464 ALA A O    4  
ATOM 4339  C CB   . ALA A 1 55 ? 10.111  4.339   -5.533  1.00 10.00 ? 464 ALA A CB   4  
ATOM 4340  H H    . ALA A 1 55 ? 9.245   4.034   -3.160  1.00 10.00 ? 464 ALA A H    4  
ATOM 4341  H HA   . ALA A 1 55 ? 8.085   4.970   -5.590  1.00 10.00 ? 464 ALA A HA   4  
ATOM 4342  H HB1  . ALA A 1 55 ? 10.194  4.729   -6.536  1.00 10.00 ? 464 ALA A HB1  4  
ATOM 4343  H HB2  . ALA A 1 55 ? 10.629  3.393   -5.471  1.00 10.00 ? 464 ALA A HB2  4  
ATOM 4344  H HB3  . ALA A 1 55 ? 10.553  5.037   -4.837  1.00 10.00 ? 464 ALA A HB3  4  
ATOM 4345  N N    . GLU A 1 56 ? 7.809   1.864   -4.962  1.00 10.00 ? 465 GLU A N    4  
ATOM 4346  C CA   . GLU A 1 56 ? 7.303   0.581   -5.431  1.00 10.00 ? 465 GLU A CA   4  
ATOM 4347  C C    . GLU A 1 56 ? 5.779   0.519   -5.345  1.00 10.00 ? 465 GLU A C    4  
ATOM 4348  O O    . GLU A 1 56 ? 5.143   -0.247  -6.068  1.00 10.00 ? 465 GLU A O    4  
ATOM 4349  C CB   . GLU A 1 56 ? 7.915   -0.559  -4.614  1.00 10.00 ? 465 GLU A CB   4  
ATOM 4350  C CG   . GLU A 1 56 ? 7.667   -1.935  -5.210  1.00 10.00 ? 465 GLU A CG   4  
ATOM 4351  C CD   . GLU A 1 56 ? 8.683   -2.301  -6.274  1.00 10.00 ? 465 GLU A CD   4  
ATOM 4352  O OE1  . GLU A 1 56 ? 8.851   -1.516  -7.230  1.00 10.00 ? 465 GLU A OE1  4  
ATOM 4353  O OE2  . GLU A 1 56 ? 9.312   -3.374  -6.151  1.00 10.00 ? 465 GLU A OE2  4  
ATOM 4354  H H    . GLU A 1 56 ? 7.922   2.007   -4.000  1.00 10.00 ? 465 GLU A H    4  
ATOM 4355  H HA   . GLU A 1 56 ? 7.597   0.468   -6.463  1.00 10.00 ? 465 GLU A HA   4  
ATOM 4356  H HB2  . GLU A 1 56 ? 8.983   -0.406  -4.549  1.00 10.00 ? 465 GLU A HB2  4  
ATOM 4357  H HB3  . GLU A 1 56 ? 7.495   -0.540  -3.620  1.00 10.00 ? 465 GLU A HB3  4  
ATOM 4358  H HG2  . GLU A 1 56 ? 7.715   -2.670  -4.420  1.00 10.00 ? 465 GLU A HG2  4  
ATOM 4359  H HG3  . GLU A 1 56 ? 6.682   -1.949  -5.653  1.00 10.00 ? 465 GLU A HG3  4  
ATOM 4360  N N    . CYS A 1 57 ? 5.194   1.327   -4.462  1.00 10.00 ? 466 CYS A N    4  
ATOM 4361  C CA   . CYS A 1 57 ? 3.745   1.346   -4.303  1.00 10.00 ? 466 CYS A CA   4  
ATOM 4362  C C    . CYS A 1 57 ? 3.090   2.079   -5.464  1.00 10.00 ? 466 CYS A C    4  
ATOM 4363  O O    . CYS A 1 57 ? 1.954   1.782   -5.833  1.00 10.00 ? 466 CYS A O    4  
ATOM 4364  C CB   . CYS A 1 57 ? 3.349   2.002   -2.978  1.00 10.00 ? 466 CYS A CB   4  
ATOM 4365  S SG   . CYS A 1 57 ? 3.227   0.850   -1.591  1.00 10.00 ? 466 CYS A SG   4  
ATOM 4366  H H    . CYS A 1 57 ? 5.745   1.922   -3.909  1.00 10.00 ? 466 CYS A H    4  
ATOM 4367  H HA   . CYS A 1 57 ? 3.400   0.320   -4.307  1.00 10.00 ? 466 CYS A HA   4  
ATOM 4368  H HB2  . CYS A 1 57 ? 4.082   2.751   -2.719  1.00 10.00 ? 466 CYS A HB2  4  
ATOM 4369  H HB3  . CYS A 1 57 ? 2.386   2.477   -3.095  1.00 10.00 ? 466 CYS A HB3  4  
ATOM 4370  H HG   . CYS A 1 57 ? 3.617   1.271   -0.821  1.00 10.00 ? 466 CYS A HG   4  
ATOM 4371  N N    . VAL A 1 58 ? 3.816   3.031   -6.048  1.00 10.00 ? 467 VAL A N    4  
ATOM 4372  C CA   . VAL A 1 58 ? 3.300   3.789   -7.181  1.00 10.00 ? 467 VAL A CA   4  
ATOM 4373  C C    . VAL A 1 58 ? 2.712   2.843   -8.217  1.00 10.00 ? 467 VAL A C    4  
ATOM 4374  O O    . VAL A 1 58 ? 1.736   3.162   -8.889  1.00 10.00 ? 467 VAL A O    4  
ATOM 4375  C CB   . VAL A 1 58 ? 4.400   4.638   -7.850  1.00 10.00 ? 467 VAL A CB   4  
ATOM 4376  C CG1  . VAL A 1 58 ? 3.857   5.355   -9.082  1.00 10.00 ? 467 VAL A CG1  4  
ATOM 4377  C CG2  . VAL A 1 58 ? 4.985   5.634   -6.861  1.00 10.00 ? 467 VAL A CG2  4  
ATOM 4378  H H    . VAL A 1 58 ? 4.720   3.218   -5.718  1.00 10.00 ? 467 VAL A H    4  
ATOM 4379  H HA   . VAL A 1 58 ? 2.525   4.451   -6.820  1.00 10.00 ? 467 VAL A HA   4  
ATOM 4380  H HB   . VAL A 1 58 ? 5.192   3.976   -8.169  1.00 10.00 ? 467 VAL A HB   4  
ATOM 4381  H HG11 . VAL A 1 58 ? 3.077   6.040   -8.785  1.00 10.00 ? 467 VAL A HG11 4  
ATOM 4382  H HG12 . VAL A 1 58 ? 3.454   4.629   -9.777  1.00 10.00 ? 467 VAL A HG12 4  
ATOM 4383  H HG13 . VAL A 1 58 ? 4.655   5.904   -9.559  1.00 10.00 ? 467 VAL A HG13 4  
ATOM 4384  H HG21 . VAL A 1 58 ? 4.887   5.244   -5.858  1.00 10.00 ? 467 VAL A HG21 4  
ATOM 4385  H HG22 . VAL A 1 58 ? 4.453   6.571   -6.936  1.00 10.00 ? 467 VAL A HG22 4  
ATOM 4386  H HG23 . VAL A 1 58 ? 6.029   5.793   -7.084  1.00 10.00 ? 467 VAL A HG23 4  
ATOM 4387  N N    . LEU A 1 59 ? 3.321   1.670   -8.335  1.00 10.00 ? 468 LEU A N    4  
ATOM 4388  C CA   . LEU A 1 59 ? 2.871   0.665   -9.285  1.00 10.00 ? 468 LEU A CA   4  
ATOM 4389  C C    . LEU A 1 59 ? 1.370   0.430   -9.174  1.00 10.00 ? 468 LEU A C    4  
ATOM 4390  O O    . LEU A 1 59 ? 0.710   0.100   -10.156 1.00 10.00 ? 468 LEU A O    4  
ATOM 4391  C CB   . LEU A 1 59 ? 3.626   -0.647  -9.061  1.00 10.00 ? 468 LEU A CB   4  
ATOM 4392  C CG   . LEU A 1 59 ? 4.067   -1.368  -10.336 1.00 10.00 ? 468 LEU A CG   4  
ATOM 4393  C CD1  . LEU A 1 59 ? 5.411   -2.048  -10.130 1.00 10.00 ? 468 LEU A CD1  4  
ATOM 4394  C CD2  . LEU A 1 59 ? 3.015   -2.381  -10.765 1.00 10.00 ? 468 LEU A CD2  4  
ATOM 4395  H H    . LEU A 1 59 ? 4.096   1.475   -7.767  1.00 10.00 ? 468 LEU A H    4  
ATOM 4396  H HA   . LEU A 1 59 ? 3.090   1.029   -10.270 1.00 10.00 ? 468 LEU A HA   4  
ATOM 4397  H HB2  . LEU A 1 59 ? 4.506   -0.435  -8.469  1.00 10.00 ? 468 LEU A HB2  4  
ATOM 4398  H HB3  . LEU A 1 59 ? 2.989   -1.314  -8.499  1.00 10.00 ? 468 LEU A HB3  4  
ATOM 4399  H HG   . LEU A 1 59 ? 4.177   -0.644  -11.131 1.00 10.00 ? 468 LEU A HG   4  
ATOM 4400  H HD11 . LEU A 1 59 ? 6.205   -1.362  -10.389 1.00 10.00 ? 468 LEU A HD11 4  
ATOM 4401  H HD12 . LEU A 1 59 ? 5.472   -2.923  -10.758 1.00 10.00 ? 468 LEU A HD12 4  
ATOM 4402  H HD13 . LEU A 1 59 ? 5.512   -2.340  -9.094  1.00 10.00 ? 468 LEU A HD13 4  
ATOM 4403  H HD21 . LEU A 1 59 ? 3.010   -3.209  -10.071 1.00 10.00 ? 468 LEU A HD21 4  
ATOM 4404  H HD22 . LEU A 1 59 ? 3.247   -2.742  -11.756 1.00 10.00 ? 468 LEU A HD22 4  
ATOM 4405  H HD23 . LEU A 1 59 ? 2.044   -1.911  -10.771 1.00 10.00 ? 468 LEU A HD23 4  
ATOM 4406  N N    . TYR A 1 60 ? 0.842   0.595   -7.969  1.00 10.00 ? 469 TYR A N    4  
ATOM 4407  C CA   . TYR A 1 60 ? -0.578  0.390   -7.725  1.00 10.00 ? 469 TYR A CA   4  
ATOM 4408  C C    . TYR A 1 60 ? -1.408  1.634   -8.062  1.00 10.00 ? 469 TYR A C    4  
ATOM 4409  O O    . TYR A 1 60 ? -2.634  1.599   -7.990  1.00 10.00 ? 469 TYR A O    4  
ATOM 4410  C CB   . TYR A 1 60 ? -0.809  -0.059  -6.270  1.00 10.00 ? 469 TYR A CB   4  
ATOM 4411  C CG   . TYR A 1 60 ? -1.313  1.002   -5.314  1.00 10.00 ? 469 TYR A CG   4  
ATOM 4412  C CD1  . TYR A 1 60 ? -0.852  2.305   -5.398  1.00 10.00 ? 469 TYR A CD1  4  
ATOM 4413  C CD2  . TYR A 1 60 ? -2.240  0.692   -4.317  1.00 10.00 ? 469 TYR A CD2  4  
ATOM 4414  C CE1  . TYR A 1 60 ? -1.293  3.278   -4.526  1.00 10.00 ? 469 TYR A CE1  4  
ATOM 4415  C CE2  . TYR A 1 60 ? -2.687  1.663   -3.444  1.00 10.00 ? 469 TYR A CE2  4  
ATOM 4416  C CZ   . TYR A 1 60 ? -2.211  2.954   -3.553  1.00 10.00 ? 469 TYR A CZ   4  
ATOM 4417  O OH   . TYR A 1 60 ? -2.646  3.923   -2.683  1.00 10.00 ? 469 TYR A OH   4  
ATOM 4418  H H    . TYR A 1 60 ? 1.423   0.851   -7.231  1.00 10.00 ? 469 TYR A H    4  
ATOM 4419  H HA   . TYR A 1 60 ? -0.887  -0.414  -8.371  1.00 10.00 ? 469 TYR A HA   4  
ATOM 4420  H HB2  . TYR A 1 60 ? -1.527  -0.860  -6.266  1.00 10.00 ? 469 TYR A HB2  4  
ATOM 4421  H HB3  . TYR A 1 60 ? 0.124   -0.423  -5.878  1.00 10.00 ? 469 TYR A HB3  4  
ATOM 4422  H HD1  . TYR A 1 60 ? -0.137  2.554   -6.164  1.00 10.00 ? 469 TYR A HD1  4  
ATOM 4423  H HD2  . TYR A 1 60 ? -2.612  -0.330  -4.222  1.00 10.00 ? 469 TYR A HD2  4  
ATOM 4424  H HE1  . TYR A 1 60 ? -0.920  4.288   -4.611  1.00 10.00 ? 469 TYR A HE1  4  
ATOM 4425  H HE2  . TYR A 1 60 ? -3.408  1.406   -2.680  1.00 10.00 ? 469 TYR A HE2  4  
ATOM 4426  H HH   . TYR A 1 60 ? -2.030  3.996   -1.951  1.00 10.00 ? 469 TYR A HH   4  
ATOM 4427  N N    . TYR A 1 61 ? -0.742  2.735   -8.426  1.00 10.00 ? 470 TYR A N    4  
ATOM 4428  C CA   . TYR A 1 61 ? -1.445  3.969   -8.759  1.00 10.00 ? 470 TYR A CA   4  
ATOM 4429  C C    . TYR A 1 61 ? -1.946  3.930   -10.199 1.00 10.00 ? 470 TYR A C    4  
ATOM 4430  O O    . TYR A 1 61 ? -3.118  4.199   -10.462 1.00 10.00 ? 470 TYR A O    4  
ATOM 4431  C CB   . TYR A 1 61 ? -0.537  5.186   -8.518  1.00 10.00 ? 470 TYR A CB   4  
ATOM 4432  C CG   . TYR A 1 61 ? -0.130  5.929   -9.773  1.00 10.00 ? 470 TYR A CG   4  
ATOM 4433  C CD1  . TYR A 1 61 ? 0.952   5.503   -10.529 1.00 10.00 ? 470 TYR A CD1  4  
ATOM 4434  C CD2  . TYR A 1 61 ? -0.829  7.050   -10.201 1.00 10.00 ? 470 TYR A CD2  4  
ATOM 4435  C CE1  . TYR A 1 61 ? 1.329   6.170   -11.674 1.00 10.00 ? 470 TYR A CE1  4  
ATOM 4436  C CE2  . TYR A 1 61 ? -0.459  7.725   -11.348 1.00 10.00 ? 470 TYR A CE2  4  
ATOM 4437  C CZ   . TYR A 1 61 ? 0.621   7.281   -12.082 1.00 10.00 ? 470 TYR A CZ   4  
ATOM 4438  O OH   . TYR A 1 61 ? 0.994   7.950   -13.225 1.00 10.00 ? 470 TYR A OH   4  
ATOM 4439  H H    . TYR A 1 61 ? 0.237   2.719   -8.470  1.00 10.00 ? 470 TYR A H    4  
ATOM 4440  H HA   . TYR A 1 61 ? -2.304  4.041   -8.105  1.00 10.00 ? 470 TYR A HA   4  
ATOM 4441  H HB2  . TYR A 1 61 ? -1.053  5.886   -7.878  1.00 10.00 ? 470 TYR A HB2  4  
ATOM 4442  H HB3  . TYR A 1 61 ? 0.364   4.856   -8.021  1.00 10.00 ? 470 TYR A HB3  4  
ATOM 4443  H HD1  . TYR A 1 61 ? 1.505   4.636   -10.213 1.00 10.00 ? 470 TYR A HD1  4  
ATOM 4444  H HD2  . TYR A 1 61 ? -1.673  7.394   -9.623  1.00 10.00 ? 470 TYR A HD2  4  
ATOM 4445  H HE1  . TYR A 1 61 ? 2.172   5.817   -12.244 1.00 10.00 ? 470 TYR A HE1  4  
ATOM 4446  H HE2  . TYR A 1 61 ? -1.013  8.595   -11.665 1.00 10.00 ? 470 TYR A HE2  4  
ATOM 4447  H HH   . TYR A 1 61 ? 0.927   8.896   -13.080 1.00 10.00 ? 470 TYR A HH   4  
ATOM 4448  N N    . TYR A 1 62 ? -1.065  3.574   -11.130 1.00 10.00 ? 471 TYR A N    4  
ATOM 4449  C CA   . TYR A 1 62 ? -1.457  3.487   -12.529 1.00 10.00 ? 471 TYR A CA   4  
ATOM 4450  C C    . TYR A 1 62 ? -2.237  2.196   -12.774 1.00 10.00 ? 471 TYR A C    4  
ATOM 4451  O O    . TYR A 1 62 ? -2.813  1.997   -13.843 1.00 10.00 ? 471 TYR A O    4  
ATOM 4452  C CB   . TYR A 1 62 ? -0.240  3.586   -13.455 1.00 10.00 ? 471 TYR A CB   4  
ATOM 4453  C CG   . TYR A 1 62 ? 0.694   2.399   -13.403 1.00 10.00 ? 471 TYR A CG   4  
ATOM 4454  C CD1  . TYR A 1 62 ? 0.470   1.281   -14.198 1.00 10.00 ? 471 TYR A CD1  4  
ATOM 4455  C CD2  . TYR A 1 62 ? 1.810   2.403   -12.575 1.00 10.00 ? 471 TYR A CD2  4  
ATOM 4456  C CE1  . TYR A 1 62 ? 1.331   0.201   -14.169 1.00 10.00 ? 471 TYR A CE1  4  
ATOM 4457  C CE2  . TYR A 1 62 ? 2.672   1.325   -12.539 1.00 10.00 ? 471 TYR A CE2  4  
ATOM 4458  C CZ   . TYR A 1 62 ? 2.429   0.227   -13.337 1.00 10.00 ? 471 TYR A CZ   4  
ATOM 4459  O OH   . TYR A 1 62 ? 3.289   -0.846  -13.305 1.00 10.00 ? 471 TYR A OH   4  
ATOM 4460  H H    . TYR A 1 62 ? -0.145  3.351   -10.868 1.00 10.00 ? 471 TYR A H    4  
ATOM 4461  H HA   . TYR A 1 62 ? -2.114  4.320   -12.729 1.00 10.00 ? 471 TYR A HA   4  
ATOM 4462  H HB2  . TYR A 1 62 ? -0.583  3.686   -14.472 1.00 10.00 ? 471 TYR A HB2  4  
ATOM 4463  H HB3  . TYR A 1 62 ? 0.329   4.465   -13.188 1.00 10.00 ? 471 TYR A HB3  4  
ATOM 4464  H HD1  . TYR A 1 62 ? -0.394  1.262   -14.846 1.00 10.00 ? 471 TYR A HD1  4  
ATOM 4465  H HD2  . TYR A 1 62 ? 2.000   3.265   -11.948 1.00 10.00 ? 471 TYR A HD2  4  
ATOM 4466  H HE1  . TYR A 1 62 ? 1.139   -0.658  -14.793 1.00 10.00 ? 471 TYR A HE1  4  
ATOM 4467  H HE2  . TYR A 1 62 ? 3.532   1.345   -11.887 1.00 10.00 ? 471 TYR A HE2  4  
ATOM 4468  H HH   . TYR A 1 62 ? 2.786   -1.661  -13.370 1.00 10.00 ? 471 TYR A HH   4  
ATOM 4469  N N    . LEU A 1 63 ? -2.278  1.338   -11.753 1.00 10.00 ? 472 LEU A N    4  
ATOM 4470  C CA   . LEU A 1 63 ? -3.016  0.085   -11.822 1.00 10.00 ? 472 LEU A CA   4  
ATOM 4471  C C    . LEU A 1 63 ? -4.484  0.356   -11.527 1.00 10.00 ? 472 LEU A C    4  
ATOM 4472  O O    . LEU A 1 63 ? -5.380  -0.139  -12.212 1.00 10.00 ? 472 LEU A O    4  
ATOM 4473  C CB   . LEU A 1 63 ? -2.458  -0.912  -10.801 1.00 10.00 ? 472 LEU A CB   4  
ATOM 4474  C CG   . LEU A 1 63 ? -1.397  -1.880  -11.329 1.00 10.00 ? 472 LEU A CG   4  
ATOM 4475  C CD1  . LEU A 1 63 ? -0.422  -1.166  -12.250 1.00 10.00 ? 472 LEU A CD1  4  
ATOM 4476  C CD2  . LEU A 1 63 ? -0.657  -2.537  -10.172 1.00 10.00 ? 472 LEU A CD2  4  
ATOM 4477  H H    . LEU A 1 63 ? -1.821  1.568   -10.920 1.00 10.00 ? 472 LEU A H    4  
ATOM 4478  H HA   . LEU A 1 63 ? -2.916  -0.319  -12.818 1.00 10.00 ? 472 LEU A HA   4  
ATOM 4479  H HB2  . LEU A 1 63 ? -2.026  -0.351  -9.985  1.00 10.00 ? 472 LEU A HB2  4  
ATOM 4480  H HB3  . LEU A 1 63 ? -3.281  -1.495  -10.414 1.00 10.00 ? 472 LEU A HB3  4  
ATOM 4481  H HG   . LEU A 1 63 ? -1.886  -2.656  -11.898 1.00 10.00 ? 472 LEU A HG   4  
ATOM 4482  H HD11 . LEU A 1 63 ? 0.578   -1.536  -12.075 1.00 10.00 ? 472 LEU A HD11 4  
ATOM 4483  H HD12 . LEU A 1 63 ? -0.452  -0.104  -12.053 1.00 10.00 ? 472 LEU A HD12 4  
ATOM 4484  H HD13 . LEU A 1 63 ? -0.698  -1.348  -13.278 1.00 10.00 ? 472 LEU A HD13 4  
ATOM 4485  H HD21 . LEU A 1 63 ? -0.203  -1.775  -9.552  1.00 10.00 ? 472 LEU A HD21 4  
ATOM 4486  H HD22 . LEU A 1 63 ? 0.110   -3.190  -10.560 1.00 10.00 ? 472 LEU A HD22 4  
ATOM 4487  H HD23 . LEU A 1 63 ? -1.353  -3.113  -9.579  1.00 10.00 ? 472 LEU A HD23 4  
ATOM 4488  N N    . THR A 1 64 ? -4.709  1.163   -10.495 1.00 10.00 ? 473 THR A N    4  
ATOM 4489  C CA   . THR A 1 64 ? -6.052  1.541   -10.076 1.00 10.00 ? 473 THR A CA   4  
ATOM 4490  C C    . THR A 1 64 ? -6.811  2.199   -11.224 1.00 10.00 ? 473 THR A C    4  
ATOM 4491  O O    . THR A 1 64 ? -7.984  1.905   -11.456 1.00 10.00 ? 473 THR A O    4  
ATOM 4492  C CB   . THR A 1 64 ? -5.974  2.499   -8.886  1.00 10.00 ? 473 THR A CB   4  
ATOM 4493  O OG1  . THR A 1 64 ? -5.286  3.683   -9.248  1.00 10.00 ? 473 THR A OG1  4  
ATOM 4494  C CG2  . THR A 1 64 ? -5.272  1.913   -7.681  1.00 10.00 ? 473 THR A CG2  4  
ATOM 4495  H H    . THR A 1 64 ? -3.942  1.522   -10.003 1.00 10.00 ? 473 THR A H    4  
ATOM 4496  H HA   . THR A 1 64 ? -6.577  0.651   -9.776  1.00 10.00 ? 473 THR A HA   4  
ATOM 4497  H HB   . THR A 1 64 ? -6.977  2.766   -8.585  1.00 10.00 ? 473 THR A HB   4  
ATOM 4498  H HG1  . THR A 1 64 ? -4.374  3.471   -9.464  1.00 10.00 ? 473 THR A HG1  4  
ATOM 4499  H HG21 . THR A 1 64 ? -4.819  0.970   -7.949  1.00 10.00 ? 473 THR A HG21 4  
ATOM 4500  H HG22 . THR A 1 64 ? -5.988  1.757   -6.888  1.00 10.00 ? 473 THR A HG22 4  
ATOM 4501  H HG23 . THR A 1 64 ? -4.505  2.596   -7.342  1.00 10.00 ? 473 THR A HG23 4  
ATOM 4502  N N    . LYS A 1 65 ? -6.132  3.090   -11.939 1.00 10.00 ? 474 LYS A N    4  
ATOM 4503  C CA   . LYS A 1 65 ? -6.740  3.793   -13.064 1.00 10.00 ? 474 LYS A CA   4  
ATOM 4504  C C    . LYS A 1 65 ? -6.659  2.967   -14.348 1.00 10.00 ? 474 LYS A C    4  
ATOM 4505  O O    . LYS A 1 65 ? -7.159  3.384   -15.392 1.00 10.00 ? 474 LYS A O    4  
ATOM 4506  C CB   . LYS A 1 65 ? -6.057  5.145   -13.273 1.00 10.00 ? 474 LYS A CB   4  
ATOM 4507  C CG   . LYS A 1 65 ? -4.590  5.033   -13.657 1.00 10.00 ? 474 LYS A CG   4  
ATOM 4508  C CD   . LYS A 1 65 ? -3.816  6.287   -13.277 1.00 10.00 ? 474 LYS A CD   4  
ATOM 4509  C CE   . LYS A 1 65 ? -2.923  6.758   -14.415 1.00 10.00 ? 474 LYS A CE   4  
ATOM 4510  N NZ   . LYS A 1 65 ? -1.897  5.741   -14.773 1.00 10.00 ? 474 LYS A NZ   4  
ATOM 4511  H H    . LYS A 1 65 ? -5.200  3.282   -11.703 1.00 10.00 ? 474 LYS A H    4  
ATOM 4512  H HA   . LYS A 1 65 ? -7.779  3.960   -12.824 1.00 10.00 ? 474 LYS A HA   4  
ATOM 4513  H HB2  . LYS A 1 65 ? -6.572  5.677   -14.059 1.00 10.00 ? 474 LYS A HB2  4  
ATOM 4514  H HB3  . LYS A 1 65 ? -6.125  5.716   -12.359 1.00 10.00 ? 474 LYS A HB3  4  
ATOM 4515  H HG2  . LYS A 1 65 ? -4.157  4.187   -13.146 1.00 10.00 ? 474 LYS A HG2  4  
ATOM 4516  H HG3  . LYS A 1 65 ? -4.518  4.886   -14.726 1.00 10.00 ? 474 LYS A HG3  4  
ATOM 4517  H HD2  . LYS A 1 65 ? -4.516  7.072   -13.035 1.00 10.00 ? 474 LYS A HD2  4  
ATOM 4518  H HD3  . LYS A 1 65 ? -3.202  6.071   -12.416 1.00 10.00 ? 474 LYS A HD3  4  
ATOM 4519  H HE2  . LYS A 1 65 ? -3.539  6.956   -15.280 1.00 10.00 ? 474 LYS A HE2  4  
ATOM 4520  H HE3  . LYS A 1 65 ? -2.427  7.669   -14.111 1.00 10.00 ? 474 LYS A HE3  4  
ATOM 4521  H HZ1  . LYS A 1 65 ? -1.596  5.870   -15.761 1.00 10.00 ? 474 LYS A HZ1  4  
ATOM 4522  H HZ2  . LYS A 1 65 ? -2.287  4.784   -14.664 1.00 10.00 ? 474 LYS A HZ2  4  
ATOM 4523  H HZ3  . LYS A 1 65 ? -1.067  5.837   -14.154 1.00 10.00 ? 474 LYS A HZ3  4  
ATOM 4524  N N    . LYS A 1 66 ? -6.032  1.796   -14.267 1.00 10.00 ? 475 LYS A N    4  
ATOM 4525  C CA   . LYS A 1 66 ? -5.897  0.925   -15.429 1.00 10.00 ? 475 LYS A CA   4  
ATOM 4526  C C    . LYS A 1 66 ? -7.252  0.370   -15.853 1.00 10.00 ? 475 LYS A C    4  
ATOM 4527  O O    . LYS A 1 66 ? -7.499  0.148   -17.039 1.00 10.00 ? 475 LYS A O    4  
ATOM 4528  C CB   . LYS A 1 66 ? -4.935  -0.224  -15.121 1.00 10.00 ? 475 LYS A CB   4  
ATOM 4529  C CG   . LYS A 1 66 ? -4.275  -0.813  -16.357 1.00 10.00 ? 475 LYS A CG   4  
ATOM 4530  C CD   . LYS A 1 66 ? -3.227  0.126   -16.931 1.00 10.00 ? 475 LYS A CD   4  
ATOM 4531  C CE   . LYS A 1 66 ? -3.769  0.905   -18.120 1.00 10.00 ? 475 LYS A CE   4  
ATOM 4532  N NZ   . LYS A 1 66 ? -3.226  2.291   -18.170 1.00 10.00 ? 475 LYS A NZ   4  
ATOM 4533  H H    . LYS A 1 66 ? -5.653  1.511   -13.411 1.00 10.00 ? 475 LYS A H    4  
ATOM 4534  H HA   . LYS A 1 66 ? -5.492  1.514   -16.238 1.00 10.00 ? 475 LYS A HA   4  
ATOM 4535  H HB2  . LYS A 1 66 ? -4.158  0.139   -14.463 1.00 10.00 ? 475 LYS A HB2  4  
ATOM 4536  H HB3  . LYS A 1 66 ? -5.480  -1.010  -14.620 1.00 10.00 ? 475 LYS A HB3  4  
ATOM 4537  H HG2  . LYS A 1 66 ? -3.801  -1.745  -16.091 1.00 10.00 ? 475 LYS A HG2  4  
ATOM 4538  H HG3  . LYS A 1 66 ? -5.034  -0.995  -17.105 1.00 10.00 ? 475 LYS A HG3  4  
ATOM 4539  H HD2  . LYS A 1 66 ? -2.924  0.824   -16.165 1.00 10.00 ? 475 LYS A HD2  4  
ATOM 4540  H HD3  . LYS A 1 66 ? -2.374  -0.455  -17.251 1.00 10.00 ? 475 LYS A HD3  4  
ATOM 4541  H HE2  . LYS A 1 66 ? -3.495  0.389   -19.028 1.00 10.00 ? 475 LYS A HE2  4  
ATOM 4542  H HE3  . LYS A 1 66 ? -4.845  0.951   -18.043 1.00 10.00 ? 475 LYS A HE3  4  
ATOM 4543  H HZ1  . LYS A 1 66 ? -2.202  2.280   -17.988 1.00 10.00 ? 475 LYS A HZ1  4  
ATOM 4544  H HZ2  . LYS A 1 66 ? -3.688  2.882   -17.450 1.00 10.00 ? 475 LYS A HZ2  4  
ATOM 4545  H HZ3  . LYS A 1 66 ? -3.397  2.708   -19.106 1.00 10.00 ? 475 LYS A HZ3  4  
ATOM 4546  N N    . ASN A 1 67 ? -8.126  0.143   -14.878 1.00 10.00 ? 476 ASN A N    4  
ATOM 4547  C CA   . ASN A 1 67 ? -9.456  -0.390  -15.152 1.00 10.00 ? 476 ASN A CA   4  
ATOM 4548  C C    . ASN A 1 67 ? -10.555 0.539   -14.632 1.00 10.00 ? 476 ASN A C    4  
ATOM 4549  O O    . ASN A 1 67 ? -11.738 0.306   -14.881 1.00 10.00 ? 476 ASN A O    4  
ATOM 4550  C CB   . ASN A 1 67 ? -9.608  -1.775  -14.521 1.00 10.00 ? 476 ASN A CB   4  
ATOM 4551  C CG   . ASN A 1 67 ? -9.097  -2.881  -15.424 1.00 10.00 ? 476 ASN A CG   4  
ATOM 4552  O OD1  . ASN A 1 67 ? -8.085  -3.518  -15.133 1.00 10.00 ? 476 ASN A OD1  4  
ATOM 4553  N ND2  . ASN A 1 67 ? -9.797  -3.114  -16.528 1.00 10.00 ? 476 ASN A ND2  4  
ATOM 4554  H H    . ASN A 1 67 ? -7.870  0.337   -13.952 1.00 10.00 ? 476 ASN A H    4  
ATOM 4555  H HA   . ASN A 1 67 ? -9.560  -0.483  -16.223 1.00 10.00 ? 476 ASN A HA   4  
ATOM 4556  H HB2  . ASN A 1 67 ? -9.053  -1.806  -13.596 1.00 10.00 ? 476 ASN A HB2  4  
ATOM 4557  H HB3  . ASN A 1 67 ? -10.653 -1.958  -14.314 1.00 10.00 ? 476 ASN A HB3  4  
ATOM 4558  H HD21 . ASN A 1 67 ? -10.593 -2.568  -16.696 1.00 10.00 ? 476 ASN A HD21 4  
ATOM 4559  H HD22 . ASN A 1 67 ? -9.489  -3.823  -17.130 1.00 10.00 ? 476 ASN A HD22 4  
ATOM 4560  N N    . GLU A 1 68 ? -10.165 1.588   -13.910 1.00 10.00 ? 477 GLU A N    4  
ATOM 4561  C CA   . GLU A 1 68 ? -11.131 2.536   -13.364 1.00 10.00 ? 477 GLU A CA   4  
ATOM 4562  C C    . GLU A 1 68 ? -11.007 3.896   -14.043 1.00 10.00 ? 477 GLU A C    4  
ATOM 4563  O O    . GLU A 1 68 ? -11.994 4.617   -14.193 1.00 10.00 ? 477 GLU A O    4  
ATOM 4564  C CB   . GLU A 1 68 ? -10.931 2.687   -11.856 1.00 10.00 ? 477 GLU A CB   4  
ATOM 4565  C CG   . GLU A 1 68 ? -11.159 1.400   -11.080 1.00 10.00 ? 477 GLU A CG   4  
ATOM 4566  C CD   . GLU A 1 68 ? -12.561 1.303   -10.512 1.00 10.00 ? 477 GLU A CD   4  
ATOM 4567  O OE1  . GLU A 1 68 ? -13.458 2.006   -11.022 1.00 10.00 ? 477 GLU A OE1  4  
ATOM 4568  O OE2  . GLU A 1 68 ? -12.763 0.523   -9.557  1.00 10.00 ? 477 GLU A OE2  4  
ATOM 4569  H H    . GLU A 1 68 ? -9.211  1.727   -13.739 1.00 10.00 ? 477 GLU A H    4  
ATOM 4570  H HA   . GLU A 1 68 ? -12.120 2.144   -13.548 1.00 10.00 ? 477 GLU A HA   4  
ATOM 4571  H HB2  . GLU A 1 68 ? -9.920  3.019   -11.670 1.00 10.00 ? 477 GLU A HB2  4  
ATOM 4572  H HB3  . GLU A 1 68 ? -11.619 3.432   -11.485 1.00 10.00 ? 477 GLU A HB3  4  
ATOM 4573  H HG2  . GLU A 1 68 ? -10.996 0.562   -11.741 1.00 10.00 ? 477 GLU A HG2  4  
ATOM 4574  H HG3  . GLU A 1 68 ? -10.451 1.356   -10.264 1.00 10.00 ? 477 GLU A HG3  4  
ATOM 4575  N N    . ASN A 1 69 ? -9.791  4.241   -14.451 1.00 10.00 ? 478 ASN A N    4  
ATOM 4576  C CA   . ASN A 1 69 ? -9.538  5.516   -15.113 1.00 10.00 ? 478 ASN A CA   4  
ATOM 4577  C C    . ASN A 1 69 ? -9.947  6.683   -14.219 1.00 10.00 ? 478 ASN A C    4  
ATOM 4578  O O    . ASN A 1 69 ? -11.099 7.120   -14.240 1.00 10.00 ? 478 ASN A O    4  
ATOM 4579  C CB   . ASN A 1 69 ? -10.296 5.584   -16.440 1.00 10.00 ? 478 ASN A CB   4  
ATOM 4580  C CG   . ASN A 1 69 ? -9.643  6.527   -17.431 1.00 10.00 ? 478 ASN A CG   4  
ATOM 4581  O OD1  . ASN A 1 69 ? -10.286 7.436   -17.957 1.00 10.00 ? 478 ASN A OD1  4  
ATOM 4582  N ND2  . ASN A 1 69 ? -8.359  6.315   -17.691 1.00 10.00 ? 478 ASN A ND2  4  
ATOM 4583  H H    . ASN A 1 69 ? -9.045  3.625   -14.303 1.00 10.00 ? 478 ASN A H    4  
ATOM 4584  H HA   . ASN A 1 69 ? -8.479  5.583   -15.309 1.00 10.00 ? 478 ASN A HA   4  
ATOM 4585  H HB2  . ASN A 1 69 ? -10.331 4.598   -16.879 1.00 10.00 ? 478 ASN A HB2  4  
ATOM 4586  H HB3  . ASN A 1 69 ? -11.304 5.927   -16.254 1.00 10.00 ? 478 ASN A HB3  4  
ATOM 4587  H HD21 . ASN A 1 69 ? -7.910  5.572   -17.236 1.00 10.00 ? 478 ASN A HD21 4  
ATOM 4588  H HD22 . ASN A 1 69 ? -7.911  6.910   -18.329 1.00 10.00 ? 478 ASN A HD22 4  
ATOM 4589  N N    . TYR A 1 70 ? -8.998  7.186   -13.437 1.00 10.00 ? 479 TYR A N    4  
ATOM 4590  C CA   . TYR A 1 70 ? -9.260  8.302   -12.537 1.00 10.00 ? 479 TYR A CA   4  
ATOM 4591  C C    . TYR A 1 70 ? -7.975  9.063   -12.223 1.00 10.00 ? 479 TYR A C    4  
ATOM 4592  O O    . TYR A 1 70 ? -7.031  8.503   -11.663 1.00 10.00 ? 479 TYR A O    4  
ATOM 4593  C CB   . TYR A 1 70 ? -9.910  7.801   -11.243 1.00 10.00 ? 479 TYR A CB   4  
ATOM 4594  C CG   . TYR A 1 70 ? -8.951  7.108   -10.299 1.00 10.00 ? 479 TYR A CG   4  
ATOM 4595  C CD1  . TYR A 1 70 ? -8.563  5.791   -10.511 1.00 10.00 ? 479 TYR A CD1  4  
ATOM 4596  C CD2  . TYR A 1 70 ? -8.434  7.775   -9.196  1.00 10.00 ? 479 TYR A CD2  4  
ATOM 4597  C CE1  . TYR A 1 70 ? -7.688  5.157   -9.648  1.00 10.00 ? 479 TYR A CE1  4  
ATOM 4598  C CE2  . TYR A 1 70 ? -7.557  7.149   -8.331  1.00 10.00 ? 479 TYR A CE2  4  
ATOM 4599  C CZ   . TYR A 1 70 ? -7.187  5.842   -8.560  1.00 10.00 ? 479 TYR A CZ   4  
ATOM 4600  O OH   . TYR A 1 70 ? -6.318  5.218   -7.697  1.00 10.00 ? 479 TYR A OH   4  
ATOM 4601  H H    . TYR A 1 70 ? -8.099  6.796   -13.465 1.00 10.00 ? 479 TYR A H    4  
ATOM 4602  H HA   . TYR A 1 70 ? -9.945  8.972   -13.035 1.00 10.00 ? 479 TYR A HA   4  
ATOM 4603  H HB2  . TYR A 1 70 ? -10.341 8.640   -10.718 1.00 10.00 ? 479 TYR A HB2  4  
ATOM 4604  H HB3  . TYR A 1 70 ? -10.694 7.099   -11.493 1.00 10.00 ? 479 TYR A HB3  4  
ATOM 4605  H HD1  . TYR A 1 70 ? -8.956  5.259   -11.365 1.00 10.00 ? 479 TYR A HD1  4  
ATOM 4606  H HD2  . TYR A 1 70 ? -8.725  8.800   -9.017  1.00 10.00 ? 479 TYR A HD2  4  
ATOM 4607  H HE1  . TYR A 1 70 ? -7.396  4.133   -9.831  1.00 10.00 ? 479 TYR A HE1  4  
ATOM 4608  H HE2  . TYR A 1 70 ? -7.165  7.685   -7.479  1.00 10.00 ? 479 TYR A HE2  4  
ATOM 4609  H HH   . TYR A 1 70 ? -5.546  5.772   -7.562  1.00 10.00 ? 479 TYR A HH   4  
ATOM 4610  N N    . LYS A 1 71 ? -7.946  10.340  -12.584 1.00 10.00 ? 480 LYS A N    4  
ATOM 4611  C CA   . LYS A 1 71 ? -6.777  11.176  -12.340 1.00 10.00 ? 480 LYS A CA   4  
ATOM 4612  C C    . LYS A 1 71 ? -7.187  12.623  -12.085 1.00 10.00 ? 480 LYS A C    4  
ATOM 4613  O O    . LYS A 1 71 ? -7.833  13.220  -12.974 1.00 10.00 ? 480 LYS A O    4  
ATOM 4614  C CB   . LYS A 1 71 ? -5.816  11.108  -13.527 1.00 10.00 ? 480 LYS A CB   4  
ATOM 4615  C CG   . LYS A 1 71 ? -4.539  11.905  -13.323 1.00 10.00 ? 480 LYS A CG   4  
ATOM 4616  C CD   . LYS A 1 71 ? -4.068  12.546  -14.619 1.00 10.00 ? 480 LYS A CD   4  
ATOM 4617  C CE   . LYS A 1 71 ? -3.080  11.656  -15.353 1.00 10.00 ? 480 LYS A CE   4  
ATOM 4618  N NZ   . LYS A 1 71 ? -2.057  12.451  -16.089 1.00 10.00 ? 480 LYS A NZ   4  
ATOM 4619  O OXT  . LYS A 1 71 ? -6.861  13.149  -11.000 1.00 10.00 ? 480 LYS A OXT  4  
ATOM 4620  H H    . LYS A 1 71 ? -8.729  10.729  -13.026 1.00 10.00 ? 480 LYS A H    4  
ATOM 4621  H HA   . LYS A 1 71 ? -6.277  10.797  -11.461 1.00 10.00 ? 480 LYS A HA   4  
ATOM 4622  H HB2  . LYS A 1 71 ? -5.548  10.075  -13.699 1.00 10.00 ? 480 LYS A HB2  4  
ATOM 4623  H HB3  . LYS A 1 71 ? -6.318  11.491  -14.404 1.00 10.00 ? 480 LYS A HB3  4  
ATOM 4624  H HG2  . LYS A 1 71 ? -4.722  12.682  -12.596 1.00 10.00 ? 480 LYS A HG2  4  
ATOM 4625  H HG3  . LYS A 1 71 ? -3.767  11.243  -12.958 1.00 10.00 ? 480 LYS A HG3  4  
ATOM 4626  H HD2  . LYS A 1 71 ? -4.924  12.719  -15.255 1.00 10.00 ? 480 LYS A HD2  4  
ATOM 4627  H HD3  . LYS A 1 71 ? -3.591  13.488  -14.390 1.00 10.00 ? 480 LYS A HD3  4  
ATOM 4628  H HE2  . LYS A 1 71 ? -2.581  11.023  -14.635 1.00 10.00 ? 480 LYS A HE2  4  
ATOM 4629  H HE3  . LYS A 1 71 ? -3.621  11.043  -16.059 1.00 10.00 ? 480 LYS A HE3  4  
ATOM 4630  H HZ1  . LYS A 1 71 ? -1.609  13.137  -15.448 1.00 10.00 ? 480 LYS A HZ1  4  
ATOM 4631  H HZ2  . LYS A 1 71 ? -2.502  12.966  -16.875 1.00 10.00 ? 480 LYS A HZ2  4  
ATOM 4632  H HZ3  . LYS A 1 71 ? -1.323  11.821  -16.474 1.00 10.00 ? 480 LYS A HZ3  4  
ATOM 4633  N N    . ASN A 1 4  ? -1.421  3.922   22.775  1.00 10.00 ? 413 ASN A N    5  
ATOM 4634  C CA   . ASN A 1 4  ? -0.080  3.948   22.201  1.00 10.00 ? 413 ASN A CA   5  
ATOM 4635  C C    . ASN A 1 4  ? 0.177   5.265   21.476  1.00 10.00 ? 413 ASN A C    5  
ATOM 4636  O O    . ASN A 1 4  ? 1.252   5.852   21.595  1.00 10.00 ? 413 ASN A O    5  
ATOM 4637  C CB   . ASN A 1 4  ? 0.108   2.776   21.236  1.00 10.00 ? 413 ASN A CB   5  
ATOM 4638  C CG   . ASN A 1 4  ? 0.170   1.441   21.953  1.00 10.00 ? 413 ASN A CG   5  
ATOM 4639  O OD1  . ASN A 1 4  ? -0.762  1.060   22.660  1.00 10.00 ? 413 ASN A OD1  5  
ATOM 4640  N ND2  . ASN A 1 4  ? 1.273   0.724   21.772  1.00 10.00 ? 413 ASN A ND2  5  
ATOM 4641  H H    . ASN A 1 4  ? -2.191  3.799   22.181  1.00 10.00 ? 413 ASN A H    5  
ATOM 4642  H HA   . ASN A 1 4  ? 0.629   3.853   23.011  1.00 10.00 ? 413 ASN A HA   5  
ATOM 4643  H HB2  . ASN A 1 4  ? -0.719  2.753   20.543  1.00 10.00 ? 413 ASN A HB2  5  
ATOM 4644  H HB3  . ASN A 1 4  ? 1.029   2.914   20.688  1.00 10.00 ? 413 ASN A HB3  5  
ATOM 4645  H HD21 . ASN A 1 4  ? 1.976   1.092   21.196  1.00 10.00 ? 413 ASN A HD21 5  
ATOM 4646  H HD22 . ASN A 1 4  ? 1.340   -0.143  22.224  1.00 10.00 ? 413 ASN A HD22 5  
ATOM 4647  N N    . GLY A 1 5  ? -0.819  5.725   20.725  1.00 10.00 ? 414 GLY A N    5  
ATOM 4648  C CA   . GLY A 1 5  ? -0.681  6.969   19.992  1.00 10.00 ? 414 GLY A CA   5  
ATOM 4649  C C    . GLY A 1 5  ? -1.682  7.090   18.860  1.00 10.00 ? 414 GLY A C    5  
ATOM 4650  O O    . GLY A 1 5  ? -2.867  7.334   19.094  1.00 10.00 ? 414 GLY A O    5  
ATOM 4651  H H    . GLY A 1 5  ? -1.653  5.214   20.669  1.00 10.00 ? 414 GLY A H    5  
ATOM 4652  H HA2  . GLY A 1 5  ? -0.825  7.794   20.675  1.00 10.00 ? 414 GLY A HA2  5  
ATOM 4653  H HA3  . GLY A 1 5  ? 0.317   7.024   19.582  1.00 10.00 ? 414 GLY A HA3  5  
ATOM 4654  N N    . LEU A 1 6  ? -1.207  6.919   17.631  1.00 10.00 ? 415 LEU A N    5  
ATOM 4655  C CA   . LEU A 1 6  ? -2.068  7.010   16.458  1.00 10.00 ? 415 LEU A CA   5  
ATOM 4656  C C    . LEU A 1 6  ? -2.249  5.642   15.808  1.00 10.00 ? 415 LEU A C    5  
ATOM 4657  O O    . LEU A 1 6  ? -3.311  5.337   15.266  1.00 10.00 ? 415 LEU A O    5  
ATOM 4658  C CB   . LEU A 1 6  ? -1.484  7.996   15.445  1.00 10.00 ? 415 LEU A CB   5  
ATOM 4659  C CG   . LEU A 1 6  ? -0.072  7.663   14.958  1.00 10.00 ? 415 LEU A CG   5  
ATOM 4660  C CD1  . LEU A 1 6  ? 0.108   8.090   13.510  1.00 10.00 ? 415 LEU A CD1  5  
ATOM 4661  C CD2  . LEU A 1 6  ? 0.967   8.332   15.846  1.00 10.00 ? 415 LEU A CD2  5  
ATOM 4662  H H    . LEU A 1 6  ? -0.253  6.727   17.510  1.00 10.00 ? 415 LEU A H    5  
ATOM 4663  H HA   . LEU A 1 6  ? -3.033  7.371   16.783  1.00 10.00 ? 415 LEU A HA   5  
ATOM 4664  H HB2  . LEU A 1 6  ? -2.140  8.029   14.587  1.00 10.00 ? 415 LEU A HB2  5  
ATOM 4665  H HB3  . LEU A 1 6  ? -1.462  8.975   15.898  1.00 10.00 ? 415 LEU A HB3  5  
ATOM 4666  H HG   . LEU A 1 6  ? 0.079   6.595   15.013  1.00 10.00 ? 415 LEU A HG   5  
ATOM 4667  H HD11 . LEU A 1 6  ? 0.823   7.439   13.029  1.00 10.00 ? 415 LEU A HD11 5  
ATOM 4668  H HD12 . LEU A 1 6  ? 0.469   9.108   13.476  1.00 10.00 ? 415 LEU A HD12 5  
ATOM 4669  H HD13 . LEU A 1 6  ? -0.839  8.026   12.996  1.00 10.00 ? 415 LEU A HD13 5  
ATOM 4670  H HD21 . LEU A 1 6  ? 0.538   9.211   16.304  1.00 10.00 ? 415 LEU A HD21 5  
ATOM 4671  H HD22 . LEU A 1 6  ? 1.820   8.618   15.249  1.00 10.00 ? 415 LEU A HD22 5  
ATOM 4672  H HD23 . LEU A 1 6  ? 1.281   7.643   16.615  1.00 10.00 ? 415 LEU A HD23 5  
ATOM 4673  N N    . MET A 1 7  ? -1.205  4.822   15.867  1.00 10.00 ? 416 MET A N    5  
ATOM 4674  C CA   . MET A 1 7  ? -1.249  3.486   15.284  1.00 10.00 ? 416 MET A CA   5  
ATOM 4675  C C    . MET A 1 7  ? 0.043   2.727   15.565  1.00 10.00 ? 416 MET A C    5  
ATOM 4676  O O    . MET A 1 7  ? 1.081   3.329   15.842  1.00 10.00 ? 416 MET A O    5  
ATOM 4677  C CB   . MET A 1 7  ? -1.485  3.573   13.775  1.00 10.00 ? 416 MET A CB   5  
ATOM 4678  C CG   . MET A 1 7  ? -2.214  2.367   13.203  1.00 10.00 ? 416 MET A CG   5  
ATOM 4679  S SD   . MET A 1 7  ? -2.616  2.564   11.456  1.00 10.00 ? 416 MET A SD   5  
ATOM 4680  C CE   . MET A 1 7  ? -4.397  2.369   11.495  1.00 10.00 ? 416 MET A CE   5  
ATOM 4681  H H    . MET A 1 7  ? -0.385  5.122   16.313  1.00 10.00 ? 416 MET A H    5  
ATOM 4682  H HA   . MET A 1 7  ? -2.071  2.953   15.738  1.00 10.00 ? 416 MET A HA   5  
ATOM 4683  H HB2  . MET A 1 7  ? -2.072  4.454   13.565  1.00 10.00 ? 416 MET A HB2  5  
ATOM 4684  H HB3  . MET A 1 7  ? -0.530  3.659   13.277  1.00 10.00 ? 416 MET A HB3  5  
ATOM 4685  H HG2  . MET A 1 7  ? -1.585  1.497   13.316  1.00 10.00 ? 416 MET A HG2  5  
ATOM 4686  H HG3  . MET A 1 7  ? -3.130  2.222   13.755  1.00 10.00 ? 416 MET A HG3  5  
ATOM 4687  H HE1  . MET A 1 7  ? -4.774  2.703   12.450  1.00 10.00 ? 416 MET A HE1  5  
ATOM 4688  H HE2  . MET A 1 7  ? -4.647  1.327   11.354  1.00 10.00 ? 416 MET A HE2  5  
ATOM 4689  H HE3  . MET A 1 7  ? -4.840  2.957   10.706  1.00 10.00 ? 416 MET A HE3  5  
ATOM 4690  N N    . ALA A 1 8  ? -0.028  1.401   15.492  1.00 10.00 ? 417 ALA A N    5  
ATOM 4691  C CA   . ALA A 1 8  ? 1.137   0.559   15.739  1.00 10.00 ? 417 ALA A CA   5  
ATOM 4692  C C    . ALA A 1 8  ? 0.841   -0.897  15.398  1.00 10.00 ? 417 ALA A C    5  
ATOM 4693  O O    . ALA A 1 8  ? -0.276  -1.240  15.010  1.00 10.00 ? 417 ALA A O    5  
ATOM 4694  C CB   . ALA A 1 8  ? 1.581   0.685   17.188  1.00 10.00 ? 417 ALA A CB   5  
ATOM 4695  H H    . ALA A 1 8  ? -0.882  0.980   15.268  1.00 10.00 ? 417 ALA A H    5  
ATOM 4696  H HA   . ALA A 1 8  ? 1.941   0.910   15.108  1.00 10.00 ? 417 ALA A HA   5  
ATOM 4697  H HB1  . ALA A 1 8  ? 1.821   1.716   17.403  1.00 10.00 ? 417 ALA A HB1  5  
ATOM 4698  H HB2  . ALA A 1 8  ? 2.455   0.070   17.351  1.00 10.00 ? 417 ALA A HB2  5  
ATOM 4699  H HB3  . ALA A 1 8  ? 0.783   0.357   17.839  1.00 10.00 ? 417 ALA A HB3  5  
ATOM 4700  N N    . ASP A 1 9  ? 1.850   -1.750  15.544  1.00 10.00 ? 418 ASP A N    5  
ATOM 4701  C CA   . ASP A 1 9  ? 1.697   -3.171  15.250  1.00 10.00 ? 418 ASP A CA   5  
ATOM 4702  C C    . ASP A 1 9  ? 1.309   -3.387  13.789  1.00 10.00 ? 418 ASP A C    5  
ATOM 4703  O O    . ASP A 1 9  ? 0.128   -3.376  13.445  1.00 10.00 ? 418 ASP A O    5  
ATOM 4704  C CB   . ASP A 1 9  ? 0.639   -3.789  16.166  1.00 10.00 ? 418 ASP A CB   5  
ATOM 4705  C CG   . ASP A 1 9  ? 1.226   -4.298  17.468  1.00 10.00 ? 418 ASP A CG   5  
ATOM 4706  O OD1  . ASP A 1 9  ? 2.188   -5.094  17.414  1.00 10.00 ? 418 ASP A OD1  5  
ATOM 4707  O OD2  . ASP A 1 9  ? 0.724   -3.903  18.541  1.00 10.00 ? 418 ASP A OD2  5  
ATOM 4708  H H    . ASP A 1 9  ? 2.716   -1.418  15.856  1.00 10.00 ? 418 ASP A H    5  
ATOM 4709  H HA   . ASP A 1 9  ? 2.645   -3.652  15.436  1.00 10.00 ? 418 ASP A HA   5  
ATOM 4710  H HB2  . ASP A 1 9  ? -0.109  -3.045  16.397  1.00 10.00 ? 418 ASP A HB2  5  
ATOM 4711  H HB3  . ASP A 1 9  ? 0.169   -4.618  15.656  1.00 10.00 ? 418 ASP A HB3  5  
ATOM 4712  N N    . PRO A 1 10 ? 2.304   -3.585  12.906  1.00 10.00 ? 419 PRO A N    5  
ATOM 4713  C CA   . PRO A 1 10 ? 2.060   -3.804  11.476  1.00 10.00 ? 419 PRO A CA   5  
ATOM 4714  C C    . PRO A 1 10 ? 1.007   -4.879  11.225  1.00 10.00 ? 419 PRO A C    5  
ATOM 4715  O O    . PRO A 1 10 ? 1.072   -5.970  11.792  1.00 10.00 ? 419 PRO A O    5  
ATOM 4716  C CB   . PRO A 1 10 ? 3.422   -4.255  10.950  1.00 10.00 ? 419 PRO A CB   5  
ATOM 4717  C CG   . PRO A 1 10 ? 4.408   -3.641  11.881  1.00 10.00 ? 419 PRO A CG   5  
ATOM 4718  C CD   . PRO A 1 10 ? 3.744   -3.613  13.231  1.00 10.00 ? 419 PRO A CD   5  
ATOM 4719  H HA   . PRO A 1 10 ? 1.763   -2.890  10.983  1.00 10.00 ? 419 PRO A HA   5  
ATOM 4720  H HB2  . PRO A 1 10 ? 3.479   -5.334  10.967  1.00 10.00 ? 419 PRO A HB2  5  
ATOM 4721  H HB3  . PRO A 1 10 ? 3.558   -3.897  9.940   1.00 10.00 ? 419 PRO A HB3  5  
ATOM 4722  H HG2  . PRO A 1 10 ? 5.304   -4.243  11.916  1.00 10.00 ? 419 PRO A HG2  5  
ATOM 4723  H HG3  . PRO A 1 10 ? 4.642   -2.636  11.558  1.00 10.00 ? 419 PRO A HG3  5  
ATOM 4724  H HD2  . PRO A 1 10 ? 3.995   -4.501  13.792  1.00 10.00 ? 419 PRO A HD2  5  
ATOM 4725  H HD3  . PRO A 1 10 ? 4.032   -2.727  13.775  1.00 10.00 ? 419 PRO A HD3  5  
ATOM 4726  N N    . MET A 1 11 ? 0.039   -4.563  10.372  1.00 10.00 ? 420 MET A N    5  
ATOM 4727  C CA   . MET A 1 11 ? -1.029  -5.499  10.045  1.00 10.00 ? 420 MET A CA   5  
ATOM 4728  C C    . MET A 1 11 ? -1.144  -5.678  8.539   1.00 10.00 ? 420 MET A C    5  
ATOM 4729  O O    . MET A 1 11 ? -0.590  -6.624  7.986   1.00 10.00 ? 420 MET A O    5  
ATOM 4730  C CB   . MET A 1 11 ? -2.357  -5.013  10.634  1.00 10.00 ? 420 MET A CB   5  
ATOM 4731  C CG   . MET A 1 11 ? -2.890  -5.900  11.747  1.00 10.00 ? 420 MET A CG   5  
ATOM 4732  S SD   . MET A 1 11 ? -2.033  -5.641  13.312  1.00 10.00 ? 420 MET A SD   5  
ATOM 4733  C CE   . MET A 1 11 ? -1.705  -7.332  13.803  1.00 10.00 ? 420 MET A CE   5  
ATOM 4734  H H    . MET A 1 11 ? 0.040   -3.677  9.952   1.00 10.00 ? 420 MET A H    5  
ATOM 4735  H HA   . MET A 1 11 ? -0.780  -6.458  10.478  1.00 10.00 ? 420 MET A HA   5  
ATOM 4736  H HB2  . MET A 1 11 ? -2.216  -4.019  11.033  1.00 10.00 ? 420 MET A HB2  5  
ATOM 4737  H HB3  . MET A 1 11 ? -3.096  -4.973  9.849   1.00 10.00 ? 420 MET A HB3  5  
ATOM 4738  H HG2  . MET A 1 11 ? -3.939  -5.687  11.888  1.00 10.00 ? 420 MET A HG2  5  
ATOM 4739  H HG3  . MET A 1 11 ? -2.770  -6.933  11.453  1.00 10.00 ? 420 MET A HG3  5  
ATOM 4740  H HE1  . MET A 1 11 ? -0.956  -7.343  14.581  1.00 10.00 ? 420 MET A HE1  5  
ATOM 4741  H HE2  . MET A 1 11 ? -1.347  -7.891  12.951  1.00 10.00 ? 420 MET A HE2  5  
ATOM 4742  H HE3  . MET A 1 11 ? -2.614  -7.783  14.172  1.00 10.00 ? 420 MET A HE3  5  
ATOM 4743  N N    . LYS A 1 12 ? -1.861  -4.770  7.876   1.00 10.00 ? 421 LYS A N    5  
ATOM 4744  C CA   . LYS A 1 12 ? -2.034  -4.855  6.425   1.00 10.00 ? 421 LYS A CA   5  
ATOM 4745  C C    . LYS A 1 12 ? -0.709  -5.129  5.746   1.00 10.00 ? 421 LYS A C    5  
ATOM 4746  O O    . LYS A 1 12 ? 0.074   -4.217  5.481   1.00 10.00 ? 421 LYS A O    5  
ATOM 4747  C CB   . LYS A 1 12 ? -2.650  -3.585  5.861   1.00 10.00 ? 421 LYS A CB   5  
ATOM 4748  C CG   . LYS A 1 12 ? -2.831  -3.630  4.351   1.00 10.00 ? 421 LYS A CG   5  
ATOM 4749  C CD   . LYS A 1 12 ? -4.122  -4.319  3.968   1.00 10.00 ? 421 LYS A CD   5  
ATOM 4750  C CE   . LYS A 1 12 ? -3.879  -5.532  3.082   1.00 10.00 ? 421 LYS A CE   5  
ATOM 4751  N NZ   . LYS A 1 12 ? -2.983  -6.528  3.732   1.00 10.00 ? 421 LYS A NZ   5  
ATOM 4752  H H    . LYS A 1 12 ? -2.276  -4.035  8.370   1.00 10.00 ? 421 LYS A H    5  
ATOM 4753  H HA   . LYS A 1 12 ? -2.698  -5.679  6.223   1.00 10.00 ? 421 LYS A HA   5  
ATOM 4754  H HB2  . LYS A 1 12 ? -3.617  -3.441  6.316   1.00 10.00 ? 421 LYS A HB2  5  
ATOM 4755  H HB3  . LYS A 1 12 ? -2.013  -2.750  6.105   1.00 10.00 ? 421 LYS A HB3  5  
ATOM 4756  H HG2  . LYS A 1 12 ? -2.854  -2.622  3.970   1.00 10.00 ? 421 LYS A HG2  5  
ATOM 4757  H HG3  . LYS A 1 12 ? -2.001  -4.166  3.913   1.00 10.00 ? 421 LYS A HG3  5  
ATOM 4758  H HD2  . LYS A 1 12 ? -4.627  -4.637  4.864   1.00 10.00 ? 421 LYS A HD2  5  
ATOM 4759  H HD3  . LYS A 1 12 ? -4.738  -3.615  3.435   1.00 10.00 ? 421 LYS A HD3  5  
ATOM 4760  H HE2  . LYS A 1 12 ? -4.827  -6.002  2.869   1.00 10.00 ? 421 LYS A HE2  5  
ATOM 4761  H HE3  . LYS A 1 12 ? -3.427  -5.203  2.159   1.00 10.00 ? 421 LYS A HE3  5  
ATOM 4762  H HZ1  . LYS A 1 12 ? -2.963  -7.406  3.176   1.00 10.00 ? 421 LYS A HZ1  5  
ATOM 4763  H HZ2  . LYS A 1 12 ? -3.325  -6.746  4.689   1.00 10.00 ? 421 LYS A HZ2  5  
ATOM 4764  H HZ3  . LYS A 1 12 ? -2.017  -6.149  3.799   1.00 10.00 ? 421 LYS A HZ3  5  
ATOM 4765  N N    . VAL A 1 13 ? -0.466  -6.401  5.492   1.00 10.00 ? 422 VAL A N    5  
ATOM 4766  C CA   . VAL A 1 13 ? 0.763   -6.843  4.872   1.00 10.00 ? 422 VAL A CA   5  
ATOM 4767  C C    . VAL A 1 13 ? 0.756   -8.361  4.760   1.00 10.00 ? 422 VAL A C    5  
ATOM 4768  O O    . VAL A 1 13 ? 1.055   -8.931  3.711   1.00 10.00 ? 422 VAL A O    5  
ATOM 4769  C CB   . VAL A 1 13 ? 1.968   -6.351  5.698   1.00 10.00 ? 422 VAL A CB   5  
ATOM 4770  C CG1  . VAL A 1 13 ? 2.266   -7.276  6.872   1.00 10.00 ? 422 VAL A CG1  5  
ATOM 4771  C CG2  . VAL A 1 13 ? 3.190   -6.180  4.813   1.00 10.00 ? 422 VAL A CG2  5  
ATOM 4772  H H    . VAL A 1 13 ? -1.132  -7.067  5.745   1.00 10.00 ? 422 VAL A H    5  
ATOM 4773  H HA   . VAL A 1 13 ? 0.816   -6.412  3.887   1.00 10.00 ? 422 VAL A HA   5  
ATOM 4774  H HB   . VAL A 1 13 ? 1.701   -5.385  6.101   1.00 10.00 ? 422 VAL A HB   5  
ATOM 4775  H HG11 . VAL A 1 13 ? 1.398   -7.334  7.514   1.00 10.00 ? 422 VAL A HG11 5  
ATOM 4776  H HG12 . VAL A 1 13 ? 3.102   -6.888  7.433   1.00 10.00 ? 422 VAL A HG12 5  
ATOM 4777  H HG13 . VAL A 1 13 ? 2.507   -8.263  6.503   1.00 10.00 ? 422 VAL A HG13 5  
ATOM 4778  H HG21 . VAL A 1 13 ? 3.074   -5.295  4.206   1.00 10.00 ? 422 VAL A HG21 5  
ATOM 4779  H HG22 . VAL A 1 13 ? 3.295   -7.044  4.174   1.00 10.00 ? 422 VAL A HG22 5  
ATOM 4780  H HG23 . VAL A 1 13 ? 4.069   -6.081  5.431   1.00 10.00 ? 422 VAL A HG23 5  
ATOM 4781  N N    . TYR A 1 14 ? 0.367   -8.998  5.858   1.00 10.00 ? 423 TYR A N    5  
ATOM 4782  C CA   . TYR A 1 14 ? 0.254   -10.450 5.932   1.00 10.00 ? 423 TYR A CA   5  
ATOM 4783  C C    . TYR A 1 14 ? -0.463  -10.999 4.698   1.00 10.00 ? 423 TYR A C    5  
ATOM 4784  O O    . TYR A 1 14 ? -0.226  -12.133 4.283   1.00 10.00 ? 423 TYR A O    5  
ATOM 4785  C CB   . TYR A 1 14 ? -0.495  -10.871 7.215   1.00 10.00 ? 423 TYR A CB   5  
ATOM 4786  C CG   . TYR A 1 14 ? -1.425  -9.818  7.802   1.00 10.00 ? 423 TYR A CG   5  
ATOM 4787  C CD1  . TYR A 1 14 ? -2.003  -8.830  7.013   1.00 10.00 ? 423 TYR A CD1  5  
ATOM 4788  C CD2  . TYR A 1 14 ? -1.715  -9.811  9.161   1.00 10.00 ? 423 TYR A CD2  5  
ATOM 4789  C CE1  . TYR A 1 14 ? -2.827  -7.876  7.550   1.00 10.00 ? 423 TYR A CE1  5  
ATOM 4790  C CE2  . TYR A 1 14 ? -2.549  -8.855  9.709   1.00 10.00 ? 423 TYR A CE2  5  
ATOM 4791  C CZ   . TYR A 1 14 ? -3.099  -7.886  8.900   1.00 10.00 ? 423 TYR A CZ   5  
ATOM 4792  O OH   . TYR A 1 14 ? -3.933  -6.934  9.438   1.00 10.00 ? 423 TYR A OH   5  
ATOM 4793  H H    . TYR A 1 14 ? 0.127   -8.467  6.642   1.00 10.00 ? 423 TYR A H    5  
ATOM 4794  H HA   . TYR A 1 14 ? 1.254   -10.860 5.955   1.00 10.00 ? 423 TYR A HA   5  
ATOM 4795  H HB2  . TYR A 1 14 ? -1.088  -11.745 7.004   1.00 10.00 ? 423 TYR A HB2  5  
ATOM 4796  H HB3  . TYR A 1 14 ? 0.233   -11.116 7.974   1.00 10.00 ? 423 TYR A HB3  5  
ATOM 4797  H HD1  . TYR A 1 14 ? -1.799  -8.811  5.959   1.00 10.00 ? 423 TYR A HD1  5  
ATOM 4798  H HD2  . TYR A 1 14 ? -1.277  -10.566 9.795   1.00 10.00 ? 423 TYR A HD2  5  
ATOM 4799  H HE1  . TYR A 1 14 ? -3.234  -7.112  6.912   1.00 10.00 ? 423 TYR A HE1  5  
ATOM 4800  H HE2  . TYR A 1 14 ? -2.759  -8.865  10.766  1.00 10.00 ? 423 TYR A HE2  5  
ATOM 4801  H HH   . TYR A 1 14 ? -4.831  -7.272  9.462   1.00 10.00 ? 423 TYR A HH   5  
ATOM 4802  N N    . LYS A 1 15 ? -1.325  -10.176 4.106   1.00 10.00 ? 424 LYS A N    5  
ATOM 4803  C CA   . LYS A 1 15 ? -2.060  -10.560 2.911   1.00 10.00 ? 424 LYS A CA   5  
ATOM 4804  C C    . LYS A 1 15 ? -1.538  -9.777  1.712   1.00 10.00 ? 424 LYS A C    5  
ATOM 4805  O O    . LYS A 1 15 ? -1.572  -10.253 0.579   1.00 10.00 ? 424 LYS A O    5  
ATOM 4806  C CB   . LYS A 1 15 ? -3.557  -10.304 3.096   1.00 10.00 ? 424 LYS A CB   5  
ATOM 4807  C CG   . LYS A 1 15 ? -4.225  -11.276 4.056   1.00 10.00 ? 424 LYS A CG   5  
ATOM 4808  C CD   . LYS A 1 15 ? -4.029  -10.852 5.503   1.00 10.00 ? 424 LYS A CD   5  
ATOM 4809  C CE   . LYS A 1 15 ? -4.752  -9.549  5.805   1.00 10.00 ? 424 LYS A CE   5  
ATOM 4810  N NZ   . LYS A 1 15 ? -6.160  -9.570  5.321   1.00 10.00 ? 424 LYS A NZ   5  
ATOM 4811  H H    . LYS A 1 15 ? -1.459  -9.280  4.475   1.00 10.00 ? 424 LYS A H    5  
ATOM 4812  H HA   . LYS A 1 15 ? -1.896  -11.614 2.740   1.00 10.00 ? 424 LYS A HA   5  
ATOM 4813  H HB2  . LYS A 1 15 ? -3.695  -9.303  3.477   1.00 10.00 ? 424 LYS A HB2  5  
ATOM 4814  H HB3  . LYS A 1 15 ? -4.045  -10.386 2.137   1.00 10.00 ? 424 LYS A HB3  5  
ATOM 4815  H HG2  . LYS A 1 15 ? -5.283  -11.308 3.841   1.00 10.00 ? 424 LYS A HG2  5  
ATOM 4816  H HG3  . LYS A 1 15 ? -3.796  -12.257 3.917   1.00 10.00 ? 424 LYS A HG3  5  
ATOM 4817  H HD2  . LYS A 1 15 ? -4.417  -11.625 6.150   1.00 10.00 ? 424 LYS A HD2  5  
ATOM 4818  H HD3  . LYS A 1 15 ? -2.973  -10.719 5.689   1.00 10.00 ? 424 LYS A HD3  5  
ATOM 4819  H HE2  . LYS A 1 15 ? -4.750  -9.390  6.873   1.00 10.00 ? 424 LYS A HE2  5  
ATOM 4820  H HE3  . LYS A 1 15 ? -4.226  -8.740  5.321   1.00 10.00 ? 424 LYS A HE3  5  
ATOM 4821  H HZ1  . LYS A 1 15 ? -6.184  -9.474  4.285   1.00 10.00 ? 424 LYS A HZ1  5  
ATOM 4822  H HZ2  . LYS A 1 15 ? -6.695  -8.785  5.743   1.00 10.00 ? 424 LYS A HZ2  5  
ATOM 4823  H HZ3  . LYS A 1 15 ? -6.615  -10.468 5.586   1.00 10.00 ? 424 LYS A HZ3  5  
ATOM 4824  N N    . ASP A 1 16 ? -1.047  -8.567  1.979   1.00 10.00 ? 425 ASP A N    5  
ATOM 4825  C CA   . ASP A 1 16 ? -0.506  -7.708  0.935   1.00 10.00 ? 425 ASP A CA   5  
ATOM 4826  C C    . ASP A 1 16 ? 0.641   -8.392  0.192   1.00 10.00 ? 425 ASP A C    5  
ATOM 4827  O O    . ASP A 1 16 ? 1.003   -7.989  -0.912  1.00 10.00 ? 425 ASP A O    5  
ATOM 4828  C CB   . ASP A 1 16 ? -0.022  -6.389  1.539   1.00 10.00 ? 425 ASP A CB   5  
ATOM 4829  C CG   . ASP A 1 16 ? -0.296  -5.203  0.637   1.00 10.00 ? 425 ASP A CG   5  
ATOM 4830  O OD1  . ASP A 1 16 ? -1.211  -5.300  -0.207  1.00 10.00 ? 425 ASP A OD1  5  
ATOM 4831  O OD2  . ASP A 1 16 ? 0.403   -4.178  0.775   1.00 10.00 ? 425 ASP A OD2  5  
ATOM 4832  H H    . ASP A 1 16 ? -1.047  -8.246  2.906   1.00 10.00 ? 425 ASP A H    5  
ATOM 4833  H HA   . ASP A 1 16 ? -1.299  -7.500  0.235   1.00 10.00 ? 425 ASP A HA   5  
ATOM 4834  H HB2  . ASP A 1 16 ? -0.527  -6.225  2.478   1.00 10.00 ? 425 ASP A HB2  5  
ATOM 4835  H HB3  . ASP A 1 16 ? 1.043   -6.449  1.712   1.00 10.00 ? 425 ASP A HB3  5  
ATOM 4836  N N    . ARG A 1 17 ? 1.219   -9.427  0.797   1.00 10.00 ? 426 ARG A N    5  
ATOM 4837  C CA   . ARG A 1 17 ? 2.323   -10.147 0.171   1.00 10.00 ? 426 ARG A CA   5  
ATOM 4838  C C    . ARG A 1 17 ? 1.964   -10.558 -1.256  1.00 10.00 ? 426 ARG A C    5  
ATOM 4839  O O    . ARG A 1 17 ? 2.830   -10.636 -2.126  1.00 10.00 ? 426 ARG A O    5  
ATOM 4840  C CB   . ARG A 1 17 ? 2.697   -11.378 1.004   1.00 10.00 ? 426 ARG A CB   5  
ATOM 4841  C CG   . ARG A 1 17 ? 4.194   -11.547 1.197   1.00 10.00 ? 426 ARG A CG   5  
ATOM 4842  C CD   . ARG A 1 17 ? 4.779   -12.526 0.192   1.00 10.00 ? 426 ARG A CD   5  
ATOM 4843  N NE   . ARG A 1 17 ? 4.776   -13.897 0.695   1.00 10.00 ? 426 ARG A NE   5  
ATOM 4844  C CZ   . ARG A 1 17 ? 5.530   -14.316 1.709   1.00 10.00 ? 426 ARG A CZ   5  
ATOM 4845  N NH1  . ARG A 1 17 ? 6.349   -13.475 2.328   1.00 10.00 ? 426 ARG A NH1  5  
ATOM 4846  N NH2  . ARG A 1 17 ? 5.466   -15.581 2.104   1.00 10.00 ? 426 ARG A NH2  5  
ATOM 4847  H H    . ARG A 1 17 ? 0.900   -9.710  1.678   1.00 10.00 ? 426 ARG A H    5  
ATOM 4848  H HA   . ARG A 1 17 ? 3.171   -9.479  0.130   1.00 10.00 ? 426 ARG A HA   5  
ATOM 4849  H HB2  . ARG A 1 17 ? 2.237   -11.292 1.979   1.00 10.00 ? 426 ARG A HB2  5  
ATOM 4850  H HB3  . ARG A 1 17 ? 2.316   -12.260 0.512   1.00 10.00 ? 426 ARG A HB3  5  
ATOM 4851  H HG2  . ARG A 1 17 ? 4.676   -10.589 1.073   1.00 10.00 ? 426 ARG A HG2  5  
ATOM 4852  H HG3  . ARG A 1 17 ? 4.379   -11.918 2.196   1.00 10.00 ? 426 ARG A HG3  5  
ATOM 4853  H HD2  . ARG A 1 17 ? 4.193   -12.485 -0.714  1.00 10.00 ? 426 ARG A HD2  5  
ATOM 4854  H HD3  . ARG A 1 17 ? 5.796   -12.235 -0.026  1.00 10.00 ? 426 ARG A HD3  5  
ATOM 4855  H HE   . ARG A 1 17 ? 4.181   -14.540 0.256   1.00 10.00 ? 426 ARG A HE   5  
ATOM 4856  H HH11 . ARG A 1 17 ? 6.402   -12.521 2.035   1.00 10.00 ? 426 ARG A HH11 5  
ATOM 4857  H HH12 . ARG A 1 17 ? 6.914   -13.796 3.089   1.00 10.00 ? 426 ARG A HH12 5  
ATOM 4858  H HH21 . ARG A 1 17 ? 4.850   -16.218 1.641   1.00 10.00 ? 426 ARG A HH21 5  
ATOM 4859  H HH22 . ARG A 1 17 ? 6.033   -15.896 2.865   1.00 10.00 ? 426 ARG A HH22 5  
ATOM 4860  N N    . GLN A 1 18 ? 0.678   -10.799 -1.490  1.00 10.00 ? 427 GLN A N    5  
ATOM 4861  C CA   . GLN A 1 18 ? 0.199   -11.177 -2.817  1.00 10.00 ? 427 GLN A CA   5  
ATOM 4862  C C    . GLN A 1 18 ? -0.478  -9.989  -3.484  1.00 10.00 ? 427 GLN A C    5  
ATOM 4863  O O    . GLN A 1 18 ? -1.395  -10.144 -4.292  1.00 10.00 ? 427 GLN A O    5  
ATOM 4864  C CB   . GLN A 1 18 ? -0.769  -12.361 -2.727  1.00 10.00 ? 427 GLN A CB   5  
ATOM 4865  C CG   . GLN A 1 18 ? -0.440  -13.343 -1.610  1.00 10.00 ? 427 GLN A CG   5  
ATOM 4866  C CD   . GLN A 1 18 ? -1.016  -12.920 -0.272  1.00 10.00 ? 427 GLN A CD   5  
ATOM 4867  O OE1  . GLN A 1 18 ? -2.178  -12.521 -0.183  1.00 10.00 ? 427 GLN A OE1  5  
ATOM 4868  N NE2  . GLN A 1 18 ? -0.205  -13.008 0.778   1.00 10.00 ? 427 GLN A NE2  5  
ATOM 4869  H H    . GLN A 1 18 ? 0.033   -10.706 -0.759  1.00 10.00 ? 427 GLN A H    5  
ATOM 4870  H HA   . GLN A 1 18 ? 1.057   -11.457 -3.413  1.00 10.00 ? 427 GLN A HA   5  
ATOM 4871  H HB2  . GLN A 1 18 ? -1.767  -11.983 -2.561  1.00 10.00 ? 427 GLN A HB2  5  
ATOM 4872  H HB3  . GLN A 1 18 ? -0.750  -12.898 -3.665  1.00 10.00 ? 427 GLN A HB3  5  
ATOM 4873  H HG2  . GLN A 1 18 ? -0.844  -14.310 -1.869  1.00 10.00 ? 427 GLN A HG2  5  
ATOM 4874  H HG3  . GLN A 1 18 ? 0.634   -13.415 -1.517  1.00 10.00 ? 427 GLN A HG3  5  
ATOM 4875  H HE21 . GLN A 1 18 ? 0.705   -13.339 0.631   1.00 10.00 ? 427 GLN A HE21 5  
ATOM 4876  H HE22 . GLN A 1 18 ? -0.549  -12.737 1.655   1.00 10.00 ? 427 GLN A HE22 5  
ATOM 4877  N N    . VAL A 1 19 ? 0.000   -8.804  -3.136  1.00 10.00 ? 428 VAL A N    5  
ATOM 4878  C CA   . VAL A 1 19 ? -0.521  -7.559  -3.682  1.00 10.00 ? 428 VAL A CA   5  
ATOM 4879  C C    . VAL A 1 19 ? 0.564   -6.840  -4.459  1.00 10.00 ? 428 VAL A C    5  
ATOM 4880  O O    . VAL A 1 19 ? 0.290   -6.175  -5.456  1.00 10.00 ? 428 VAL A O    5  
ATOM 4881  C CB   . VAL A 1 19 ? -1.058  -6.644  -2.572  1.00 10.00 ? 428 VAL A CB   5  
ATOM 4882  C CG1  . VAL A 1 19 ? -1.009  -5.180  -2.985  1.00 10.00 ? 428 VAL A CG1  5  
ATOM 4883  C CG2  . VAL A 1 19 ? -2.472  -7.053  -2.196  1.00 10.00 ? 428 VAL A CG2  5  
ATOM 4884  H H    . VAL A 1 19 ? 0.736   -8.767  -2.493  1.00 10.00 ? 428 VAL A H    5  
ATOM 4885  H HA   . VAL A 1 19 ? -1.332  -7.797  -4.355  1.00 10.00 ? 428 VAL A HA   5  
ATOM 4886  H HB   . VAL A 1 19 ? -0.427  -6.767  -1.710  1.00 10.00 ? 428 VAL A HB   5  
ATOM 4887  H HG11 . VAL A 1 19 ? -0.088  -4.738  -2.638  1.00 10.00 ? 428 VAL A HG11 5  
ATOM 4888  H HG12 . VAL A 1 19 ? -1.847  -4.654  -2.550  1.00 10.00 ? 428 VAL A HG12 5  
ATOM 4889  H HG13 . VAL A 1 19 ? -1.059  -5.108  -4.060  1.00 10.00 ? 428 VAL A HG13 5  
ATOM 4890  H HG21 . VAL A 1 19 ? -2.876  -7.700  -2.960  1.00 10.00 ? 428 VAL A HG21 5  
ATOM 4891  H HG22 . VAL A 1 19 ? -3.089  -6.172  -2.110  1.00 10.00 ? 428 VAL A HG22 5  
ATOM 4892  H HG23 . VAL A 1 19 ? -2.457  -7.575  -1.251  1.00 10.00 ? 428 VAL A HG23 5  
ATOM 4893  N N    . MET A 1 20 ? 1.804   -6.987  -4.005  1.00 10.00 ? 429 MET A N    5  
ATOM 4894  C CA   . MET A 1 20 ? 2.939   -6.364  -4.684  1.00 10.00 ? 429 MET A CA   5  
ATOM 4895  C C    . MET A 1 20 ? 2.806   -6.539  -6.198  1.00 10.00 ? 429 MET A C    5  
ATOM 4896  O O    . MET A 1 20 ? 3.290   -5.719  -6.978  1.00 10.00 ? 429 MET A O    5  
ATOM 4897  C CB   . MET A 1 20 ? 4.254   -6.982  -4.204  1.00 10.00 ? 429 MET A CB   5  
ATOM 4898  C CG   . MET A 1 20 ? 5.413   -6.001  -4.178  1.00 10.00 ? 429 MET A CG   5  
ATOM 4899  S SD   . MET A 1 20 ? 6.983   -6.766  -4.628  1.00 10.00 ? 429 MET A SD   5  
ATOM 4900  C CE   . MET A 1 20 ? 6.999   -8.178  -3.527  1.00 10.00 ? 429 MET A CE   5  
ATOM 4901  H H    . MET A 1 20 ? 1.959   -7.534  -3.203  1.00 10.00 ? 429 MET A H    5  
ATOM 4902  H HA   . MET A 1 20 ? 2.933   -5.310  -4.449  1.00 10.00 ? 429 MET A HA   5  
ATOM 4903  H HB2  . MET A 1 20 ? 4.114   -7.367  -3.205  1.00 10.00 ? 429 MET A HB2  5  
ATOM 4904  H HB3  . MET A 1 20 ? 4.516   -7.798  -4.862  1.00 10.00 ? 429 MET A HB3  5  
ATOM 4905  H HG2  . MET A 1 20 ? 5.207   -5.201  -4.874  1.00 10.00 ? 429 MET A HG2  5  
ATOM 4906  H HG3  . MET A 1 20 ? 5.500   -5.593  -3.182  1.00 10.00 ? 429 MET A HG3  5  
ATOM 4907  H HE1  . MET A 1 20 ? 6.846   -9.082  -4.098  1.00 10.00 ? 429 MET A HE1  5  
ATOM 4908  H HE2  . MET A 1 20 ? 6.209   -8.075  -2.798  1.00 10.00 ? 429 MET A HE2  5  
ATOM 4909  H HE3  . MET A 1 20 ? 7.952   -8.229  -3.021  1.00 10.00 ? 429 MET A HE3  5  
ATOM 4910  N N    . ASN A 1 21 ? 2.131   -7.619  -6.597  1.00 10.00 ? 430 ASN A N    5  
ATOM 4911  C CA   . ASN A 1 21 ? 1.908   -7.921  -8.002  1.00 10.00 ? 430 ASN A CA   5  
ATOM 4912  C C    . ASN A 1 21 ? 0.420   -8.122  -8.286  1.00 10.00 ? 430 ASN A C    5  
ATOM 4913  O O    . ASN A 1 21 ? 0.048   -8.825  -9.226  1.00 10.00 ? 430 ASN A O    5  
ATOM 4914  C CB   . ASN A 1 21 ? 2.684   -9.181  -8.387  1.00 10.00 ? 430 ASN A CB   5  
ATOM 4915  C CG   . ASN A 1 21 ? 4.125   -8.886  -8.750  1.00 10.00 ? 430 ASN A CG   5  
ATOM 4916  O OD1  . ASN A 1 21 ? 4.441   -8.601  -9.906  1.00 10.00 ? 430 ASN A OD1  5  
ATOM 4917  N ND2  . ASN A 1 21 ? 5.011   -8.953  -7.763  1.00 10.00 ? 430 ASN A ND2  5  
ATOM 4918  H H    . ASN A 1 21 ? 1.770   -8.229  -5.922  1.00 10.00 ? 430 ASN A H    5  
ATOM 4919  H HA   . ASN A 1 21 ? 2.265   -7.085  -8.585  1.00 10.00 ? 430 ASN A HA   5  
ATOM 4920  H HB2  . ASN A 1 21 ? 2.674   -9.868  -7.548  1.00 10.00 ? 430 ASN A HB2  5  
ATOM 4921  H HB3  . ASN A 1 21 ? 2.203   -9.647  -9.234  1.00 10.00 ? 430 ASN A HB3  5  
ATOM 4922  H HD21 . ASN A 1 21 ? 4.688   -9.186  -6.867  1.00 10.00 ? 430 ASN A HD21 5  
ATOM 4923  H HD22 . ASN A 1 21 ? 5.950   -8.767  -7.969  1.00 10.00 ? 430 ASN A HD22 5  
ATOM 4924  N N    . MET A 1 22 ? -0.424  -7.496  -7.467  1.00 10.00 ? 431 MET A N    5  
ATOM 4925  C CA   . MET A 1 22 ? -1.875  -7.595  -7.617  1.00 10.00 ? 431 MET A CA   5  
ATOM 4926  C C    . MET A 1 22 ? -2.592  -7.062  -6.381  1.00 10.00 ? 431 MET A C    5  
ATOM 4927  O O    . MET A 1 22 ? -3.128  -7.828  -5.580  1.00 10.00 ? 431 MET A O    5  
ATOM 4928  C CB   . MET A 1 22 ? -2.304  -9.040  -7.856  1.00 10.00 ? 431 MET A CB   5  
ATOM 4929  C CG   . MET A 1 22 ? -2.618  -9.354  -9.309  1.00 10.00 ? 431 MET A CG   5  
ATOM 4930  S SD   . MET A 1 22 ? -2.159  -11.036 -9.770  1.00 10.00 ? 431 MET A SD   5  
ATOM 4931  C CE   . MET A 1 22 ? -0.908  -10.718 -11.011 1.00 10.00 ? 431 MET A CE   5  
ATOM 4932  H H    . MET A 1 22 ? -0.062  -6.951  -6.744  1.00 10.00 ? 431 MET A H    5  
ATOM 4933  H HA   . MET A 1 22 ? -2.160  -6.998  -8.470  1.00 10.00 ? 431 MET A HA   5  
ATOM 4934  H HB2  . MET A 1 22 ? -1.513  -9.694  -7.527  1.00 10.00 ? 431 MET A HB2  5  
ATOM 4935  H HB3  . MET A 1 22 ? -3.190  -9.234  -7.267  1.00 10.00 ? 431 MET A HB3  5  
ATOM 4936  H HG2  . MET A 1 22 ? -3.678  -9.230  -9.470  1.00 10.00 ? 431 MET A HG2  5  
ATOM 4937  H HG3  . MET A 1 22 ? -2.075  -8.663  -9.937  1.00 10.00 ? 431 MET A HG3  5  
ATOM 4938  H HE1  . MET A 1 22 ? -1.112  -11.313 -11.889 1.00 10.00 ? 431 MET A HE1  5  
ATOM 4939  H HE2  . MET A 1 22 ? 0.064   -10.977 -10.618 1.00 10.00 ? 431 MET A HE2  5  
ATOM 4940  H HE3  . MET A 1 22 ? -0.921  -9.671  -11.276 1.00 10.00 ? 431 MET A HE3  5  
ATOM 4941  N N    . TRP A 1 23 ? -2.625  -5.747  -6.246  1.00 10.00 ? 432 TRP A N    5  
ATOM 4942  C CA   . TRP A 1 23 ? -3.306  -5.119  -5.124  1.00 10.00 ? 432 TRP A CA   5  
ATOM 4943  C C    . TRP A 1 23 ? -4.801  -5.267  -5.313  1.00 10.00 ? 432 TRP A C    5  
ATOM 4944  O O    . TRP A 1 23 ? -5.401  -4.647  -6.192  1.00 10.00 ? 432 TRP A O    5  
ATOM 4945  C CB   . TRP A 1 23 ? -2.923  -3.643  -4.986  1.00 10.00 ? 432 TRP A CB   5  
ATOM 4946  C CG   . TRP A 1 23 ? -1.521  -3.302  -5.418  1.00 10.00 ? 432 TRP A CG   5  
ATOM 4947  C CD1  . TRP A 1 23 ? -0.981  -3.452  -6.662  1.00 10.00 ? 432 TRP A CD1  5  
ATOM 4948  C CD2  . TRP A 1 23 ? -0.480  -2.735  -4.604  1.00 10.00 ? 432 TRP A CD2  5  
ATOM 4949  N NE1  . TRP A 1 23 ? 0.306   -2.986  -6.678  1.00 10.00 ? 432 TRP A NE1  5  
ATOM 4950  C CE2  . TRP A 1 23 ? 0.639   -2.547  -5.433  1.00 10.00 ? 432 TRP A CE2  5  
ATOM 4951  C CE3  . TRP A 1 23 ? -0.389  -2.358  -3.264  1.00 10.00 ? 432 TRP A CE3  5  
ATOM 4952  C CZ2  . TRP A 1 23 ? 1.829   -1.996  -4.970  1.00 10.00 ? 432 TRP A CZ2  5  
ATOM 4953  C CZ3  . TRP A 1 23 ? 0.796   -1.818  -2.799  1.00 10.00 ? 432 TRP A CZ3  5  
ATOM 4954  C CH2  . TRP A 1 23 ? 1.889   -1.635  -3.652  1.00 10.00 ? 432 TRP A CH2  5  
ATOM 4955  H H    . TRP A 1 23 ? -2.207  -5.193  -6.926  1.00 10.00 ? 432 TRP A H    5  
ATOM 4956  H HA   . TRP A 1 23 ? -3.037  -5.645  -4.218  1.00 10.00 ? 432 TRP A HA   5  
ATOM 4957  H HB2  . TRP A 1 23 ? -3.601  -3.053  -5.581  1.00 10.00 ? 432 TRP A HB2  5  
ATOM 4958  H HB3  . TRP A 1 23 ? -3.027  -3.356  -3.953  1.00 10.00 ? 432 TRP A HB3  5  
ATOM 4959  H HD1  . TRP A 1 23 ? -1.505  -3.870  -7.507  1.00 10.00 ? 432 TRP A HD1  5  
ATOM 4960  H HE1  . TRP A 1 23 ? 0.890   -2.971  -7.454  1.00 10.00 ? 432 TRP A HE1  5  
ATOM 4961  H HE3  . TRP A 1 23 ? -1.216  -2.495  -2.594  1.00 10.00 ? 432 TRP A HE3  5  
ATOM 4962  H HZ2  . TRP A 1 23 ? 2.671   -1.831  -5.624  1.00 10.00 ? 432 TRP A HZ2  5  
ATOM 4963  H HZ3  . TRP A 1 23 ? 0.883   -1.522  -1.765  1.00 10.00 ? 432 TRP A HZ3  5  
ATOM 4964  H HH2  . TRP A 1 23 ? 2.796   -1.213  -3.247  1.00 10.00 ? 432 TRP A HH2  5  
ATOM 4965  N N    . SER A 1 24 ? -5.387  -6.121  -4.493  1.00 10.00 ? 433 SER A N    5  
ATOM 4966  C CA   . SER A 1 24 ? -6.815  -6.398  -4.567  1.00 10.00 ? 433 SER A CA   5  
ATOM 4967  C C    . SER A 1 24 ? -7.636  -5.146  -4.302  1.00 10.00 ? 433 SER A C    5  
ATOM 4968  O O    . SER A 1 24 ? -7.236  -4.285  -3.519  1.00 10.00 ? 433 SER A O    5  
ATOM 4969  C CB   . SER A 1 24 ? -7.194  -7.492  -3.566  1.00 10.00 ? 433 SER A CB   5  
ATOM 4970  O OG   . SER A 1 24 ? -8.422  -8.103  -3.920  1.00 10.00 ? 433 SER A OG   5  
ATOM 4971  H H    . SER A 1 24 ? -4.835  -6.587  -3.826  1.00 10.00 ? 433 SER A H    5  
ATOM 4972  H HA   . SER A 1 24 ? -7.031  -6.750  -5.565  1.00 10.00 ? 433 SER A HA   5  
ATOM 4973  H HB2  . SER A 1 24 ? -6.423  -8.247  -3.552  1.00 10.00 ? 433 SER A HB2  5  
ATOM 4974  H HB3  . SER A 1 24 ? -7.291  -7.058  -2.582  1.00 10.00 ? 433 SER A HB3  5  
ATOM 4975  H HG   . SER A 1 24 ? -8.313  -9.057  -3.936  1.00 10.00 ? 433 SER A HG   5  
ATOM 4976  N N    . GLU A 1 25 ? -8.797  -5.057  -4.946  1.00 10.00 ? 434 GLU A N    5  
ATOM 4977  C CA   . GLU A 1 25 ? -9.681  -3.912  -4.760  1.00 10.00 ? 434 GLU A CA   5  
ATOM 4978  C C    . GLU A 1 25 ? -9.895  -3.658  -3.272  1.00 10.00 ? 434 GLU A C    5  
ATOM 4979  O O    . GLU A 1 25 ? -10.131 -2.528  -2.847  1.00 10.00 ? 434 GLU A O    5  
ATOM 4980  C CB   . GLU A 1 25 ? -11.025 -4.157  -5.450  1.00 10.00 ? 434 GLU A CB   5  
ATOM 4981  C CG   . GLU A 1 25 ? -11.762 -2.878  -5.815  1.00 10.00 ? 434 GLU A CG   5  
ATOM 4982  C CD   . GLU A 1 25 ? -12.490 -2.983  -7.141  1.00 10.00 ? 434 GLU A CD   5  
ATOM 4983  O OE1  . GLU A 1 25 ? -13.545 -3.651  -7.188  1.00 10.00 ? 434 GLU A OE1  5  
ATOM 4984  O OE2  . GLU A 1 25 ? -12.005 -2.400  -8.132  1.00 10.00 ? 434 GLU A OE2  5  
ATOM 4985  H H    . GLU A 1 25 ? -9.069  -5.780  -5.549  1.00 10.00 ? 434 GLU A H    5  
ATOM 4986  H HA   . GLU A 1 25 ? -9.208  -3.047  -5.199  1.00 10.00 ? 434 GLU A HA   5  
ATOM 4987  H HB2  . GLU A 1 25 ? -10.855 -4.720  -6.356  1.00 10.00 ? 434 GLU A HB2  5  
ATOM 4988  H HB3  . GLU A 1 25 ? -11.655 -4.735  -4.791  1.00 10.00 ? 434 GLU A HB3  5  
ATOM 4989  H HG2  . GLU A 1 25 ? -12.484 -2.661  -5.041  1.00 10.00 ? 434 GLU A HG2  5  
ATOM 4990  H HG3  . GLU A 1 25 ? -11.048 -2.070  -5.876  1.00 10.00 ? 434 GLU A HG3  5  
ATOM 4991  N N    . GLN A 1 26 ? -9.793  -4.728  -2.486  1.00 10.00 ? 435 GLN A N    5  
ATOM 4992  C CA   . GLN A 1 26 ? -9.956  -4.640  -1.045  1.00 10.00 ? 435 GLN A CA   5  
ATOM 4993  C C    . GLN A 1 26 ? -8.624  -4.314  -0.380  1.00 10.00 ? 435 GLN A C    5  
ATOM 4994  O O    . GLN A 1 26 ? -8.588  -3.673  0.670   1.00 10.00 ? 435 GLN A O    5  
ATOM 4995  C CB   . GLN A 1 26 ? -10.507 -5.954  -0.491  1.00 10.00 ? 435 GLN A CB   5  
ATOM 4996  C CG   . GLN A 1 26 ? -11.829 -6.369  -1.114  1.00 10.00 ? 435 GLN A CG   5  
ATOM 4997  C CD   . GLN A 1 26 ? -12.936 -5.368  -0.855  1.00 10.00 ? 435 GLN A CD   5  
ATOM 4998  O OE1  . GLN A 1 26 ? -13.819 -5.600  -0.029  1.00 10.00 ? 435 GLN A OE1  5  
ATOM 4999  N NE2  . GLN A 1 26 ? -12.896 -4.244  -1.562  1.00 10.00 ? 435 GLN A NE2  5  
ATOM 5000  H H    . GLN A 1 26 ? -9.595  -5.599  -2.888  1.00 10.00 ? 435 GLN A H    5  
ATOM 5001  H HA   . GLN A 1 26 ? -10.654 -3.845  -0.835  1.00 10.00 ? 435 GLN A HA   5  
ATOM 5002  H HB2  . GLN A 1 26 ? -9.785  -6.736  -0.673  1.00 10.00 ? 435 GLN A HB2  5  
ATOM 5003  H HB3  . GLN A 1 26 ? -10.651 -5.850  0.574   1.00 10.00 ? 435 GLN A HB3  5  
ATOM 5004  H HG2  . GLN A 1 26 ? -11.695 -6.466  -2.181  1.00 10.00 ? 435 GLN A HG2  5  
ATOM 5005  H HG3  . GLN A 1 26 ? -12.122 -7.324  -0.701  1.00 10.00 ? 435 GLN A HG3  5  
ATOM 5006  H HE21 . GLN A 1 26 ? -12.164 -4.127  -2.203  1.00 10.00 ? 435 GLN A HE21 5  
ATOM 5007  H HE22 . GLN A 1 26 ? -13.599 -3.578  -1.415  1.00 10.00 ? 435 GLN A HE22 5  
ATOM 5008  N N    . GLU A 1 27 ? -7.528  -4.749  -1.000  1.00 10.00 ? 436 GLU A N    5  
ATOM 5009  C CA   . GLU A 1 27 ? -6.209  -4.488  -0.468  1.00 10.00 ? 436 GLU A CA   5  
ATOM 5010  C C    . GLU A 1 27 ? -5.842  -3.034  -0.708  1.00 10.00 ? 436 GLU A C    5  
ATOM 5011  O O    . GLU A 1 27 ? -5.458  -2.320  0.219   1.00 10.00 ? 436 GLU A O    5  
ATOM 5012  C CB   . GLU A 1 27 ? -5.209  -5.447  -1.109  1.00 10.00 ? 436 GLU A CB   5  
ATOM 5013  C CG   . GLU A 1 27 ? -4.506  -6.343  -0.102  1.00 10.00 ? 436 GLU A CG   5  
ATOM 5014  C CD   . GLU A 1 27 ? -4.747  -7.819  -0.363  1.00 10.00 ? 436 GLU A CD   5  
ATOM 5015  O OE1  . GLU A 1 27 ? -5.769  -8.150  -1.000  1.00 10.00 ? 436 GLU A OE1  5  
ATOM 5016  O OE2  . GLU A 1 27 ? -3.914  -8.642  0.071   1.00 10.00 ? 436 GLU A OE2  5  
ATOM 5017  H H    . GLU A 1 27 ? -7.603  -5.249  -1.842  1.00 10.00 ? 436 GLU A H    5  
ATOM 5018  H HA   . GLU A 1 27 ? -6.237  -4.657  0.594   1.00 10.00 ? 436 GLU A HA   5  
ATOM 5019  H HB2  . GLU A 1 27 ? -5.736  -6.076  -1.812  1.00 10.00 ? 436 GLU A HB2  5  
ATOM 5020  H HB3  . GLU A 1 27 ? -4.466  -4.878  -1.643  1.00 10.00 ? 436 GLU A HB3  5  
ATOM 5021  H HG2  . GLU A 1 27 ? -3.444  -6.155  -0.145  1.00 10.00 ? 436 GLU A HG2  5  
ATOM 5022  H HG3  . GLU A 1 27 ? -4.872  -6.105  0.886   1.00 10.00 ? 436 GLU A HG3  5  
ATOM 5023  N N    . LYS A 1 28 ? -6.014  -2.580  -1.945  1.00 10.00 ? 437 LYS A N    5  
ATOM 5024  C CA   . LYS A 1 28 ? -5.752  -1.184  -2.286  1.00 10.00 ? 437 LYS A CA   5  
ATOM 5025  C C    . LYS A 1 28 ? -6.569  -0.283  -1.373  1.00 10.00 ? 437 LYS A C    5  
ATOM 5026  O O    . LYS A 1 28 ? -6.265  0.891   -1.203  1.00 10.00 ? 437 LYS A O    5  
ATOM 5027  C CB   . LYS A 1 28 ? -6.114  -0.917  -3.750  1.00 10.00 ? 437 LYS A CB   5  
ATOM 5028  C CG   . LYS A 1 28 ? -4.913  -0.894  -4.682  1.00 10.00 ? 437 LYS A CG   5  
ATOM 5029  C CD   . LYS A 1 28 ? -5.297  -1.295  -6.097  1.00 10.00 ? 437 LYS A CD   5  
ATOM 5030  C CE   . LYS A 1 28 ? -4.126  -1.144  -7.057  1.00 10.00 ? 437 LYS A CE   5  
ATOM 5031  N NZ   . LYS A 1 28 ? -4.230  -2.082  -8.210  1.00 10.00 ? 437 LYS A NZ   5  
ATOM 5032  H H    . LYS A 1 28 ? -6.361  -3.186  -2.630  1.00 10.00 ? 437 LYS A H    5  
ATOM 5033  H HA   . LYS A 1 28 ? -4.706  -0.973  -2.133  1.00 10.00 ? 437 LYS A HA   5  
ATOM 5034  H HB2  . LYS A 1 28 ? -6.789  -1.690  -4.088  1.00 10.00 ? 437 LYS A HB2  5  
ATOM 5035  H HB3  . LYS A 1 28 ? -6.613  0.039   -3.818  1.00 10.00 ? 437 LYS A HB3  5  
ATOM 5036  H HG2  . LYS A 1 28 ? -4.503  0.104   -4.700  1.00 10.00 ? 437 LYS A HG2  5  
ATOM 5037  H HG3  . LYS A 1 28 ? -4.169  -1.585  -4.311  1.00 10.00 ? 437 LYS A HG3  5  
ATOM 5038  H HD2  . LYS A 1 28 ? -5.618  -2.325  -6.096  1.00 10.00 ? 437 LYS A HD2  5  
ATOM 5039  H HD3  . LYS A 1 28 ? -6.108  -0.664  -6.431  1.00 10.00 ? 437 LYS A HD3  5  
ATOM 5040  H HE2  . LYS A 1 28 ? -4.109  -0.132  -7.429  1.00 10.00 ? 437 LYS A HE2  5  
ATOM 5041  H HE3  . LYS A 1 28 ? -3.211  -1.346  -6.521  1.00 10.00 ? 437 LYS A HE3  5  
ATOM 5042  H HZ1  . LYS A 1 28 ? -4.646  -2.984  -7.901  1.00 10.00 ? 437 LYS A HZ1  5  
ATOM 5043  H HZ2  . LYS A 1 28 ? -3.287  -2.266  -8.606  1.00 10.00 ? 437 LYS A HZ2  5  
ATOM 5044  H HZ3  . LYS A 1 28 ? -4.831  -1.669  -8.952  1.00 10.00 ? 437 LYS A HZ3  5  
ATOM 5045  N N    . GLU A 1 29 ? -7.606  -0.856  -0.777  1.00 10.00 ? 438 GLU A N    5  
ATOM 5046  C CA   . GLU A 1 29 ? -8.473  -0.121  0.128   1.00 10.00 ? 438 GLU A CA   5  
ATOM 5047  C C    . GLU A 1 29 ? -7.706  0.369   1.349   1.00 10.00 ? 438 GLU A C    5  
ATOM 5048  O O    . GLU A 1 29 ? -8.080  1.365   1.962   1.00 10.00 ? 438 GLU A O    5  
ATOM 5049  C CB   . GLU A 1 29 ? -9.636  -1.003  0.573   1.00 10.00 ? 438 GLU A CB   5  
ATOM 5050  C CG   . GLU A 1 29 ? -10.936 -0.243  0.776   1.00 10.00 ? 438 GLU A CG   5  
ATOM 5051  C CD   . GLU A 1 29 ? -11.623 0.095   -0.533  1.00 10.00 ? 438 GLU A CD   5  
ATOM 5052  O OE1  . GLU A 1 29 ? -11.329 1.171   -1.097  1.00 10.00 ? 438 GLU A OE1  5  
ATOM 5053  O OE2  . GLU A 1 29 ? -12.454 -0.714  -0.995  1.00 10.00 ? 438 GLU A OE2  5  
ATOM 5054  H H    . GLU A 1 29 ? -7.789  -1.806  -0.945  1.00 10.00 ? 438 GLU A H    5  
ATOM 5055  H HA   . GLU A 1 29 ? -8.862  0.734   -0.405  1.00 10.00 ? 438 GLU A HA   5  
ATOM 5056  H HB2  . GLU A 1 29 ? -9.799  -1.765  -0.174  1.00 10.00 ? 438 GLU A HB2  5  
ATOM 5057  H HB3  . GLU A 1 29 ? -9.370  -1.477  1.506   1.00 10.00 ? 438 GLU A HB3  5  
ATOM 5058  H HG2  . GLU A 1 29 ? -11.605 -0.851  1.368   1.00 10.00 ? 438 GLU A HG2  5  
ATOM 5059  H HG3  . GLU A 1 29 ? -10.723 0.675   1.302   1.00 10.00 ? 438 GLU A HG3  5  
ATOM 5060  N N    . THR A 1 30 ? -6.644  -0.341  1.711   1.00 10.00 ? 439 THR A N    5  
ATOM 5061  C CA   . THR A 1 30 ? -5.853  0.038   2.875   1.00 10.00 ? 439 THR A CA   5  
ATOM 5062  C C    . THR A 1 30 ? -4.741  1.019   2.507   1.00 10.00 ? 439 THR A C    5  
ATOM 5063  O O    . THR A 1 30 ? -4.597  2.067   3.137   1.00 10.00 ? 439 THR A O    5  
ATOM 5064  C CB   . THR A 1 30 ? -5.270  -1.208  3.543   1.00 10.00 ? 439 THR A CB   5  
ATOM 5065  O OG1  . THR A 1 30 ? -6.304  -2.102  3.918   1.00 10.00 ? 439 THR A OG1  5  
ATOM 5066  C CG2  . THR A 1 30 ? -4.459  -0.903  4.783   1.00 10.00 ? 439 THR A CG2  5  
ATOM 5067  H H    . THR A 1 30 ? -6.394  -1.141  1.194   1.00 10.00 ? 439 THR A H    5  
ATOM 5068  H HA   . THR A 1 30 ? -6.517  0.527   3.571   1.00 10.00 ? 439 THR A HA   5  
ATOM 5069  H HB   . THR A 1 30 ? -4.624  -1.715  2.838   1.00 10.00 ? 439 THR A HB   5  
ATOM 5070  H HG1  . THR A 1 30 ? -6.547  -2.645  3.164   1.00 10.00 ? 439 THR A HG1  5  
ATOM 5071  H HG21 . THR A 1 30 ? -4.315  -1.810  5.351   1.00 10.00 ? 439 THR A HG21 5  
ATOM 5072  H HG22 . THR A 1 30 ? -4.985  -0.179  5.389   1.00 10.00 ? 439 THR A HG22 5  
ATOM 5073  H HG23 . THR A 1 30 ? -3.500  -0.502  4.497   1.00 10.00 ? 439 THR A HG23 5  
ATOM 5074  N N    . PHE A 1 31 ? -3.962  0.683   1.486   1.00 10.00 ? 440 PHE A N    5  
ATOM 5075  C CA   . PHE A 1 31 ? -2.873  1.541   1.042   1.00 10.00 ? 440 PHE A CA   5  
ATOM 5076  C C    . PHE A 1 31 ? -3.419  2.774   0.329   1.00 10.00 ? 440 PHE A C    5  
ATOM 5077  O O    . PHE A 1 31 ? -2.840  3.855   0.409   1.00 10.00 ? 440 PHE A O    5  
ATOM 5078  C CB   . PHE A 1 31 ? -1.929  0.772   0.110   1.00 10.00 ? 440 PHE A CB   5  
ATOM 5079  C CG   . PHE A 1 31 ? -2.297  -0.660  -0.084  1.00 10.00 ? 440 PHE A CG   5  
ATOM 5080  C CD1  . PHE A 1 31 ? -2.210  -1.578  0.946   1.00 10.00 ? 440 PHE A CD1  5  
ATOM 5081  C CD2  . PHE A 1 31 ? -2.750  -1.078  -1.309  1.00 10.00 ? 440 PHE A CD2  5  
ATOM 5082  C CE1  . PHE A 1 31 ? -2.569  -2.889  0.739   1.00 10.00 ? 440 PHE A CE1  5  
ATOM 5083  C CE2  . PHE A 1 31 ? -3.112  -2.378  -1.520  1.00 10.00 ? 440 PHE A CE2  5  
ATOM 5084  C CZ   . PHE A 1 31 ? -3.020  -3.281  -0.502  1.00 10.00 ? 440 PHE A CZ   5  
ATOM 5085  H H    . PHE A 1 31 ? -4.121  -0.157  1.017   1.00 10.00 ? 440 PHE A H    5  
ATOM 5086  H HA   . PHE A 1 31 ? -2.325  1.859   1.916   1.00 10.00 ? 440 PHE A HA   5  
ATOM 5087  H HB2  . PHE A 1 31 ? -1.948  1.232   -0.863  1.00 10.00 ? 440 PHE A HB2  5  
ATOM 5088  H HB3  . PHE A 1 31 ? -0.927  0.808   0.504   1.00 10.00 ? 440 PHE A HB3  5  
ATOM 5089  H HD1  . PHE A 1 31 ? -1.860  -1.262  1.916   1.00 10.00 ? 440 PHE A HD1  5  
ATOM 5090  H HD2  . PHE A 1 31 ? -2.822  -0.372  -2.108  1.00 10.00 ? 440 PHE A HD2  5  
ATOM 5091  H HE1  . PHE A 1 31 ? -2.497  -3.606  1.542   1.00 10.00 ? 440 PHE A HE1  5  
ATOM 5092  H HE2  . PHE A 1 31 ? -3.473  -2.690  -2.490  1.00 10.00 ? 440 PHE A HE2  5  
ATOM 5093  H HZ   . PHE A 1 31 ? -3.310  -4.282  -0.675  1.00 10.00 ? 440 PHE A HZ   5  
ATOM 5094  N N    . ARG A 1 32 ? -4.540  2.605   -0.368  1.00 10.00 ? 441 ARG A N    5  
ATOM 5095  C CA   . ARG A 1 32 ? -5.153  3.716   -1.087  1.00 10.00 ? 441 ARG A CA   5  
ATOM 5096  C C    . ARG A 1 32 ? -5.925  4.621   -0.131  1.00 10.00 ? 441 ARG A C    5  
ATOM 5097  O O    . ARG A 1 32 ? -6.068  5.818   -0.379  1.00 10.00 ? 441 ARG A O    5  
ATOM 5098  C CB   . ARG A 1 32 ? -6.085  3.216   -2.193  1.00 10.00 ? 441 ARG A CB   5  
ATOM 5099  C CG   . ARG A 1 32 ? -6.414  4.273   -3.235  1.00 10.00 ? 441 ARG A CG   5  
ATOM 5100  C CD   . ARG A 1 32 ? -7.120  3.670   -4.439  1.00 10.00 ? 441 ARG A CD   5  
ATOM 5101  N NE   . ARG A 1 32 ? -8.238  4.497   -4.887  1.00 10.00 ? 441 ARG A NE   5  
ATOM 5102  C CZ   . ARG A 1 32 ? -9.199  4.066   -5.701  1.00 10.00 ? 441 ARG A CZ   5  
ATOM 5103  N NH1  . ARG A 1 32 ? -9.184  2.819   -6.156  1.00 10.00 ? 441 ARG A NH1  5  
ATOM 5104  N NH2  . ARG A 1 32 ? -10.180 4.882   -6.060  1.00 10.00 ? 441 ARG A NH2  5  
ATOM 5105  H H    . ARG A 1 32 ? -4.963  1.721   -0.397  1.00 10.00 ? 441 ARG A H    5  
ATOM 5106  H HA   . ARG A 1 32 ? -4.356  4.285   -1.541  1.00 10.00 ? 441 ARG A HA   5  
ATOM 5107  H HB2  . ARG A 1 32 ? -5.616  2.382   -2.693  1.00 10.00 ? 441 ARG A HB2  5  
ATOM 5108  H HB3  . ARG A 1 32 ? -7.010  2.884   -1.744  1.00 10.00 ? 441 ARG A HB3  5  
ATOM 5109  H HG2  . ARG A 1 32 ? -7.057  5.016   -2.789  1.00 10.00 ? 441 ARG A HG2  5  
ATOM 5110  H HG3  . ARG A 1 32 ? -5.495  4.738   -3.563  1.00 10.00 ? 441 ARG A HG3  5  
ATOM 5111  H HD2  . ARG A 1 32 ? -6.410  3.574   -5.245  1.00 10.00 ? 441 ARG A HD2  5  
ATOM 5112  H HD3  . ARG A 1 32 ? -7.493  2.693   -4.169  1.00 10.00 ? 441 ARG A HD3  5  
ATOM 5113  H HE   . ARG A 1 32 ? -8.274  5.422   -4.566  1.00 10.00 ? 441 ARG A HE   5  
ATOM 5114  H HH11 . ARG A 1 32 ? -8.448  2.197   -5.889  1.00 10.00 ? 441 ARG A HH11 5  
ATOM 5115  H HH12 . ARG A 1 32 ? -9.909  2.500   -6.766  1.00 10.00 ? 441 ARG A HH12 5  
ATOM 5116  H HH21 . ARG A 1 32 ? -10.197 5.823   -5.719  1.00 10.00 ? 441 ARG A HH21 5  
ATOM 5117  H HH22 . ARG A 1 32 ? -10.902 4.559   -6.670  1.00 10.00 ? 441 ARG A HH22 5  
ATOM 5118  N N    . GLU A 1 33 ? -6.423  4.045   0.965   1.00 10.00 ? 442 GLU A N    5  
ATOM 5119  C CA   . GLU A 1 33 ? -7.178  4.817   1.947   1.00 10.00 ? 442 GLU A CA   5  
ATOM 5120  C C    . GLU A 1 33 ? -6.242  5.594   2.862   1.00 10.00 ? 442 GLU A C    5  
ATOM 5121  O O    . GLU A 1 33 ? -6.537  6.725   3.247   1.00 10.00 ? 442 GLU A O    5  
ATOM 5122  C CB   . GLU A 1 33 ? -8.080  3.903   2.779   1.00 10.00 ? 442 GLU A CB   5  
ATOM 5123  C CG   . GLU A 1 33 ? -8.856  4.631   3.864   1.00 10.00 ? 442 GLU A CG   5  
ATOM 5124  C CD   . GLU A 1 33 ? -10.030 3.825   4.383   1.00 10.00 ? 442 GLU A CD   5  
ATOM 5125  O OE1  . GLU A 1 33 ? -9.811  2.934   5.230   1.00 10.00 ? 442 GLU A OE1  5  
ATOM 5126  O OE2  . GLU A 1 33 ? -11.170 4.085   3.942   1.00 10.00 ? 442 GLU A OE2  5  
ATOM 5127  H H    . GLU A 1 33 ? -6.280  3.085   1.116   1.00 10.00 ? 442 GLU A H    5  
ATOM 5128  H HA   . GLU A 1 33 ? -7.795  5.519   1.409   1.00 10.00 ? 442 GLU A HA   5  
ATOM 5129  H HB2  . GLU A 1 33 ? -8.790  3.424   2.121   1.00 10.00 ? 442 GLU A HB2  5  
ATOM 5130  H HB3  . GLU A 1 33 ? -7.470  3.145   3.249   1.00 10.00 ? 442 GLU A HB3  5  
ATOM 5131  H HG2  . GLU A 1 33 ? -8.190  4.838   4.689   1.00 10.00 ? 442 GLU A HG2  5  
ATOM 5132  H HG3  . GLU A 1 33 ? -9.226  5.562   3.460   1.00 10.00 ? 442 GLU A HG3  5  
ATOM 5133  N N    . LYS A 1 34 ? -5.109  4.990   3.200   1.00 10.00 ? 443 LYS A N    5  
ATOM 5134  C CA   . LYS A 1 34 ? -4.138  5.643   4.058   1.00 10.00 ? 443 LYS A CA   5  
ATOM 5135  C C    . LYS A 1 34 ? -3.520  6.824   3.330   1.00 10.00 ? 443 LYS A C    5  
ATOM 5136  O O    . LYS A 1 34 ? -3.315  7.886   3.909   1.00 10.00 ? 443 LYS A O    5  
ATOM 5137  C CB   . LYS A 1 34 ? -3.051  4.659   4.490   1.00 10.00 ? 443 LYS A CB   5  
ATOM 5138  C CG   . LYS A 1 34 ? -3.350  3.960   5.806   1.00 10.00 ? 443 LYS A CG   5  
ATOM 5139  C CD   . LYS A 1 34 ? -4.565  3.054   5.694   1.00 10.00 ? 443 LYS A CD   5  
ATOM 5140  C CE   . LYS A 1 34 ? -5.273  2.903   7.031   1.00 10.00 ? 443 LYS A CE   5  
ATOM 5141  N NZ   . LYS A 1 34 ? -6.434  1.974   6.943   1.00 10.00 ? 443 LYS A NZ   5  
ATOM 5142  H H    . LYS A 1 34 ? -4.918  4.093   2.858   1.00 10.00 ? 443 LYS A H    5  
ATOM 5143  H HA   . LYS A 1 34 ? -4.658  6.005   4.933   1.00 10.00 ? 443 LYS A HA   5  
ATOM 5144  H HB2  . LYS A 1 34 ? -2.936  3.906   3.724   1.00 10.00 ? 443 LYS A HB2  5  
ATOM 5145  H HB3  . LYS A 1 34 ? -2.119  5.196   4.598   1.00 10.00 ? 443 LYS A HB3  5  
ATOM 5146  H HG2  . LYS A 1 34 ? -2.495  3.362   6.088   1.00 10.00 ? 443 LYS A HG2  5  
ATOM 5147  H HG3  . LYS A 1 34 ? -3.536  4.706   6.565   1.00 10.00 ? 443 LYS A HG3  5  
ATOM 5148  H HD2  . LYS A 1 34 ? -5.255  3.479   4.980   1.00 10.00 ? 443 LYS A HD2  5  
ATOM 5149  H HD3  . LYS A 1 34 ? -4.247  2.080   5.354   1.00 10.00 ? 443 LYS A HD3  5  
ATOM 5150  H HE2  . LYS A 1 34 ? -4.570  2.519   7.754   1.00 10.00 ? 443 LYS A HE2  5  
ATOM 5151  H HE3  . LYS A 1 34 ? -5.622  3.874   7.351   1.00 10.00 ? 443 LYS A HE3  5  
ATOM 5152  H HZ1  . LYS A 1 34 ? -6.849  2.010   5.990   1.00 10.00 ? 443 LYS A HZ1  5  
ATOM 5153  H HZ2  . LYS A 1 34 ? -7.161  2.245   7.636   1.00 10.00 ? 443 LYS A HZ2  5  
ATOM 5154  H HZ3  . LYS A 1 34 ? -6.128  1.001   7.142   1.00 10.00 ? 443 LYS A HZ3  5  
ATOM 5155  N N    . PHE A 1 35 ? -3.248  6.641   2.042   1.00 10.00 ? 444 PHE A N    5  
ATOM 5156  C CA   . PHE A 1 35 ? -2.677  7.701   1.234   1.00 10.00 ? 444 PHE A CA   5  
ATOM 5157  C C    . PHE A 1 35 ? -3.670  8.839   1.148   1.00 10.00 ? 444 PHE A C    5  
ATOM 5158  O O    . PHE A 1 35 ? -3.296  10.012  1.114   1.00 10.00 ? 444 PHE A O    5  
ATOM 5159  C CB   . PHE A 1 35 ? -2.302  7.171   -0.148  1.00 10.00 ? 444 PHE A CB   5  
ATOM 5160  C CG   . PHE A 1 35 ? -1.633  8.184   -1.029  1.00 10.00 ? 444 PHE A CG   5  
ATOM 5161  C CD1  . PHE A 1 35 ? -2.330  9.282   -1.507  1.00 10.00 ? 444 PHE A CD1  5  
ATOM 5162  C CD2  . PHE A 1 35 ? -0.303  8.035   -1.378  1.00 10.00 ? 444 PHE A CD2  5  
ATOM 5163  C CE1  . PHE A 1 35 ? -1.709  10.213  -2.318  1.00 10.00 ? 444 PHE A CE1  5  
ATOM 5164  C CE2  . PHE A 1 35 ? 0.324   8.961   -2.189  1.00 10.00 ? 444 PHE A CE2  5  
ATOM 5165  C CZ   . PHE A 1 35 ? -0.380  10.053  -2.660  1.00 10.00 ? 444 PHE A CZ   5  
ATOM 5166  H H    . PHE A 1 35 ? -3.458  5.786   1.624   1.00 10.00 ? 444 PHE A H    5  
ATOM 5167  H HA   . PHE A 1 35 ? -1.787  8.059   1.732   1.00 10.00 ? 444 PHE A HA   5  
ATOM 5168  H HB2  . PHE A 1 35 ? -1.617  6.342   -0.024  1.00 10.00 ? 444 PHE A HB2  5  
ATOM 5169  H HB3  . PHE A 1 35 ? -3.193  6.824   -0.649  1.00 10.00 ? 444 PHE A HB3  5  
ATOM 5170  H HD1  . PHE A 1 35 ? -3.369  9.408   -1.240  1.00 10.00 ? 444 PHE A HD1  5  
ATOM 5171  H HD2  . PHE A 1 35 ? 0.247   7.181   -1.008  1.00 10.00 ? 444 PHE A HD2  5  
ATOM 5172  H HE1  . PHE A 1 35 ? -2.263  11.065  -2.685  1.00 10.00 ? 444 PHE A HE1  5  
ATOM 5173  H HE2  . PHE A 1 35 ? 1.363   8.833   -2.453  1.00 10.00 ? 444 PHE A HE2  5  
ATOM 5174  H HZ   . PHE A 1 35 ? 0.108   10.778  -3.293  1.00 10.00 ? 444 PHE A HZ   5  
ATOM 5175  N N    . MET A 1 36 ? -4.950  8.483   1.179   1.00 10.00 ? 445 MET A N    5  
ATOM 5176  C CA   . MET A 1 36 ? -5.999  9.477   1.175   1.00 10.00 ? 445 MET A CA   5  
ATOM 5177  C C    . MET A 1 36 ? -6.044  10.120  2.558   1.00 10.00 ? 445 MET A C    5  
ATOM 5178  O O    . MET A 1 36 ? -6.404  11.286  2.716   1.00 10.00 ? 445 MET A O    5  
ATOM 5179  C CB   . MET A 1 36 ? -7.349  8.846   0.830   1.00 10.00 ? 445 MET A CB   5  
ATOM 5180  C CG   . MET A 1 36 ? -8.498  9.841   0.805   1.00 10.00 ? 445 MET A CG   5  
ATOM 5181  S SD   . MET A 1 36 ? -8.775  10.542  -0.832  1.00 10.00 ? 445 MET A SD   5  
ATOM 5182  C CE   . MET A 1 36 ? -7.290  11.523  -1.037  1.00 10.00 ? 445 MET A CE   5  
ATOM 5183  H H    . MET A 1 36 ? -5.186  7.536   1.253   1.00 10.00 ? 445 MET A H    5  
ATOM 5184  H HA   . MET A 1 36 ? -5.744  10.219  0.441   1.00 10.00 ? 445 MET A HA   5  
ATOM 5185  H HB2  . MET A 1 36 ? -7.279  8.385   -0.144  1.00 10.00 ? 445 MET A HB2  5  
ATOM 5186  H HB3  . MET A 1 36 ? -7.576  8.086   1.563   1.00 10.00 ? 445 MET A HB3  5  
ATOM 5187  H HG2  . MET A 1 36 ? -9.399  9.338   1.122   1.00 10.00 ? 445 MET A HG2  5  
ATOM 5188  H HG3  . MET A 1 36 ? -8.275  10.644  1.492   1.00 10.00 ? 445 MET A HG3  5  
ATOM 5189  H HE1  . MET A 1 36 ? -6.488  10.892  -1.389  1.00 10.00 ? 445 MET A HE1  5  
ATOM 5190  H HE2  . MET A 1 36 ? -7.014  11.959  -0.088  1.00 10.00 ? 445 MET A HE2  5  
ATOM 5191  H HE3  . MET A 1 36 ? -7.474  12.308  -1.754  1.00 10.00 ? 445 MET A HE3  5  
ATOM 5192  N N    . GLN A 1 37 ? -5.637  9.327   3.551   1.00 10.00 ? 446 GLN A N    5  
ATOM 5193  C CA   . GLN A 1 37 ? -5.574  9.760   4.938   1.00 10.00 ? 446 GLN A CA   5  
ATOM 5194  C C    . GLN A 1 37 ? -4.391  10.692  5.137   1.00 10.00 ? 446 GLN A C    5  
ATOM 5195  O O    . GLN A 1 37 ? -4.463  11.676  5.874   1.00 10.00 ? 446 GLN A O    5  
ATOM 5196  C CB   . GLN A 1 37 ? -5.403  8.537   5.844   1.00 10.00 ? 446 GLN A CB   5  
ATOM 5197  C CG   . GLN A 1 37 ? -5.787  8.788   7.293   1.00 10.00 ? 446 GLN A CG   5  
ATOM 5198  C CD   . GLN A 1 37 ? -6.838  7.816   7.794   1.00 10.00 ? 446 GLN A CD   5  
ATOM 5199  O OE1  . GLN A 1 37 ? -7.763  8.199   8.510   1.00 10.00 ? 446 GLN A OE1  5  
ATOM 5200  N NE2  . GLN A 1 37 ? -6.699  6.548   7.420   1.00 10.00 ? 446 GLN A NE2  5  
ATOM 5201  H H    . GLN A 1 37 ? -5.349  8.418   3.336   1.00 10.00 ? 446 GLN A H    5  
ATOM 5202  H HA   . GLN A 1 37 ? -6.490  10.272  5.186   1.00 10.00 ? 446 GLN A HA   5  
ATOM 5203  H HB2  . GLN A 1 37 ? -6.019  7.735   5.464   1.00 10.00 ? 446 GLN A HB2  5  
ATOM 5204  H HB3  . GLN A 1 37 ? -4.360  8.223   5.816   1.00 10.00 ? 446 GLN A HB3  5  
ATOM 5205  H HG2  . GLN A 1 37 ? -4.906  8.690   7.908   1.00 10.00 ? 446 GLN A HG2  5  
ATOM 5206  H HG3  . GLN A 1 37 ? -6.176  9.792   7.380   1.00 10.00 ? 446 GLN A HG3  5  
ATOM 5207  H HE21 . GLN A 1 37 ? -5.937  6.316   6.850   1.00 10.00 ? 446 GLN A HE21 5  
ATOM 5208  H HE22 . GLN A 1 37 ? -7.365  5.900   7.727   1.00 10.00 ? 446 GLN A HE22 5  
ATOM 5209  N N    . HIS A 1 38 ? -3.294  10.349  4.477   1.00 10.00 ? 447 HIS A N    5  
ATOM 5210  C CA   . HIS A 1 38 ? -2.061  11.111  4.561   1.00 10.00 ? 447 HIS A CA   5  
ATOM 5211  C C    . HIS A 1 38 ? -1.838  11.919  3.282   1.00 10.00 ? 447 HIS A C    5  
ATOM 5212  O O    . HIS A 1 38 ? -1.363  11.391  2.277   1.00 10.00 ? 447 HIS A O    5  
ATOM 5213  C CB   . HIS A 1 38 ? -0.901  10.147  4.816   1.00 10.00 ? 447 HIS A CB   5  
ATOM 5214  C CG   . HIS A 1 38 ? -1.189  9.176   5.924   1.00 10.00 ? 447 HIS A CG   5  
ATOM 5215  N ND1  . HIS A 1 38 ? -1.176  9.539   7.254   1.00 10.00 ? 447 HIS A ND1  5  
ATOM 5216  C CD2  . HIS A 1 38 ? -1.528  7.858   5.902   1.00 10.00 ? 447 HIS A CD2  5  
ATOM 5217  C CE1  . HIS A 1 38 ? -1.494  8.496   7.999   1.00 10.00 ? 447 HIS A CE1  5  
ATOM 5218  N NE2  . HIS A 1 38 ? -1.712  7.466   7.204   1.00 10.00 ? 447 HIS A NE2  5  
ATOM 5219  H H    . HIS A 1 38 ? -3.313  9.544   3.919   1.00 10.00 ? 447 HIS A H    5  
ATOM 5220  H HA   . HIS A 1 38 ? -2.146  11.789  5.397   1.00 10.00 ? 447 HIS A HA   5  
ATOM 5221  H HB2  . HIS A 1 38 ? -0.703  9.582   3.918   1.00 10.00 ? 447 HIS A HB2  5  
ATOM 5222  H HB3  . HIS A 1 38 ? -0.020  10.713  5.085   1.00 10.00 ? 447 HIS A HB3  5  
ATOM 5223  H HD1  . HIS A 1 38 ? -0.965  10.432  7.601   1.00 10.00 ? 447 HIS A HD1  5  
ATOM 5224  H HD2  . HIS A 1 38 ? -1.639  7.229   5.024   1.00 10.00 ? 447 HIS A HD2  5  
ATOM 5225  H HE1  . HIS A 1 38 ? -1.552  8.484   9.077   1.00 10.00 ? 447 HIS A HE1  5  
ATOM 5226  H HE2  . HIS A 1 38 ? -2.080  6.603   7.491   1.00 10.00 ? 447 HIS A HE2  5  
ATOM 5227  N N    . PRO A 1 39 ? -2.200  13.218  3.302   1.00 10.00 ? 448 PRO A N    5  
ATOM 5228  C CA   . PRO A 1 39 ? -2.061  14.109  2.147   1.00 10.00 ? 448 PRO A CA   5  
ATOM 5229  C C    . PRO A 1 39 ? -0.759  13.912  1.374   1.00 10.00 ? 448 PRO A C    5  
ATOM 5230  O O    . PRO A 1 39 ? 0.257   14.532  1.685   1.00 10.00 ? 448 PRO A O    5  
ATOM 5231  C CB   . PRO A 1 39 ? -2.098  15.493  2.786   1.00 10.00 ? 448 PRO A CB   5  
ATOM 5232  C CG   . PRO A 1 39 ? -2.990  15.332  3.969   1.00 10.00 ? 448 PRO A CG   5  
ATOM 5233  C CD   . PRO A 1 39 ? -2.791  13.920  4.462   1.00 10.00 ? 448 PRO A CD   5  
ATOM 5234  H HA   . PRO A 1 39 ? -2.896  14.006  1.469   1.00 10.00 ? 448 PRO A HA   5  
ATOM 5235  H HB2  . PRO A 1 39 ? -1.100  15.786  3.077   1.00 10.00 ? 448 PRO A HB2  5  
ATOM 5236  H HB3  . PRO A 1 39 ? -2.501  16.208  2.083   1.00 10.00 ? 448 PRO A HB3  5  
ATOM 5237  H HG2  . PRO A 1 39 ? -2.710  16.038  4.737   1.00 10.00 ? 448 PRO A HG2  5  
ATOM 5238  H HG3  . PRO A 1 39 ? -4.018  15.485  3.676   1.00 10.00 ? 448 PRO A HG3  5  
ATOM 5239  H HD2  . PRO A 1 39 ? -2.114  13.908  5.303   1.00 10.00 ? 448 PRO A HD2  5  
ATOM 5240  H HD3  . PRO A 1 39 ? -3.739  13.480  4.734   1.00 10.00 ? 448 PRO A HD3  5  
ATOM 5241  N N    . LYS A 1 40 ? -0.812  13.056  0.354   1.00 10.00 ? 449 LYS A N    5  
ATOM 5242  C CA   . LYS A 1 40 ? 0.349   12.776  -0.494  1.00 10.00 ? 449 LYS A CA   5  
ATOM 5243  C C    . LYS A 1 40 ? 1.628   12.609  0.321   1.00 10.00 ? 449 LYS A C    5  
ATOM 5244  O O    . LYS A 1 40 ? 2.254   13.590  0.723   1.00 10.00 ? 449 LYS A O    5  
ATOM 5245  C CB   . LYS A 1 40 ? 0.532   13.896  -1.520  1.00 10.00 ? 449 LYS A CB   5  
ATOM 5246  C CG   . LYS A 1 40 ? 1.593   13.595  -2.565  1.00 10.00 ? 449 LYS A CG   5  
ATOM 5247  C CD   . LYS A 1 40 ? 1.576   14.621  -3.687  1.00 10.00 ? 449 LYS A CD   5  
ATOM 5248  C CE   . LYS A 1 40 ? 0.746   14.143  -4.867  1.00 10.00 ? 449 LYS A CE   5  
ATOM 5249  N NZ   . LYS A 1 40 ? 0.762   15.121  -5.990  1.00 10.00 ? 449 LYS A NZ   5  
ATOM 5250  H H    . LYS A 1 40 ? -1.660  12.609  0.156   1.00 10.00 ? 449 LYS A H    5  
ATOM 5251  H HA   . LYS A 1 40 ? 0.153   11.854  -1.020  1.00 10.00 ? 449 LYS A HA   5  
ATOM 5252  H HB2  . LYS A 1 40 ? -0.407  14.061  -2.027  1.00 10.00 ? 449 LYS A HB2  5  
ATOM 5253  H HB3  . LYS A 1 40 ? 0.815   14.800  -1.001  1.00 10.00 ? 449 LYS A HB3  5  
ATOM 5254  H HG2  . LYS A 1 40 ? 2.563   13.607  -2.094  1.00 10.00 ? 449 LYS A HG2  5  
ATOM 5255  H HG3  . LYS A 1 40 ? 1.405   12.616  -2.983  1.00 10.00 ? 449 LYS A HG3  5  
ATOM 5256  H HD2  . LYS A 1 40 ? 1.154   15.542  -3.313  1.00 10.00 ? 449 LYS A HD2  5  
ATOM 5257  H HD3  . LYS A 1 40 ? 2.590   14.794  -4.018  1.00 10.00 ? 449 LYS A HD3  5  
ATOM 5258  H HE2  . LYS A 1 40 ? 1.146   13.202  -5.216  1.00 10.00 ? 449 LYS A HE2  5  
ATOM 5259  H HE3  . LYS A 1 40 ? -0.274  14.000  -4.540  1.00 10.00 ? 449 LYS A HE3  5  
ATOM 5260  H HZ1  . LYS A 1 40 ? 0.450   14.661  -6.869  1.00 10.00 ? 449 LYS A HZ1  5  
ATOM 5261  H HZ2  . LYS A 1 40 ? 1.725   15.490  -6.129  1.00 10.00 ? 449 LYS A HZ2  5  
ATOM 5262  H HZ3  . LYS A 1 40 ? 0.125   15.916  -5.781  1.00 10.00 ? 449 LYS A HZ3  5  
ATOM 5263  N N    . ASN A 1 41 ? 2.022   11.360  0.549   1.00 10.00 ? 450 ASN A N    5  
ATOM 5264  C CA   . ASN A 1 41 ? 3.234   11.071  1.304   1.00 10.00 ? 450 ASN A CA   5  
ATOM 5265  C C    . ASN A 1 41 ? 3.945   9.844   0.746   1.00 10.00 ? 450 ASN A C    5  
ATOM 5266  O O    . ASN A 1 41 ? 5.106   9.916   0.346   1.00 10.00 ? 450 ASN A O    5  
ATOM 5267  C CB   . ASN A 1 41 ? 2.911   10.866  2.789   1.00 10.00 ? 450 ASN A CB   5  
ATOM 5268  C CG   . ASN A 1 41 ? 1.704   9.975   3.012   1.00 10.00 ? 450 ASN A CG   5  
ATOM 5269  O OD1  . ASN A 1 41 ? 0.718   10.045  2.279   1.00 10.00 ? 450 ASN A OD1  5  
ATOM 5270  N ND2  . ASN A 1 41 ? 1.776   9.125   4.032   1.00 10.00 ? 450 ASN A ND2  5  
ATOM 5271  H H    . ASN A 1 41 ? 1.488   10.618  0.195   1.00 10.00 ? 450 ASN A H    5  
ATOM 5272  H HA   . ASN A 1 41 ? 3.888   11.918  1.206   1.00 10.00 ? 450 ASN A HA   5  
ATOM 5273  H HB2  . ASN A 1 41 ? 3.761   10.413  3.275   1.00 10.00 ? 450 ASN A HB2  5  
ATOM 5274  H HB3  . ASN A 1 41 ? 2.714   11.826  3.242   1.00 10.00 ? 450 ASN A HB3  5  
ATOM 5275  H HD21 . ASN A 1 41 ? 2.591   9.122   4.576   1.00 10.00 ? 450 ASN A HD21 5  
ATOM 5276  H HD22 . ASN A 1 41 ? 1.009   8.538   4.200   1.00 10.00 ? 450 ASN A HD22 5  
ATOM 5277  N N    . PHE A 1 42 ? 3.239   8.720   0.724   1.00 10.00 ? 451 PHE A N    5  
ATOM 5278  C CA   . PHE A 1 42 ? 3.796   7.467   0.219   1.00 10.00 ? 451 PHE A CA   5  
ATOM 5279  C C    . PHE A 1 42 ? 4.873   6.913   1.153   1.00 10.00 ? 451 PHE A C    5  
ATOM 5280  O O    . PHE A 1 42 ? 5.428   5.844   0.903   1.00 10.00 ? 451 PHE A O    5  
ATOM 5281  C CB   . PHE A 1 42 ? 4.363   7.666   -1.192  1.00 10.00 ? 451 PHE A CB   5  
ATOM 5282  C CG   . PHE A 1 42 ? 3.758   6.757   -2.228  1.00 10.00 ? 451 PHE A CG   5  
ATOM 5283  C CD1  . PHE A 1 42 ? 2.430   6.374   -2.142  1.00 10.00 ? 451 PHE A CD1  5  
ATOM 5284  C CD2  . PHE A 1 42 ? 4.516   6.293   -3.292  1.00 10.00 ? 451 PHE A CD2  5  
ATOM 5285  C CE1  . PHE A 1 42 ? 1.868   5.545   -3.091  1.00 10.00 ? 451 PHE A CE1  5  
ATOM 5286  C CE2  . PHE A 1 42 ? 3.958   5.465   -4.248  1.00 10.00 ? 451 PHE A CE2  5  
ATOM 5287  C CZ   . PHE A 1 42 ? 2.633   5.090   -4.147  1.00 10.00 ? 451 PHE A CZ   5  
ATOM 5288  H H    . PHE A 1 42 ? 2.321   8.732   1.058   1.00 10.00 ? 451 PHE A H    5  
ATOM 5289  H HA   . PHE A 1 42 ? 2.990   6.752   0.172   1.00 10.00 ? 451 PHE A HA   5  
ATOM 5290  H HB2  . PHE A 1 42 ? 4.177   8.683   -1.502  1.00 10.00 ? 451 PHE A HB2  5  
ATOM 5291  H HB3  . PHE A 1 42 ? 5.428   7.490   -1.175  1.00 10.00 ? 451 PHE A HB3  5  
ATOM 5292  H HD1  . PHE A 1 42 ? 1.834   6.726   -1.317  1.00 10.00 ? 451 PHE A HD1  5  
ATOM 5293  H HD2  . PHE A 1 42 ? 5.553   6.585   -3.370  1.00 10.00 ? 451 PHE A HD2  5  
ATOM 5294  H HE1  . PHE A 1 42 ? 0.830   5.257   -3.008  1.00 10.00 ? 451 PHE A HE1  5  
ATOM 5295  H HE2  . PHE A 1 42 ? 4.560   5.110   -5.072  1.00 10.00 ? 451 PHE A HE2  5  
ATOM 5296  H HZ   . PHE A 1 42 ? 2.195   4.442   -4.893  1.00 10.00 ? 451 PHE A HZ   5  
ATOM 5297  N N    . GLY A 1 43 ? 5.154   7.633   2.237   1.00 10.00 ? 452 GLY A N    5  
ATOM 5298  C CA   . GLY A 1 43 ? 6.146   7.183   3.190   1.00 10.00 ? 452 GLY A CA   5  
ATOM 5299  C C    . GLY A 1 43 ? 5.524   6.356   4.295   1.00 10.00 ? 452 GLY A C    5  
ATOM 5300  O O    . GLY A 1 43 ? 6.144   5.424   4.807   1.00 10.00 ? 452 GLY A O    5  
ATOM 5301  H H    . GLY A 1 43 ? 4.677   8.467   2.398   1.00 10.00 ? 452 GLY A H    5  
ATOM 5302  H HA2  . GLY A 1 43 ? 6.884   6.586   2.674   1.00 10.00 ? 452 GLY A HA2  5  
ATOM 5303  H HA3  . GLY A 1 43 ? 6.630   8.043   3.626   1.00 10.00 ? 452 GLY A HA3  5  
ATOM 5304  N N    . LEU A 1 44 ? 4.287   6.691   4.654   1.00 10.00 ? 453 LEU A N    5  
ATOM 5305  C CA   . LEU A 1 44 ? 3.576   5.963   5.695   1.00 10.00 ? 453 LEU A CA   5  
ATOM 5306  C C    . LEU A 1 44 ? 2.963   4.694   5.132   1.00 10.00 ? 453 LEU A C    5  
ATOM 5307  O O    . LEU A 1 44 ? 3.156   3.606   5.676   1.00 10.00 ? 453 LEU A O    5  
ATOM 5308  C CB   . LEU A 1 44 ? 2.478   6.822   6.322   1.00 10.00 ? 453 LEU A CB   5  
ATOM 5309  C CG   . LEU A 1 44 ? 1.475   6.045   7.182   1.00 10.00 ? 453 LEU A CG   5  
ATOM 5310  C CD1  . LEU A 1 44 ? 0.942   6.919   8.302   1.00 10.00 ? 453 LEU A CD1  5  
ATOM 5311  C CD2  . LEU A 1 44 ? 0.338   5.504   6.320   1.00 10.00 ? 453 LEU A CD2  5  
ATOM 5312  H H    . LEU A 1 44 ? 3.842   7.437   4.202   1.00 10.00 ? 453 LEU A H    5  
ATOM 5313  H HA   . LEU A 1 44 ? 4.288   5.694   6.455   1.00 10.00 ? 453 LEU A HA   5  
ATOM 5314  H HB2  . LEU A 1 44 ? 2.946   7.576   6.939   1.00 10.00 ? 453 LEU A HB2  5  
ATOM 5315  H HB3  . LEU A 1 44 ? 1.935   7.313   5.529   1.00 10.00 ? 453 LEU A HB3  5  
ATOM 5316  H HG   . LEU A 1 44 ? 1.978   5.205   7.633   1.00 10.00 ? 453 LEU A HG   5  
ATOM 5317  H HD11 . LEU A 1 44 ? 0.895   7.944   7.968   1.00 10.00 ? 453 LEU A HD11 5  
ATOM 5318  H HD12 . LEU A 1 44 ? 1.599   6.848   9.156   1.00 10.00 ? 453 LEU A HD12 5  
ATOM 5319  H HD13 . LEU A 1 44 ? -0.047  6.584   8.580   1.00 10.00 ? 453 LEU A HD13 5  
ATOM 5320  H HD21 . LEU A 1 44 ? 0.586   4.509   5.976   1.00 10.00 ? 453 LEU A HD21 5  
ATOM 5321  H HD22 . LEU A 1 44 ? 0.190   6.150   5.468   1.00 10.00 ? 453 LEU A HD22 5  
ATOM 5322  H HD23 . LEU A 1 44 ? -0.570  5.464   6.903   1.00 10.00 ? 453 LEU A HD23 5  
ATOM 5323  N N    . ILE A 1 45 ? 2.219   4.834   4.043   1.00 10.00 ? 454 ILE A N    5  
ATOM 5324  C CA   . ILE A 1 45 ? 1.582   3.692   3.417   1.00 10.00 ? 454 ILE A CA   5  
ATOM 5325  C C    . ILE A 1 45 ? 2.606   2.618   3.113   1.00 10.00 ? 454 ILE A C    5  
ATOM 5326  O O    . ILE A 1 45 ? 2.368   1.440   3.347   1.00 10.00 ? 454 ILE A O    5  
ATOM 5327  C CB   . ILE A 1 45 ? 0.827   4.106   2.146   1.00 10.00 ? 454 ILE A CB   5  
ATOM 5328  C CG1  . ILE A 1 45 ? -0.510  4.690   2.553   1.00 10.00 ? 454 ILE A CG1  5  
ATOM 5329  C CG2  . ILE A 1 45 ? 0.640   2.935   1.188   1.00 10.00 ? 454 ILE A CG2  5  
ATOM 5330  C CD1  . ILE A 1 45 ? -0.479  6.197   2.631   1.00 10.00 ? 454 ILE A CD1  5  
ATOM 5331  H H    . ILE A 1 45 ? 2.096   5.727   3.652   1.00 10.00 ? 454 ILE A H    5  
ATOM 5332  H HA   . ILE A 1 45 ? 0.866   3.297   4.118   1.00 10.00 ? 454 ILE A HA   5  
ATOM 5333  H HB   . ILE A 1 45 ? 1.396   4.874   1.649   1.00 10.00 ? 454 ILE A HB   5  
ATOM 5334  H HG12 . ILE A 1 45 ? -1.266  4.398   1.837   1.00 10.00 ? 454 ILE A HG12 5  
ATOM 5335  H HG13 . ILE A 1 45 ? -0.771  4.308   3.530   1.00 10.00 ? 454 ILE A HG13 5  
ATOM 5336  H HG21 . ILE A 1 45 ? -0.169  3.154   0.505   1.00 10.00 ? 454 ILE A HG21 5  
ATOM 5337  H HG22 . ILE A 1 45 ? 0.405   2.044   1.750   1.00 10.00 ? 454 ILE A HG22 5  
ATOM 5338  H HG23 . ILE A 1 45 ? 1.551   2.780   0.629   1.00 10.00 ? 454 ILE A HG23 5  
ATOM 5339  H HD11 . ILE A 1 45 ? 0.460   6.515   3.056   1.00 10.00 ? 454 ILE A HD11 5  
ATOM 5340  H HD12 . ILE A 1 45 ? -1.286  6.544   3.250   1.00 10.00 ? 454 ILE A HD12 5  
ATOM 5341  H HD13 . ILE A 1 45 ? -0.578  6.608   1.639   1.00 10.00 ? 454 ILE A HD13 5  
ATOM 5342  N N    . ALA A 1 46 ? 3.763   3.045   2.635   1.00 10.00 ? 455 ALA A N    5  
ATOM 5343  C CA   . ALA A 1 46 ? 4.848   2.123   2.342   1.00 10.00 ? 455 ALA A CA   5  
ATOM 5344  C C    . ALA A 1 46 ? 5.563   1.721   3.631   1.00 10.00 ? 455 ALA A C    5  
ATOM 5345  O O    . ALA A 1 46 ? 6.635   1.117   3.594   1.00 10.00 ? 455 ALA A O    5  
ATOM 5346  C CB   . ALA A 1 46 ? 5.828   2.753   1.365   1.00 10.00 ? 455 ALA A CB   5  
ATOM 5347  H H    . ALA A 1 46 ? 3.901   4.004   2.505   1.00 10.00 ? 455 ALA A H    5  
ATOM 5348  H HA   . ALA A 1 46 ? 4.428   1.243   1.881   1.00 10.00 ? 455 ALA A HA   5  
ATOM 5349  H HB1  . ALA A 1 46 ? 6.055   3.761   1.683   1.00 10.00 ? 455 ALA A HB1  5  
ATOM 5350  H HB2  . ALA A 1 46 ? 5.389   2.777   0.379   1.00 10.00 ? 455 ALA A HB2  5  
ATOM 5351  H HB3  . ALA A 1 46 ? 6.737   2.171   1.340   1.00 10.00 ? 455 ALA A HB3  5  
ATOM 5352  N N    . SER A 1 47 ? 4.962   2.067   4.771   1.00 10.00 ? 456 SER A N    5  
ATOM 5353  C CA   . SER A 1 47 ? 5.540   1.751   6.069   1.00 10.00 ? 456 SER A CA   5  
ATOM 5354  C C    . SER A 1 47 ? 4.669   0.758   6.834   1.00 10.00 ? 456 SER A C    5  
ATOM 5355  O O    . SER A 1 47 ? 5.186   -0.079  7.575   1.00 10.00 ? 456 SER A O    5  
ATOM 5356  C CB   . SER A 1 47 ? 5.722   3.029   6.892   1.00 10.00 ? 456 SER A CB   5  
ATOM 5357  O OG   . SER A 1 47 ? 7.061   3.163   7.335   1.00 10.00 ? 456 SER A OG   5  
ATOM 5358  H H    . SER A 1 47 ? 4.111   2.552   4.740   1.00 10.00 ? 456 SER A H    5  
ATOM 5359  H HA   . SER A 1 47 ? 6.508   1.305   5.899   1.00 10.00 ? 456 SER A HA   5  
ATOM 5360  H HB2  . SER A 1 47 ? 5.470   3.885   6.284   1.00 10.00 ? 456 SER A HB2  5  
ATOM 5361  H HB3  . SER A 1 47 ? 5.071   2.997   7.754   1.00 10.00 ? 456 SER A HB3  5  
ATOM 5362  H HG   . SER A 1 47 ? 7.361   4.062   7.180   1.00 10.00 ? 456 SER A HG   5  
ATOM 5363  N N    . PHE A 1 48 ? 3.349   0.843   6.657   1.00 10.00 ? 457 PHE A N    5  
ATOM 5364  C CA   . PHE A 1 48 ? 2.449   -0.074  7.350   1.00 10.00 ? 457 PHE A CA   5  
ATOM 5365  C C    . PHE A 1 48 ? 2.410   -1.424  6.636   1.00 10.00 ? 457 PHE A C    5  
ATOM 5366  O O    . PHE A 1 48 ? 2.208   -2.464  7.263   1.00 10.00 ? 457 PHE A O    5  
ATOM 5367  C CB   . PHE A 1 48 ? 1.044   0.532   7.483   1.00 10.00 ? 457 PHE A CB   5  
ATOM 5368  C CG   . PHE A 1 48 ? 0.216   0.469   6.233   1.00 10.00 ? 457 PHE A CG   5  
ATOM 5369  C CD1  . PHE A 1 48 ? -0.285  -0.742  5.779   1.00 10.00 ? 457 PHE A CD1  5  
ATOM 5370  C CD2  . PHE A 1 48 ? -0.064  1.620   5.510   1.00 10.00 ? 457 PHE A CD2  5  
ATOM 5371  C CE1  . PHE A 1 48 ? -1.046  -0.806  4.633   1.00 10.00 ? 457 PHE A CE1  5  
ATOM 5372  C CE2  . PHE A 1 48 ? -0.826  1.559   4.363   1.00 10.00 ? 457 PHE A CE2  5  
ATOM 5373  C CZ   . PHE A 1 48 ? -1.317  0.349   3.924   1.00 10.00 ? 457 PHE A CZ   5  
ATOM 5374  H H    . PHE A 1 48 ? 2.977   1.526   6.050   1.00 10.00 ? 457 PHE A H    5  
ATOM 5375  H HA   . PHE A 1 48 ? 2.853   -0.228  8.341   1.00 10.00 ? 457 PHE A HA   5  
ATOM 5376  H HB2  . PHE A 1 48 ? 0.507   0.004   8.258   1.00 10.00 ? 457 PHE A HB2  5  
ATOM 5377  H HB3  . PHE A 1 48 ? 1.137   1.571   7.767   1.00 10.00 ? 457 PHE A HB3  5  
ATOM 5378  H HD1  . PHE A 1 48 ? -0.078  -1.645  6.335   1.00 10.00 ? 457 PHE A HD1  5  
ATOM 5379  H HD2  . PHE A 1 48 ? 0.318   2.575   5.850   1.00 10.00 ? 457 PHE A HD2  5  
ATOM 5380  H HE1  . PHE A 1 48 ? -1.426  -1.759  4.291   1.00 10.00 ? 457 PHE A HE1  5  
ATOM 5381  H HE2  . PHE A 1 48 ? -1.039  2.459   3.808   1.00 10.00 ? 457 PHE A HE2  5  
ATOM 5382  H HZ   . PHE A 1 48 ? -1.910  0.309   3.028   1.00 10.00 ? 457 PHE A HZ   5  
ATOM 5383  N N    . LEU A 1 49 ? 2.629   -1.398  5.324   1.00 10.00 ? 458 LEU A N    5  
ATOM 5384  C CA   . LEU A 1 49 ? 2.647   -2.618  4.521   1.00 10.00 ? 458 LEU A CA   5  
ATOM 5385  C C    . LEU A 1 49 ? 4.068   -2.884  4.029   1.00 10.00 ? 458 LEU A C    5  
ATOM 5386  O O    . LEU A 1 49 ? 4.302   -3.096  2.842   1.00 10.00 ? 458 LEU A O    5  
ATOM 5387  C CB   . LEU A 1 49 ? 1.678   -2.500  3.339   1.00 10.00 ? 458 LEU A CB   5  
ATOM 5388  C CG   . LEU A 1 49 ? 1.605   -1.115  2.699   1.00 10.00 ? 458 LEU A CG   5  
ATOM 5389  C CD1  . LEU A 1 49 ? 2.972   -0.712  2.170   1.00 10.00 ? 458 LEU A CD1  5  
ATOM 5390  C CD2  . LEU A 1 49 ? 0.563   -1.084  1.585   1.00 10.00 ? 458 LEU A CD2  5  
ATOM 5391  H H    . LEU A 1 49 ? 2.800   -0.539  4.887   1.00 10.00 ? 458 LEU A H    5  
ATOM 5392  H HA   . LEU A 1 49 ? 2.339   -3.437  5.152   1.00 10.00 ? 458 LEU A HA   5  
ATOM 5393  H HB2  . LEU A 1 49 ? 1.979   -3.209  2.582   1.00 10.00 ? 458 LEU A HB2  5  
ATOM 5394  H HB3  . LEU A 1 49 ? 0.690   -2.764  3.684   1.00 10.00 ? 458 LEU A HB3  5  
ATOM 5395  H HG   . LEU A 1 49 ? 1.313   -0.398  3.451   1.00 10.00 ? 458 LEU A HG   5  
ATOM 5396  H HD11 . LEU A 1 49 ? 3.407   -1.537  1.634   1.00 10.00 ? 458 LEU A HD11 5  
ATOM 5397  H HD12 . LEU A 1 49 ? 3.612   -0.445  2.999   1.00 10.00 ? 458 LEU A HD12 5  
ATOM 5398  H HD13 . LEU A 1 49 ? 2.866   0.133   1.508   1.00 10.00 ? 458 LEU A HD13 5  
ATOM 5399  H HD21 . LEU A 1 49 ? 1.027   -0.766  0.663   1.00 10.00 ? 458 LEU A HD21 5  
ATOM 5400  H HD22 . LEU A 1 49 ? -0.229  -0.392  1.844   1.00 10.00 ? 458 LEU A HD22 5  
ATOM 5401  H HD23 . LEU A 1 49 ? 0.145   -2.071  1.454   1.00 10.00 ? 458 LEU A HD23 5  
ATOM 5402  N N    . GLU A 1 50 ? 5.005   -2.848  4.978   1.00 10.00 ? 459 GLU A N    5  
ATOM 5403  C CA   . GLU A 1 50 ? 6.438   -3.059  4.726   1.00 10.00 ? 459 GLU A CA   5  
ATOM 5404  C C    . GLU A 1 50 ? 6.711   -3.929  3.500   1.00 10.00 ? 459 GLU A C    5  
ATOM 5405  O O    . GLU A 1 50 ? 7.624   -3.644  2.726   1.00 10.00 ? 459 GLU A O    5  
ATOM 5406  C CB   . GLU A 1 50 ? 7.096   -3.689  5.955   1.00 10.00 ? 459 GLU A CB   5  
ATOM 5407  C CG   . GLU A 1 50 ? 8.597   -3.463  6.025   1.00 10.00 ? 459 GLU A CG   5  
ATOM 5408  C CD   . GLU A 1 50 ? 9.380   -4.509  5.257   1.00 10.00 ? 459 GLU A CD   5  
ATOM 5409  O OE1  . GLU A 1 50 ? 8.879   -5.645  5.122   1.00 10.00 ? 459 GLU A OE1  5  
ATOM 5410  O OE2  . GLU A 1 50 ? 10.494  -4.193  4.790   1.00 10.00 ? 459 GLU A OE2  5  
ATOM 5411  H H    . GLU A 1 50 ? 4.721   -2.657  5.891   1.00 10.00 ? 459 GLU A H    5  
ATOM 5412  H HA   . GLU A 1 50 ? 6.884   -2.090  4.561   1.00 10.00 ? 459 GLU A HA   5  
ATOM 5413  H HB2  . GLU A 1 50 ? 6.648   -3.268  6.844   1.00 10.00 ? 459 GLU A HB2  5  
ATOM 5414  H HB3  . GLU A 1 50 ? 6.913   -4.754  5.940   1.00 10.00 ? 459 GLU A HB3  5  
ATOM 5415  H HG2  . GLU A 1 50 ? 8.821   -2.491  5.610   1.00 10.00 ? 459 GLU A HG2  5  
ATOM 5416  H HG3  . GLU A 1 50 ? 8.904   -3.491  7.060   1.00 10.00 ? 459 GLU A HG3  5  
ATOM 5417  N N    . ARG A 1 51 ? 5.923   -4.985  3.326   1.00 10.00 ? 460 ARG A N    5  
ATOM 5418  C CA   . ARG A 1 51 ? 6.092   -5.886  2.186   1.00 10.00 ? 460 ARG A CA   5  
ATOM 5419  C C    . ARG A 1 51 ? 6.272   -5.093  0.893   1.00 10.00 ? 460 ARG A C    5  
ATOM 5420  O O    . ARG A 1 51 ? 6.921   -5.552  -0.046  1.00 10.00 ? 460 ARG A O    5  
ATOM 5421  C CB   . ARG A 1 51 ? 4.887   -6.821  2.063   1.00 10.00 ? 460 ARG A CB   5  
ATOM 5422  C CG   . ARG A 1 51 ? 5.063   -8.137  2.802   1.00 10.00 ? 460 ARG A CG   5  
ATOM 5423  C CD   . ARG A 1 51 ? 6.303   -8.881  2.332   1.00 10.00 ? 460 ARG A CD   5  
ATOM 5424  N NE   . ARG A 1 51 ? 7.453   -8.630  3.197   1.00 10.00 ? 460 ARG A NE   5  
ATOM 5425  C CZ   . ARG A 1 51 ? 7.545   -9.062  4.452   1.00 10.00 ? 460 ARG A CZ   5  
ATOM 5426  N NH1  . ARG A 1 51 ? 6.559   -9.767  4.993   1.00 10.00 ? 460 ARG A NH1  5  
ATOM 5427  N NH2  . ARG A 1 51 ? 8.627   -8.789  5.169   1.00 10.00 ? 460 ARG A NH2  5  
ATOM 5428  H H    . ARG A 1 51 ? 5.212   -5.163  3.974   1.00 10.00 ? 460 ARG A H    5  
ATOM 5429  H HA   . ARG A 1 51 ? 6.980   -6.475  2.359   1.00 10.00 ? 460 ARG A HA   5  
ATOM 5430  H HB2  . ARG A 1 51 ? 4.016   -6.322  2.460   1.00 10.00 ? 460 ARG A HB2  5  
ATOM 5431  H HB3  . ARG A 1 51 ? 4.722   -7.040  1.018   1.00 10.00 ? 460 ARG A HB3  5  
ATOM 5432  H HG2  . ARG A 1 51 ? 5.156   -7.936  3.858   1.00 10.00 ? 460 ARG A HG2  5  
ATOM 5433  H HG3  . ARG A 1 51 ? 4.195   -8.756  2.627   1.00 10.00 ? 460 ARG A HG3  5  
ATOM 5434  H HD2  . ARG A 1 51 ? 6.092   -9.939  2.327   1.00 10.00 ? 460 ARG A HD2  5  
ATOM 5435  H HD3  . ARG A 1 51 ? 6.541   -8.558  1.328   1.00 10.00 ? 460 ARG A HD3  5  
ATOM 5436  H HE   . ARG A 1 51 ? 8.196   -8.111  2.822   1.00 10.00 ? 460 ARG A HE   5  
ATOM 5437  H HH11 . ARG A 1 51 ? 5.741   -9.976  4.457   1.00 10.00 ? 460 ARG A HH11 5  
ATOM 5438  H HH12 . ARG A 1 51 ? 6.634   -10.089 5.936   1.00 10.00 ? 460 ARG A HH12 5  
ATOM 5439  H HH21 . ARG A 1 51 ? 9.373   -8.259  4.766   1.00 10.00 ? 460 ARG A HH21 5  
ATOM 5440  H HH22 . ARG A 1 51 ? 8.696   -9.114  6.112   1.00 10.00 ? 460 ARG A HH22 5  
ATOM 5441  N N    . LYS A 1 52 ? 5.696   -3.896  0.863   1.00 10.00 ? 461 LYS A N    5  
ATOM 5442  C CA   . LYS A 1 52 ? 5.790   -3.022  -0.301  1.00 10.00 ? 461 LYS A CA   5  
ATOM 5443  C C    . LYS A 1 52 ? 6.893   -1.985  -0.097  1.00 10.00 ? 461 LYS A C    5  
ATOM 5444  O O    . LYS A 1 52 ? 7.758   -2.147  0.763   1.00 10.00 ? 461 LYS A O    5  
ATOM 5445  C CB   . LYS A 1 52 ? 4.451   -2.317  -0.557  1.00 10.00 ? 461 LYS A CB   5  
ATOM 5446  C CG   . LYS A 1 52 ? 3.228   -3.109  -0.113  1.00 10.00 ? 461 LYS A CG   5  
ATOM 5447  C CD   . LYS A 1 52 ? 2.744   -4.044  -1.208  1.00 10.00 ? 461 LYS A CD   5  
ATOM 5448  C CE   . LYS A 1 52 ? 3.570   -5.317  -1.257  1.00 10.00 ? 461 LYS A CE   5  
ATOM 5449  N NZ   . LYS A 1 52 ? 2.976   -6.395  -0.423  1.00 10.00 ? 461 LYS A NZ   5  
ATOM 5450  H H    . LYS A 1 52 ? 5.197   -3.587  1.648   1.00 10.00 ? 461 LYS A H    5  
ATOM 5451  H HA   . LYS A 1 52 ? 6.038   -3.633  -1.156  1.00 10.00 ? 461 LYS A HA   5  
ATOM 5452  H HB2  . LYS A 1 52 ? 4.451   -1.375  -0.030  1.00 10.00 ? 461 LYS A HB2  5  
ATOM 5453  H HB3  . LYS A 1 52 ? 4.361   -2.123  -1.616  1.00 10.00 ? 461 LYS A HB3  5  
ATOM 5454  H HG2  . LYS A 1 52 ? 3.480   -3.690  0.763   1.00 10.00 ? 461 LYS A HG2  5  
ATOM 5455  H HG3  . LYS A 1 52 ? 2.436   -2.417  0.133   1.00 10.00 ? 461 LYS A HG3  5  
ATOM 5456  H HD2  . LYS A 1 52 ? 1.713   -4.303  -1.018  1.00 10.00 ? 461 LYS A HD2  5  
ATOM 5457  H HD3  . LYS A 1 52 ? 2.820   -3.537  -2.159  1.00 10.00 ? 461 LYS A HD3  5  
ATOM 5458  H HE2  . LYS A 1 52 ? 3.624   -5.654  -2.280  1.00 10.00 ? 461 LYS A HE2  5  
ATOM 5459  H HE3  . LYS A 1 52 ? 4.565   -5.101  -0.897  1.00 10.00 ? 461 LYS A HE3  5  
ATOM 5460  H HZ1  . LYS A 1 52 ? 1.988   -6.555  -0.701  1.00 10.00 ? 461 LYS A HZ1  5  
ATOM 5461  H HZ2  . LYS A 1 52 ? 3.004   -6.127  0.582   1.00 10.00 ? 461 LYS A HZ2  5  
ATOM 5462  H HZ3  . LYS A 1 52 ? 3.508   -7.280  -0.550  1.00 10.00 ? 461 LYS A HZ3  5  
ATOM 5463  N N    . THR A 1 53 ? 6.854   -0.917  -0.888  1.00 10.00 ? 462 THR A N    5  
ATOM 5464  C CA   . THR A 1 53 ? 7.846   0.148   -0.786  1.00 10.00 ? 462 THR A CA   5  
ATOM 5465  C C    . THR A 1 53 ? 7.282   1.454   -1.331  1.00 10.00 ? 462 THR A C    5  
ATOM 5466  O O    . THR A 1 53 ? 6.259   1.457   -2.013  1.00 10.00 ? 462 THR A O    5  
ATOM 5467  C CB   . THR A 1 53 ? 9.122   -0.233  -1.546  1.00 10.00 ? 462 THR A CB   5  
ATOM 5468  O OG1  . THR A 1 53 ? 9.002   -1.524  -2.118  1.00 10.00 ? 462 THR A OG1  5  
ATOM 5469  C CG2  . THR A 1 53 ? 10.359  -0.233  -0.674  1.00 10.00 ? 462 THR A CG2  5  
ATOM 5470  H H    . THR A 1 53 ? 6.139   -0.840  -1.552  1.00 10.00 ? 462 THR A H    5  
ATOM 5471  H HA   . THR A 1 53 ? 8.085   0.280   0.259   1.00 10.00 ? 462 THR A HA   5  
ATOM 5472  H HB   . THR A 1 53 ? 9.281   0.478   -2.344  1.00 10.00 ? 462 THR A HB   5  
ATOM 5473  H HG1  . THR A 1 53 ? 9.645   -1.622  -2.824  1.00 10.00 ? 462 THR A HG1  5  
ATOM 5474  H HG21 . THR A 1 53 ? 10.285  0.561   0.056   1.00 10.00 ? 462 THR A HG21 5  
ATOM 5475  H HG22 . THR A 1 53 ? 11.232  -0.076  -1.288  1.00 10.00 ? 462 THR A HG22 5  
ATOM 5476  H HG23 . THR A 1 53 ? 10.442  -1.182  -0.165  1.00 10.00 ? 462 THR A HG23 5  
ATOM 5477  N N    . VAL A 1 54 ? 7.948   2.563   -1.029  1.00 10.00 ? 463 VAL A N    5  
ATOM 5478  C CA   . VAL A 1 54 ? 7.496   3.865   -1.501  1.00 10.00 ? 463 VAL A CA   5  
ATOM 5479  C C    . VAL A 1 54 ? 7.659   3.978   -3.011  1.00 10.00 ? 463 VAL A C    5  
ATOM 5480  O O    . VAL A 1 54 ? 6.777   4.483   -3.706  1.00 10.00 ? 463 VAL A O    5  
ATOM 5481  C CB   . VAL A 1 54 ? 8.262   5.019   -0.823  1.00 10.00 ? 463 VAL A CB   5  
ATOM 5482  C CG1  . VAL A 1 54 ? 7.633   6.358   -1.175  1.00 10.00 ? 463 VAL A CG1  5  
ATOM 5483  C CG2  . VAL A 1 54 ? 8.305   4.823   0.687   1.00 10.00 ? 463 VAL A CG2  5  
ATOM 5484  H H    . VAL A 1 54 ? 8.758   2.504   -0.482  1.00 10.00 ? 463 VAL A H    5  
ATOM 5485  H HA   . VAL A 1 54 ? 6.448   3.961   -1.257  1.00 10.00 ? 463 VAL A HA   5  
ATOM 5486  H HB   . VAL A 1 54 ? 9.277   5.016   -1.192  1.00 10.00 ? 463 VAL A HB   5  
ATOM 5487  H HG11 . VAL A 1 54 ? 8.409   7.068   -1.422  1.00 10.00 ? 463 VAL A HG11 5  
ATOM 5488  H HG12 . VAL A 1 54 ? 7.065   6.725   -0.331  1.00 10.00 ? 463 VAL A HG12 5  
ATOM 5489  H HG13 . VAL A 1 54 ? 6.975   6.235   -2.024  1.00 10.00 ? 463 VAL A HG13 5  
ATOM 5490  H HG21 . VAL A 1 54 ? 7.608   5.502   1.158   1.00 10.00 ? 463 VAL A HG21 5  
ATOM 5491  H HG22 . VAL A 1 54 ? 9.302   5.025   1.048   1.00 10.00 ? 463 VAL A HG22 5  
ATOM 5492  H HG23 . VAL A 1 54 ? 8.034   3.806   0.927   1.00 10.00 ? 463 VAL A HG23 5  
ATOM 5493  N N    . ALA A 1 55 ? 8.787   3.491   -3.515  1.00 10.00 ? 464 ALA A N    5  
ATOM 5494  C CA   . ALA A 1 55 ? 9.061   3.524   -4.946  1.00 10.00 ? 464 ALA A CA   5  
ATOM 5495  C C    . ALA A 1 55 ? 8.348   2.379   -5.657  1.00 10.00 ? 464 ALA A C    5  
ATOM 5496  O O    . ALA A 1 55 ? 8.057   2.461   -6.851  1.00 10.00 ? 464 ALA A O    5  
ATOM 5497  C CB   . ALA A 1 55 ? 10.559  3.457   -5.199  1.00 10.00 ? 464 ALA A CB   5  
ATOM 5498  H H    . ALA A 1 55 ? 9.448   3.093   -2.911  1.00 10.00 ? 464 ALA A H    5  
ATOM 5499  H HA   . ALA A 1 55 ? 8.693   4.463   -5.335  1.00 10.00 ? 464 ALA A HA   5  
ATOM 5500  H HB1  . ALA A 1 55 ? 10.982  4.449   -5.123  1.00 10.00 ? 464 ALA A HB1  5  
ATOM 5501  H HB2  . ALA A 1 55 ? 10.739  3.065   -6.189  1.00 10.00 ? 464 ALA A HB2  5  
ATOM 5502  H HB3  . ALA A 1 55 ? 11.020  2.811   -4.467  1.00 10.00 ? 464 ALA A HB3  5  
ATOM 5503  N N    . GLU A 1 56 ? 8.066   1.313   -4.914  1.00 10.00 ? 465 GLU A N    5  
ATOM 5504  C CA   . GLU A 1 56 ? 7.384   0.150   -5.470  1.00 10.00 ? 465 GLU A CA   5  
ATOM 5505  C C    . GLU A 1 56 ? 5.869   0.303   -5.359  1.00 10.00 ? 465 GLU A C    5  
ATOM 5506  O O    . GLU A 1 56 ? 5.120   -0.272  -6.148  1.00 10.00 ? 465 GLU A O    5  
ATOM 5507  C CB   . GLU A 1 56 ? 7.833   -1.123  -4.751  1.00 10.00 ? 465 GLU A CB   5  
ATOM 5508  C CG   . GLU A 1 56 ? 7.340   -2.400  -5.411  1.00 10.00 ? 465 GLU A CG   5  
ATOM 5509  C CD   . GLU A 1 56 ? 8.146   -2.768  -6.642  1.00 10.00 ? 465 GLU A CD   5  
ATOM 5510  O OE1  . GLU A 1 56 ? 9.369   -2.515  -6.649  1.00 10.00 ? 465 GLU A OE1  5  
ATOM 5511  O OE2  . GLU A 1 56 ? 7.553   -3.311  -7.599  1.00 10.00 ? 465 GLU A OE2  5  
ATOM 5512  H H    . GLU A 1 56 ? 8.321   1.307   -3.969  1.00 10.00 ? 465 GLU A H    5  
ATOM 5513  H HA   . GLU A 1 56 ? 7.650   0.077   -6.514  1.00 10.00 ? 465 GLU A HA   5  
ATOM 5514  H HB2  . GLU A 1 56 ? 8.912   -1.148  -4.728  1.00 10.00 ? 465 GLU A HB2  5  
ATOM 5515  H HB3  . GLU A 1 56 ? 7.461   -1.100  -3.737  1.00 10.00 ? 465 GLU A HB3  5  
ATOM 5516  H HG2  . GLU A 1 56 ? 7.411   -3.209  -4.700  1.00 10.00 ? 465 GLU A HG2  5  
ATOM 5517  H HG3  . GLU A 1 56 ? 6.309   -2.266  -5.701  1.00 10.00 ? 465 GLU A HG3  5  
ATOM 5518  N N    . CYS A 1 57 ? 5.422   1.084   -4.379  1.00 10.00 ? 466 CYS A N    5  
ATOM 5519  C CA   . CYS A 1 57 ? 3.997   1.310   -4.175  1.00 10.00 ? 466 CYS A CA   5  
ATOM 5520  C C    . CYS A 1 57 ? 3.376   1.952   -5.407  1.00 10.00 ? 466 CYS A C    5  
ATOM 5521  O O    . CYS A 1 57 ? 2.185   1.788   -5.672  1.00 10.00 ? 466 CYS A O    5  
ATOM 5522  C CB   . CYS A 1 57 ? 3.760   2.189   -2.944  1.00 10.00 ? 466 CYS A CB   5  
ATOM 5523  S SG   . CYS A 1 57 ? 3.408   1.262   -1.432  1.00 10.00 ? 466 CYS A SG   5  
ATOM 5524  H H    . CYS A 1 57 ? 6.065   1.519   -3.781  1.00 10.00 ? 466 CYS A H    5  
ATOM 5525  H HA   . CYS A 1 57 ? 3.530   0.348   -4.017  1.00 10.00 ? 466 CYS A HA   5  
ATOM 5526  H HB2  . CYS A 1 57 ? 4.640   2.788   -2.763  1.00 10.00 ? 466 CYS A HB2  5  
ATOM 5527  H HB3  . CYS A 1 57 ? 2.920   2.841   -3.132  1.00 10.00 ? 466 CYS A HB3  5  
ATOM 5528  H HG   . CYS A 1 57 ? 2.458   1.138   -1.374  1.00 10.00 ? 466 CYS A HG   5  
ATOM 5529  N N    . VAL A 1 58 ? 4.196   2.670   -6.173  1.00 10.00 ? 467 VAL A N    5  
ATOM 5530  C CA   . VAL A 1 58 ? 3.727   3.315   -7.392  1.00 10.00 ? 467 VAL A CA   5  
ATOM 5531  C C    . VAL A 1 58 ? 3.091   2.294   -8.332  1.00 10.00 ? 467 VAL A C    5  
ATOM 5532  O O    . VAL A 1 58 ? 2.347   2.651   -9.244  1.00 10.00 ? 467 VAL A O    5  
ATOM 5533  C CB   . VAL A 1 58 ? 4.875   4.034   -8.127  1.00 10.00 ? 467 VAL A CB   5  
ATOM 5534  C CG1  . VAL A 1 58 ? 5.961   3.046   -8.523  1.00 10.00 ? 467 VAL A CG1  5  
ATOM 5535  C CG2  . VAL A 1 58 ? 4.349   4.776   -9.348  1.00 10.00 ? 467 VAL A CG2  5  
ATOM 5536  H H    . VAL A 1 58 ? 5.139   2.754   -5.919  1.00 10.00 ? 467 VAL A H    5  
ATOM 5537  H HA   . VAL A 1 58 ? 2.984   4.050   -7.117  1.00 10.00 ? 467 VAL A HA   5  
ATOM 5538  H HB   . VAL A 1 58 ? 5.309   4.759   -7.454  1.00 10.00 ? 467 VAL A HB   5  
ATOM 5539  H HG11 . VAL A 1 58 ? 6.023   2.263   -7.781  1.00 10.00 ? 467 VAL A HG11 5  
ATOM 5540  H HG12 . VAL A 1 58 ? 6.910   3.558   -8.585  1.00 10.00 ? 467 VAL A HG12 5  
ATOM 5541  H HG13 . VAL A 1 58 ? 5.723   2.613   -9.483  1.00 10.00 ? 467 VAL A HG13 5  
ATOM 5542  H HG21 . VAL A 1 58 ? 3.887   4.071   -10.026 1.00 10.00 ? 467 VAL A HG21 5  
ATOM 5543  H HG22 . VAL A 1 58 ? 5.166   5.273   -9.849  1.00 10.00 ? 467 VAL A HG22 5  
ATOM 5544  H HG23 . VAL A 1 58 ? 3.618   5.507   -9.038  1.00 10.00 ? 467 VAL A HG23 5  
ATOM 5545  N N    . LEU A 1 59 ? 3.389   1.017   -8.103  1.00 10.00 ? 468 LEU A N    5  
ATOM 5546  C CA   . LEU A 1 59 ? 2.846   -0.055  -8.925  1.00 10.00 ? 468 LEU A CA   5  
ATOM 5547  C C    . LEU A 1 59 ? 1.365   -0.297  -8.629  1.00 10.00 ? 468 LEU A C    5  
ATOM 5548  O O    . LEU A 1 59 ? 0.741   -1.160  -9.242  1.00 10.00 ? 468 LEU A O    5  
ATOM 5549  C CB   . LEU A 1 59 ? 3.648   -1.340  -8.704  1.00 10.00 ? 468 LEU A CB   5  
ATOM 5550  C CG   . LEU A 1 59 ? 4.109   -2.043  -9.982  1.00 10.00 ? 468 LEU A CG   5  
ATOM 5551  C CD1  . LEU A 1 59 ? 5.385   -1.406  -10.511 1.00 10.00 ? 468 LEU A CD1  5  
ATOM 5552  C CD2  . LEU A 1 59 ? 4.319   -3.528  -9.725  1.00 10.00 ? 468 LEU A CD2  5  
ATOM 5553  H H    . LEU A 1 59 ? 3.989   0.788   -7.365  1.00 10.00 ? 468 LEU A H    5  
ATOM 5554  H HA   . LEU A 1 59 ? 2.940   0.247   -9.957  1.00 10.00 ? 468 LEU A HA   5  
ATOM 5555  H HB2  . LEU A 1 59 ? 4.522   -1.094  -8.116  1.00 10.00 ? 468 LEU A HB2  5  
ATOM 5556  H HB3  . LEU A 1 59 ? 3.038   -2.029  -8.140  1.00 10.00 ? 468 LEU A HB3  5  
ATOM 5557  H HG   . LEU A 1 59 ? 3.345   -1.938  -10.739 1.00 10.00 ? 468 LEU A HG   5  
ATOM 5558  H HD11 . LEU A 1 59 ? 5.384   -1.440  -11.591 1.00 10.00 ? 468 LEU A HD11 5  
ATOM 5559  H HD12 . LEU A 1 59 ? 6.241   -1.947  -10.134 1.00 10.00 ? 468 LEU A HD12 5  
ATOM 5560  H HD13 . LEU A 1 59 ? 5.436   -0.378  -10.183 1.00 10.00 ? 468 LEU A HD13 5  
ATOM 5561  H HD21 . LEU A 1 59 ? 3.385   -4.051  -9.859  1.00 10.00 ? 468 LEU A HD21 5  
ATOM 5562  H HD22 . LEU A 1 59 ? 4.672   -3.672  -8.715  1.00 10.00 ? 468 LEU A HD22 5  
ATOM 5563  H HD23 . LEU A 1 59 ? 5.051   -3.913  -10.420 1.00 10.00 ? 468 LEU A HD23 5  
ATOM 5564  N N    . TYR A 1 60 ? 0.811   0.463   -7.690  1.00 10.00 ? 469 TYR A N    5  
ATOM 5565  C CA   . TYR A 1 60 ? -0.596  0.331   -7.329  1.00 10.00 ? 469 TYR A CA   5  
ATOM 5566  C C    . TYR A 1 60 ? -1.364  1.626   -7.612  1.00 10.00 ? 469 TYR A C    5  
ATOM 5567  O O    . TYR A 1 60 ? -2.594  1.648   -7.568  1.00 10.00 ? 469 TYR A O    5  
ATOM 5568  C CB   . TYR A 1 60 ? -0.729  -0.071  -5.853  1.00 10.00 ? 469 TYR A CB   5  
ATOM 5569  C CG   . TYR A 1 60 ? -1.224  1.005   -4.913  1.00 10.00 ? 469 TYR A CG   5  
ATOM 5570  C CD1  . TYR A 1 60 ? -0.697  2.286   -4.959  1.00 10.00 ? 469 TYR A CD1  5  
ATOM 5571  C CD2  . TYR A 1 60 ? -2.209  0.731   -3.971  1.00 10.00 ? 469 TYR A CD2  5  
ATOM 5572  C CE1  . TYR A 1 60 ? -1.137  3.270   -4.098  1.00 10.00 ? 469 TYR A CE1  5  
ATOM 5573  C CE2  . TYR A 1 60 ? -2.653  1.709   -3.106  1.00 10.00 ? 469 TYR A CE2  5  
ATOM 5574  C CZ   . TYR A 1 60 ? -2.114  2.978   -3.174  1.00 10.00 ? 469 TYR A CZ   5  
ATOM 5575  O OH   . TYR A 1 60 ? -2.547  3.955   -2.311  1.00 10.00 ? 469 TYR A OH   5  
ATOM 5576  H H    . TYR A 1 60 ? 1.356   1.123   -7.226  1.00 10.00 ? 469 TYR A H    5  
ATOM 5577  H HA   . TYR A 1 60 ? -1.010  -0.456  -7.938  1.00 10.00 ? 469 TYR A HA   5  
ATOM 5578  H HB2  . TYR A 1 60 ? -1.413  -0.897  -5.781  1.00 10.00 ? 469 TYR A HB2  5  
ATOM 5579  H HB3  . TYR A 1 60 ? 0.238   -0.382  -5.500  1.00 10.00 ? 469 TYR A HB3  5  
ATOM 5580  H HD1  . TYR A 1 60 ? 0.067   2.509   -5.685  1.00 10.00 ? 469 TYR A HD1  5  
ATOM 5581  H HD2  . TYR A 1 60 ? -2.630  -0.270  -3.911  1.00 10.00 ? 469 TYR A HD2  5  
ATOM 5582  H HE1  . TYR A 1 60 ? -0.715  4.262   -4.152  1.00 10.00 ? 469 TYR A HE1  5  
ATOM 5583  H HE2  . TYR A 1 60 ? -3.419  1.472   -2.380  1.00 10.00 ? 469 TYR A HE2  5  
ATOM 5584  H HH   . TYR A 1 60 ? -1.834  4.195   -1.714  1.00 10.00 ? 469 TYR A HH   5  
ATOM 5585  N N    . TYR A 1 61 ? -0.633  2.710   -7.881  1.00 10.00 ? 470 TYR A N    5  
ATOM 5586  C CA   . TYR A 1 61 ? -1.256  4.000   -8.142  1.00 10.00 ? 470 TYR A CA   5  
ATOM 5587  C C    . TYR A 1 61 ? -1.584  4.177   -9.623  1.00 10.00 ? 470 TYR A C    5  
ATOM 5588  O O    . TYR A 1 61 ? -2.557  4.847   -9.967  1.00 10.00 ? 470 TYR A O    5  
ATOM 5589  C CB   . TYR A 1 61 ? -0.353  5.136   -7.631  1.00 10.00 ? 470 TYR A CB   5  
ATOM 5590  C CG   . TYR A 1 61 ? 0.218   6.032   -8.712  1.00 10.00 ? 470 TYR A CG   5  
ATOM 5591  C CD1  . TYR A 1 61 ? 1.080   5.526   -9.674  1.00 10.00 ? 470 TYR A CD1  5  
ATOM 5592  C CD2  . TYR A 1 61 ? -0.106  7.382   -8.767  1.00 10.00 ? 470 TYR A CD2  5  
ATOM 5593  C CE1  . TYR A 1 61 ? 1.605   6.336   -10.660 1.00 10.00 ? 470 TYR A CE1  5  
ATOM 5594  C CE2  . TYR A 1 61 ? 0.415   8.200   -9.751  1.00 10.00 ? 470 TYR A CE2  5  
ATOM 5595  C CZ   . TYR A 1 61 ? 1.270   7.673   -10.695 1.00 10.00 ? 470 TYR A CZ   5  
ATOM 5596  O OH   . TYR A 1 61 ? 1.792   8.484   -11.676 1.00 10.00 ? 470 TYR A OH   5  
ATOM 5597  H H    . TYR A 1 61 ? 0.344   2.643   -7.890  1.00 10.00 ? 470 TYR A H    5  
ATOM 5598  H HA   . TYR A 1 61 ? -2.183  4.026   -7.587  1.00 10.00 ? 470 TYR A HA   5  
ATOM 5599  H HB2  . TYR A 1 61 ? -0.924  5.761   -6.961  1.00 10.00 ? 470 TYR A HB2  5  
ATOM 5600  H HB3  . TYR A 1 61 ? 0.476   4.705   -7.088  1.00 10.00 ? 470 TYR A HB3  5  
ATOM 5601  H HD1  . TYR A 1 61 ? 1.339   4.480   -9.645  1.00 10.00 ? 470 TYR A HD1  5  
ATOM 5602  H HD2  . TYR A 1 61 ? -0.777  7.792   -8.026  1.00 10.00 ? 470 TYR A HD2  5  
ATOM 5603  H HE1  . TYR A 1 61 ? 2.274   5.920   -11.397 1.00 10.00 ? 470 TYR A HE1  5  
ATOM 5604  H HE2  . TYR A 1 61 ? 0.152   9.248   -9.777  1.00 10.00 ? 470 TYR A HE2  5  
ATOM 5605  H HH   . TYR A 1 61 ? 1.121   9.106   -11.968 1.00 10.00 ? 470 TYR A HH   5  
ATOM 5606  N N    . TYR A 1 62 ? -0.780  3.581   -10.501 1.00 10.00 ? 471 TYR A N    5  
ATOM 5607  C CA   . TYR A 1 62 ? -1.031  3.704   -11.934 1.00 10.00 ? 471 TYR A CA   5  
ATOM 5608  C C    . TYR A 1 62 ? -2.090  2.700   -12.393 1.00 10.00 ? 471 TYR A C    5  
ATOM 5609  O O    . TYR A 1 62 ? -2.479  2.684   -13.560 1.00 10.00 ? 471 TYR A O    5  
ATOM 5610  C CB   . TYR A 1 62 ? 0.271   3.550   -12.736 1.00 10.00 ? 471 TYR A CB   5  
ATOM 5611  C CG   . TYR A 1 62 ? 0.692   2.119   -12.983 1.00 10.00 ? 471 TYR A CG   5  
ATOM 5612  C CD1  . TYR A 1 62 ? 0.087   1.359   -13.976 1.00 10.00 ? 471 TYR A CD1  5  
ATOM 5613  C CD2  . TYR A 1 62 ? 1.697   1.529   -12.226 1.00 10.00 ? 471 TYR A CD2  5  
ATOM 5614  C CE1  . TYR A 1 62 ? 0.469   0.052   -14.207 1.00 10.00 ? 471 TYR A CE1  5  
ATOM 5615  C CE2  . TYR A 1 62 ? 2.085   0.223   -12.453 1.00 10.00 ? 471 TYR A CE2  5  
ATOM 5616  C CZ   . TYR A 1 62 ? 1.469   -0.512  -13.443 1.00 10.00 ? 471 TYR A CZ   5  
ATOM 5617  O OH   . TYR A 1 62 ? 1.853   -1.813  -13.671 1.00 10.00 ? 471 TYR A OH   5  
ATOM 5618  H H    . TYR A 1 62 ? -0.011  3.051   -10.184 1.00 10.00 ? 471 TYR A H    5  
ATOM 5619  H HA   . TYR A 1 62 ? -1.424  4.697   -12.100 1.00 10.00 ? 471 TYR A HA   5  
ATOM 5620  H HB2  . TYR A 1 62 ? 0.147   4.024   -13.697 1.00 10.00 ? 471 TYR A HB2  5  
ATOM 5621  H HB3  . TYR A 1 62 ? 1.069   4.042   -12.201 1.00 10.00 ? 471 TYR A HB3  5  
ATOM 5622  H HD1  . TYR A 1 62 ? -0.696  1.803   -14.573 1.00 10.00 ? 471 TYR A HD1  5  
ATOM 5623  H HD2  . TYR A 1 62 ? 2.179   2.108   -11.450 1.00 10.00 ? 471 TYR A HD2  5  
ATOM 5624  H HE1  . TYR A 1 62 ? -0.015  -0.523  -14.983 1.00 10.00 ? 471 TYR A HE1  5  
ATOM 5625  H HE2  . TYR A 1 62 ? 2.868   -0.219  -11.855 1.00 10.00 ? 471 TYR A HE2  5  
ATOM 5626  H HH   . TYR A 1 62 ? 1.857   -2.296  -12.841 1.00 10.00 ? 471 TYR A HH   5  
ATOM 5627  N N    . LEU A 1 63 ? -2.573  1.886   -11.457 1.00 10.00 ? 472 LEU A N    5  
ATOM 5628  C CA   . LEU A 1 63 ? -3.608  0.903   -11.750 1.00 10.00 ? 472 LEU A CA   5  
ATOM 5629  C C    . LEU A 1 63 ? -4.941  1.403   -11.214 1.00 10.00 ? 472 LEU A C    5  
ATOM 5630  O O    . LEU A 1 63 ? -5.992  1.195   -11.821 1.00 10.00 ? 472 LEU A O    5  
ATOM 5631  C CB   . LEU A 1 63 ? -3.267  -0.447  -11.114 1.00 10.00 ? 472 LEU A CB   5  
ATOM 5632  C CG   . LEU A 1 63 ? -1.971  -1.089  -11.602 1.00 10.00 ? 472 LEU A CG   5  
ATOM 5633  C CD1  . LEU A 1 63 ? -1.995  -1.255  -13.114 1.00 10.00 ? 472 LEU A CD1  5  
ATOM 5634  C CD2  . LEU A 1 63 ? -0.772  -0.260  -11.175 1.00 10.00 ? 472 LEU A CD2  5  
ATOM 5635  H H    . LEU A 1 63 ? -2.238  1.959   -10.540 1.00 10.00 ? 472 LEU A H    5  
ATOM 5636  H HA   . LEU A 1 63 ? -3.674  0.789   -12.821 1.00 10.00 ? 472 LEU A HA   5  
ATOM 5637  H HB2  . LEU A 1 63 ? -3.195  -0.308  -10.045 1.00 10.00 ? 472 LEU A HB2  5  
ATOM 5638  H HB3  . LEU A 1 63 ? -4.079  -1.130  -11.315 1.00 10.00 ? 472 LEU A HB3  5  
ATOM 5639  H HG   . LEU A 1 63 ? -1.875  -2.070  -11.161 1.00 10.00 ? 472 LEU A HG   5  
ATOM 5640  H HD11 . LEU A 1 63 ? -1.935  -0.286  -13.584 1.00 10.00 ? 472 LEU A HD11 5  
ATOM 5641  H HD12 . LEU A 1 63 ? -2.913  -1.742  -13.409 1.00 10.00 ? 472 LEU A HD12 5  
ATOM 5642  H HD13 . LEU A 1 63 ? -1.153  -1.858  -13.423 1.00 10.00 ? 472 LEU A HD13 5  
ATOM 5643  H HD21 . LEU A 1 63 ? -0.727  0.637   -11.767 1.00 10.00 ? 472 LEU A HD21 5  
ATOM 5644  H HD22 . LEU A 1 63 ? 0.132   -0.832  -11.319 1.00 10.00 ? 472 LEU A HD22 5  
ATOM 5645  H HD23 . LEU A 1 63 ? -0.868  0.004   -10.129 1.00 10.00 ? 472 LEU A HD23 5  
ATOM 5646  N N    . THR A 1 64 ? -4.877  2.074   -10.069 1.00 10.00 ? 473 THR A N    5  
ATOM 5647  C CA   . THR A 1 64 ? -6.060  2.628   -9.431  1.00 10.00 ? 473 THR A CA   5  
ATOM 5648  C C    . THR A 1 64 ? -6.566  3.846   -10.194 1.00 10.00 ? 473 THR A C    5  
ATOM 5649  O O    . THR A 1 64 ? -7.757  4.156   -10.164 1.00 10.00 ? 473 THR A O    5  
ATOM 5650  C CB   . THR A 1 64 ? -5.748  2.998   -7.977  1.00 10.00 ? 473 THR A CB   5  
ATOM 5651  O OG1  . THR A 1 64 ? -4.536  3.722   -7.895  1.00 10.00 ? 473 THR A OG1  5  
ATOM 5652  C CG2  . THR A 1 64 ? -5.625  1.795   -7.065  1.00 10.00 ? 473 THR A CG2  5  
ATOM 5653  H H    . THR A 1 64 ? -4.003  2.206   -9.645  1.00 10.00 ? 473 THR A H    5  
ATOM 5654  H HA   . THR A 1 64 ? -6.828  1.878   -9.439  1.00 10.00 ? 473 THR A HA   5  
ATOM 5655  H HB   . THR A 1 64 ? -6.544  3.621   -7.597  1.00 10.00 ? 473 THR A HB   5  
ATOM 5656  H HG1  . THR A 1 64 ? -4.591  4.359   -7.180  1.00 10.00 ? 473 THR A HG1  5  
ATOM 5657  H HG21 . THR A 1 64 ? -4.632  1.767   -6.637  1.00 10.00 ? 473 THR A HG21 5  
ATOM 5658  H HG22 . THR A 1 64 ? -5.797  0.894   -7.633  1.00 10.00 ? 473 THR A HG22 5  
ATOM 5659  H HG23 . THR A 1 64 ? -6.356  1.866   -6.273  1.00 10.00 ? 473 THR A HG23 5  
ATOM 5660  N N    . LYS A 1 65 ? -5.657  4.538   -10.878 1.00 10.00 ? 474 LYS A N    5  
ATOM 5661  C CA   . LYS A 1 65 ? -6.025  5.722   -11.645 1.00 10.00 ? 474 LYS A CA   5  
ATOM 5662  C C    . LYS A 1 65 ? -6.330  5.364   -13.096 1.00 10.00 ? 474 LYS A C    5  
ATOM 5663  O O    . LYS A 1 65 ? -7.085  6.065   -13.771 1.00 10.00 ? 474 LYS A O    5  
ATOM 5664  C CB   . LYS A 1 65 ? -4.905  6.764   -11.586 1.00 10.00 ? 474 LYS A CB   5  
ATOM 5665  C CG   . LYS A 1 65 ? -3.621  6.314   -12.261 1.00 10.00 ? 474 LYS A CG   5  
ATOM 5666  C CD   . LYS A 1 65 ? -2.443  7.185   -11.854 1.00 10.00 ? 474 LYS A CD   5  
ATOM 5667  C CE   . LYS A 1 65 ? -1.517  7.454   -13.029 1.00 10.00 ? 474 LYS A CE   5  
ATOM 5668  N NZ   . LYS A 1 65 ? -1.013  8.856   -13.029 1.00 10.00 ? 474 LYS A NZ   5  
ATOM 5669  H H    . LYS A 1 65 ? -4.718  4.246   -10.868 1.00 10.00 ? 474 LYS A H    5  
ATOM 5670  H HA   . LYS A 1 65 ? -6.915  6.139   -11.197 1.00 10.00 ? 474 LYS A HA   5  
ATOM 5671  H HB2  . LYS A 1 65 ? -5.245  7.667   -12.071 1.00 10.00 ? 474 LYS A HB2  5  
ATOM 5672  H HB3  . LYS A 1 65 ? -4.686  6.982   -10.551 1.00 10.00 ? 474 LYS A HB3  5  
ATOM 5673  H HG2  . LYS A 1 65 ? -3.416  5.293   -11.978 1.00 10.00 ? 474 LYS A HG2  5  
ATOM 5674  H HG3  . LYS A 1 65 ? -3.749  6.375   -13.332 1.00 10.00 ? 474 LYS A HG3  5  
ATOM 5675  H HD2  . LYS A 1 65 ? -2.816  8.126   -11.480 1.00 10.00 ? 474 LYS A HD2  5  
ATOM 5676  H HD3  . LYS A 1 65 ? -1.887  6.681   -11.077 1.00 10.00 ? 474 LYS A HD3  5  
ATOM 5677  H HE2  . LYS A 1 65 ? -0.675  6.779   -12.970 1.00 10.00 ? 474 LYS A HE2  5  
ATOM 5678  H HE3  . LYS A 1 65 ? -2.058  7.276   -13.946 1.00 10.00 ? 474 LYS A HE3  5  
ATOM 5679  H HZ1  . LYS A 1 65 ? -1.697  9.481   -13.500 1.00 10.00 ? 474 LYS A HZ1  5  
ATOM 5680  H HZ2  . LYS A 1 65 ? -0.105  8.910   -13.533 1.00 10.00 ? 474 LYS A HZ2  5  
ATOM 5681  H HZ3  . LYS A 1 65 ? -0.874  9.185   -12.052 1.00 10.00 ? 474 LYS A HZ3  5  
ATOM 5682  N N    . LYS A 1 66 ? -5.746  4.271   -13.572 1.00 10.00 ? 475 LYS A N    5  
ATOM 5683  C CA   . LYS A 1 66 ? -5.968  3.828   -14.942 1.00 10.00 ? 475 LYS A CA   5  
ATOM 5684  C C    . LYS A 1 66 ? -7.441  3.500   -15.179 1.00 10.00 ? 475 LYS A C    5  
ATOM 5685  O O    . LYS A 1 66 ? -7.905  3.480   -16.320 1.00 10.00 ? 475 LYS A O    5  
ATOM 5686  C CB   . LYS A 1 66 ? -5.104  2.603   -15.251 1.00 10.00 ? 475 LYS A CB   5  
ATOM 5687  C CG   . LYS A 1 66 ? -5.276  2.077   -16.667 1.00 10.00 ? 475 LYS A CG   5  
ATOM 5688  C CD   . LYS A 1 66 ? -4.992  3.156   -17.699 1.00 10.00 ? 475 LYS A CD   5  
ATOM 5689  C CE   . LYS A 1 66 ? -4.777  2.562   -19.082 1.00 10.00 ? 475 LYS A CE   5  
ATOM 5690  N NZ   . LYS A 1 66 ? -3.749  3.310   -19.856 1.00 10.00 ? 475 LYS A NZ   5  
ATOM 5691  H H    . LYS A 1 66 ? -5.156  3.749   -12.989 1.00 10.00 ? 475 LYS A H    5  
ATOM 5692  H HA   . LYS A 1 66 ? -5.681  4.634   -15.601 1.00 10.00 ? 475 LYS A HA   5  
ATOM 5693  H HB2  . LYS A 1 66 ? -4.067  2.865   -15.111 1.00 10.00 ? 475 LYS A HB2  5  
ATOM 5694  H HB3  . LYS A 1 66 ? -5.364  1.812   -14.563 1.00 10.00 ? 475 LYS A HB3  5  
ATOM 5695  H HG2  . LYS A 1 66 ? -4.592  1.257   -16.822 1.00 10.00 ? 475 LYS A HG2  5  
ATOM 5696  H HG3  . LYS A 1 66 ? -6.292  1.731   -16.792 1.00 10.00 ? 475 LYS A HG3  5  
ATOM 5697  H HD2  . LYS A 1 66 ? -5.829  3.835   -17.738 1.00 10.00 ? 475 LYS A HD2  5  
ATOM 5698  H HD3  . LYS A 1 66 ? -4.102  3.694   -17.407 1.00 10.00 ? 475 LYS A HD3  5  
ATOM 5699  H HE2  . LYS A 1 66 ? -4.458  1.536   -18.973 1.00 10.00 ? 475 LYS A HE2  5  
ATOM 5700  H HE3  . LYS A 1 66 ? -5.713  2.590   -19.621 1.00 10.00 ? 475 LYS A HE3  5  
ATOM 5701  H HZ1  . LYS A 1 66 ? -3.781  3.030   -20.858 1.00 10.00 ? 475 LYS A HZ1  5  
ATOM 5702  H HZ2  . LYS A 1 66 ? -2.801  3.105   -19.482 1.00 10.00 ? 475 LYS A HZ2  5  
ATOM 5703  H HZ3  . LYS A 1 66 ? -3.923  4.333   -19.787 1.00 10.00 ? 475 LYS A HZ3  5  
ATOM 5704  N N    . ASN A 1 67 ? -8.171  3.237   -14.098 1.00 10.00 ? 476 ASN A N    5  
ATOM 5705  C CA   . ASN A 1 67 ? -9.589  2.903   -14.196 1.00 10.00 ? 476 ASN A CA   5  
ATOM 5706  C C    . ASN A 1 67 ? -10.461 3.911   -13.448 1.00 10.00 ? 476 ASN A C    5  
ATOM 5707  O O    . ASN A 1 67 ? -11.650 4.042   -13.736 1.00 10.00 ? 476 ASN A O    5  
ATOM 5708  C CB   . ASN A 1 67 ? -9.838  1.497   -13.650 1.00 10.00 ? 476 ASN A CB   5  
ATOM 5709  C CG   . ASN A 1 67 ? -9.626  0.422   -14.698 1.00 10.00 ? 476 ASN A CG   5  
ATOM 5710  O OD1  . ASN A 1 67 ? -10.539 -0.341  -15.015 1.00 10.00 ? 476 ASN A OD1  5  
ATOM 5711  N ND2  . ASN A 1 67 ? -8.417  0.357   -15.243 1.00 10.00 ? 476 ASN A ND2  5  
ATOM 5712  H H    . ASN A 1 67 ? -7.747  3.261   -13.215 1.00 10.00 ? 476 ASN A H    5  
ATOM 5713  H HA   . ASN A 1 67 ? -9.859  2.922   -15.242 1.00 10.00 ? 476 ASN A HA   5  
ATOM 5714  H HB2  . ASN A 1 67 ? -9.161  1.311   -12.829 1.00 10.00 ? 476 ASN A HB2  5  
ATOM 5715  H HB3  . ASN A 1 67 ? -10.856 1.431   -13.293 1.00 10.00 ? 476 ASN A HB3  5  
ATOM 5716  H HD21 . ASN A 1 67 ? -7.738  0.997   -14.942 1.00 10.00 ? 476 ASN A HD21 5  
ATOM 5717  H HD22 . ASN A 1 67 ? -8.252  -0.328  -15.925 1.00 10.00 ? 476 ASN A HD22 5  
ATOM 5718  N N    . GLU A 1 68 ? -9.872  4.619   -12.486 1.00 10.00 ? 477 GLU A N    5  
ATOM 5719  C CA   . GLU A 1 68 ? -10.617 5.604   -11.706 1.00 10.00 ? 477 GLU A CA   5  
ATOM 5720  C C    . GLU A 1 68 ? -10.273 7.024   -12.144 1.00 10.00 ? 477 GLU A C    5  
ATOM 5721  O O    . GLU A 1 68 ? -11.130 7.906   -12.153 1.00 10.00 ? 477 GLU A O    5  
ATOM 5722  C CB   . GLU A 1 68 ? -10.323 5.433   -10.216 1.00 10.00 ? 477 GLU A CB   5  
ATOM 5723  C CG   . GLU A 1 68 ? -10.461 3.999   -9.729  1.00 10.00 ? 477 GLU A CG   5  
ATOM 5724  C CD   . GLU A 1 68 ? -11.903 3.606   -9.478  1.00 10.00 ? 477 GLU A CD   5  
ATOM 5725  O OE1  . GLU A 1 68 ? -12.789 4.097   -10.208 1.00 10.00 ? 477 GLU A OE1  5  
ATOM 5726  O OE2  . GLU A 1 68 ? -12.147 2.806   -8.550  1.00 10.00 ? 477 GLU A OE2  5  
ATOM 5727  H H    . GLU A 1 68 ? -8.922  4.476   -12.293 1.00 10.00 ? 477 GLU A H    5  
ATOM 5728  H HA   . GLU A 1 68 ? -11.670 5.434   -11.878 1.00 10.00 ? 477 GLU A HA   5  
ATOM 5729  H HB2  . GLU A 1 68 ? -9.314  5.761   -10.020 1.00 10.00 ? 477 GLU A HB2  5  
ATOM 5730  H HB3  . GLU A 1 68 ? -11.009 6.049   -9.652  1.00 10.00 ? 477 GLU A HB3  5  
ATOM 5731  H HG2  . GLU A 1 68 ? -10.049 3.338   -10.476 1.00 10.00 ? 477 GLU A HG2  5  
ATOM 5732  H HG3  . GLU A 1 68 ? -9.907  3.890   -8.808  1.00 10.00 ? 477 GLU A HG3  5  
ATOM 5733  N N    . ASN A 1 69 ? -9.012  7.236   -12.503 1.00 10.00 ? 478 ASN A N    5  
ATOM 5734  C CA   . ASN A 1 69 ? -8.550  8.548   -12.939 1.00 10.00 ? 478 ASN A CA   5  
ATOM 5735  C C    . ASN A 1 69 ? -8.721  9.578   -11.827 1.00 10.00 ? 478 ASN A C    5  
ATOM 5736  O O    . ASN A 1 69 ? -9.525  10.502  -11.939 1.00 10.00 ? 478 ASN A O    5  
ATOM 5737  C CB   . ASN A 1 69 ? -9.315  8.992   -14.188 1.00 10.00 ? 478 ASN A CB   5  
ATOM 5738  C CG   . ASN A 1 69 ? -8.616  8.582   -15.469 1.00 10.00 ? 478 ASN A CG   5  
ATOM 5739  O OD1  . ASN A 1 69 ? -7.622  7.857   -15.443 1.00 10.00 ? 478 ASN A OD1  5  
ATOM 5740  N ND2  . ASN A 1 69 ? -9.136  9.046   -16.601 1.00 10.00 ? 478 ASN A ND2  5  
ATOM 5741  H H    . ASN A 1 69 ? -8.377  6.493   -12.471 1.00 10.00 ? 478 ASN A H    5  
ATOM 5742  H HA   . ASN A 1 69 ? -7.501  8.466   -13.179 1.00 10.00 ? 478 ASN A HA   5  
ATOM 5743  H HB2  . ASN A 1 69 ? -10.299 8.548   -14.178 1.00 10.00 ? 478 ASN A HB2  5  
ATOM 5744  H HB3  . ASN A 1 69 ? -9.411  10.068  -14.179 1.00 10.00 ? 478 ASN A HB3  5  
ATOM 5745  H HD21 . ASN A 1 69 ? -9.930  9.618   -16.545 1.00 10.00 ? 478 ASN A HD21 5  
ATOM 5746  H HD22 . ASN A 1 69 ? -8.704  8.796   -17.444 1.00 10.00 ? 478 ASN A HD22 5  
ATOM 5747  N N    . TYR A 1 70 ? -7.959  9.410   -10.749 1.00 10.00 ? 479 TYR A N    5  
ATOM 5748  C CA   . TYR A 1 70 ? -8.029  10.326  -9.617  1.00 10.00 ? 479 TYR A CA   5  
ATOM 5749  C C    . TYR A 1 70 ? -6.918  11.366  -9.687  1.00 10.00 ? 479 TYR A C    5  
ATOM 5750  O O    . TYR A 1 70 ? -6.365  11.771  -8.664  1.00 10.00 ? 479 TYR A O    5  
ATOM 5751  C CB   . TYR A 1 70 ? -7.946  9.552   -8.298  1.00 10.00 ? 479 TYR A CB   5  
ATOM 5752  C CG   . TYR A 1 70 ? -6.778  8.592   -8.221  1.00 10.00 ? 479 TYR A CG   5  
ATOM 5753  C CD1  . TYR A 1 70 ? -5.499  9.046   -7.920  1.00 10.00 ? 479 TYR A CD1  5  
ATOM 5754  C CD2  . TYR A 1 70 ? -6.954  7.230   -8.441  1.00 10.00 ? 479 TYR A CD2  5  
ATOM 5755  C CE1  . TYR A 1 70 ? -4.431  8.173   -7.842  1.00 10.00 ? 479 TYR A CE1  5  
ATOM 5756  C CE2  . TYR A 1 70 ? -5.890  6.350   -8.364  1.00 10.00 ? 479 TYR A CE2  5  
ATOM 5757  C CZ   . TYR A 1 70 ? -4.632  6.828   -8.065  1.00 10.00 ? 479 TYR A CZ   5  
ATOM 5758  O OH   . TYR A 1 70 ? -3.568  5.958   -7.988  1.00 10.00 ? 479 TYR A OH   5  
ATOM 5759  H H    . TYR A 1 70 ? -7.337  8.653   -10.716 1.00 10.00 ? 479 TYR A H    5  
ATOM 5760  H HA   . TYR A 1 70 ? -8.979  10.834  -9.666  1.00 10.00 ? 479 TYR A HA   5  
ATOM 5761  H HB2  . TYR A 1 70 ? -7.851  10.255  -7.484  1.00 10.00 ? 479 TYR A HB2  5  
ATOM 5762  H HB3  . TYR A 1 70 ? -8.854  8.982   -8.168  1.00 10.00 ? 479 TYR A HB3  5  
ATOM 5763  H HD1  . TYR A 1 70 ? -5.344  10.099  -7.746  1.00 10.00 ? 479 TYR A HD1  5  
ATOM 5764  H HD2  . TYR A 1 70 ? -7.940  6.860   -8.678  1.00 10.00 ? 479 TYR A HD2  5  
ATOM 5765  H HE1  . TYR A 1 70 ? -3.446  8.547   -7.608  1.00 10.00 ? 479 TYR A HE1  5  
ATOM 5766  H HE2  . TYR A 1 70 ? -6.049  5.295   -8.536  1.00 10.00 ? 479 TYR A HE2  5  
ATOM 5767  H HH   . TYR A 1 70 ? -2.828  6.313   -8.485  1.00 10.00 ? 479 TYR A HH   5  
ATOM 5768  N N    . LYS A 1 71 ? -6.600  11.798  -10.900 1.00 10.00 ? 480 LYS A N    5  
ATOM 5769  C CA   . LYS A 1 71 ? -5.556  12.795  -11.109 1.00 10.00 ? 480 LYS A CA   5  
ATOM 5770  C C    . LYS A 1 71 ? -5.928  14.118  -10.447 1.00 10.00 ? 480 LYS A C    5  
ATOM 5771  O O    . LYS A 1 71 ? -5.136  15.078  -10.559 1.00 10.00 ? 480 LYS A O    5  
ATOM 5772  C CB   . LYS A 1 71 ? -5.317  13.009  -12.604 1.00 10.00 ? 480 LYS A CB   5  
ATOM 5773  C CG   . LYS A 1 71 ? -6.597  13.177  -13.407 1.00 10.00 ? 480 LYS A CG   5  
ATOM 5774  C CD   . LYS A 1 71 ? -6.410  14.155  -14.555 1.00 10.00 ? 480 LYS A CD   5  
ATOM 5775  C CE   . LYS A 1 71 ? -7.649  15.010  -14.766 1.00 10.00 ? 480 LYS A CE   5  
ATOM 5776  N NZ   . LYS A 1 71 ? -7.874  15.319  -16.204 1.00 10.00 ? 480 LYS A NZ   5  
ATOM 5777  O OXT  . LYS A 1 71 ? -7.007  14.185  -9.824  1.00 10.00 ? 480 LYS A OXT  5  
ATOM 5778  H H    . LYS A 1 71 ? -7.081  11.440  -11.674 1.00 10.00 ? 480 LYS A H    5  
ATOM 5779  H HA   . LYS A 1 71 ? -4.648  12.423  -10.658 1.00 10.00 ? 480 LYS A HA   5  
ATOM 5780  H HB2  . LYS A 1 71 ? -4.715  13.896  -12.738 1.00 10.00 ? 480 LYS A HB2  5  
ATOM 5781  H HB3  . LYS A 1 71 ? -4.780  12.158  -12.997 1.00 10.00 ? 480 LYS A HB3  5  
ATOM 5782  H HG2  . LYS A 1 71 ? -6.886  12.218  -13.810 1.00 10.00 ? 480 LYS A HG2  5  
ATOM 5783  H HG3  . LYS A 1 71 ? -7.374  13.546  -12.753 1.00 10.00 ? 480 LYS A HG3  5  
ATOM 5784  H HD2  . LYS A 1 71 ? -5.574  14.801  -14.333 1.00 10.00 ? 480 LYS A HD2  5  
ATOM 5785  H HD3  . LYS A 1 71 ? -6.209  13.600  -15.460 1.00 10.00 ? 480 LYS A HD3  5  
ATOM 5786  H HE2  . LYS A 1 71 ? -8.507  14.478  -14.383 1.00 10.00 ? 480 LYS A HE2  5  
ATOM 5787  H HE3  . LYS A 1 71 ? -7.529  15.936  -14.222 1.00 10.00 ? 480 LYS A HE3  5  
ATOM 5788  H HZ1  . LYS A 1 71 ? -8.584  16.073  -16.302 1.00 10.00 ? 480 LYS A HZ1  5  
ATOM 5789  H HZ2  . LYS A 1 71 ? -8.214  14.472  -16.702 1.00 10.00 ? 480 LYS A HZ2  5  
ATOM 5790  H HZ3  . LYS A 1 71 ? -6.986  15.634  -16.646 1.00 10.00 ? 480 LYS A HZ3  5  
ATOM 5791  N N    . ASN A 1 4  ? 15.678  3.080   10.444  1.00 10.00 ? 413 ASN A N    6  
ATOM 5792  C CA   . ASN A 1 4  ? 14.606  3.947   10.919  1.00 10.00 ? 413 ASN A CA   6  
ATOM 5793  C C    . ASN A 1 4  ? 13.682  3.198   11.873  1.00 10.00 ? 413 ASN A C    6  
ATOM 5794  O O    . ASN A 1 4  ? 13.829  1.992   12.077  1.00 10.00 ? 413 ASN A O    6  
ATOM 5795  C CB   . ASN A 1 4  ? 13.803  4.495   9.737   1.00 10.00 ? 413 ASN A CB   6  
ATOM 5796  C CG   . ASN A 1 4  ? 13.135  3.397   8.933   1.00 10.00 ? 413 ASN A CG   6  
ATOM 5797  O OD1  . ASN A 1 4  ? 12.126  2.830   9.353   1.00 10.00 ? 413 ASN A OD1  6  
ATOM 5798  N ND2  . ASN A 1 4  ? 13.696  3.091   7.770   1.00 10.00 ? 413 ASN A ND2  6  
ATOM 5799  H H    . ASN A 1 4  ? 15.762  2.907   9.483   1.00 10.00 ? 413 ASN A H    6  
ATOM 5800  H HA   . ASN A 1 4  ? 15.057  4.772   11.449  1.00 10.00 ? 413 ASN A HA   6  
ATOM 5801  H HB2  . ASN A 1 4  ? 13.038  5.160   10.108  1.00 10.00 ? 413 ASN A HB2  6  
ATOM 5802  H HB3  . ASN A 1 4  ? 14.466  5.043   9.084   1.00 10.00 ? 413 ASN A HB3  6  
ATOM 5803  H HD21 . ASN A 1 4  ? 14.498  3.583   7.499   1.00 10.00 ? 413 ASN A HD21 6  
ATOM 5804  H HD22 . ASN A 1 4  ? 13.285  2.384   7.229   1.00 10.00 ? 413 ASN A HD22 6  
ATOM 5805  N N    . GLY A 1 5  ? 12.729  3.919   12.455  1.00 10.00 ? 414 GLY A N    6  
ATOM 5806  C CA   . GLY A 1 5  ? 11.795  3.304   13.380  1.00 10.00 ? 414 GLY A CA   6  
ATOM 5807  C C    . GLY A 1 5  ? 12.089  3.660   14.824  1.00 10.00 ? 414 GLY A C    6  
ATOM 5808  O O    . GLY A 1 5  ? 13.176  4.141   15.142  1.00 10.00 ? 414 GLY A O    6  
ATOM 5809  H H    . GLY A 1 5  ? 12.660  4.875   12.255  1.00 10.00 ? 414 GLY A H    6  
ATOM 5810  H HA2  . GLY A 1 5  ? 10.795  3.633   13.137  1.00 10.00 ? 414 GLY A HA2  6  
ATOM 5811  H HA3  . GLY A 1 5  ? 11.847  2.231   13.268  1.00 10.00 ? 414 GLY A HA3  6  
ATOM 5812  N N    . LEU A 1 6  ? 11.118  3.422   15.700  1.00 10.00 ? 415 LEU A N    6  
ATOM 5813  C CA   . LEU A 1 6  ? 11.278  3.720   17.118  1.00 10.00 ? 415 LEU A CA   6  
ATOM 5814  C C    . LEU A 1 6  ? 10.178  3.058   17.941  1.00 10.00 ? 415 LEU A C    6  
ATOM 5815  O O    . LEU A 1 6  ? 10.452  2.246   18.823  1.00 10.00 ? 415 LEU A O    6  
ATOM 5816  C CB   . LEU A 1 6  ? 11.260  5.234   17.348  1.00 10.00 ? 415 LEU A CB   6  
ATOM 5817  C CG   . LEU A 1 6  ? 12.042  5.711   18.573  1.00 10.00 ? 415 LEU A CG   6  
ATOM 5818  C CD1  . LEU A 1 6  ? 12.504  7.148   18.384  1.00 10.00 ? 415 LEU A CD1  6  
ATOM 5819  C CD2  . LEU A 1 6  ? 11.193  5.582   19.828  1.00 10.00 ? 415 LEU A CD2  6  
ATOM 5820  H H    . LEU A 1 6  ? 10.274  3.037   15.384  1.00 10.00 ? 415 LEU A H    6  
ATOM 5821  H HA   . LEU A 1 6  ? 12.232  3.329   17.434  1.00 10.00 ? 415 LEU A HA   6  
ATOM 5822  H HB2  . LEU A 1 6  ? 11.674  5.713   16.473  1.00 10.00 ? 415 LEU A HB2  6  
ATOM 5823  H HB3  . LEU A 1 6  ? 10.234  5.548   17.459  1.00 10.00 ? 415 LEU A HB3  6  
ATOM 5824  H HG   . LEU A 1 6  ? 12.920  5.092   18.696  1.00 10.00 ? 415 LEU A HG   6  
ATOM 5825  H HD11 . LEU A 1 6  ? 13.281  7.181   17.635  1.00 10.00 ? 415 LEU A HD11 6  
ATOM 5826  H HD12 . LEU A 1 6  ? 12.888  7.528   19.319  1.00 10.00 ? 415 LEU A HD12 6  
ATOM 5827  H HD13 . LEU A 1 6  ? 11.670  7.754   18.064  1.00 10.00 ? 415 LEU A HD13 6  
ATOM 5828  H HD21 . LEU A 1 6  ? 10.450  6.365   19.842  1.00 10.00 ? 415 LEU A HD21 6  
ATOM 5829  H HD22 . LEU A 1 6  ? 11.825  5.670   20.700  1.00 10.00 ? 415 LEU A HD22 6  
ATOM 5830  H HD23 . LEU A 1 6  ? 10.703  4.620   19.835  1.00 10.00 ? 415 LEU A HD23 6  
ATOM 5831  N N    . MET A 1 7  ? 8.931   3.410   17.644  1.00 10.00 ? 416 MET A N    6  
ATOM 5832  C CA   . MET A 1 7  ? 7.788   2.849   18.356  1.00 10.00 ? 416 MET A CA   6  
ATOM 5833  C C    . MET A 1 7  ? 6.645   2.540   17.393  1.00 10.00 ? 416 MET A C    6  
ATOM 5834  O O    . MET A 1 7  ? 5.672   3.290   17.309  1.00 10.00 ? 416 MET A O    6  
ATOM 5835  C CB   . MET A 1 7  ? 7.311   3.816   19.440  1.00 10.00 ? 416 MET A CB   6  
ATOM 5836  C CG   . MET A 1 7  ? 6.556   3.138   20.572  1.00 10.00 ? 416 MET A CG   6  
ATOM 5837  S SD   . MET A 1 7  ? 4.767   3.251   20.381  1.00 10.00 ? 416 MET A SD   6  
ATOM 5838  C CE   . MET A 1 7  ? 4.217   2.636   21.970  1.00 10.00 ? 416 MET A CE   6  
ATOM 5839  H H    . MET A 1 7  ? 8.775   4.062   16.930  1.00 10.00 ? 416 MET A H    6  
ATOM 5840  H HA   . MET A 1 7  ? 8.108   1.929   18.822  1.00 10.00 ? 416 MET A HA   6  
ATOM 5841  H HB2  . MET A 1 7  ? 8.169   4.321   19.859  1.00 10.00 ? 416 MET A HB2  6  
ATOM 5842  H HB3  . MET A 1 7  ? 6.658   4.550   18.990  1.00 10.00 ? 416 MET A HB3  6  
ATOM 5843  H HG2  . MET A 1 7  ? 6.835   2.095   20.598  1.00 10.00 ? 416 MET A HG2  6  
ATOM 5844  H HG3  . MET A 1 7  ? 6.836   3.606   21.504  1.00 10.00 ? 416 MET A HG3  6  
ATOM 5845  H HE1  . MET A 1 7  ? 4.362   1.567   22.012  1.00 10.00 ? 416 MET A HE1  6  
ATOM 5846  H HE2  . MET A 1 7  ? 3.169   2.862   22.101  1.00 10.00 ? 416 MET A HE2  6  
ATOM 5847  H HE3  . MET A 1 7  ? 4.787   3.109   22.757  1.00 10.00 ? 416 MET A HE3  6  
ATOM 5848  N N    . ALA A 1 8  ? 6.771   1.434   16.668  1.00 10.00 ? 417 ALA A N    6  
ATOM 5849  C CA   . ALA A 1 8  ? 5.750   1.027   15.711  1.00 10.00 ? 417 ALA A CA   6  
ATOM 5850  C C    . ALA A 1 8  ? 5.457   -0.465  15.822  1.00 10.00 ? 417 ALA A C    6  
ATOM 5851  O O    . ALA A 1 8  ? 5.944   -1.138  16.732  1.00 10.00 ? 417 ALA A O    6  
ATOM 5852  C CB   . ALA A 1 8  ? 6.184   1.377   14.296  1.00 10.00 ? 417 ALA A CB   6  
ATOM 5853  H H    . ALA A 1 8  ? 7.571   0.878   16.779  1.00 10.00 ? 417 ALA A H    6  
ATOM 5854  H HA   . ALA A 1 8  ? 4.847   1.577   15.933  1.00 10.00 ? 417 ALA A HA   6  
ATOM 5855  H HB1  . ALA A 1 8  ? 6.856   0.617   13.927  1.00 10.00 ? 417 ALA A HB1  6  
ATOM 5856  H HB2  . ALA A 1 8  ? 6.688   2.333   14.300  1.00 10.00 ? 417 ALA A HB2  6  
ATOM 5857  H HB3  . ALA A 1 8  ? 5.315   1.432   13.657  1.00 10.00 ? 417 ALA A HB3  6  
ATOM 5858  N N    . ASP A 1 9  ? 4.661   -0.978  14.891  1.00 10.00 ? 418 ASP A N    6  
ATOM 5859  C CA   . ASP A 1 9  ? 4.304   -2.392  14.884  1.00 10.00 ? 418 ASP A CA   6  
ATOM 5860  C C    . ASP A 1 9  ? 3.608   -2.772  13.579  1.00 10.00 ? 418 ASP A C    6  
ATOM 5861  O O    . ASP A 1 9  ? 2.381   -2.728  13.484  1.00 10.00 ? 418 ASP A O    6  
ATOM 5862  C CB   . ASP A 1 9  ? 3.396   -2.716  16.072  1.00 10.00 ? 418 ASP A CB   6  
ATOM 5863  C CG   . ASP A 1 9  ? 4.177   -3.165  17.291  1.00 10.00 ? 418 ASP A CG   6  
ATOM 5864  O OD1  . ASP A 1 9  ? 4.718   -4.291  17.268  1.00 10.00 ? 418 ASP A OD1  6  
ATOM 5865  O OD2  . ASP A 1 9  ? 4.250   -2.390  18.268  1.00 10.00 ? 418 ASP A OD2  6  
ATOM 5866  H H    . ASP A 1 9  ? 4.305   -0.392  14.191  1.00 10.00 ? 418 ASP A H    6  
ATOM 5867  H HA   . ASP A 1 9  ? 5.215   -2.965  14.971  1.00 10.00 ? 418 ASP A HA   6  
ATOM 5868  H HB2  . ASP A 1 9  ? 2.830   -1.835  16.335  1.00 10.00 ? 418 ASP A HB2  6  
ATOM 5869  H HB3  . ASP A 1 9  ? 2.715   -3.506  15.792  1.00 10.00 ? 418 ASP A HB3  6  
ATOM 5870  N N    . PRO A 1 10 ? 4.385   -3.152  12.551  1.00 10.00 ? 419 PRO A N    6  
ATOM 5871  C CA   . PRO A 1 10 ? 3.837   -3.540  11.247  1.00 10.00 ? 419 PRO A CA   6  
ATOM 5872  C C    . PRO A 1 10 ? 2.748   -4.599  11.369  1.00 10.00 ? 419 PRO A C    6  
ATOM 5873  O O    . PRO A 1 10 ? 2.958   -5.655  11.967  1.00 10.00 ? 419 PRO A O    6  
ATOM 5874  C CB   . PRO A 1 10 ? 5.051   -4.105  10.504  1.00 10.00 ? 419 PRO A CB   6  
ATOM 5875  C CG   . PRO A 1 10 ? 6.223   -3.437  11.133  1.00 10.00 ? 419 PRO A CG   6  
ATOM 5876  C CD   . PRO A 1 10 ? 5.858   -3.233  12.578  1.00 10.00 ? 419 PRO A CD   6  
ATOM 5877  H HA   . PRO A 1 10 ? 3.449   -2.687  10.711  1.00 10.00 ? 419 PRO A HA   6  
ATOM 5878  H HB2  . PRO A 1 10 ? 5.088   -5.177  10.634  1.00 10.00 ? 419 PRO A HB2  6  
ATOM 5879  H HB3  . PRO A 1 10 ? 4.977   -3.865  9.454   1.00 10.00 ? 419 PRO A HB3  6  
ATOM 5880  H HG2  . PRO A 1 10 ? 7.095   -4.072  11.053  1.00 10.00 ? 419 PRO A HG2  6  
ATOM 5881  H HG3  . PRO A 1 10 ? 6.406   -2.486  10.655  1.00 10.00 ? 419 PRO A HG3  6  
ATOM 5882  H HD2  . PRO A 1 10 ? 6.187   -4.073  13.172  1.00 10.00 ? 419 PRO A HD2  6  
ATOM 5883  H HD3  . PRO A 1 10 ? 6.287   -2.315  12.949  1.00 10.00 ? 419 PRO A HD3  6  
ATOM 5884  N N    . MET A 1 11 ? 1.582   -4.310  10.799  1.00 10.00 ? 420 MET A N    6  
ATOM 5885  C CA   . MET A 1 11 ? 0.458   -5.235  10.844  1.00 10.00 ? 420 MET A CA   6  
ATOM 5886  C C    . MET A 1 11 ? -0.077  -5.490  9.445   1.00 10.00 ? 420 MET A C    6  
ATOM 5887  O O    . MET A 1 11 ? 0.310   -6.456  8.798   1.00 10.00 ? 420 MET A O    6  
ATOM 5888  C CB   . MET A 1 11 ? -0.648  -4.675  11.740  1.00 10.00 ? 420 MET A CB   6  
ATOM 5889  C CG   . MET A 1 11 ? -1.860  -5.584  11.854  1.00 10.00 ? 420 MET A CG   6  
ATOM 5890  S SD   . MET A 1 11 ? -3.412  -4.668  11.913  1.00 10.00 ? 420 MET A SD   6  
ATOM 5891  C CE   . MET A 1 11 ? -4.589  -5.969  11.554  1.00 10.00 ? 420 MET A CE   6  
ATOM 5892  H H    . MET A 1 11 ? 1.474   -3.453  10.337  1.00 10.00 ? 420 MET A H    6  
ATOM 5893  H HA   . MET A 1 11 ? 0.807   -6.173  11.251  1.00 10.00 ? 420 MET A HA   6  
ATOM 5894  H HB2  . MET A 1 11 ? -0.247  -4.518  12.731  1.00 10.00 ? 420 MET A HB2  6  
ATOM 5895  H HB3  . MET A 1 11 ? -0.971  -3.725  11.337  1.00 10.00 ? 420 MET A HB3  6  
ATOM 5896  H HG2  . MET A 1 11 ? -1.881  -6.243  10.998  1.00 10.00 ? 420 MET A HG2  6  
ATOM 5897  H HG3  . MET A 1 11 ? -1.770  -6.171  12.756  1.00 10.00 ? 420 MET A HG3  6  
ATOM 5898  H HE1  . MET A 1 11 ? -5.041  -5.791  10.589  1.00 10.00 ? 420 MET A HE1  6  
ATOM 5899  H HE2  . MET A 1 11 ? -5.356  -5.981  12.314  1.00 10.00 ? 420 MET A HE2  6  
ATOM 5900  H HE3  . MET A 1 11 ? -4.079  -6.922  11.542  1.00 10.00 ? 420 MET A HE3  6  
ATOM 5901  N N    . LYS A 1 12 ? -0.957  -4.615  8.973   1.00 10.00 ? 421 LYS A N    6  
ATOM 5902  C CA   . LYS A 1 12 ? -1.529  -4.763  7.640   1.00 10.00 ? 421 LYS A CA   6  
ATOM 5903  C C    . LYS A 1 12 ? -0.429  -4.985  6.613   1.00 10.00 ? 421 LYS A C    6  
ATOM 5904  O O    . LYS A 1 12 ? 0.213   -4.038  6.161   1.00 10.00 ? 421 LYS A O    6  
ATOM 5905  C CB   . LYS A 1 12 ? -2.352  -3.536  7.270   1.00 10.00 ? 421 LYS A CB   6  
ATOM 5906  C CG   . LYS A 1 12 ? -2.928  -3.614  5.870   1.00 10.00 ? 421 LYS A CG   6  
ATOM 5907  C CD   . LYS A 1 12 ? -4.313  -4.231  5.857   1.00 10.00 ? 421 LYS A CD   6  
ATOM 5908  C CE   . LYS A 1 12 ? -5.278  -3.482  6.764   1.00 10.00 ? 421 LYS A CE   6  
ATOM 5909  N NZ   . LYS A 1 12 ? -6.611  -3.297  6.127   1.00 10.00 ? 421 LYS A NZ   6  
ATOM 5910  H H    . LYS A 1 12 ? -1.222  -3.855  9.527   1.00 10.00 ? 421 LYS A H    6  
ATOM 5911  H HA   . LYS A 1 12 ? -2.174  -5.625  7.648   1.00 10.00 ? 421 LYS A HA   6  
ATOM 5912  H HB2  . LYS A 1 12 ? -3.165  -3.435  7.973   1.00 10.00 ? 421 LYS A HB2  6  
ATOM 5913  H HB3  . LYS A 1 12 ? -1.722  -2.660  7.331   1.00 10.00 ? 421 LYS A HB3  6  
ATOM 5914  H HG2  . LYS A 1 12 ? -2.988  -2.622  5.465   1.00 10.00 ? 421 LYS A HG2  6  
ATOM 5915  H HG3  . LYS A 1 12 ? -2.273  -4.220  5.258   1.00 10.00 ? 421 LYS A HG3  6  
ATOM 5916  H HD2  . LYS A 1 12 ? -4.691  -4.200  4.846   1.00 10.00 ? 421 LYS A HD2  6  
ATOM 5917  H HD3  . LYS A 1 12 ? -4.242  -5.256  6.186   1.00 10.00 ? 421 LYS A HD3  6  
ATOM 5918  H HE2  . LYS A 1 12 ? -5.402  -4.044  7.678   1.00 10.00 ? 421 LYS A HE2  6  
ATOM 5919  H HE3  . LYS A 1 12 ? -4.859  -2.513  6.993   1.00 10.00 ? 421 LYS A HE3  6  
ATOM 5920  H HZ1  . LYS A 1 12 ? -6.773  -4.038  5.416   1.00 10.00 ? 421 LYS A HZ1  6  
ATOM 5921  H HZ2  . LYS A 1 12 ? -6.658  -2.369  5.660   1.00 10.00 ? 421 LYS A HZ2  6  
ATOM 5922  H HZ3  . LYS A 1 12 ? -7.361  -3.349  6.845   1.00 10.00 ? 421 LYS A HZ3  6  
ATOM 5923  N N    . VAL A 1 13 ? -0.213  -6.246  6.261   1.00 10.00 ? 422 VAL A N    6  
ATOM 5924  C CA   . VAL A 1 13 ? 0.818   -6.605  5.304   1.00 10.00 ? 422 VAL A CA   6  
ATOM 5925  C C    . VAL A 1 13 ? 0.855   -8.118  5.091   1.00 10.00 ? 422 VAL A C    6  
ATOM 5926  O O    . VAL A 1 13 ? 0.905   -8.603  3.962   1.00 10.00 ? 422 VAL A O    6  
ATOM 5927  C CB   . VAL A 1 13 ? 2.185   -6.091  5.791   1.00 10.00 ? 422 VAL A CB   6  
ATOM 5928  C CG1  . VAL A 1 13 ? 2.783   -7.006  6.852   1.00 10.00 ? 422 VAL A CG1  6  
ATOM 5929  C CG2  . VAL A 1 13 ? 3.141   -5.913  4.626   1.00 10.00 ? 422 VAL A CG2  6  
ATOM 5930  H H    . VAL A 1 13 ? -0.755  -6.952  6.664   1.00 10.00 ? 422 VAL A H    6  
ATOM 5931  H HA   . VAL A 1 13 ? 0.582   -6.122  4.370   1.00 10.00 ? 422 VAL A HA   6  
ATOM 5932  H HB   . VAL A 1 13 ? 2.020   -5.126  6.246   1.00 10.00 ? 422 VAL A HB   6  
ATOM 5933  H HG11 . VAL A 1 13 ? 3.713   -6.588  7.207   1.00 10.00 ? 422 VAL A HG11 6  
ATOM 5934  H HG12 . VAL A 1 13 ? 2.965   -7.981  6.427   1.00 10.00 ? 422 VAL A HG12 6  
ATOM 5935  H HG13 . VAL A 1 13 ? 2.091   -7.098  7.679   1.00 10.00 ? 422 VAL A HG13 6  
ATOM 5936  H HG21 . VAL A 1 13 ? 4.018   -5.382  4.963   1.00 10.00 ? 422 VAL A HG21 6  
ATOM 5937  H HG22 . VAL A 1 13 ? 2.654   -5.350  3.844   1.00 10.00 ? 422 VAL A HG22 6  
ATOM 5938  H HG23 . VAL A 1 13 ? 3.430   -6.882  4.246   1.00 10.00 ? 422 VAL A HG23 6  
ATOM 5939  N N    . TYR A 1 14 ? 0.804   -8.840  6.199   1.00 10.00 ? 423 TYR A N    6  
ATOM 5940  C CA   . TYR A 1 14 ? 0.793   -10.301 6.218   1.00 10.00 ? 423 TYR A CA   6  
ATOM 5941  C C    . TYR A 1 14 ? -0.027  -10.869 5.060   1.00 10.00 ? 423 TYR A C    6  
ATOM 5942  O O    . TYR A 1 14 ? 0.287   -11.933 4.527   1.00 10.00 ? 423 TYR A O    6  
ATOM 5943  C CB   . TYR A 1 14 ? 0.201   -10.771 7.555   1.00 10.00 ? 423 TYR A CB   6  
ATOM 5944  C CG   . TYR A 1 14 ? -1.091  -10.060 7.905   1.00 10.00 ? 423 TYR A CG   6  
ATOM 5945  C CD1  . TYR A 1 14 ? -1.087  -8.702  8.159   1.00 10.00 ? 423 TYR A CD1  6  
ATOM 5946  C CD2  . TYR A 1 14 ? -2.304  -10.732 7.965   1.00 10.00 ? 423 TYR A CD2  6  
ATOM 5947  C CE1  . TYR A 1 14 ? -2.232  -8.020  8.461   1.00 10.00 ? 423 TYR A CE1  6  
ATOM 5948  C CE2  . TYR A 1 14 ? -3.473  -10.055 8.269   1.00 10.00 ? 423 TYR A CE2  6  
ATOM 5949  C CZ   . TYR A 1 14 ? -3.432  -8.696  8.516   1.00 10.00 ? 423 TYR A CZ   6  
ATOM 5950  O OH   . TYR A 1 14 ? -4.590  -8.017  8.819   1.00 10.00 ? 423 TYR A OH   6  
ATOM 5951  H H    . TYR A 1 14 ? 0.759   -8.368  7.049   1.00 10.00 ? 423 TYR A H    6  
ATOM 5952  H HA   . TYR A 1 14 ? 1.810   -10.651 6.135   1.00 10.00 ? 423 TYR A HA   6  
ATOM 5953  H HB2  . TYR A 1 14 ? 0.002   -11.830 7.509   1.00 10.00 ? 423 TYR A HB2  6  
ATOM 5954  H HB3  . TYR A 1 14 ? 0.911   -10.569 8.348   1.00 10.00 ? 423 TYR A HB3  6  
ATOM 5955  H HD1  . TYR A 1 14 ? -0.157  -8.168  8.120   1.00 10.00 ? 423 TYR A HD1  6  
ATOM 5956  H HD2  . TYR A 1 14 ? -2.330  -11.793 7.769   1.00 10.00 ? 423 TYR A HD2  6  
ATOM 5957  H HE1  . TYR A 1 14 ? -2.179  -6.955  8.642   1.00 10.00 ? 423 TYR A HE1  6  
ATOM 5958  H HE2  . TYR A 1 14 ? -4.410  -10.590 8.313   1.00 10.00 ? 423 TYR A HE2  6  
ATOM 5959  H HH   . TYR A 1 14 ? -4.945  -7.616  8.023   1.00 10.00 ? 423 TYR A HH   6  
ATOM 5960  N N    . LYS A 1 15 ? -1.079  -10.150 4.675   1.00 10.00 ? 424 LYS A N    6  
ATOM 5961  C CA   . LYS A 1 15 ? -1.941  -10.583 3.581   1.00 10.00 ? 424 LYS A CA   6  
ATOM 5962  C C    . LYS A 1 15 ? -1.652  -9.791  2.308   1.00 10.00 ? 424 LYS A C    6  
ATOM 5963  O O    . LYS A 1 15 ? -1.953  -10.242 1.203   1.00 10.00 ? 424 LYS A O    6  
ATOM 5964  C CB   . LYS A 1 15 ? -3.412  -10.425 3.970   1.00 10.00 ? 424 LYS A CB   6  
ATOM 5965  C CG   . LYS A 1 15 ? -3.961  -11.600 4.763   1.00 10.00 ? 424 LYS A CG   6  
ATOM 5966  C CD   . LYS A 1 15 ? -3.955  -12.878 3.941   1.00 10.00 ? 424 LYS A CD   6  
ATOM 5967  C CE   . LYS A 1 15 ? -2.752  -13.747 4.271   1.00 10.00 ? 424 LYS A CE   6  
ATOM 5968  N NZ   . LYS A 1 15 ? -3.096  -14.830 5.232   1.00 10.00 ? 424 LYS A NZ   6  
ATOM 5969  H H    . LYS A 1 15 ? -1.280  -9.307  5.138   1.00 10.00 ? 424 LYS A H    6  
ATOM 5970  H HA   . LYS A 1 15 ? -1.739  -11.628 3.393   1.00 10.00 ? 424 LYS A HA   6  
ATOM 5971  H HB2  . LYS A 1 15 ? -3.520  -9.533  4.568   1.00 10.00 ? 424 LYS A HB2  6  
ATOM 5972  H HB3  . LYS A 1 15 ? -4.001  -10.319 3.071   1.00 10.00 ? 424 LYS A HB3  6  
ATOM 5973  H HG2  . LYS A 1 15 ? -3.351  -11.746 5.641   1.00 10.00 ? 424 LYS A HG2  6  
ATOM 5974  H HG3  . LYS A 1 15 ? -4.976  -11.378 5.060   1.00 10.00 ? 424 LYS A HG3  6  
ATOM 5975  H HD2  . LYS A 1 15 ? -4.856  -13.435 4.151   1.00 10.00 ? 424 LYS A HD2  6  
ATOM 5976  H HD3  . LYS A 1 15 ? -3.926  -12.620 2.892   1.00 10.00 ? 424 LYS A HD3  6  
ATOM 5977  H HE2  . LYS A 1 15 ? -2.384  -14.192 3.357   1.00 10.00 ? 424 LYS A HE2  6  
ATOM 5978  H HE3  . LYS A 1 15 ? -1.982  -13.124 4.702   1.00 10.00 ? 424 LYS A HE3  6  
ATOM 5979  H HZ1  . LYS A 1 15 ? -3.326  -14.424 6.161   1.00 10.00 ? 424 LYS A HZ1  6  
ATOM 5980  H HZ2  . LYS A 1 15 ? -2.291  -15.480 5.341   1.00 10.00 ? 424 LYS A HZ2  6  
ATOM 5981  H HZ3  . LYS A 1 15 ? -3.916  -15.369 4.886   1.00 10.00 ? 424 LYS A HZ3  6  
ATOM 5982  N N    . ASP A 1 16 ? -1.071  -8.608  2.471   1.00 10.00 ? 425 ASP A N    6  
ATOM 5983  C CA   . ASP A 1 16 ? -0.744  -7.749  1.340   1.00 10.00 ? 425 ASP A CA   6  
ATOM 5984  C C    . ASP A 1 16 ? 0.450   -8.285  0.548   1.00 10.00 ? 425 ASP A C    6  
ATOM 5985  O O    . ASP A 1 16 ? 0.706   -7.840  -0.569  1.00 10.00 ? 425 ASP A O    6  
ATOM 5986  C CB   . ASP A 1 16 ? -0.443  -6.328  1.823   1.00 10.00 ? 425 ASP A CB   6  
ATOM 5987  C CG   . ASP A 1 16 ? -1.472  -5.815  2.813   1.00 10.00 ? 425 ASP A CG   6  
ATOM 5988  O OD1  . ASP A 1 16 ? -2.466  -6.530  3.063   1.00 10.00 ? 425 ASP A OD1  6  
ATOM 5989  O OD2  . ASP A 1 16 ? -1.284  -4.697  3.335   1.00 10.00 ? 425 ASP A OD2  6  
ATOM 5990  H H    . ASP A 1 16 ? -0.859  -8.302  3.376   1.00 10.00 ? 425 ASP A H    6  
ATOM 5991  H HA   . ASP A 1 16 ? -1.605  -7.721  0.694   1.00 10.00 ? 425 ASP A HA   6  
ATOM 5992  H HB2  . ASP A 1 16 ? 0.524   -6.316  2.302   1.00 10.00 ? 425 ASP A HB2  6  
ATOM 5993  H HB3  . ASP A 1 16 ? -0.426  -5.663  0.972   1.00 10.00 ? 425 ASP A HB3  6  
ATOM 5994  N N    . ARG A 1 17 ? 1.186   -9.232  1.125   1.00 10.00 ? 426 ARG A N    6  
ATOM 5995  C CA   . ARG A 1 17 ? 2.356   -9.805  0.456   1.00 10.00 ? 426 ARG A CA   6  
ATOM 5996  C C    . ARG A 1 17 ? 2.028   -10.237 -0.970  1.00 10.00 ? 426 ARG A C    6  
ATOM 5997  O O    . ARG A 1 17 ? 2.901   -10.259 -1.838  1.00 10.00 ? 426 ARG A O    6  
ATOM 5998  C CB   . ARG A 1 17 ? 2.897   -10.994 1.253   1.00 10.00 ? 426 ARG A CB   6  
ATOM 5999  C CG   . ARG A 1 17 ? 4.304   -11.404 0.853   1.00 10.00 ? 426 ARG A CG   6  
ATOM 6000  C CD   . ARG A 1 17 ? 4.849   -12.490 1.767   1.00 10.00 ? 426 ARG A CD   6  
ATOM 6001  N NE   . ARG A 1 17 ? 6.280   -12.328 2.017   1.00 10.00 ? 426 ARG A NE   6  
ATOM 6002  C CZ   . ARG A 1 17 ? 6.998   -13.154 2.773   1.00 10.00 ? 426 ARG A CZ   6  
ATOM 6003  N NH1  . ARG A 1 17 ? 6.425   -14.200 3.357   1.00 10.00 ? 426 ARG A NH1  6  
ATOM 6004  N NH2  . ARG A 1 17 ? 8.294   -12.934 2.948   1.00 10.00 ? 426 ARG A NH2  6  
ATOM 6005  H H    . ARG A 1 17 ? 0.945   -9.549  2.020   1.00 10.00 ? 426 ARG A H    6  
ATOM 6006  H HA   . ARG A 1 17 ? 3.115   -9.039  0.409   1.00 10.00 ? 426 ARG A HA   6  
ATOM 6007  H HB2  . ARG A 1 17 ? 2.905   -10.736 2.301   1.00 10.00 ? 426 ARG A HB2  6  
ATOM 6008  H HB3  . ARG A 1 17 ? 2.242   -11.840 1.104   1.00 10.00 ? 426 ARG A HB3  6  
ATOM 6009  H HG2  . ARG A 1 17 ? 4.286   -11.778 -0.160  1.00 10.00 ? 426 ARG A HG2  6  
ATOM 6010  H HG3  . ARG A 1 17 ? 4.950   -10.541 0.908   1.00 10.00 ? 426 ARG A HG3  6  
ATOM 6011  H HD2  . ARG A 1 17 ? 4.323   -12.446 2.709   1.00 10.00 ? 426 ARG A HD2  6  
ATOM 6012  H HD3  . ARG A 1 17 ? 4.680   -13.451 1.305   1.00 10.00 ? 426 ARG A HD3  6  
ATOM 6013  H HE   . ARG A 1 17 ? 6.728   -11.563 1.598   1.00 10.00 ? 426 ARG A HE   6  
ATOM 6014  H HH11 . ARG A 1 17 ? 5.448   -14.371 3.228   1.00 10.00 ? 426 ARG A HH11 6  
ATOM 6015  H HH12 . ARG A 1 17 ? 6.969   -14.817 3.923   1.00 10.00 ? 426 ARG A HH12 6  
ATOM 6016  H HH21 . ARG A 1 17 ? 8.732   -12.148 2.511   1.00 10.00 ? 426 ARG A HH21 6  
ATOM 6017  H HH22 . ARG A 1 17 ? 8.834   -13.555 3.517   1.00 10.00 ? 426 ARG A HH22 6  
ATOM 6018  N N    . GLN A 1 18 ? 0.764   -10.561 -1.213  1.00 10.00 ? 427 GLN A N    6  
ATOM 6019  C CA   . GLN A 1 18 ? 0.323   -10.970 -2.543  1.00 10.00 ? 427 GLN A CA   6  
ATOM 6020  C C    . GLN A 1 18 ? -0.330  -9.791  -3.251  1.00 10.00 ? 427 GLN A C    6  
ATOM 6021  O O    . GLN A 1 18 ? -1.255  -9.952  -4.048  1.00 10.00 ? 427 GLN A O    6  
ATOM 6022  C CB   . GLN A 1 18 ? -0.645  -12.164 -2.469  1.00 10.00 ? 427 GLN A CB   6  
ATOM 6023  C CG   . GLN A 1 18 ? -1.173  -12.463 -1.069  1.00 10.00 ? 427 GLN A CG   6  
ATOM 6024  C CD   . GLN A 1 18 ? -0.094  -12.964 -0.125  1.00 10.00 ? 427 GLN A CD   6  
ATOM 6025  O OE1  . GLN A 1 18 ? 0.777   -13.742 -0.515  1.00 10.00 ? 427 GLN A OE1  6  
ATOM 6026  N NE2  . GLN A 1 18 ? -0.149  -12.517 1.127   1.00 10.00 ? 427 GLN A NE2  6  
ATOM 6027  H H    . GLN A 1 18 ? 0.109   -10.510 -0.486  1.00 10.00 ? 427 GLN A H    6  
ATOM 6028  H HA   . GLN A 1 18 ? 1.200   -11.258 -3.107  1.00 10.00 ? 427 GLN A HA   6  
ATOM 6029  H HB2  . GLN A 1 18 ? -1.490  -11.965 -3.109  1.00 10.00 ? 427 GLN A HB2  6  
ATOM 6030  H HB3  . GLN A 1 18 ? -0.134  -13.045 -2.830  1.00 10.00 ? 427 GLN A HB3  6  
ATOM 6031  H HG2  . GLN A 1 18 ? -1.595  -11.559 -0.658  1.00 10.00 ? 427 GLN A HG2  6  
ATOM 6032  H HG3  . GLN A 1 18 ? -1.944  -13.217 -1.144  1.00 10.00 ? 427 GLN A HG3  6  
ATOM 6033  H HE21 . GLN A 1 18 ? -0.872  -11.902 1.364   1.00 10.00 ? 427 GLN A HE21 6  
ATOM 6034  H HE22 . GLN A 1 18 ? 0.539   -12.818 1.761   1.00 10.00 ? 427 GLN A HE22 6  
ATOM 6035  N N    . VAL A 1 19 ? 0.176   -8.602  -2.944  1.00 10.00 ? 428 VAL A N    6  
ATOM 6036  C CA   . VAL A 1 19 ? -0.318  -7.366  -3.527  1.00 10.00 ? 428 VAL A CA   6  
ATOM 6037  C C    . VAL A 1 19 ? 0.749   -6.736  -4.404  1.00 10.00 ? 428 VAL A C    6  
ATOM 6038  O O    . VAL A 1 19 ? 0.439   -6.092  -5.407  1.00 10.00 ? 428 VAL A O    6  
ATOM 6039  C CB   . VAL A 1 19 ? -0.739  -6.373  -2.434  1.00 10.00 ? 428 VAL A CB   6  
ATOM 6040  C CG1  . VAL A 1 19 ? -1.184  -5.049  -3.033  1.00 10.00 ? 428 VAL A CG1  6  
ATOM 6041  C CG2  . VAL A 1 19 ? -1.840  -6.973  -1.581  1.00 10.00 ? 428 VAL A CG2  6  
ATOM 6042  H H    . VAL A 1 19 ? 0.914   -8.558  -2.304  1.00 10.00 ? 428 VAL A H    6  
ATOM 6043  H HA   . VAL A 1 19 ? -1.180  -7.597  -4.133  1.00 10.00 ? 428 VAL A HA   6  
ATOM 6044  H HB   . VAL A 1 19 ? 0.116   -6.185  -1.803  1.00 10.00 ? 428 VAL A HB   6  
ATOM 6045  H HG11 . VAL A 1 19 ? -2.246  -4.922  -2.884  1.00 10.00 ? 428 VAL A HG11 6  
ATOM 6046  H HG12 . VAL A 1 19 ? -0.963  -5.034  -4.091  1.00 10.00 ? 428 VAL A HG12 6  
ATOM 6047  H HG13 . VAL A 1 19 ? -0.656  -4.247  -2.545  1.00 10.00 ? 428 VAL A HG13 6  
ATOM 6048  H HG21 . VAL A 1 19 ? -2.013  -6.344  -0.722  1.00 10.00 ? 428 VAL A HG21 6  
ATOM 6049  H HG22 . VAL A 1 19 ? -1.544  -7.959  -1.253  1.00 10.00 ? 428 VAL A HG22 6  
ATOM 6050  H HG23 . VAL A 1 19 ? -2.745  -7.045  -2.164  1.00 10.00 ? 428 VAL A HG23 6  
ATOM 6051  N N    . MET A 1 20 ? 2.012   -6.940  -4.035  1.00 10.00 ? 429 MET A N    6  
ATOM 6052  C CA   . MET A 1 20 ? 3.125   -6.404  -4.815  1.00 10.00 ? 429 MET A CA   6  
ATOM 6053  C C    . MET A 1 20 ? 2.908   -6.667  -6.304  1.00 10.00 ? 429 MET A C    6  
ATOM 6054  O O    . MET A 1 20 ? 3.412   -5.938  -7.158  1.00 10.00 ? 429 MET A O    6  
ATOM 6055  C CB   . MET A 1 20 ? 4.445   -7.032  -4.362  1.00 10.00 ? 429 MET A CB   6  
ATOM 6056  C CG   . MET A 1 20 ? 4.516   -8.533  -4.594  1.00 10.00 ? 429 MET A CG   6  
ATOM 6057  S SD   . MET A 1 20 ? 6.188   -9.101  -4.959  1.00 10.00 ? 429 MET A SD   6  
ATOM 6058  C CE   . MET A 1 20 ? 7.117   -8.267  -3.675  1.00 10.00 ? 429 MET A CE   6  
ATOM 6059  H H    . MET A 1 20 ? 2.200   -7.472  -3.230  1.00 10.00 ? 429 MET A H    6  
ATOM 6060  H HA   . MET A 1 20 ? 3.165   -5.337  -4.650  1.00 10.00 ? 429 MET A HA   6  
ATOM 6061  H HB2  . MET A 1 20 ? 5.256   -6.569  -4.904  1.00 10.00 ? 429 MET A HB2  6  
ATOM 6062  H HB3  . MET A 1 20 ? 4.578   -6.846  -3.308  1.00 10.00 ? 429 MET A HB3  6  
ATOM 6063  H HG2  . MET A 1 20 ? 4.167   -9.036  -3.704  1.00 10.00 ? 429 MET A HG2  6  
ATOM 6064  H HG3  . MET A 1 20 ? 3.874   -8.786  -5.424  1.00 10.00 ? 429 MET A HG3  6  
ATOM 6065  H HE1  . MET A 1 20 ? 6.892   -7.210  -3.696  1.00 10.00 ? 429 MET A HE1  6  
ATOM 6066  H HE2  . MET A 1 20 ? 8.174   -8.412  -3.844  1.00 10.00 ? 429 MET A HE2  6  
ATOM 6067  H HE3  . MET A 1 20 ? 6.847   -8.673  -2.712  1.00 10.00 ? 429 MET A HE3  6  
ATOM 6068  N N    . ASN A 1 21 ? 2.146   -7.719  -6.602  1.00 10.00 ? 430 ASN A N    6  
ATOM 6069  C CA   . ASN A 1 21 ? 1.850   -8.091  -7.977  1.00 10.00 ? 430 ASN A CA   6  
ATOM 6070  C C    . ASN A 1 21 ? 0.347   -8.251  -8.193  1.00 10.00 ? 430 ASN A C    6  
ATOM 6071  O O    . ASN A 1 21 ? -0.083  -8.961  -9.102  1.00 10.00 ? 430 ASN A O    6  
ATOM 6072  C CB   . ASN A 1 21 ? 2.563   -9.399  -8.320  1.00 10.00 ? 430 ASN A CB   6  
ATOM 6073  C CG   . ASN A 1 21 ? 3.986   -9.177  -8.795  1.00 10.00 ? 430 ASN A CG   6  
ATOM 6074  O OD1  . ASN A 1 21 ? 4.925   -9.172  -7.998  1.00 10.00 ? 430 ASN A OD1  6  
ATOM 6075  N ND2  . ASN A 1 21 ? 4.152   -8.989  -10.099 1.00 10.00 ? 430 ASN A ND2  6  
ATOM 6076  H H    . ASN A 1 21 ? 1.776   -8.262  -5.876  1.00 10.00 ? 430 ASN A H    6  
ATOM 6077  H HA   . ASN A 1 21 ? 2.213   -7.305  -8.621  1.00 10.00 ? 430 ASN A HA   6  
ATOM 6078  H HB2  . ASN A 1 21 ? 2.590   -10.027 -7.438  1.00 10.00 ? 430 ASN A HB2  6  
ATOM 6079  H HB3  . ASN A 1 21 ? 2.016   -9.906  -9.101  1.00 10.00 ? 430 ASN A HB3  6  
ATOM 6080  H HD21 . ASN A 1 21 ? 3.359   -9.006  -10.674 1.00 10.00 ? 430 ASN A HD21 6  
ATOM 6081  H HD22 . ASN A 1 21 ? 5.061   -8.843  -10.433 1.00 10.00 ? 430 ASN A HD22 6  
ATOM 6082  N N    . MET A 1 22 ? -0.449  -7.584  -7.359  1.00 10.00 ? 431 MET A N    6  
ATOM 6083  C CA   . MET A 1 22 ? -1.905  -7.653  -7.470  1.00 10.00 ? 431 MET A CA   6  
ATOM 6084  C C    . MET A 1 22 ? -2.589  -6.993  -6.280  1.00 10.00 ? 431 MET A C    6  
ATOM 6085  O O    . MET A 1 22 ? -2.944  -7.660  -5.309  1.00 10.00 ? 431 MET A O    6  
ATOM 6086  C CB   . MET A 1 22 ? -2.376  -9.104  -7.568  1.00 10.00 ? 431 MET A CB   6  
ATOM 6087  C CG   . MET A 1 22 ? -2.752  -9.531  -8.978  1.00 10.00 ? 431 MET A CG   6  
ATOM 6088  S SD   . MET A 1 22 ? -4.294  -10.464 -9.036  1.00 10.00 ? 431 MET A SD   6  
ATOM 6089  C CE   . MET A 1 22 ? -5.059  -9.765  -10.497 1.00 10.00 ? 431 MET A CE   6  
ATOM 6090  H H    . MET A 1 22 ? -0.051  -7.031  -6.658  1.00 10.00 ? 431 MET A H    6  
ATOM 6091  H HA   . MET A 1 22 ? -2.193  -7.131  -8.370  1.00 10.00 ? 431 MET A HA   6  
ATOM 6092  H HB2  . MET A 1 22 ? -1.587  -9.750  -7.216  1.00 10.00 ? 431 MET A HB2  6  
ATOM 6093  H HB3  . MET A 1 22 ? -3.243  -9.227  -6.932  1.00 10.00 ? 431 MET A HB3  6  
ATOM 6094  H HG2  . MET A 1 22 ? -2.860  -8.648  -9.590  1.00 10.00 ? 431 MET A HG2  6  
ATOM 6095  H HG3  . MET A 1 22 ? -1.960  -10.147 -9.376  1.00 10.00 ? 431 MET A HG3  6  
ATOM 6096  H HE1  . MET A 1 22 ? -5.450  -10.560 -11.114 1.00 10.00 ? 431 MET A HE1  6  
ATOM 6097  H HE2  . MET A 1 22 ? -4.324  -9.204  -11.054 1.00 10.00 ? 431 MET A HE2  6  
ATOM 6098  H HE3  . MET A 1 22 ? -5.865  -9.109  -10.201 1.00 10.00 ? 431 MET A HE3  6  
ATOM 6099  N N    . TRP A 1 23 ? -2.814  -5.692  -6.378  1.00 10.00 ? 432 TRP A N    6  
ATOM 6100  C CA   . TRP A 1 23 ? -3.500  -4.967  -5.320  1.00 10.00 ? 432 TRP A CA   6  
ATOM 6101  C C    . TRP A 1 23 ? -4.993  -5.016  -5.591  1.00 10.00 ? 432 TRP A C    6  
ATOM 6102  O O    . TRP A 1 23 ? -5.516  -4.282  -6.429  1.00 10.00 ? 432 TRP A O    6  
ATOM 6103  C CB   . TRP A 1 23 ? -3.026  -3.513  -5.219  1.00 10.00 ? 432 TRP A CB   6  
ATOM 6104  C CG   . TRP A 1 23 ? -1.591  -3.268  -5.606  1.00 10.00 ? 432 TRP A CG   6  
ATOM 6105  C CD1  . TRP A 1 23 ? -1.001  -3.536  -6.806  1.00 10.00 ? 432 TRP A CD1  6  
ATOM 6106  C CD2  . TRP A 1 23 ? -0.567  -2.676  -4.789  1.00 10.00 ? 432 TRP A CD2  6  
ATOM 6107  N NE1  . TRP A 1 23 ? 0.303   -3.117  -6.794  1.00 10.00 ? 432 TRP A NE1  6  
ATOM 6108  C CE2  . TRP A 1 23 ? 0.596   -2.597  -5.571  1.00 10.00 ? 432 TRP A CE2  6  
ATOM 6109  C CE3  . TRP A 1 23 ? -0.524  -2.198  -3.482  1.00 10.00 ? 432 TRP A CE3  6  
ATOM 6110  C CZ2  . TRP A 1 23 ? 1.784   -2.054  -5.093  1.00 10.00 ? 432 TRP A CZ2  6  
ATOM 6111  C CZ3  . TRP A 1 23 ? 0.657   -1.667  -3.000  1.00 10.00 ? 432 TRP A CZ3  6  
ATOM 6112  C CH2  . TRP A 1 23 ? 1.796   -1.594  -3.806  1.00 10.00 ? 432 TRP A CH2  6  
ATOM 6113  H H    . TRP A 1 23 ? -2.547  -5.221  -7.189  1.00 10.00 ? 432 TRP A H    6  
ATOM 6114  H HA   . TRP A 1 23 ? -3.310  -5.472  -4.383  1.00 10.00 ? 432 TRP A HA   6  
ATOM 6115  H HB2  . TRP A 1 23 ? -3.642  -2.904  -5.862  1.00 10.00 ? 432 TRP A HB2  6  
ATOM 6116  H HB3  . TRP A 1 23 ? -3.152  -3.180  -4.203  1.00 10.00 ? 432 TRP A HB3  6  
ATOM 6117  H HD1  . TRP A 1 23 ? -1.500  -3.996  -7.639  1.00 10.00 ? 432 TRP A HD1  6  
ATOM 6118  H HE1  . TRP A 1 23 ? 0.922   -3.183  -7.538  1.00 10.00 ? 432 TRP A HE1  6  
ATOM 6119  H HE3  . TRP A 1 23 ? -1.387  -2.249  -2.848  1.00 10.00 ? 432 TRP A HE3  6  
ATOM 6120  H HZ2  . TRP A 1 23 ? 2.661   -1.973  -5.714  1.00 10.00 ? 432 TRP A HZ2  6  
ATOM 6121  H HZ3  . TRP A 1 23 ? 0.705   -1.294  -1.988  1.00 10.00 ? 432 TRP A HZ3  6  
ATOM 6122  H HH2  . TRP A 1 23 ? 2.698   -1.176  -3.388  1.00 10.00 ? 432 TRP A HH2  6  
ATOM 6123  N N    . SER A 1 24 ? -5.664  -5.917  -4.893  1.00 10.00 ? 433 SER A N    6  
ATOM 6124  C CA   . SER A 1 24 ? -7.101  -6.109  -5.064  1.00 10.00 ? 433 SER A CA   6  
ATOM 6125  C C    . SER A 1 24 ? -7.879  -4.845  -4.727  1.00 10.00 ? 433 SER A C    6  
ATOM 6126  O O    . SER A 1 24 ? -7.458  -4.052  -3.887  1.00 10.00 ? 433 SER A O    6  
ATOM 6127  C CB   . SER A 1 24 ? -7.587  -7.273  -4.195  1.00 10.00 ? 433 SER A CB   6  
ATOM 6128  O OG   . SER A 1 24 ? -7.989  -6.825  -2.911  1.00 10.00 ? 433 SER A OG   6  
ATOM 6129  H H    . SER A 1 24 ? -5.174  -6.479  -4.255  1.00 10.00 ? 433 SER A H    6  
ATOM 6130  H HA   . SER A 1 24 ? -7.276  -6.356  -6.101  1.00 10.00 ? 433 SER A HA   6  
ATOM 6131  H HB2  . SER A 1 24 ? -8.430  -7.749  -4.673  1.00 10.00 ? 433 SER A HB2  6  
ATOM 6132  H HB3  . SER A 1 24 ? -6.788  -7.990  -4.078  1.00 10.00 ? 433 SER A HB3  6  
ATOM 6133  H HG   . SER A 1 24 ? -7.856  -7.527  -2.270  1.00 10.00 ? 433 SER A HG   6  
ATOM 6134  N N    . GLU A 1 25 ? -9.026  -4.669  -5.380  1.00 10.00 ? 434 GLU A N    6  
ATOM 6135  C CA   . GLU A 1 25 ? -9.871  -3.507  -5.135  1.00 10.00 ? 434 GLU A CA   6  
ATOM 6136  C C    . GLU A 1 25 ? -10.104 -3.334  -3.639  1.00 10.00 ? 434 GLU A C    6  
ATOM 6137  O O    . GLU A 1 25 ? -10.286 -2.220  -3.149  1.00 10.00 ? 434 GLU A O    6  
ATOM 6138  C CB   . GLU A 1 25 ? -11.209 -3.656  -5.862  1.00 10.00 ? 434 GLU A CB   6  
ATOM 6139  C CG   . GLU A 1 25 ? -12.025 -2.374  -5.903  1.00 10.00 ? 434 GLU A CG   6  
ATOM 6140  C CD   . GLU A 1 25 ? -13.405 -2.580  -6.497  1.00 10.00 ? 434 GLU A CD   6  
ATOM 6141  O OE1  . GLU A 1 25 ? -14.011 -3.641  -6.237  1.00 10.00 ? 434 GLU A OE1  6  
ATOM 6142  O OE2  . GLU A 1 25 ? -13.878 -1.681  -7.223  1.00 10.00 ? 434 GLU A OE2  6  
ATOM 6143  H H    . GLU A 1 25 ? -9.314  -5.342  -6.033  1.00 10.00 ? 434 GLU A H    6  
ATOM 6144  H HA   . GLU A 1 25 ? -9.357  -2.635  -5.513  1.00 10.00 ? 434 GLU A HA   6  
ATOM 6145  H HB2  . GLU A 1 25 ? -11.021 -3.970  -6.878  1.00 10.00 ? 434 GLU A HB2  6  
ATOM 6146  H HB3  . GLU A 1 25 ? -11.795 -4.414  -5.362  1.00 10.00 ? 434 GLU A HB3  6  
ATOM 6147  H HG2  . GLU A 1 25 ? -12.137 -2.002  -4.895  1.00 10.00 ? 434 GLU A HG2  6  
ATOM 6148  H HG3  . GLU A 1 25 ? -11.497 -1.645  -6.499  1.00 10.00 ? 434 GLU A HG3  6  
ATOM 6149  N N    . GLN A 1 26 ? -10.079 -4.452  -2.919  1.00 10.00 ? 435 GLN A N    6  
ATOM 6150  C CA   . GLN A 1 26 ? -10.269 -4.440  -1.477  1.00 10.00 ? 435 GLN A CA   6  
ATOM 6151  C C    . GLN A 1 26 ? -8.940  -4.198  -0.773  1.00 10.00 ? 435 GLN A C    6  
ATOM 6152  O O    . GLN A 1 26 ? -8.897  -3.612  0.309   1.00 10.00 ? 435 GLN A O    6  
ATOM 6153  C CB   . GLN A 1 26 ? -10.876 -5.763  -1.008  1.00 10.00 ? 435 GLN A CB   6  
ATOM 6154  C CG   . GLN A 1 26 ? -12.203 -6.091  -1.672  1.00 10.00 ? 435 GLN A CG   6  
ATOM 6155  C CD   . GLN A 1 26 ? -13.289 -5.088  -1.334  1.00 10.00 ? 435 GLN A CD   6  
ATOM 6156  O OE1  . GLN A 1 26 ? -14.193 -5.375  -0.548  1.00 10.00 ? 435 GLN A OE1  6  
ATOM 6157  N NE2  . GLN A 1 26 ? -13.205 -3.903  -1.928  1.00 10.00 ? 435 GLN A NE2  6  
ATOM 6158  H H    . GLN A 1 26 ? -9.918  -5.307  -3.370  1.00 10.00 ? 435 GLN A H    6  
ATOM 6159  H HA   . GLN A 1 26 ? -10.943 -3.633  -1.236  1.00 10.00 ? 435 GLN A HA   6  
ATOM 6160  H HB2  . GLN A 1 26 ? -10.181 -6.560  -1.226  1.00 10.00 ? 435 GLN A HB2  6  
ATOM 6161  H HB3  . GLN A 1 26 ? -11.034 -5.715  0.060   1.00 10.00 ? 435 GLN A HB3  6  
ATOM 6162  H HG2  . GLN A 1 26 ? -12.063 -6.100  -2.743  1.00 10.00 ? 435 GLN A HG2  6  
ATOM 6163  H HG3  . GLN A 1 26 ? -12.523 -7.070  -1.343  1.00 10.00 ? 435 GLN A HG3  6  
ATOM 6164  H HE21 . GLN A 1 26 ? -12.458 -3.746  -2.542  1.00 10.00 ? 435 GLN A HE21 6  
ATOM 6165  H HE22 . GLN A 1 26 ? -13.894 -3.236  -1.728  1.00 10.00 ? 435 GLN A HE22 6  
ATOM 6166  N N    . GLU A 1 27 ? -7.852  -4.640  -1.401  1.00 10.00 ? 436 GLU A N    6  
ATOM 6167  C CA   . GLU A 1 27 ? -6.530  -4.459  -0.844  1.00 10.00 ? 436 GLU A CA   6  
ATOM 6168  C C    . GLU A 1 27 ? -6.104  -3.013  -1.009  1.00 10.00 ? 436 GLU A C    6  
ATOM 6169  O O    . GLU A 1 27 ? -5.719  -2.357  -0.041  1.00 10.00 ? 436 GLU A O    6  
ATOM 6170  C CB   . GLU A 1 27 ? -5.561  -5.429  -1.524  1.00 10.00 ? 436 GLU A CB   6  
ATOM 6171  C CG   . GLU A 1 27 ? -5.086  -6.552  -0.614  1.00 10.00 ? 436 GLU A CG   6  
ATOM 6172  C CD   . GLU A 1 27 ? -4.602  -6.055  0.736   1.00 10.00 ? 436 GLU A CD   6  
ATOM 6173  O OE1  . GLU A 1 27 ? -5.438  -5.928  1.655   1.00 10.00 ? 436 GLU A OE1  6  
ATOM 6174  O OE2  . GLU A 1 27 ? -3.390  -5.797  0.873   1.00 10.00 ? 436 GLU A OE2  6  
ATOM 6175  H H    . GLU A 1 27 ? -7.936  -5.091  -2.265  1.00 10.00 ? 436 GLU A H    6  
ATOM 6176  H HA   . GLU A 1 27 ? -6.578  -4.676  0.208   1.00 10.00 ? 436 GLU A HA   6  
ATOM 6177  H HB2  . GLU A 1 27 ? -6.060  -5.873  -2.372  1.00 10.00 ? 436 GLU A HB2  6  
ATOM 6178  H HB3  . GLU A 1 27 ? -4.704  -4.884  -1.877  1.00 10.00 ? 436 GLU A HB3  6  
ATOM 6179  H HG2  . GLU A 1 27 ? -5.905  -7.236  -0.453  1.00 10.00 ? 436 GLU A HG2  6  
ATOM 6180  H HG3  . GLU A 1 27 ? -4.276  -7.073  -1.100  1.00 10.00 ? 436 GLU A HG3  6  
ATOM 6181  N N    . LYS A 1 28 ? -6.230  -2.497  -2.226  1.00 10.00 ? 437 LYS A N    6  
ATOM 6182  C CA   . LYS A 1 28 ? -5.913  -1.097  -2.490  1.00 10.00 ? 437 LYS A CA   6  
ATOM 6183  C C    . LYS A 1 28 ? -6.715  -0.219  -1.543  1.00 10.00 ? 437 LYS A C    6  
ATOM 6184  O O    . LYS A 1 28 ? -6.374  0.930   -1.300  1.00 10.00 ? 437 LYS A O    6  
ATOM 6185  C CB   . LYS A 1 28 ? -6.242  -0.739  -3.941  1.00 10.00 ? 437 LYS A CB   6  
ATOM 6186  C CG   . LYS A 1 28 ? -5.033  -0.754  -4.861  1.00 10.00 ? 437 LYS A CG   6  
ATOM 6187  C CD   . LYS A 1 28 ? -5.435  -1.028  -6.301  1.00 10.00 ? 437 LYS A CD   6  
ATOM 6188  C CE   . LYS A 1 28 ? -4.306  -0.711  -7.266  1.00 10.00 ? 437 LYS A CE   6  
ATOM 6189  N NZ   . LYS A 1 28 ? -4.790  -0.596  -8.668  1.00 10.00 ? 437 LYS A NZ   6  
ATOM 6190  H H    . LYS A 1 28 ? -6.584  -3.055  -2.946  1.00 10.00 ? 437 LYS A H    6  
ATOM 6191  H HA   . LYS A 1 28 ? -4.861  -0.932  -2.309  1.00 10.00 ? 437 LYS A HA   6  
ATOM 6192  H HB2  . LYS A 1 28 ? -6.963  -1.448  -4.320  1.00 10.00 ? 437 LYS A HB2  6  
ATOM 6193  H HB3  . LYS A 1 28 ? -6.675  0.250   -3.968  1.00 10.00 ? 437 LYS A HB3  6  
ATOM 6194  H HG2  . LYS A 1 28 ? -4.542  0.207   -4.812  1.00 10.00 ? 437 LYS A HG2  6  
ATOM 6195  H HG3  . LYS A 1 28 ? -4.352  -1.526  -4.534  1.00 10.00 ? 437 LYS A HG3  6  
ATOM 6196  H HD2  . LYS A 1 28 ? -5.697  -2.070  -6.400  1.00 10.00 ? 437 LYS A HD2  6  
ATOM 6197  H HD3  . LYS A 1 28 ? -6.290  -0.415  -6.548  1.00 10.00 ? 437 LYS A HD3  6  
ATOM 6198  H HE2  . LYS A 1 28 ? -3.851  0.224   -6.974  1.00 10.00 ? 437 LYS A HE2  6  
ATOM 6199  H HE3  . LYS A 1 28 ? -3.570  -1.500  -7.212  1.00 10.00 ? 437 LYS A HE3  6  
ATOM 6200  H HZ1  . LYS A 1 28 ? -4.766  -1.527  -9.133  1.00 10.00 ? 437 LYS A HZ1  6  
ATOM 6201  H HZ2  . LYS A 1 28 ? -4.187  0.061   -9.201  1.00 10.00 ? 437 LYS A HZ2  6  
ATOM 6202  H HZ3  . LYS A 1 28 ? -5.767  -0.240  -8.680  1.00 10.00 ? 437 LYS A HZ3  6  
ATOM 6203  N N    . GLU A 1 29 ? -7.782  -0.787  -0.998  1.00 10.00 ? 438 GLU A N    6  
ATOM 6204  C CA   . GLU A 1 29 ? -8.636  -0.070  -0.068  1.00 10.00 ? 438 GLU A CA   6  
ATOM 6205  C C    . GLU A 1 29 ? -7.853  0.380   1.156   1.00 10.00 ? 438 GLU A C    6  
ATOM 6206  O O    . GLU A 1 29 ? -8.212  1.359   1.800   1.00 10.00 ? 438 GLU A O    6  
ATOM 6207  C CB   . GLU A 1 29 ? -9.802  -0.955  0.364   1.00 10.00 ? 438 GLU A CB   6  
ATOM 6208  C CG   . GLU A 1 29 ? -11.093 -0.189  0.605   1.00 10.00 ? 438 GLU A CG   6  
ATOM 6209  C CD   . GLU A 1 29 ? -10.923 0.941   1.600   1.00 10.00 ? 438 GLU A CD   6  
ATOM 6210  O OE1  . GLU A 1 29 ? -10.591 0.656   2.771   1.00 10.00 ? 438 GLU A OE1  6  
ATOM 6211  O OE2  . GLU A 1 29 ? -11.122 2.112   1.211   1.00 10.00 ? 438 GLU A OE2  6  
ATOM 6212  H H    . GLU A 1 29 ? -7.997  -1.718  -1.222  1.00 10.00 ? 438 GLU A H    6  
ATOM 6213  H HA   . GLU A 1 29 ? -9.019  0.801   -0.575  1.00 10.00 ? 438 GLU A HA   6  
ATOM 6214  H HB2  . GLU A 1 29 ? -9.982  -1.692  -0.404  1.00 10.00 ? 438 GLU A HB2  6  
ATOM 6215  H HB3  . GLU A 1 29 ? -9.531  -1.460  1.280   1.00 10.00 ? 438 GLU A HB3  6  
ATOM 6216  H HG2  . GLU A 1 29 ? -11.430 0.227   -0.334  1.00 10.00 ? 438 GLU A HG2  6  
ATOM 6217  H HG3  . GLU A 1 29 ? -11.838 -0.874  0.982   1.00 10.00 ? 438 GLU A HG3  6  
ATOM 6218  N N    . THR A 1 30 ? -6.789  -0.345  1.486   1.00 10.00 ? 439 THR A N    6  
ATOM 6219  C CA   . THR A 1 30 ? -5.986  0.004   2.652   1.00 10.00 ? 439 THR A CA   6  
ATOM 6220  C C    . THR A 1 30 ? -4.845  0.955   2.290   1.00 10.00 ? 439 THR A C    6  
ATOM 6221  O O    . THR A 1 30 ? -4.662  1.987   2.937   1.00 10.00 ? 439 THR A O    6  
ATOM 6222  C CB   . THR A 1 30 ? -5.436  -1.263  3.310   1.00 10.00 ? 439 THR A CB   6  
ATOM 6223  O OG1  . THR A 1 30 ? -6.485  -2.030  3.873   1.00 10.00 ? 439 THR A OG1  6  
ATOM 6224  C CG2  . THR A 1 30 ? -4.430  -0.989  4.408   1.00 10.00 ? 439 THR A CG2  6  
ATOM 6225  H H    . THR A 1 30 ? -6.549  -1.136  0.946   1.00 10.00 ? 439 THR A H    6  
ATOM 6226  H HA   . THR A 1 30 ? -6.634  0.507   3.351   1.00 10.00 ? 439 THR A HA   6  
ATOM 6227  H HB   . THR A 1 30 ? -4.945  -1.864  2.555   1.00 10.00 ? 439 THR A HB   6  
ATOM 6228  H HG1  . THR A 1 30 ? -6.864  -2.598  3.198   1.00 10.00 ? 439 THR A HG1  6  
ATOM 6229  H HG21 . THR A 1 30 ? -4.330  0.077   4.550   1.00 10.00 ? 439 THR A HG21 6  
ATOM 6230  H HG22 . THR A 1 30 ? -3.475  -1.405  4.129   1.00 10.00 ? 439 THR A HG22 6  
ATOM 6231  H HG23 . THR A 1 30 ? -4.766  -1.445  5.327   1.00 10.00 ? 439 THR A HG23 6  
ATOM 6232  N N    . PHE A 1 31 ? -4.080  0.606   1.266   1.00 10.00 ? 440 PHE A N    6  
ATOM 6233  C CA   . PHE A 1 31 ? -2.960  1.430   0.835   1.00 10.00 ? 440 PHE A CA   6  
ATOM 6234  C C    . PHE A 1 31 ? -3.453  2.663   0.086   1.00 10.00 ? 440 PHE A C    6  
ATOM 6235  O O    . PHE A 1 31 ? -2.811  3.712   0.110   1.00 10.00 ? 440 PHE A O    6  
ATOM 6236  C CB   . PHE A 1 31 ? -2.016  0.617   -0.055  1.00 10.00 ? 440 PHE A CB   6  
ATOM 6237  C CG   . PHE A 1 31 ? -2.447  -0.796  -0.264  1.00 10.00 ? 440 PHE A CG   6  
ATOM 6238  C CD1  . PHE A 1 31 ? -2.417  -1.719  0.766   1.00 10.00 ? 440 PHE A CD1  6  
ATOM 6239  C CD2  . PHE A 1 31 ? -2.906  -1.190  -1.496  1.00 10.00 ? 440 PHE A CD2  6  
ATOM 6240  C CE1  . PHE A 1 31 ? -2.836  -3.011  0.551   1.00 10.00 ? 440 PHE A CE1  6  
ATOM 6241  C CE2  . PHE A 1 31 ? -3.328  -2.472  -1.713  1.00 10.00 ? 440 PHE A CE2  6  
ATOM 6242  C CZ   . PHE A 1 31 ? -3.290  -3.378  -0.697  1.00 10.00 ? 440 PHE A CZ   6  
ATOM 6243  H H    . PHE A 1 31 ? -4.265  -0.224  0.787   1.00 10.00 ? 440 PHE A H    6  
ATOM 6244  H HA   . PHE A 1 31 ? -2.424  1.748   1.716   1.00 10.00 ? 440 PHE A HA   6  
ATOM 6245  H HB2  . PHE A 1 31 ? -1.971  1.075   -1.028  1.00 10.00 ? 440 PHE A HB2  6  
ATOM 6246  H HB3  . PHE A 1 31 ? -1.032  0.605   0.382   1.00 10.00 ? 440 PHE A HB3  6  
ATOM 6247  H HD1  . PHE A 1 31 ? -2.064  -1.421  1.740   1.00 10.00 ? 440 PHE A HD1  6  
ATOM 6248  H HD2  . PHE A 1 31 ? -2.935  -0.481  -2.296  1.00 10.00 ? 440 PHE A HD2  6  
ATOM 6249  H HE1  . PHE A 1 31 ? -2.808  -3.732  1.353   1.00 10.00 ? 440 PHE A HE1  6  
ATOM 6250  H HE2  . PHE A 1 31 ? -3.693  -2.769  -2.687  1.00 10.00 ? 440 PHE A HE2  6  
ATOM 6251  H HZ   . PHE A 1 31 ? -3.628  -4.364  -0.877  1.00 10.00 ? 440 PHE A HZ   6  
ATOM 6252  N N    . ARG A 1 32 ? -4.601  2.534   -0.575  1.00 10.00 ? 441 ARG A N    6  
ATOM 6253  C CA   . ARG A 1 32 ? -5.170  3.648   -1.321  1.00 10.00 ? 441 ARG A CA   6  
ATOM 6254  C C    . ARG A 1 32 ? -5.961  4.569   -0.395  1.00 10.00 ? 441 ARG A C    6  
ATOM 6255  O O    . ARG A 1 32 ? -6.085  5.765   -0.657  1.00 10.00 ? 441 ARG A O    6  
ATOM 6256  C CB   . ARG A 1 32 ? -6.070  3.153   -2.455  1.00 10.00 ? 441 ARG A CB   6  
ATOM 6257  C CG   . ARG A 1 32 ? -6.273  4.176   -3.561  1.00 10.00 ? 441 ARG A CG   6  
ATOM 6258  C CD   . ARG A 1 32 ? -7.506  5.030   -3.311  1.00 10.00 ? 441 ARG A CD   6  
ATOM 6259  N NE   . ARG A 1 32 ? -7.995  5.655   -4.537  1.00 10.00 ? 441 ARG A NE   6  
ATOM 6260  C CZ   . ARG A 1 32 ? -8.567  4.984   -5.535  1.00 10.00 ? 441 ARG A CZ   6  
ATOM 6261  N NH1  . ARG A 1 32 ? -8.722  3.668   -5.457  1.00 10.00 ? 441 ARG A NH1  6  
ATOM 6262  N NH2  . ARG A 1 32 ? -8.986  5.631   -6.614  1.00 10.00 ? 441 ARG A NH2  6  
ATOM 6263  H H    . ARG A 1 32 ? -5.073  1.674   -0.557  1.00 10.00 ? 441 ARG A H    6  
ATOM 6264  H HA   . ARG A 1 32 ? -4.350  4.203   -1.749  1.00 10.00 ? 441 ARG A HA   6  
ATOM 6265  H HB2  . ARG A 1 32 ? -5.629  2.268   -2.890  1.00 10.00 ? 441 ARG A HB2  6  
ATOM 6266  H HB3  . ARG A 1 32 ? -7.037  2.900   -2.048  1.00 10.00 ? 441 ARG A HB3  6  
ATOM 6267  H HG2  . ARG A 1 32 ? -5.407  4.819   -3.606  1.00 10.00 ? 441 ARG A HG2  6  
ATOM 6268  H HG3  . ARG A 1 32 ? -6.388  3.657   -4.502  1.00 10.00 ? 441 ARG A HG3  6  
ATOM 6269  H HD2  . ARG A 1 32 ? -8.285  4.402   -2.903  1.00 10.00 ? 441 ARG A HD2  6  
ATOM 6270  H HD3  . ARG A 1 32 ? -7.255  5.801   -2.600  1.00 10.00 ? 441 ARG A HD3  6  
ATOM 6271  H HE   . ARG A 1 32 ? -7.894  6.626   -4.622  1.00 10.00 ? 441 ARG A HE   6  
ATOM 6272  H HH11 . ARG A 1 32 ? -8.409  3.175   -4.645  1.00 10.00 ? 441 ARG A HH11 6  
ATOM 6273  H HH12 . ARG A 1 32 ? -9.152  3.170   -6.209  1.00 10.00 ? 441 ARG A HH12 6  
ATOM 6274  H HH21 . ARG A 1 32 ? -8.871  6.623   -6.679  1.00 10.00 ? 441 ARG A HH21 6  
ATOM 6275  H HH22 . ARG A 1 32 ? -9.414  5.127   -7.365  1.00 10.00 ? 441 ARG A HH22 6  
ATOM 6276  N N    . GLU A 1 33 ? -6.494  4.009   0.694   1.00 10.00 ? 442 GLU A N    6  
ATOM 6277  C CA   . GLU A 1 33 ? -7.266  4.800   1.647   1.00 10.00 ? 442 GLU A CA   6  
ATOM 6278  C C    . GLU A 1 33 ? -6.343  5.517   2.621   1.00 10.00 ? 442 GLU A C    6  
ATOM 6279  O O    . GLU A 1 33 ? -6.617  6.644   3.031   1.00 10.00 ? 442 GLU A O    6  
ATOM 6280  C CB   . GLU A 1 33 ? -8.252  3.922   2.416   1.00 10.00 ? 442 GLU A CB   6  
ATOM 6281  C CG   . GLU A 1 33 ? -9.113  4.696   3.403   1.00 10.00 ? 442 GLU A CG   6  
ATOM 6282  C CD   . GLU A 1 33 ? -9.743  3.802   4.453   1.00 10.00 ? 442 GLU A CD   6  
ATOM 6283  O OE1  . GLU A 1 33 ? -10.491 2.877   4.073   1.00 10.00 ? 442 GLU A OE1  6  
ATOM 6284  O OE2  . GLU A 1 33 ? -9.488  4.028   5.655   1.00 10.00 ? 442 GLU A OE2  6  
ATOM 6285  H H    . GLU A 1 33 ? -6.364  3.048   0.861   1.00 10.00 ? 442 GLU A H    6  
ATOM 6286  H HA   . GLU A 1 33 ? -7.817  5.540   1.088   1.00 10.00 ? 442 GLU A HA   6  
ATOM 6287  H HB2  . GLU A 1 33 ? -8.905  3.432   1.710   1.00 10.00 ? 442 GLU A HB2  6  
ATOM 6288  H HB3  . GLU A 1 33 ? -7.699  3.174   2.965   1.00 10.00 ? 442 GLU A HB3  6  
ATOM 6289  H HG2  . GLU A 1 33 ? -8.497  5.430   3.900   1.00 10.00 ? 442 GLU A HG2  6  
ATOM 6290  H HG3  . GLU A 1 33 ? -9.900  5.197   2.857   1.00 10.00 ? 442 GLU A HG3  6  
ATOM 6291  N N    . LYS A 1 34 ? -5.241  4.865   2.981   1.00 10.00 ? 443 LYS A N    6  
ATOM 6292  C CA   . LYS A 1 34 ? -4.285  5.462   3.891   1.00 10.00 ? 443 LYS A CA   6  
ATOM 6293  C C    . LYS A 1 34 ? -3.656  6.678   3.235   1.00 10.00 ? 443 LYS A C    6  
ATOM 6294  O O    . LYS A 1 34 ? -3.470  7.714   3.867   1.00 10.00 ? 443 LYS A O    6  
ATOM 6295  C CB   . LYS A 1 34 ? -3.206  4.450   4.278   1.00 10.00 ? 443 LYS A CB   6  
ATOM 6296  C CG   . LYS A 1 34 ? -3.623  3.518   5.404   1.00 10.00 ? 443 LYS A CG   6  
ATOM 6297  C CD   . LYS A 1 34 ? -3.438  4.170   6.764   1.00 10.00 ? 443 LYS A CD   6  
ATOM 6298  C CE   . LYS A 1 34 ? -4.266  3.476   7.834   1.00 10.00 ? 443 LYS A CE   6  
ATOM 6299  N NZ   . LYS A 1 34 ? -3.679  3.647   9.190   1.00 10.00 ? 443 LYS A NZ   6  
ATOM 6300  H H    . LYS A 1 34 ? -5.062  3.975   2.614   1.00 10.00 ? 443 LYS A H    6  
ATOM 6301  H HA   . LYS A 1 34 ? -4.815  5.776   4.778   1.00 10.00 ? 443 LYS A HA   6  
ATOM 6302  H HB2  . LYS A 1 34 ? -2.965  3.849   3.413   1.00 10.00 ? 443 LYS A HB2  6  
ATOM 6303  H HB3  . LYS A 1 34 ? -2.322  4.985   4.592   1.00 10.00 ? 443 LYS A HB3  6  
ATOM 6304  H HG2  . LYS A 1 34 ? -4.664  3.259   5.279   1.00 10.00 ? 443 LYS A HG2  6  
ATOM 6305  H HG3  . LYS A 1 34 ? -3.020  2.622   5.359   1.00 10.00 ? 443 LYS A HG3  6  
ATOM 6306  H HD2  . LYS A 1 34 ? -2.395  4.116   7.040   1.00 10.00 ? 443 LYS A HD2  6  
ATOM 6307  H HD3  . LYS A 1 34 ? -3.742  5.204   6.701   1.00 10.00 ? 443 LYS A HD3  6  
ATOM 6308  H HE2  . LYS A 1 34 ? -5.262  3.892   7.826   1.00 10.00 ? 443 LYS A HE2  6  
ATOM 6309  H HE3  . LYS A 1 34 ? -4.316  2.421   7.602   1.00 10.00 ? 443 LYS A HE3  6  
ATOM 6310  H HZ1  . LYS A 1 34 ? -3.846  4.615   9.532   1.00 10.00 ? 443 LYS A HZ1  6  
ATOM 6311  H HZ2  . LYS A 1 34 ? -2.653  3.475   9.161   1.00 10.00 ? 443 LYS A HZ2  6  
ATOM 6312  H HZ3  . LYS A 1 34 ? -4.113  2.975   9.856   1.00 10.00 ? 443 LYS A HZ3  6  
ATOM 6313  N N    . PHE A 1 35 ? -3.356  6.551   1.947   1.00 10.00 ? 444 PHE A N    6  
ATOM 6314  C CA   . PHE A 1 35 ? -2.774  7.644   1.194   1.00 10.00 ? 444 PHE A CA   6  
ATOM 6315  C C    . PHE A 1 35 ? -3.778  8.776   1.120   1.00 10.00 ? 444 PHE A C    6  
ATOM 6316  O O    . PHE A 1 35 ? -3.412  9.951   1.114   1.00 10.00 ? 444 PHE A O    6  
ATOM 6317  C CB   . PHE A 1 35 ? -2.359  7.163   -0.194  1.00 10.00 ? 444 PHE A CB   6  
ATOM 6318  C CG   . PHE A 1 35 ? -1.651  8.201   -1.012  1.00 10.00 ? 444 PHE A CG   6  
ATOM 6319  C CD1  . PHE A 1 35 ? -2.311  9.338   -1.450  1.00 10.00 ? 444 PHE A CD1  6  
ATOM 6320  C CD2  . PHE A 1 35 ? -0.319  8.036   -1.343  1.00 10.00 ? 444 PHE A CD2  6  
ATOM 6321  C CE1  . PHE A 1 35 ? -1.653  10.292  -2.204  1.00 10.00 ? 444 PHE A CE1  6  
ATOM 6322  C CE2  . PHE A 1 35 ? 0.346   8.984   -2.096  1.00 10.00 ? 444 PHE A CE2  6  
ATOM 6323  C CZ   . PHE A 1 35 ? -0.321  10.113  -2.527  1.00 10.00 ? 444 PHE A CZ   6  
ATOM 6324  H H    . PHE A 1 35 ? -3.555  5.714   1.490   1.00 10.00 ? 444 PHE A H    6  
ATOM 6325  H HA   . PHE A 1 35 ? -1.901  7.990   1.728   1.00 10.00 ? 444 PHE A HA   6  
ATOM 6326  H HB2  . PHE A 1 35 ? -1.686  6.322   -0.079  1.00 10.00 ? 444 PHE A HB2  6  
ATOM 6327  H HB3  . PHE A 1 35 ? -3.236  6.845   -0.737  1.00 10.00 ? 444 PHE A HB3  6  
ATOM 6328  H HD1  . PHE A 1 35 ? -3.352  9.477   -1.197  1.00 10.00 ? 444 PHE A HD1  6  
ATOM 6329  H HD2  . PHE A 1 35 ? 0.201   7.151   -1.005  1.00 10.00 ? 444 PHE A HD2  6  
ATOM 6330  H HE1  . PHE A 1 35 ? -2.178  11.173  -2.540  1.00 10.00 ? 444 PHE A HE1  6  
ATOM 6331  H HE2  . PHE A 1 35 ? 1.388   8.842   -2.347  1.00 10.00 ? 444 PHE A HE2  6  
ATOM 6332  H HZ   . PHE A 1 35 ? 0.196   10.857  -3.116  1.00 10.00 ? 444 PHE A HZ   6  
ATOM 6333  N N    . MET A 1 36 ? -5.054  8.411   1.127   1.00 10.00 ? 445 MET A N    6  
ATOM 6334  C CA   . MET A 1 36 ? -6.111  9.396   1.128   1.00 10.00 ? 445 MET A CA   6  
ATOM 6335  C C    . MET A 1 36 ? -6.197  9.994   2.529   1.00 10.00 ? 445 MET A C    6  
ATOM 6336  O O    . MET A 1 36 ? -6.587  11.146  2.717   1.00 10.00 ? 445 MET A O    6  
ATOM 6337  C CB   . MET A 1 36 ? -7.447  8.765   0.730   1.00 10.00 ? 445 MET A CB   6  
ATOM 6338  C CG   . MET A 1 36 ? -7.721  8.814   -0.765  1.00 10.00 ? 445 MET A CG   6  
ATOM 6339  S SD   . MET A 1 36 ? -8.468  10.369  -1.284  1.00 10.00 ? 445 MET A SD   6  
ATOM 6340  C CE   . MET A 1 36 ? -7.010  11.376  -1.544  1.00 10.00 ? 445 MET A CE   6  
ATOM 6341  H H    . MET A 1 36 ? -5.283  7.459   1.177   1.00 10.00 ? 445 MET A H    6  
ATOM 6342  H HA   . MET A 1 36 ? -5.845  10.164  0.425   1.00 10.00 ? 445 MET A HA   6  
ATOM 6343  H HB2  . MET A 1 36 ? -7.451  7.731   1.042   1.00 10.00 ? 445 MET A HB2  6  
ATOM 6344  H HB3  . MET A 1 36 ? -8.245  9.288   1.237   1.00 10.00 ? 445 MET A HB3  6  
ATOM 6345  H HG2  . MET A 1 36 ? -6.787  8.686   -1.292  1.00 10.00 ? 445 MET A HG2  6  
ATOM 6346  H HG3  . MET A 1 36 ? -8.390  8.006   -1.020  1.00 10.00 ? 445 MET A HG3  6  
ATOM 6347  H HE1  . MET A 1 36 ? -6.253  10.790  -2.045  1.00 10.00 ? 445 MET A HE1  6  
ATOM 6348  H HE2  . MET A 1 36 ? -6.631  11.714  -0.591  1.00 10.00 ? 445 MET A HE2  6  
ATOM 6349  H HE3  . MET A 1 36 ? -7.265  12.231  -2.152  1.00 10.00 ? 445 MET A HE3  6  
ATOM 6350  N N    . GLN A 1 37 ? -5.791  9.179   3.505   1.00 10.00 ? 446 GLN A N    6  
ATOM 6351  C CA   . GLN A 1 37 ? -5.766  9.569   4.907   1.00 10.00 ? 446 GLN A CA   6  
ATOM 6352  C C    . GLN A 1 37 ? -4.590  10.495  5.168   1.00 10.00 ? 446 GLN A C    6  
ATOM 6353  O O    . GLN A 1 37 ? -4.691  11.470  5.914   1.00 10.00 ? 446 GLN A O    6  
ATOM 6354  C CB   . GLN A 1 37 ? -5.620  8.319   5.780   1.00 10.00 ? 446 GLN A CB   6  
ATOM 6355  C CG   . GLN A 1 37 ? -6.018  8.536   7.231   1.00 10.00 ? 446 GLN A CG   6  
ATOM 6356  C CD   . GLN A 1 37 ? -7.080  7.558   7.696   1.00 10.00 ? 446 GLN A CD   6  
ATOM 6357  O OE1  . GLN A 1 37 ? -8.010  7.929   8.413   1.00 10.00 ? 446 GLN A OE1  6  
ATOM 6358  N NE2  . GLN A 1 37 ? -6.948  6.301   7.289   1.00 10.00 ? 446 GLN A NE2  6  
ATOM 6359  H H    . GLN A 1 37 ? -5.479  8.284   3.268   1.00 10.00 ? 446 GLN A H    6  
ATOM 6360  H HA   . GLN A 1 37 ? -6.689  10.074  5.145   1.00 10.00 ? 446 GLN A HA   6  
ATOM 6361  H HB2  . GLN A 1 37 ? -6.241  7.536   5.371   1.00 10.00 ? 446 GLN A HB2  6  
ATOM 6362  H HB3  . GLN A 1 37 ? -4.581  7.994   5.753   1.00 10.00 ? 446 GLN A HB3  6  
ATOM 6363  H HG2  . GLN A 1 37 ? -5.143  8.414   7.852   1.00 10.00 ? 446 GLN A HG2  6  
ATOM 6364  H HG3  . GLN A 1 37 ? -6.399  9.539   7.341   1.00 10.00 ? 446 GLN A HG3  6  
ATOM 6365  H HE21 . GLN A 1 37 ? -6.183  6.077   6.720   1.00 10.00 ? 446 GLN A HE21 6  
ATOM 6366  H HE22 . GLN A 1 37 ? -7.623  5.649   7.572   1.00 10.00 ? 446 GLN A HE22 6  
ATOM 6367  N N    . HIS A 1 38 ? -3.467  10.159  4.548   1.00 10.00 ? 447 HIS A N    6  
ATOM 6368  C CA   . HIS A 1 38 ? -2.239  10.918  4.693   1.00 10.00 ? 447 HIS A CA   6  
ATOM 6369  C C    . HIS A 1 38 ? -2.004  11.805  3.466   1.00 10.00 ? 447 HIS A C    6  
ATOM 6370  O O    . HIS A 1 38 ? -1.786  11.303  2.364   1.00 10.00 ? 447 HIS A O    6  
ATOM 6371  C CB   . HIS A 1 38 ? -1.079  9.942   4.901   1.00 10.00 ? 447 HIS A CB   6  
ATOM 6372  C CG   . HIS A 1 38 ? -1.363  8.931   5.974   1.00 10.00 ? 447 HIS A CG   6  
ATOM 6373  N ND1  . HIS A 1 38 ? -1.332  9.243   7.317   1.00 10.00 ? 447 HIS A ND1  6  
ATOM 6374  C CD2  . HIS A 1 38 ? -1.718  7.617   5.906   1.00 10.00 ? 447 HIS A CD2  6  
ATOM 6375  C CE1  . HIS A 1 38 ? -1.651  8.176   8.026   1.00 10.00 ? 447 HIS A CE1  6  
ATOM 6376  N NE2  . HIS A 1 38 ? -1.891  7.178   7.196   1.00 10.00 ? 447 HIS A NE2  6  
ATOM 6377  H H    . HIS A 1 38 ? -3.464  9.362   3.978   1.00 10.00 ? 447 HIS A H    6  
ATOM 6378  H HA   . HIS A 1 38 ? -2.336  11.540  5.568   1.00 10.00 ? 447 HIS A HA   6  
ATOM 6379  H HB2  . HIS A 1 38 ? -0.892  9.411   3.980   1.00 10.00 ? 447 HIS A HB2  6  
ATOM 6380  H HB3  . HIS A 1 38 ? -0.195  10.494  5.184   1.00 10.00 ? 447 HIS A HB3  6  
ATOM 6381  H HD1  . HIS A 1 38 ? -1.106  10.119  7.695   1.00 10.00 ? 447 HIS A HD1  6  
ATOM 6382  H HD2  . HIS A 1 38 ? -1.846  7.021   5.006   1.00 10.00 ? 447 HIS A HD2  6  
ATOM 6383  H HE1  . HIS A 1 38 ? -1.698  8.124   9.103   1.00 10.00 ? 447 HIS A HE1  6  
ATOM 6384  H HE2  . HIS A 1 38 ? -2.252  6.305   7.455   1.00 10.00 ? 447 HIS A HE2  6  
ATOM 6385  N N    . PRO A 1 39 ? -2.068  13.141  3.637   1.00 10.00 ? 448 PRO A N    6  
ATOM 6386  C CA   . PRO A 1 39 ? -1.885  14.095  2.534   1.00 10.00 ? 448 PRO A CA   6  
ATOM 6387  C C    . PRO A 1 39 ? -0.567  13.911  1.788   1.00 10.00 ? 448 PRO A C    6  
ATOM 6388  O O    . PRO A 1 39 ? 0.468   14.431  2.201   1.00 10.00 ? 448 PRO A O    6  
ATOM 6389  C CB   . PRO A 1 39 ? -1.923  15.469  3.220   1.00 10.00 ? 448 PRO A CB   6  
ATOM 6390  C CG   . PRO A 1 39 ? -1.758  15.193  4.676   1.00 10.00 ? 448 PRO A CG   6  
ATOM 6391  C CD   . PRO A 1 39 ? -2.340  13.831  4.908   1.00 10.00 ? 448 PRO A CD   6  
ATOM 6392  H HA   . PRO A 1 39 ? -2.699  14.029  1.828   1.00 10.00 ? 448 PRO A HA   6  
ATOM 6393  H HB2  . PRO A 1 39 ? -1.119  16.083  2.843   1.00 10.00 ? 448 PRO A HB2  6  
ATOM 6394  H HB3  . PRO A 1 39 ? -2.870  15.947  3.017   1.00 10.00 ? 448 PRO A HB3  6  
ATOM 6395  H HG2  . PRO A 1 39 ? -0.709  15.202  4.936   1.00 10.00 ? 448 PRO A HG2  6  
ATOM 6396  H HG3  . PRO A 1 39 ? -2.294  15.933  5.253   1.00 10.00 ? 448 PRO A HG3  6  
ATOM 6397  H HD2  . PRO A 1 39 ? -1.840  13.342  5.731   1.00 10.00 ? 448 PRO A HD2  6  
ATOM 6398  H HD3  . PRO A 1 39 ? -3.402  13.897  5.092   1.00 10.00 ? 448 PRO A HD3  6  
ATOM 6399  N N    . LYS A 1 40 ? -0.628  13.183  0.672   1.00 10.00 ? 449 LYS A N    6  
ATOM 6400  C CA   . LYS A 1 40 ? 0.544   12.931  -0.170  1.00 10.00 ? 449 LYS A CA   6  
ATOM 6401  C C    . LYS A 1 40 ? 1.800   12.654  0.653   1.00 10.00 ? 449 LYS A C    6  
ATOM 6402  O O    . LYS A 1 40 ? 2.450   13.578  1.143   1.00 10.00 ? 449 LYS A O    6  
ATOM 6403  C CB   . LYS A 1 40 ? 0.788   14.123  -1.098  1.00 10.00 ? 449 LYS A CB   6  
ATOM 6404  C CG   . LYS A 1 40 ? 1.519   13.756  -2.379  1.00 10.00 ? 449 LYS A CG   6  
ATOM 6405  C CD   . LYS A 1 40 ? 3.026   13.856  -2.210  1.00 10.00 ? 449 LYS A CD   6  
ATOM 6406  C CE   . LYS A 1 40 ? 3.712   14.203  -3.521  1.00 10.00 ? 449 LYS A CE   6  
ATOM 6407  N NZ   . LYS A 1 40 ? 5.014   13.497  -3.671  1.00 10.00 ? 449 LYS A NZ   6  
ATOM 6408  H H    . LYS A 1 40 ? -1.493  12.813  0.398   1.00 10.00 ? 449 LYS A H    6  
ATOM 6409  H HA   . LYS A 1 40 ? 0.331   12.063  -0.774  1.00 10.00 ? 449 LYS A HA   6  
ATOM 6410  H HB2  . LYS A 1 40 ? -0.164  14.558  -1.364  1.00 10.00 ? 449 LYS A HB2  6  
ATOM 6411  H HB3  . LYS A 1 40 ? 1.377   14.859  -0.572  1.00 10.00 ? 449 LYS A HB3  6  
ATOM 6412  H HG2  . LYS A 1 40 ? 1.264   12.743  -2.650  1.00 10.00 ? 449 LYS A HG2  6  
ATOM 6413  H HG3  . LYS A 1 40 ? 1.208   14.430  -3.164  1.00 10.00 ? 449 LYS A HG3  6  
ATOM 6414  H HD2  . LYS A 1 40 ? 3.247   14.626  -1.485  1.00 10.00 ? 449 LYS A HD2  6  
ATOM 6415  H HD3  . LYS A 1 40 ? 3.402   12.908  -1.856  1.00 10.00 ? 449 LYS A HD3  6  
ATOM 6416  H HE2  . LYS A 1 40 ? 3.064   13.922  -4.337  1.00 10.00 ? 449 LYS A HE2  6  
ATOM 6417  H HE3  . LYS A 1 40 ? 3.884   15.269  -3.550  1.00 10.00 ? 449 LYS A HE3  6  
ATOM 6418  H HZ1  . LYS A 1 40 ? 4.880   12.472  -3.552  1.00 10.00 ? 449 LYS A HZ1  6  
ATOM 6419  H HZ2  . LYS A 1 40 ? 5.688   13.831  -2.953  1.00 10.00 ? 449 LYS A HZ2  6  
ATOM 6420  H HZ3  . LYS A 1 40 ? 5.412   13.677  -4.614  1.00 10.00 ? 449 LYS A HZ3  6  
ATOM 6421  N N    . ASN A 1 41 ? 2.145   11.380  0.787   1.00 10.00 ? 450 ASN A N    6  
ATOM 6422  C CA   . ASN A 1 41 ? 3.331   10.989  1.540   1.00 10.00 ? 450 ASN A CA   6  
ATOM 6423  C C    . ASN A 1 41 ? 3.990   9.762   0.923   1.00 10.00 ? 450 ASN A C    6  
ATOM 6424  O O    . ASN A 1 41 ? 5.136   9.818   0.475   1.00 10.00 ? 450 ASN A O    6  
ATOM 6425  C CB   . ASN A 1 41 ? 2.980   10.721  3.008   1.00 10.00 ? 450 ASN A CB   6  
ATOM 6426  C CG   . ASN A 1 41 ? 1.653   10.004  3.178   1.00 10.00 ? 450 ASN A CG   6  
ATOM 6427  O OD1  . ASN A 1 41 ? 0.634   10.416  2.624   1.00 10.00 ? 450 ASN A OD1  6  
ATOM 6428  N ND2  . ASN A 1 41 ? 1.659   8.924   3.951   1.00 10.00 ? 450 ASN A ND2  6  
ATOM 6429  H H    . ASN A 1 41 ? 1.595   10.687  0.366   1.00 10.00 ? 450 ASN A H    6  
ATOM 6430  H HA   . ASN A 1 41 ? 4.028   11.808  1.495   1.00 10.00 ? 450 ASN A HA   6  
ATOM 6431  H HB2  . ASN A 1 41 ? 3.753   10.110  3.449   1.00 10.00 ? 450 ASN A HB2  6  
ATOM 6432  H HB3  . ASN A 1 41 ? 2.928   11.662  3.535   1.00 10.00 ? 450 ASN A HB3  6  
ATOM 6433  H HD21 . ASN A 1 41 ? 2.507   8.654   4.362   1.00 10.00 ? 450 ASN A HD21 6  
ATOM 6434  H HD22 . ASN A 1 41 ? 0.817   8.439   4.077   1.00 10.00 ? 450 ASN A HD22 6  
ATOM 6435  N N    . PHE A 1 42 ? 3.261   8.653   0.908   1.00 10.00 ? 451 PHE A N    6  
ATOM 6436  C CA   . PHE A 1 42 ? 3.766   7.399   0.352   1.00 10.00 ? 451 PHE A CA   6  
ATOM 6437  C C    . PHE A 1 42 ? 4.814   6.763   1.267   1.00 10.00 ? 451 PHE A C    6  
ATOM 6438  O O    . PHE A 1 42 ? 5.301   5.665   0.992   1.00 10.00 ? 451 PHE A O    6  
ATOM 6439  C CB   . PHE A 1 42 ? 4.345   7.624   -1.050  1.00 10.00 ? 451 PHE A CB   6  
ATOM 6440  C CG   . PHE A 1 42 ? 3.783   6.697   -2.092  1.00 10.00 ? 451 PHE A CG   6  
ATOM 6441  C CD1  . PHE A 1 42 ? 2.444   6.347   -2.070  1.00 10.00 ? 451 PHE A CD1  6  
ATOM 6442  C CD2  . PHE A 1 42 ? 4.589   6.177   -3.092  1.00 10.00 ? 451 PHE A CD2  6  
ATOM 6443  C CE1  . PHE A 1 42 ? 1.916   5.498   -3.021  1.00 10.00 ? 451 PHE A CE1  6  
ATOM 6444  C CE2  . PHE A 1 42 ? 4.067   5.327   -4.048  1.00 10.00 ? 451 PHE A CE2  6  
ATOM 6445  C CZ   . PHE A 1 42 ? 2.728   4.987   -4.013  1.00 10.00 ? 451 PHE A CZ   6  
ATOM 6446  H H    . PHE A 1 42 ? 2.358   8.676   1.283   1.00 10.00 ? 451 PHE A H    6  
ATOM 6447  H HA   . PHE A 1 42 ? 2.930   6.721   0.277   1.00 10.00 ? 451 PHE A HA   6  
ATOM 6448  H HB2  . PHE A 1 42 ? 4.129   8.636   -1.359  1.00 10.00 ? 451 PHE A HB2  6  
ATOM 6449  H HB3  . PHE A 1 42 ? 5.414   7.484   -1.019  1.00 10.00 ? 451 PHE A HB3  6  
ATOM 6450  H HD1  . PHE A 1 42 ? 1.810   6.745   -1.295  1.00 10.00 ? 451 PHE A HD1  6  
ATOM 6451  H HD2  . PHE A 1 42 ? 5.635   6.442   -3.121  1.00 10.00 ? 451 PHE A HD2  6  
ATOM 6452  H HE1  . PHE A 1 42 ? 0.868   5.237   -2.988  1.00 10.00 ? 451 PHE A HE1  6  
ATOM 6453  H HE2  . PHE A 1 42 ? 4.705   4.928   -4.823  1.00 10.00 ? 451 PHE A HE2  6  
ATOM 6454  H HZ   . PHE A 1 42 ? 2.318   4.323   -4.760  1.00 10.00 ? 451 PHE A HZ   6  
ATOM 6455  N N    . GLY A 1 43 ? 5.145   7.443   2.362   1.00 10.00 ? 452 GLY A N    6  
ATOM 6456  C CA   . GLY A 1 43 ? 6.113   6.914   3.300   1.00 10.00 ? 452 GLY A CA   6  
ATOM 6457  C C    . GLY A 1 43 ? 5.450   6.058   4.357   1.00 10.00 ? 452 GLY A C    6  
ATOM 6458  O O    . GLY A 1 43 ? 6.046   5.105   4.861   1.00 10.00 ? 452 GLY A O    6  
ATOM 6459  H H    . GLY A 1 43 ? 4.720   8.302   2.543   1.00 10.00 ? 452 GLY A H    6  
ATOM 6460  H HA2  . GLY A 1 43 ? 6.834   6.316   2.762   1.00 10.00 ? 452 GLY A HA2  6  
ATOM 6461  H HA3  . GLY A 1 43 ? 6.623   7.734   3.781   1.00 10.00 ? 452 GLY A HA3  6  
ATOM 6462  N N    . LEU A 1 44 ? 4.203   6.392   4.685   1.00 10.00 ? 453 LEU A N    6  
ATOM 6463  C CA   . LEU A 1 44 ? 3.449   5.641   5.678   1.00 10.00 ? 453 LEU A CA   6  
ATOM 6464  C C    . LEU A 1 44 ? 2.821   4.412   5.046   1.00 10.00 ? 453 LEU A C    6  
ATOM 6465  O O    . LEU A 1 44 ? 3.003   3.293   5.524   1.00 10.00 ? 453 LEU A O    6  
ATOM 6466  C CB   . LEU A 1 44 ? 2.357   6.506   6.310   1.00 10.00 ? 453 LEU A CB   6  
ATOM 6467  C CG   . LEU A 1 44 ? 1.301   5.725   7.099   1.00 10.00 ? 453 LEU A CG   6  
ATOM 6468  C CD1  . LEU A 1 44 ? 0.773   6.557   8.253   1.00 10.00 ? 453 LEU A CD1  6  
ATOM 6469  C CD2  . LEU A 1 44 ? 0.167   5.283   6.179   1.00 10.00 ? 453 LEU A CD2  6  
ATOM 6470  H H    . LEU A 1 44 ? 3.781   7.156   4.240   1.00 10.00 ? 453 LEU A H    6  
ATOM 6471  H HA   . LEU A 1 44 ? 4.135   5.324   6.443   1.00 10.00 ? 453 LEU A HA   6  
ATOM 6472  H HB2  . LEU A 1 44 ? 2.828   7.213   6.978   1.00 10.00 ? 453 LEU A HB2  6  
ATOM 6473  H HB3  . LEU A 1 44 ? 1.857   7.053   5.525   1.00 10.00 ? 453 LEU A HB3  6  
ATOM 6474  H HG   . LEU A 1 44 ? 1.757   4.840   7.514   1.00 10.00 ? 453 LEU A HG   6  
ATOM 6475  H HD11 . LEU A 1 44 ? 0.737   7.596   7.962   1.00 10.00 ? 453 LEU A HD11 6  
ATOM 6476  H HD12 . LEU A 1 44 ? 1.426   6.445   9.106   1.00 10.00 ? 453 LEU A HD12 6  
ATOM 6477  H HD13 . LEU A 1 44 ? -0.220  6.220   8.515   1.00 10.00 ? 453 LEU A HD13 6  
ATOM 6478  H HD21 . LEU A 1 44 ? -0.752  5.214   6.744   1.00 10.00 ? 453 LEU A HD21 6  
ATOM 6479  H HD22 . LEU A 1 44 ? 0.401   4.315   5.758   1.00 10.00 ? 453 LEU A HD22 6  
ATOM 6480  H HD23 . LEU A 1 44 ? 0.047   6.000   5.382   1.00 10.00 ? 453 LEU A HD23 6  
ATOM 6481  N N    . ILE A 1 45 ? 2.078   4.623   3.967   1.00 10.00 ? 454 ILE A N    6  
ATOM 6482  C CA   . ILE A 1 45 ? 1.427   3.526   3.275   1.00 10.00 ? 454 ILE A CA   6  
ATOM 6483  C C    . ILE A 1 45 ? 2.435   2.459   2.910   1.00 10.00 ? 454 ILE A C    6  
ATOM 6484  O O    . ILE A 1 45 ? 2.196   1.280   3.123   1.00 10.00 ? 454 ILE A O    6  
ATOM 6485  C CB   . ILE A 1 45 ? 0.682   4.024   2.029   1.00 10.00 ? 454 ILE A CB   6  
ATOM 6486  C CG1  . ILE A 1 45 ? -0.659  4.569   2.466   1.00 10.00 ? 454 ILE A CG1  6  
ATOM 6487  C CG2  . ILE A 1 45 ? 0.509   2.921   0.990   1.00 10.00 ? 454 ILE A CG2  6  
ATOM 6488  C CD1  . ILE A 1 45 ? -0.637  6.067   2.649   1.00 10.00 ? 454 ILE A CD1  6  
ATOM 6489  H H    . ILE A 1 45 ? 1.965   5.537   3.629   1.00 10.00 ? 454 ILE A H    6  
ATOM 6490  H HA   . ILE A 1 45 ? 0.703   3.099   3.950   1.00 10.00 ? 454 ILE A HA   6  
ATOM 6491  H HB   . ILE A 1 45 ? 1.251   4.828   1.590   1.00 10.00 ? 454 ILE A HB   6  
ATOM 6492  H HG12 . ILE A 1 45 ? -1.409  4.321   1.728   1.00 10.00 ? 454 ILE A HG12 6  
ATOM 6493  H HG13 . ILE A 1 45 ? -0.920  4.116   3.415   1.00 10.00 ? 454 ILE A HG13 6  
ATOM 6494  H HG21 . ILE A 1 45 ? 0.035   2.066   1.447   1.00 10.00 ? 454 ILE A HG21 6  
ATOM 6495  H HG22 . ILE A 1 45 ? 1.477   2.633   0.606   1.00 10.00 ? 454 ILE A HG22 6  
ATOM 6496  H HG23 . ILE A 1 45 ? -0.105  3.284   0.178   1.00 10.00 ? 454 ILE A HG23 6  
ATOM 6497  H HD11 . ILE A 1 45 ? -0.705  6.545   1.684   1.00 10.00 ? 454 ILE A HD11 6  
ATOM 6498  H HD12 . ILE A 1 45 ? 0.286   6.356   3.127   1.00 10.00 ? 454 ILE A HD12 6  
ATOM 6499  H HD13 . ILE A 1 45 ? -1.465  6.368   3.262   1.00 10.00 ? 454 ILE A HD13 6  
ATOM 6500  N N    . ALA A 1 46 ? 3.578   2.888   2.401   1.00 10.00 ? 455 ALA A N    6  
ATOM 6501  C CA   . ALA A 1 46 ? 4.642   1.963   2.050   1.00 10.00 ? 455 ALA A CA   6  
ATOM 6502  C C    . ALA A 1 46 ? 5.419   1.556   3.298   1.00 10.00 ? 455 ALA A C    6  
ATOM 6503  O O    . ALA A 1 46 ? 6.498   0.970   3.207   1.00 10.00 ? 455 ALA A O    6  
ATOM 6504  C CB   . ALA A 1 46 ? 5.573   2.591   1.025   1.00 10.00 ? 455 ALA A CB   6  
ATOM 6505  H H    . ALA A 1 46 ? 3.720   3.850   2.287   1.00 10.00 ? 455 ALA A H    6  
ATOM 6506  H HA   . ALA A 1 46 ? 4.192   1.085   1.610   1.00 10.00 ? 455 ALA A HA   6  
ATOM 6507  H HB1  . ALA A 1 46 ? 6.418   1.940   0.861   1.00 10.00 ? 455 ALA A HB1  6  
ATOM 6508  H HB2  . ALA A 1 46 ? 5.919   3.545   1.393   1.00 10.00 ? 455 ALA A HB2  6  
ATOM 6509  H HB3  . ALA A 1 46 ? 5.041   2.733   0.095   1.00 10.00 ? 455 ALA A HB3  6  
ATOM 6510  N N    . SER A 1 47 ? 4.864   1.877   4.470   1.00 10.00 ? 456 SER A N    6  
ATOM 6511  C CA   . SER A 1 47 ? 5.504   1.554   5.736   1.00 10.00 ? 456 SER A CA   6  
ATOM 6512  C C    . SER A 1 47 ? 4.650   0.594   6.560   1.00 10.00 ? 456 SER A C    6  
ATOM 6513  O O    . SER A 1 47 ? 5.183   -0.242  7.287   1.00 10.00 ? 456 SER A O    6  
ATOM 6514  C CB   . SER A 1 47 ? 5.775   2.829   6.535   1.00 10.00 ? 456 SER A CB   6  
ATOM 6515  O OG   . SER A 1 47 ? 7.103   3.285   6.335   1.00 10.00 ? 456 SER A OG   6  
ATOM 6516  H H    . SER A 1 47 ? 4.005   2.349   4.482   1.00 10.00 ? 456 SER A H    6  
ATOM 6517  H HA   . SER A 1 47 ? 6.446   1.074   5.515   1.00 10.00 ? 456 SER A HA   6  
ATOM 6518  H HB2  . SER A 1 47 ? 5.092   3.602   6.219   1.00 10.00 ? 456 SER A HB2  6  
ATOM 6519  H HB3  . SER A 1 47 ? 5.632   2.631   7.587   1.00 10.00 ? 456 SER A HB3  6  
ATOM 6520  H HG   . SER A 1 47 ? 7.627   3.095   7.116   1.00 10.00 ? 456 SER A HG   6  
ATOM 6521  N N    . PHE A 1 48 ? 3.325   0.706   6.448   1.00 10.00 ? 457 PHE A N    6  
ATOM 6522  C CA   . PHE A 1 48 ? 2.442   -0.178  7.202   1.00 10.00 ? 457 PHE A CA   6  
ATOM 6523  C C    . PHE A 1 48 ? 2.342   -1.543  6.517   1.00 10.00 ? 457 PHE A C    6  
ATOM 6524  O O    . PHE A 1 48 ? 2.103   -2.559  7.169   1.00 10.00 ? 457 PHE A O    6  
ATOM 6525  C CB   . PHE A 1 48 ? 1.054   0.456   7.393   1.00 10.00 ? 457 PHE A CB   6  
ATOM 6526  C CG   . PHE A 1 48 ? 0.143   0.327   6.207   1.00 10.00 ? 457 PHE A CG   6  
ATOM 6527  C CD1  . PHE A 1 48 ? -0.393  -0.905  5.862   1.00 10.00 ? 457 PHE A CD1  6  
ATOM 6528  C CD2  . PHE A 1 48 ? -0.171  1.433   5.432   1.00 10.00 ? 457 PHE A CD2  6  
ATOM 6529  C CE1  . PHE A 1 48 ? -1.220  -1.031  4.767   1.00 10.00 ? 457 PHE A CE1  6  
ATOM 6530  C CE2  . PHE A 1 48 ? -1.001  1.313   4.338   1.00 10.00 ? 457 PHE A CE2  6  
ATOM 6531  C CZ   . PHE A 1 48 ? -1.525  0.082   4.003   1.00 10.00 ? 457 PHE A CZ   6  
ATOM 6532  H H    . PHE A 1 48 ? 2.936   1.389   5.848   1.00 10.00 ? 457 PHE A H    6  
ATOM 6533  H HA   . PHE A 1 48 ? 2.891   -0.323  8.175   1.00 10.00 ? 457 PHE A HA   6  
ATOM 6534  H HB2  . PHE A 1 48 ? 0.566   -0.015  8.234   1.00 10.00 ? 457 PHE A HB2  6  
ATOM 6535  H HB3  . PHE A 1 48 ? 1.177   1.509   7.603   1.00 10.00 ? 457 PHE A HB3  6  
ATOM 6536  H HD1  . PHE A 1 48 ? -0.162  -1.774  6.464   1.00 10.00 ? 457 PHE A HD1  6  
ATOM 6537  H HD2  . PHE A 1 48 ? 0.236   2.402   5.692   1.00 10.00 ? 457 PHE A HD2  6  
ATOM 6538  H HE1  . PHE A 1 48 ? -1.628  -2.002  4.509   1.00 10.00 ? 457 PHE A HE1  6  
ATOM 6539  H HE2  . PHE A 1 48 ? -1.239  2.183   3.742   1.00 10.00 ? 457 PHE A HE2  6  
ATOM 6540  H HZ   . PHE A 1 48 ? -2.173  -0.010  3.147   1.00 10.00 ? 457 PHE A HZ   6  
ATOM 6541  N N    . LEU A 1 49 ? 2.546   -1.555  5.201   1.00 10.00 ? 458 LEU A N    6  
ATOM 6542  C CA   . LEU A 1 49 ? 2.501   -2.792  4.425   1.00 10.00 ? 458 LEU A CA   6  
ATOM 6543  C C    . LEU A 1 49 ? 3.896   -3.133  3.903   1.00 10.00 ? 458 LEU A C    6  
ATOM 6544  O O    . LEU A 1 49 ? 4.065   -3.496  2.743   1.00 10.00 ? 458 LEU A O    6  
ATOM 6545  C CB   . LEU A 1 49 ? 1.505   -2.668  3.266   1.00 10.00 ? 458 LEU A CB   6  
ATOM 6546  C CG   . LEU A 1 49 ? 1.440   -1.287  2.617   1.00 10.00 ? 458 LEU A CG   6  
ATOM 6547  C CD1  . LEU A 1 49 ? 2.793   -0.927  2.026   1.00 10.00 ? 458 LEU A CD1  6  
ATOM 6548  C CD2  . LEU A 1 49 ? 0.349   -1.235  1.551   1.00 10.00 ? 458 LEU A CD2  6  
ATOM 6549  H H    . LEU A 1 49 ? 2.745   -0.714  4.740   1.00 10.00 ? 458 LEU A H    6  
ATOM 6550  H HA   . LEU A 1 49 ? 2.177   -3.583  5.082   1.00 10.00 ? 458 LEU A HA   6  
ATOM 6551  H HB2  . LEU A 1 49 ? 1.776   -3.388  2.507   1.00 10.00 ? 458 LEU A HB2  6  
ATOM 6552  H HB3  . LEU A 1 49 ? 0.522   -2.914  3.637   1.00 10.00 ? 458 LEU A HB3  6  
ATOM 6553  H HG   . LEU A 1 49 ? 1.201   -0.557  3.377   1.00 10.00 ? 458 LEU A HG   6  
ATOM 6554  H HD11 . LEU A 1 49 ? 3.271   -1.817  1.656   1.00 10.00 ? 458 LEU A HD11 6  
ATOM 6555  H HD12 . LEU A 1 49 ? 3.413   -0.482  2.791   1.00 10.00 ? 458 LEU A HD12 6  
ATOM 6556  H HD13 . LEU A 1 49 ? 2.658   -0.225  1.216   1.00 10.00 ? 458 LEU A HD13 6  
ATOM 6557  H HD21 . LEU A 1 49 ? -0.080  -2.219  1.423   1.00 10.00 ? 458 LEU A HD21 6  
ATOM 6558  H HD22 . LEU A 1 49 ? 0.773   -0.905  0.615   1.00 10.00 ? 458 LEU A HD22 6  
ATOM 6559  H HD23 . LEU A 1 49 ? -0.429  -0.544  1.855   1.00 10.00 ? 458 LEU A HD23 6  
ATOM 6560  N N    . GLU A 1 50 ? 4.880   -2.997  4.798   1.00 10.00 ? 459 GLU A N    6  
ATOM 6561  C CA   . GLU A 1 50 ? 6.304   -3.263  4.523   1.00 10.00 ? 459 GLU A CA   6  
ATOM 6562  C C    . GLU A 1 50 ? 6.564   -3.939  3.175   1.00 10.00 ? 459 GLU A C    6  
ATOM 6563  O O    . GLU A 1 50 ? 7.332   -3.428  2.360   1.00 10.00 ? 459 GLU A O    6  
ATOM 6564  C CB   . GLU A 1 50 ? 6.894   -4.120  5.642   1.00 10.00 ? 459 GLU A CB   6  
ATOM 6565  C CG   . GLU A 1 50 ? 6.999   -3.394  6.974   1.00 10.00 ? 459 GLU A CG   6  
ATOM 6566  C CD   . GLU A 1 50 ? 8.242   -3.780  7.751   1.00 10.00 ? 459 GLU A CD   6  
ATOM 6567  O OE1  . GLU A 1 50 ? 9.298   -3.151  7.533   1.00 10.00 ? 459 GLU A OE1  6  
ATOM 6568  O OE2  . GLU A 1 50 ? 8.159   -4.713  8.579   1.00 10.00 ? 459 GLU A OE2  6  
ATOM 6569  H H    . GLU A 1 50 ? 4.636   -2.697  5.695   1.00 10.00 ? 459 GLU A H    6  
ATOM 6570  H HA   . GLU A 1 50 ? 6.812   -2.311  4.526   1.00 10.00 ? 459 GLU A HA   6  
ATOM 6571  H HB2  . GLU A 1 50 ? 6.270   -4.991  5.780   1.00 10.00 ? 459 GLU A HB2  6  
ATOM 6572  H HB3  . GLU A 1 50 ? 7.883   -4.440  5.353   1.00 10.00 ? 459 GLU A HB3  6  
ATOM 6573  H HG2  . GLU A 1 50 ? 7.025   -2.331  6.789   1.00 10.00 ? 459 GLU A HG2  6  
ATOM 6574  H HG3  . GLU A 1 50 ? 6.131   -3.635  7.570   1.00 10.00 ? 459 GLU A HG3  6  
ATOM 6575  N N    . ARG A 1 51 ? 5.934   -5.091  2.950   1.00 10.00 ? 460 ARG A N    6  
ATOM 6576  C CA   . ARG A 1 51 ? 6.107   -5.839  1.705   1.00 10.00 ? 460 ARG A CA   6  
ATOM 6577  C C    . ARG A 1 51 ? 6.117   -4.905  0.501   1.00 10.00 ? 460 ARG A C    6  
ATOM 6578  O O    . ARG A 1 51 ? 6.776   -5.172  -0.504  1.00 10.00 ? 460 ARG A O    6  
ATOM 6579  C CB   . ARG A 1 51 ? 4.995   -6.880  1.552   1.00 10.00 ? 460 ARG A CB   6  
ATOM 6580  C CG   . ARG A 1 51 ? 5.380   -8.260  2.058   1.00 10.00 ? 460 ARG A CG   6  
ATOM 6581  C CD   . ARG A 1 51 ? 5.848   -8.216  3.505   1.00 10.00 ? 460 ARG A CD   6  
ATOM 6582  N NE   . ARG A 1 51 ? 5.568   -9.463  4.210   1.00 10.00 ? 460 ARG A NE   6  
ATOM 6583  C CZ   . ARG A 1 51 ? 5.679   -9.610  5.528   1.00 10.00 ? 460 ARG A CZ   6  
ATOM 6584  N NH1  . ARG A 1 51 ? 6.062   -8.592  6.287   1.00 10.00 ? 460 ARG A NH1  6  
ATOM 6585  N NH2  . ARG A 1 51 ? 5.405   -10.780 6.090   1.00 10.00 ? 460 ARG A NH2  6  
ATOM 6586  H H    . ARG A 1 51 ? 5.341   -5.447  3.636   1.00 10.00 ? 460 ARG A H    6  
ATOM 6587  H HA   . ARG A 1 51 ? 7.058   -6.349  1.756   1.00 10.00 ? 460 ARG A HA   6  
ATOM 6588  H HB2  . ARG A 1 51 ? 4.128   -6.547  2.102   1.00 10.00 ? 460 ARG A HB2  6  
ATOM 6589  H HB3  . ARG A 1 51 ? 4.738   -6.963  0.507   1.00 10.00 ? 460 ARG A HB3  6  
ATOM 6590  H HG2  . ARG A 1 51 ? 4.521   -8.911  1.989   1.00 10.00 ? 460 ARG A HG2  6  
ATOM 6591  H HG3  . ARG A 1 51 ? 6.179   -8.650  1.443   1.00 10.00 ? 460 ARG A HG3  6  
ATOM 6592  H HD2  . ARG A 1 51 ? 6.912   -8.035  3.520   1.00 10.00 ? 460 ARG A HD2  6  
ATOM 6593  H HD3  . ARG A 1 51 ? 5.339   -7.406  4.008   1.00 10.00 ? 460 ARG A HD3  6  
ATOM 6594  H HE   . ARG A 1 51 ? 5.282   -10.232 3.673   1.00 10.00 ? 460 ARG A HE   6  
ATOM 6595  H HH11 . ARG A 1 51 ? 6.270   -7.707  5.871   1.00 10.00 ? 460 ARG A HH11 6  
ATOM 6596  H HH12 . ARG A 1 51 ? 6.143   -8.709  7.277   1.00 10.00 ? 460 ARG A HH12 6  
ATOM 6597  H HH21 . ARG A 1 51 ? 5.115   -11.552 5.522   1.00 10.00 ? 460 ARG A HH21 6  
ATOM 6598  H HH22 . ARG A 1 51 ? 5.488   -10.891 7.080   1.00 10.00 ? 460 ARG A HH22 6  
ATOM 6599  N N    . LYS A 1 52 ? 5.388   -3.802  0.620   1.00 10.00 ? 461 LYS A N    6  
ATOM 6600  C CA   . LYS A 1 52 ? 5.318   -2.813  -0.451  1.00 10.00 ? 461 LYS A CA   6  
ATOM 6601  C C    . LYS A 1 52 ? 6.211   -1.622  -0.127  1.00 10.00 ? 461 LYS A C    6  
ATOM 6602  O O    . LYS A 1 52 ? 6.133   -1.053  0.961   1.00 10.00 ? 461 LYS A O    6  
ATOM 6603  C CB   . LYS A 1 52 ? 3.878   -2.331  -0.678  1.00 10.00 ? 461 LYS A CB   6  
ATOM 6604  C CG   . LYS A 1 52 ? 2.801   -3.282  -0.172  1.00 10.00 ? 461 LYS A CG   6  
ATOM 6605  C CD   . LYS A 1 52 ? 2.333   -4.216  -1.273  1.00 10.00 ? 461 LYS A CD   6  
ATOM 6606  C CE   . LYS A 1 52 ? 3.344   -5.317  -1.537  1.00 10.00 ? 461 LYS A CE   6  
ATOM 6607  N NZ   . LYS A 1 52 ? 2.931   -6.611  -0.928  1.00 10.00 ? 461 LYS A NZ   6  
ATOM 6608  H H    . LYS A 1 52 ? 4.892   -3.646  1.453   1.00 10.00 ? 461 LYS A H    6  
ATOM 6609  H HA   . LYS A 1 52 ? 5.679   -3.281  -1.355  1.00 10.00 ? 461 LYS A HA   6  
ATOM 6610  H HB2  . LYS A 1 52 ? 3.749   -1.382  -0.181  1.00 10.00 ? 461 LYS A HB2  6  
ATOM 6611  H HB3  . LYS A 1 52 ? 3.728   -2.189  -1.738  1.00 10.00 ? 461 LYS A HB3  6  
ATOM 6612  H HG2  . LYS A 1 52 ? 3.196   -3.869  0.644   1.00 10.00 ? 461 LYS A HG2  6  
ATOM 6613  H HG3  . LYS A 1 52 ? 1.959   -2.702  0.176   1.00 10.00 ? 461 LYS A HG3  6  
ATOM 6614  H HD2  . LYS A 1 52 ? 1.395   -4.664  -0.980  1.00 10.00 ? 461 LYS A HD2  6  
ATOM 6615  H HD3  . LYS A 1 52 ? 2.193   -3.644  -2.179  1.00 10.00 ? 461 LYS A HD3  6  
ATOM 6616  H HE2  . LYS A 1 52 ? 3.441   -5.447  -2.603  1.00 10.00 ? 461 LYS A HE2  6  
ATOM 6617  H HE3  . LYS A 1 52 ? 4.296   -5.021  -1.124  1.00 10.00 ? 461 LYS A HE3  6  
ATOM 6618  H HZ1  . LYS A 1 52 ? 3.643   -7.343  -1.127  1.00 10.00 ? 461 LYS A HZ1  6  
ATOM 6619  H HZ2  . LYS A 1 52 ? 2.018   -6.916  -1.320  1.00 10.00 ? 461 LYS A HZ2  6  
ATOM 6620  H HZ3  . LYS A 1 52 ? 2.836   -6.506  0.102   1.00 10.00 ? 461 LYS A HZ3  6  
ATOM 6621  N N    . THR A 1 53 ? 7.059   -1.249  -1.077  1.00 10.00 ? 462 THR A N    6  
ATOM 6622  C CA   . THR A 1 53 ? 7.966   -0.122  -0.889  1.00 10.00 ? 462 THR A CA   6  
ATOM 6623  C C    . THR A 1 53 ? 7.313   1.178   -1.343  1.00 10.00 ? 462 THR A C    6  
ATOM 6624  O O    . THR A 1 53 ? 6.258   1.163   -1.976  1.00 10.00 ? 462 THR A O    6  
ATOM 6625  C CB   . THR A 1 53 ? 9.271   -0.350  -1.658  1.00 10.00 ? 462 THR A CB   6  
ATOM 6626  O OG1  . THR A 1 53 ? 9.333   -1.673  -2.163  1.00 10.00 ? 462 THR A OG1  6  
ATOM 6627  C CG2  . THR A 1 53 ? 10.508  -0.124  -0.816  1.00 10.00 ? 462 THR A CG2  6  
ATOM 6628  H H    . THR A 1 53 ? 7.075   -1.741  -1.925  1.00 10.00 ? 462 THR A H    6  
ATOM 6629  H HA   . THR A 1 53 ? 8.188   -0.050  0.166   1.00 10.00 ? 462 THR A HA   6  
ATOM 6630  H HB   . THR A 1 53 ? 9.311   0.334   -2.492  1.00 10.00 ? 462 THR A HB   6  
ATOM 6631  H HG1  . THR A 1 53 ? 9.179   -2.297  -1.450  1.00 10.00 ? 462 THR A HG1  6  
ATOM 6632  H HG21 . THR A 1 53 ? 11.232  0.440   -1.385  1.00 10.00 ? 462 THR A HG21 6  
ATOM 6633  H HG22 . THR A 1 53 ? 10.932  -1.077  -0.535  1.00 10.00 ? 462 THR A HG22 6  
ATOM 6634  H HG23 . THR A 1 53 ? 10.242  0.428   0.074   1.00 10.00 ? 462 THR A HG23 6  
ATOM 6635  N N    . VAL A 1 54 ? 7.945   2.301   -1.021  1.00 10.00 ? 463 VAL A N    6  
ATOM 6636  C CA   . VAL A 1 54 ? 7.417   3.604   -1.405  1.00 10.00 ? 463 VAL A CA   6  
ATOM 6637  C C    . VAL A 1 54 ? 7.467   3.774   -2.919  1.00 10.00 ? 463 VAL A C    6  
ATOM 6638  O O    . VAL A 1 54 ? 6.457   4.078   -3.552  1.00 10.00 ? 463 VAL A O    6  
ATOM 6639  C CB   . VAL A 1 54 ? 8.192   4.757   -0.734  1.00 10.00 ? 463 VAL A CB   6  
ATOM 6640  C CG1  . VAL A 1 54 ? 7.438   6.071   -0.888  1.00 10.00 ? 463 VAL A CG1  6  
ATOM 6641  C CG2  . VAL A 1 54 ? 8.448   4.450   0.736   1.00 10.00 ? 463 VAL A CG2  6  
ATOM 6642  H H    . VAL A 1 54 ? 8.785   2.253   -0.517  1.00 10.00 ? 463 VAL A H    6  
ATOM 6643  H HA   . VAL A 1 54 ? 6.387   3.652   -1.084  1.00 10.00 ? 463 VAL A HA   6  
ATOM 6644  H HB   . VAL A 1 54 ? 9.147   4.858   -1.229  1.00 10.00 ? 463 VAL A HB   6  
ATOM 6645  H HG11 . VAL A 1 54 ? 6.533   5.903   -1.453  1.00 10.00 ? 463 VAL A HG11 6  
ATOM 6646  H HG12 . VAL A 1 54 ? 8.059   6.784   -1.410  1.00 10.00 ? 463 VAL A HG12 6  
ATOM 6647  H HG13 . VAL A 1 54 ? 7.185   6.461   0.088   1.00 10.00 ? 463 VAL A HG13 6  
ATOM 6648  H HG21 . VAL A 1 54 ? 9.512   4.408   0.915   1.00 10.00 ? 463 VAL A HG21 6  
ATOM 6649  H HG22 . VAL A 1 54 ? 8.005   3.498   0.989   1.00 10.00 ? 463 VAL A HG22 6  
ATOM 6650  H HG23 . VAL A 1 54 ? 8.009   5.223   1.349   1.00 10.00 ? 463 VAL A HG23 6  
ATOM 6651  N N    . ALA A 1 55 ? 8.644   3.557   -3.496  1.00 10.00 ? 464 ALA A N    6  
ATOM 6652  C CA   . ALA A 1 55 ? 8.815   3.666   -4.938  1.00 10.00 ? 464 ALA A CA   6  
ATOM 6653  C C    . ALA A 1 55 ? 8.147   2.490   -5.637  1.00 10.00 ? 464 ALA A C    6  
ATOM 6654  O O    . ALA A 1 55 ? 7.650   2.616   -6.756  1.00 10.00 ? 464 ALA A O    6  
ATOM 6655  C CB   . ALA A 1 55 ? 10.292  3.733   -5.295  1.00 10.00 ? 464 ALA A CB   6  
ATOM 6656  H H    . ALA A 1 55 ? 9.410   3.302   -2.941  1.00 10.00 ? 464 ALA A H    6  
ATOM 6657  H HA   . ALA A 1 55 ? 8.343   4.582   -5.265  1.00 10.00 ? 464 ALA A HA   6  
ATOM 6658  H HB1  . ALA A 1 55 ? 10.406  4.160   -6.281  1.00 10.00 ? 464 ALA A HB1  6  
ATOM 6659  H HB2  . ALA A 1 55 ? 10.710  2.736   -5.285  1.00 10.00 ? 464 ALA A HB2  6  
ATOM 6660  H HB3  . ALA A 1 55 ? 10.810  4.348   -4.574  1.00 10.00 ? 464 ALA A HB3  6  
ATOM 6661  N N    . GLU A 1 56 ? 8.129   1.346   -4.958  1.00 10.00 ? 465 GLU A N    6  
ATOM 6662  C CA   . GLU A 1 56 ? 7.509   0.145   -5.500  1.00 10.00 ? 465 GLU A CA   6  
ATOM 6663  C C    . GLU A 1 56 ? 5.991   0.252   -5.422  1.00 10.00 ? 465 GLU A C    6  
ATOM 6664  O O    . GLU A 1 56 ? 5.276   -0.311  -6.249  1.00 10.00 ? 465 GLU A O    6  
ATOM 6665  C CB   . GLU A 1 56 ? 7.989   -1.091  -4.738  1.00 10.00 ? 465 GLU A CB   6  
ATOM 6666  C CG   . GLU A 1 56 ? 7.644   -2.402  -5.427  1.00 10.00 ? 465 GLU A CG   6  
ATOM 6667  C CD   . GLU A 1 56 ? 8.696   -3.471  -5.206  1.00 10.00 ? 465 GLU A CD   6  
ATOM 6668  O OE1  . GLU A 1 56 ? 9.253   -3.534  -4.090  1.00 10.00 ? 465 GLU A OE1  6  
ATOM 6669  O OE2  . GLU A 1 56 ? 8.960   -4.247  -6.149  1.00 10.00 ? 465 GLU A OE2  6  
ATOM 6670  H H    . GLU A 1 56 ? 8.534   1.313   -4.066  1.00 10.00 ? 465 GLU A H    6  
ATOM 6671  H HA   . GLU A 1 56 ? 7.801   0.058   -6.536  1.00 10.00 ? 465 GLU A HA   6  
ATOM 6672  H HB2  . GLU A 1 56 ? 9.062   -1.039  -4.628  1.00 10.00 ? 465 GLU A HB2  6  
ATOM 6673  H HB3  . GLU A 1 56 ? 7.535   -1.095  -3.758  1.00 10.00 ? 465 GLU A HB3  6  
ATOM 6674  H HG2  . GLU A 1 56 ? 6.701   -2.760  -5.039  1.00 10.00 ? 465 GLU A HG2  6  
ATOM 6675  H HG3  . GLU A 1 56 ? 7.551   -2.222  -6.488  1.00 10.00 ? 465 GLU A HG3  6  
ATOM 6676  N N    . CYS A 1 57 ? 5.506   0.987   -4.423  1.00 10.00 ? 466 CYS A N    6  
ATOM 6677  C CA   . CYS A 1 57 ? 4.073   1.177   -4.243  1.00 10.00 ? 466 CYS A CA   6  
ATOM 6678  C C    . CYS A 1 57 ? 3.477   1.883   -5.452  1.00 10.00 ? 466 CYS A C    6  
ATOM 6679  O O    . CYS A 1 57 ? 2.296   1.720   -5.760  1.00 10.00 ? 466 CYS A O    6  
ATOM 6680  C CB   . CYS A 1 57 ? 3.793   1.979   -2.971  1.00 10.00 ? 466 CYS A CB   6  
ATOM 6681  S SG   . CYS A 1 57 ? 3.375   0.964   -1.535  1.00 10.00 ? 466 CYS A SG   6  
ATOM 6682  H H    . CYS A 1 57 ? 6.127   1.416   -3.799  1.00 10.00 ? 466 CYS A H    6  
ATOM 6683  H HA   . CYS A 1 57 ? 3.619   0.202   -4.155  1.00 10.00 ? 466 CYS A HA   6  
ATOM 6684  H HB2  . CYS A 1 57 ? 4.669   2.558   -2.719  1.00 10.00 ? 466 CYS A HB2  6  
ATOM 6685  H HB3  . CYS A 1 57 ? 2.966   2.651   -3.152  1.00 10.00 ? 466 CYS A HB3  6  
ATOM 6686  H HG   . CYS A 1 57 ? 2.421   0.981   -1.428  1.00 10.00 ? 466 CYS A HG   6  
ATOM 6687  N N    . VAL A 1 58 ? 4.308   2.653   -6.152  1.00 10.00 ? 467 VAL A N    6  
ATOM 6688  C CA   . VAL A 1 58 ? 3.867   3.363   -7.345  1.00 10.00 ? 467 VAL A CA   6  
ATOM 6689  C C    . VAL A 1 58 ? 3.232   2.388   -8.337  1.00 10.00 ? 467 VAL A C    6  
ATOM 6690  O O    . VAL A 1 58 ? 2.466   2.785   -9.212  1.00 10.00 ? 467 VAL A O    6  
ATOM 6691  C CB   . VAL A 1 58 ? 5.043   4.099   -8.026  1.00 10.00 ? 467 VAL A CB   6  
ATOM 6692  C CG1  . VAL A 1 58 ? 4.629   4.661   -9.380  1.00 10.00 ? 467 VAL A CG1  6  
ATOM 6693  C CG2  . VAL A 1 58 ? 5.567   5.207   -7.126  1.00 10.00 ? 467 VAL A CG2  6  
ATOM 6694  H H    . VAL A 1 58 ? 5.243   2.732   -5.868  1.00 10.00 ? 467 VAL A H    6  
ATOM 6695  H HA   . VAL A 1 58 ? 3.131   4.095   -7.046  1.00 10.00 ? 467 VAL A HA   6  
ATOM 6696  H HB   . VAL A 1 58 ? 5.842   3.390   -8.184  1.00 10.00 ? 467 VAL A HB   6  
ATOM 6697  H HG11 . VAL A 1 58 ? 3.840   5.384   -9.244  1.00 10.00 ? 467 VAL A HG11 6  
ATOM 6698  H HG12 . VAL A 1 58 ? 4.275   3.857   -10.012 1.00 10.00 ? 467 VAL A HG12 6  
ATOM 6699  H HG13 . VAL A 1 58 ? 5.479   5.137   -9.847  1.00 10.00 ? 467 VAL A HG13 6  
ATOM 6700  H HG21 . VAL A 1 58 ? 6.131   4.775   -6.313  1.00 10.00 ? 467 VAL A HG21 6  
ATOM 6701  H HG22 . VAL A 1 58 ? 4.736   5.770   -6.727  1.00 10.00 ? 467 VAL A HG22 6  
ATOM 6702  H HG23 . VAL A 1 58 ? 6.205   5.864   -7.698  1.00 10.00 ? 467 VAL A HG23 6  
ATOM 6703  N N    . LEU A 1 59 ? 3.556   1.106   -8.186  1.00 10.00 ? 468 LEU A N    6  
ATOM 6704  C CA   . LEU A 1 59 ? 3.019   0.074   -9.059  1.00 10.00 ? 468 LEU A CA   6  
ATOM 6705  C C    . LEU A 1 59 ? 1.519   -0.125  -8.837  1.00 10.00 ? 468 LEU A C    6  
ATOM 6706  O O    . LEU A 1 59 ? 0.875   -0.856  -9.584  1.00 10.00 ? 468 LEU A O    6  
ATOM 6707  C CB   . LEU A 1 59 ? 3.765   -1.242  -8.833  1.00 10.00 ? 468 LEU A CB   6  
ATOM 6708  C CG   . LEU A 1 59 ? 4.181   -1.979  -10.108 1.00 10.00 ? 468 LEU A CG   6  
ATOM 6709  C CD1  . LEU A 1 59 ? 5.256   -1.199  -10.848 1.00 10.00 ? 468 LEU A CD1  6  
ATOM 6710  C CD2  . LEU A 1 59 ? 4.668   -3.382  -9.777  1.00 10.00 ? 468 LEU A CD2  6  
ATOM 6711  H H    . LEU A 1 59 ? 4.172   0.847   -7.472  1.00 10.00 ? 468 LEU A H    6  
ATOM 6712  H HA   . LEU A 1 59 ? 3.174   0.395   -10.078 1.00 10.00 ? 468 LEU A HA   6  
ATOM 6713  H HB2  . LEU A 1 59 ? 4.655   -1.031  -8.257  1.00 10.00 ? 468 LEU A HB2  6  
ATOM 6714  H HB3  . LEU A 1 59 ? 3.131   -1.898  -8.255  1.00 10.00 ? 468 LEU A HB3  6  
ATOM 6715  H HG   . LEU A 1 59 ? 3.323   -2.066  -10.760 1.00 10.00 ? 468 LEU A HG   6  
ATOM 6716  H HD11 . LEU A 1 59 ? 5.412   -1.637  -11.822 1.00 10.00 ? 468 LEU A HD11 6  
ATOM 6717  H HD12 . LEU A 1 59 ? 6.178   -1.236  -10.286 1.00 10.00 ? 468 LEU A HD12 6  
ATOM 6718  H HD13 . LEU A 1 59 ? 4.943   -0.172  -10.961 1.00 10.00 ? 468 LEU A HD13 6  
ATOM 6719  H HD21 . LEU A 1 59 ? 5.109   -3.826  -10.657 1.00 10.00 ? 468 LEU A HD21 6  
ATOM 6720  H HD22 . LEU A 1 59 ? 3.834   -3.985  -9.449  1.00 10.00 ? 468 LEU A HD22 6  
ATOM 6721  H HD23 . LEU A 1 59 ? 5.406   -3.329  -8.991  1.00 10.00 ? 468 LEU A HD23 6  
ATOM 6722  N N    . TYR A 1 60 ? 0.969   0.519   -7.809  1.00 10.00 ? 469 TYR A N    6  
ATOM 6723  C CA   . TYR A 1 60 ? -0.456  0.401   -7.513  1.00 10.00 ? 469 TYR A CA   6  
ATOM 6724  C C    . TYR A 1 60 ? -1.193  1.718   -7.766  1.00 10.00 ? 469 TYR A C    6  
ATOM 6725  O O    . TYR A 1 60 ? -2.422  1.746   -7.791  1.00 10.00 ? 469 TYR A O    6  
ATOM 6726  C CB   . TYR A 1 60 ? -0.662  -0.075  -6.063  1.00 10.00 ? 469 TYR A CB   6  
ATOM 6727  C CG   . TYR A 1 60 ? -1.158  0.963   -5.078  1.00 10.00 ? 469 TYR A CG   6  
ATOM 6728  C CD1  . TYR A 1 60 ? -0.639  2.247   -5.082  1.00 10.00 ? 469 TYR A CD1  6  
ATOM 6729  C CD2  . TYR A 1 60 ? -2.141  0.654   -4.137  1.00 10.00 ? 469 TYR A CD2  6  
ATOM 6730  C CE1  . TYR A 1 60 ? -1.075  3.201   -4.187  1.00 10.00 ? 469 TYR A CE1  6  
ATOM 6731  C CE2  . TYR A 1 60 ? -2.582  1.606   -3.239  1.00 10.00 ? 469 TYR A CE2  6  
ATOM 6732  C CZ   . TYR A 1 60 ? -2.046  2.876   -3.268  1.00 10.00 ? 469 TYR A CZ   6  
ATOM 6733  O OH   . TYR A 1 60 ? -2.477  3.824   -2.373  1.00 10.00 ? 469 TYR A OH   6  
ATOM 6734  H H    . TYR A 1 60 ? 1.529   1.077   -7.238  1.00 10.00 ? 469 TYR A H    6  
ATOM 6735  H HA   . TYR A 1 60 ? -0.855  -0.350  -8.176  1.00 10.00 ? 469 TYR A HA   6  
ATOM 6736  H HB2  . TYR A 1 60 ? -1.376  -0.879  -6.065  1.00 10.00 ? 469 TYR A HB2  6  
ATOM 6737  H HB3  . TYR A 1 60 ? 0.278   -0.441  -5.694  1.00 10.00 ? 469 TYR A HB3  6  
ATOM 6738  H HD1  . TYR A 1 60 ? 0.122   2.495   -5.801  1.00 10.00 ? 469 TYR A HD1  6  
ATOM 6739  H HD2  . TYR A 1 60 ? -2.560  -0.355  -4.101  1.00 10.00 ? 469 TYR A HD2  6  
ATOM 6740  H HE1  . TYR A 1 60 ? -0.655  4.195   -4.210  1.00 10.00 ? 469 TYR A HE1  6  
ATOM 6741  H HE2  . TYR A 1 60 ? -3.345  1.348   -2.516  1.00 10.00 ? 469 TYR A HE2  6  
ATOM 6742  H HH   . TYR A 1 60 ? -2.565  4.670   -2.819  1.00 10.00 ? 469 TYR A HH   6  
ATOM 6743  N N    . TYR A 1 61 ? -0.445  2.809   -7.929  1.00 10.00 ? 470 TYR A N    6  
ATOM 6744  C CA   . TYR A 1 61 ? -1.051  4.114   -8.149  1.00 10.00 ? 470 TYR A CA   6  
ATOM 6745  C C    . TYR A 1 61 ? -1.253  4.395   -9.637  1.00 10.00 ? 470 TYR A C    6  
ATOM 6746  O O    . TYR A 1 61 ? -2.200  5.082   -10.017 1.00 10.00 ? 470 TYR A O    6  
ATOM 6747  C CB   . TYR A 1 61 ? -0.202  5.212   -7.486  1.00 10.00 ? 470 TYR A CB   6  
ATOM 6748  C CG   . TYR A 1 61 ? 0.430   6.195   -8.450  1.00 10.00 ? 470 TYR A CG   6  
ATOM 6749  C CD1  . TYR A 1 61 ? 1.381   5.777   -9.368  1.00 10.00 ? 470 TYR A CD1  6  
ATOM 6750  C CD2  . TYR A 1 61 ? 0.073   7.538   -8.439  1.00 10.00 ? 470 TYR A CD2  6  
ATOM 6751  C CE1  . TYR A 1 61 ? 1.961   6.665   -10.250 1.00 10.00 ? 470 TYR A CE1  6  
ATOM 6752  C CE2  . TYR A 1 61 ? 0.649   8.435   -9.318  1.00 10.00 ? 470 TYR A CE2  6  
ATOM 6753  C CZ   . TYR A 1 61 ? 1.593   7.993   -10.222 1.00 10.00 ? 470 TYR A CZ   6  
ATOM 6754  O OH   . TYR A 1 61 ? 2.169   8.883   -11.100 1.00 10.00 ? 470 TYR A OH   6  
ATOM 6755  H H    . TYR A 1 61 ? 0.533   2.737   -7.885  1.00 10.00 ? 470 TYR A H    6  
ATOM 6756  H HA   . TYR A 1 61 ? -2.021  4.100   -7.675  1.00 10.00 ? 470 TYR A HA   6  
ATOM 6757  H HB2  . TYR A 1 61 ? -0.827  5.776   -6.810  1.00 10.00 ? 470 TYR A HB2  6  
ATOM 6758  H HB3  . TYR A 1 61 ? 0.593   4.746   -6.923  1.00 10.00 ? 470 TYR A HB3  6  
ATOM 6759  H HD1  . TYR A 1 61 ? 1.666   4.738   -9.389  1.00 10.00 ? 470 TYR A HD1  6  
ATOM 6760  H HD2  . TYR A 1 61 ? -0.665  7.880   -7.729  1.00 10.00 ? 470 TYR A HD2  6  
ATOM 6761  H HE1  . TYR A 1 61 ? 2.698   6.316   -10.955 1.00 10.00 ? 470 TYR A HE1  6  
ATOM 6762  H HE2  . TYR A 1 61 ? 0.360   9.475   -9.295  1.00 10.00 ? 470 TYR A HE2  6  
ATOM 6763  H HH   . TYR A 1 61 ? 1.488   9.431   -11.494 1.00 10.00 ? 470 TYR A HH   6  
ATOM 6764  N N    . TYR A 1 62 ? -0.369  3.865   -10.479 1.00 10.00 ? 471 TYR A N    6  
ATOM 6765  C CA   . TYR A 1 62 ? -0.492  4.083   -11.914 1.00 10.00 ? 471 TYR A CA   6  
ATOM 6766  C C    . TYR A 1 62 ? -1.630  3.243   -12.496 1.00 10.00 ? 471 TYR A C    6  
ATOM 6767  O O    . TYR A 1 62 ? -2.020  3.424   -13.649 1.00 10.00 ? 471 TYR A O    6  
ATOM 6768  C CB   . TYR A 1 62 ? 0.838   3.802   -12.630 1.00 10.00 ? 471 TYR A CB   6  
ATOM 6769  C CG   . TYR A 1 62 ? 1.087   2.347   -12.960 1.00 10.00 ? 471 TYR A CG   6  
ATOM 6770  C CD1  . TYR A 1 62 ? 0.470   1.746   -14.051 1.00 10.00 ? 471 TYR A CD1  6  
ATOM 6771  C CD2  . TYR A 1 62 ? 1.945   1.575   -12.185 1.00 10.00 ? 471 TYR A CD2  6  
ATOM 6772  C CE1  . TYR A 1 62 ? 0.701   0.419   -14.361 1.00 10.00 ? 471 TYR A CE1  6  
ATOM 6773  C CE2  . TYR A 1 62 ? 2.180   0.248   -12.489 1.00 10.00 ? 471 TYR A CE2  6  
ATOM 6774  C CZ   . TYR A 1 62 ? 1.556   -0.325  -13.576 1.00 10.00 ? 471 TYR A CZ   6  
ATOM 6775  O OH   . TYR A 1 62 ? 1.788   -1.646  -13.881 1.00 10.00 ? 471 TYR A OH   6  
ATOM 6776  H H    . TYR A 1 62 ? 0.372   3.320   -10.131 1.00 10.00 ? 471 TYR A H    6  
ATOM 6777  H HA   . TYR A 1 62 ? -0.746  5.125   -12.055 1.00 10.00 ? 471 TYR A HA   6  
ATOM 6778  H HB2  . TYR A 1 62 ? 0.858   4.353   -13.558 1.00 10.00 ? 471 TYR A HB2  6  
ATOM 6779  H HB3  . TYR A 1 62 ? 1.649   4.142   -12.003 1.00 10.00 ? 471 TYR A HB3  6  
ATOM 6780  H HD1  . TYR A 1 62 ? -0.200  2.333   -14.664 1.00 10.00 ? 471 TYR A HD1  6  
ATOM 6781  H HD2  . TYR A 1 62 ? 2.433   2.029   -11.333 1.00 10.00 ? 471 TYR A HD2  6  
ATOM 6782  H HE1  . TYR A 1 62 ? 0.213   -0.028  -15.213 1.00 10.00 ? 471 TYR A HE1  6  
ATOM 6783  H HE2  . TYR A 1 62 ? 2.850   -0.336  -11.875 1.00 10.00 ? 471 TYR A HE2  6  
ATOM 6784  H HH   . TYR A 1 62 ? 2.694   -1.751  -14.181 1.00 10.00 ? 471 TYR A HH   6  
ATOM 6785  N N    . LEU A 1 63 ? -2.180  2.348   -11.677 1.00 10.00 ? 472 LEU A N    6  
ATOM 6786  C CA   . LEU A 1 63 ? -3.297  1.510   -12.098 1.00 10.00 ? 472 LEU A CA   6  
ATOM 6787  C C    . LEU A 1 63 ? -4.596  2.088   -11.547 1.00 10.00 ? 472 LEU A C    6  
ATOM 6788  O O    . LEU A 1 63 ? -5.653  1.981   -12.166 1.00 10.00 ? 472 LEU A O    6  
ATOM 6789  C CB   . LEU A 1 63 ? -3.122  0.059   -11.624 1.00 10.00 ? 472 LEU A CB   6  
ATOM 6790  C CG   . LEU A 1 63 ? -1.915  -0.204  -10.721 1.00 10.00 ? 472 LEU A CG   6  
ATOM 6791  C CD1  . LEU A 1 63 ? -1.945  -1.629  -10.191 1.00 10.00 ? 472 LEU A CD1  6  
ATOM 6792  C CD2  . LEU A 1 63 ? -0.622  0.063   -11.475 1.00 10.00 ? 472 LEU A CD2  6  
ATOM 6793  H H    . LEU A 1 63 ? -1.842  2.264   -10.761 1.00 10.00 ? 472 LEU A H    6  
ATOM 6794  H HA   . LEU A 1 63 ? -3.339  1.529   -13.177 1.00 10.00 ? 472 LEU A HA   6  
ATOM 6795  H HB2  . LEU A 1 63 ? -4.012  -0.235  -11.090 1.00 10.00 ? 472 LEU A HB2  6  
ATOM 6796  H HB3  . LEU A 1 63 ? -3.028  -0.570  -12.497 1.00 10.00 ? 472 LEU A HB3  6  
ATOM 6797  H HG   . LEU A 1 63 ? -1.955  0.468   -9.874  1.00 10.00 ? 472 LEU A HG   6  
ATOM 6798  H HD11 . LEU A 1 63 ? -1.132  -1.773  -9.495  1.00 10.00 ? 472 LEU A HD11 6  
ATOM 6799  H HD12 . LEU A 1 63 ? -1.841  -2.321  -11.014 1.00 10.00 ? 472 LEU A HD12 6  
ATOM 6800  H HD13 . LEU A 1 63 ? -2.884  -1.807  -9.689  1.00 10.00 ? 472 LEU A HD13 6  
ATOM 6801  H HD21 . LEU A 1 63 ? 0.008   0.715   -10.887 1.00 10.00 ? 472 LEU A HD21 6  
ATOM 6802  H HD22 . LEU A 1 63 ? -0.848  0.535   -12.418 1.00 10.00 ? 472 LEU A HD22 6  
ATOM 6803  H HD23 . LEU A 1 63 ? -0.108  -0.870  -11.652 1.00 10.00 ? 472 LEU A HD23 6  
ATOM 6804  N N    . THR A 1 64 ? -4.494  2.721   -10.379 1.00 10.00 ? 473 THR A N    6  
ATOM 6805  C CA   . THR A 1 64 ? -5.644  3.343   -9.737  1.00 10.00 ? 473 THR A CA   6  
ATOM 6806  C C    . THR A 1 64 ? -6.032  4.620   -10.474 1.00 10.00 ? 473 THR A C    6  
ATOM 6807  O O    . THR A 1 64 ? -7.198  5.016   -10.477 1.00 10.00 ? 473 THR A O    6  
ATOM 6808  C CB   . THR A 1 64 ? -5.328  3.661   -8.272  1.00 10.00 ? 473 THR A CB   6  
ATOM 6809  O OG1  . THR A 1 64 ? -4.241  4.564   -8.179  1.00 10.00 ? 473 THR A OG1  6  
ATOM 6810  C CG2  . THR A 1 64 ? -4.977  2.437   -7.450  1.00 10.00 ? 473 THR A CG2  6  
ATOM 6811  H H    . THR A 1 64 ? -3.618  2.781   -9.944  1.00 10.00 ? 473 THR A H    6  
ATOM 6812  H HA   . THR A 1 64 ? -6.469  2.650   -9.778  1.00 10.00 ? 473 THR A HA   6  
ATOM 6813  H HB   . THR A 1 64 ? -6.194  4.124   -7.821  1.00 10.00 ? 473 THR A HB   6  
ATOM 6814  H HG1  . THR A 1 64 ? -4.428  5.346   -8.703  1.00 10.00 ? 473 THR A HG1  6  
ATOM 6815  H HG21 . THR A 1 64 ? -5.845  2.116   -6.893  1.00 10.00 ? 473 THR A HG21 6  
ATOM 6816  H HG22 . THR A 1 64 ? -4.178  2.680   -6.762  1.00 10.00 ? 473 THR A HG22 6  
ATOM 6817  H HG23 . THR A 1 64 ? -4.657  1.643   -8.107  1.00 10.00 ? 473 THR A HG23 6  
ATOM 6818  N N    . LYS A 1 65 ? -5.046  5.262   -11.096 1.00 10.00 ? 474 LYS A N    6  
ATOM 6819  C CA   . LYS A 1 65 ? -5.285  6.496   -11.833 1.00 10.00 ? 474 LYS A CA   6  
ATOM 6820  C C    . LYS A 1 65 ? -5.520  6.218   -13.317 1.00 10.00 ? 474 LYS A C    6  
ATOM 6821  O O    . LYS A 1 65 ? -6.079  7.051   -14.031 1.00 10.00 ? 474 LYS A O    6  
ATOM 6822  C CB   . LYS A 1 65 ? -4.103  7.451   -11.661 1.00 10.00 ? 474 LYS A CB   6  
ATOM 6823  C CG   . LYS A 1 65 ? -2.819  6.955   -12.306 1.00 10.00 ? 474 LYS A CG   6  
ATOM 6824  C CD   . LYS A 1 65 ? -1.614  7.757   -11.841 1.00 10.00 ? 474 LYS A CD   6  
ATOM 6825  C CE   . LYS A 1 65 ? -1.173  8.763   -12.893 1.00 10.00 ? 474 LYS A CE   6  
ATOM 6826  N NZ   . LYS A 1 65 ? -2.327  9.518   -13.457 1.00 10.00 ? 474 LYS A NZ   6  
ATOM 6827  H H    . LYS A 1 65 ? -4.134  4.898   -11.057 1.00 10.00 ? 474 LYS A H    6  
ATOM 6828  H HA   . LYS A 1 65 ? -6.172  6.958   -11.425 1.00 10.00 ? 474 LYS A HA   6  
ATOM 6829  H HB2  . LYS A 1 65 ? -4.357  8.404   -12.100 1.00 10.00 ? 474 LYS A HB2  6  
ATOM 6830  H HB3  . LYS A 1 65 ? -3.919  7.589   -10.605 1.00 10.00 ? 474 LYS A HB3  6  
ATOM 6831  H HG2  . LYS A 1 65 ? -2.672  5.919   -12.042 1.00 10.00 ? 474 LYS A HG2  6  
ATOM 6832  H HG3  . LYS A 1 65 ? -2.909  7.046   -13.378 1.00 10.00 ? 474 LYS A HG3  6  
ATOM 6833  H HD2  . LYS A 1 65 ? -1.874  8.289   -10.937 1.00 10.00 ? 474 LYS A HD2  6  
ATOM 6834  H HD3  . LYS A 1 65 ? -0.798  7.079   -11.640 1.00 10.00 ? 474 LYS A HD3  6  
ATOM 6835  H HE2  . LYS A 1 65 ? -0.486  9.462   -12.440 1.00 10.00 ? 474 LYS A HE2  6  
ATOM 6836  H HE3  . LYS A 1 65 ? -0.674  8.234   -13.691 1.00 10.00 ? 474 LYS A HE3  6  
ATOM 6837  H HZ1  . LYS A 1 65 ? -3.007  9.746   -12.705 1.00 10.00 ? 474 LYS A HZ1  6  
ATOM 6838  H HZ2  . LYS A 1 65 ? -2.807  8.947   -14.183 1.00 10.00 ? 474 LYS A HZ2  6  
ATOM 6839  H HZ3  . LYS A 1 65 ? -1.996  10.403  -13.893 1.00 10.00 ? 474 LYS A HZ3  6  
ATOM 6840  N N    . LYS A 1 66 ? -5.094  5.047   -13.777 1.00 10.00 ? 475 LYS A N    6  
ATOM 6841  C CA   . LYS A 1 66 ? -5.264  4.670   -15.175 1.00 10.00 ? 475 LYS A CA   6  
ATOM 6842  C C    . LYS A 1 66 ? -6.737  4.704   -15.577 1.00 10.00 ? 475 LYS A C    6  
ATOM 6843  O O    . LYS A 1 66 ? -7.065  4.876   -16.751 1.00 10.00 ? 475 LYS A O    6  
ATOM 6844  C CB   . LYS A 1 66 ? -4.687  3.275   -15.423 1.00 10.00 ? 475 LYS A CB   6  
ATOM 6845  C CG   . LYS A 1 66 ? -3.954  3.146   -16.747 1.00 10.00 ? 475 LYS A CG   6  
ATOM 6846  C CD   . LYS A 1 66 ? -2.768  2.200   -16.638 1.00 10.00 ? 475 LYS A CD   6  
ATOM 6847  C CE   . LYS A 1 66 ? -3.143  0.789   -17.061 1.00 10.00 ? 475 LYS A CE   6  
ATOM 6848  N NZ   . LYS A 1 66 ? -3.480  -0.071  -15.893 1.00 10.00 ? 475 LYS A NZ   6  
ATOM 6849  H H    . LYS A 1 66 ? -4.655  4.420   -13.164 1.00 10.00 ? 475 LYS A H    6  
ATOM 6850  H HA   . LYS A 1 66 ? -4.724  5.384   -15.778 1.00 10.00 ? 475 LYS A HA   6  
ATOM 6851  H HB2  . LYS A 1 66 ? -3.996  3.038   -14.628 1.00 10.00 ? 475 LYS A HB2  6  
ATOM 6852  H HB3  . LYS A 1 66 ? -5.494  2.557   -15.412 1.00 10.00 ? 475 LYS A HB3  6  
ATOM 6853  H HG2  . LYS A 1 66 ? -4.637  2.766   -17.492 1.00 10.00 ? 475 LYS A HG2  6  
ATOM 6854  H HG3  . LYS A 1 66 ? -3.598  4.121   -17.047 1.00 10.00 ? 475 LYS A HG3  6  
ATOM 6855  H HD2  . LYS A 1 66 ? -1.975  2.558   -17.276 1.00 10.00 ? 475 LYS A HD2  6  
ATOM 6856  H HD3  . LYS A 1 66 ? -2.429  2.181   -15.613 1.00 10.00 ? 475 LYS A HD3  6  
ATOM 6857  H HE2  . LYS A 1 66 ? -3.997  0.838   -17.718 1.00 10.00 ? 475 LYS A HE2  6  
ATOM 6858  H HE3  . LYS A 1 66 ? -2.307  0.352   -17.590 1.00 10.00 ? 475 LYS A HE3  6  
ATOM 6859  H HZ1  . LYS A 1 66 ? -2.855  0.154   -15.092 1.00 10.00 ? 475 LYS A HZ1  6  
ATOM 6860  H HZ2  . LYS A 1 66 ? -3.359  -1.074  -16.140 1.00 10.00 ? 475 LYS A HZ2  6  
ATOM 6861  H HZ3  . LYS A 1 66 ? -4.466  0.088   -15.605 1.00 10.00 ? 475 LYS A HZ3  6  
ATOM 6862  N N    . ASN A 1 67 ? -7.622  4.531   -14.597 1.00 10.00 ? 476 ASN A N    6  
ATOM 6863  C CA   . ASN A 1 67 ? -9.058  4.535   -14.859 1.00 10.00 ? 476 ASN A CA   6  
ATOM 6864  C C    . ASN A 1 67 ? -9.782  5.599   -14.032 1.00 10.00 ? 476 ASN A C    6  
ATOM 6865  O O    . ASN A 1 67 ? -10.870 6.042   -14.400 1.00 10.00 ? 476 ASN A O    6  
ATOM 6866  C CB   . ASN A 1 67 ? -9.651  3.157   -14.560 1.00 10.00 ? 476 ASN A CB   6  
ATOM 6867  C CG   . ASN A 1 67 ? -10.740 2.772   -15.541 1.00 10.00 ? 476 ASN A CG   6  
ATOM 6868  O OD1  . ASN A 1 67 ? -11.476 3.625   -16.036 1.00 10.00 ? 476 ASN A OD1  6  
ATOM 6869  N ND2  . ASN A 1 67 ? -10.848 1.480   -15.828 1.00 10.00 ? 476 ASN A ND2  6  
ATOM 6870  H H    . ASN A 1 67 ? -7.302  4.392   -13.682 1.00 10.00 ? 476 ASN A H    6  
ATOM 6871  H HA   . ASN A 1 67 ? -9.202  4.755   -15.906 1.00 10.00 ? 476 ASN A HA   6  
ATOM 6872  H HB2  . ASN A 1 67 ? -8.868  2.416   -14.612 1.00 10.00 ? 476 ASN A HB2  6  
ATOM 6873  H HB3  . ASN A 1 67 ? -10.072 3.161   -13.565 1.00 10.00 ? 476 ASN A HB3  6  
ATOM 6874  H HD21 . ASN A 1 67 ? -10.228 0.857   -15.396 1.00 10.00 ? 476 ASN A HD21 6  
ATOM 6875  H HD22 . ASN A 1 67 ? -11.544 1.203   -16.461 1.00 10.00 ? 476 ASN A HD22 6  
ATOM 6876  N N    . GLU A 1 68 ? -9.183  6.004   -12.914 1.00 10.00 ? 477 GLU A N    6  
ATOM 6877  C CA   . GLU A 1 68 ? -9.792  7.010   -12.049 1.00 10.00 ? 477 GLU A CA   6  
ATOM 6878  C C    . GLU A 1 68 ? -9.214  8.394   -12.324 1.00 10.00 ? 477 GLU A C    6  
ATOM 6879  O O    . GLU A 1 68 ? -9.903  9.404   -12.180 1.00 10.00 ? 477 GLU A O    6  
ATOM 6880  C CB   . GLU A 1 68 ? -9.584  6.641   -10.579 1.00 10.00 ? 477 GLU A CB   6  
ATOM 6881  C CG   . GLU A 1 68 ? -10.434 7.459   -9.620  1.00 10.00 ? 477 GLU A CG   6  
ATOM 6882  C CD   . GLU A 1 68 ? -11.652 6.702   -9.131  1.00 10.00 ? 477 GLU A CD   6  
ATOM 6883  O OE1  . GLU A 1 68 ? -12.575 6.474   -9.941  1.00 10.00 ? 477 GLU A OE1  6  
ATOM 6884  O OE2  . GLU A 1 68 ? -11.684 6.335   -7.937  1.00 10.00 ? 477 GLU A OE2  6  
ATOM 6885  H H    . GLU A 1 68 ? -8.320  5.617   -12.663 1.00 10.00 ? 477 GLU A H    6  
ATOM 6886  H HA   . GLU A 1 68 ? -10.850 7.028   -12.258 1.00 10.00 ? 477 GLU A HA   6  
ATOM 6887  H HB2  . GLU A 1 68 ? -9.828  5.598   -10.443 1.00 10.00 ? 477 GLU A HB2  6  
ATOM 6888  H HB3  . GLU A 1 68 ? -8.545  6.794   -10.325 1.00 10.00 ? 477 GLU A HB3  6  
ATOM 6889  H HG2  . GLU A 1 68 ? -9.831  7.730   -8.767  1.00 10.00 ? 477 GLU A HG2  6  
ATOM 6890  H HG3  . GLU A 1 68 ? -10.763 8.354   -10.126 1.00 10.00 ? 477 GLU A HG3  6  
ATOM 6891  N N    . ASN A 1 69 ? -7.947  8.434   -12.718 1.00 10.00 ? 478 ASN A N    6  
ATOM 6892  C CA   . ASN A 1 69 ? -7.275  9.695   -13.011 1.00 10.00 ? 478 ASN A CA   6  
ATOM 6893  C C    . ASN A 1 69 ? -7.223  10.582  -11.772 1.00 10.00 ? 478 ASN A C    6  
ATOM 6894  O O    . ASN A 1 69 ? -8.068  11.459  -11.587 1.00 10.00 ? 478 ASN A O    6  
ATOM 6895  C CB   . ASN A 1 69 ? -7.990  10.427  -14.148 1.00 10.00 ? 478 ASN A CB   6  
ATOM 6896  C CG   . ASN A 1 69 ? -7.103  11.454  -14.823 1.00 10.00 ? 478 ASN A CG   6  
ATOM 6897  O OD1  . ASN A 1 69 ? -7.219  12.653  -14.570 1.00 10.00 ? 478 ASN A OD1  6  
ATOM 6898  N ND2  . ASN A 1 69 ? -6.210  10.986  -15.688 1.00 10.00 ? 478 ASN A ND2  6  
ATOM 6899  H H    . ASN A 1 69 ? -7.452  7.595   -12.812 1.00 10.00 ? 478 ASN A H    6  
ATOM 6900  H HA   . ASN A 1 69 ? -6.265  9.468   -13.319 1.00 10.00 ? 478 ASN A HA   6  
ATOM 6901  H HB2  . ASN A 1 69 ? -8.305  9.707   -14.889 1.00 10.00 ? 478 ASN A HB2  6  
ATOM 6902  H HB3  . ASN A 1 69 ? -8.859  10.932  -13.752 1.00 10.00 ? 478 ASN A HB3  6  
ATOM 6903  H HD21 . ASN A 1 69 ? -6.174  10.019  -15.839 1.00 10.00 ? 478 ASN A HD21 6  
ATOM 6904  H HD22 . ASN A 1 69 ? -5.623  11.628  -16.139 1.00 10.00 ? 478 ASN A HD22 6  
ATOM 6905  N N    . TYR A 1 70 ? -6.226  10.349  -10.924 1.00 10.00 ? 479 TYR A N    6  
ATOM 6906  C CA   . TYR A 1 70 ? -6.064  11.128  -9.703  1.00 10.00 ? 479 TYR A CA   6  
ATOM 6907  C C    . TYR A 1 70 ? -4.611  11.116  -9.237  1.00 10.00 ? 479 TYR A C    6  
ATOM 6908  O O    . TYR A 1 70 ? -4.051  10.059  -8.943  1.00 10.00 ? 479 TYR A O    6  
ATOM 6909  C CB   . TYR A 1 70 ? -6.981  10.585  -8.600  1.00 10.00 ? 479 TYR A CB   6  
ATOM 6910  C CG   . TYR A 1 70 ? -6.489  9.301   -7.966  1.00 10.00 ? 479 TYR A CG   6  
ATOM 6911  C CD1  . TYR A 1 70 ? -6.703  8.072   -8.579  1.00 10.00 ? 479 TYR A CD1  6  
ATOM 6912  C CD2  . TYR A 1 70 ? -5.811  9.321   -6.755  1.00 10.00 ? 479 TYR A CD2  6  
ATOM 6913  C CE1  . TYR A 1 70 ? -6.255  6.899   -8.000  1.00 10.00 ? 479 TYR A CE1  6  
ATOM 6914  C CE2  . TYR A 1 70 ? -5.359  8.153   -6.170  1.00 10.00 ? 479 TYR A CE2  6  
ATOM 6915  C CZ   . TYR A 1 70 ? -5.583  6.946   -6.796  1.00 10.00 ? 479 TYR A CZ   6  
ATOM 6916  O OH   . TYR A 1 70 ? -5.137  5.781   -6.216  1.00 10.00 ? 479 TYR A OH   6  
ATOM 6917  H H    . TYR A 1 70 ? -5.583  9.638   -11.125 1.00 10.00 ? 479 TYR A H    6  
ATOM 6918  H HA   . TYR A 1 70 ? -6.347  12.147  -9.923  1.00 10.00 ? 479 TYR A HA   6  
ATOM 6919  H HB2  . TYR A 1 70 ? -7.068  11.326  -7.820  1.00 10.00 ? 479 TYR A HB2  6  
ATOM 6920  H HB3  . TYR A 1 70 ? -7.959  10.396  -9.019  1.00 10.00 ? 479 TYR A HB3  6  
ATOM 6921  H HD1  . TYR A 1 70 ? -7.227  8.040   -9.522  1.00 10.00 ? 479 TYR A HD1  6  
ATOM 6922  H HD2  . TYR A 1 70 ? -5.636  10.268  -6.267  1.00 10.00 ? 479 TYR A HD2  6  
ATOM 6923  H HE1  . TYR A 1 70 ? -6.431  5.953   -8.491  1.00 10.00 ? 479 TYR A HE1  6  
ATOM 6924  H HE2  . TYR A 1 70 ? -4.834  8.190   -5.228  1.00 10.00 ? 479 TYR A HE2  6  
ATOM 6925  H HH   . TYR A 1 70 ? -4.239  5.602   -6.506  1.00 10.00 ? 479 TYR A HH   6  
ATOM 6926  N N    . LYS A 1 71 ? -4.006  12.296  -9.172  1.00 10.00 ? 480 LYS A N    6  
ATOM 6927  C CA   . LYS A 1 71 ? -2.617  12.420  -8.741  1.00 10.00 ? 480 LYS A CA   6  
ATOM 6928  C C    . LYS A 1 71 ? -2.461  13.548  -7.727  1.00 10.00 ? 480 LYS A C    6  
ATOM 6929  O O    . LYS A 1 71 ? -3.457  13.874  -7.048  1.00 10.00 ? 480 LYS A O    6  
ATOM 6930  C CB   . LYS A 1 71 ? -1.708  12.671  -9.945  1.00 10.00 ? 480 LYS A CB   6  
ATOM 6931  C CG   . LYS A 1 71 ? -2.025  11.791  -11.144 1.00 10.00 ? 480 LYS A CG   6  
ATOM 6932  C CD   . LYS A 1 71 ? -3.051  12.441  -12.057 1.00 10.00 ? 480 LYS A CD   6  
ATOM 6933  C CE   . LYS A 1 71 ? -2.440  13.579  -12.859 1.00 10.00 ? 480 LYS A CE   6  
ATOM 6934  N NZ   . LYS A 1 71 ? -3.481  14.433  -13.494 1.00 10.00 ? 480 LYS A NZ   6  
ATOM 6935  O OXT  . LYS A 1 71 ? -1.344  14.097  -7.621  1.00 10.00 ? 480 LYS A OXT  6  
ATOM 6936  H H    . LYS A 1 71 ? -4.504  13.102  -9.420  1.00 10.00 ? 480 LYS A H    6  
ATOM 6937  H HA   . LYS A 1 71 ? -2.332  11.489  -8.274  1.00 10.00 ? 480 LYS A HA   6  
ATOM 6938  H HB2  . LYS A 1 71 ? -1.808  13.703  -10.249 1.00 10.00 ? 480 LYS A HB2  6  
ATOM 6939  H HB3  . LYS A 1 71 ? -0.685  12.490  -9.653  1.00 10.00 ? 480 LYS A HB3  6  
ATOM 6940  H HG2  . LYS A 1 71 ? -1.117  11.619  -11.702 1.00 10.00 ? 480 LYS A HG2  6  
ATOM 6941  H HG3  . LYS A 1 71 ? -2.416  10.848  -10.790 1.00 10.00 ? 480 LYS A HG3  6  
ATOM 6942  H HD2  . LYS A 1 71 ? -3.433  11.698  -12.741 1.00 10.00 ? 480 LYS A HD2  6  
ATOM 6943  H HD3  . LYS A 1 71 ? -3.859  12.830  -11.455 1.00 10.00 ? 480 LYS A HD3  6  
ATOM 6944  H HE2  . LYS A 1 71 ? -1.842  14.188  -12.198 1.00 10.00 ? 480 LYS A HE2  6  
ATOM 6945  H HE3  . LYS A 1 71 ? -1.809  13.161  -13.630 1.00 10.00 ? 480 LYS A HE3  6  
ATOM 6946  H HZ1  . LYS A 1 71 ? -3.980  14.988  -12.769 1.00 10.00 ? 480 LYS A HZ1  6  
ATOM 6947  H HZ2  . LYS A 1 71 ? -4.172  13.841  -13.997 1.00 10.00 ? 480 LYS A HZ2  6  
ATOM 6948  H HZ3  . LYS A 1 71 ? -3.042  15.086  -14.174 1.00 10.00 ? 480 LYS A HZ3  6  
ATOM 6949  N N    . ASN A 1 4  ? -1.466  0.905   25.934  1.00 10.00 ? 413 ASN A N    7  
ATOM 6950  C CA   . ASN A 1 4  ? -0.019  0.864   25.747  1.00 10.00 ? 413 ASN A CA   7  
ATOM 6951  C C    . ASN A 1 4  ? 0.580   2.263   25.835  1.00 10.00 ? 413 ASN A C    7  
ATOM 6952  O O    . ASN A 1 4  ? -0.103  3.221   26.197  1.00 10.00 ? 413 ASN A O    7  
ATOM 6953  C CB   . ASN A 1 4  ? 0.323   0.232   24.397  1.00 10.00 ? 413 ASN A CB   7  
ATOM 6954  C CG   . ASN A 1 4  ? -0.392  -1.086  24.177  1.00 10.00 ? 413 ASN A CG   7  
ATOM 6955  O OD1  . ASN A 1 4  ? -1.205  -1.220  23.263  1.00 10.00 ? 413 ASN A OD1  7  
ATOM 6956  N ND2  . ASN A 1 4  ? -0.092  -2.070  25.017  1.00 10.00 ? 413 ASN A ND2  7  
ATOM 6957  H H    . ASN A 1 4  ? -1.865  0.414   26.682  1.00 10.00 ? 413 ASN A H    7  
ATOM 6958  H HA   . ASN A 1 4  ? 0.399   0.256   26.536  1.00 10.00 ? 413 ASN A HA   7  
ATOM 6959  H HB2  . ASN A 1 4  ? 0.040   0.911   23.607  1.00 10.00 ? 413 ASN A HB2  7  
ATOM 6960  H HB3  . ASN A 1 4  ? 1.388   0.056   24.350  1.00 10.00 ? 413 ASN A HB3  7  
ATOM 6961  H HD21 . ASN A 1 4  ? 0.565   -1.892  25.723  1.00 10.00 ? 413 ASN A HD21 7  
ATOM 6962  H HD22 . ASN A 1 4  ? -0.540  -2.933  24.897  1.00 10.00 ? 413 ASN A HD22 7  
ATOM 6963  N N    . GLY A 1 5  ? 1.861   2.374   25.500  1.00 10.00 ? 414 GLY A N    7  
ATOM 6964  C CA   . GLY A 1 5  ? 2.531   3.660   25.547  1.00 10.00 ? 414 GLY A CA   7  
ATOM 6965  C C    . GLY A 1 5  ? 2.715   4.270   24.170  1.00 10.00 ? 414 GLY A C    7  
ATOM 6966  O O    . GLY A 1 5  ? 3.653   5.033   23.942  1.00 10.00 ? 414 GLY A O    7  
ATOM 6967  H H    . GLY A 1 5  ? 2.356   1.577   25.218  1.00 10.00 ? 414 GLY A H    7  
ATOM 6968  H HA2  . GLY A 1 5  ? 1.947   4.337   26.153  1.00 10.00 ? 414 GLY A HA2  7  
ATOM 6969  H HA3  . GLY A 1 5  ? 3.501   3.532   26.004  1.00 10.00 ? 414 GLY A HA3  7  
ATOM 6970  N N    . LEU A 1 6  ? 1.817   3.932   23.251  1.00 10.00 ? 415 LEU A N    7  
ATOM 6971  C CA   . LEU A 1 6  ? 1.883   4.451   21.890  1.00 10.00 ? 415 LEU A CA   7  
ATOM 6972  C C    . LEU A 1 6  ? 3.191   4.048   21.218  1.00 10.00 ? 415 LEU A C    7  
ATOM 6973  O O    . LEU A 1 6  ? 4.225   4.686   21.416  1.00 10.00 ? 415 LEU A O    7  
ATOM 6974  C CB   . LEU A 1 6  ? 1.748   5.975   21.895  1.00 10.00 ? 415 LEU A CB   7  
ATOM 6975  C CG   . LEU A 1 6  ? 0.998   6.563   20.699  1.00 10.00 ? 415 LEU A CG   7  
ATOM 6976  C CD1  . LEU A 1 6  ? -0.500  6.575   20.961  1.00 10.00 ? 415 LEU A CD1  7  
ATOM 6977  C CD2  . LEU A 1 6  ? 1.500   7.966   20.393  1.00 10.00 ? 415 LEU A CD2  7  
ATOM 6978  H H    . LEU A 1 6  ? 1.091   3.320   23.493  1.00 10.00 ? 415 LEU A H    7  
ATOM 6979  H HA   . LEU A 1 6  ? 1.062   4.028   21.332  1.00 10.00 ? 415 LEU A HA   7  
ATOM 6980  H HB2  . LEU A 1 6  ? 1.228   6.265   22.798  1.00 10.00 ? 415 LEU A HB2  7  
ATOM 6981  H HB3  . LEU A 1 6  ? 2.738   6.404   21.916  1.00 10.00 ? 415 LEU A HB3  7  
ATOM 6982  H HG   . LEU A 1 6  ? 1.179   5.945   19.831  1.00 10.00 ? 415 LEU A HG   7  
ATOM 6983  H HD11 . LEU A 1 6  ? -1.028  6.715   20.030  1.00 10.00 ? 415 LEU A HD11 7  
ATOM 6984  H HD12 . LEU A 1 6  ? -0.741  7.384   21.636  1.00 10.00 ? 415 LEU A HD12 7  
ATOM 6985  H HD13 . LEU A 1 6  ? -0.796  5.637   21.406  1.00 10.00 ? 415 LEU A HD13 7  
ATOM 6986  H HD21 . LEU A 1 6  ? 2.570   7.943   20.252  1.00 10.00 ? 415 LEU A HD21 7  
ATOM 6987  H HD22 . LEU A 1 6  ? 1.260   8.622   21.218  1.00 10.00 ? 415 LEU A HD22 7  
ATOM 6988  H HD23 . LEU A 1 6  ? 1.025   8.330   19.495  1.00 10.00 ? 415 LEU A HD23 7  
ATOM 6989  N N    . MET A 1 7  ? 3.139   2.985   20.422  1.00 10.00 ? 416 MET A N    7  
ATOM 6990  C CA   . MET A 1 7  ? 4.321   2.497   19.719  1.00 10.00 ? 416 MET A CA   7  
ATOM 6991  C C    . MET A 1 7  ? 3.936   1.836   18.400  1.00 10.00 ? 416 MET A C    7  
ATOM 6992  O O    . MET A 1 7  ? 2.868   1.235   18.284  1.00 10.00 ? 416 MET A O    7  
ATOM 6993  C CB   . MET A 1 7  ? 5.087   1.505   20.596  1.00 10.00 ? 416 MET A CB   7  
ATOM 6994  C CG   . MET A 1 7  ? 6.447   1.122   20.035  1.00 10.00 ? 416 MET A CG   7  
ATOM 6995  S SD   . MET A 1 7  ? 7.766   2.205   20.617  1.00 10.00 ? 416 MET A SD   7  
ATOM 6996  C CE   . MET A 1 7  ? 9.172   1.098   20.538  1.00 10.00 ? 416 MET A CE   7  
ATOM 6997  H H    . MET A 1 7  ? 2.286   2.518   20.304  1.00 10.00 ? 416 MET A H    7  
ATOM 6998  H HA   . MET A 1 7  ? 4.956   3.345   19.511  1.00 10.00 ? 416 MET A HA   7  
ATOM 6999  H HB2  . MET A 1 7  ? 5.234   1.943   21.572  1.00 10.00 ? 416 MET A HB2  7  
ATOM 7000  H HB3  . MET A 1 7  ? 4.498   0.605   20.700  1.00 10.00 ? 416 MET A HB3  7  
ATOM 7001  H HG2  . MET A 1 7  ? 6.673   0.110   20.335  1.00 10.00 ? 416 MET A HG2  7  
ATOM 7002  H HG3  . MET A 1 7  ? 6.405   1.176   18.958  1.00 10.00 ? 416 MET A HG3  7  
ATOM 7003  H HE1  . MET A 1 7  ? 8.999   0.349   19.779  1.00 10.00 ? 416 MET A HE1  7  
ATOM 7004  H HE2  . MET A 1 7  ? 9.305   0.615   21.495  1.00 10.00 ? 416 MET A HE2  7  
ATOM 7005  H HE3  . MET A 1 7  ? 10.061  1.660   20.292  1.00 10.00 ? 416 MET A HE3  7  
ATOM 7006  N N    . ALA A 1 8  ? 4.812   1.952   17.408  1.00 10.00 ? 417 ALA A N    7  
ATOM 7007  C CA   . ALA A 1 8  ? 4.564   1.366   16.097  1.00 10.00 ? 417 ALA A CA   7  
ATOM 7008  C C    . ALA A 1 8  ? 4.409   -0.148  16.193  1.00 10.00 ? 417 ALA A C    7  
ATOM 7009  O O    . ALA A 1 8  ? 4.763   -0.755  17.203  1.00 10.00 ? 417 ALA A O    7  
ATOM 7010  C CB   . ALA A 1 8  ? 5.688   1.724   15.137  1.00 10.00 ? 417 ALA A CB   7  
ATOM 7011  H H    . ALA A 1 8  ? 5.645   2.444   17.562  1.00 10.00 ? 417 ALA A H    7  
ATOM 7012  H HA   . ALA A 1 8  ? 3.646   1.788   15.711  1.00 10.00 ? 417 ALA A HA   7  
ATOM 7013  H HB1  . ALA A 1 8  ? 6.534   1.076   15.315  1.00 10.00 ? 417 ALA A HB1  7  
ATOM 7014  H HB2  . ALA A 1 8  ? 5.982   2.751   15.295  1.00 10.00 ? 417 ALA A HB2  7  
ATOM 7015  H HB3  . ALA A 1 8  ? 5.347   1.599   14.120  1.00 10.00 ? 417 ALA A HB3  7  
ATOM 7016  N N    . ASP A 1 9  ? 3.879   -0.752  15.134  1.00 10.00 ? 418 ASP A N    7  
ATOM 7017  C CA   . ASP A 1 9  ? 3.678   -2.196  15.099  1.00 10.00 ? 418 ASP A CA   7  
ATOM 7018  C C    . ASP A 1 9  ? 3.131   -2.638  13.744  1.00 10.00 ? 418 ASP A C    7  
ATOM 7019  O O    . ASP A 1 9  ? 1.918   -2.722  13.551  1.00 10.00 ? 418 ASP A O    7  
ATOM 7020  C CB   . ASP A 1 9  ? 2.720   -2.626  16.212  1.00 10.00 ? 418 ASP A CB   7  
ATOM 7021  C CG   . ASP A 1 9  ? 2.867   -4.092  16.567  1.00 10.00 ? 418 ASP A CG   7  
ATOM 7022  O OD1  . ASP A 1 9  ? 4.013   -4.589  16.576  1.00 10.00 ? 418 ASP A OD1  7  
ATOM 7023  O OD2  . ASP A 1 9  ? 1.836   -4.743  16.839  1.00 10.00 ? 418 ASP A OD2  7  
ATOM 7024  H H    . ASP A 1 9  ? 3.616   -0.213  14.358  1.00 10.00 ? 418 ASP A H    7  
ATOM 7025  H HA   . ASP A 1 9  ? 4.636   -2.668  15.260  1.00 10.00 ? 418 ASP A HA   7  
ATOM 7026  H HB2  . ASP A 1 9  ? 2.919   -2.039  17.097  1.00 10.00 ? 418 ASP A HB2  7  
ATOM 7027  H HB3  . ASP A 1 9  ? 1.704   -2.451  15.891  1.00 10.00 ? 418 ASP A HB3  7  
ATOM 7028  N N    . PRO A 1 10 ? 4.025   -2.927  12.781  1.00 10.00 ? 419 PRO A N    7  
ATOM 7029  C CA   . PRO A 1 10 ? 3.625   -3.362  11.439  1.00 10.00 ? 419 PRO A CA   7  
ATOM 7030  C C    . PRO A 1 10 ? 2.646   -4.531  11.476  1.00 10.00 ? 419 PRO A C    7  
ATOM 7031  O O    . PRO A 1 10 ? 2.939   -5.579  12.051  1.00 10.00 ? 419 PRO A O    7  
ATOM 7032  C CB   . PRO A 1 10 ? 4.945   -3.790  10.795  1.00 10.00 ? 419 PRO A CB   7  
ATOM 7033  C CG   . PRO A 1 10 ? 5.989   -3.008  11.515  1.00 10.00 ? 419 PRO A CG   7  
ATOM 7034  C CD   . PRO A 1 10 ? 5.491   -2.854  12.926  1.00 10.00 ? 419 PRO A CD   7  
ATOM 7035  H HA   . PRO A 1 10 ? 3.192   -2.550  10.873  1.00 10.00 ? 419 PRO A HA   7  
ATOM 7036  H HB2  . PRO A 1 10 ? 5.086   -4.854  10.928  1.00 10.00 ? 419 PRO A HB2  7  
ATOM 7037  H HB3  . PRO A 1 10 ? 4.930   -3.552  9.742   1.00 10.00 ? 419 PRO A HB3  7  
ATOM 7038  H HG2  . PRO A 1 10 ? 6.924   -3.547  11.504  1.00 10.00 ? 419 PRO A HG2  7  
ATOM 7039  H HG3  . PRO A 1 10 ? 6.106   -2.039  11.053  1.00 10.00 ? 419 PRO A HG3  7  
ATOM 7040  H HD2  . PRO A 1 10 ? 5.858   -3.660  13.546  1.00 10.00 ? 419 PRO A HD2  7  
ATOM 7041  H HD3  . PRO A 1 10 ? 5.790   -1.898  13.330  1.00 10.00 ? 419 PRO A HD3  7  
ATOM 7042  N N    . MET A 1 11 ? 1.485   -4.343  10.860  1.00 10.00 ? 420 MET A N    7  
ATOM 7043  C CA   . MET A 1 11 ? 0.462   -5.380  10.821  1.00 10.00 ? 420 MET A CA   7  
ATOM 7044  C C    . MET A 1 11 ? -0.003  -5.625  9.397   1.00 10.00 ? 420 MET A C    7  
ATOM 7045  O O    . MET A 1 11 ? 0.485   -6.533  8.734   1.00 10.00 ? 420 MET A O    7  
ATOM 7046  C CB   . MET A 1 11 ? -0.725  -4.985  11.700  1.00 10.00 ? 420 MET A CB   7  
ATOM 7047  C CG   . MET A 1 11 ? -0.611  -5.474  13.135  1.00 10.00 ? 420 MET A CG   7  
ATOM 7048  S SD   . MET A 1 11 ? -2.100  -5.153  14.099  1.00 10.00 ? 420 MET A SD   7  
ATOM 7049  C CE   . MET A 1 11 ? -3.220  -6.367  13.408  1.00 10.00 ? 420 MET A CE   7  
ATOM 7050  H H    . MET A 1 11 ? 1.309   -3.485  10.419  1.00 10.00 ? 420 MET A H    7  
ATOM 7051  H HA   . MET A 1 11 ? 0.894   -6.296  11.198  1.00 10.00 ? 420 MET A HA   7  
ATOM 7052  H HB2  . MET A 1 11 ? -0.805  -3.908  11.712  1.00 10.00 ? 420 MET A HB2  7  
ATOM 7053  H HB3  . MET A 1 11 ? -1.627  -5.398  11.271  1.00 10.00 ? 420 MET A HB3  7  
ATOM 7054  H HG2  . MET A 1 11 ? -0.429  -6.540  13.124  1.00 10.00 ? 420 MET A HG2  7  
ATOM 7055  H HG3  . MET A 1 11 ? 0.222   -4.974  13.606  1.00 10.00 ? 420 MET A HG3  7  
ATOM 7056  H HE1  . MET A 1 11 ? -3.120  -6.379  12.333  1.00 10.00 ? 420 MET A HE1  7  
ATOM 7057  H HE2  . MET A 1 11 ? -4.235  -6.112  13.673  1.00 10.00 ? 420 MET A HE2  7  
ATOM 7058  H HE3  . MET A 1 11 ? -2.980  -7.344  13.803  1.00 10.00 ? 420 MET A HE3  7  
ATOM 7059  N N    . LYS A 1 12 ? -0.944  -4.816  8.926   1.00 10.00 ? 421 LYS A N    7  
ATOM 7060  C CA   . LYS A 1 12 ? -1.461  -4.972  7.572   1.00 10.00 ? 421 LYS A CA   7  
ATOM 7061  C C    . LYS A 1 12 ? -0.333  -5.111  6.570   1.00 10.00 ? 421 LYS A C    7  
ATOM 7062  O O    . LYS A 1 12 ? 0.291   -4.127  6.177   1.00 10.00 ? 421 LYS A O    7  
ATOM 7063  C CB   . LYS A 1 12 ? -2.356  -3.810  7.178   1.00 10.00 ? 421 LYS A CB   7  
ATOM 7064  C CG   . LYS A 1 12 ? -3.218  -4.129  5.973   1.00 10.00 ? 421 LYS A CG   7  
ATOM 7065  C CD   . LYS A 1 12 ? -2.386  -4.409  4.732   1.00 10.00 ? 421 LYS A CD   7  
ATOM 7066  C CE   . LYS A 1 12 ? -3.142  -4.059  3.461   1.00 10.00 ? 421 LYS A CE   7  
ATOM 7067  N NZ   . LYS A 1 12 ? -3.393  -5.261  2.617   1.00 10.00 ? 421 LYS A NZ   7  
ATOM 7068  H H    . LYS A 1 12 ? -1.296  -4.104  9.500   1.00 10.00 ? 421 LYS A H    7  
ATOM 7069  H HA   . LYS A 1 12 ? -2.046  -5.875  7.548   1.00 10.00 ? 421 LYS A HA   7  
ATOM 7070  H HB2  . LYS A 1 12 ? -3.003  -3.567  8.008   1.00 10.00 ? 421 LYS A HB2  7  
ATOM 7071  H HB3  . LYS A 1 12 ? -1.745  -2.957  6.944   1.00 10.00 ? 421 LYS A HB3  7  
ATOM 7072  H HG2  . LYS A 1 12 ? -3.805  -5.008  6.193   1.00 10.00 ? 421 LYS A HG2  7  
ATOM 7073  H HG3  . LYS A 1 12 ? -3.863  -3.289  5.781   1.00 10.00 ? 421 LYS A HG3  7  
ATOM 7074  H HD2  . LYS A 1 12 ? -1.481  -3.824  4.775   1.00 10.00 ? 421 LYS A HD2  7  
ATOM 7075  H HD3  . LYS A 1 12 ? -2.134  -5.459  4.712   1.00 10.00 ? 421 LYS A HD3  7  
ATOM 7076  H HE2  . LYS A 1 12 ? -4.088  -3.616  3.729   1.00 10.00 ? 421 LYS A HE2  7  
ATOM 7077  H HE3  . LYS A 1 12 ? -2.558  -3.348  2.895   1.00 10.00 ? 421 LYS A HE3  7  
ATOM 7078  H HZ1  . LYS A 1 12 ? -2.555  -5.473  2.038   1.00 10.00 ? 421 LYS A HZ1  7  
ATOM 7079  H HZ2  . LYS A 1 12 ? -4.202  -5.093  1.987   1.00 10.00 ? 421 LYS A HZ2  7  
ATOM 7080  H HZ3  . LYS A 1 12 ? -3.602  -6.082  3.220   1.00 10.00 ? 421 LYS A HZ3  7  
ATOM 7081  N N    . VAL A 1 13 ? -0.084  -6.346  6.162   1.00 10.00 ? 422 VAL A N    7  
ATOM 7082  C CA   . VAL A 1 13 ? 0.964   -6.641  5.209   1.00 10.00 ? 422 VAL A CA   7  
ATOM 7083  C C    . VAL A 1 13 ? 1.056   -8.146  4.984   1.00 10.00 ? 422 VAL A C    7  
ATOM 7084  O O    . VAL A 1 13 ? 1.142   -8.621  3.853   1.00 10.00 ? 422 VAL A O    7  
ATOM 7085  C CB   . VAL A 1 13 ? 2.309   -6.075  5.695   1.00 10.00 ? 422 VAL A CB   7  
ATOM 7086  C CG1  . VAL A 1 13 ? 2.934   -6.962  6.764   1.00 10.00 ? 422 VAL A CG1  7  
ATOM 7087  C CG2  . VAL A 1 13 ? 3.263   -5.876  4.529   1.00 10.00 ? 422 VAL A CG2  7  
ATOM 7088  H H    . VAL A 1 13 ? -0.626  -7.079  6.516   1.00 10.00 ? 422 VAL A H    7  
ATOM 7089  H HA   . VAL A 1 13 ? 0.702   -6.163  4.283   1.00 10.00 ? 422 VAL A HA   7  
ATOM 7090  H HB   . VAL A 1 13 ? 2.107   -5.109  6.139   1.00 10.00 ? 422 VAL A HB   7  
ATOM 7091  H HG11 . VAL A 1 13 ? 3.172   -7.925  6.339   1.00 10.00 ? 422 VAL A HG11 7  
ATOM 7092  H HG12 . VAL A 1 13 ? 2.236   -7.091  7.578   1.00 10.00 ? 422 VAL A HG12 7  
ATOM 7093  H HG13 . VAL A 1 13 ? 3.836   -6.498  7.135   1.00 10.00 ? 422 VAL A HG13 7  
ATOM 7094  H HG21 . VAL A 1 13 ? 4.268   -5.758  4.905   1.00 10.00 ? 422 VAL A HG21 7  
ATOM 7095  H HG22 . VAL A 1 13 ? 2.979   -4.994  3.976   1.00 10.00 ? 422 VAL A HG22 7  
ATOM 7096  H HG23 . VAL A 1 13 ? 3.221   -6.737  3.879   1.00 10.00 ? 422 VAL A HG23 7  
ATOM 7097  N N    . TYR A 1 14 ? 1.002   -8.877  6.089   1.00 10.00 ? 423 TYR A N    7  
ATOM 7098  C CA   . TYR A 1 14 ? 1.030   -10.338 6.089   1.00 10.00 ? 423 TYR A CA   7  
ATOM 7099  C C    . TYR A 1 14 ? 0.227   -10.892 4.915   1.00 10.00 ? 423 TYR A C    7  
ATOM 7100  O O    . TYR A 1 14 ? 0.587   -11.912 4.326   1.00 10.00 ? 423 TYR A O    7  
ATOM 7101  C CB   . TYR A 1 14 ? 0.440   -10.844 7.413   1.00 10.00 ? 423 TYR A CB   7  
ATOM 7102  C CG   . TYR A 1 14 ? -0.861  -10.161 7.768   1.00 10.00 ? 423 TYR A CG   7  
ATOM 7103  C CD1  . TYR A 1 14 ? -0.868  -8.820  8.097   1.00 10.00 ? 423 TYR A CD1  7  
ATOM 7104  C CD2  . TYR A 1 14 ? -2.074  -10.835 7.748   1.00 10.00 ? 423 TYR A CD2  7  
ATOM 7105  C CE1  . TYR A 1 14 ? -2.023  -8.156  8.396   1.00 10.00 ? 423 TYR A CE1  7  
ATOM 7106  C CE2  . TYR A 1 14 ? -3.254  -10.178 8.054   1.00 10.00 ? 423 TYR A CE2  7  
ATOM 7107  C CZ   . TYR A 1 14 ? -3.223  -8.834  8.378   1.00 10.00 ? 423 TYR A CZ   7  
ATOM 7108  O OH   . TYR A 1 14 ? -4.391  -8.173  8.678   1.00 10.00 ? 423 TYR A OH   7  
ATOM 7109  H H    . TYR A 1 14 ? 0.921   -8.415  6.940   1.00 10.00 ? 423 TYR A H    7  
ATOM 7110  H HA   . TYR A 1 14 ? 2.054   -10.662 6.002   1.00 10.00 ? 423 TYR A HA   7  
ATOM 7111  H HB2  . TYR A 1 14 ? 0.259   -11.906 7.345   1.00 10.00 ? 423 TYR A HB2  7  
ATOM 7112  H HB3  . TYR A 1 14 ? 1.144   -10.646 8.214   1.00 10.00 ? 423 TYR A HB3  7  
ATOM 7113  H HD1  . TYR A 1 14 ? 0.063   -8.287  8.118   1.00 10.00 ? 423 TYR A HD1  7  
ATOM 7114  H HD2  . TYR A 1 14 ? -2.092  -11.884 7.495   1.00 10.00 ? 423 TYR A HD2  7  
ATOM 7115  H HE1  . TYR A 1 14 ? -1.977  -7.105  8.635   1.00 10.00 ? 423 TYR A HE1  7  
ATOM 7116  H HE2  . TYR A 1 14 ? -4.191  -10.713 8.038   1.00 10.00 ? 423 TYR A HE2  7  
ATOM 7117  H HH   . TYR A 1 14 ? -4.950  -8.737  9.217   1.00 10.00 ? 423 TYR A HH   7  
ATOM 7118  N N    . LYS A 1 15 ? -0.857  -10.198 4.570   1.00 10.00 ? 424 LYS A N    7  
ATOM 7119  C CA   . LYS A 1 15 ? -1.705  -10.607 3.455   1.00 10.00 ? 424 LYS A CA   7  
ATOM 7120  C C    . LYS A 1 15 ? -1.376  -9.785  2.212   1.00 10.00 ? 424 LYS A C    7  
ATOM 7121  O O    . LYS A 1 15 ? -1.534  -10.247 1.083   1.00 10.00 ? 424 LYS A O    7  
ATOM 7122  C CB   . LYS A 1 15 ? -3.181  -10.442 3.818   1.00 10.00 ? 424 LYS A CB   7  
ATOM 7123  C CG   . LYS A 1 15 ? -3.664  -11.429 4.867   1.00 10.00 ? 424 LYS A CG   7  
ATOM 7124  C CD   . LYS A 1 15 ? -4.324  -12.641 4.229   1.00 10.00 ? 424 LYS A CD   7  
ATOM 7125  C CE   . LYS A 1 15 ? -3.362  -13.814 4.136   1.00 10.00 ? 424 LYS A CE   7  
ATOM 7126  N NZ   . LYS A 1 15 ? -4.055  -15.118 4.326   1.00 10.00 ? 424 LYS A NZ   7  
ATOM 7127  H H    . LYS A 1 15 ? -1.088  -9.382  5.071   1.00 10.00 ? 424 LYS A H    7  
ATOM 7128  H HA   . LYS A 1 15 ? -1.504  -11.648 3.249   1.00 10.00 ? 424 LYS A HA   7  
ATOM 7129  H HB2  . LYS A 1 15 ? -3.337  -9.442  4.196   1.00 10.00 ? 424 LYS A HB2  7  
ATOM 7130  H HB3  . LYS A 1 15 ? -3.777  -10.577 2.926   1.00 10.00 ? 424 LYS A HB3  7  
ATOM 7131  H HG2  . LYS A 1 15 ? -2.819  -11.759 5.453   1.00 10.00 ? 424 LYS A HG2  7  
ATOM 7132  H HG3  . LYS A 1 15 ? -4.380  -10.937 5.508   1.00 10.00 ? 424 LYS A HG3  7  
ATOM 7133  H HD2  . LYS A 1 15 ? -5.174  -12.933 4.828   1.00 10.00 ? 424 LYS A HD2  7  
ATOM 7134  H HD3  . LYS A 1 15 ? -4.655  -12.378 3.235   1.00 10.00 ? 424 LYS A HD3  7  
ATOM 7135  H HE2  . LYS A 1 15 ? -2.896  -13.804 3.162   1.00 10.00 ? 424 LYS A HE2  7  
ATOM 7136  H HE3  . LYS A 1 15 ? -2.604  -13.704 4.898   1.00 10.00 ? 424 LYS A HE3  7  
ATOM 7137  H HZ1  . LYS A 1 15 ? -5.019  -15.071 3.936   1.00 10.00 ? 424 LYS A HZ1  7  
ATOM 7138  H HZ2  . LYS A 1 15 ? -4.113  -15.348 5.338   1.00 10.00 ? 424 LYS A HZ2  7  
ATOM 7139  H HZ3  . LYS A 1 15 ? -3.533  -15.875 3.839   1.00 10.00 ? 424 LYS A HZ3  7  
ATOM 7140  N N    . ASP A 1 16 ? -0.912  -8.561  2.438   1.00 10.00 ? 425 ASP A N    7  
ATOM 7141  C CA   . ASP A 1 16 ? -0.548  -7.655  1.357   1.00 10.00 ? 425 ASP A CA   7  
ATOM 7142  C C    . ASP A 1 16 ? 0.557   -8.247  0.480   1.00 10.00 ? 425 ASP A C    7  
ATOM 7143  O O    . ASP A 1 16 ? 0.737   -7.833  -0.663  1.00 10.00 ? 425 ASP A O    7  
ATOM 7144  C CB   . ASP A 1 16 ? -0.085  -6.316  1.936   1.00 10.00 ? 425 ASP A CB   7  
ATOM 7145  C CG   . ASP A 1 16 ? -0.044  -5.210  0.901   1.00 10.00 ? 425 ASP A CG   7  
ATOM 7146  O OD1  . ASP A 1 16 ? -1.020  -5.076  0.136   1.00 10.00 ? 425 ASP A OD1  7  
ATOM 7147  O OD2  . ASP A 1 16 ? 0.965   -4.475  0.859   1.00 10.00 ? 425 ASP A OD2  7  
ATOM 7148  H H    . ASP A 1 16 ? -0.808  -8.256  3.364   1.00 10.00 ? 425 ASP A H    7  
ATOM 7149  H HA   . ASP A 1 16 ? -1.424  -7.489  0.751   1.00 10.00 ? 425 ASP A HA   7  
ATOM 7150  H HB2  . ASP A 1 16 ? -0.761  -6.019  2.724   1.00 10.00 ? 425 ASP A HB2  7  
ATOM 7151  H HB3  . ASP A 1 16 ? 0.907   -6.435  2.347   1.00 10.00 ? 425 ASP A HB3  7  
ATOM 7152  N N    . ARG A 1 17 ? 1.298   -9.212  1.021   1.00 10.00 ? 426 ARG A N    7  
ATOM 7153  C CA   . ARG A 1 17 ? 2.390   -9.847  0.282   1.00 10.00 ? 426 ARG A CA   7  
ATOM 7154  C C    . ARG A 1 17 ? 1.955   -10.248 -1.128  1.00 10.00 ? 426 ARG A C    7  
ATOM 7155  O O    . ARG A 1 17 ? 2.770   -10.286 -2.049  1.00 10.00 ? 426 ARG A O    7  
ATOM 7156  C CB   . ARG A 1 17 ? 2.905   -11.071 1.043   1.00 10.00 ? 426 ARG A CB   7  
ATOM 7157  C CG   . ARG A 1 17 ? 4.378   -10.981 1.410   1.00 10.00 ? 426 ARG A CG   7  
ATOM 7158  C CD   . ARG A 1 17 ? 4.963   -12.353 1.708   1.00 10.00 ? 426 ARG A CD   7  
ATOM 7159  N NE   . ARG A 1 17 ? 5.046   -13.185 0.510   1.00 10.00 ? 426 ARG A NE   7  
ATOM 7160  C CZ   . ARG A 1 17 ? 5.938   -13.000 -0.460  1.00 10.00 ? 426 ARG A CZ   7  
ATOM 7161  N NH1  . ARG A 1 17 ? 6.826   -12.016 -0.376  1.00 10.00 ? 426 ARG A NH1  7  
ATOM 7162  N NH2  . ARG A 1 17 ? 5.945   -13.802 -1.516  1.00 10.00 ? 426 ARG A NH2  7  
ATOM 7163  H H    . ARG A 1 17 ? 1.115   -9.499  1.939   1.00 10.00 ? 426 ARG A H    7  
ATOM 7164  H HA   . ARG A 1 17 ? 3.190   -9.126  0.198   1.00 10.00 ? 426 ARG A HA   7  
ATOM 7165  H HB2  . ARG A 1 17 ? 2.336   -11.181 1.955   1.00 10.00 ? 426 ARG A HB2  7  
ATOM 7166  H HB3  . ARG A 1 17 ? 2.764   -11.950 0.432   1.00 10.00 ? 426 ARG A HB3  7  
ATOM 7167  H HG2  . ARG A 1 17 ? 4.918   -10.542 0.585   1.00 10.00 ? 426 ARG A HG2  7  
ATOM 7168  H HG3  . ARG A 1 17 ? 4.483   -10.358 2.285   1.00 10.00 ? 426 ARG A HG3  7  
ATOM 7169  H HD2  . ARG A 1 17 ? 5.954   -12.227 2.116   1.00 10.00 ? 426 ARG A HD2  7  
ATOM 7170  H HD3  . ARG A 1 17 ? 4.335   -12.847 2.436   1.00 10.00 ? 426 ARG A HD3  7  
ATOM 7171  H HE   . ARG A 1 17 ? 4.402   -13.918 0.423   1.00 10.00 ? 426 ARG A HE   7  
ATOM 7172  H HH11 . ARG A 1 17 ? 6.826   -11.409 0.417   1.00 10.00 ? 426 ARG A HH11 7  
ATOM 7173  H HH12 . ARG A 1 17 ? 7.494   -11.884 -1.109  1.00 10.00 ? 426 ARG A HH12 7  
ATOM 7174  H HH21 . ARG A 1 17 ? 5.279   -14.546 -1.584  1.00 10.00 ? 426 ARG A HH21 7  
ATOM 7175  H HH22 . ARG A 1 17 ? 6.616   -13.665 -2.245  1.00 10.00 ? 426 ARG A HH22 7  
ATOM 7176  N N    . GLN A 1 18 ? 0.667   -10.532 -1.290  1.00 10.00 ? 427 GLN A N    7  
ATOM 7177  C CA   . GLN A 1 18 ? 0.130   -10.915 -2.593  1.00 10.00 ? 427 GLN A CA   7  
ATOM 7178  C C    . GLN A 1 18 ? -0.523  -9.716  -3.266  1.00 10.00 ? 427 GLN A C    7  
ATOM 7179  O O    . GLN A 1 18 ? -1.503  -9.850  -3.999  1.00 10.00 ? 427 GLN A O    7  
ATOM 7180  C CB   . GLN A 1 18 ? -0.881  -12.056 -2.443  1.00 10.00 ? 427 GLN A CB   7  
ATOM 7181  C CG   . GLN A 1 18 ? -0.486  -13.090 -1.399  1.00 10.00 ? 427 GLN A CG   7  
ATOM 7182  C CD   . GLN A 1 18 ? -0.914  -12.698 0.004   1.00 10.00 ? 427 GLN A CD   7  
ATOM 7183  O OE1  . GLN A 1 18 ? -2.102  -12.520 0.275   1.00 10.00 ? 427 GLN A OE1  7  
ATOM 7184  N NE2  . GLN A 1 18 ? 0.055   -12.563 0.903   1.00 10.00 ? 427 GLN A NE2  7  
ATOM 7185  H H    . GLN A 1 18 ? 0.064   -10.476 -0.522  1.00 10.00 ? 427 GLN A H    7  
ATOM 7186  H HA   . GLN A 1 18 ? 0.954   -11.246 -3.210  1.00 10.00 ? 427 GLN A HA   7  
ATOM 7187  H HB2  . GLN A 1 18 ? -1.836  -11.640 -2.163  1.00 10.00 ? 427 GLN A HB2  7  
ATOM 7188  H HB3  . GLN A 1 18 ? -0.982  -12.558 -3.394  1.00 10.00 ? 427 GLN A HB3  7  
ATOM 7189  H HG2  . GLN A 1 18 ? -0.951  -14.032 -1.650  1.00 10.00 ? 427 GLN A HG2  7  
ATOM 7190  H HG3  . GLN A 1 18 ? 0.588   -13.205 -1.412  1.00 10.00 ? 427 GLN A HG3  7  
ATOM 7191  H HE21 . GLN A 1 18 ? 0.977   -12.722 0.616   1.00 10.00 ? 427 GLN A HE21 7  
ATOM 7192  H HE22 . GLN A 1 18 ? -0.192  -12.307 1.818   1.00 10.00 ? 427 GLN A HE22 7  
ATOM 7193  N N    . VAL A 1 19 ? 0.039   -8.545  -3.005  1.00 10.00 ? 428 VAL A N    7  
ATOM 7194  C CA   . VAL A 1 19 ? -0.459  -7.301  -3.569  1.00 10.00 ? 428 VAL A CA   7  
ATOM 7195  C C    . VAL A 1 19 ? 0.607   -6.638  -4.426  1.00 10.00 ? 428 VAL A C    7  
ATOM 7196  O O    . VAL A 1 19 ? 0.296   -5.990  -5.425  1.00 10.00 ? 428 VAL A O    7  
ATOM 7197  C CB   . VAL A 1 19 ? -0.911  -6.335  -2.463  1.00 10.00 ? 428 VAL A CB   7  
ATOM 7198  C CG1  . VAL A 1 19 ? -1.336  -4.993  -3.042  1.00 10.00 ? 428 VAL A CG1  7  
ATOM 7199  C CG2  . VAL A 1 19 ? -2.038  -6.961  -1.660  1.00 10.00 ? 428 VAL A CG2  7  
ATOM 7200  H H    . VAL A 1 19 ? 0.817   -8.519  -2.412  1.00 10.00 ? 428 VAL A H    7  
ATOM 7201  H HA   . VAL A 1 19 ? -1.311  -7.531  -4.190  1.00 10.00 ? 428 VAL A HA   7  
ATOM 7202  H HB   . VAL A 1 19 ? -0.075  -6.167  -1.801  1.00 10.00 ? 428 VAL A HB   7  
ATOM 7203  H HG11 . VAL A 1 19 ? -1.099  -4.958  -4.097  1.00 10.00 ? 428 VAL A HG11 7  
ATOM 7204  H HG12 . VAL A 1 19 ? -0.809  -4.207  -2.528  1.00 10.00 ? 428 VAL A HG12 7  
ATOM 7205  H HG13 . VAL A 1 19 ? -2.399  -4.861  -2.906  1.00 10.00 ? 428 VAL A HG13 7  
ATOM 7206  H HG21 . VAL A 1 19 ? -2.446  -6.230  -0.979  1.00 10.00 ? 428 VAL A HG21 7  
ATOM 7207  H HG22 . VAL A 1 19 ? -1.658  -7.803  -1.102  1.00 10.00 ? 428 VAL A HG22 7  
ATOM 7208  H HG23 . VAL A 1 19 ? -2.812  -7.298  -2.333  1.00 10.00 ? 428 VAL A HG23 7  
ATOM 7209  N N    . MET A 1 20 ? 1.869   -6.822  -4.048  1.00 10.00 ? 429 MET A N    7  
ATOM 7210  C CA   . MET A 1 20 ? 2.978   -6.255  -4.810  1.00 10.00 ? 429 MET A CA   7  
ATOM 7211  C C    . MET A 1 20 ? 2.783   -6.515  -6.303  1.00 10.00 ? 429 MET A C    7  
ATOM 7212  O O    . MET A 1 20 ? 3.275   -5.767  -7.148  1.00 10.00 ? 429 MET A O    7  
ATOM 7213  C CB   . MET A 1 20 ? 4.308   -6.856  -4.347  1.00 10.00 ? 429 MET A CB   7  
ATOM 7214  C CG   . MET A 1 20 ? 4.407   -8.357  -4.571  1.00 10.00 ? 429 MET A CG   7  
ATOM 7215  S SD   . MET A 1 20 ? 6.096   -8.902  -4.890  1.00 10.00 ? 429 MET A SD   7  
ATOM 7216  C CE   . MET A 1 20 ? 6.833   -8.685  -3.272  1.00 10.00 ? 429 MET A CE   7  
ATOM 7217  H H    . MET A 1 20 ? 2.058   -7.360  -3.248  1.00 10.00 ? 429 MET A H    7  
ATOM 7218  H HA   . MET A 1 20 ? 2.992   -5.189  -4.637  1.00 10.00 ? 429 MET A HA   7  
ATOM 7219  H HB2  . MET A 1 20 ? 5.112   -6.381  -4.888  1.00 10.00 ? 429 MET A HB2  7  
ATOM 7220  H HB3  . MET A 1 20 ? 4.432   -6.663  -3.292  1.00 10.00 ? 429 MET A HB3  7  
ATOM 7221  H HG2  . MET A 1 20 ? 4.041   -8.863  -3.690  1.00 10.00 ? 429 MET A HG2  7  
ATOM 7222  H HG3  . MET A 1 20 ? 3.791   -8.622  -5.418  1.00 10.00 ? 429 MET A HG3  7  
ATOM 7223  H HE1  . MET A 1 20 ? 7.433   -7.787  -3.268  1.00 10.00 ? 429 MET A HE1  7  
ATOM 7224  H HE2  . MET A 1 20 ? 7.457   -9.536  -3.045  1.00 10.00 ? 429 MET A HE2  7  
ATOM 7225  H HE3  . MET A 1 20 ? 6.054   -8.602  -2.530  1.00 10.00 ? 429 MET A HE3  7  
ATOM 7226  N N    . ASN A 1 21 ? 2.054   -7.588  -6.613  1.00 10.00 ? 430 ASN A N    7  
ATOM 7227  C CA   . ASN A 1 21 ? 1.780   -7.961  -7.993  1.00 10.00 ? 430 ASN A CA   7  
ATOM 7228  C C    . ASN A 1 21 ? 0.280   -8.125  -8.233  1.00 10.00 ? 430 ASN A C    7  
ATOM 7229  O O    . ASN A 1 21 ? -0.133  -8.823  -9.159  1.00 10.00 ? 430 ASN A O    7  
ATOM 7230  C CB   . ASN A 1 21 ? 2.503   -9.266  -8.326  1.00 10.00 ? 430 ASN A CB   7  
ATOM 7231  C CG   . ASN A 1 21 ? 3.945   -9.041  -8.739  1.00 10.00 ? 430 ASN A CG   7  
ATOM 7232  O OD1  . ASN A 1 21 ? 4.868   -9.581  -8.128  1.00 10.00 ? 430 ASN A OD1  7  
ATOM 7233  N ND2  . ASN A 1 21 ? 4.144   -8.240  -9.778  1.00 10.00 ? 430 ASN A ND2  7  
ATOM 7234  H H    . ASN A 1 21 ? 1.692   -8.143  -5.894  1.00 10.00 ? 430 ASN A H    7  
ATOM 7235  H HA   . ASN A 1 21 ? 2.150   -7.173  -8.632  1.00 10.00 ? 430 ASN A HA   7  
ATOM 7236  H HB2  . ASN A 1 21 ? 2.492   -9.908  -7.453  1.00 10.00 ? 430 ASN A HB2  7  
ATOM 7237  H HB3  . ASN A 1 21 ? 1.987   -9.760  -9.136  1.00 10.00 ? 430 ASN A HB3  7  
ATOM 7238  H HD21 . ASN A 1 21 ? 3.362   -7.845  -10.215 1.00 10.00 ? 430 ASN A HD21 7  
ATOM 7239  H HD22 . ASN A 1 21 ? 5.067   -8.077  -10.067 1.00 10.00 ? 430 ASN A HD22 7  
ATOM 7240  N N    . MET A 1 22 ? -0.531  -7.479  -7.399  1.00 10.00 ? 431 MET A N    7  
ATOM 7241  C CA   . MET A 1 22 ? -1.985  -7.555  -7.528  1.00 10.00 ? 431 MET A CA   7  
ATOM 7242  C C    . MET A 1 22 ? -2.683  -6.907  -6.339  1.00 10.00 ? 431 MET A C    7  
ATOM 7243  O O    . MET A 1 22 ? -3.051  -7.584  -5.380  1.00 10.00 ? 431 MET A O    7  
ATOM 7244  C CB   . MET A 1 22 ? -2.448  -9.007  -7.641  1.00 10.00 ? 431 MET A CB   7  
ATOM 7245  C CG   . MET A 1 22 ? -2.795  -9.428  -9.061  1.00 10.00 ? 431 MET A CG   7  
ATOM 7246  S SD   . MET A 1 22 ? -4.330  -10.371 -9.152  1.00 10.00 ? 431 MET A SD   7  
ATOM 7247  C CE   . MET A 1 22 ? -3.703  -12.047 -9.077  1.00 10.00 ? 431 MET A CE   7  
ATOM 7248  H H    . MET A 1 22 ? -0.146  -6.936  -6.684  1.00 10.00 ? 431 MET A H    7  
ATOM 7249  H HA   . MET A 1 22 ? -2.265  -7.027  -8.426  1.00 10.00 ? 431 MET A HA   7  
ATOM 7250  H HB2  . MET A 1 22 ? -1.662  -9.652  -7.278  1.00 10.00 ? 431 MET A HB2  7  
ATOM 7251  H HB3  . MET A 1 22 ? -3.326  -9.138  -7.023  1.00 10.00 ? 431 MET A HB3  7  
ATOM 7252  H HG2  . MET A 1 22 ? -2.898  -8.542  -9.670  1.00 10.00 ? 431 MET A HG2  7  
ATOM 7253  H HG3  . MET A 1 22 ? -1.992  -10.038 -9.448  1.00 10.00 ? 431 MET A HG3  7  
ATOM 7254  H HE1  . MET A 1 22 ? -2.685  -12.035 -8.715  1.00 10.00 ? 431 MET A HE1  7  
ATOM 7255  H HE2  . MET A 1 22 ? -3.729  -12.486 -10.064 1.00 10.00 ? 431 MET A HE2  7  
ATOM 7256  H HE3  . MET A 1 22 ? -4.316  -12.632 -8.407  1.00 10.00 ? 431 MET A HE3  7  
ATOM 7257  N N    . TRP A 1 23 ? -2.899  -5.603  -6.422  1.00 10.00 ? 432 TRP A N    7  
ATOM 7258  C CA   . TRP A 1 23 ? -3.591  -4.888  -5.362  1.00 10.00 ? 432 TRP A CA   7  
ATOM 7259  C C    . TRP A 1 23 ? -5.084  -4.922  -5.641  1.00 10.00 ? 432 TRP A C    7  
ATOM 7260  O O    . TRP A 1 23 ? -5.598  -4.166  -6.466  1.00 10.00 ? 432 TRP A O    7  
ATOM 7261  C CB   . TRP A 1 23 ? -3.105  -3.439  -5.236  1.00 10.00 ? 432 TRP A CB   7  
ATOM 7262  C CG   . TRP A 1 23 ? -1.670  -3.195  -5.621  1.00 10.00 ? 432 TRP A CG   7  
ATOM 7263  C CD1  . TRP A 1 23 ? -1.083  -3.451  -6.825  1.00 10.00 ? 432 TRP A CD1  7  
ATOM 7264  C CD2  . TRP A 1 23 ? -0.641  -2.616  -4.799  1.00 10.00 ? 432 TRP A CD2  7  
ATOM 7265  N NE1  . TRP A 1 23 ? 0.220   -3.036  -6.813  1.00 10.00 ? 432 TRP A NE1  7  
ATOM 7266  C CE2  . TRP A 1 23 ? 0.520   -2.529  -5.585  1.00 10.00 ? 432 TRP A CE2  7  
ATOM 7267  C CE3  . TRP A 1 23 ? -0.591  -2.151  -3.486  1.00 10.00 ? 432 TRP A CE3  7  
ATOM 7268  C CZ2  . TRP A 1 23 ? 1.711   -1.996  -5.105  1.00 10.00 ? 432 TRP A CZ2  7  
ATOM 7269  C CZ3  . TRP A 1 23 ? 0.594   -1.630  -3.003  1.00 10.00 ? 432 TRP A CZ3  7  
ATOM 7270  C CH2  . TRP A 1 23 ? 1.730   -1.550  -3.813  1.00 10.00 ? 432 TRP A CH2  7  
ATOM 7271  H H    . TRP A 1 23 ? -2.618  -5.124  -7.223  1.00 10.00 ? 432 TRP A H    7  
ATOM 7272  H HA   . TRP A 1 23 ? -3.412  -5.407  -4.431  1.00 10.00 ? 432 TRP A HA   7  
ATOM 7273  H HB2  . TRP A 1 23 ? -3.719  -2.812  -5.862  1.00 10.00 ? 432 TRP A HB2  7  
ATOM 7274  H HB3  . TRP A 1 23 ? -3.224  -3.127  -4.213  1.00 10.00 ? 432 TRP A HB3  7  
ATOM 7275  H HD1  . TRP A 1 23 ? -1.587  -3.900  -7.662  1.00 10.00 ? 432 TRP A HD1  7  
ATOM 7276  H HE1  . TRP A 1 23 ? 0.836   -3.095  -7.557  1.00 10.00 ? 432 TRP A HE1  7  
ATOM 7277  H HE3  . TRP A 1 23 ? -1.449  -2.209  -2.847  1.00 10.00 ? 432 TRP A HE3  7  
ATOM 7278  H HZ2  . TRP A 1 23 ? 2.588   -1.910  -5.729  1.00 10.00 ? 432 TRP A HZ2  7  
ATOM 7279  H HZ3  . TRP A 1 23 ? 0.648   -1.268  -1.987  1.00 10.00 ? 432 TRP A HZ3  7  
ATOM 7280  H HH2  . TRP A 1 23 ? 2.635   -1.139  -3.395  1.00 10.00 ? 432 TRP A HH2  7  
ATOM 7281  N N    . SER A 1 24 ? -5.764  -5.831  -4.961  1.00 10.00 ? 433 SER A N    7  
ATOM 7282  C CA   . SER A 1 24 ? -7.202  -6.014  -5.135  1.00 10.00 ? 433 SER A CA   7  
ATOM 7283  C C    . SER A 1 24 ? -7.978  -4.763  -4.749  1.00 10.00 ? 433 SER A C    7  
ATOM 7284  O O    . SER A 1 24 ? -7.539  -3.983  -3.908  1.00 10.00 ? 433 SER A O    7  
ATOM 7285  C CB   . SER A 1 24 ? -7.687  -7.202  -4.303  1.00 10.00 ? 433 SER A CB   7  
ATOM 7286  O OG   . SER A 1 24 ? -8.729  -7.898  -4.965  1.00 10.00 ? 433 SER A OG   7  
ATOM 7287  H H    . SER A 1 24 ? -5.279  -6.406  -4.333  1.00 10.00 ? 433 SER A H    7  
ATOM 7288  H HA   . SER A 1 24 ? -7.383  -6.225  -6.178  1.00 10.00 ? 433 SER A HA   7  
ATOM 7289  H HB2  . SER A 1 24 ? -6.865  -7.883  -4.138  1.00 10.00 ? 433 SER A HB2  7  
ATOM 7290  H HB3  . SER A 1 24 ? -8.055  -6.846  -3.352  1.00 10.00 ? 433 SER A HB3  7  
ATOM 7291  H HG   . SER A 1 24 ? -8.768  -8.801  -4.639  1.00 10.00 ? 433 SER A HG   7  
ATOM 7292  N N    . GLU A 1 25 ? -9.146  -4.584  -5.364  1.00 10.00 ? 434 GLU A N    7  
ATOM 7293  C CA   . GLU A 1 25 ? -9.993  -3.432  -5.074  1.00 10.00 ? 434 GLU A CA   7  
ATOM 7294  C C    . GLU A 1 25 ? -10.184 -3.283  -3.568  1.00 10.00 ? 434 GLU A C    7  
ATOM 7295  O O    . GLU A 1 25 ? -10.320 -2.174  -3.053  1.00 10.00 ? 434 GLU A O    7  
ATOM 7296  C CB   . GLU A 1 25 ? -11.351 -3.581  -5.762  1.00 10.00 ? 434 GLU A CB   7  
ATOM 7297  C CG   . GLU A 1 25 ? -11.251 -3.939  -7.236  1.00 10.00 ? 434 GLU A CG   7  
ATOM 7298  C CD   . GLU A 1 25 ? -12.447 -3.461  -8.035  1.00 10.00 ? 434 GLU A CD   7  
ATOM 7299  O OE1  . GLU A 1 25 ? -13.533 -4.061  -7.893  1.00 10.00 ? 434 GLU A OE1  7  
ATOM 7300  O OE2  . GLU A 1 25 ? -12.298 -2.487  -8.801  1.00 10.00 ? 434 GLU A OE2  7  
ATOM 7301  H H    . GLU A 1 25 ? -9.448  -5.247  -6.020  1.00 10.00 ? 434 GLU A H    7  
ATOM 7302  H HA   . GLU A 1 25 ? -9.498  -2.550  -5.453  1.00 10.00 ? 434 GLU A HA   7  
ATOM 7303  H HB2  . GLU A 1 25 ? -11.911 -4.357  -5.262  1.00 10.00 ? 434 GLU A HB2  7  
ATOM 7304  H HB3  . GLU A 1 25 ? -11.889 -2.649  -5.676  1.00 10.00 ? 434 GLU A HB3  7  
ATOM 7305  H HG2  . GLU A 1 25 ? -10.360 -3.484  -7.644  1.00 10.00 ? 434 GLU A HG2  7  
ATOM 7306  H HG3  . GLU A 1 25 ? -11.180 -5.013  -7.328  1.00 10.00 ? 434 GLU A HG3  7  
ATOM 7307  N N    . GLN A 1 26 ? -10.174 -4.415  -2.871  1.00 10.00 ? 435 GLN A N    7  
ATOM 7308  C CA   . GLN A 1 26 ? -10.328 -4.423  -1.424  1.00 10.00 ? 435 GLN A CA   7  
ATOM 7309  C C    . GLN A 1 26 ? -8.986  -4.174  -0.751  1.00 10.00 ? 435 GLN A C    7  
ATOM 7310  O O    . GLN A 1 26 ? -8.920  -3.587  0.330   1.00 10.00 ? 435 GLN A O    7  
ATOM 7311  C CB   . GLN A 1 26 ? -10.910 -5.758  -0.957  1.00 10.00 ? 435 GLN A CB   7  
ATOM 7312  C CG   . GLN A 1 26 ? -11.723 -5.651  0.323   1.00 10.00 ? 435 GLN A CG   7  
ATOM 7313  C CD   . GLN A 1 26 ? -13.204 -5.457  0.061   1.00 10.00 ? 435 GLN A CD   7  
ATOM 7314  O OE1  . GLN A 1 26 ? -14.047 -6.026  0.756   1.00 10.00 ? 435 GLN A OE1  7  
ATOM 7315  N NE2  . GLN A 1 26 ? -13.530 -4.654  -0.945  1.00 10.00 ? 435 GLN A NE2  7  
ATOM 7316  H H    . GLN A 1 26 ? -10.050 -5.265  -3.342  1.00 10.00 ? 435 GLN A H    7  
ATOM 7317  H HA   . GLN A 1 26 ? -11.005 -3.627  -1.156  1.00 10.00 ? 435 GLN A HA   7  
ATOM 7318  H HB2  . GLN A 1 26 ? -11.550 -6.150  -1.733  1.00 10.00 ? 435 GLN A HB2  7  
ATOM 7319  H HB3  . GLN A 1 26 ? -10.099 -6.449  -0.786  1.00 10.00 ? 435 GLN A HB3  7  
ATOM 7320  H HG2  . GLN A 1 26 ? -11.590 -6.557  0.895   1.00 10.00 ? 435 GLN A HG2  7  
ATOM 7321  H HG3  . GLN A 1 26 ? -11.360 -4.809  0.895   1.00 10.00 ? 435 GLN A HG3  7  
ATOM 7322  H HE21 . GLN A 1 26 ? -12.808 -4.235  -1.457  1.00 10.00 ? 435 GLN A HE21 7  
ATOM 7323  H HE22 . GLN A 1 26 ? -14.480 -4.511  -1.133  1.00 10.00 ? 435 GLN A HE22 7  
ATOM 7324  N N    . GLU A 1 27 ? -7.912  -4.610  -1.404  1.00 10.00 ? 436 GLU A N    7  
ATOM 7325  C CA   . GLU A 1 27 ? -6.576  -4.422  -0.882  1.00 10.00 ? 436 GLU A CA   7  
ATOM 7326  C C    . GLU A 1 27 ? -6.171  -2.968  -1.044  1.00 10.00 ? 436 GLU A C    7  
ATOM 7327  O O    . GLU A 1 27 ? -5.738  -2.324  -0.088  1.00 10.00 ? 436 GLU A O    7  
ATOM 7328  C CB   . GLU A 1 27 ? -5.619  -5.373  -1.602  1.00 10.00 ? 436 GLU A CB   7  
ATOM 7329  C CG   . GLU A 1 27 ? -4.919  -6.354  -0.673  1.00 10.00 ? 436 GLU A CG   7  
ATOM 7330  C CD   . GLU A 1 27 ? -5.874  -7.034  0.291   1.00 10.00 ? 436 GLU A CD   7  
ATOM 7331  O OE1  . GLU A 1 27 ? -6.413  -8.102  -0.064  1.00 10.00 ? 436 GLU A OE1  7  
ATOM 7332  O OE2  . GLU A 1 27 ? -6.081  -6.497  1.399   1.00 10.00 ? 436 GLU A OE2  7  
ATOM 7333  H H    . GLU A 1 27 ? -8.018  -5.061  -2.269  1.00 10.00 ? 436 GLU A H    7  
ATOM 7334  H HA   . GLU A 1 27 ? -6.590  -4.650  0.171   1.00 10.00 ? 436 GLU A HA   7  
ATOM 7335  H HB2  . GLU A 1 27 ? -6.183  -5.943  -2.326  1.00 10.00 ? 436 GLU A HB2  7  
ATOM 7336  H HB3  . GLU A 1 27 ? -4.873  -4.797  -2.122  1.00 10.00 ? 436 GLU A HB3  7  
ATOM 7337  H HG2  . GLU A 1 27 ? -4.440  -7.113  -1.269  1.00 10.00 ? 436 GLU A HG2  7  
ATOM 7338  H HG3  . GLU A 1 27 ? -4.173  -5.821  -0.101  1.00 10.00 ? 436 GLU A HG3  7  
ATOM 7339  N N    . LYS A 1 28 ? -6.369  -2.433  -2.244  1.00 10.00 ? 437 LYS A N    7  
ATOM 7340  C CA   . LYS A 1 28 ? -6.082  -1.027  -2.509  1.00 10.00 ? 437 LYS A CA   7  
ATOM 7341  C C    . LYS A 1 28 ? -6.858  -0.166  -1.526  1.00 10.00 ? 437 LYS A C    7  
ATOM 7342  O O    . LYS A 1 28 ? -6.535  0.993   -1.305  1.00 10.00 ? 437 LYS A O    7  
ATOM 7343  C CB   . LYS A 1 28 ? -6.468  -0.670  -3.945  1.00 10.00 ? 437 LYS A CB   7  
ATOM 7344  C CG   . LYS A 1 28 ? -5.444  0.208   -4.646  1.00 10.00 ? 437 LYS A CG   7  
ATOM 7345  C CD   . LYS A 1 28 ? -6.066  0.977   -5.800  1.00 10.00 ? 437 LYS A CD   7  
ATOM 7346  C CE   . LYS A 1 28 ? -7.183  1.895   -5.326  1.00 10.00 ? 437 LYS A CE   7  
ATOM 7347  N NZ   . LYS A 1 28 ? -8.514  1.458   -5.830  1.00 10.00 ? 437 LYS A NZ   7  
ATOM 7348  H H    . LYS A 1 28 ? -6.756  -2.984  -2.952  1.00 10.00 ? 437 LYS A H    7  
ATOM 7349  H HA   . LYS A 1 28 ? -5.029  -0.850  -2.367  1.00 10.00 ? 437 LYS A HA   7  
ATOM 7350  H HB2  . LYS A 1 28 ? -6.578  -1.581  -4.515  1.00 10.00 ? 437 LYS A HB2  7  
ATOM 7351  H HB3  . LYS A 1 28 ? -7.413  -0.147  -3.934  1.00 10.00 ? 437 LYS A HB3  7  
ATOM 7352  H HG2  . LYS A 1 28 ? -5.042  0.911   -3.935  1.00 10.00 ? 437 LYS A HG2  7  
ATOM 7353  H HG3  . LYS A 1 28 ? -4.650  -0.416  -5.029  1.00 10.00 ? 437 LYS A HG3  7  
ATOM 7354  H HD2  . LYS A 1 28 ? -5.302  1.574   -6.275  1.00 10.00 ? 437 LYS A HD2  7  
ATOM 7355  H HD3  . LYS A 1 28 ? -6.470  0.274   -6.513  1.00 10.00 ? 437 LYS A HD3  7  
ATOM 7356  H HE2  . LYS A 1 28 ? -7.200  1.894   -4.246  1.00 10.00 ? 437 LYS A HE2  7  
ATOM 7357  H HE3  . LYS A 1 28 ? -6.984  2.896   -5.680  1.00 10.00 ? 437 LYS A HE3  7  
ATOM 7358  H HZ1  . LYS A 1 28 ? -8.489  0.448   -6.076  1.00 10.00 ? 437 LYS A HZ1  7  
ATOM 7359  H HZ2  . LYS A 1 28 ? -8.772  2.003   -6.678  1.00 10.00 ? 437 LYS A HZ2  7  
ATOM 7360  H HZ3  . LYS A 1 28 ? -9.240  1.608   -5.101  1.00 10.00 ? 437 LYS A HZ3  7  
ATOM 7361  N N    . GLU A 1 29 ? -7.879  -0.759  -0.924  1.00 10.00 ? 438 GLU A N    7  
ATOM 7362  C CA   . GLU A 1 29 ? -8.699  -0.061  0.048   1.00 10.00 ? 438 GLU A CA   7  
ATOM 7363  C C    . GLU A 1 29 ? -7.876  0.344   1.261   1.00 10.00 ? 438 GLU A C    7  
ATOM 7364  O O    . GLU A 1 29 ? -8.226  1.286   1.966   1.00 10.00 ? 438 GLU A O    7  
ATOM 7365  C CB   . GLU A 1 29 ? -9.864  -0.944  0.486   1.00 10.00 ? 438 GLU A CB   7  
ATOM 7366  C CG   . GLU A 1 29 ? -11.070 -0.164  0.983   1.00 10.00 ? 438 GLU A CG   7  
ATOM 7367  C CD   . GLU A 1 29 ? -12.123 -1.054  1.612   1.00 10.00 ? 438 GLU A CD   7  
ATOM 7368  O OE1  . GLU A 1 29 ? -11.750 -1.940  2.410   1.00 10.00 ? 438 GLU A OE1  7  
ATOM 7369  O OE2  . GLU A 1 29 ? -13.319 -0.867  1.306   1.00 10.00 ? 438 GLU A OE2  7  
ATOM 7370  H H    . GLU A 1 29 ? -8.078  -1.697  -1.131  1.00 10.00 ? 438 GLU A H    7  
ATOM 7371  H HA   . GLU A 1 29 ? -9.085  0.830   -0.424  1.00 10.00 ? 438 GLU A HA   7  
ATOM 7372  H HB2  . GLU A 1 29 ? -10.174 -1.553  -0.351  1.00 10.00 ? 438 GLU A HB2  7  
ATOM 7373  H HB3  . GLU A 1 29 ? -9.525  -1.589  1.283   1.00 10.00 ? 438 GLU A HB3  7  
ATOM 7374  H HG2  . GLU A 1 29 ? -10.739 0.552   1.721   1.00 10.00 ? 438 GLU A HG2  7  
ATOM 7375  H HG3  . GLU A 1 29 ? -11.512 0.360   0.149   1.00 10.00 ? 438 GLU A HG3  7  
ATOM 7376  N N    . THR A 1 30 ? -6.789  -0.376  1.514   1.00 10.00 ? 439 THR A N    7  
ATOM 7377  C CA   . THR A 1 30 ? -5.942  -0.071  2.659   1.00 10.00 ? 439 THR A CA   7  
ATOM 7378  C C    . THR A 1 30 ? -4.815  0.890   2.287   1.00 10.00 ? 439 THR A C    7  
ATOM 7379  O O    . THR A 1 30 ? -4.590  1.887   2.973   1.00 10.00 ? 439 THR A O    7  
ATOM 7380  C CB   . THR A 1 30 ? -5.373  -1.362  3.254   1.00 10.00 ? 439 THR A CB   7  
ATOM 7381  O OG1  . THR A 1 30 ? -6.420  -2.217  3.678   1.00 10.00 ? 439 THR A OG1  7  
ATOM 7382  C CG2  . THR A 1 30 ? -4.465  -1.129  4.443   1.00 10.00 ? 439 THR A CG2  7  
ATOM 7383  H H    . THR A 1 30 ? -6.557  -1.134  0.926   1.00 10.00 ? 439 THR A H    7  
ATOM 7384  H HA   . THR A 1 30 ? -6.563  0.411   3.397   1.00 10.00 ? 439 THR A HA   7  
ATOM 7385  H HB   . THR A 1 30 ? -4.804  -1.877  2.493   1.00 10.00 ? 439 THR A HB   7  
ATOM 7386  H HG1  . THR A 1 30 ? -6.961  -1.764  4.327   1.00 10.00 ? 439 THR A HG1  7  
ATOM 7387  H HG21 . THR A 1 30 ? -3.633  -1.814  4.399   1.00 10.00 ? 439 THR A HG21 7  
ATOM 7388  H HG22 . THR A 1 30 ? -5.018  -1.293  5.356   1.00 10.00 ? 439 THR A HG22 7  
ATOM 7389  H HG23 . THR A 1 30 ? -4.096  -0.115  4.423   1.00 10.00 ? 439 THR A HG23 7  
ATOM 7390  N N    . PHE A 1 31 ? -4.109  0.592   1.205   1.00 10.00 ? 440 PHE A N    7  
ATOM 7391  C CA   . PHE A 1 31 ? -3.011  1.436   0.756   1.00 10.00 ? 440 PHE A CA   7  
ATOM 7392  C C    . PHE A 1 31 ? -3.542  2.691   0.076   1.00 10.00 ? 440 PHE A C    7  
ATOM 7393  O O    . PHE A 1 31 ? -2.927  3.755   0.154   1.00 10.00 ? 440 PHE A O    7  
ATOM 7394  C CB   . PHE A 1 31 ? -2.100  0.670   -0.209  1.00 10.00 ? 440 PHE A CB   7  
ATOM 7395  C CG   . PHE A 1 31 ? -2.523  -0.735  -0.456  1.00 10.00 ? 440 PHE A CG   7  
ATOM 7396  C CD1  . PHE A 1 31 ? -2.382  -1.714  0.509   1.00 10.00 ? 440 PHE A CD1  7  
ATOM 7397  C CD2  . PHE A 1 31 ? -3.073  -1.068  -1.666  1.00 10.00 ? 440 PHE A CD2  7  
ATOM 7398  C CE1  . PHE A 1 31 ? -2.790  -3.003  0.253   1.00 10.00 ? 440 PHE A CE1  7  
ATOM 7399  C CE2  . PHE A 1 31 ? -3.482  -2.347  -1.926  1.00 10.00 ? 440 PHE A CE2  7  
ATOM 7400  C CZ   . PHE A 1 31 ? -3.340  -3.310  -0.970  1.00 10.00 ? 440 PHE A CZ   7  
ATOM 7401  H H    . PHE A 1 31 ? -4.327  -0.211  0.696   1.00 10.00 ? 440 PHE A H    7  
ATOM 7402  H HA   . PHE A 1 31 ? -2.439  1.725   1.625   1.00 10.00 ? 440 PHE A HA   7  
ATOM 7403  H HB2  . PHE A 1 31 ? -2.104  1.169   -1.164  1.00 10.00 ? 440 PHE A HB2  7  
ATOM 7404  H HB3  . PHE A 1 31 ? -1.096  0.653   0.183   1.00 10.00 ? 440 PHE A HB3  7  
ATOM 7405  H HD1  . PHE A 1 31 ? -1.959  -1.464  1.468   1.00 10.00 ? 440 PHE A HD1  7  
ATOM 7406  H HD2  . PHE A 1 31 ? -3.188  -0.310  -2.416  1.00 10.00 ? 440 PHE A HD2  7  
ATOM 7407  H HE1  . PHE A 1 31 ? -2.679  -3.768  1.005   1.00 10.00 ? 440 PHE A HE1  7  
ATOM 7408  H HE2  . PHE A 1 31 ? -3.921  -2.592  -2.883  1.00 10.00 ? 440 PHE A HE2  7  
ATOM 7409  H HZ   . PHE A 1 31 ? -3.662  -4.297  -1.179  1.00 10.00 ? 440 PHE A HZ   7  
ATOM 7410  N N    . ARG A 1 32 ? -4.687  2.567   -0.590  1.00 10.00 ? 441 ARG A N    7  
ATOM 7411  C CA   . ARG A 1 32 ? -5.283  3.704   -1.275  1.00 10.00 ? 441 ARG A CA   7  
ATOM 7412  C C    . ARG A 1 32 ? -6.045  4.586   -0.290  1.00 10.00 ? 441 ARG A C    7  
ATOM 7413  O O    . ARG A 1 32 ? -6.252  5.774   -0.545  1.00 10.00 ? 441 ARG A O    7  
ATOM 7414  C CB   . ARG A 1 32 ? -6.219  3.249   -2.395  1.00 10.00 ? 441 ARG A CB   7  
ATOM 7415  C CG   . ARG A 1 32 ? -6.436  4.303   -3.470  1.00 10.00 ? 441 ARG A CG   7  
ATOM 7416  C CD   . ARG A 1 32 ? -7.914  4.504   -3.767  1.00 10.00 ? 441 ARG A CD   7  
ATOM 7417  N NE   . ARG A 1 32 ? -8.590  5.246   -2.706  1.00 10.00 ? 441 ARG A NE   7  
ATOM 7418  C CZ   . ARG A 1 32 ? -9.911  5.266   -2.541  1.00 10.00 ? 441 ARG A CZ   7  
ATOM 7419  N NH1  . ARG A 1 32 ? -10.700 4.588   -3.365  1.00 10.00 ? 441 ARG A NH1  7  
ATOM 7420  N NH2  . ARG A 1 32 ? -10.444 5.966   -1.549  1.00 10.00 ? 441 ARG A NH2  7  
ATOM 7421  H H    . ARG A 1 32 ? -5.140  1.696   -0.619  1.00 10.00 ? 441 ARG A H    7  
ATOM 7422  H HA   . ARG A 1 32 ? -4.476  4.274   -1.709  1.00 10.00 ? 441 ARG A HA   7  
ATOM 7423  H HB2  . ARG A 1 32 ? -5.801  2.371   -2.864  1.00 10.00 ? 441 ARG A HB2  7  
ATOM 7424  H HB3  . ARG A 1 32 ? -7.179  2.998   -1.969  1.00 10.00 ? 441 ARG A HB3  7  
ATOM 7425  H HG2  . ARG A 1 32 ? -6.018  5.240   -3.132  1.00 10.00 ? 441 ARG A HG2  7  
ATOM 7426  H HG3  . ARG A 1 32 ? -5.935  3.990   -4.374  1.00 10.00 ? 441 ARG A HG3  7  
ATOM 7427  H HD2  . ARG A 1 32 ? -8.011  5.051   -4.693  1.00 10.00 ? 441 ARG A HD2  7  
ATOM 7428  H HD3  . ARG A 1 32 ? -8.382  3.535   -3.872  1.00 10.00 ? 441 ARG A HD3  7  
ATOM 7429  H HE   . ARG A 1 32 ? -8.031  5.755   -2.083  1.00 10.00 ? 441 ARG A HE   7  
ATOM 7430  H HH11 . ARG A 1 32 ? -10.305 4.058   -4.115  1.00 10.00 ? 441 ARG A HH11 7  
ATOM 7431  H HH12 . ARG A 1 32 ? -11.691 4.607   -3.236  1.00 10.00 ? 441 ARG A HH12 7  
ATOM 7432  H HH21 . ARG A 1 32 ? -9.854  6.479   -0.925  1.00 10.00 ? 441 ARG A HH21 7  
ATOM 7433  H HH22 . ARG A 1 32 ? -11.436 5.982   -1.425  1.00 10.00 ? 441 ARG A HH22 7  
ATOM 7434  N N    . GLU A 1 33 ? -6.463  4.007   0.838   1.00 10.00 ? 442 GLU A N    7  
ATOM 7435  C CA   . GLU A 1 33 ? -7.199  4.762   1.846   1.00 10.00 ? 442 GLU A CA   7  
ATOM 7436  C C    . GLU A 1 33 ? -6.245  5.501   2.771   1.00 10.00 ? 442 GLU A C    7  
ATOM 7437  O O    . GLU A 1 33 ? -6.525  6.622   3.195   1.00 10.00 ? 442 GLU A O    7  
ATOM 7438  C CB   . GLU A 1 33 ? -8.109  3.842   2.660   1.00 10.00 ? 442 GLU A CB   7  
ATOM 7439  C CG   . GLU A 1 33 ? -8.875  4.557   3.761   1.00 10.00 ? 442 GLU A CG   7  
ATOM 7440  C CD   . GLU A 1 33 ? -9.565  3.597   4.710   1.00 10.00 ? 442 GLU A CD   7  
ATOM 7441  O OE1  . GLU A 1 33 ? -8.918  2.620   5.140   1.00 10.00 ? 442 GLU A OE1  7  
ATOM 7442  O OE2  . GLU A 1 33 ? -10.753 3.823   5.023   1.00 10.00 ? 442 GLU A OE2  7  
ATOM 7443  H H    . GLU A 1 33 ? -6.270  3.054   0.998   1.00 10.00 ? 442 GLU A H    7  
ATOM 7444  H HA   . GLU A 1 33 ? -7.807  5.487   1.330   1.00 10.00 ? 442 GLU A HA   7  
ATOM 7445  H HB2  . GLU A 1 33 ? -8.826  3.384   1.995   1.00 10.00 ? 442 GLU A HB2  7  
ATOM 7446  H HB3  . GLU A 1 33 ? -7.506  3.068   3.114   1.00 10.00 ? 442 GLU A HB3  7  
ATOM 7447  H HG2  . GLU A 1 33 ? -8.183  5.164   4.328   1.00 10.00 ? 442 GLU A HG2  7  
ATOM 7448  H HG3  . GLU A 1 33 ? -9.621  5.193   3.308   1.00 10.00 ? 442 GLU A HG3  7  
ATOM 7449  N N    . LYS A 1 34 ? -5.111  4.878   3.075   1.00 10.00 ? 443 LYS A N    7  
ATOM 7450  C CA   . LYS A 1 34 ? -4.127  5.498   3.940   1.00 10.00 ? 443 LYS A CA   7  
ATOM 7451  C C    . LYS A 1 34 ? -3.397  6.594   3.183   1.00 10.00 ? 443 LYS A C    7  
ATOM 7452  O O    . LYS A 1 34 ? -3.175  7.681   3.708   1.00 10.00 ? 443 LYS A O    7  
ATOM 7453  C CB   . LYS A 1 34 ? -3.132  4.460   4.461   1.00 10.00 ? 443 LYS A CB   7  
ATOM 7454  C CG   . LYS A 1 34 ? -3.551  3.818   5.775   1.00 10.00 ? 443 LYS A CG   7  
ATOM 7455  C CD   . LYS A 1 34 ? -4.962  3.253   5.700   1.00 10.00 ? 443 LYS A CD   7  
ATOM 7456  C CE   . LYS A 1 34 ? -5.047  1.879   6.346   1.00 10.00 ? 443 LYS A CE   7  
ATOM 7457  N NZ   . LYS A 1 34 ? -6.397  1.270   6.182   1.00 10.00 ? 443 LYS A NZ   7  
ATOM 7458  H H    . LYS A 1 34 ? -4.929  3.991   2.701   1.00 10.00 ? 443 LYS A H    7  
ATOM 7459  H HA   . LYS A 1 34 ? -4.649  5.939   4.776   1.00 10.00 ? 443 LYS A HA   7  
ATOM 7460  H HB2  . LYS A 1 34 ? -3.020  3.680   3.723   1.00 10.00 ? 443 LYS A HB2  7  
ATOM 7461  H HB3  . LYS A 1 34 ? -2.178  4.942   4.611   1.00 10.00 ? 443 LYS A HB3  7  
ATOM 7462  H HG2  . LYS A 1 34 ? -2.866  3.016   6.007   1.00 10.00 ? 443 LYS A HG2  7  
ATOM 7463  H HG3  . LYS A 1 34 ? -3.513  4.562   6.557   1.00 10.00 ? 443 LYS A HG3  7  
ATOM 7464  H HD2  . LYS A 1 34 ? -5.635  3.922   6.213   1.00 10.00 ? 443 LYS A HD2  7  
ATOM 7465  H HD3  . LYS A 1 34 ? -5.253  3.171   4.663   1.00 10.00 ? 443 LYS A HD3  7  
ATOM 7466  H HE2  . LYS A 1 34 ? -4.313  1.233   5.889   1.00 10.00 ? 443 LYS A HE2  7  
ATOM 7467  H HE3  . LYS A 1 34 ? -4.832  1.978   7.401   1.00 10.00 ? 443 LYS A HE3  7  
ATOM 7468  H HZ1  . LYS A 1 34 ? -6.376  0.271   6.469   1.00 10.00 ? 443 LYS A HZ1  7  
ATOM 7469  H HZ2  . LYS A 1 34 ? -6.696  1.327   5.187   1.00 10.00 ? 443 LYS A HZ2  7  
ATOM 7470  H HZ3  . LYS A 1 34 ? -7.090  1.774   6.770   1.00 10.00 ? 443 LYS A HZ3  7  
ATOM 7471  N N    . PHE A 1 35 ? -3.052  6.316   1.930   1.00 10.00 ? 444 PHE A N    7  
ATOM 7472  C CA   . PHE A 1 35 ? -2.375  7.297   1.102   1.00 10.00 ? 444 PHE A CA   7  
ATOM 7473  C C    . PHE A 1 35 ? -3.309  8.468   0.876   1.00 10.00 ? 444 PHE A C    7  
ATOM 7474  O O    . PHE A 1 35 ? -2.878  9.616   0.767   1.00 10.00 ? 444 PHE A O    7  
ATOM 7475  C CB   . PHE A 1 35 ? -1.928  6.665   -0.215  1.00 10.00 ? 444 PHE A CB   7  
ATOM 7476  C CG   . PHE A 1 35 ? -1.101  7.575   -1.075  1.00 10.00 ? 444 PHE A CG   7  
ATOM 7477  C CD1  . PHE A 1 35 ? -1.676  8.661   -1.713  1.00 10.00 ? 444 PHE A CD1  7  
ATOM 7478  C CD2  . PHE A 1 35 ? 0.253   7.339   -1.247  1.00 10.00 ? 444 PHE A CD2  7  
ATOM 7479  C CE1  . PHE A 1 35 ? -0.914  9.499   -2.507  1.00 10.00 ? 444 PHE A CE1  7  
ATOM 7480  C CE2  . PHE A 1 35 ? 1.020   8.172   -2.039  1.00 10.00 ? 444 PHE A CE2  7  
ATOM 7481  C CZ   . PHE A 1 35 ? 0.435   9.253   -2.670  1.00 10.00 ? 444 PHE A CZ   7  
ATOM 7482  H H    . PHE A 1 35 ? -3.281  5.448   1.549   1.00 10.00 ? 444 PHE A H    7  
ATOM 7483  H HA   . PHE A 1 35 ? -1.509  7.649   1.642   1.00 10.00 ? 444 PHE A HA   7  
ATOM 7484  H HB2  . PHE A 1 35 ? -1.327  5.790   0.010   1.00 10.00 ? 444 PHE A HB2  7  
ATOM 7485  H HB3  . PHE A 1 35 ? -2.797  6.364   -0.779  1.00 10.00 ? 444 PHE A HB3  7  
ATOM 7486  H HD1  . PHE A 1 35 ? -2.731  8.854   -1.585  1.00 10.00 ? 444 PHE A HD1  7  
ATOM 7487  H HD2  . PHE A 1 35 ? 0.710   6.493   -0.754  1.00 10.00 ? 444 PHE A HD2  7  
ATOM 7488  H HE1  . PHE A 1 35 ? -1.374  10.343  -2.998  1.00 10.00 ? 444 PHE A HE1  7  
ATOM 7489  H HE2  . PHE A 1 35 ? 2.074   7.978   -2.165  1.00 10.00 ? 444 PHE A HE2  7  
ATOM 7490  H HZ   . PHE A 1 35 ? 1.032   9.906   -3.290  1.00 10.00 ? 444 PHE A HZ   7  
ATOM 7491  N N    . MET A 1 36 ? -4.605  8.171   0.876   1.00 10.00 ? 445 MET A N    7  
ATOM 7492  C CA   . MET A 1 36 ? -5.609  9.202   0.746   1.00 10.00 ? 445 MET A CA   7  
ATOM 7493  C C    . MET A 1 36 ? -5.740  9.897   2.096   1.00 10.00 ? 445 MET A C    7  
ATOM 7494  O O    . MET A 1 36 ? -6.022  11.093  2.182   1.00 10.00 ? 445 MET A O    7  
ATOM 7495  C CB   . MET A 1 36 ? -6.951  8.607   0.312   1.00 10.00 ? 445 MET A CB   7  
ATOM 7496  C CG   . MET A 1 36 ? -7.119  8.518   -1.195  1.00 10.00 ? 445 MET A CG   7  
ATOM 7497  S SD   . MET A 1 36 ? -8.037  9.912   -1.876  1.00 10.00 ? 445 MET A SD   7  
ATOM 7498  C CE   . MET A 1 36 ? -7.607  9.787   -3.610  1.00 10.00 ? 445 MET A CE   7  
ATOM 7499  H H    . MET A 1 36 ? -4.886  7.244   1.017   1.00 10.00 ? 445 MET A H    7  
ATOM 7500  H HA   . MET A 1 36 ? -5.265  9.905   0.010   1.00 10.00 ? 445 MET A HA   7  
ATOM 7501  H HB2  . MET A 1 36 ? -7.040  7.612   0.723   1.00 10.00 ? 445 MET A HB2  7  
ATOM 7502  H HB3  . MET A 1 36 ? -7.747  9.222   0.705   1.00 10.00 ? 445 MET A HB3  7  
ATOM 7503  H HG2  . MET A 1 36 ? -6.140  8.494   -1.652  1.00 10.00 ? 445 MET A HG2  7  
ATOM 7504  H HG3  . MET A 1 36 ? -7.647  7.606   -1.432  1.00 10.00 ? 445 MET A HG3  7  
ATOM 7505  H HE1  . MET A 1 36 ? -7.137  8.833   -3.797  1.00 10.00 ? 445 MET A HE1  7  
ATOM 7506  H HE2  . MET A 1 36 ? -6.922  10.581  -3.869  1.00 10.00 ? 445 MET A HE2  7  
ATOM 7507  H HE3  . MET A 1 36 ? -8.500  9.872   -4.210  1.00 10.00 ? 445 MET A HE3  7  
ATOM 7508  N N    . GLN A 1 37 ? -5.492  9.116   3.149   1.00 10.00 ? 446 GLN A N    7  
ATOM 7509  C CA   . GLN A 1 37 ? -5.527  9.598   4.522   1.00 10.00 ? 446 GLN A CA   7  
ATOM 7510  C C    . GLN A 1 37 ? -4.341  10.513  4.775   1.00 10.00 ? 446 GLN A C    7  
ATOM 7511  O O    . GLN A 1 37 ? -4.435  11.511  5.486   1.00 10.00 ? 446 GLN A O    7  
ATOM 7512  C CB   . GLN A 1 37 ? -5.446  8.408   5.483   1.00 10.00 ? 446 GLN A CB   7  
ATOM 7513  C CG   . GLN A 1 37 ? -5.877  8.736   6.903   1.00 10.00 ? 446 GLN A CG   7  
ATOM 7514  C CD   . GLN A 1 37 ? -6.568  7.571   7.585   1.00 10.00 ? 446 GLN A CD   7  
ATOM 7515  O OE1  . GLN A 1 37 ? -6.205  7.180   8.692   1.00 10.00 ? 446 GLN A OE1  7  
ATOM 7516  N NE2  . GLN A 1 37 ? -7.574  7.011   6.921   1.00 10.00 ? 446 GLN A NE2  7  
ATOM 7517  H H    . GLN A 1 37 ? -5.252  8.181   2.992   1.00 10.00 ? 446 GLN A H    7  
ATOM 7518  H HA   . GLN A 1 37 ? -6.448  10.137  4.682   1.00 10.00 ? 446 GLN A HA   7  
ATOM 7519  H HB2  . GLN A 1 37 ? -6.080  7.617   5.112   1.00 10.00 ? 446 GLN A HB2  7  
ATOM 7520  H HB3  . GLN A 1 37 ? -4.416  8.049   5.512   1.00 10.00 ? 446 GLN A HB3  7  
ATOM 7521  H HG2  . GLN A 1 37 ? -5.003  9.002   7.478   1.00 10.00 ? 446 GLN A HG2  7  
ATOM 7522  H HG3  . GLN A 1 37 ? -6.558  9.575   6.874   1.00 10.00 ? 446 GLN A HG3  7  
ATOM 7523  H HE21 . GLN A 1 37 ? -7.810  7.375   6.043   1.00 10.00 ? 446 GLN A HE21 7  
ATOM 7524  H HE22 . GLN A 1 37 ? -8.038  6.254   7.337   1.00 10.00 ? 446 GLN A HE22 7  
ATOM 7525  N N    . HIS A 1 38 ? -3.216  10.131  4.188   1.00 10.00 ? 447 HIS A N    7  
ATOM 7526  C CA   . HIS A 1 38 ? -1.973  10.861  4.327   1.00 10.00 ? 447 HIS A CA   7  
ATOM 7527  C C    . HIS A 1 38 ? -1.620  11.571  3.019   1.00 10.00 ? 447 HIS A C    7  
ATOM 7528  O O    . HIS A 1 38 ? -1.026  10.979  2.120   1.00 10.00 ? 447 HIS A O    7  
ATOM 7529  C CB   . HIS A 1 38 ? -0.874  9.879   4.741   1.00 10.00 ? 447 HIS A CB   7  
ATOM 7530  C CG   . HIS A 1 38 ? -1.301  8.975   5.865   1.00 10.00 ? 447 HIS A CG   7  
ATOM 7531  N ND1  . HIS A 1 38 ? -1.457  9.423   7.158   1.00 10.00 ? 447 HIS A ND1  7  
ATOM 7532  C CD2  . HIS A 1 38 ? -1.644  7.657   5.883   1.00 10.00 ? 447 HIS A CD2  7  
ATOM 7533  C CE1  . HIS A 1 38 ? -1.874  8.430   7.922   1.00 10.00 ? 447 HIS A CE1  7  
ATOM 7534  N NE2  . HIS A 1 38 ? -1.998  7.349   7.174   1.00 10.00 ? 447 HIS A NE2  7  
ATOM 7535  H H    . HIS A 1 38 ? -3.222  9.313   3.647   1.00 10.00 ? 447 HIS A H    7  
ATOM 7536  H HA   . HIS A 1 38 ? -2.102  11.596  5.107   1.00 10.00 ? 447 HIS A HA   7  
ATOM 7537  H HB2  . HIS A 1 38 ? -0.613  9.261   3.896   1.00 10.00 ? 447 HIS A HB2  7  
ATOM 7538  H HB3  . HIS A 1 38 ? -0.005  10.431  5.067   1.00 10.00 ? 447 HIS A HB3  7  
ATOM 7539  H HD1  . HIS A 1 38 ? -1.285  10.336  7.472   1.00 10.00 ? 447 HIS A HD1  7  
ATOM 7540  H HD2  . HIS A 1 38 ? -1.642  6.969   5.041   1.00 10.00 ? 447 HIS A HD2  7  
ATOM 7541  H HE1  . HIS A 1 38 ? -2.068  8.486   8.981   1.00 10.00 ? 447 HIS A HE1  7  
ATOM 7542  H HE2  . HIS A 1 38 ? -2.447  6.525   7.453   1.00 10.00 ? 447 HIS A HE2  7  
ATOM 7543  N N    . PRO A 1 39 ? -2.007  12.858  2.897   1.00 10.00 ? 448 PRO A N    7  
ATOM 7544  C CA   . PRO A 1 39 ? -1.758  13.664  1.698   1.00 10.00 ? 448 PRO A CA   7  
ATOM 7545  C C    . PRO A 1 39 ? -0.402  13.399  1.051   1.00 10.00 ? 448 PRO A C    7  
ATOM 7546  O O    . PRO A 1 39 ? 0.609   13.978  1.446   1.00 10.00 ? 448 PRO A O    7  
ATOM 7547  C CB   . PRO A 1 39 ? -1.825  15.088  2.240   1.00 10.00 ? 448 PRO A CB   7  
ATOM 7548  C CG   . PRO A 1 39 ? -2.829  15.020  3.339   1.00 10.00 ? 448 PRO A CG   7  
ATOM 7549  C CD   . PRO A 1 39 ? -2.737  13.630  3.923   1.00 10.00 ? 448 PRO A CD   7  
ATOM 7550  H HA   . PRO A 1 39 ? -2.537  13.525  0.963   1.00 10.00 ? 448 PRO A HA   7  
ATOM 7551  H HB2  . PRO A 1 39 ? -0.852  15.382  2.609   1.00 10.00 ? 448 PRO A HB2  7  
ATOM 7552  H HB3  . PRO A 1 39 ? -2.139  15.762  1.458   1.00 10.00 ? 448 PRO A HB3  7  
ATOM 7553  H HG2  . PRO A 1 39 ? -2.598  15.757  4.093   1.00 10.00 ? 448 PRO A HG2  7  
ATOM 7554  H HG3  . PRO A 1 39 ? -3.819  15.191  2.940   1.00 10.00 ? 448 PRO A HG3  7  
ATOM 7555  H HD2  . PRO A 1 39 ? -2.186  13.650  4.852   1.00 10.00 ? 448 PRO A HD2  7  
ATOM 7556  H HD3  . PRO A 1 39 ? -3.724  13.222  4.081   1.00 10.00 ? 448 PRO A HD3  7  
ATOM 7557  N N    . LYS A 1 40 ? -0.400  12.530  0.040   1.00 10.00 ? 449 LYS A N    7  
ATOM 7558  C CA   . LYS A 1 40 ? 0.818   12.184  -0.693  1.00 10.00 ? 449 LYS A CA   7  
ATOM 7559  C C    . LYS A 1 40 ? 2.010   12.001  0.243   1.00 10.00 ? 449 LYS A C    7  
ATOM 7560  O O    . LYS A 1 40 ? 2.677   12.968  0.612   1.00 10.00 ? 449 LYS A O    7  
ATOM 7561  C CB   . LYS A 1 40 ? 1.135   13.264  -1.728  1.00 10.00 ? 449 LYS A CB   7  
ATOM 7562  C CG   . LYS A 1 40 ? 0.466   13.031  -3.073  1.00 10.00 ? 449 LYS A CG   7  
ATOM 7563  C CD   . LYS A 1 40 ? 1.360   13.468  -4.223  1.00 10.00 ? 449 LYS A CD   7  
ATOM 7564  C CE   . LYS A 1 40 ? 2.208   12.316  -4.739  1.00 10.00 ? 449 LYS A CE   7  
ATOM 7565  N NZ   . LYS A 1 40 ? 3.568   12.767  -5.146  1.00 10.00 ? 449 LYS A NZ   7  
ATOM 7566  H H    . LYS A 1 40 ? -1.247  12.117  -0.229  1.00 10.00 ? 449 LYS A H    7  
ATOM 7567  H HA   . LYS A 1 40 ? 0.638   11.253  -1.206  1.00 10.00 ? 449 LYS A HA   7  
ATOM 7568  H HB2  . LYS A 1 40 ? 0.805   14.219  -1.348  1.00 10.00 ? 449 LYS A HB2  7  
ATOM 7569  H HB3  . LYS A 1 40 ? 2.204   13.297  -1.882  1.00 10.00 ? 449 LYS A HB3  7  
ATOM 7570  H HG2  . LYS A 1 40 ? 0.250   11.978  -3.179  1.00 10.00 ? 449 LYS A HG2  7  
ATOM 7571  H HG3  . LYS A 1 40 ? -0.454  13.594  -3.109  1.00 10.00 ? 449 LYS A HG3  7  
ATOM 7572  H HD2  . LYS A 1 40 ? 0.741   13.834  -5.028  1.00 10.00 ? 449 LYS A HD2  7  
ATOM 7573  H HD3  . LYS A 1 40 ? 2.012   14.258  -3.879  1.00 10.00 ? 449 LYS A HD3  7  
ATOM 7574  H HE2  . LYS A 1 40 ? 2.303   11.578  -3.957  1.00 10.00 ? 449 LYS A HE2  7  
ATOM 7575  H HE3  . LYS A 1 40 ? 1.713   11.876  -5.591  1.00 10.00 ? 449 LYS A HE3  7  
ATOM 7576  H HZ1  . LYS A 1 40 ? 4.141   12.976  -4.304  1.00 10.00 ? 449 LYS A HZ1  7  
ATOM 7577  H HZ2  . LYS A 1 40 ? 3.501   13.625  -5.728  1.00 10.00 ? 449 LYS A HZ2  7  
ATOM 7578  H HZ3  . LYS A 1 40 ? 4.040   12.022  -5.698  1.00 10.00 ? 449 LYS A HZ3  7  
ATOM 7579  N N    . ASN A 1 41 ? 2.279   10.756  0.620   1.00 10.00 ? 450 ASN A N    7  
ATOM 7580  C CA   . ASN A 1 41 ? 3.394   10.458  1.506   1.00 10.00 ? 450 ASN A CA   7  
ATOM 7581  C C    . ASN A 1 41 ? 4.107   9.179   1.087   1.00 10.00 ? 450 ASN A C    7  
ATOM 7582  O O    . ASN A 1 41 ? 5.316   9.177   0.859   1.00 10.00 ? 450 ASN A O    7  
ATOM 7583  C CB   . ASN A 1 41 ? 2.914   10.339  2.957   1.00 10.00 ? 450 ASN A CB   7  
ATOM 7584  C CG   . ASN A 1 41 ? 1.723   9.411   3.104   1.00 10.00 ? 450 ASN A CG   7  
ATOM 7585  O OD1  . ASN A 1 41 ? 0.850   9.363   2.238   1.00 10.00 ? 450 ASN A OD1  7  
ATOM 7586  N ND2  . ASN A 1 41 ? 1.680   8.664   4.204   1.00 10.00 ? 450 ASN A ND2  7  
ATOM 7587  H H    . ASN A 1 41 ? 1.716   10.023  0.291   1.00 10.00 ? 450 ASN A H    7  
ATOM 7588  H HA   . ASN A 1 41 ? 4.092   11.274  1.438   1.00 10.00 ? 450 ASN A HA   7  
ATOM 7589  H HB2  . ASN A 1 41 ? 3.720   9.956   3.566   1.00 10.00 ? 450 ASN A HB2  7  
ATOM 7590  H HB3  . ASN A 1 41 ? 2.631   11.317  3.317   1.00 10.00 ? 450 ASN A HB3  7  
ATOM 7591  H HD21 . ASN A 1 41 ? 2.409   8.749   4.853   1.00 10.00 ? 450 ASN A HD21 7  
ATOM 7592  H HD22 . ASN A 1 41 ? 0.919   8.058   4.320   1.00 10.00 ? 450 ASN A HD22 7  
ATOM 7593  N N    . PHE A 1 42 ? 3.354   8.089   1.006   1.00 10.00 ? 451 PHE A N    7  
ATOM 7594  C CA   . PHE A 1 42 ? 3.913   6.793   0.636   1.00 10.00 ? 451 PHE A CA   7  
ATOM 7595  C C    . PHE A 1 42 ? 4.882   6.290   1.709   1.00 10.00 ? 451 PHE A C    7  
ATOM 7596  O O    . PHE A 1 42 ? 5.452   5.206   1.580   1.00 10.00 ? 451 PHE A O    7  
ATOM 7597  C CB   . PHE A 1 42 ? 4.625   6.881   -0.722  1.00 10.00 ? 451 PHE A CB   7  
ATOM 7598  C CG   . PHE A 1 42 ? 3.875   6.264   -1.881  1.00 10.00 ? 451 PHE A CG   7  
ATOM 7599  C CD1  . PHE A 1 42 ? 2.724   5.511   -1.685  1.00 10.00 ? 451 PHE A CD1  7  
ATOM 7600  C CD2  . PHE A 1 42 ? 4.334   6.441   -3.177  1.00 10.00 ? 451 PHE A CD2  7  
ATOM 7601  C CE1  . PHE A 1 42 ? 2.051   4.954   -2.754  1.00 10.00 ? 451 PHE A CE1  7  
ATOM 7602  C CE2  . PHE A 1 42 ? 3.665   5.883   -4.249  1.00 10.00 ? 451 PHE A CE2  7  
ATOM 7603  C CZ   . PHE A 1 42 ? 2.521   5.140   -4.038  1.00 10.00 ? 451 PHE A CZ   7  
ATOM 7604  H H    . PHE A 1 42 ? 2.401   8.153   1.212   1.00 10.00 ? 451 PHE A H    7  
ATOM 7605  H HA   . PHE A 1 42 ? 3.098   6.097   0.564   1.00 10.00 ? 451 PHE A HA   7  
ATOM 7606  H HB2  . PHE A 1 42 ? 4.790   7.919   -0.961  1.00 10.00 ? 451 PHE A HB2  7  
ATOM 7607  H HB3  . PHE A 1 42 ? 5.581   6.383   -0.646  1.00 10.00 ? 451 PHE A HB3  7  
ATOM 7608  H HD1  . PHE A 1 42 ? 2.351   5.361   -0.685  1.00 10.00 ? 451 PHE A HD1  7  
ATOM 7609  H HD2  . PHE A 1 42 ? 5.227   7.022   -3.347  1.00 10.00 ? 451 PHE A HD2  7  
ATOM 7610  H HE1  . PHE A 1 42 ? 1.155   4.375   -2.584  1.00 10.00 ? 451 PHE A HE1  7  
ATOM 7611  H HE2  . PHE A 1 42 ? 4.033   6.032   -5.253  1.00 10.00 ? 451 PHE A HE2  7  
ATOM 7612  H HZ   . PHE A 1 42 ? 1.999   4.701   -4.874  1.00 10.00 ? 451 PHE A HZ   7  
ATOM 7613  N N    . GLY A 1 43 ? 5.054   7.074   2.773   1.00 10.00 ? 452 GLY A N    7  
ATOM 7614  C CA   . GLY A 1 43 ? 5.935   6.682   3.851   1.00 10.00 ? 452 GLY A CA   7  
ATOM 7615  C C    . GLY A 1 43 ? 5.194   5.899   4.912   1.00 10.00 ? 452 GLY A C    7  
ATOM 7616  O O    . GLY A 1 43 ? 5.674   4.864   5.376   1.00 10.00 ? 452 GLY A O    7  
ATOM 7617  H H    . GLY A 1 43 ? 4.569   7.917   2.833   1.00 10.00 ? 452 GLY A H    7  
ATOM 7618  H HA2  . GLY A 1 43 ? 6.732   6.071   3.452   1.00 10.00 ? 452 GLY A HA2  7  
ATOM 7619  H HA3  . GLY A 1 43 ? 6.359   7.567   4.301   1.00 10.00 ? 452 GLY A HA3  7  
ATOM 7620  N N    . LEU A 1 44 ? 4.011   6.383   5.284   1.00 10.00 ? 453 LEU A N    7  
ATOM 7621  C CA   . LEU A 1 44 ? 3.199   5.703   6.282   1.00 10.00 ? 453 LEU A CA   7  
ATOM 7622  C C    . LEU A 1 44 ? 2.687   4.389   5.724   1.00 10.00 ? 453 LEU A C    7  
ATOM 7623  O O    . LEU A 1 44 ? 2.878   3.332   6.323   1.00 10.00 ? 453 LEU A O    7  
ATOM 7624  C CB   . LEU A 1 44 ? 2.018   6.565   6.725   1.00 10.00 ? 453 LEU A CB   7  
ATOM 7625  C CG   . LEU A 1 44 ? 1.010   5.835   7.614   1.00 10.00 ? 453 LEU A CG   7  
ATOM 7626  C CD1  . LEU A 1 44 ? 0.413   6.781   8.641   1.00 10.00 ? 453 LEU A CD1  7  
ATOM 7627  C CD2  . LEU A 1 44 ? -0.079  5.183   6.766   1.00 10.00 ? 453 LEU A CD2  7  
ATOM 7628  H H    . LEU A 1 44 ? 3.674   7.204   4.869   1.00 10.00 ? 453 LEU A H    7  
ATOM 7629  H HA   . LEU A 1 44 ? 3.825   5.497   7.132   1.00 10.00 ? 453 LEU A HA   7  
ATOM 7630  H HB2  . LEU A 1 44 ? 2.402   7.417   7.267   1.00 10.00 ? 453 LEU A HB2  7  
ATOM 7631  H HB3  . LEU A 1 44 ? 1.502   6.917   5.845   1.00 10.00 ? 453 LEU A HB3  7  
ATOM 7632  H HG   . LEU A 1 44 ? 1.522   5.055   8.150   1.00 10.00 ? 453 LEU A HG   7  
ATOM 7633  H HD11 . LEU A 1 44 ? 0.978   6.715   9.559   1.00 10.00 ? 453 LEU A HD11 7  
ATOM 7634  H HD12 . LEU A 1 44 ? -0.614  6.507   8.829   1.00 10.00 ? 453 LEU A HD12 7  
ATOM 7635  H HD13 . LEU A 1 44 ? 0.456   7.792   8.264   1.00 10.00 ? 453 LEU A HD13 7  
ATOM 7636  H HD21 . LEU A 1 44 ? -1.021  5.228   7.291   1.00 10.00 ? 453 LEU A HD21 7  
ATOM 7637  H HD22 . LEU A 1 44 ? 0.177   4.150   6.579   1.00 10.00 ? 453 LEU A HD22 7  
ATOM 7638  H HD23 . LEU A 1 44 ? -0.165  5.705   5.826   1.00 10.00 ? 453 LEU A HD23 7  
ATOM 7639  N N    . ILE A 1 45 ? 2.049   4.458   4.562   1.00 10.00 ? 454 ILE A N    7  
ATOM 7640  C CA   . ILE A 1 45 ? 1.530   3.266   3.919   1.00 10.00 ? 454 ILE A CA   7  
ATOM 7641  C C    . ILE A 1 45 ? 2.642   2.247   3.766   1.00 10.00 ? 454 ILE A C    7  
ATOM 7642  O O    . ILE A 1 45 ? 2.534   1.116   4.234   1.00 10.00 ? 454 ILE A O    7  
ATOM 7643  C CB   . ILE A 1 45 ? 0.902   3.602   2.556   1.00 10.00 ? 454 ILE A CB   7  
ATOM 7644  C CG1  . ILE A 1 45 ? -0.447  4.257   2.789   1.00 10.00 ? 454 ILE A CG1  7  
ATOM 7645  C CG2  . ILE A 1 45 ? 0.762   2.363   1.679   1.00 10.00 ? 454 ILE A CG2  7  
ATOM 7646  C CD1  . ILE A 1 45 ? -0.371  5.763   2.716   1.00 10.00 ? 454 ILE A CD1  7  
ATOM 7647  H H    . ILE A 1 45 ? 1.936   5.328   4.122   1.00 10.00 ? 454 ILE A H    7  
ATOM 7648  H HA   . ILE A 1 45 ? 0.765   2.858   4.554   1.00 10.00 ? 454 ILE A HA   7  
ATOM 7649  H HB   . ILE A 1 45 ? 1.543   4.310   2.055   1.00 10.00 ? 454 ILE A HB   7  
ATOM 7650  H HG12 . ILE A 1 45 ? -1.155  3.910   2.046   1.00 10.00 ? 454 ILE A HG12 7  
ATOM 7651  H HG13 . ILE A 1 45 ? -0.795  3.987   3.774   1.00 10.00 ? 454 ILE A HG13 7  
ATOM 7652  H HG21 . ILE A 1 45 ? -0.168  2.412   1.132   1.00 10.00 ? 454 ILE A HG21 7  
ATOM 7653  H HG22 . ILE A 1 45 ? 0.766   1.480   2.301   1.00 10.00 ? 454 ILE A HG22 7  
ATOM 7654  H HG23 . ILE A 1 45 ? 1.586   2.319   0.984   1.00 10.00 ? 454 ILE A HG23 7  
ATOM 7655  H HD11 . ILE A 1 45 ? 0.567   6.096   3.129   1.00 10.00 ? 454 ILE A HD11 7  
ATOM 7656  H HD12 . ILE A 1 45 ? -1.180  6.193   3.280   1.00 10.00 ? 454 ILE A HD12 7  
ATOM 7657  H HD13 . ILE A 1 45 ? -0.437  6.074   1.688   1.00 10.00 ? 454 ILE A HD13 7  
ATOM 7658  N N    . ALA A 1 46 ? 3.733   2.685   3.157   1.00 10.00 ? 455 ALA A N    7  
ATOM 7659  C CA   . ALA A 1 46 ? 4.903   1.839   2.980   1.00 10.00 ? 455 ALA A CA   7  
ATOM 7660  C C    . ALA A 1 46 ? 5.443   1.384   4.335   1.00 10.00 ? 455 ALA A C    7  
ATOM 7661  O O    . ALA A 1 46 ? 6.335   0.539   4.406   1.00 10.00 ? 455 ALA A O    7  
ATOM 7662  C CB   . ALA A 1 46 ? 5.978   2.583   2.202   1.00 10.00 ? 455 ALA A CB   7  
ATOM 7663  H H    . ALA A 1 46 ? 3.761   3.612   2.849   1.00 10.00 ? 455 ALA A H    7  
ATOM 7664  H HA   . ALA A 1 46 ? 4.610   0.973   2.407   1.00 10.00 ? 455 ALA A HA   7  
ATOM 7665  H HB1  . ALA A 1 46 ? 6.316   3.432   2.777   1.00 10.00 ? 455 ALA A HB1  7  
ATOM 7666  H HB2  . ALA A 1 46 ? 5.572   2.923   1.261   1.00 10.00 ? 455 ALA A HB2  7  
ATOM 7667  H HB3  . ALA A 1 46 ? 6.812   1.920   2.017   1.00 10.00 ? 455 ALA A HB3  7  
ATOM 7668  N N    . SER A 1 47 ? 4.895   1.952   5.412   1.00 10.00 ? 456 SER A N    7  
ATOM 7669  C CA   . SER A 1 47 ? 5.320   1.607   6.762   1.00 10.00 ? 456 SER A CA   7  
ATOM 7670  C C    . SER A 1 47 ? 4.439   0.507   7.346   1.00 10.00 ? 456 SER A C    7  
ATOM 7671  O O    . SER A 1 47 ? 4.930   -0.388  8.034   1.00 10.00 ? 456 SER A O    7  
ATOM 7672  C CB   . SER A 1 47 ? 5.284   2.843   7.666   1.00 10.00 ? 456 SER A CB   7  
ATOM 7673  O OG   . SER A 1 47 ? 6.573   3.142   8.172   1.00 10.00 ? 456 SER A OG   7  
ATOM 7674  H H    . SER A 1 47 ? 4.187   2.620   5.295   1.00 10.00 ? 456 SER A H    7  
ATOM 7675  H HA   . SER A 1 47 ? 6.335   1.245   6.706   1.00 10.00 ? 456 SER A HA   7  
ATOM 7676  H HB2  . SER A 1 47 ? 4.929   3.691   7.098   1.00 10.00 ? 456 SER A HB2  7  
ATOM 7677  H HB3  . SER A 1 47 ? 4.617   2.662   8.496   1.00 10.00 ? 456 SER A HB3  7  
ATOM 7678  H HG   . SER A 1 47 ? 6.775   4.066   8.007   1.00 10.00 ? 456 SER A HG   7  
ATOM 7679  N N    . PHE A 1 48 ? 3.136   0.569   7.068   1.00 10.00 ? 457 PHE A N    7  
ATOM 7680  C CA   . PHE A 1 48 ? 2.215   -0.440  7.576   1.00 10.00 ? 457 PHE A CA   7  
ATOM 7681  C C    . PHE A 1 48 ? 2.230   -1.671  6.671   1.00 10.00 ? 457 PHE A C    7  
ATOM 7682  O O    . PHE A 1 48 ? 2.132   -2.802  7.145   1.00 10.00 ? 457 PHE A O    7  
ATOM 7683  C CB   . PHE A 1 48 ? 0.798   0.140   7.732   1.00 10.00 ? 457 PHE A CB   7  
ATOM 7684  C CG   . PHE A 1 48 ? -0.034  0.121   6.481   1.00 10.00 ? 457 PHE A CG   7  
ATOM 7685  C CD1  . PHE A 1 48 ? -0.537  -1.073  5.987   1.00 10.00 ? 457 PHE A CD1  7  
ATOM 7686  C CD2  . PHE A 1 48 ? -0.314  1.298   5.796   1.00 10.00 ? 457 PHE A CD2  7  
ATOM 7687  C CE1  . PHE A 1 48 ? -1.298  -1.097  4.841   1.00 10.00 ? 457 PHE A CE1  7  
ATOM 7688  C CE2  . PHE A 1 48 ? -1.079  1.275   4.648   1.00 10.00 ? 457 PHE A CE2  7  
ATOM 7689  C CZ   . PHE A 1 48 ? -1.571  0.080   4.171   1.00 10.00 ? 457 PHE A CZ   7  
ATOM 7690  H H    . PHE A 1 48 ? 2.792   1.299   6.508   1.00 10.00 ? 457 PHE A H    7  
ATOM 7691  H HA   . PHE A 1 48 ? 2.575   -0.737  8.551   1.00 10.00 ? 457 PHE A HA   7  
ATOM 7692  H HB2  . PHE A 1 48 ? 0.270   -0.428  8.482   1.00 10.00 ? 457 PHE A HB2  7  
ATOM 7693  H HB3  . PHE A 1 48 ? 0.876   1.166   8.062   1.00 10.00 ? 457 PHE A HB3  7  
ATOM 7694  H HD1  . PHE A 1 48 ? -0.333  -1.996  6.514   1.00 10.00 ? 457 PHE A HD1  7  
ATOM 7695  H HD2  . PHE A 1 48 ? 0.071   2.243   6.164   1.00 10.00 ? 457 PHE A HD2  7  
ATOM 7696  H HE1  . PHE A 1 48 ? -1.674  -2.037  4.469   1.00 10.00 ? 457 PHE A HE1  7  
ATOM 7697  H HE2  . PHE A 1 48 ? -1.293  2.192   4.123   1.00 10.00 ? 457 PHE A HE2  7  
ATOM 7698  H HZ   . PHE A 1 48 ? -2.167  0.068   3.274   1.00 10.00 ? 457 PHE A HZ   7  
ATOM 7699  N N    . LEU A 1 49 ? 2.391   -1.443  5.367   1.00 10.00 ? 458 LEU A N    7  
ATOM 7700  C CA   . LEU A 1 49 ? 2.459   -2.536  4.400   1.00 10.00 ? 458 LEU A CA   7  
ATOM 7701  C C    . LEU A 1 49 ? 3.878   -2.637  3.840   1.00 10.00 ? 458 LEU A C    7  
ATOM 7702  O O    . LEU A 1 49 ? 4.083   -2.712  2.632   1.00 10.00 ? 458 LEU A O    7  
ATOM 7703  C CB   . LEU A 1 49 ? 1.439   -2.341  3.269   1.00 10.00 ? 458 LEU A CB   7  
ATOM 7704  C CG   . LEU A 1 49 ? 1.336   -0.923  2.697   1.00 10.00 ? 458 LEU A CG   7  
ATOM 7705  C CD1  . LEU A 1 49 ? 2.680   -0.470  2.152   1.00 10.00 ? 458 LEU A CD1  7  
ATOM 7706  C CD2  . LEU A 1 49 ? 0.273   -0.861  1.606   1.00 10.00 ? 458 LEU A CD2  7  
ATOM 7707  H H    . LEU A 1 49 ? 2.488   -0.521  5.052   1.00 10.00 ? 458 LEU A H    7  
ATOM 7708  H HA   . LEU A 1 49 ? 2.231   -3.452  4.927   1.00 10.00 ? 458 LEU A HA   7  
ATOM 7709  H HB2  . LEU A 1 49 ? 1.699   -3.010  2.463   1.00 10.00 ? 458 LEU A HB2  7  
ATOM 7710  H HB3  . LEU A 1 49 ? 0.467   -2.622  3.643   1.00 10.00 ? 458 LEU A HB3  7  
ATOM 7711  H HG   . LEU A 1 49 ? 1.047   -0.244  3.486   1.00 10.00 ? 458 LEU A HG   7  
ATOM 7712  H HD11 . LEU A 1 49 ? 2.572   0.501   1.691   1.00 10.00 ? 458 LEU A HD11 7  
ATOM 7713  H HD12 . LEU A 1 49 ? 3.027   -1.181  1.420   1.00 10.00 ? 458 LEU A HD12 7  
ATOM 7714  H HD13 . LEU A 1 49 ? 3.393   -0.409  2.959   1.00 10.00 ? 458 LEU A HD13 7  
ATOM 7715  H HD21 . LEU A 1 49 ? -0.054  -1.861  1.364   1.00 10.00 ? 458 LEU A HD21 7  
ATOM 7716  H HD22 . LEU A 1 49 ? 0.688   -0.395  0.724   1.00 10.00 ? 458 LEU A HD22 7  
ATOM 7717  H HD23 . LEU A 1 49 ? -0.572  -0.281  1.953   1.00 10.00 ? 458 LEU A HD23 7  
ATOM 7718  N N    . GLU A 1 50 ? 4.846   -2.617  4.758   1.00 10.00 ? 459 GLU A N    7  
ATOM 7719  C CA   . GLU A 1 50 ? 6.282   -2.680  4.444   1.00 10.00 ? 459 GLU A CA   7  
ATOM 7720  C C    . GLU A 1 50 ? 6.585   -3.388  3.125   1.00 10.00 ? 459 GLU A C    7  
ATOM 7721  O O    . GLU A 1 50 ? 7.416   -2.925  2.344   1.00 10.00 ? 459 GLU A O    7  
ATOM 7722  C CB   . GLU A 1 50 ? 7.031   -3.380  5.579   1.00 10.00 ? 459 GLU A CB   7  
ATOM 7723  C CG   . GLU A 1 50 ? 7.103   -2.558  6.857   1.00 10.00 ? 459 GLU A CG   7  
ATOM 7724  C CD   . GLU A 1 50 ? 7.789   -3.300  7.988   1.00 10.00 ? 459 GLU A CD   7  
ATOM 7725  O OE1  . GLU A 1 50 ? 8.944   -3.733  7.800   1.00 10.00 ? 459 GLU A OE1  7  
ATOM 7726  O OE2  . GLU A 1 50 ? 7.170   -3.446  9.063   1.00 10.00 ? 459 GLU A OE2  7  
ATOM 7727  H H    . GLU A 1 50 ? 4.583   -2.542  5.694   1.00 10.00 ? 459 GLU A H    7  
ATOM 7728  H HA   . GLU A 1 50 ? 6.642   -1.666  4.375   1.00 10.00 ? 459 GLU A HA   7  
ATOM 7729  H HB2  . GLU A 1 50 ? 6.532   -4.311  5.804   1.00 10.00 ? 459 GLU A HB2  7  
ATOM 7730  H HB3  . GLU A 1 50 ? 8.039   -3.590  5.255   1.00 10.00 ? 459 GLU A HB3  7  
ATOM 7731  H HG2  . GLU A 1 50 ? 7.655   -1.652  6.656   1.00 10.00 ? 459 GLU A HG2  7  
ATOM 7732  H HG3  . GLU A 1 50 ? 6.100   -2.308  7.166   1.00 10.00 ? 459 GLU A HG3  7  
ATOM 7733  N N    . ARG A 1 51 ? 5.916   -4.509  2.878   1.00 10.00 ? 460 ARG A N    7  
ATOM 7734  C CA   . ARG A 1 51 ? 6.128   -5.271  1.650   1.00 10.00 ? 460 ARG A CA   7  
ATOM 7735  C C    . ARG A 1 51 ? 6.116   -4.359  0.425   1.00 10.00 ? 460 ARG A C    7  
ATOM 7736  O O    . ARG A 1 51 ? 6.709   -4.678  -0.606  1.00 10.00 ? 460 ARG A O    7  
ATOM 7737  C CB   . ARG A 1 51 ? 5.058   -6.356  1.508   1.00 10.00 ? 460 ARG A CB   7  
ATOM 7738  C CG   . ARG A 1 51 ? 5.502   -7.722  2.011   1.00 10.00 ? 460 ARG A CG   7  
ATOM 7739  C CD   . ARG A 1 51 ? 6.053   -7.646  3.426   1.00 10.00 ? 460 ARG A CD   7  
ATOM 7740  N NE   . ARG A 1 51 ? 6.491   -8.950  3.915   1.00 10.00 ? 460 ARG A NE   7  
ATOM 7741  C CZ   . ARG A 1 51 ? 5.668   -9.866  4.425   1.00 10.00 ? 460 ARG A CZ   7  
ATOM 7742  N NH1  . ARG A 1 51 ? 4.366   -9.626  4.511   1.00 10.00 ? 460 ARG A NH1  7  
ATOM 7743  N NH2  . ARG A 1 51 ? 6.151   -11.027 4.848   1.00 10.00 ? 460 ARG A NH2  7  
ATOM 7744  H H    . ARG A 1 51 ? 5.268   -4.832  3.535   1.00 10.00 ? 460 ARG A H    7  
ATOM 7745  H HA   . ARG A 1 51 ? 7.097   -5.744  1.720   1.00 10.00 ? 460 ARG A HA   7  
ATOM 7746  H HB2  . ARG A 1 51 ? 4.183   -6.057  2.066   1.00 10.00 ? 460 ARG A HB2  7  
ATOM 7747  H HB3  . ARG A 1 51 ? 4.794   -6.450  0.465   1.00 10.00 ? 460 ARG A HB3  7  
ATOM 7748  H HG2  . ARG A 1 51 ? 4.654   -8.390  2.002   1.00 10.00 ? 460 ARG A HG2  7  
ATOM 7749  H HG3  . ARG A 1 51 ? 6.270   -8.103  1.355   1.00 10.00 ? 460 ARG A HG3  7  
ATOM 7750  H HD2  . ARG A 1 51 ? 6.895   -6.969  3.435   1.00 10.00 ? 460 ARG A HD2  7  
ATOM 7751  H HD3  . ARG A 1 51 ? 5.281   -7.266  4.080   1.00 10.00 ? 460 ARG A HD3  7  
ATOM 7752  H HE   . ARG A 1 51 ? 7.447   -9.156  3.863   1.00 10.00 ? 460 ARG A HE   7  
ATOM 7753  H HH11 . ARG A 1 51 ? 3.995   -8.755  4.192   1.00 10.00 ? 460 ARG A HH11 7  
ATOM 7754  H HH12 . ARG A 1 51 ? 3.755   -10.319 4.894   1.00 10.00 ? 460 ARG A HH12 7  
ATOM 7755  H HH21 . ARG A 1 51 ? 7.131   -11.213 4.786   1.00 10.00 ? 460 ARG A HH21 7  
ATOM 7756  H HH22 . ARG A 1 51 ? 5.535   -11.714 5.231   1.00 10.00 ? 460 ARG A HH22 7  
ATOM 7757  N N    . LYS A 1 52 ? 5.437   -3.224  0.548   1.00 10.00 ? 461 LYS A N    7  
ATOM 7758  C CA   . LYS A 1 52 ? 5.343   -2.261  -0.542  1.00 10.00 ? 461 LYS A CA   7  
ATOM 7759  C C    . LYS A 1 52 ? 6.145   -1.004  -0.224  1.00 10.00 ? 461 LYS A C    7  
ATOM 7760  O O    . LYS A 1 52 ? 5.807   -0.256  0.694   1.00 10.00 ? 461 LYS A O    7  
ATOM 7761  C CB   . LYS A 1 52 ? 3.882   -1.878  -0.812  1.00 10.00 ? 461 LYS A CB   7  
ATOM 7762  C CG   . LYS A 1 52 ? 2.861   -2.884  -0.296  1.00 10.00 ? 461 LYS A CG   7  
ATOM 7763  C CD   . LYS A 1 52 ? 2.433   -3.840  -1.396  1.00 10.00 ? 461 LYS A CD   7  
ATOM 7764  C CE   . LYS A 1 52 ? 3.194   -5.153  -1.325  1.00 10.00 ? 461 LYS A CE   7  
ATOM 7765  N NZ   . LYS A 1 52 ? 2.587   -6.096  -0.347  1.00 10.00 ? 461 LYS A NZ   7  
ATOM 7766  H H    . LYS A 1 52 ? 4.986   -3.027  1.393   1.00 10.00 ? 461 LYS A H    7  
ATOM 7767  H HA   . LYS A 1 52 ? 5.755   -2.722  -1.427  1.00 10.00 ? 461 LYS A HA   7  
ATOM 7768  H HB2  . LYS A 1 52 ? 3.681   -0.926  -0.346  1.00 10.00 ? 461 LYS A HB2  7  
ATOM 7769  H HB3  . LYS A 1 52 ? 3.745   -1.778  -1.879  1.00 10.00 ? 461 LYS A HB3  7  
ATOM 7770  H HG2  . LYS A 1 52 ? 3.293   -3.448  0.518   1.00 10.00 ? 461 LYS A HG2  7  
ATOM 7771  H HG3  . LYS A 1 52 ? 1.994   -2.348  0.061   1.00 10.00 ? 461 LYS A HG3  7  
ATOM 7772  H HD2  . LYS A 1 52 ? 1.377   -4.041  -1.296  1.00 10.00 ? 461 LYS A HD2  7  
ATOM 7773  H HD3  . LYS A 1 52 ? 2.625   -3.376  -2.354  1.00 10.00 ? 461 LYS A HD3  7  
ATOM 7774  H HE2  . LYS A 1 52 ? 3.184   -5.610  -2.303  1.00 10.00 ? 461 LYS A HE2  7  
ATOM 7775  H HE3  . LYS A 1 52 ? 4.213   -4.950  -1.033  1.00 10.00 ? 461 LYS A HE3  7  
ATOM 7776  H HZ1  . LYS A 1 52 ? 2.625   -5.691  0.610   1.00 10.00 ? 461 LYS A HZ1  7  
ATOM 7777  H HZ2  . LYS A 1 52 ? 3.103   -6.998  -0.352  1.00 10.00 ? 461 LYS A HZ2  7  
ATOM 7778  H HZ3  . LYS A 1 52 ? 1.595   -6.277  -0.597  1.00 10.00 ? 461 LYS A HZ3  7  
ATOM 7779  N N    . THR A 1 53 ? 7.199   -0.772  -0.994  1.00 10.00 ? 462 THR A N    7  
ATOM 7780  C CA   . THR A 1 53 ? 8.041   0.402   -0.798  1.00 10.00 ? 462 THR A CA   7  
ATOM 7781  C C    . THR A 1 53 ? 7.379   1.636   -1.403  1.00 10.00 ? 462 THR A C    7  
ATOM 7782  O O    . THR A 1 53 ? 6.384   1.526   -2.116  1.00 10.00 ? 462 THR A O    7  
ATOM 7783  C CB   . THR A 1 53 ? 9.421   0.185   -1.427  1.00 10.00 ? 462 THR A CB   7  
ATOM 7784  O OG1  . THR A 1 53 ? 9.589   -1.167  -1.818  1.00 10.00 ? 462 THR A OG1  7  
ATOM 7785  C CG2  . THR A 1 53 ? 10.563  0.540   -0.499  1.00 10.00 ? 462 THR A CG2  7  
ATOM 7786  H H    . THR A 1 53 ? 7.412   -1.402  -1.713  1.00 10.00 ? 462 THR A H    7  
ATOM 7787  H HA   . THR A 1 53 ? 8.158   0.554   0.265   1.00 10.00 ? 462 THR A HA   7  
ATOM 7788  H HB   . THR A 1 53 ? 9.506   0.806   -2.308  1.00 10.00 ? 462 THR A HB   7  
ATOM 7789  H HG1  . THR A 1 53 ? 9.981   -1.200  -2.693  1.00 10.00 ? 462 THR A HG1  7  
ATOM 7790  H HG21 . THR A 1 53 ? 10.668  -0.229  0.253   1.00 10.00 ? 462 THR A HG21 7  
ATOM 7791  H HG22 . THR A 1 53 ? 10.357  1.485   -0.020  1.00 10.00 ? 462 THR A HG22 7  
ATOM 7792  H HG23 . THR A 1 53 ? 11.478  0.614   -1.067  1.00 10.00 ? 462 THR A HG23 7  
ATOM 7793  N N    . VAL A 1 54 ? 7.932   2.809   -1.116  1.00 10.00 ? 463 VAL A N    7  
ATOM 7794  C CA   . VAL A 1 54 ? 7.381   4.054   -1.641  1.00 10.00 ? 463 VAL A CA   7  
ATOM 7795  C C    . VAL A 1 54 ? 7.402   4.053   -3.168  1.00 10.00 ? 463 VAL A C    7  
ATOM 7796  O O    . VAL A 1 54 ? 6.363   4.207   -3.811  1.00 10.00 ? 463 VAL A O    7  
ATOM 7797  C CB   . VAL A 1 54 ? 8.154   5.282   -1.108  1.00 10.00 ? 463 VAL A CB   7  
ATOM 7798  C CG1  . VAL A 1 54 ? 7.727   6.556   -1.828  1.00 10.00 ? 463 VAL A CG1  7  
ATOM 7799  C CG2  . VAL A 1 54 ? 7.954   5.423   0.395   1.00 10.00 ? 463 VAL A CG2  7  
ATOM 7800  H H    . VAL A 1 54 ? 8.725   2.839   -0.542  1.00 10.00 ? 463 VAL A H    7  
ATOM 7801  H HA   . VAL A 1 54 ? 6.355   4.127   -1.310  1.00 10.00 ? 463 VAL A HA   7  
ATOM 7802  H HB   . VAL A 1 54 ? 9.206   5.127   -1.295  1.00 10.00 ? 463 VAL A HB   7  
ATOM 7803  H HG11 . VAL A 1 54 ? 8.519   6.880   -2.486  1.00 10.00 ? 463 VAL A HG11 7  
ATOM 7804  H HG12 . VAL A 1 54 ? 7.524   7.331   -1.103  1.00 10.00 ? 463 VAL A HG12 7  
ATOM 7805  H HG13 . VAL A 1 54 ? 6.836   6.361   -2.406  1.00 10.00 ? 463 VAL A HG13 7  
ATOM 7806  H HG21 . VAL A 1 54 ? 7.204   6.177   0.591   1.00 10.00 ? 463 VAL A HG21 7  
ATOM 7807  H HG22 . VAL A 1 54 ? 8.886   5.714   0.856   1.00 10.00 ? 463 VAL A HG22 7  
ATOM 7808  H HG23 . VAL A 1 54 ? 7.630   4.477   0.805   1.00 10.00 ? 463 VAL A HG23 7  
ATOM 7809  N N    . ALA A 1 55 ? 8.584   3.869   -3.741  1.00 10.00 ? 464 ALA A N    7  
ATOM 7810  C CA   . ALA A 1 55 ? 8.731   3.838   -5.191  1.00 10.00 ? 464 ALA A CA   7  
ATOM 7811  C C    . ALA A 1 55 ? 8.119   2.569   -5.776  1.00 10.00 ? 464 ALA A C    7  
ATOM 7812  O O    . ALA A 1 55 ? 7.814   2.508   -6.967  1.00 10.00 ? 464 ALA A O    7  
ATOM 7813  C CB   . ALA A 1 55 ? 10.198  3.946   -5.576  1.00 10.00 ? 464 ALA A CB   7  
ATOM 7814  H H    . ALA A 1 55 ? 9.376   3.745   -3.177  1.00 10.00 ? 464 ALA A H    7  
ATOM 7815  H HA   . ALA A 1 55 ? 8.212   4.695   -5.597  1.00 10.00 ? 464 ALA A HA   7  
ATOM 7816  H HB1  . ALA A 1 55 ? 10.280  4.361   -6.569  1.00 10.00 ? 464 ALA A HB1  7  
ATOM 7817  H HB2  . ALA A 1 55 ? 10.648  2.965   -5.558  1.00 10.00 ? 464 ALA A HB2  7  
ATOM 7818  H HB3  . ALA A 1 55 ? 10.709  4.589   -4.873  1.00 10.00 ? 464 ALA A HB3  7  
ATOM 7819  N N    . GLU A 1 56 ? 7.941   1.556   -4.931  1.00 10.00 ? 465 GLU A N    7  
ATOM 7820  C CA   . GLU A 1 56 ? 7.365   0.290   -5.366  1.00 10.00 ? 465 GLU A CA   7  
ATOM 7821  C C    . GLU A 1 56 ? 5.842   0.324   -5.286  1.00 10.00 ? 465 GLU A C    7  
ATOM 7822  O O    . GLU A 1 56 ? 5.159   -0.389  -6.021  1.00 10.00 ? 465 GLU A O    7  
ATOM 7823  C CB   . GLU A 1 56 ? 7.908   -0.859  -4.513  1.00 10.00 ? 465 GLU A CB   7  
ATOM 7824  C CG   . GLU A 1 56 ? 7.365   -2.222  -4.911  1.00 10.00 ? 465 GLU A CG   7  
ATOM 7825  C CD   . GLU A 1 56 ? 8.297   -3.354  -4.529  1.00 10.00 ? 465 GLU A CD   7  
ATOM 7826  O OE1  . GLU A 1 56 ? 9.484   -3.302  -4.914  1.00 10.00 ? 465 GLU A OE1  7  
ATOM 7827  O OE2  . GLU A 1 56 ? 7.841   -4.294  -3.843  1.00 10.00 ? 465 GLU A OE2  7  
ATOM 7828  H H    . GLU A 1 56 ? 8.203   1.663   -3.993  1.00 10.00 ? 465 GLU A H    7  
ATOM 7829  H HA   . GLU A 1 56 ? 7.657   0.131   -6.393  1.00 10.00 ? 465 GLU A HA   7  
ATOM 7830  H HB2  . GLU A 1 56 ? 8.984   -0.883  -4.604  1.00 10.00 ? 465 GLU A HB2  7  
ATOM 7831  H HB3  . GLU A 1 56 ? 7.647   -0.678  -3.482  1.00 10.00 ? 465 GLU A HB3  7  
ATOM 7832  H HG2  . GLU A 1 56 ? 6.416   -2.375  -4.418  1.00 10.00 ? 465 GLU A HG2  7  
ATOM 7833  H HG3  . GLU A 1 56 ? 7.220   -2.239  -5.981  1.00 10.00 ? 465 GLU A HG3  7  
ATOM 7834  N N    . CYS A 1 57 ? 5.310   1.162   -4.398  1.00 10.00 ? 466 CYS A N    7  
ATOM 7835  C CA   . CYS A 1 57 ? 3.867   1.284   -4.241  1.00 10.00 ? 466 CYS A CA   7  
ATOM 7836  C C    . CYS A 1 57 ? 3.261   1.979   -5.452  1.00 10.00 ? 466 CYS A C    7  
ATOM 7837  O O    . CYS A 1 57 ? 2.081   1.803   -5.758  1.00 10.00 ? 466 CYS A O    7  
ATOM 7838  C CB   . CYS A 1 57 ? 3.525   2.052   -2.962  1.00 10.00 ? 466 CYS A CB   7  
ATOM 7839  S SG   . CYS A 1 57 ? 1.829   1.805   -2.386  1.00 10.00 ? 466 CYS A SG   7  
ATOM 7840  H H    . CYS A 1 57 ? 5.899   1.713   -3.843  1.00 10.00 ? 466 CYS A H    7  
ATOM 7841  H HA   . CYS A 1 57 ? 3.458   0.288   -4.176  1.00 10.00 ? 466 CYS A HA   7  
ATOM 7842  H HB2  . CYS A 1 57 ? 4.187   1.735   -2.171  1.00 10.00 ? 466 CYS A HB2  7  
ATOM 7843  H HB3  . CYS A 1 57 ? 3.663   3.109   -3.137  1.00 10.00 ? 466 CYS A HB3  7  
ATOM 7844  H HG   . CYS A 1 57 ? 1.673   0.860   -2.322  1.00 10.00 ? 466 CYS A HG   7  
ATOM 7845  N N    . VAL A 1 58 ? 4.083   2.756   -6.151  1.00 10.00 ? 467 VAL A N    7  
ATOM 7846  C CA   . VAL A 1 58 ? 3.640   3.462   -7.344  1.00 10.00 ? 467 VAL A CA   7  
ATOM 7847  C C    . VAL A 1 58 ? 3.017   2.484   -8.340  1.00 10.00 ? 467 VAL A C    7  
ATOM 7848  O O    . VAL A 1 58 ? 2.205   2.866   -9.179  1.00 10.00 ? 467 VAL A O    7  
ATOM 7849  C CB   . VAL A 1 58 ? 4.817   4.199   -8.022  1.00 10.00 ? 467 VAL A CB   7  
ATOM 7850  C CG1  . VAL A 1 58 ? 4.349   4.952   -9.258  1.00 10.00 ? 467 VAL A CG1  7  
ATOM 7851  C CG2  . VAL A 1 58 ? 5.489   5.146   -7.040  1.00 10.00 ? 467 VAL A CG2  7  
ATOM 7852  H H    . VAL A 1 58 ? 5.017   2.845   -5.865  1.00 10.00 ? 467 VAL A H    7  
ATOM 7853  H HA   . VAL A 1 58 ? 2.900   4.191   -7.051  1.00 10.00 ? 467 VAL A HA   7  
ATOM 7854  H HB   . VAL A 1 58 ? 5.544   3.463   -8.331  1.00 10.00 ? 467 VAL A HB   7  
ATOM 7855  H HG11 . VAL A 1 58 ? 3.738   5.790   -8.960  1.00 10.00 ? 467 VAL A HG11 7  
ATOM 7856  H HG12 . VAL A 1 58 ? 3.771   4.290   -9.886  1.00 10.00 ? 467 VAL A HG12 7  
ATOM 7857  H HG13 . VAL A 1 58 ? 5.207   5.310   -9.807  1.00 10.00 ? 467 VAL A HG13 7  
ATOM 7858  H HG21 . VAL A 1 58 ? 5.043   6.126   -7.122  1.00 10.00 ? 467 VAL A HG21 7  
ATOM 7859  H HG22 . VAL A 1 58 ? 6.543   5.210   -7.267  1.00 10.00 ? 467 VAL A HG22 7  
ATOM 7860  H HG23 . VAL A 1 58 ? 5.360   4.775   -6.034  1.00 10.00 ? 467 VAL A HG23 7  
ATOM 7861  N N    . LEU A 1 59 ? 3.408   1.216   -8.231  1.00 10.00 ? 468 LEU A N    7  
ATOM 7862  C CA   . LEU A 1 59 ? 2.902   0.171   -9.112  1.00 10.00 ? 468 LEU A CA   7  
ATOM 7863  C C    . LEU A 1 59 ? 1.408   -0.089  -8.895  1.00 10.00 ? 468 LEU A C    7  
ATOM 7864  O O    . LEU A 1 59 ? 0.794   -0.852  -9.635  1.00 10.00 ? 468 LEU A O    7  
ATOM 7865  C CB   . LEU A 1 59 ? 3.698   -1.118  -8.893  1.00 10.00 ? 468 LEU A CB   7  
ATOM 7866  C CG   . LEU A 1 59 ? 4.473   -1.616  -10.114 1.00 10.00 ? 468 LEU A CG   7  
ATOM 7867  C CD1  . LEU A 1 59 ? 5.846   -0.966  -10.178 1.00 10.00 ? 468 LEU A CD1  7  
ATOM 7868  C CD2  . LEU A 1 59 ? 4.600   -3.132  -10.082 1.00 10.00 ? 468 LEU A CD2  7  
ATOM 7869  H H    . LEU A 1 59 ? 4.060   0.977   -7.540  1.00 10.00 ? 468 LEU A H    7  
ATOM 7870  H HA   . LEU A 1 59 ? 3.049   0.504   -10.130 1.00 10.00 ? 468 LEU A HA   7  
ATOM 7871  H HB2  . LEU A 1 59 ? 4.404   -0.946  -8.090  1.00 10.00 ? 468 LEU A HB2  7  
ATOM 7872  H HB3  . LEU A 1 59 ? 3.014   -1.895  -8.587  1.00 10.00 ? 468 LEU A HB3  7  
ATOM 7873  H HG   . LEU A 1 59 ? 3.933   -1.344  -11.010 1.00 10.00 ? 468 LEU A HG   7  
ATOM 7874  H HD11 . LEU A 1 59 ? 6.167   -0.705  -9.180  1.00 10.00 ? 468 LEU A HD11 7  
ATOM 7875  H HD12 . LEU A 1 59 ? 5.793   -0.073  -10.783 1.00 10.00 ? 468 LEU A HD12 7  
ATOM 7876  H HD13 . LEU A 1 59 ? 6.552   -1.656  -10.614 1.00 10.00 ? 468 LEU A HD13 7  
ATOM 7877  H HD21 . LEU A 1 59 ? 5.520   -3.427  -10.566 1.00 10.00 ? 468 LEU A HD21 7  
ATOM 7878  H HD22 . LEU A 1 59 ? 3.762   -3.575  -10.601 1.00 10.00 ? 468 LEU A HD22 7  
ATOM 7879  H HD23 . LEU A 1 59 ? 4.609   -3.470  -9.056  1.00 10.00 ? 468 LEU A HD23 7  
ATOM 7880  N N    . TYR A 1 60 ? 0.826   0.533   -7.880  1.00 10.00 ? 469 TYR A N    7  
ATOM 7881  C CA   . TYR A 1 60 ? -0.596  0.348   -7.600  1.00 10.00 ? 469 TYR A CA   7  
ATOM 7882  C C    . TYR A 1 60 ? -1.415  1.587   -7.974  1.00 10.00 ? 469 TYR A C    7  
ATOM 7883  O O    . TYR A 1 60 ? -2.631  1.607   -7.794  1.00 10.00 ? 469 TYR A O    7  
ATOM 7884  C CB   . TYR A 1 60 ? -0.808  -0.030  -6.128  1.00 10.00 ? 469 TYR A CB   7  
ATOM 7885  C CG   . TYR A 1 60 ? -1.337  1.062   -5.229  1.00 10.00 ? 469 TYR A CG   7  
ATOM 7886  C CD1  . TYR A 1 60 ? -0.838  2.351   -5.310  1.00 10.00 ? 469 TYR A CD1  7  
ATOM 7887  C CD2  . TYR A 1 60 ? -2.324  0.794   -4.286  1.00 10.00 ? 469 TYR A CD2  7  
ATOM 7888  C CE1  . TYR A 1 60 ? -1.305  3.351   -4.484  1.00 10.00 ? 469 TYR A CE1  7  
ATOM 7889  C CE2  . TYR A 1 60 ? -2.799  1.788   -3.457  1.00 10.00 ? 469 TYR A CE2  7  
ATOM 7890  C CZ   . TYR A 1 60 ? -2.286  3.066   -3.559  1.00 10.00 ? 469 TYR A CZ   7  
ATOM 7891  O OH   . TYR A 1 60 ? -2.749  4.061   -2.734  1.00 10.00 ? 469 TYR A OH   7  
ATOM 7892  H H    . TYR A 1 60 ? 1.357   1.113   -7.309  1.00 10.00 ? 469 TYR A H    7  
ATOM 7893  H HA   . TYR A 1 60 ? -0.933  -0.475  -8.211  1.00 10.00 ? 469 TYR A HA   7  
ATOM 7894  H HB2  . TYR A 1 60 ? -1.507  -0.846  -6.081  1.00 10.00 ? 469 TYR A HB2  7  
ATOM 7895  H HB3  . TYR A 1 60 ? 0.136   -0.351  -5.721  1.00 10.00 ? 469 TYR A HB3  7  
ATOM 7896  H HD1  . TYR A 1 60 ? -0.073  2.565   -6.038  1.00 10.00 ? 469 TYR A HD1  7  
ATOM 7897  H HD2  . TYR A 1 60 ? -2.725  -0.214  -4.201  1.00 10.00 ? 469 TYR A HD2  7  
ATOM 7898  H HE1  . TYR A 1 60 ? -0.902  4.350   -4.565  1.00 10.00 ? 469 TYR A HE1  7  
ATOM 7899  H HE2  . TYR A 1 60 ? -3.568  1.557   -2.732  1.00 10.00 ? 469 TYR A HE2  7  
ATOM 7900  H HH   . TYR A 1 60 ? -2.869  4.867   -3.239  1.00 10.00 ? 469 TYR A HH   7  
ATOM 7901  N N    . TYR A 1 61 ? -0.751  2.621   -8.487  1.00 10.00 ? 470 TYR A N    7  
ATOM 7902  C CA   . TYR A 1 61 ? -1.445  3.845   -8.869  1.00 10.00 ? 470 TYR A CA   7  
ATOM 7903  C C    . TYR A 1 61 ? -1.600  3.939   -10.386 1.00 10.00 ? 470 TYR A C    7  
ATOM 7904  O O    . TYR A 1 61 ? -2.671  4.281   -10.887 1.00 10.00 ? 470 TYR A O    7  
ATOM 7905  C CB   . TYR A 1 61 ? -0.705  5.074   -8.316  1.00 10.00 ? 470 TYR A CB   7  
ATOM 7906  C CG   . TYR A 1 61 ? -0.017  5.917   -9.369  1.00 10.00 ? 470 TYR A CG   7  
ATOM 7907  C CD1  . TYR A 1 61 ? -0.723  6.865   -10.098 1.00 10.00 ? 470 TYR A CD1  7  
ATOM 7908  C CD2  . TYR A 1 61 ? 1.336   5.761   -9.632  1.00 10.00 ? 470 TYR A CD2  7  
ATOM 7909  C CE1  . TYR A 1 61 ? -0.098  7.633   -11.062 1.00 10.00 ? 470 TYR A CE1  7  
ATOM 7910  C CE2  . TYR A 1 61 ? 1.969   6.525   -10.593 1.00 10.00 ? 470 TYR A CE2  7  
ATOM 7911  C CZ   . TYR A 1 61 ? 1.248   7.459   -11.306 1.00 10.00 ? 470 TYR A CZ   7  
ATOM 7912  O OH   . TYR A 1 61 ? 1.875   8.221   -12.264 1.00 10.00 ? 470 TYR A OH   7  
ATOM 7913  H H    . TYR A 1 61 ? 0.219   2.564   -8.607  1.00 10.00 ? 470 TYR A H    7  
ATOM 7914  H HA   . TYR A 1 61 ? -2.430  3.810   -8.427  1.00 10.00 ? 470 TYR A HA   7  
ATOM 7915  H HB2  . TYR A 1 61 ? -1.411  5.706   -7.801  1.00 10.00 ? 470 TYR A HB2  7  
ATOM 7916  H HB3  . TYR A 1 61 ? 0.048   4.742   -7.614  1.00 10.00 ? 470 TYR A HB3  7  
ATOM 7917  H HD1  . TYR A 1 61 ? -1.777  6.998   -9.905  1.00 10.00 ? 470 TYR A HD1  7  
ATOM 7918  H HD2  . TYR A 1 61 ? 1.897   5.029   -9.072  1.00 10.00 ? 470 TYR A HD2  7  
ATOM 7919  H HE1  . TYR A 1 61 ? -0.664  8.365   -11.620 1.00 10.00 ? 470 TYR A HE1  7  
ATOM 7920  H HE2  . TYR A 1 61 ? 3.021   6.387   -10.783 1.00 10.00 ? 470 TYR A HE2  7  
ATOM 7921  H HH   . TYR A 1 61 ? 2.113   7.666   -13.010 1.00 10.00 ? 470 TYR A HH   7  
ATOM 7922  N N    . TYR A 1 62 ? -0.528  3.637   -11.116 1.00 10.00 ? 471 TYR A N    7  
ATOM 7923  C CA   . TYR A 1 62 ? -0.567  3.698   -12.573 1.00 10.00 ? 471 TYR A CA   7  
ATOM 7924  C C    . TYR A 1 62 ? -0.976  2.354   -13.179 1.00 10.00 ? 471 TYR A C    7  
ATOM 7925  O O    . TYR A 1 62 ? -1.101  2.228   -14.397 1.00 10.00 ? 471 TYR A O    7  
ATOM 7926  C CB   . TYR A 1 62 ? 0.782   4.174   -13.130 1.00 10.00 ? 471 TYR A CB   7  
ATOM 7927  C CG   . TYR A 1 62 ? 1.842   3.101   -13.253 1.00 10.00 ? 471 TYR A CG   7  
ATOM 7928  C CD1  . TYR A 1 62 ? 2.659   2.784   -12.176 1.00 10.00 ? 471 TYR A CD1  7  
ATOM 7929  C CD2  . TYR A 1 62 ? 2.035   2.417   -14.447 1.00 10.00 ? 471 TYR A CD2  7  
ATOM 7930  C CE1  . TYR A 1 62 ? 3.636   1.814   -12.281 1.00 10.00 ? 471 TYR A CE1  7  
ATOM 7931  C CE2  . TYR A 1 62 ? 3.012   1.445   -14.562 1.00 10.00 ? 471 TYR A CE2  7  
ATOM 7932  C CZ   . TYR A 1 62 ? 3.809   1.147   -13.477 1.00 10.00 ? 471 TYR A CZ   7  
ATOM 7933  O OH   . TYR A 1 62 ? 4.782   0.180   -13.587 1.00 10.00 ? 471 TYR A OH   7  
ATOM 7934  H H    . TYR A 1 62 ? 0.302   3.372   -10.666 1.00 10.00 ? 471 TYR A H    7  
ATOM 7935  H HA   . TYR A 1 62 ? -1.324  4.423   -12.838 1.00 10.00 ? 471 TYR A HA   7  
ATOM 7936  H HB2  . TYR A 1 62 ? 0.628   4.592   -14.112 1.00 10.00 ? 471 TYR A HB2  7  
ATOM 7937  H HB3  . TYR A 1 62 ? 1.172   4.943   -12.478 1.00 10.00 ? 471 TYR A HB3  7  
ATOM 7938  H HD1  . TYR A 1 62 ? 2.521   3.308   -11.244 1.00 10.00 ? 471 TYR A HD1  7  
ATOM 7939  H HD2  . TYR A 1 62 ? 1.408   2.653   -15.294 1.00 10.00 ? 471 TYR A HD2  7  
ATOM 7940  H HE1  . TYR A 1 62 ? 4.258   1.580   -11.429 1.00 10.00 ? 471 TYR A HE1  7  
ATOM 7941  H HE2  . TYR A 1 62 ? 3.147   0.925   -15.499 1.00 10.00 ? 471 TYR A HE2  7  
ATOM 7942  H HH   . TYR A 1 62 ? 4.713   -0.430  -12.849 1.00 10.00 ? 471 TYR A HH   7  
ATOM 7943  N N    . LEU A 1 63 ? -1.214  1.362   -12.323 1.00 10.00 ? 472 LEU A N    7  
ATOM 7944  C CA   . LEU A 1 63 ? -1.643  0.046   -12.779 1.00 10.00 ? 472 LEU A CA   7  
ATOM 7945  C C    . LEU A 1 63 ? -3.144  -0.095  -12.578 1.00 10.00 ? 472 LEU A C    7  
ATOM 7946  O O    . LEU A 1 63 ? -3.851  -0.644  -13.424 1.00 10.00 ? 472 LEU A O    7  
ATOM 7947  C CB   . LEU A 1 63 ? -0.908  -1.057  -12.019 1.00 10.00 ? 472 LEU A CB   7  
ATOM 7948  C CG   . LEU A 1 63 ? 0.557   -1.235  -12.409 1.00 10.00 ? 472 LEU A CG   7  
ATOM 7949  C CD1  . LEU A 1 63 ? 1.351   0.010   -12.054 1.00 10.00 ? 472 LEU A CD1  7  
ATOM 7950  C CD2  . LEU A 1 63 ? 1.147   -2.464  -11.732 1.00 10.00 ? 472 LEU A CD2  7  
ATOM 7951  H H    . LEU A 1 63 ? -1.120  1.526   -11.362 1.00 10.00 ? 472 LEU A H    7  
ATOM 7952  H HA   . LEU A 1 63 ? -1.419  -0.034  -13.833 1.00 10.00 ? 472 LEU A HA   7  
ATOM 7953  H HB2  . LEU A 1 63 ? -0.957  -0.833  -10.963 1.00 10.00 ? 472 LEU A HB2  7  
ATOM 7954  H HB3  . LEU A 1 63 ? -1.421  -1.991  -12.196 1.00 10.00 ? 472 LEU A HB3  7  
ATOM 7955  H HG   . LEU A 1 63 ? 0.621   -1.378  -13.477 1.00 10.00 ? 472 LEU A HG   7  
ATOM 7956  H HD11 . LEU A 1 63 ? 0.879   0.519   -11.225 1.00 10.00 ? 472 LEU A HD11 7  
ATOM 7957  H HD12 . LEU A 1 63 ? 1.384   0.668   -12.906 1.00 10.00 ? 472 LEU A HD12 7  
ATOM 7958  H HD13 . LEU A 1 63 ? 2.356   -0.271  -11.778 1.00 10.00 ? 472 LEU A HD13 7  
ATOM 7959  H HD21 . LEU A 1 63 ? 0.559   -2.712  -10.859 1.00 10.00 ? 472 LEU A HD21 7  
ATOM 7960  H HD22 . LEU A 1 63 ? 2.164   -2.257  -11.433 1.00 10.00 ? 472 LEU A HD22 7  
ATOM 7961  H HD23 . LEU A 1 63 ? 1.136   -3.295  -12.421 1.00 10.00 ? 472 LEU A HD23 7  
ATOM 7962  N N    . THR A 1 64 ? -3.621  0.427   -11.454 1.00 10.00 ? 473 THR A N    7  
ATOM 7963  C CA   . THR A 1 64 ? -5.039  0.389   -11.131 1.00 10.00 ? 473 THR A CA   7  
ATOM 7964  C C    . THR A 1 64 ? -5.819  1.288   -12.084 1.00 10.00 ? 473 THR A C    7  
ATOM 7965  O O    . THR A 1 64 ? -6.991  1.041   -12.368 1.00 10.00 ? 473 THR A O    7  
ATOM 7966  C CB   . THR A 1 64 ? -5.266  0.829   -9.682  1.00 10.00 ? 473 THR A CB   7  
ATOM 7967  O OG1  . THR A 1 64 ? -4.795  2.149   -9.480  1.00 10.00 ? 473 THR A OG1  7  
ATOM 7968  C CG2  . THR A 1 64 ? -4.576  -0.064  -8.667  1.00 10.00 ? 473 THR A CG2  7  
ATOM 7969  H H    . THR A 1 64 ? -3.002  0.862   -10.832 1.00 10.00 ? 473 THR A H    7  
ATOM 7970  H HA   . THR A 1 64 ? -5.385  -0.625  -11.250 1.00 10.00 ? 473 THR A HA   7  
ATOM 7971  H HB   . THR A 1 64 ? -6.325  0.810   -9.473  1.00 10.00 ? 473 THR A HB   7  
ATOM 7972  H HG1  . THR A 1 64 ? -3.838  2.164   -9.552  1.00 10.00 ? 473 THR A HG1  7  
ATOM 7973  H HG21 . THR A 1 64 ? -3.573  -0.283  -9.003  1.00 10.00 ? 473 THR A HG21 7  
ATOM 7974  H HG22 . THR A 1 64 ? -5.130  -0.985  -8.563  1.00 10.00 ? 473 THR A HG22 7  
ATOM 7975  H HG23 . THR A 1 64 ? -4.532  0.439   -7.711  1.00 10.00 ? 473 THR A HG23 7  
ATOM 7976  N N    . LYS A 1 65 ? -5.157  2.332   -12.579 1.00 10.00 ? 474 LYS A N    7  
ATOM 7977  C CA   . LYS A 1 65 ? -5.788  3.265   -13.506 1.00 10.00 ? 474 LYS A CA   7  
ATOM 7978  C C    . LYS A 1 65 ? -5.443  2.927   -14.954 1.00 10.00 ? 474 LYS A C    7  
ATOM 7979  O O    . LYS A 1 65 ? -5.828  3.647   -15.874 1.00 10.00 ? 474 LYS A O    7  
ATOM 7980  C CB   . LYS A 1 65 ? -5.361  4.700   -13.185 1.00 10.00 ? 474 LYS A CB   7  
ATOM 7981  C CG   . LYS A 1 65 ? -3.892  4.974   -13.461 1.00 10.00 ? 474 LYS A CG   7  
ATOM 7982  C CD   . LYS A 1 65 ? -3.403  6.199   -12.708 1.00 10.00 ? 474 LYS A CD   7  
ATOM 7983  C CE   . LYS A 1 65 ? -3.683  7.478   -13.480 1.00 10.00 ? 474 LYS A CE   7  
ATOM 7984  N NZ   . LYS A 1 65 ? -5.117  7.591   -13.864 1.00 10.00 ? 474 LYS A NZ   7  
ATOM 7985  H H    . LYS A 1 65 ? -4.222  2.477   -12.320 1.00 10.00 ? 474 LYS A H    7  
ATOM 7986  H HA   . LYS A 1 65 ? -6.859  3.181   -13.381 1.00 10.00 ? 474 LYS A HA   7  
ATOM 7987  H HB2  . LYS A 1 65 ? -5.950  5.381   -13.779 1.00 10.00 ? 474 LYS A HB2  7  
ATOM 7988  H HB3  . LYS A 1 65 ? -5.548  4.892   -12.139 1.00 10.00 ? 474 LYS A HB3  7  
ATOM 7989  H HG2  . LYS A 1 65 ? -3.310  4.118   -13.152 1.00 10.00 ? 474 LYS A HG2  7  
ATOM 7990  H HG3  . LYS A 1 65 ? -3.759  5.137   -14.521 1.00 10.00 ? 474 LYS A HG3  7  
ATOM 7991  H HD2  . LYS A 1 65 ? -3.906  6.248   -11.755 1.00 10.00 ? 474 LYS A HD2  7  
ATOM 7992  H HD3  . LYS A 1 65 ? -2.337  6.111   -12.549 1.00 10.00 ? 474 LYS A HD3  7  
ATOM 7993  H HE2  . LYS A 1 65 ? -3.418  8.323   -12.862 1.00 10.00 ? 474 LYS A HE2  7  
ATOM 7994  H HE3  . LYS A 1 65 ? -3.078  7.483   -14.375 1.00 10.00 ? 474 LYS A HE3  7  
ATOM 7995  H HZ1  . LYS A 1 65 ? -5.358  8.584   -14.060 1.00 10.00 ? 474 LYS A HZ1  7  
ATOM 7996  H HZ2  . LYS A 1 65 ? -5.722  7.244   -13.093 1.00 10.00 ? 474 LYS A HZ2  7  
ATOM 7997  H HZ3  . LYS A 1 65 ? -5.305  7.025   -14.718 1.00 10.00 ? 474 LYS A HZ3  7  
ATOM 7998  N N    . LYS A 1 66 ? -4.730  1.821   -15.155 1.00 10.00 ? 475 LYS A N    7  
ATOM 7999  C CA   . LYS A 1 66 ? -4.358  1.388   -16.496 1.00 10.00 ? 475 LYS A CA   7  
ATOM 8000  C C    . LYS A 1 66 ? -5.450  0.495   -17.076 1.00 10.00 ? 475 LYS A C    7  
ATOM 8001  O O    . LYS A 1 66 ? -5.171  -0.533  -17.692 1.00 10.00 ? 475 LYS A O    7  
ATOM 8002  C CB   . LYS A 1 66 ? -3.024  0.638   -16.465 1.00 10.00 ? 475 LYS A CB   7  
ATOM 8003  C CG   . LYS A 1 66 ? -2.113  0.970   -17.635 1.00 10.00 ? 475 LYS A CG   7  
ATOM 8004  C CD   . LYS A 1 66 ? -2.198  -0.087  -18.725 1.00 10.00 ? 475 LYS A CD   7  
ATOM 8005  C CE   . LYS A 1 66 ? -2.129  0.536   -20.110 1.00 10.00 ? 475 LYS A CE   7  
ATOM 8006  N NZ   . LYS A 1 66 ? -1.355  -0.308  -21.061 1.00 10.00 ? 475 LYS A NZ   7  
ATOM 8007  H H    . LYS A 1 66 ? -4.460  1.278   -14.387 1.00 10.00 ? 475 LYS A H    7  
ATOM 8008  H HA   . LYS A 1 66 ? -4.258  2.266   -17.115 1.00 10.00 ? 475 LYS A HA   7  
ATOM 8009  H HB2  . LYS A 1 66 ? -2.506  0.887   -15.551 1.00 10.00 ? 475 LYS A HB2  7  
ATOM 8010  H HB3  . LYS A 1 66 ? -3.220  -0.424  -16.478 1.00 10.00 ? 475 LYS A HB3  7  
ATOM 8011  H HG2  . LYS A 1 66 ? -2.406  1.923   -18.049 1.00 10.00 ? 475 LYS A HG2  7  
ATOM 8012  H HG3  . LYS A 1 66 ? -1.094  1.027   -17.280 1.00 10.00 ? 475 LYS A HG3  7  
ATOM 8013  H HD2  . LYS A 1 66 ? -1.375  -0.775  -18.610 1.00 10.00 ? 475 LYS A HD2  7  
ATOM 8014  H HD3  . LYS A 1 66 ? -3.133  -0.618  -18.625 1.00 10.00 ? 475 LYS A HD3  7  
ATOM 8015  H HE2  . LYS A 1 66 ? -3.134  0.658   -20.486 1.00 10.00 ? 475 LYS A HE2  7  
ATOM 8016  H HE3  . LYS A 1 66 ? -1.655  1.504   -20.033 1.00 10.00 ? 475 LYS A HE3  7  
ATOM 8017  H HZ1  . LYS A 1 66 ? -1.722  -0.187  -22.027 1.00 10.00 ? 475 LYS A HZ1  7  
ATOM 8018  H HZ2  . LYS A 1 66 ? -1.435  -1.311  -20.796 1.00 10.00 ? 475 LYS A HZ2  7  
ATOM 8019  H HZ3  . LYS A 1 66 ? -0.352  -0.036  -21.046 1.00 10.00 ? 475 LYS A HZ3  7  
ATOM 8020  N N    . ASN A 1 67 ? -6.699  0.899   -16.860 1.00 10.00 ? 476 ASN A N    7  
ATOM 8021  C CA   . ASN A 1 67 ? -7.852  0.152   -17.340 1.00 10.00 ? 476 ASN A CA   7  
ATOM 8022  C C    . ASN A 1 67 ? -9.149  0.816   -16.883 1.00 10.00 ? 476 ASN A C    7  
ATOM 8023  O O    . ASN A 1 67 ? -10.167 0.747   -17.570 1.00 10.00 ? 476 ASN A O    7  
ATOM 8024  C CB   . ASN A 1 67 ? -7.801  -1.294  -16.839 1.00 10.00 ? 476 ASN A CB   7  
ATOM 8025  C CG   . ASN A 1 67 ? -8.188  -2.292  -17.912 1.00 10.00 ? 476 ASN A CG   7  
ATOM 8026  O OD1  . ASN A 1 67 ? -8.354  -1.935  -19.078 1.00 10.00 ? 476 ASN A OD1  7  
ATOM 8027  N ND2  . ASN A 1 67 ? -8.335  -3.553  -17.523 1.00 10.00 ? 476 ASN A ND2  7  
ATOM 8028  H H    . ASN A 1 67 ? -6.849  1.725   -16.359 1.00 10.00 ? 476 ASN A H    7  
ATOM 8029  H HA   . ASN A 1 67 ? -7.823  0.152   -18.420 1.00 10.00 ? 476 ASN A HA   7  
ATOM 8030  H HB2  . ASN A 1 67 ? -6.798  -1.519  -16.510 1.00 10.00 ? 476 ASN A HB2  7  
ATOM 8031  H HB3  . ASN A 1 67 ? -8.481  -1.405  -16.007 1.00 10.00 ? 476 ASN A HB3  7  
ATOM 8032  H HD21 . ASN A 1 67 ? -8.187  -3.766  -16.578 1.00 10.00 ? 476 ASN A HD21 7  
ATOM 8033  H HD22 . ASN A 1 67 ? -8.584  -4.220  -18.196 1.00 10.00 ? 476 ASN A HD22 7  
ATOM 8034  N N    . GLU A 1 68 ? -9.104  1.461   -15.716 1.00 10.00 ? 477 GLU A N    7  
ATOM 8035  C CA   . GLU A 1 68 ? -10.277 2.137   -15.174 1.00 10.00 ? 477 GLU A CA   7  
ATOM 8036  C C    . GLU A 1 68 ? -10.109 3.652   -15.239 1.00 10.00 ? 477 GLU A C    7  
ATOM 8037  O O    . GLU A 1 68 ? -11.088 4.390   -15.357 1.00 10.00 ? 477 GLU A O    7  
ATOM 8038  C CB   . GLU A 1 68 ? -10.520 1.701   -13.729 1.00 10.00 ? 477 GLU A CB   7  
ATOM 8039  C CG   . GLU A 1 68 ? -11.975 1.803   -13.298 1.00 10.00 ? 477 GLU A CG   7  
ATOM 8040  C CD   . GLU A 1 68 ? -12.353 0.755   -12.270 1.00 10.00 ? 477 GLU A CD   7  
ATOM 8041  O OE1  . GLU A 1 68 ? -11.726 -0.325  -12.265 1.00 10.00 ? 477 GLU A OE1  7  
ATOM 8042  O OE2  . GLU A 1 68 ? -13.276 1.015   -11.469 1.00 10.00 ? 477 GLU A OE2  7  
ATOM 8043  H H    . GLU A 1 68 ? -8.262  1.486   -15.209 1.00 10.00 ? 477 GLU A H    7  
ATOM 8044  H HA   . GLU A 1 68 ? -11.129 1.855   -15.774 1.00 10.00 ? 477 GLU A HA   7  
ATOM 8045  H HB2  . GLU A 1 68 ? -10.205 0.674   -13.617 1.00 10.00 ? 477 GLU A HB2  7  
ATOM 8046  H HB3  . GLU A 1 68 ? -9.929  2.323   -13.072 1.00 10.00 ? 477 GLU A HB3  7  
ATOM 8047  H HG2  . GLU A 1 68 ? -12.143 2.780   -12.872 1.00 10.00 ? 477 GLU A HG2  7  
ATOM 8048  H HG3  . GLU A 1 68 ? -12.603 1.677   -14.168 1.00 10.00 ? 477 GLU A HG3  7  
ATOM 8049  N N    . ASN A 1 69 ? -8.864  4.109   -15.162 1.00 10.00 ? 478 ASN A N    7  
ATOM 8050  C CA   . ASN A 1 69 ? -8.569  5.537   -15.211 1.00 10.00 ? 478 ASN A CA   7  
ATOM 8051  C C    . ASN A 1 69 ? -9.247  6.271   -14.060 1.00 10.00 ? 478 ASN A C    7  
ATOM 8052  O O    . ASN A 1 69 ? -10.397 6.694   -14.172 1.00 10.00 ? 478 ASN A O    7  
ATOM 8053  C CB   . ASN A 1 69 ? -9.024  6.126   -16.548 1.00 10.00 ? 478 ASN A CB   7  
ATOM 8054  C CG   . ASN A 1 69 ? -8.147  5.686   -17.703 1.00 10.00 ? 478 ASN A CG   7  
ATOM 8055  O OD1  . ASN A 1 69 ? -7.293  6.438   -18.171 1.00 10.00 ? 478 ASN A OD1  7  
ATOM 8056  N ND2  . ASN A 1 69 ? -8.355  4.460   -18.170 1.00 10.00 ? 478 ASN A ND2  7  
ATOM 8057  H H    . ASN A 1 69 ? -8.125  3.472   -15.069 1.00 10.00 ? 478 ASN A H    7  
ATOM 8058  H HA   . ASN A 1 69 ? -7.499  5.657   -15.121 1.00 10.00 ? 478 ASN A HA   7  
ATOM 8059  H HB2  . ASN A 1 69 ? -10.036 5.808   -16.748 1.00 10.00 ? 478 ASN A HB2  7  
ATOM 8060  H HB3  . ASN A 1 69 ? -8.994  7.204   -16.487 1.00 10.00 ? 478 ASN A HB3  7  
ATOM 8061  H HD21 . ASN A 1 69 ? -9.052  3.916   -17.749 1.00 10.00 ? 478 ASN A HD21 7  
ATOM 8062  H HD22 . ASN A 1 69 ? -7.801  4.149   -18.917 1.00 10.00 ? 478 ASN A HD22 7  
ATOM 8063  N N    . TYR A 1 70 ? -8.526  6.421   -12.954 1.00 10.00 ? 479 TYR A N    7  
ATOM 8064  C CA   . TYR A 1 70 ? -9.060  7.105   -11.783 1.00 10.00 ? 479 TYR A CA   7  
ATOM 8065  C C    . TYR A 1 70 ? -7.937  7.720   -10.951 1.00 10.00 ? 479 TYR A C    7  
ATOM 8066  O O    . TYR A 1 70 ? -7.074  7.011   -10.434 1.00 10.00 ? 479 TYR A O    7  
ATOM 8067  C CB   . TYR A 1 70 ? -9.882  6.133   -10.930 1.00 10.00 ? 479 TYR A CB   7  
ATOM 8068  C CG   . TYR A 1 70 ? -9.047  5.142   -10.147 1.00 10.00 ? 479 TYR A CG   7  
ATOM 8069  C CD1  . TYR A 1 70 ? -8.551  3.989   -10.745 1.00 10.00 ? 479 TYR A CD1  7  
ATOM 8070  C CD2  . TYR A 1 70 ? -8.755  5.362   -8.806  1.00 10.00 ? 479 TYR A CD2  7  
ATOM 8071  C CE1  . TYR A 1 70 ? -7.790  3.085   -10.029 1.00 10.00 ? 479 TYR A CE1  7  
ATOM 8072  C CE2  . TYR A 1 70 ? -7.994  4.464   -8.085  1.00 10.00 ? 479 TYR A CE2  7  
ATOM 8073  C CZ   . TYR A 1 70 ? -7.515  3.327   -8.700  1.00 10.00 ? 479 TYR A CZ   7  
ATOM 8074  O OH   . TYR A 1 70 ? -6.759  2.429   -7.984  1.00 10.00 ? 479 TYR A OH   7  
ATOM 8075  H H    . TYR A 1 70 ? -7.615  6.063   -12.925 1.00 10.00 ? 479 TYR A H    7  
ATOM 8076  H HA   . TYR A 1 70 ? -9.706  7.896   -12.131 1.00 10.00 ? 479 TYR A HA   7  
ATOM 8077  H HB2  . TYR A 1 70 ? -10.472 6.697   -10.224 1.00 10.00 ? 479 TYR A HB2  7  
ATOM 8078  H HB3  . TYR A 1 70 ? -10.544 5.572   -11.574 1.00 10.00 ? 479 TYR A HB3  7  
ATOM 8079  H HD1  . TYR A 1 70 ? -8.768  3.804   -11.787 1.00 10.00 ? 479 TYR A HD1  7  
ATOM 8080  H HD2  . TYR A 1 70 ? -9.132  6.254   -8.327  1.00 10.00 ? 479 TYR A HD2  7  
ATOM 8081  H HE1  . TYR A 1 70 ? -7.413  2.194   -10.510 1.00 10.00 ? 479 TYR A HE1  7  
ATOM 8082  H HE2  . TYR A 1 70 ? -7.779  4.653   -7.043  1.00 10.00 ? 479 TYR A HE2  7  
ATOM 8083  H HH   . TYR A 1 70 ? -7.241  1.603   -7.897  1.00 10.00 ? 479 TYR A HH   7  
ATOM 8084  N N    . LYS A 1 71 ? -7.956  9.042   -10.829 1.00 10.00 ? 480 LYS A N    7  
ATOM 8085  C CA   . LYS A 1 71 ? -6.940  9.753   -10.061 1.00 10.00 ? 480 LYS A CA   7  
ATOM 8086  C C    . LYS A 1 71 ? -7.540  10.966  -9.357  1.00 10.00 ? 480 LYS A C    7  
ATOM 8087  O O    . LYS A 1 71 ? -7.015  11.351  -8.292  1.00 10.00 ? 480 LYS A O    7  
ATOM 8088  C CB   . LYS A 1 71 ? -5.792  10.189  -10.976 1.00 10.00 ? 480 LYS A CB   7  
ATOM 8089  C CG   . LYS A 1 71 ? -4.438  9.641   -10.556 1.00 10.00 ? 480 LYS A CG   7  
ATOM 8090  C CD   . LYS A 1 71 ? -3.821  10.473  -9.445  1.00 10.00 ? 480 LYS A CD   7  
ATOM 8091  C CE   . LYS A 1 71 ? -2.426  9.983   -9.092  1.00 10.00 ? 480 LYS A CE   7  
ATOM 8092  N NZ   . LYS A 1 71 ? -1.907  10.628  -7.854  1.00 10.00 ? 480 LYS A NZ   7  
ATOM 8093  O OXT  . LYS A 1 71 ? -8.529  11.523  -9.879  1.00 10.00 ? 480 LYS A OXT  7  
ATOM 8094  H H    . LYS A 1 71 ? -8.669  9.553   -11.266 1.00 10.00 ? 480 LYS A H    7  
ATOM 8095  H HA   . LYS A 1 71 ? -6.554  9.073   -9.315  1.00 10.00 ? 480 LYS A HA   7  
ATOM 8096  H HB2  . LYS A 1 71 ? -5.998  9.847   -11.980 1.00 10.00 ? 480 LYS A HB2  7  
ATOM 8097  H HB3  . LYS A 1 71 ? -5.735  11.268  -10.977 1.00 10.00 ? 480 LYS A HB3  7  
ATOM 8098  H HG2  . LYS A 1 71 ? -4.563  8.627   -10.207 1.00 10.00 ? 480 LYS A HG2  7  
ATOM 8099  H HG3  . LYS A 1 71 ? -3.777  9.649   -11.411 1.00 10.00 ? 480 LYS A HG3  7  
ATOM 8100  H HD2  . LYS A 1 71 ? -3.759  11.501  -9.768  1.00 10.00 ? 480 LYS A HD2  7  
ATOM 8101  H HD3  . LYS A 1 71 ? -4.448  10.406  -8.568  1.00 10.00 ? 480 LYS A HD3  7  
ATOM 8102  H HE2  . LYS A 1 71 ? -2.459  8.915   -8.943  1.00 10.00 ? 480 LYS A HE2  7  
ATOM 8103  H HE3  . LYS A 1 71 ? -1.760  10.211  -9.913  1.00 10.00 ? 480 LYS A HE3  7  
ATOM 8104  H HZ1  . LYS A 1 71 ? -2.144  10.050  -7.023  1.00 10.00 ? 480 LYS A HZ1  7  
ATOM 8105  H HZ2  . LYS A 1 71 ? -2.329  11.571  -7.738  1.00 10.00 ? 480 LYS A HZ2  7  
ATOM 8106  H HZ3  . LYS A 1 71 ? -0.873  10.729  -7.910  1.00 10.00 ? 480 LYS A HZ3  7  
ATOM 8107  N N    . ASN A 1 4  ? 12.723  7.480   22.230  1.00 10.00 ? 413 ASN A N    8  
ATOM 8108  C CA   . ASN A 1 4  ? 11.702  7.281   21.209  1.00 10.00 ? 413 ASN A CA   8  
ATOM 8109  C C    . ASN A 1 4  ? 10.434  6.690   21.815  1.00 10.00 ? 413 ASN A C    8  
ATOM 8110  O O    . ASN A 1 4  ? 10.491  5.933   22.785  1.00 10.00 ? 413 ASN A O    8  
ATOM 8111  C CB   . ASN A 1 4  ? 12.229  6.362   20.104  1.00 10.00 ? 413 ASN A CB   8  
ATOM 8112  C CG   . ASN A 1 4  ? 13.598  6.784   19.607  1.00 10.00 ? 413 ASN A CG   8  
ATOM 8113  O OD1  . ASN A 1 4  ? 13.772  7.891   19.097  1.00 10.00 ? 413 ASN A OD1  8  
ATOM 8114  N ND2  . ASN A 1 4  ? 14.578  5.899   19.752  1.00 10.00 ? 413 ASN A ND2  8  
ATOM 8115  H H    . ASN A 1 4  ? 13.191  6.701   22.597  1.00 10.00 ? 413 ASN A H    8  
ATOM 8116  H HA   . ASN A 1 4  ? 11.468  8.245   20.782  1.00 10.00 ? 413 ASN A HA   8  
ATOM 8117  H HB2  . ASN A 1 4  ? 12.299  5.355   20.485  1.00 10.00 ? 413 ASN A HB2  8  
ATOM 8118  H HB3  . ASN A 1 4  ? 11.541  6.381   19.271  1.00 10.00 ? 413 ASN A HB3  8  
ATOM 8119  H HD21 . ASN A 1 4  ? 14.366  5.038   20.166  1.00 10.00 ? 413 ASN A HD21 8  
ATOM 8120  H HD22 . ASN A 1 4  ? 15.474  6.146   19.439  1.00 10.00 ? 413 ASN A HD22 8  
ATOM 8121  N N    . GLY A 1 5  ? 9.289   7.039   21.237  1.00 10.00 ? 414 GLY A N    8  
ATOM 8122  C CA   . GLY A 1 5  ? 8.022   6.535   21.734  1.00 10.00 ? 414 GLY A CA   8  
ATOM 8123  C C    . GLY A 1 5  ? 6.907   6.664   20.716  1.00 10.00 ? 414 GLY A C    8  
ATOM 8124  O O    . GLY A 1 5  ? 6.165   7.646   20.720  1.00 10.00 ? 414 GLY A O    8  
ATOM 8125  H H    . GLY A 1 5  ? 9.304   7.645   20.467  1.00 10.00 ? 414 GLY A H    8  
ATOM 8126  H HA2  . GLY A 1 5  ? 8.140   5.492   21.992  1.00 10.00 ? 414 GLY A HA2  8  
ATOM 8127  H HA3  . GLY A 1 5  ? 7.751   7.086   22.621  1.00 10.00 ? 414 GLY A HA3  8  
ATOM 8128  N N    . LEU A 1 6  ? 6.787   5.670   19.841  1.00 10.00 ? 415 LEU A N    8  
ATOM 8129  C CA   . LEU A 1 6  ? 5.754   5.677   18.812  1.00 10.00 ? 415 LEU A CA   8  
ATOM 8130  C C    . LEU A 1 6  ? 4.662   4.662   19.132  1.00 10.00 ? 415 LEU A C    8  
ATOM 8131  O O    . LEU A 1 6  ? 3.477   4.998   19.158  1.00 10.00 ? 415 LEU A O    8  
ATOM 8132  C CB   . LEU A 1 6  ? 6.365   5.372   17.444  1.00 10.00 ? 415 LEU A CB   8  
ATOM 8133  C CG   . LEU A 1 6  ? 7.152   6.524   16.814  1.00 10.00 ? 415 LEU A CG   8  
ATOM 8134  C CD1  . LEU A 1 6  ? 6.288   7.772   16.722  1.00 10.00 ? 415 LEU A CD1  8  
ATOM 8135  C CD2  . LEU A 1 6  ? 8.415   6.805   17.614  1.00 10.00 ? 415 LEU A CD2  8  
ATOM 8136  H H    . LEU A 1 6  ? 7.409   4.914   19.888  1.00 10.00 ? 415 LEU A H    8  
ATOM 8137  H HA   . LEU A 1 6  ? 5.316   6.664   18.789  1.00 10.00 ? 415 LEU A HA   8  
ATOM 8138  H HB2  . LEU A 1 6  ? 7.029   4.526   17.550  1.00 10.00 ? 415 LEU A HB2  8  
ATOM 8139  H HB3  . LEU A 1 6  ? 5.567   5.100   16.769  1.00 10.00 ? 415 LEU A HB3  8  
ATOM 8140  H HG   . LEU A 1 6  ? 7.445   6.246   15.812  1.00 10.00 ? 415 LEU A HG   8  
ATOM 8141  H HD11 . LEU A 1 6  ? 6.776   8.502   16.093  1.00 10.00 ? 415 LEU A HD11 8  
ATOM 8142  H HD12 . LEU A 1 6  ? 6.145   8.184   17.709  1.00 10.00 ? 415 LEU A HD12 8  
ATOM 8143  H HD13 . LEU A 1 6  ? 5.328   7.515   16.297  1.00 10.00 ? 415 LEU A HD13 8  
ATOM 8144  H HD21 . LEU A 1 6  ? 8.154   7.316   18.530  1.00 10.00 ? 415 LEU A HD21 8  
ATOM 8145  H HD22 . LEU A 1 6  ? 9.079   7.427   17.032  1.00 10.00 ? 415 LEU A HD22 8  
ATOM 8146  H HD23 . LEU A 1 6  ? 8.907   5.873   17.850  1.00 10.00 ? 415 LEU A HD23 8  
ATOM 8147  N N    . MET A 1 7  ? 5.067   3.420   19.374  1.00 10.00 ? 416 MET A N    8  
ATOM 8148  C CA   . MET A 1 7  ? 4.123   2.355   19.692  1.00 10.00 ? 416 MET A CA   8  
ATOM 8149  C C    . MET A 1 7  ? 3.149   2.129   18.540  1.00 10.00 ? 416 MET A C    8  
ATOM 8150  O O    . MET A 1 7  ? 2.330   2.993   18.228  1.00 10.00 ? 416 MET A O    8  
ATOM 8151  C CB   . MET A 1 7  ? 3.351   2.693   20.969  1.00 10.00 ? 416 MET A CB   8  
ATOM 8152  C CG   . MET A 1 7  ? 4.246   3.039   22.148  1.00 10.00 ? 416 MET A CG   8  
ATOM 8153  S SD   . MET A 1 7  ? 4.495   1.644   23.263  1.00 10.00 ? 416 MET A SD   8  
ATOM 8154  C CE   . MET A 1 7  ? 5.313   0.481   22.175  1.00 10.00 ? 416 MET A CE   8  
ATOM 8155  H H    . MET A 1 7  ? 6.025   3.215   19.339  1.00 10.00 ? 416 MET A H    8  
ATOM 8156  H HA   . MET A 1 7  ? 4.687   1.449   19.853  1.00 10.00 ? 416 MET A HA   8  
ATOM 8157  H HB2  . MET A 1 7  ? 2.707   3.539   20.773  1.00 10.00 ? 416 MET A HB2  8  
ATOM 8158  H HB3  . MET A 1 7  ? 2.742   1.845   21.244  1.00 10.00 ? 416 MET A HB3  8  
ATOM 8159  H HG2  . MET A 1 7  ? 5.208   3.356   21.771  1.00 10.00 ? 416 MET A HG2  8  
ATOM 8160  H HG3  . MET A 1 7  ? 3.793   3.849   22.701  1.00 10.00 ? 416 MET A HG3  8  
ATOM 8161  H HE1  . MET A 1 7  ? 5.735   -0.322  22.759  1.00 10.00 ? 416 MET A HE1  8  
ATOM 8162  H HE2  . MET A 1 7  ? 6.100   0.986   21.634  1.00 10.00 ? 416 MET A HE2  8  
ATOM 8163  H HE3  . MET A 1 7  ? 4.597   0.079   21.473  1.00 10.00 ? 416 MET A HE3  8  
ATOM 8164  N N    . ALA A 1 8  ? 3.244   0.962   17.913  1.00 10.00 ? 417 ALA A N    8  
ATOM 8165  C CA   . ALA A 1 8  ? 2.371   0.621   16.796  1.00 10.00 ? 417 ALA A CA   8  
ATOM 8166  C C    . ALA A 1 8  ? 2.242   -0.890  16.642  1.00 10.00 ? 417 ALA A C    8  
ATOM 8167  O O    . ALA A 1 8  ? 3.052   -1.651  17.171  1.00 10.00 ? 417 ALA A O    8  
ATOM 8168  C CB   . ALA A 1 8  ? 2.896   1.241   15.510  1.00 10.00 ? 417 ALA A CB   8  
ATOM 8169  H H    . ALA A 1 8  ? 3.917   0.313   18.209  1.00 10.00 ? 417 ALA A H    8  
ATOM 8170  H HA   . ALA A 1 8  ? 1.396   1.038   16.997  1.00 10.00 ? 417 ALA A HA   8  
ATOM 8171  H HB1  . ALA A 1 8  ? 2.643   0.605   14.674  1.00 10.00 ? 417 ALA A HB1  8  
ATOM 8172  H HB2  . ALA A 1 8  ? 3.969   1.344   15.571  1.00 10.00 ? 417 ALA A HB2  8  
ATOM 8173  H HB3  . ALA A 1 8  ? 2.448   2.214   15.370  1.00 10.00 ? 417 ALA A HB3  8  
ATOM 8174  N N    . ASP A 1 9  ? 1.216   -1.319  15.914  1.00 10.00 ? 418 ASP A N    8  
ATOM 8175  C CA   . ASP A 1 9  ? 0.979   -2.741  15.690  1.00 10.00 ? 418 ASP A CA   8  
ATOM 8176  C C    . ASP A 1 9  ? 0.722   -3.024  14.212  1.00 10.00 ? 418 ASP A C    8  
ATOM 8177  O O    . ASP A 1 9  ? -0.428  -3.103  13.778  1.00 10.00 ? 418 ASP A O    8  
ATOM 8178  C CB   . ASP A 1 9  ? -0.208  -3.220  16.527  1.00 10.00 ? 418 ASP A CB   8  
ATOM 8179  C CG   . ASP A 1 9  ? -0.064  -4.665  16.962  1.00 10.00 ? 418 ASP A CG   8  
ATOM 8180  O OD1  . ASP A 1 9  ? 1.020   -5.028  17.466  1.00 10.00 ? 418 ASP A OD1  8  
ATOM 8181  O OD2  . ASP A 1 9  ? -1.035  -5.433  16.799  1.00 10.00 ? 418 ASP A OD2  8  
ATOM 8182  H H    . ASP A 1 9  ? 0.603   -0.665  15.518  1.00 10.00 ? 418 ASP A H    8  
ATOM 8183  H HA   . ASP A 1 9  ? 1.865   -3.277  15.999  1.00 10.00 ? 418 ASP A HA   8  
ATOM 8184  H HB2  . ASP A 1 9  ? -0.290  -2.604  17.412  1.00 10.00 ? 418 ASP A HB2  8  
ATOM 8185  H HB3  . ASP A 1 9  ? -1.113  -3.127  15.945  1.00 10.00 ? 418 ASP A HB3  8  
ATOM 8186  N N    . PRO A 1 10 ? 1.794   -3.184  13.417  1.00 10.00 ? 419 PRO A N    8  
ATOM 8187  C CA   . PRO A 1 10 ? 1.679   -3.460  11.981  1.00 10.00 ? 419 PRO A CA   8  
ATOM 8188  C C    . PRO A 1 10 ? 0.767   -4.649  11.692  1.00 10.00 ? 419 PRO A C    8  
ATOM 8189  O O    . PRO A 1 10 ? 0.905   -5.710  12.299  1.00 10.00 ? 419 PRO A O    8  
ATOM 8190  C CB   . PRO A 1 10 ? 3.116   -3.773  11.562  1.00 10.00 ? 419 PRO A CB   8  
ATOM 8191  C CG   . PRO A 1 10 ? 3.965   -3.069  12.561  1.00 10.00 ? 419 PRO A CG   8  
ATOM 8192  C CD   . PRO A 1 10 ? 3.200   -3.107  13.855  1.00 10.00 ? 419 PRO A CD   8  
ATOM 8193  H HA   . PRO A 1 10 ? 1.322   -2.596  11.440  1.00 10.00 ? 419 PRO A HA   8  
ATOM 8194  H HB2  . PRO A 1 10 ? 3.277   -4.841  11.589  1.00 10.00 ? 419 PRO A HB2  8  
ATOM 8195  H HB3  . PRO A 1 10 ? 3.291   -3.403  10.563  1.00 10.00 ? 419 PRO A HB3  8  
ATOM 8196  H HG2  . PRO A 1 10 ? 4.910   -3.582  12.668  1.00 10.00 ? 419 PRO A HG2  8  
ATOM 8197  H HG3  . PRO A 1 10 ? 4.126   -2.046  12.250  1.00 10.00 ? 419 PRO A HG3  8  
ATOM 8198  H HD2  . PRO A 1 10 ? 3.474   -3.979  14.430  1.00 10.00 ? 419 PRO A HD2  8  
ATOM 8199  H HD3  . PRO A 1 10 ? 3.377   -2.206  14.425  1.00 10.00 ? 419 PRO A HD3  8  
ATOM 8200  N N    . MET A 1 11 ? -0.163  -4.462  10.762  1.00 10.00 ? 420 MET A N    8  
ATOM 8201  C CA   . MET A 1 11 ? -1.096  -5.519  10.392  1.00 10.00 ? 420 MET A CA   8  
ATOM 8202  C C    . MET A 1 11 ? -1.124  -5.714  8.884   1.00 10.00 ? 420 MET A C    8  
ATOM 8203  O O    . MET A 1 11 ? -0.455  -6.600  8.361   1.00 10.00 ? 420 MET A O    8  
ATOM 8204  C CB   . MET A 1 11 ? -2.499  -5.195  10.916  1.00 10.00 ? 420 MET A CB   8  
ATOM 8205  C CG   . MET A 1 11 ? -3.551  -6.219  10.520  1.00 10.00 ? 420 MET A CG   8  
ATOM 8206  S SD   . MET A 1 11 ? -4.933  -6.278  11.676  1.00 10.00 ? 420 MET A SD   8  
ATOM 8207  C CE   . MET A 1 11 ? -4.994  -8.030  12.044  1.00 10.00 ? 420 MET A CE   8  
ATOM 8208  H H    . MET A 1 11 ? -0.224  -3.593  10.313  1.00 10.00 ? 420 MET A H    8  
ATOM 8209  H HA   . MET A 1 11 ? -0.756  -6.438  10.845  1.00 10.00 ? 420 MET A HA   8  
ATOM 8210  H HB2  . MET A 1 11 ? -2.465  -5.146  11.994  1.00 10.00 ? 420 MET A HB2  8  
ATOM 8211  H HB3  . MET A 1 11 ? -2.801  -4.232  10.531  1.00 10.00 ? 420 MET A HB3  8  
ATOM 8212  H HG2  . MET A 1 11 ? -3.931  -5.966  9.541   1.00 10.00 ? 420 MET A HG2  8  
ATOM 8213  H HG3  . MET A 1 11 ? -3.089  -7.194  10.482  1.00 10.00 ? 420 MET A HG3  8  
ATOM 8214  H HE1  . MET A 1 11 ? -6.017  -8.325  12.223  1.00 10.00 ? 420 MET A HE1  8  
ATOM 8215  H HE2  . MET A 1 11 ? -4.400  -8.235  12.923  1.00 10.00 ? 420 MET A HE2  8  
ATOM 8216  H HE3  . MET A 1 11 ? -4.599  -8.586  11.206  1.00 10.00 ? 420 MET A HE3  8  
ATOM 8217  N N    . LYS A 1 12 ? -1.898  -4.890  8.184   1.00 10.00 ? 421 LYS A N    8  
ATOM 8218  C CA   . LYS A 1 12 ? -2.001  -4.996  6.731   1.00 10.00 ? 421 LYS A CA   8  
ATOM 8219  C C    . LYS A 1 12 ? -0.634  -5.162  6.089   1.00 10.00 ? 421 LYS A C    8  
ATOM 8220  O O    . LYS A 1 12 ? 0.095   -4.190  5.890   1.00 10.00 ? 421 LYS A O    8  
ATOM 8221  C CB   . LYS A 1 12 ? -2.690  -3.779  6.132   1.00 10.00 ? 421 LYS A CB   8  
ATOM 8222  C CG   . LYS A 1 12 ? -2.954  -3.940  4.646   1.00 10.00 ? 421 LYS A CG   8  
ATOM 8223  C CD   . LYS A 1 12 ? -4.304  -4.570  4.401   1.00 10.00 ? 421 LYS A CD   8  
ATOM 8224  C CE   . LYS A 1 12 ? -4.433  -5.092  2.979   1.00 10.00 ? 421 LYS A CE   8  
ATOM 8225  N NZ   . LYS A 1 12 ? -5.416  -6.207  2.882   1.00 10.00 ? 421 LYS A NZ   8  
ATOM 8226  H H    . LYS A 1 12 ? -2.410  -4.201  8.654   1.00 10.00 ? 421 LYS A H    8  
ATOM 8227  H HA   . LYS A 1 12 ? -2.591  -5.870  6.506   1.00 10.00 ? 421 LYS A HA   8  
ATOM 8228  H HB2  . LYS A 1 12 ? -3.634  -3.627  6.635   1.00 10.00 ? 421 LYS A HB2  8  
ATOM 8229  H HB3  . LYS A 1 12 ? -2.064  -2.914  6.280   1.00 10.00 ? 421 LYS A HB3  8  
ATOM 8230  H HG2  . LYS A 1 12 ? -2.928  -2.974  4.171   1.00 10.00 ? 421 LYS A HG2  8  
ATOM 8231  H HG3  . LYS A 1 12 ? -2.189  -4.575  4.220   1.00 10.00 ? 421 LYS A HG3  8  
ATOM 8232  H HD2  . LYS A 1 12 ? -4.432  -5.391  5.092   1.00 10.00 ? 421 LYS A HD2  8  
ATOM 8233  H HD3  . LYS A 1 12 ? -5.064  -3.825  4.576   1.00 10.00 ? 421 LYS A HD3  8  
ATOM 8234  H HE2  . LYS A 1 12 ? -4.756  -4.284  2.341   1.00 10.00 ? 421 LYS A HE2  8  
ATOM 8235  H HE3  . LYS A 1 12 ? -3.467  -5.445  2.651   1.00 10.00 ? 421 LYS A HE3  8  
ATOM 8236  H HZ1  . LYS A 1 12 ? -6.197  -5.941  2.249   1.00 10.00 ? 421 LYS A HZ1  8  
ATOM 8237  H HZ2  . LYS A 1 12 ? -5.806  -6.427  3.821   1.00 10.00 ? 421 LYS A HZ2  8  
ATOM 8238  H HZ3  . LYS A 1 12 ? -4.953  -7.059  2.505   1.00 10.00 ? 421 LYS A HZ3  8  
ATOM 8239  N N    . VAL A 1 13 ? -0.299  -6.402  5.770   1.00 10.00 ? 422 VAL A N    8  
ATOM 8240  C CA   . VAL A 1 13 ? 0.975   -6.718  5.153   1.00 10.00 ? 422 VAL A CA   8  
ATOM 8241  C C    . VAL A 1 13 ? 1.080   -8.223  4.913   1.00 10.00 ? 422 VAL A C    8  
ATOM 8242  O O    . VAL A 1 13 ? 1.367   -8.677  3.805   1.00 10.00 ? 422 VAL A O    8  
ATOM 8243  C CB   . VAL A 1 13 ? 2.141   -6.197  6.021   1.00 10.00 ? 422 VAL A CB   8  
ATOM 8244  C CG1  . VAL A 1 13 ? 2.453   -7.133  7.182   1.00 10.00 ? 422 VAL A CG1  8  
ATOM 8245  C CG2  . VAL A 1 13 ? 3.378   -5.954  5.171   1.00 10.00 ? 422 VAL A CG2  8  
ATOM 8246  H H    . VAL A 1 13 ? -0.929  -7.125  5.954   1.00 10.00 ? 422 VAL A H    8  
ATOM 8247  H HA   . VAL A 1 13 ? 1.005   -6.213  4.206   1.00 10.00 ? 422 VAL A HA   8  
ATOM 8248  H HB   . VAL A 1 13 ? 1.827   -5.248  6.439   1.00 10.00 ? 422 VAL A HB   8  
ATOM 8249  H HG11 . VAL A 1 13 ? 3.250   -6.714  7.778   1.00 10.00 ? 422 VAL A HG11 8  
ATOM 8250  H HG12 . VAL A 1 13 ? 2.759   -8.095  6.797   1.00 10.00 ? 422 VAL A HG12 8  
ATOM 8251  H HG13 . VAL A 1 13 ? 1.571   -7.254  7.794   1.00 10.00 ? 422 VAL A HG13 8  
ATOM 8252  H HG21 . VAL A 1 13 ? 4.124   -6.702  5.398   1.00 10.00 ? 422 VAL A HG21 8  
ATOM 8253  H HG22 . VAL A 1 13 ? 3.775   -4.974  5.386   1.00 10.00 ? 422 VAL A HG22 8  
ATOM 8254  H HG23 . VAL A 1 13 ? 3.115   -6.014  4.126   1.00 10.00 ? 422 VAL A HG23 8  
ATOM 8255  N N    . TYR A 1 14 ? 0.793   -8.980  5.964   1.00 10.00 ? 423 TYR A N    8  
ATOM 8256  C CA   . TYR A 1 14 ? 0.782   -10.439 5.931   1.00 10.00 ? 423 TYR A CA   8  
ATOM 8257  C C    . TYR A 1 14 ? 0.172   -10.947 4.629   1.00 10.00 ? 423 TYR A C    8  
ATOM 8258  O O    . TYR A 1 14 ? 0.703   -11.853 3.987   1.00 10.00 ? 423 TYR A O    8  
ATOM 8259  C CB   . TYR A 1 14 ? -0.047  -10.944 7.121   1.00 10.00 ? 423 TYR A CB   8  
ATOM 8260  C CG   . TYR A 1 14 ? -1.415  -10.295 7.194   1.00 10.00 ? 423 TYR A CG   8  
ATOM 8261  C CD1  . TYR A 1 14 ? -1.532  -8.927  7.384   1.00 10.00 ? 423 TYR A CD1  8  
ATOM 8262  C CD2  . TYR A 1 14 ? -2.583  -11.032 7.049   1.00 10.00 ? 423 TYR A CD2  8  
ATOM 8263  C CE1  . TYR A 1 14 ? -2.748  -8.304  7.431   1.00 10.00 ? 423 TYR A CE1  8  
ATOM 8264  C CE2  . TYR A 1 14 ? -3.822  -10.415 7.098   1.00 10.00 ? 423 TYR A CE2  8  
ATOM 8265  C CZ   . TYR A 1 14 ? -3.899  -9.049  7.289   1.00 10.00 ? 423 TYR A CZ   8  
ATOM 8266  O OH   . TYR A 1 14 ? -5.127  -8.429  7.334   1.00 10.00 ? 423 TYR A OH   8  
ATOM 8267  H H    . TYR A 1 14 ? 0.551   -8.535  6.794   1.00 10.00 ? 423 TYR A H    8  
ATOM 8268  H HA   . TYR A 1 14 ? 1.794   -10.796 6.015   1.00 10.00 ? 423 TYR A HA   8  
ATOM 8269  H HB2  . TYR A 1 14 ? -0.182  -12.011 7.039   1.00 10.00 ? 423 TYR A HB2  8  
ATOM 8270  H HB3  . TYR A 1 14 ? 0.476   -10.715 8.041   1.00 10.00 ? 423 TYR A HB3  8  
ATOM 8271  H HD1  . TYR A 1 14 ? -0.642  -8.341  7.501   1.00 10.00 ? 423 TYR A HD1  8  
ATOM 8272  H HD2  . TYR A 1 14 ? -2.518  -12.099 6.900   1.00 10.00 ? 423 TYR A HD2  8  
ATOM 8273  H HE1  . TYR A 1 14 ? -2.785  -7.233  7.572   1.00 10.00 ? 423 TYR A HE1  8  
ATOM 8274  H HE2  . TYR A 1 14 ? -4.722  -11.002 6.987   1.00 10.00 ? 423 TYR A HE2  8  
ATOM 8275  H HH   . TYR A 1 14 ? -5.082  -7.595  6.862   1.00 10.00 ? 423 TYR A HH   8  
ATOM 8276  N N    . LYS A 1 15 ? -0.945  -10.341 4.246   1.00 10.00 ? 424 LYS A N    8  
ATOM 8277  C CA   . LYS A 1 15 ? -1.640  -10.708 3.018   1.00 10.00 ? 424 LYS A CA   8  
ATOM 8278  C C    . LYS A 1 15 ? -1.237  -9.776  1.878   1.00 10.00 ? 424 LYS A C    8  
ATOM 8279  O O    . LYS A 1 15 ? -1.378  -10.116 0.704   1.00 10.00 ? 424 LYS A O    8  
ATOM 8280  C CB   . LYS A 1 15 ? -3.154  -10.655 3.226   1.00 10.00 ? 424 LYS A CB   8  
ATOM 8281  C CG   . LYS A 1 15 ? -3.729  -11.925 3.832   1.00 10.00 ? 424 LYS A CG   8  
ATOM 8282  C CD   . LYS A 1 15 ? -5.248  -11.936 3.766   1.00 10.00 ? 424 LYS A CD   8  
ATOM 8283  C CE   . LYS A 1 15 ? -5.853  -12.628 4.976   1.00 10.00 ? 424 LYS A CE   8  
ATOM 8284  N NZ   . LYS A 1 15 ? -7.144  -12.006 5.383   1.00 10.00 ? 424 LYS A NZ   8  
ATOM 8285  H H    . LYS A 1 15 ? -1.308  -9.619  4.801   1.00 10.00 ? 424 LYS A H    8  
ATOM 8286  H HA   . LYS A 1 15 ? -1.354  -11.717 2.762   1.00 10.00 ? 424 LYS A HA   8  
ATOM 8287  H HB2  . LYS A 1 15 ? -3.387  -9.830  3.885   1.00 10.00 ? 424 LYS A HB2  8  
ATOM 8288  H HB3  . LYS A 1 15 ? -3.632  -10.488 2.272   1.00 10.00 ? 424 LYS A HB3  8  
ATOM 8289  H HG2  . LYS A 1 15 ? -3.350  -12.776 3.287   1.00 10.00 ? 424 LYS A HG2  8  
ATOM 8290  H HG3  . LYS A 1 15 ? -3.422  -11.991 4.865   1.00 10.00 ? 424 LYS A HG3  8  
ATOM 8291  H HD2  . LYS A 1 15 ? -5.604  -10.917 3.730   1.00 10.00 ? 424 LYS A HD2  8  
ATOM 8292  H HD3  . LYS A 1 15 ? -5.555  -12.458 2.871   1.00 10.00 ? 424 LYS A HD3  8  
ATOM 8293  H HE2  . LYS A 1 15 ? -6.025  -13.665 4.733   1.00 10.00 ? 424 LYS A HE2  8  
ATOM 8294  H HE3  . LYS A 1 15 ? -5.157  -12.562 5.798   1.00 10.00 ? 424 LYS A HE3  8  
ATOM 8295  H HZ1  . LYS A 1 15 ? -6.974  -11.255 6.083   1.00 10.00 ? 424 LYS A HZ1  8  
ATOM 8296  H HZ2  . LYS A 1 15 ? -7.769  -12.722 5.804   1.00 10.00 ? 424 LYS A HZ2  8  
ATOM 8297  H HZ3  . LYS A 1 15 ? -7.619  -11.592 4.555   1.00 10.00 ? 424 LYS A HZ3  8  
ATOM 8298  N N    . ASP A 1 16 ? -0.734  -8.599  2.235   1.00 10.00 ? 425 ASP A N    8  
ATOM 8299  C CA   . ASP A 1 16 ? -0.305  -7.617  1.250   1.00 10.00 ? 425 ASP A CA   8  
ATOM 8300  C C    . ASP A 1 16 ? 0.868   -8.141  0.421   1.00 10.00 ? 425 ASP A C    8  
ATOM 8301  O O    . ASP A 1 16 ? 1.177   -7.605  -0.640  1.00 10.00 ? 425 ASP A O    8  
ATOM 8302  C CB   . ASP A 1 16 ? 0.094   -6.318  1.951   1.00 10.00 ? 425 ASP A CB   8  
ATOM 8303  C CG   . ASP A 1 16 ? -0.299  -5.081  1.168   1.00 10.00 ? 425 ASP A CG   8  
ATOM 8304  O OD1  . ASP A 1 16 ? -0.381  -5.164  -0.074  1.00 10.00 ? 425 ASP A OD1  8  
ATOM 8305  O OD2  . ASP A 1 16 ? -0.520  -4.027  1.800   1.00 10.00 ? 425 ASP A OD2  8  
ATOM 8306  H H    . ASP A 1 16 ? -0.647  -8.386  3.185   1.00 10.00 ? 425 ASP A H    8  
ATOM 8307  H HA   . ASP A 1 16 ? -1.136  -7.421  0.594   1.00 10.00 ? 425 ASP A HA   8  
ATOM 8308  H HB2  . ASP A 1 16 ? -0.395  -6.276  2.914   1.00 10.00 ? 425 ASP A HB2  8  
ATOM 8309  H HB3  . ASP A 1 16 ? 1.164   -6.307  2.096   1.00 10.00 ? 425 ASP A HB3  8  
ATOM 8310  N N    . ARG A 1 17 ? 1.523   -9.191  0.911   1.00 10.00 ? 426 ARG A N    8  
ATOM 8311  C CA   . ARG A 1 17 ? 2.662   -9.775  0.209   1.00 10.00 ? 426 ARG A CA   8  
ATOM 8312  C C    . ARG A 1 17 ? 2.275   -10.217 -1.197  1.00 10.00 ? 426 ARG A C    8  
ATOM 8313  O O    . ARG A 1 17 ? 3.103   -10.209 -2.108  1.00 10.00 ? 426 ARG A O    8  
ATOM 8314  C CB   . ARG A 1 17 ? 3.224   -10.957 1.002   1.00 10.00 ? 426 ARG A CB   8  
ATOM 8315  C CG   . ARG A 1 17 ? 4.728   -11.124 0.862   1.00 10.00 ? 426 ARG A CG   8  
ATOM 8316  C CD   . ARG A 1 17 ? 5.319   -11.863 2.051   1.00 10.00 ? 426 ARG A CD   8  
ATOM 8317  N NE   . ARG A 1 17 ? 5.436   -13.298 1.800   1.00 10.00 ? 426 ARG A NE   8  
ATOM 8318  C CZ   . ARG A 1 17 ? 6.349   -13.839 0.997   1.00 10.00 ? 426 ARG A CZ   8  
ATOM 8319  N NH1  . ARG A 1 17 ? 7.226   -13.069 0.365   1.00 10.00 ? 426 ARG A NH1  8  
ATOM 8320  N NH2  . ARG A 1 17 ? 6.384   -15.153 0.826   1.00 10.00 ? 426 ARG A NH2  8  
ATOM 8321  H H    . ARG A 1 17 ? 1.239   -9.579  1.764   1.00 10.00 ? 426 ARG A H    8  
ATOM 8322  H HA   . ARG A 1 17 ? 3.422   -9.012  0.126   1.00 10.00 ? 426 ARG A HA   8  
ATOM 8323  H HB2  . ARG A 1 17 ? 2.995   -10.816 2.050   1.00 10.00 ? 426 ARG A HB2  8  
ATOM 8324  H HB3  . ARG A 1 17 ? 2.749   -11.865 0.658   1.00 10.00 ? 426 ARG A HB3  8  
ATOM 8325  H HG2  . ARG A 1 17 ? 4.937   -11.683 -0.038  1.00 10.00 ? 426 ARG A HG2  8  
ATOM 8326  H HG3  . ARG A 1 17 ? 5.184   -10.147 0.794   1.00 10.00 ? 426 ARG A HG3  8  
ATOM 8327  H HD2  . ARG A 1 17 ? 6.302   -11.464 2.255   1.00 10.00 ? 426 ARG A HD2  8  
ATOM 8328  H HD3  . ARG A 1 17 ? 4.682   -11.707 2.909   1.00 10.00 ? 426 ARG A HD3  8  
ATOM 8329  H HE   . ARG A 1 17 ? 4.800   -13.889 2.255   1.00 10.00 ? 426 ARG A HE   8  
ATOM 8330  H HH11 . ARG A 1 17 ? 7.205   -12.078 0.491   1.00 10.00 ? 426 ARG A HH11 8  
ATOM 8331  H HH12 . ARG A 1 17 ? 7.910   -13.482 -0.237  1.00 10.00 ? 426 ARG A HH12 8  
ATOM 8332  H HH21 . ARG A 1 17 ? 5.726   -15.737 1.300   1.00 10.00 ? 426 ARG A HH21 8  
ATOM 8333  H HH22 . ARG A 1 17 ? 7.070   -15.560 0.222   1.00 10.00 ? 426 ARG A HH22 8  
ATOM 8334  N N    . GLN A 1 18 ? 1.010   -10.581 -1.378  1.00 10.00 ? 427 GLN A N    8  
ATOM 8335  C CA   . GLN A 1 18 ? 0.523   -11.001 -2.689  1.00 10.00 ? 427 GLN A CA   8  
ATOM 8336  C C    . GLN A 1 18 ? -0.207  -9.846  -3.363  1.00 10.00 ? 427 GLN A C    8  
ATOM 8337  O O    . GLN A 1 18 ? -1.142  -10.045 -4.139  1.00 10.00 ? 427 GLN A O    8  
ATOM 8338  C CB   . GLN A 1 18 ? -0.390  -12.235 -2.589  1.00 10.00 ? 427 GLN A CB   8  
ATOM 8339  C CG   . GLN A 1 18 ? -0.801  -12.607 -1.171  1.00 10.00 ? 427 GLN A CG   8  
ATOM 8340  C CD   . GLN A 1 18 ? 0.366   -13.084 -0.324  1.00 10.00 ? 427 GLN A CD   8  
ATOM 8341  O OE1  . GLN A 1 18 ? 1.163   -13.915 -0.757  1.00 10.00 ? 427 GLN A OE1  8  
ATOM 8342  N NE2  . GLN A 1 18 ? 0.467   -12.558 0.893   1.00 10.00 ? 427 GLN A NE2  8  
ATOM 8343  H H    . GLN A 1 18 ? 0.389   -10.552 -0.620  1.00 10.00 ? 427 GLN A H    8  
ATOM 8344  H HA   . GLN A 1 18 ? 1.386   -11.248 -3.291  1.00 10.00 ? 427 GLN A HA   8  
ATOM 8345  H HB2  . GLN A 1 18 ? -1.288  -12.048 -3.158  1.00 10.00 ? 427 GLN A HB2  8  
ATOM 8346  H HB3  . GLN A 1 18 ? 0.125   -13.080 -3.022  1.00 10.00 ? 427 GLN A HB3  8  
ATOM 8347  H HG2  . GLN A 1 18 ? -1.237  -11.741 -0.699  1.00 10.00 ? 427 GLN A HG2  8  
ATOM 8348  H HG3  . GLN A 1 18 ? -1.537  -13.396 -1.219  1.00 10.00 ? 427 GLN A HG3  8  
ATOM 8349  H HE21 . GLN A 1 18 ? -0.206  -11.901 1.168   1.00 10.00 ? 427 GLN A HE21 8  
ATOM 8350  H HE22 . GLN A 1 18 ? 1.210   -12.846 1.464   1.00 10.00 ? 427 GLN A HE22 8  
ATOM 8351  N N    . VAL A 1 19 ? 0.249   -8.637  -3.059  1.00 10.00 ? 428 VAL A N    8  
ATOM 8352  C CA   . VAL A 1 19 ? -0.321  -7.422  -3.622  1.00 10.00 ? 428 VAL A CA   8  
ATOM 8353  C C    . VAL A 1 19 ? 0.681   -6.750  -4.541  1.00 10.00 ? 428 VAL A C    8  
ATOM 8354  O O    . VAL A 1 19 ? 0.302   -6.115  -5.524  1.00 10.00 ? 428 VAL A O    8  
ATOM 8355  C CB   . VAL A 1 19 ? -0.737  -6.436  -2.523  1.00 10.00 ? 428 VAL A CB   8  
ATOM 8356  C CG1  . VAL A 1 19 ? -1.115  -5.091  -3.119  1.00 10.00 ? 428 VAL A CG1  8  
ATOM 8357  C CG2  . VAL A 1 19 ? -1.881  -7.006  -1.704  1.00 10.00 ? 428 VAL A CG2  8  
ATOM 8358  H H    . VAL A 1 19 ? 1.004   -8.562  -2.441  1.00 10.00 ? 428 VAL A H    8  
ATOM 8359  H HA   . VAL A 1 19 ? -1.195  -7.689  -4.195  1.00 10.00 ? 428 VAL A HA   8  
ATOM 8360  H HB   . VAL A 1 19 ? 0.109   -6.288  -1.871  1.00 10.00 ? 428 VAL A HB   8  
ATOM 8361  H HG11 . VAL A 1 19 ? -1.961  -4.683  -2.585  1.00 10.00 ? 428 VAL A HG11 8  
ATOM 8362  H HG12 . VAL A 1 19 ? -1.372  -5.219  -4.161  1.00 10.00 ? 428 VAL A HG12 8  
ATOM 8363  H HG13 . VAL A 1 19 ? -0.276  -4.420  -3.035  1.00 10.00 ? 428 VAL A HG13 8  
ATOM 8364  H HG21 . VAL A 1 19 ? -2.020  -6.408  -0.818  1.00 10.00 ? 428 VAL A HG21 8  
ATOM 8365  H HG22 . VAL A 1 19 ? -1.650  -8.022  -1.421  1.00 10.00 ? 428 VAL A HG22 8  
ATOM 8366  H HG23 . VAL A 1 19 ? -2.784  -6.993  -2.294  1.00 10.00 ? 428 VAL A HG23 8  
ATOM 8367  N N    . MET A 1 20 ? 1.964   -6.906  -4.229  1.00 10.00 ? 429 MET A N    8  
ATOM 8368  C CA   . MET A 1 20 ? 3.019   -6.325  -5.055  1.00 10.00 ? 429 MET A CA   8  
ATOM 8369  C C    . MET A 1 20 ? 2.740   -6.598  -6.535  1.00 10.00 ? 429 MET A C    8  
ATOM 8370  O O    . MET A 1 20 ? 3.166   -5.843  -7.409  1.00 10.00 ? 429 MET A O    8  
ATOM 8371  C CB   . MET A 1 20 ? 4.382   -6.899  -4.662  1.00 10.00 ? 429 MET A CB   8  
ATOM 8372  C CG   . MET A 1 20 ? 4.442   -8.416  -4.719  1.00 10.00 ? 429 MET A CG   8  
ATOM 8373  S SD   . MET A 1 20 ? 6.105   -9.055  -4.441  1.00 10.00 ? 429 MET A SD   8  
ATOM 8374  C CE   . MET A 1 20 ? 6.243   -10.237 -5.779  1.00 10.00 ? 429 MET A CE   8  
ATOM 8375  H H    . MET A 1 20 ? 2.208   -7.433  -3.432  1.00 10.00 ? 429 MET A H    8  
ATOM 8376  H HA   . MET A 1 20 ? 3.022   -5.258  -4.890  1.00 10.00 ? 429 MET A HA   8  
ATOM 8377  H HB2  . MET A 1 20 ? 5.132   -6.505  -5.333  1.00 10.00 ? 429 MET A HB2  8  
ATOM 8378  H HB3  . MET A 1 20 ? 4.613   -6.587  -3.655  1.00 10.00 ? 429 MET A HB3  8  
ATOM 8379  H HG2  . MET A 1 20 ? 3.787   -8.817  -3.960  1.00 10.00 ? 429 MET A HG2  8  
ATOM 8380  H HG3  . MET A 1 20 ? 4.105   -8.740  -5.693  1.00 10.00 ? 429 MET A HG3  8  
ATOM 8381  H HE1  . MET A 1 20 ? 6.060   -9.739  -6.720  1.00 10.00 ? 429 MET A HE1  8  
ATOM 8382  H HE2  . MET A 1 20 ? 5.514   -11.023 -5.641  1.00 10.00 ? 429 MET A HE2  8  
ATOM 8383  H HE3  . MET A 1 20 ? 7.235   -10.663 -5.783  1.00 10.00 ? 429 MET A HE3  8  
ATOM 8384  N N    . ASN A 1 21 ? 2.011   -7.683  -6.798  1.00 10.00 ? 430 ASN A N    8  
ATOM 8385  C CA   . ASN A 1 21 ? 1.655   -8.066  -8.157  1.00 10.00 ? 430 ASN A CA   8  
ATOM 8386  C C    . ASN A 1 21 ? 0.143   -8.260  -8.295  1.00 10.00 ? 430 ASN A C    8  
ATOM 8387  O O    . ASN A 1 21 ? -0.319  -8.973  -9.184  1.00 10.00 ? 430 ASN A O    8  
ATOM 8388  C CB   . ASN A 1 21 ? 2.379   -9.357  -8.539  1.00 10.00 ? 430 ASN A CB   8  
ATOM 8389  C CG   . ASN A 1 21 ? 3.765   -9.101  -9.100  1.00 10.00 ? 430 ASN A CG   8  
ATOM 8390  O OD1  . ASN A 1 21 ? 4.580   -8.419  -8.480  1.00 10.00 ? 430 ASN A OD1  8  
ATOM 8391  N ND2  . ASN A 1 21 ? 4.036   -9.648  -10.279 1.00 10.00 ? 430 ASN A ND2  8  
ATOM 8392  H H    . ASN A 1 21 ? 1.700   -8.240  -6.055  1.00 10.00 ? 430 ASN A H    8  
ATOM 8393  H HA   . ASN A 1 21 ? 1.968   -7.274  -8.820  1.00 10.00 ? 430 ASN A HA   8  
ATOM 8394  H HB2  . ASN A 1 21 ? 2.475   -9.981  -7.660  1.00 10.00 ? 430 ASN A HB2  8  
ATOM 8395  H HB3  . ASN A 1 21 ? 1.799   -9.882  -9.284  1.00 10.00 ? 430 ASN A HB3  8  
ATOM 8396  H HD21 . ASN A 1 21 ? 3.338   -10.179 -10.715 1.00 10.00 ? 430 ASN A HD21 8  
ATOM 8397  H HD22 . ASN A 1 21 ? 4.924   -9.498  -10.665 1.00 10.00 ? 430 ASN A HD22 8  
ATOM 8398  N N    . MET A 1 22 ? -0.624  -7.619  -7.411  1.00 10.00 ? 431 MET A N    8  
ATOM 8399  C CA   . MET A 1 22 ? -2.084  -7.721  -7.437  1.00 10.00 ? 431 MET A CA   8  
ATOM 8400  C C    . MET A 1 22 ? -2.716  -7.053  -6.219  1.00 10.00 ? 431 MET A C    8  
ATOM 8401  O O    . MET A 1 22 ? -2.988  -7.709  -5.214  1.00 10.00 ? 431 MET A O    8  
ATOM 8402  C CB   . MET A 1 22 ? -2.525  -9.182  -7.483  1.00 10.00 ? 431 MET A CB   8  
ATOM 8403  C CG   . MET A 1 22 ? -2.948  -9.650  -8.867  1.00 10.00 ? 431 MET A CG   8  
ATOM 8404  S SD   . MET A 1 22 ? -4.463  -10.629 -8.839  1.00 10.00 ? 431 MET A SD   8  
ATOM 8405  C CE   . MET A 1 22 ? -5.375  -9.881  -10.186 1.00 10.00 ? 431 MET A CE   8  
ATOM 8406  H H    . MET A 1 22 ? -0.200  -7.063  -6.728  1.00 10.00 ? 431 MET A H    8  
ATOM 8407  H HA   . MET A 1 22 ? -2.434  -7.221  -8.327  1.00 10.00 ? 431 MET A HA   8  
ATOM 8408  H HB2  . MET A 1 22 ? -1.708  -9.803  -7.149  1.00 10.00 ? 431 MET A HB2  8  
ATOM 8409  H HB3  . MET A 1 22 ? -3.363  -9.309  -6.810  1.00 10.00 ? 431 MET A HB3  8  
ATOM 8410  H HG2  . MET A 1 22 ? -3.110  -8.783  -9.491  1.00 10.00 ? 431 MET A HG2  8  
ATOM 8411  H HG3  . MET A 1 22 ? -2.155  -10.251 -9.287  1.00 10.00 ? 431 MET A HG3  8  
ATOM 8412  H HE1  . MET A 1 22 ? -5.055  -8.857  -10.314 1.00 10.00 ? 431 MET A HE1  8  
ATOM 8413  H HE2  . MET A 1 22 ? -6.431  -9.902  -9.962  1.00 10.00 ? 431 MET A HE2  8  
ATOM 8414  H HE3  . MET A 1 22 ? -5.190  -10.431 -11.097 1.00 10.00 ? 431 MET A HE3  8  
ATOM 8415  N N    . TRP A 1 23 ? -2.984  -5.762  -6.328  1.00 10.00 ? 432 TRP A N    8  
ATOM 8416  C CA   . TRP A 1 23 ? -3.620  -5.021  -5.246  1.00 10.00 ? 432 TRP A CA   8  
ATOM 8417  C C    . TRP A 1 23 ? -5.128  -5.152  -5.374  1.00 10.00 ? 432 TRP A C    8  
ATOM 8418  O O    . TRP A 1 23 ? -5.760  -4.486  -6.192  1.00 10.00 ? 432 TRP A O    8  
ATOM 8419  C CB   . TRP A 1 23 ? -3.205  -3.548  -5.270  1.00 10.00 ? 432 TRP A CB   8  
ATOM 8420  C CG   . TRP A 1 23 ? -1.777  -3.303  -5.668  1.00 10.00 ? 432 TRP A CG   8  
ATOM 8421  C CD1  . TRP A 1 23 ? -1.204  -3.589  -6.868  1.00 10.00 ? 432 TRP A CD1  8  
ATOM 8422  C CD2  . TRP A 1 23 ? -0.743  -2.703  -4.873  1.00 10.00 ? 432 TRP A CD2  8  
ATOM 8423  N NE1  . TRP A 1 23 ? 0.102   -3.178  -6.880  1.00 10.00 ? 432 TRP A NE1  8  
ATOM 8424  C CE2  . TRP A 1 23 ? 0.411   -2.643  -5.668  1.00 10.00 ? 432 TRP A CE2  8  
ATOM 8425  C CE3  . TRP A 1 23 ? -0.684  -2.204  -3.576  1.00 10.00 ? 432 TRP A CE3  8  
ATOM 8426  C CZ2  . TRP A 1 23 ? 1.606   -2.101  -5.211  1.00 10.00 ? 432 TRP A CZ2  8  
ATOM 8427  C CZ3  . TRP A 1 23 ? 0.503   -1.671  -3.113  1.00 10.00 ? 432 TRP A CZ3  8  
ATOM 8428  C CH2  . TRP A 1 23 ? 1.637   -1.620  -3.933  1.00 10.00 ? 432 TRP A CH2  8  
ATOM 8429  H H    . TRP A 1 23 ? -2.777  -5.304  -7.164  1.00 10.00 ? 432 TRP A H    8  
ATOM 8430  H HA   . TRP A 1 23 ? -3.322  -5.464  -4.304  1.00 10.00 ? 432 TRP A HA   8  
ATOM 8431  H HB2  . TRP A 1 23 ? -3.831  -3.025  -5.975  1.00 10.00 ? 432 TRP A HB2  8  
ATOM 8432  H HB3  . TRP A 1 23 ? -3.354  -3.127  -4.289  1.00 10.00 ? 432 TRP A HB3  8  
ATOM 8433  H HD1  . TRP A 1 23 ? -1.721  -4.057  -7.686  1.00 10.00 ? 432 TRP A HD1  8  
ATOM 8434  H HE1  . TRP A 1 23 ? 0.712   -3.259  -7.629  1.00 10.00 ? 432 TRP A HE1  8  
ATOM 8435  H HE3  . TRP A 1 23 ? -1.541  -2.238  -2.936  1.00 10.00 ? 432 TRP A HE3  8  
ATOM 8436  H HZ2  . TRP A 1 23 ? 2.479   -2.043  -5.840  1.00 10.00 ? 432 TRP A HZ2  8  
ATOM 8437  H HZ3  . TRP A 1 23 ? 0.565   -1.282  -2.109  1.00 10.00 ? 432 TRP A HZ3  8  
ATOM 8438  H HH2  . TRP A 1 23 ? 2.545   -1.198  -3.532  1.00 10.00 ? 432 TRP A HH2  8  
ATOM 8439  N N    . SER A 1 24 ? -5.686  -6.043  -4.572  1.00 10.00 ? 433 SER A N    8  
ATOM 8440  C CA   . SER A 1 24 ? -7.121  -6.311  -4.592  1.00 10.00 ? 433 SER A CA   8  
ATOM 8441  C C    . SER A 1 24 ? -7.929  -5.074  -4.226  1.00 10.00 ? 433 SER A C    8  
ATOM 8442  O O    . SER A 1 24 ? -7.475  -4.226  -3.458  1.00 10.00 ? 433 SER A O    8  
ATOM 8443  C CB   . SER A 1 24 ? -7.459  -7.454  -3.633  1.00 10.00 ? 433 SER A CB   8  
ATOM 8444  O OG   . SER A 1 24 ? -8.746  -7.981  -3.902  1.00 10.00 ? 433 SER A OG   8  
ATOM 8445  H H    . SER A 1 24 ? -5.110  -6.548  -3.956  1.00 10.00 ? 433 SER A H    8  
ATOM 8446  H HA   . SER A 1 24 ? -7.384  -6.610  -5.595  1.00 10.00 ? 433 SER A HA   8  
ATOM 8447  H HB2  . SER A 1 24 ? -6.731  -8.243  -3.746  1.00 10.00 ? 433 SER A HB2  8  
ATOM 8448  H HB3  . SER A 1 24 ? -7.438  -7.087  -2.618  1.00 10.00 ? 433 SER A HB3  8  
ATOM 8449  H HG   . SER A 1 24 ? -9.387  -7.581  -3.309  1.00 10.00 ? 433 SER A HG   8  
ATOM 8450  N N    . GLU A 1 25 ? -9.142  -4.985  -4.772  1.00 10.00 ? 434 GLU A N    8  
ATOM 8451  C CA   . GLU A 1 25 ? -10.027 -3.859  -4.492  1.00 10.00 ? 434 GLU A CA   8  
ATOM 8452  C C    . GLU A 1 25 ? -10.121 -3.624  -2.990  1.00 10.00 ? 434 GLU A C    8  
ATOM 8453  O O    . GLU A 1 25 ? -10.299 -2.495  -2.533  1.00 10.00 ? 434 GLU A O    8  
ATOM 8454  C CB   . GLU A 1 25 ? -11.419 -4.119  -5.069  1.00 10.00 ? 434 GLU A CB   8  
ATOM 8455  C CG   . GLU A 1 25 ? -12.258 -2.861  -5.226  1.00 10.00 ? 434 GLU A CG   8  
ATOM 8456  C CD   . GLU A 1 25 ? -13.747 -3.148  -5.217  1.00 10.00 ? 434 GLU A CD   8  
ATOM 8457  O OE1  . GLU A 1 25 ? -14.343 -3.164  -4.120  1.00 10.00 ? 434 GLU A OE1  8  
ATOM 8458  O OE2  . GLU A 1 25 ? -14.317 -3.358  -6.308  1.00 10.00 ? 434 GLU A OE2  8  
ATOM 8459  H H    . GLU A 1 25 ? -9.452  -5.699  -5.368  1.00 10.00 ? 434 GLU A H    8  
ATOM 8460  H HA   . GLU A 1 25 ? -9.609  -2.980  -4.959  1.00 10.00 ? 434 GLU A HA   8  
ATOM 8461  H HB2  . GLU A 1 25 ? -11.314 -4.578  -6.042  1.00 10.00 ? 434 GLU A HB2  8  
ATOM 8462  H HB3  . GLU A 1 25 ? -11.947 -4.799  -4.416  1.00 10.00 ? 434 GLU A HB3  8  
ATOM 8463  H HG2  . GLU A 1 25 ? -12.033 -2.190  -4.411  1.00 10.00 ? 434 GLU A HG2  8  
ATOM 8464  H HG3  . GLU A 1 25 ? -12.003 -2.387  -6.162  1.00 10.00 ? 434 GLU A HG3  8  
ATOM 8465  N N    . GLN A 1 26 ? -9.986  -4.705  -2.229  1.00 10.00 ? 435 GLN A N    8  
ATOM 8466  C CA   . GLN A 1 26 ? -10.038 -4.632  -0.777  1.00 10.00 ? 435 GLN A CA   8  
ATOM 8467  C C    . GLN A 1 26 ? -8.663  -4.304  -0.215  1.00 10.00 ? 435 GLN A C    8  
ATOM 8468  O O    . GLN A 1 26 ? -8.545  -3.662  0.829   1.00 10.00 ? 435 GLN A O    8  
ATOM 8469  C CB   . GLN A 1 26 ? -10.537 -5.955  -0.196  1.00 10.00 ? 435 GLN A CB   8  
ATOM 8470  C CG   . GLN A 1 26 ? -11.292 -5.799  1.114   1.00 10.00 ? 435 GLN A CG   8  
ATOM 8471  C CD   . GLN A 1 26 ? -12.794 -5.726  0.918   1.00 10.00 ? 435 GLN A CD   8  
ATOM 8472  O OE1  . GLN A 1 26 ? -13.560 -6.308  1.686   1.00 10.00 ? 435 GLN A OE1  8  
ATOM 8473  N NE2  . GLN A 1 26 ? -13.222 -5.011  -0.116  1.00 10.00 ? 435 GLN A NE2  8  
ATOM 8474  H H    . GLN A 1 26 ? -9.837  -5.574  -2.656  1.00 10.00 ? 435 GLN A H    8  
ATOM 8475  H HA   . GLN A 1 26 ? -10.723 -3.844  -0.507  1.00 10.00 ? 435 GLN A HA   8  
ATOM 8476  H HB2  . GLN A 1 26 ? -11.195 -6.424  -0.913  1.00 10.00 ? 435 GLN A HB2  8  
ATOM 8477  H HB3  . GLN A 1 26 ? -9.688  -6.600  -0.025  1.00 10.00 ? 435 GLN A HB3  8  
ATOM 8478  H HG2  . GLN A 1 26 ? -11.067 -6.644  1.747   1.00 10.00 ? 435 GLN A HG2  8  
ATOM 8479  H HG3  . GLN A 1 26 ? -10.962 -4.890  1.598   1.00 10.00 ? 435 GLN A HG3  8  
ATOM 8480  H HE21 . GLN A 1 26 ? -12.555 -4.576  -0.687  1.00 10.00 ? 435 GLN A HE21 8  
ATOM 8481  H HE22 . GLN A 1 26 ? -14.188 -4.948  -0.266  1.00 10.00 ? 435 GLN A HE22 8  
ATOM 8482  N N    . GLU A 1 27 ? -7.620  -4.738  -0.919  1.00 10.00 ? 436 GLU A N    8  
ATOM 8483  C CA   . GLU A 1 27 ? -6.262  -4.482  -0.498  1.00 10.00 ? 436 GLU A CA   8  
ATOM 8484  C C    . GLU A 1 27 ? -5.918  -3.025  -0.743  1.00 10.00 ? 436 GLU A C    8  
ATOM 8485  O O    . GLU A 1 27 ? -5.547  -2.304  0.184   1.00 10.00 ? 436 GLU A O    8  
ATOM 8486  C CB   . GLU A 1 27 ? -5.321  -5.432  -1.241  1.00 10.00 ? 436 GLU A CB   8  
ATOM 8487  C CG   . GLU A 1 27 ? -4.694  -6.481  -0.337  1.00 10.00 ? 436 GLU A CG   8  
ATOM 8488  C CD   . GLU A 1 27 ? -4.660  -7.858  -0.970  1.00 10.00 ? 436 GLU A CD   8  
ATOM 8489  O OE1  . GLU A 1 27 ? -5.522  -8.138  -1.831  1.00 10.00 ? 436 GLU A OE1  8  
ATOM 8490  O OE2  . GLU A 1 27 ? -3.773  -8.657  -0.606  1.00 10.00 ? 436 GLU A OE2  8  
ATOM 8491  H H    . GLU A 1 27 ? -7.767  -5.239  -1.750  1.00 10.00 ? 436 GLU A H    8  
ATOM 8492  H HA   . GLU A 1 27 ? -6.197  -4.665  0.560   1.00 10.00 ? 436 GLU A HA   8  
ATOM 8493  H HB2  . GLU A 1 27 ? -5.885  -5.943  -2.009  1.00 10.00 ? 436 GLU A HB2  8  
ATOM 8494  H HB3  . GLU A 1 27 ? -4.535  -4.862  -1.708  1.00 10.00 ? 436 GLU A HB3  8  
ATOM 8495  H HG2  . GLU A 1 27 ? -3.685  -6.184  -0.105  1.00 10.00 ? 436 GLU A HG2  8  
ATOM 8496  H HG3  . GLU A 1 27 ? -5.269  -6.537  0.576   1.00 10.00 ? 436 GLU A HG3  8  
ATOM 8497  N N    . LYS A 1 28 ? -6.092  -2.574  -1.977  1.00 10.00 ? 437 LYS A N    8  
ATOM 8498  C CA   . LYS A 1 28 ? -5.848  -1.175  -2.309  1.00 10.00 ? 437 LYS A CA   8  
ATOM 8499  C C    . LYS A 1 28 ? -6.670  -0.289  -1.384  1.00 10.00 ? 437 LYS A C    8  
ATOM 8500  O O    . LYS A 1 28 ? -6.376  0.885   -1.205  1.00 10.00 ? 437 LYS A O    8  
ATOM 8501  C CB   . LYS A 1 28 ? -6.225  -0.894  -3.764  1.00 10.00 ? 437 LYS A CB   8  
ATOM 8502  C CG   . LYS A 1 28 ? -5.491  -1.771  -4.760  1.00 10.00 ? 437 LYS A CG   8  
ATOM 8503  C CD   . LYS A 1 28 ? -6.121  -1.703  -6.141  1.00 10.00 ? 437 LYS A CD   8  
ATOM 8504  C CE   . LYS A 1 28 ? -7.551  -2.218  -6.127  1.00 10.00 ? 437 LYS A CE   8  
ATOM 8505  N NZ   . LYS A 1 28 ? -8.542  -1.106  -6.105  1.00 10.00 ? 437 LYS A NZ   8  
ATOM 8506  H H    . LYS A 1 28 ? -6.429  -3.184  -2.665  1.00 10.00 ? 437 LYS A H    8  
ATOM 8507  H HA   . LYS A 1 28 ? -4.800  -0.957  -2.161  1.00 10.00 ? 437 LYS A HA   8  
ATOM 8508  H HB2  . LYS A 1 28 ? -7.286  -1.056  -3.888  1.00 10.00 ? 437 LYS A HB2  8  
ATOM 8509  H HB3  . LYS A 1 28 ? -6.000  0.138   -3.991  1.00 10.00 ? 437 LYS A HB3  8  
ATOM 8510  H HG2  . LYS A 1 28 ? -4.465  -1.439  -4.828  1.00 10.00 ? 437 LYS A HG2  8  
ATOM 8511  H HG3  . LYS A 1 28 ? -5.517  -2.794  -4.412  1.00 10.00 ? 437 LYS A HG3  8  
ATOM 8512  H HD2  . LYS A 1 28 ? -6.123  -0.679  -6.476  1.00 10.00 ? 437 LYS A HD2  8  
ATOM 8513  H HD3  . LYS A 1 28 ? -5.538  -2.306  -6.822  1.00 10.00 ? 437 LYS A HD3  8  
ATOM 8514  H HE2  . LYS A 1 28 ? -7.714  -2.815  -7.012  1.00 10.00 ? 437 LYS A HE2  8  
ATOM 8515  H HE3  . LYS A 1 28 ? -7.690  -2.830  -5.249  1.00 10.00 ? 437 LYS A HE3  8  
ATOM 8516  H HZ1  . LYS A 1 28 ? -9.373  -1.356  -6.677  1.00 10.00 ? 437 LYS A HZ1  8  
ATOM 8517  H HZ2  . LYS A 1 28 ? -8.116  -0.240  -6.493  1.00 10.00 ? 437 LYS A HZ2  8  
ATOM 8518  H HZ3  . LYS A 1 28 ? -8.848  -0.920  -5.128  1.00 10.00 ? 437 LYS A HZ3  8  
ATOM 8519  N N    . GLU A 1 29 ? -7.700  -0.875  -0.788  1.00 10.00 ? 438 GLU A N    8  
ATOM 8520  C CA   . GLU A 1 29 ? -8.563  -0.147  0.125   1.00 10.00 ? 438 GLU A CA   8  
ATOM 8521  C C    . GLU A 1 29 ? -7.789  0.340   1.340   1.00 10.00 ? 438 GLU A C    8  
ATOM 8522  O O    . GLU A 1 29 ? -8.189  1.306   1.986   1.00 10.00 ? 438 GLU A O    8  
ATOM 8523  C CB   . GLU A 1 29 ? -9.729  -1.031  0.571   1.00 10.00 ? 438 GLU A CB   8  
ATOM 8524  C CG   . GLU A 1 29 ? -11.007 -0.258  0.852   1.00 10.00 ? 438 GLU A CG   8  
ATOM 8525  C CD   . GLU A 1 29 ? -11.888 -0.944  1.878   1.00 10.00 ? 438 GLU A CD   8  
ATOM 8526  O OE1  . GLU A 1 29 ? -11.342 -1.630  2.766   1.00 10.00 ? 438 GLU A OE1  8  
ATOM 8527  O OE2  . GLU A 1 29 ? -13.125 -0.793  1.792   1.00 10.00 ? 438 GLU A OE2  8  
ATOM 8528  H H    . GLU A 1 29 ? -7.880  -1.824  -0.962  1.00 10.00 ? 438 GLU A H    8  
ATOM 8529  H HA   . GLU A 1 29 ? -8.953  0.709   -0.403  1.00 10.00 ? 438 GLU A HA   8  
ATOM 8530  H HB2  . GLU A 1 29 ? -9.933  -1.755  -0.204  1.00 10.00 ? 438 GLU A HB2  8  
ATOM 8531  H HB3  . GLU A 1 29 ? -9.443  -1.554  1.472   1.00 10.00 ? 438 GLU A HB3  8  
ATOM 8532  H HG2  . GLU A 1 29 ? -10.745 0.722   1.224   1.00 10.00 ? 438 GLU A HG2  8  
ATOM 8533  H HG3  . GLU A 1 29 ? -11.561 -0.157  -0.068  1.00 10.00 ? 438 GLU A HG3  8  
ATOM 8534  N N    . THR A 1 30 ? -6.687  -0.331  1.664   1.00 10.00 ? 439 THR A N    8  
ATOM 8535  C CA   . THR A 1 30 ? -5.891  0.065   2.821   1.00 10.00 ? 439 THR A CA   8  
ATOM 8536  C C    . THR A 1 30 ? -4.749  1.005   2.435   1.00 10.00 ? 439 THR A C    8  
ATOM 8537  O O    . THR A 1 30 ? -4.507  2.003   3.113   1.00 10.00 ? 439 THR A O    8  
ATOM 8538  C CB   . THR A 1 30 ? -5.343  -1.168  3.543   1.00 10.00 ? 439 THR A CB   8  
ATOM 8539  O OG1  . THR A 1 30 ? -6.399  -2.030  3.929   1.00 10.00 ? 439 THR A OG1  8  
ATOM 8540  C CG2  . THR A 1 30 ? -4.553  -0.824  4.789   1.00 10.00 ? 439 THR A CG2  8  
ATOM 8541  H H    . THR A 1 30 ? -6.411  -1.110  1.125   1.00 10.00 ? 439 THR A H    8  
ATOM 8542  H HA   . THR A 1 30 ? -6.546  0.597   3.491   1.00 10.00 ? 439 THR A HA   8  
ATOM 8543  H HB   . THR A 1 30 ? -4.692  -1.710  2.871   1.00 10.00 ? 439 THR A HB   8  
ATOM 8544  H HG1  . THR A 1 30 ? -6.964  -1.580  4.561   1.00 10.00 ? 439 THR A HG1  8  
ATOM 8545  H HG21 . THR A 1 30 ? -3.738  -1.521  4.905   1.00 10.00 ? 439 THR A HG21 8  
ATOM 8546  H HG22 . THR A 1 30 ? -5.200  -0.881  5.651   1.00 10.00 ? 439 THR A HG22 8  
ATOM 8547  H HG23 . THR A 1 30 ? -4.159  0.178   4.701   1.00 10.00 ? 439 THR A HG23 8  
ATOM 8548  N N    . PHE A 1 31 ? -4.050  0.691   1.351   1.00 10.00 ? 440 PHE A N    8  
ATOM 8549  C CA   . PHE A 1 31 ? -2.942  1.519   0.898   1.00 10.00 ? 440 PHE A CA   8  
ATOM 8550  C C    . PHE A 1 31 ? -3.460  2.723   0.121   1.00 10.00 ? 440 PHE A C    8  
ATOM 8551  O O    . PHE A 1 31 ? -2.860  3.796   0.151   1.00 10.00 ? 440 PHE A O    8  
ATOM 8552  C CB   . PHE A 1 31 ? -1.982  0.700   0.031   1.00 10.00 ? 440 PHE A CB   8  
ATOM 8553  C CG   . PHE A 1 31 ? -2.376  -0.730  -0.122  1.00 10.00 ? 440 PHE A CG   8  
ATOM 8554  C CD1  . PHE A 1 31 ? -2.397  -1.592  0.958   1.00 10.00 ? 440 PHE A CD1  8  
ATOM 8555  C CD2  . PHE A 1 31 ? -2.744  -1.204  -1.357  1.00 10.00 ? 440 PHE A CD2  8  
ATOM 8556  C CE1  . PHE A 1 31 ? -2.780  -2.903  0.792   1.00 10.00 ? 440 PHE A CE1  8  
ATOM 8557  C CE2  . PHE A 1 31 ? -3.124  -2.505  -1.527  1.00 10.00 ? 440 PHE A CE2  8  
ATOM 8558  C CZ   . PHE A 1 31 ? -3.142  -3.349  -0.460  1.00 10.00 ? 440 PHE A CZ   8  
ATOM 8559  H H    . PHE A 1 31 ? -4.278  -0.111  0.843   1.00 10.00 ? 440 PHE A H    8  
ATOM 8560  H HA   . PHE A 1 31 ? -2.413  1.870   1.772   1.00 10.00 ? 440 PHE A HA   8  
ATOM 8561  H HB2  . PHE A 1 31 ? -1.954  1.126   -0.957  1.00 10.00 ? 440 PHE A HB2  8  
ATOM 8562  H HB3  . PHE A 1 31 ? -0.995  0.730   0.461   1.00 10.00 ? 440 PHE A HB3  8  
ATOM 8563  H HD1  . PHE A 1 31 ? -2.115  -1.233  1.936   1.00 10.00 ? 440 PHE A HD1  8  
ATOM 8564  H HD2  . PHE A 1 31 ? -2.731  -0.542  -2.197  1.00 10.00 ? 440 PHE A HD2  8  
ATOM 8565  H HE1  . PHE A 1 31 ? -2.797  -3.577  1.635   1.00 10.00 ? 440 PHE A HE1  8  
ATOM 8566  H HE2  . PHE A 1 31 ? -3.414  -2.866  -2.506  1.00 10.00 ? 440 PHE A HE2  8  
ATOM 8567  H HZ   . PHE A 1 31 ? -3.446  -4.348  -0.606  1.00 10.00 ? 440 PHE A HZ   8  
ATOM 8568  N N    . ARG A 1 32 ? -4.588  2.544   -0.563  1.00 10.00 ? 441 ARG A N    8  
ATOM 8569  C CA   . ARG A 1 32 ? -5.185  3.627   -1.329  1.00 10.00 ? 441 ARG A CA   8  
ATOM 8570  C C    . ARG A 1 32 ? -5.977  4.552   -0.409  1.00 10.00 ? 441 ARG A C    8  
ATOM 8571  O O    . ARG A 1 32 ? -6.193  5.721   -0.726  1.00 10.00 ? 441 ARG A O    8  
ATOM 8572  C CB   . ARG A 1 32 ? -6.096  3.087   -2.434  1.00 10.00 ? 441 ARG A CB   8  
ATOM 8573  C CG   . ARG A 1 32 ? -6.331  4.074   -3.567  1.00 10.00 ? 441 ARG A CG   8  
ATOM 8574  C CD   . ARG A 1 32 ? -7.783  4.072   -4.020  1.00 10.00 ? 441 ARG A CD   8  
ATOM 8575  N NE   . ARG A 1 32 ? -8.480  5.295   -3.626  1.00 10.00 ? 441 ARG A NE   8  
ATOM 8576  C CZ   . ARG A 1 32 ? -9.802  5.444   -3.680  1.00 10.00 ? 441 ARG A CZ   8  
ATOM 8577  N NH1  . ARG A 1 32 ? -10.572 4.452   -4.108  1.00 10.00 ? 441 ARG A NH1  8  
ATOM 8578  N NH2  . ARG A 1 32 ? -10.355 6.589   -3.303  1.00 10.00 ? 441 ARG A NH2  8  
ATOM 8579  H H    . ARG A 1 32 ? -5.033  1.668   -0.542  1.00 10.00 ? 441 ARG A H    8  
ATOM 8580  H HA   . ARG A 1 32 ? -4.383  4.187   -1.784  1.00 10.00 ? 441 ARG A HA   8  
ATOM 8581  H HB2  . ARG A 1 32 ? -5.650  2.195   -2.848  1.00 10.00 ? 441 ARG A HB2  8  
ATOM 8582  H HB3  . ARG A 1 32 ? -7.054  2.834   -2.003  1.00 10.00 ? 441 ARG A HB3  8  
ATOM 8583  H HG2  . ARG A 1 32 ? -6.072  5.065   -3.227  1.00 10.00 ? 441 ARG A HG2  8  
ATOM 8584  H HG3  . ARG A 1 32 ? -5.702  3.802   -4.403  1.00 10.00 ? 441 ARG A HG3  8  
ATOM 8585  H HD2  . ARG A 1 32 ? -7.811  3.984   -5.096  1.00 10.00 ? 441 ARG A HD2  8  
ATOM 8586  H HD3  . ARG A 1 32 ? -8.285  3.225   -3.578  1.00 10.00 ? 441 ARG A HD3  8  
ATOM 8587  H HE   . ARG A 1 32 ? -7.935  6.043   -3.306  1.00 10.00 ? 441 ARG A HE   8  
ATOM 8588  H HH11 . ARG A 1 32 ? -10.162 3.586   -4.394  1.00 10.00 ? 441 ARG A HH11 8  
ATOM 8589  H HH12 . ARG A 1 32 ? -11.565 4.571   -4.146  1.00 10.00 ? 441 ARG A HH12 8  
ATOM 8590  H HH21 . ARG A 1 32 ? -9.779  7.340   -2.979  1.00 10.00 ? 441 ARG A HH21 8  
ATOM 8591  H HH22 . ARG A 1 32 ? -11.347 6.702   -3.342  1.00 10.00 ? 441 ARG A HH22 8  
ATOM 8592  N N    . GLU A 1 33 ? -6.405  4.022   0.741   1.00 10.00 ? 442 GLU A N    8  
ATOM 8593  C CA   . GLU A 1 33 ? -7.165  4.812   1.701   1.00 10.00 ? 442 GLU A CA   8  
ATOM 8594  C C    . GLU A 1 33 ? -6.226  5.547   2.647   1.00 10.00 ? 442 GLU A C    8  
ATOM 8595  O O    . GLU A 1 33 ? -6.524  6.655   3.092   1.00 10.00 ? 442 GLU A O    8  
ATOM 8596  C CB   . GLU A 1 33 ? -8.119  3.924   2.500   1.00 10.00 ? 442 GLU A CB   8  
ATOM 8597  C CG   . GLU A 1 33 ? -8.956  4.687   3.513   1.00 10.00 ? 442 GLU A CG   8  
ATOM 8598  C CD   . GLU A 1 33 ? -10.381 4.910   3.044   1.00 10.00 ? 442 GLU A CD   8  
ATOM 8599  O OE1  . GLU A 1 33 ? -10.577 5.146   1.834   1.00 10.00 ? 442 GLU A OE1  8  
ATOM 8600  O OE2  . GLU A 1 33 ? -11.300 4.848   3.887   1.00 10.00 ? 442 GLU A OE2  8  
ATOM 8601  H H    . GLU A 1 33 ? -6.200  3.083   0.949   1.00 10.00 ? 442 GLU A H    8  
ATOM 8602  H HA   . GLU A 1 33 ? -7.740  5.540   1.149   1.00 10.00 ? 442 GLU A HA   8  
ATOM 8603  H HB2  . GLU A 1 33 ? -8.790  3.428   1.814   1.00 10.00 ? 442 GLU A HB2  8  
ATOM 8604  H HB3  . GLU A 1 33 ? -7.543  3.180   3.030   1.00 10.00 ? 442 GLU A HB3  8  
ATOM 8605  H HG2  . GLU A 1 33 ? -8.981  4.127   4.437   1.00 10.00 ? 442 GLU A HG2  8  
ATOM 8606  H HG3  . GLU A 1 33 ? -8.497  5.650   3.690   1.00 10.00 ? 442 GLU A HG3  8  
ATOM 8607  N N    . LYS A 1 34 ? -5.084  4.934   2.941   1.00 10.00 ? 443 LYS A N    8  
ATOM 8608  C CA   . LYS A 1 34 ? -4.107  5.548   3.819   1.00 10.00 ? 443 LYS A CA   8  
ATOM 8609  C C    . LYS A 1 34 ? -3.373  6.649   3.074   1.00 10.00 ? 443 LYS A C    8  
ATOM 8610  O O    . LYS A 1 34 ? -3.198  7.750   3.588   1.00 10.00 ? 443 LYS A O    8  
ATOM 8611  C CB   . LYS A 1 34 ? -3.116  4.505   4.336   1.00 10.00 ? 443 LYS A CB   8  
ATOM 8612  C CG   . LYS A 1 34 ? -3.671  3.641   5.457   1.00 10.00 ? 443 LYS A CG   8  
ATOM 8613  C CD   . LYS A 1 34 ? -4.165  4.488   6.621   1.00 10.00 ? 443 LYS A CD   8  
ATOM 8614  C CE   . LYS A 1 34 ? -3.767  3.885   7.958   1.00 10.00 ? 443 LYS A CE   8  
ATOM 8615  N NZ   . LYS A 1 34 ? -3.915  4.859   9.073   1.00 10.00 ? 443 LYS A NZ   8  
ATOM 8616  H H    . LYS A 1 34 ? -4.887  4.059   2.548   1.00 10.00 ? 443 LYS A H    8  
ATOM 8617  H HA   . LYS A 1 34 ? -4.636  5.982   4.655   1.00 10.00 ? 443 LYS A HA   8  
ATOM 8618  H HB2  . LYS A 1 34 ? -2.832  3.858   3.520   1.00 10.00 ? 443 LYS A HB2  8  
ATOM 8619  H HB3  . LYS A 1 34 ? -2.237  5.013   4.705   1.00 10.00 ? 443 LYS A HB3  8  
ATOM 8620  H HG2  . LYS A 1 34 ? -4.496  3.059   5.076   1.00 10.00 ? 443 LYS A HG2  8  
ATOM 8621  H HG3  . LYS A 1 34 ? -2.892  2.980   5.809   1.00 10.00 ? 443 LYS A HG3  8  
ATOM 8622  H HD2  . LYS A 1 34 ? -3.738  5.476   6.542   1.00 10.00 ? 443 LYS A HD2  8  
ATOM 8623  H HD3  . LYS A 1 34 ? -5.242  4.554   6.573   1.00 10.00 ? 443 LYS A HD3  8  
ATOM 8624  H HE2  . LYS A 1 34 ? -4.394  3.028   8.154   1.00 10.00 ? 443 LYS A HE2  8  
ATOM 8625  H HE3  . LYS A 1 34 ? -2.735  3.569   7.902   1.00 10.00 ? 443 LYS A HE3  8  
ATOM 8626  H HZ1  . LYS A 1 34 ? -3.797  5.830   8.718   1.00 10.00 ? 443 LYS A HZ1  8  
ATOM 8627  H HZ2  . LYS A 1 34 ? -3.197  4.680   9.804   1.00 10.00 ? 443 LYS A HZ2  8  
ATOM 8628  H HZ3  . LYS A 1 34 ? -4.859  4.771   9.502   1.00 10.00 ? 443 LYS A HZ3  8  
ATOM 8629  N N    . PHE A 1 35 ? -2.972  6.359   1.840   1.00 10.00 ? 444 PHE A N    8  
ATOM 8630  C CA   . PHE A 1 35 ? -2.287  7.342   1.022   1.00 10.00 ? 444 PHE A CA   8  
ATOM 8631  C C    . PHE A 1 35 ? -3.235  8.490   0.748   1.00 10.00 ? 444 PHE A C    8  
ATOM 8632  O O    . PHE A 1 35 ? -2.823  9.645   0.641   1.00 10.00 ? 444 PHE A O    8  
ATOM 8633  C CB   . PHE A 1 35 ? -1.782  6.703   -0.272  1.00 10.00 ? 444 PHE A CB   8  
ATOM 8634  C CG   . PHE A 1 35 ? -0.951  7.624   -1.116  1.00 10.00 ? 444 PHE A CG   8  
ATOM 8635  C CD1  . PHE A 1 35 ? -1.521  8.725   -1.733  1.00 10.00 ? 444 PHE A CD1  8  
ATOM 8636  C CD2  . PHE A 1 35 ? 0.402   7.385   -1.292  1.00 10.00 ? 444 PHE A CD2  8  
ATOM 8637  C CE1  . PHE A 1 35 ? -0.756  9.575   -2.510  1.00 10.00 ? 444 PHE A CE1  8  
ATOM 8638  C CE2  . PHE A 1 35 ? 1.173   8.230   -2.068  1.00 10.00 ? 444 PHE A CE2  8  
ATOM 8639  C CZ   . PHE A 1 35 ? 0.593   9.326   -2.678  1.00 10.00 ? 444 PHE A CZ   8  
ATOM 8640  H H    . PHE A 1 35 ? -3.166  5.480   1.466   1.00 10.00 ? 444 PHE A H    8  
ATOM 8641  H HA   . PHE A 1 35 ? -1.446  7.717   1.586   1.00 10.00 ? 444 PHE A HA   8  
ATOM 8642  H HB2  . PHE A 1 35 ? -1.169  5.847   -0.018  1.00 10.00 ? 444 PHE A HB2  8  
ATOM 8643  H HB3  . PHE A 1 35 ? -2.627  6.375   -0.859  1.00 10.00 ? 444 PHE A HB3  8  
ATOM 8644  H HD1  . PHE A 1 35 ? -2.575  8.920   -1.603  1.00 10.00 ? 444 PHE A HD1  8  
ATOM 8645  H HD2  . PHE A 1 35 ? 0.855   6.526   -0.815  1.00 10.00 ? 444 PHE A HD2  8  
ATOM 8646  H HE1  . PHE A 1 35 ? -1.211  10.431  -2.987  1.00 10.00 ? 444 PHE A HE1  8  
ATOM 8647  H HE2  . PHE A 1 35 ? 2.226   8.035   -2.197  1.00 10.00 ? 444 PHE A HE2  8  
ATOM 8648  H HZ   . PHE A 1 35 ? 1.194   9.988   -3.284  1.00 10.00 ? 444 PHE A HZ   8  
ATOM 8649  N N    . MET A 1 36 ? -4.523  8.168   0.703   1.00 10.00 ? 445 MET A N    8  
ATOM 8650  C CA   . MET A 1 36 ? -5.540  9.180   0.520   1.00 10.00 ? 445 MET A CA   8  
ATOM 8651  C C    . MET A 1 36 ? -5.690  9.934   1.837   1.00 10.00 ? 445 MET A C    8  
ATOM 8652  O O    . MET A 1 36 ? -5.981  11.130  1.866   1.00 10.00 ? 445 MET A O    8  
ATOM 8653  C CB   . MET A 1 36 ? -6.871  8.549   0.105   1.00 10.00 ? 445 MET A CB   8  
ATOM 8654  C CG   . MET A 1 36 ? -7.067  8.479   -1.400  1.00 10.00 ? 445 MET A CG   8  
ATOM 8655  S SD   . MET A 1 36 ? -8.031  9.863   -2.040  1.00 10.00 ? 445 MET A SD   8  
ATOM 8656  C CE   . MET A 1 36 ? -6.745  10.843  -2.809  1.00 10.00 ? 445 MET A CE   8  
ATOM 8657  H H    . MET A 1 36 ? -4.794  7.237   0.843   1.00 10.00 ? 445 MET A H    8  
ATOM 8658  H HA   . MET A 1 36 ? -5.200  9.854   -0.244  1.00 10.00 ? 445 MET A HA   8  
ATOM 8659  H HB2  . MET A 1 36 ? -6.920  7.545   0.501   1.00 10.00 ? 445 MET A HB2  8  
ATOM 8660  H HB3  . MET A 1 36 ? -7.679  9.131   0.526   1.00 10.00 ? 445 MET A HB3  8  
ATOM 8661  H HG2  . MET A 1 36 ? -6.098  8.483   -1.876  1.00 10.00 ? 445 MET A HG2  8  
ATOM 8662  H HG3  . MET A 1 36 ? -7.581  7.559   -1.640  1.00 10.00 ? 445 MET A HG3  8  
ATOM 8663  H HE1  . MET A 1 36 ? -7.193  11.579  -3.461  1.00 10.00 ? 445 MET A HE1  8  
ATOM 8664  H HE2  . MET A 1 36 ? -6.096  10.200  -3.385  1.00 10.00 ? 445 MET A HE2  8  
ATOM 8665  H HE3  . MET A 1 36 ? -6.168  11.344  -2.045  1.00 10.00 ? 445 MET A HE3  8  
ATOM 8666  N N    . GLN A 1 37 ? -5.448  9.203   2.926   1.00 10.00 ? 446 GLN A N    8  
ATOM 8667  C CA   . GLN A 1 37 ? -5.502  9.746   4.275   1.00 10.00 ? 446 GLN A CA   8  
ATOM 8668  C C    . GLN A 1 37 ? -4.306  10.654  4.506   1.00 10.00 ? 446 GLN A C    8  
ATOM 8669  O O    . GLN A 1 37 ? -4.399  11.686  5.173   1.00 10.00 ? 446 GLN A O    8  
ATOM 8670  C CB   . GLN A 1 37 ? -5.459  8.600   5.290   1.00 10.00 ? 446 GLN A CB   8  
ATOM 8671  C CG   . GLN A 1 37 ? -5.897  9.005   6.689   1.00 10.00 ? 446 GLN A CG   8  
ATOM 8672  C CD   . GLN A 1 37 ? -7.022  8.139   7.221   1.00 10.00 ? 446 GLN A CD   8  
ATOM 8673  O OE1  . GLN A 1 37 ? -7.956  8.632   7.853   1.00 10.00 ? 446 GLN A OE1  8  
ATOM 8674  N NE2  . GLN A 1 37 ? -6.938  6.837   6.968   1.00 10.00 ? 446 GLN A NE2  8  
ATOM 8675  H H    . GLN A 1 37 ? -5.200  8.263   2.814   1.00 10.00 ? 446 GLN A H    8  
ATOM 8676  H HA   . GLN A 1 37 ? -6.417  10.306  4.392   1.00 10.00 ? 446 GLN A HA   8  
ATOM 8677  H HB2  . GLN A 1 37 ? -6.107  7.808   4.948   1.00 10.00 ? 446 GLN A HB2  8  
ATOM 8678  H HB3  . GLN A 1 37 ? -4.439  8.221   5.349   1.00 10.00 ? 446 GLN A HB3  8  
ATOM 8679  H HG2  . GLN A 1 37 ? -5.052  8.922   7.356   1.00 10.00 ? 446 GLN A HG2  8  
ATOM 8680  H HG3  . GLN A 1 37 ? -6.234  10.032  6.663   1.00 10.00 ? 446 GLN A HG3  8  
ATOM 8681  H HE21 . GLN A 1 37 ? -6.165  6.514   6.460   1.00 10.00 ? 446 GLN A HE21 8  
ATOM 8682  H HE22 . GLN A 1 37 ? -7.652  6.253   7.299   1.00 10.00 ? 446 GLN A HE22 8  
ATOM 8683  N N    . HIS A 1 38 ? -3.179  10.233  3.953   1.00 10.00 ? 447 HIS A N    8  
ATOM 8684  C CA   . HIS A 1 38 ? -1.927  10.955  4.081   1.00 10.00 ? 447 HIS A CA   8  
ATOM 8685  C C    . HIS A 1 38 ? -1.557  11.618  2.751   1.00 10.00 ? 447 HIS A C    8  
ATOM 8686  O O    . HIS A 1 38 ? -1.038  10.963  1.848   1.00 10.00 ? 447 HIS A O    8  
ATOM 8687  C CB   . HIS A 1 38 ? -0.842  9.975   4.531   1.00 10.00 ? 447 HIS A CB   8  
ATOM 8688  C CG   . HIS A 1 38 ? -1.277  9.124   5.689   1.00 10.00 ? 447 HIS A CG   8  
ATOM 8689  N ND1  . HIS A 1 38 ? -1.405  9.619   6.969   1.00 10.00 ? 447 HIS A ND1  8  
ATOM 8690  C CD2  . HIS A 1 38 ? -1.651  7.816   5.757   1.00 10.00 ? 447 HIS A CD2  8  
ATOM 8691  C CE1  . HIS A 1 38 ? -1.837  8.663   7.769   1.00 10.00 ? 447 HIS A CE1  8  
ATOM 8692  N NE2  . HIS A 1 38 ? -1.997  7.561   7.061   1.00 10.00 ? 447 HIS A NE2  8  
ATOM 8693  H H    . HIS A 1 38 ? -3.187  9.394   3.449   1.00 10.00 ? 447 HIS A H    8  
ATOM 8694  H HA   . HIS A 1 38 ? -2.053  11.714  4.836   1.00 10.00 ? 447 HIS A HA   8  
ATOM 8695  H HB2  . HIS A 1 38 ? -0.591  9.321   3.711   1.00 10.00 ? 447 HIS A HB2  8  
ATOM 8696  H HB3  . HIS A 1 38 ? 0.037   10.528  4.831   1.00 10.00 ? 447 HIS A HB3  8  
ATOM 8697  H HD1  . HIS A 1 38 ? -1.207  10.537  7.249   1.00 10.00 ? 447 HIS A HD1  8  
ATOM 8698  H HD2  . HIS A 1 38 ? -1.677  7.101   4.937   1.00 10.00 ? 447 HIS A HD2  8  
ATOM 8699  H HE1  . HIS A 1 38 ? -2.021  8.763   8.828   1.00 10.00 ? 447 HIS A HE1  8  
ATOM 8700  H HE2  . HIS A 1 38 ? -2.469  6.762   7.373   1.00 10.00 ? 447 HIS A HE2  8  
ATOM 8701  N N    . PRO A 1 39 ? -1.840  12.929  2.608   1.00 10.00 ? 448 PRO A N    8  
ATOM 8702  C CA   . PRO A 1 39 ? -1.556  13.677  1.378   1.00 10.00 ? 448 PRO A CA   8  
ATOM 8703  C C    . PRO A 1 39 ? -0.142  13.448  0.853   1.00 10.00 ? 448 PRO A C    8  
ATOM 8704  O O    . PRO A 1 39 ? 0.819   14.036  1.348   1.00 10.00 ? 448 PRO A O    8  
ATOM 8705  C CB   . PRO A 1 39 ? -1.748  15.149  1.782   1.00 10.00 ? 448 PRO A CB   8  
ATOM 8706  C CG   . PRO A 1 39 ? -1.945  15.147  3.264   1.00 10.00 ? 448 PRO A CG   8  
ATOM 8707  C CD   . PRO A 1 39 ? -2.471  13.788  3.617   1.00 10.00 ? 448 PRO A CD   8  
ATOM 8708  H HA   . PRO A 1 39 ? -2.262  13.426  0.602   1.00 10.00 ? 448 PRO A HA   8  
ATOM 8709  H HB2  . PRO A 1 39 ? -0.871  15.715  1.506   1.00 10.00 ? 448 PRO A HB2  8  
ATOM 8710  H HB3  . PRO A 1 39 ? -2.611  15.550  1.273   1.00 10.00 ? 448 PRO A HB3  8  
ATOM 8711  H HG2  . PRO A 1 39 ? -1.002  15.322  3.759   1.00 10.00 ? 448 PRO A HG2  8  
ATOM 8712  H HG3  . PRO A 1 39 ? -2.660  15.908  3.539   1.00 10.00 ? 448 PRO A HG3  8  
ATOM 8713  H HD2  . PRO A 1 39 ? -2.164  13.512  4.614   1.00 10.00 ? 448 PRO A HD2  8  
ATOM 8714  H HD3  . PRO A 1 39 ? -3.548  13.761  3.529   1.00 10.00 ? 448 PRO A HD3  8  
ATOM 8715  N N    . LYS A 1 40 ? -0.032  12.596  -0.166  1.00 10.00 ? 449 LYS A N    8  
ATOM 8716  C CA   . LYS A 1 40 ? 1.255   12.286  -0.787  1.00 10.00 ? 449 LYS A CA   8  
ATOM 8717  C C    . LYS A 1 40 ? 2.351   12.074  0.253   1.00 10.00 ? 449 LYS A C    8  
ATOM 8718  O O    . LYS A 1 40 ? 2.975   13.031  0.714   1.00 10.00 ? 449 LYS A O    8  
ATOM 8719  C CB   . LYS A 1 40 ? 1.661   13.406  -1.746  1.00 10.00 ? 449 LYS A CB   8  
ATOM 8720  C CG   . LYS A 1 40 ? 2.392   12.913  -2.984  1.00 10.00 ? 449 LYS A CG   8  
ATOM 8721  C CD   . LYS A 1 40 ? 3.791   12.424  -2.648  1.00 10.00 ? 449 LYS A CD   8  
ATOM 8722  C CE   . LYS A 1 40 ? 4.505   11.887  -3.878  1.00 10.00 ? 449 LYS A CE   8  
ATOM 8723  N NZ   . LYS A 1 40 ? 4.206   10.447  -4.109  1.00 10.00 ? 449 LYS A NZ   8  
ATOM 8724  H H    . LYS A 1 40 ? -0.842  12.172  -0.516  1.00 10.00 ? 449 LYS A H    8  
ATOM 8725  H HA   . LYS A 1 40 ? 1.135   11.373  -1.352  1.00 10.00 ? 449 LYS A HA   8  
ATOM 8726  H HB2  . LYS A 1 40 ? 0.773   13.932  -2.064  1.00 10.00 ? 449 LYS A HB2  8  
ATOM 8727  H HB3  . LYS A 1 40 ? 2.309   14.094  -1.224  1.00 10.00 ? 449 LYS A HB3  8  
ATOM 8728  H HG2  . LYS A 1 40 ? 1.832   12.098  -3.420  1.00 10.00 ? 449 LYS A HG2  8  
ATOM 8729  H HG3  . LYS A 1 40 ? 2.463   13.723  -3.695  1.00 10.00 ? 449 LYS A HG3  8  
ATOM 8730  H HD2  . LYS A 1 40 ? 4.361   13.246  -2.244  1.00 10.00 ? 449 LYS A HD2  8  
ATOM 8731  H HD3  . LYS A 1 40 ? 3.720   11.637  -1.911  1.00 10.00 ? 449 LYS A HD3  8  
ATOM 8732  H HE2  . LYS A 1 40 ? 4.185   12.454  -4.740  1.00 10.00 ? 449 LYS A HE2  8  
ATOM 8733  H HE3  . LYS A 1 40 ? 5.569   12.009  -3.743  1.00 10.00 ? 449 LYS A HE3  8  
ATOM 8734  H HZ1  . LYS A 1 40 ? 3.189   10.269  -3.993  1.00 10.00 ? 449 LYS A HZ1  8  
ATOM 8735  H HZ2  . LYS A 1 40 ? 4.729   9.860   -3.428  1.00 10.00 ? 449 LYS A HZ2  8  
ATOM 8736  H HZ3  . LYS A 1 40 ? 4.488   10.174  -5.072  1.00 10.00 ? 449 LYS A HZ3  8  
ATOM 8737  N N    . ASN A 1 41 ? 2.588   10.818  0.612   1.00 10.00 ? 450 ASN A N    8  
ATOM 8738  C CA   . ASN A 1 41 ? 3.615   10.489  1.591   1.00 10.00 ? 450 ASN A CA   8  
ATOM 8739  C C    . ASN A 1 41 ? 4.299   9.175   1.247   1.00 10.00 ? 450 ASN A C    8  
ATOM 8740  O O    . ASN A 1 41 ? 5.523   9.111   1.121   1.00 10.00 ? 450 ASN A O    8  
ATOM 8741  C CB   . ASN A 1 41 ? 3.015   10.413  3.001   1.00 10.00 ? 450 ASN A CB   8  
ATOM 8742  C CG   . ASN A 1 41 ? 1.795   9.513   3.067   1.00 10.00 ? 450 ASN A CG   8  
ATOM 8743  O OD1  . ASN A 1 41 ? 0.955   9.527   2.168   1.00 10.00 ? 450 ASN A OD1  8  
ATOM 8744  N ND2  . ASN A 1 41 ? 1.692   8.716   4.131   1.00 10.00 ? 450 ASN A ND2  8  
ATOM 8745  H H    . ASN A 1 41 ? 2.063   10.096  0.207   1.00 10.00 ? 450 ASN A H    8  
ATOM 8746  H HA   . ASN A 1 41 ? 4.350   11.275  1.569   1.00 10.00 ? 450 ASN A HA   8  
ATOM 8747  H HB2  . ASN A 1 41 ? 3.759   10.027  3.681   1.00 10.00 ? 450 ASN A HB2  8  
ATOM 8748  H HB3  . ASN A 1 41 ? 2.725   11.404  3.317   1.00 10.00 ? 450 ASN A HB3  8  
ATOM 8749  H HD21 . ASN A 1 41 ? 2.400   8.750   4.810   1.00 10.00 ? 450 ASN A HD21 8  
ATOM 8750  H HD22 . ASN A 1 41 ? 0.912   8.127   4.191   1.00 10.00 ? 450 ASN A HD22 8  
ATOM 8751  N N    . PHE A 1 42 ? 3.503   8.121   1.118   1.00 10.00 ? 451 PHE A N    8  
ATOM 8752  C CA   . PHE A 1 42 ? 4.023   6.794   0.812   1.00 10.00 ? 451 PHE A CA   8  
ATOM 8753  C C    . PHE A 1 42 ? 4.974   6.308   1.909   1.00 10.00 ? 451 PHE A C    8  
ATOM 8754  O O    . PHE A 1 42 ? 5.560   5.234   1.797   1.00 10.00 ? 451 PHE A O    8  
ATOM 8755  C CB   . PHE A 1 42 ? 4.739   6.789   -0.543  1.00 10.00 ? 451 PHE A CB   8  
ATOM 8756  C CG   . PHE A 1 42 ? 3.908   6.270   -1.689  1.00 10.00 ? 451 PHE A CG   8  
ATOM 8757  C CD1  . PHE A 1 42 ? 2.887   5.352   -1.480  1.00 10.00 ? 451 PHE A CD1  8  
ATOM 8758  C CD2  . PHE A 1 42 ? 4.157   6.699   -2.984  1.00 10.00 ? 451 PHE A CD2  8  
ATOM 8759  C CE1  . PHE A 1 42 ? 2.133   4.881   -2.535  1.00 10.00 ? 451 PHE A CE1  8  
ATOM 8760  C CE2  . PHE A 1 42 ? 3.406   6.227   -4.043  1.00 10.00 ? 451 PHE A CE2  8  
ATOM 8761  C CZ   . PHE A 1 42 ? 2.391   5.317   -3.818  1.00 10.00 ? 451 PHE A CZ   8  
ATOM 8762  H H    . PHE A 1 42 ? 2.541   8.235   1.243   1.00 10.00 ? 451 PHE A H    8  
ATOM 8763  H HA   . PHE A 1 42 ? 3.184   6.122   0.769   1.00 10.00 ? 451 PHE A HA   8  
ATOM 8764  H HB2  . PHE A 1 42 ? 5.036   7.797   -0.786  1.00 10.00 ? 451 PHE A HB2  8  
ATOM 8765  H HB3  . PHE A 1 42 ? 5.619   6.170   -0.468  1.00 10.00 ? 451 PHE A HB3  8  
ATOM 8766  H HD1  . PHE A 1 42 ? 2.682   5.006   -0.480  1.00 10.00 ? 451 PHE A HD1  8  
ATOM 8767  H HD2  . PHE A 1 42 ? 4.949   7.410   -3.163  1.00 10.00 ? 451 PHE A HD2  8  
ATOM 8768  H HE1  . PHE A 1 42 ? 1.338   4.174   -2.355  1.00 10.00 ? 451 PHE A HE1  8  
ATOM 8769  H HE2  . PHE A 1 42 ? 3.610   6.572   -5.045  1.00 10.00 ? 451 PHE A HE2  8  
ATOM 8770  H HZ   . PHE A 1 42 ? 1.806   4.945   -4.645  1.00 10.00 ? 451 PHE A HZ   8  
ATOM 8771  N N    . GLY A 1 43 ? 5.109   7.096   2.975   1.00 10.00 ? 452 GLY A N    8  
ATOM 8772  C CA   . GLY A 1 43 ? 5.971   6.715   4.075   1.00 10.00 ? 452 GLY A CA   8  
ATOM 8773  C C    . GLY A 1 43 ? 5.204   5.947   5.125   1.00 10.00 ? 452 GLY A C    8  
ATOM 8774  O O    . GLY A 1 43 ? 5.698   4.962   5.673   1.00 10.00 ? 452 GLY A O    8  
ATOM 8775  H H    . GLY A 1 43 ? 4.612   7.931   3.024   1.00 10.00 ? 452 GLY A H    8  
ATOM 8776  H HA2  . GLY A 1 43 ? 6.773   6.098   3.698   1.00 10.00 ? 452 GLY A HA2  8  
ATOM 8777  H HA3  . GLY A 1 43 ? 6.388   7.605   4.522   1.00 10.00 ? 452 GLY A HA3  8  
ATOM 8778  N N    . LEU A 1 44 ? 3.978   6.391   5.391   1.00 10.00 ? 453 LEU A N    8  
ATOM 8779  C CA   . LEU A 1 44 ? 3.127   5.726   6.364   1.00 10.00 ? 453 LEU A CA   8  
ATOM 8780  C C    . LEU A 1 44 ? 2.602   4.426   5.783   1.00 10.00 ? 453 LEU A C    8  
ATOM 8781  O O    . LEU A 1 44 ? 2.689   3.369   6.408   1.00 10.00 ? 453 LEU A O    8  
ATOM 8782  C CB   . LEU A 1 44 ? 1.956   6.619   6.772   1.00 10.00 ? 453 LEU A CB   8  
ATOM 8783  C CG   . LEU A 1 44 ? 0.905   5.921   7.635   1.00 10.00 ? 453 LEU A CG   8  
ATOM 8784  C CD1  . LEU A 1 44 ? 0.314   6.885   8.649   1.00 10.00 ? 453 LEU A CD1  8  
ATOM 8785  C CD2  . LEU A 1 44 ? -0.183  5.307   6.762   1.00 10.00 ? 453 LEU A CD2  8  
ATOM 8786  H H    . LEU A 1 44 ? 3.636   7.171   4.909   1.00 10.00 ? 453 LEU A H    8  
ATOM 8787  H HA   . LEU A 1 44 ? 3.725   5.503   7.232   1.00 10.00 ? 453 LEU A HA   8  
ATOM 8788  H HB2  . LEU A 1 44 ? 2.346   7.463   7.322   1.00 10.00 ? 453 LEU A HB2  8  
ATOM 8789  H HB3  . LEU A 1 44 ? 1.474   6.981   5.877   1.00 10.00 ? 453 LEU A HB3  8  
ATOM 8790  H HG   . LEU A 1 44 ? 1.381   5.125   8.180   1.00 10.00 ? 453 LEU A HG   8  
ATOM 8791  H HD11 . LEU A 1 44 ? -0.737  6.670   8.780   1.00 10.00 ? 453 LEU A HD11 8  
ATOM 8792  H HD12 . LEU A 1 44 ? 0.435   7.898   8.296   1.00 10.00 ? 453 LEU A HD12 8  
ATOM 8793  H HD13 . LEU A 1 44 ? 0.825   6.770   9.594   1.00 10.00 ? 453 LEU A HD13 8  
ATOM 8794  H HD21 . LEU A 1 44 ? -1.137  5.389   7.260   1.00 10.00 ? 453 LEU A HD21 8  
ATOM 8795  H HD22 . LEU A 1 44 ? 0.040   4.264   6.586   1.00 10.00 ? 453 LEU A HD22 8  
ATOM 8796  H HD23 . LEU A 1 44 ? -0.225  5.827   5.817   1.00 10.00 ? 453 LEU A HD23 8  
ATOM 8797  N N    . ILE A 1 45 ? 2.067   4.507   4.571   1.00 10.00 ? 454 ILE A N    8  
ATOM 8798  C CA   . ILE A 1 45 ? 1.545   3.334   3.899   1.00 10.00 ? 454 ILE A CA   8  
ATOM 8799  C C    . ILE A 1 45 ? 2.649   2.310   3.730   1.00 10.00 ? 454 ILE A C    8  
ATOM 8800  O O    . ILE A 1 45 ? 2.555   1.192   4.231   1.00 10.00 ? 454 ILE A O    8  
ATOM 8801  C CB   . ILE A 1 45 ? 0.932   3.709   2.540   1.00 10.00 ? 454 ILE A CB   8  
ATOM 8802  C CG1  . ILE A 1 45 ? -0.401  4.390   2.780   1.00 10.00 ? 454 ILE A CG1  8  
ATOM 8803  C CG2  . ILE A 1 45 ? 0.766   2.490   1.640   1.00 10.00 ? 454 ILE A CG2  8  
ATOM 8804  C CD1  . ILE A 1 45 ? -0.296  5.895   2.724   1.00 10.00 ? 454 ILE A CD1  8  
ATOM 8805  H H    . ILE A 1 45 ? 2.033   5.375   4.117   1.00 10.00 ? 454 ILE A H    8  
ATOM 8806  H HA   . ILE A 1 45 ? 0.772   2.919   4.515   1.00 10.00 ? 454 ILE A HA   8  
ATOM 8807  H HB   . ILE A 1 45 ? 1.590   4.411   2.053   1.00 10.00 ? 454 ILE A HB   8  
ATOM 8808  H HG12 . ILE A 1 45 ? -1.117  4.067   2.033   1.00 10.00 ? 454 ILE A HG12 8  
ATOM 8809  H HG13 . ILE A 1 45 ? -0.755  4.116   3.762   1.00 10.00 ? 454 ILE A HG13 8  
ATOM 8810  H HG21 . ILE A 1 45 ? 1.677   2.328   1.082   1.00 10.00 ? 454 ILE A HG21 8  
ATOM 8811  H HG22 . ILE A 1 45 ? -0.051  2.656   0.955   1.00 10.00 ? 454 ILE A HG22 8  
ATOM 8812  H HG23 . ILE A 1 45 ? 0.558   1.621   2.247   1.00 10.00 ? 454 ILE A HG23 8  
ATOM 8813  H HD11 . ILE A 1 45 ? -1.135  6.336   3.231   1.00 10.00 ? 454 ILE A HD11 8  
ATOM 8814  H HD12 . ILE A 1 45 ? -0.284  6.214   1.694   1.00 10.00 ? 454 ILE A HD12 8  
ATOM 8815  H HD13 . ILE A 1 45 ? 0.618   6.209   3.205   1.00 10.00 ? 454 ILE A HD13 8  
ATOM 8816  N N    . ALA A 1 46 ? 3.718   2.723   3.067   1.00 10.00 ? 455 ALA A N    8  
ATOM 8817  C CA   . ALA A 1 46 ? 4.874   1.861   2.870   1.00 10.00 ? 455 ALA A CA   8  
ATOM 8818  C C    . ALA A 1 46 ? 5.452   1.422   4.214   1.00 10.00 ? 455 ALA A C    8  
ATOM 8819  O O    . ALA A 1 46 ? 6.324   0.555   4.271   1.00 10.00 ? 455 ALA A O    8  
ATOM 8820  C CB   . ALA A 1 46 ? 5.934   2.574   2.046   1.00 10.00 ? 455 ALA A CB   8  
ATOM 8821  H H    . ALA A 1 46 ? 3.741   3.640   2.731   1.00 10.00 ? 455 ALA A H    8  
ATOM 8822  H HA   . ALA A 1 46 ? 4.553   0.988   2.323   1.00 10.00 ? 455 ALA A HA   8  
ATOM 8823  H HB1  . ALA A 1 46 ? 5.468   3.054   1.198   1.00 10.00 ? 455 ALA A HB1  8  
ATOM 8824  H HB2  . ALA A 1 46 ? 6.663   1.857   1.699   1.00 10.00 ? 455 ALA A HB2  8  
ATOM 8825  H HB3  . ALA A 1 46 ? 6.423   3.319   2.656   1.00 10.00 ? 455 ALA A HB3  8  
ATOM 8826  N N    . SER A 1 47 ? 4.959   2.026   5.300   1.00 10.00 ? 456 SER A N    8  
ATOM 8827  C CA   . SER A 1 47 ? 5.432   1.690   6.636   1.00 10.00 ? 456 SER A CA   8  
ATOM 8828  C C    . SER A 1 47 ? 4.528   0.651   7.292   1.00 10.00 ? 456 SER A C    8  
ATOM 8829  O O    . SER A 1 47 ? 5.001   -0.203  8.042   1.00 10.00 ? 456 SER A O    8  
ATOM 8830  C CB   . SER A 1 47 ? 5.509   2.946   7.509   1.00 10.00 ? 456 SER A CB   8  
ATOM 8831  O OG   . SER A 1 47 ? 5.553   2.610   8.885   1.00 10.00 ? 456 SER A OG   8  
ATOM 8832  H H    . SER A 1 47 ? 4.262   2.712   5.198   1.00 10.00 ? 456 SER A H    8  
ATOM 8833  H HA   . SER A 1 47 ? 6.424   1.273   6.538   1.00 10.00 ? 456 SER A HA   8  
ATOM 8834  H HB2  . SER A 1 47 ? 6.403   3.500   7.259   1.00 10.00 ? 456 SER A HB2  8  
ATOM 8835  H HB3  . SER A 1 47 ? 4.643   3.563   7.328   1.00 10.00 ? 456 SER A HB3  8  
ATOM 8836  H HG   . SER A 1 47 ? 4.759   2.933   9.318   1.00 10.00 ? 456 SER A HG   8  
ATOM 8837  N N    . PHE A 1 48 ? 3.228   0.717   7.007   1.00 10.00 ? 457 PHE A N    8  
ATOM 8838  C CA   . PHE A 1 48 ? 2.287   -0.236  7.583   1.00 10.00 ? 457 PHE A CA   8  
ATOM 8839  C C    . PHE A 1 48 ? 2.244   -1.518  6.749   1.00 10.00 ? 457 PHE A C    8  
ATOM 8840  O O    . PHE A 1 48 ? 2.026   -2.607  7.278   1.00 10.00 ? 457 PHE A O    8  
ATOM 8841  C CB   . PHE A 1 48 ? 0.892   0.396   7.737   1.00 10.00 ? 457 PHE A CB   8  
ATOM 8842  C CG   . PHE A 1 48 ? 0.013   0.312   6.519   1.00 10.00 ? 457 PHE A CG   8  
ATOM 8843  C CD1  . PHE A 1 48 ? -0.489  -0.909  6.094   1.00 10.00 ? 457 PHE A CD1  8  
ATOM 8844  C CD2  . PHE A 1 48 ? -0.319  1.454   5.804   1.00 10.00 ? 457 PHE A CD2  8  
ATOM 8845  C CE1  . PHE A 1 48 ? -1.302  -0.990  4.985   1.00 10.00 ? 457 PHE A CE1  8  
ATOM 8846  C CE2  . PHE A 1 48 ? -1.133  1.377   4.692   1.00 10.00 ? 457 PHE A CE2  8  
ATOM 8847  C CZ   . PHE A 1 48 ? -1.625  0.156   4.282   1.00 10.00 ? 457 PHE A CZ   8  
ATOM 8848  H H    . PHE A 1 48 ? 2.898   1.415   6.399   1.00 10.00 ? 457 PHE A H    8  
ATOM 8849  H HA   . PHE A 1 48 ? 2.658   -0.492  8.566   1.00 10.00 ? 457 PHE A HA   8  
ATOM 8850  H HB2  . PHE A 1 48 ? 0.375   -0.098  8.545   1.00 10.00 ? 457 PHE A HB2  8  
ATOM 8851  H HB3  . PHE A 1 48 ? 1.011   1.440   7.986   1.00 10.00 ? 457 PHE A HB3  8  
ATOM 8852  H HD1  . PHE A 1 48 ? -0.240  -1.805  6.643   1.00 10.00 ? 457 PHE A HD1  8  
ATOM 8853  H HD2  . PHE A 1 48 ? 0.066   2.418   6.120   1.00 10.00 ? 457 PHE A HD2  8  
ATOM 8854  H HE1  . PHE A 1 48 ? -1.683  -1.951  4.668   1.00 10.00 ? 457 PHE A HE1  8  
ATOM 8855  H HE2  . PHE A 1 48 ? -1.384  2.272   4.144   1.00 10.00 ? 457 PHE A HE2  8  
ATOM 8856  H HZ   . PHE A 1 48 ? -2.261  0.100   3.416   1.00 10.00 ? 457 PHE A HZ   8  
ATOM 8857  N N    . LEU A 1 49 ? 2.485   -1.383  5.444   1.00 10.00 ? 458 LEU A N    8  
ATOM 8858  C CA   . LEU A 1 49 ? 2.507   -2.532  4.542   1.00 10.00 ? 458 LEU A CA   8  
ATOM 8859  C C    . LEU A 1 49 ? 3.916   -2.718  3.982   1.00 10.00 ? 458 LEU A C    8  
ATOM 8860  O O    . LEU A 1 49 ? 4.117   -2.778  2.772   1.00 10.00 ? 458 LEU A O    8  
ATOM 8861  C CB   . LEU A 1 49 ? 1.490   -2.359  3.407   1.00 10.00 ? 458 LEU A CB   8  
ATOM 8862  C CG   . LEU A 1 49 ? 1.388   -0.948  2.828   1.00 10.00 ? 458 LEU A CG   8  
ATOM 8863  C CD1  . LEU A 1 49 ? 2.731   -0.507  2.274   1.00 10.00 ? 458 LEU A CD1  8  
ATOM 8864  C CD2  . LEU A 1 49 ? 0.316   -0.885  1.746   1.00 10.00 ? 458 LEU A CD2  8  
ATOM 8865  H H    . LEU A 1 49 ? 2.674   -0.491  5.086   1.00 10.00 ? 458 LEU A H    8  
ATOM 8866  H HA   . LEU A 1 49 ? 2.247   -3.408  5.118   1.00 10.00 ? 458 LEU A HA   8  
ATOM 8867  H HB2  . LEU A 1 49 ? 1.759   -3.034  2.607   1.00 10.00 ? 458 LEU A HB2  8  
ATOM 8868  H HB3  . LEU A 1 49 ? 0.517   -2.642  3.779   1.00 10.00 ? 458 LEU A HB3  8  
ATOM 8869  H HG   . LEU A 1 49 ? 1.108   -0.264  3.615   1.00 10.00 ? 458 LEU A HG   8  
ATOM 8870  H HD11 . LEU A 1 49 ? 2.636   0.476   1.837   1.00 10.00 ? 458 LEU A HD11 8  
ATOM 8871  H HD12 . LEU A 1 49 ? 3.057   -1.205  1.520   1.00 10.00 ? 458 LEU A HD12 8  
ATOM 8872  H HD13 . LEU A 1 49 ? 3.457   -0.477  3.074   1.00 10.00 ? 458 LEU A HD13 8  
ATOM 8873  H HD21 . LEU A 1 49 ? -0.022  -1.883  1.516   1.00 10.00 ? 458 LEU A HD21 8  
ATOM 8874  H HD22 . LEU A 1 49 ? 0.727   -0.432  0.856   1.00 10.00 ? 458 LEU A HD22 8  
ATOM 8875  H HD23 . LEU A 1 49 ? -0.520  -0.294  2.096   1.00 10.00 ? 458 LEU A HD23 8  
ATOM 8876  N N    . GLU A 1 50 ? 4.879   -2.785  4.901   1.00 10.00 ? 459 GLU A N    8  
ATOM 8877  C CA   . GLU A 1 50 ? 6.305   -2.941  4.582   1.00 10.00 ? 459 GLU A CA   8  
ATOM 8878  C C    . GLU A 1 50 ? 6.548   -3.690  3.275   1.00 10.00 ? 459 GLU A C    8  
ATOM 8879  O O    . GLU A 1 50 ? 7.427   -3.319  2.497   1.00 10.00 ? 459 GLU A O    8  
ATOM 8880  C CB   . GLU A 1 50 ? 7.017   -3.665  5.725   1.00 10.00 ? 459 GLU A CB   8  
ATOM 8881  C CG   . GLU A 1 50 ? 7.139   -2.831  6.991   1.00 10.00 ? 459 GLU A CG   8  
ATOM 8882  C CD   . GLU A 1 50 ? 7.874   -3.559  8.099   1.00 10.00 ? 459 GLU A CD   8  
ATOM 8883  O OE1  . GLU A 1 50 ? 8.642   -4.494  7.789   1.00 10.00 ? 459 GLU A OE1  8  
ATOM 8884  O OE2  . GLU A 1 50 ? 7.683   -3.194  9.279   1.00 10.00 ? 459 GLU A OE2  8  
ATOM 8885  H H    . GLU A 1 50 ? 4.622   -2.712  5.838   1.00 10.00 ? 459 GLU A H    8  
ATOM 8886  H HA   . GLU A 1 50 ? 6.727   -1.952  4.491   1.00 10.00 ? 459 GLU A HA   8  
ATOM 8887  H HB2  . GLU A 1 50 ? 6.469   -4.564  5.965   1.00 10.00 ? 459 GLU A HB2  8  
ATOM 8888  H HB3  . GLU A 1 50 ? 8.012   -3.936  5.401   1.00 10.00 ? 459 GLU A HB3  8  
ATOM 8889  H HG2  . GLU A 1 50 ? 7.678   -1.925  6.759   1.00 10.00 ? 459 GLU A HG2  8  
ATOM 8890  H HG3  . GLU A 1 50 ? 6.148   -2.582  7.340   1.00 10.00 ? 459 GLU A HG3  8  
ATOM 8891  N N    . ARG A 1 51 ? 5.771   -4.741  3.033   1.00 10.00 ? 460 ARG A N    8  
ATOM 8892  C CA   . ARG A 1 51 ? 5.916   -5.532  1.812   1.00 10.00 ? 460 ARG A CA   8  
ATOM 8893  C C    . ARG A 1 51 ? 6.001   -4.627  0.582   1.00 10.00 ? 460 ARG A C    8  
ATOM 8894  O O    . ARG A 1 51 ? 6.567   -5.004  -0.443  1.00 10.00 ? 460 ARG A O    8  
ATOM 8895  C CB   . ARG A 1 51 ? 4.744   -6.504  1.666   1.00 10.00 ? 460 ARG A CB   8  
ATOM 8896  C CG   . ARG A 1 51 ? 4.818   -7.690  2.614   1.00 10.00 ? 460 ARG A CG   8  
ATOM 8897  C CD   . ARG A 1 51 ? 6.100   -8.482  2.416   1.00 10.00 ? 460 ARG A CD   8  
ATOM 8898  N NE   . ARG A 1 51 ? 7.188   -7.981  3.252   1.00 10.00 ? 460 ARG A NE   8  
ATOM 8899  C CZ   . ARG A 1 51 ? 7.241   -8.141  4.573   1.00 10.00 ? 460 ARG A CZ   8  
ATOM 8900  N NH1  . ARG A 1 51 ? 6.272   -8.785  5.211   1.00 10.00 ? 460 ARG A NH1  8  
ATOM 8901  N NH2  . ARG A 1 51 ? 8.266   -7.653  5.258   1.00 10.00 ? 460 ARG A NH2  8  
ATOM 8902  H H    . ARG A 1 51 ? 5.087   -4.993  3.687   1.00 10.00 ? 460 ARG A H    8  
ATOM 8903  H HA   . ARG A 1 51 ? 6.833   -6.097  1.890   1.00 10.00 ? 460 ARG A HA   8  
ATOM 8904  H HB2  . ARG A 1 51 ? 3.825   -5.972  1.859   1.00 10.00 ? 460 ARG A HB2  8  
ATOM 8905  H HB3  . ARG A 1 51 ? 4.728   -6.880  0.654   1.00 10.00 ? 460 ARG A HB3  8  
ATOM 8906  H HG2  . ARG A 1 51 ? 4.783   -7.329  3.630   1.00 10.00 ? 460 ARG A HG2  8  
ATOM 8907  H HG3  . ARG A 1 51 ? 3.972   -8.338  2.431   1.00 10.00 ? 460 ARG A HG3  8  
ATOM 8908  H HD2  . ARG A 1 51 ? 5.912   -9.516  2.668   1.00 10.00 ? 460 ARG A HD2  8  
ATOM 8909  H HD3  . ARG A 1 51 ? 6.395   -8.413  1.379   1.00 10.00 ? 460 ARG A HD3  8  
ATOM 8910  H HE   . ARG A 1 51 ? 7.917   -7.501  2.807   1.00 10.00 ? 460 ARG A HE   8  
ATOM 8911  H HH11 . ARG A 1 51 ? 5.496   -9.155  4.700   1.00 10.00 ? 460 ARG A HH11 8  
ATOM 8912  H HH12 . ARG A 1 51 ? 6.318   -8.901  6.203   1.00 10.00 ? 460 ARG A HH12 8  
ATOM 8913  H HH21 . ARG A 1 51 ? 8.999   -7.166  4.783   1.00 10.00 ? 460 ARG A HH21 8  
ATOM 8914  H HH22 . ARG A 1 51 ? 8.306   -7.772  6.251   1.00 10.00 ? 460 ARG A HH22 8  
ATOM 8915  N N    . LYS A 1 52 ? 5.433   -3.430  0.700   1.00 10.00 ? 461 LYS A N    8  
ATOM 8916  C CA   . LYS A 1 52 ? 5.440   -2.462  -0.388  1.00 10.00 ? 461 LYS A CA   8  
ATOM 8917  C C    . LYS A 1 52 ? 6.301   -1.255  -0.023  1.00 10.00 ? 461 LYS A C    8  
ATOM 8918  O O    . LYS A 1 52 ? 6.435   -0.911  1.151   1.00 10.00 ? 461 LYS A O    8  
ATOM 8919  C CB   . LYS A 1 52 ? 4.010   -2.002  -0.714  1.00 10.00 ? 461 LYS A CB   8  
ATOM 8920  C CG   . LYS A 1 52 ? 2.912   -2.911  -0.169  1.00 10.00 ? 461 LYS A CG   8  
ATOM 8921  C CD   . LYS A 1 52 ? 2.405   -3.874  -1.232  1.00 10.00 ? 461 LYS A CD   8  
ATOM 8922  C CE   . LYS A 1 52 ? 3.488   -4.841  -1.682  1.00 10.00 ? 461 LYS A CE   8  
ATOM 8923  N NZ   . LYS A 1 52 ? 3.278   -6.206  -1.126  1.00 10.00 ? 461 LYS A NZ   8  
ATOM 8924  H H    . LYS A 1 52 ? 4.998   -3.190  1.543   1.00 10.00 ? 461 LYS A H    8  
ATOM 8925  H HA   . LYS A 1 52 ? 5.863   -2.942  -1.258  1.00 10.00 ? 461 LYS A HA   8  
ATOM 8926  H HB2  . LYS A 1 52 ? 3.861   -1.015  -0.303  1.00 10.00 ? 461 LYS A HB2  8  
ATOM 8927  H HB3  . LYS A 1 52 ? 3.901   -1.952  -1.788  1.00 10.00 ? 461 LYS A HB3  8  
ATOM 8928  H HG2  . LYS A 1 52 ? 3.300   -3.479  0.666   1.00 10.00 ? 461 LYS A HG2  8  
ATOM 8929  H HG3  . LYS A 1 52 ? 2.090   -2.298  0.169   1.00 10.00 ? 461 LYS A HG3  8  
ATOM 8930  H HD2  . LYS A 1 52 ? 1.580   -4.439  -0.827  1.00 10.00 ? 461 LYS A HD2  8  
ATOM 8931  H HD3  . LYS A 1 52 ? 2.068   -3.304  -2.085  1.00 10.00 ? 461 LYS A HD3  8  
ATOM 8932  H HE2  . LYS A 1 52 ? 3.478   -4.897  -2.760  1.00 10.00 ? 461 LYS A HE2  8  
ATOM 8933  H HE3  . LYS A 1 52 ? 4.446   -4.471  -1.351  1.00 10.00 ? 461 LYS A HE3  8  
ATOM 8934  H HZ1  . LYS A 1 52 ? 3.046   -6.148  -0.115  1.00 10.00 ? 461 LYS A HZ1  8  
ATOM 8935  H HZ2  . LYS A 1 52 ? 4.142   -6.776  -1.240  1.00 10.00 ? 461 LYS A HZ2  8  
ATOM 8936  H HZ3  . LYS A 1 52 ? 2.498   -6.679  -1.624  1.00 10.00 ? 461 LYS A HZ3  8  
ATOM 8937  N N    . THR A 1 53 ? 6.885   -0.617  -1.033  1.00 10.00 ? 462 THR A N    8  
ATOM 8938  C CA   . THR A 1 53 ? 7.733   0.551   -0.811  1.00 10.00 ? 462 THR A CA   8  
ATOM 8939  C C    . THR A 1 53 ? 7.124   1.795   -1.453  1.00 10.00 ? 462 THR A C    8  
ATOM 8940  O O    . THR A 1 53 ? 6.146   1.706   -2.190  1.00 10.00 ? 462 THR A O    8  
ATOM 8941  C CB   . THR A 1 53 ? 9.136   0.307   -1.370  1.00 10.00 ? 462 THR A CB   8  
ATOM 8942  O OG1  . THR A 1 53 ? 9.328   -1.065  -1.668  1.00 10.00 ? 462 THR A OG1  8  
ATOM 8943  C CG2  . THR A 1 53 ? 10.239  0.728   -0.423  1.00 10.00 ? 462 THR A CG2  8  
ATOM 8944  H H    . THR A 1 53 ? 6.741   -0.937  -1.948  1.00 10.00 ? 462 THR A H    8  
ATOM 8945  H HA   . THR A 1 53 ? 7.803   0.711   0.255   1.00 10.00 ? 462 THR A HA   8  
ATOM 8946  H HB   . THR A 1 53 ? 9.252   0.872   -2.284  1.00 10.00 ? 462 THR A HB   8  
ATOM 8947  H HG1  . THR A 1 53 ? 9.973   -1.153  -2.373  1.00 10.00 ? 462 THR A HG1  8  
ATOM 8948  H HG21 . THR A 1 53 ? 10.909  1.405   -0.931  1.00 10.00 ? 462 THR A HG21 8  
ATOM 8949  H HG22 . THR A 1 53 ? 10.786  -0.144  -0.098  1.00 10.00 ? 462 THR A HG22 8  
ATOM 8950  H HG23 . THR A 1 53 ? 9.807   1.223   0.435   1.00 10.00 ? 462 THR A HG23 8  
ATOM 8951  N N    . VAL A 1 54 ? 7.712   2.952   -1.169  1.00 10.00 ? 463 VAL A N    8  
ATOM 8952  C CA   . VAL A 1 54 ? 7.223   4.211   -1.723  1.00 10.00 ? 463 VAL A CA   8  
ATOM 8953  C C    . VAL A 1 54 ? 7.320   4.209   -3.245  1.00 10.00 ? 463 VAL A C    8  
ATOM 8954  O O    . VAL A 1 54 ? 6.312   4.329   -3.941  1.00 10.00 ? 463 VAL A O    8  
ATOM 8955  C CB   . VAL A 1 54 ? 8.008   5.415   -1.158  1.00 10.00 ? 463 VAL A CB   8  
ATOM 8956  C CG1  . VAL A 1 54 ? 7.553   6.720   -1.804  1.00 10.00 ? 463 VAL A CG1  8  
ATOM 8957  C CG2  . VAL A 1 54 ? 7.865   5.484   0.358   1.00 10.00 ? 463 VAL A CG2  8  
ATOM 8958  H H    . VAL A 1 54 ? 8.491   2.961   -0.574  1.00 10.00 ? 463 VAL A H    8  
ATOM 8959  H HA   . VAL A 1 54 ? 6.186   4.315   -1.443  1.00 10.00 ? 463 VAL A HA   8  
ATOM 8960  H HB   . VAL A 1 54 ? 9.055   5.275   -1.390  1.00 10.00 ? 463 VAL A HB   8  
ATOM 8961  H HG11 . VAL A 1 54 ? 8.382   7.168   -2.332  1.00 10.00 ? 463 VAL A HG11 8  
ATOM 8962  H HG12 . VAL A 1 54 ? 7.205   7.399   -1.040  1.00 10.00 ? 463 VAL A HG12 8  
ATOM 8963  H HG13 . VAL A 1 54 ? 6.751   6.517   -2.498  1.00 10.00 ? 463 VAL A HG13 8  
ATOM 8964  H HG21 . VAL A 1 54 ? 8.840   5.605   0.806   1.00 10.00 ? 463 VAL A HG21 8  
ATOM 8965  H HG22 . VAL A 1 54 ? 7.416   4.570   0.719   1.00 10.00 ? 463 VAL A HG22 8  
ATOM 8966  H HG23 . VAL A 1 54 ? 7.238   6.323   0.626   1.00 10.00 ? 463 VAL A HG23 8  
ATOM 8967  N N    . ALA A 1 55 ? 8.538   4.068   -3.756  1.00 10.00 ? 464 ALA A N    8  
ATOM 8968  C CA   . ALA A 1 55 ? 8.760   4.046   -5.196  1.00 10.00 ? 464 ALA A CA   8  
ATOM 8969  C C    . ALA A 1 55 ? 8.265   2.740   -5.814  1.00 10.00 ? 464 ALA A C    8  
ATOM 8970  O O    . ALA A 1 55 ? 8.246   2.592   -7.036  1.00 10.00 ? 464 ALA A O    8  
ATOM 8971  C CB   . ALA A 1 55 ? 10.235  4.251   -5.503  1.00 10.00 ? 464 ALA A CB   8  
ATOM 8972  H H    . ALA A 1 55 ? 9.303   3.973   -3.151  1.00 10.00 ? 464 ALA A H    8  
ATOM 8973  H HA   . ALA A 1 55 ? 8.210   4.868   -5.630  1.00 10.00 ? 464 ALA A HA   8  
ATOM 8974  H HB1  . ALA A 1 55 ? 10.337  4.852   -6.395  1.00 10.00 ? 464 ALA A HB1  8  
ATOM 8975  H HB2  . ALA A 1 55 ? 10.707  3.291   -5.661  1.00 10.00 ? 464 ALA A HB2  8  
ATOM 8976  H HB3  . ALA A 1 55 ? 10.710  4.754   -4.674  1.00 10.00 ? 464 ALA A HB3  8  
ATOM 8977  N N    . GLU A 1 56 ? 7.869   1.791   -4.966  1.00 10.00 ? 465 GLU A N    8  
ATOM 8978  C CA   . GLU A 1 56 ? 7.382   0.501   -5.440  1.00 10.00 ? 465 GLU A CA   8  
ATOM 8979  C C    . GLU A 1 56 ? 5.860   0.406   -5.343  1.00 10.00 ? 465 GLU A C    8  
ATOM 8980  O O    . GLU A 1 56 ? 5.247   -0.442  -5.991  1.00 10.00 ? 465 GLU A O    8  
ATOM 8981  C CB   . GLU A 1 56 ? 8.025   -0.632  -4.637  1.00 10.00 ? 465 GLU A CB   8  
ATOM 8982  C CG   . GLU A 1 56 ? 7.593   -2.018  -5.087  1.00 10.00 ? 465 GLU A CG   8  
ATOM 8983  C CD   . GLU A 1 56 ? 8.184   -3.121  -4.230  1.00 10.00 ? 465 GLU A CD   8  
ATOM 8984  O OE1  . GLU A 1 56 ? 9.425   -3.270  -4.227  1.00 10.00 ? 465 GLU A OE1  8  
ATOM 8985  O OE2  . GLU A 1 56 ? 7.407   -3.834  -3.562  1.00 10.00 ? 465 GLU A OE2  8  
ATOM 8986  H H    . GLU A 1 56 ? 7.909   1.959   -4.004  1.00 10.00 ? 465 GLU A H    8  
ATOM 8987  H HA   . GLU A 1 56 ? 7.670   0.401   -6.474  1.00 10.00 ? 465 GLU A HA   8  
ATOM 8988  H HB2  . GLU A 1 56 ? 9.099   -0.563  -4.736  1.00 10.00 ? 465 GLU A HB2  8  
ATOM 8989  H HB3  . GLU A 1 56 ? 7.760   -0.517  -3.597  1.00 10.00 ? 465 GLU A HB3  8  
ATOM 8990  H HG2  . GLU A 1 56 ? 6.517   -2.081  -5.035  1.00 10.00 ? 465 GLU A HG2  8  
ATOM 8991  H HG3  . GLU A 1 56 ? 7.912   -2.167  -6.109  1.00 10.00 ? 465 GLU A HG3  8  
ATOM 8992  N N    . CYS A 1 57 ? 5.249   1.274   -4.537  1.00 10.00 ? 466 CYS A N    8  
ATOM 8993  C CA   . CYS A 1 57 ? 3.799   1.260   -4.380  1.00 10.00 ? 466 CYS A CA   8  
ATOM 8994  C C    . CYS A 1 57 ? 3.125   2.034   -5.505  1.00 10.00 ? 466 CYS A C    8  
ATOM 8995  O O    . CYS A 1 57 ? 1.979   1.754   -5.856  1.00 10.00 ? 466 CYS A O    8  
ATOM 8996  C CB   . CYS A 1 57 ? 3.395   1.842   -3.023  1.00 10.00 ? 466 CYS A CB   8  
ATOM 8997  S SG   . CYS A 1 57 ? 1.663   1.559   -2.590  1.00 10.00 ? 466 CYS A SG   8  
ATOM 8998  H H    . CYS A 1 57 ? 5.779   1.934   -4.040  1.00 10.00 ? 466 CYS A H    8  
ATOM 8999  H HA   . CYS A 1 57 ? 3.474   0.230   -4.431  1.00 10.00 ? 466 CYS A HA   8  
ATOM 9000  H HB2  . CYS A 1 57 ? 4.001   1.394   -2.252  1.00 10.00 ? 466 CYS A HB2  8  
ATOM 9001  H HB3  . CYS A 1 57 ? 3.563   2.909   -3.032  1.00 10.00 ? 466 CYS A HB3  8  
ATOM 9002  H HG   . CYS A 1 57 ? 1.472   2.055   -1.790  1.00 10.00 ? 466 CYS A HG   8  
ATOM 9003  N N    . VAL A 1 58 ? 3.845   2.997   -6.085  1.00 10.00 ? 467 VAL A N    8  
ATOM 9004  C CA   . VAL A 1 58 ? 3.305   3.788   -7.187  1.00 10.00 ? 467 VAL A CA   8  
ATOM 9005  C C    . VAL A 1 58 ? 2.659   2.876   -8.215  1.00 10.00 ? 467 VAL A C    8  
ATOM 9006  O O    . VAL A 1 58 ? 1.695   3.251   -8.876  1.00 10.00 ? 467 VAL A O    8  
ATOM 9007  C CB   . VAL A 1 58 ? 4.403   4.623   -7.884  1.00 10.00 ? 467 VAL A CB   8  
ATOM 9008  C CG1  . VAL A 1 58 ? 3.887   5.223   -9.190  1.00 10.00 ? 467 VAL A CG1  8  
ATOM 9009  C CG2  . VAL A 1 58 ? 4.916   5.712   -6.956  1.00 10.00 ? 467 VAL A CG2  8  
ATOM 9010  H H    . VAL A 1 58 ? 4.758   3.169   -5.773  1.00 10.00 ? 467 VAL A H    8  
ATOM 9011  H HA   . VAL A 1 58 ? 2.558   4.459   -6.792  1.00 10.00 ? 467 VAL A HA   8  
ATOM 9012  H HB   . VAL A 1 58 ? 5.228   3.965   -8.122  1.00 10.00 ? 467 VAL A HB   8  
ATOM 9013  H HG11 . VAL A 1 58 ? 4.673   5.800   -9.656  1.00 10.00 ? 467 VAL A HG11 8  
ATOM 9014  H HG12 . VAL A 1 58 ? 3.045   5.867   -8.982  1.00 10.00 ? 467 VAL A HG12 8  
ATOM 9015  H HG13 . VAL A 1 58 ? 3.576   4.429   -9.860  1.00 10.00 ? 467 VAL A HG13 8  
ATOM 9016  H HG21 . VAL A 1 58 ? 5.913   6.000   -7.256  1.00 10.00 ? 467 VAL A HG21 8  
ATOM 9017  H HG22 . VAL A 1 58 ? 4.939   5.340   -5.942  1.00 10.00 ? 467 VAL A HG22 8  
ATOM 9018  H HG23 . VAL A 1 58 ? 4.262   6.569   -7.011  1.00 10.00 ? 467 VAL A HG23 8  
ATOM 9019  N N    . LEU A 1 59 ? 3.196   1.671   -8.336  1.00 10.00 ? 468 LEU A N    8  
ATOM 9020  C CA   . LEU A 1 59 ? 2.674   0.701   -9.279  1.00 10.00 ? 468 LEU A CA   8  
ATOM 9021  C C    . LEU A 1 59 ? 1.162   0.576   -9.143  1.00 10.00 ? 468 LEU A C    8  
ATOM 9022  O O    . LEU A 1 59 ? 0.437   0.534   -10.136 1.00 10.00 ? 468 LEU A O    8  
ATOM 9023  C CB   . LEU A 1 59 ? 3.338   -0.660  -9.053  1.00 10.00 ? 468 LEU A CB   8  
ATOM 9024  C CG   . LEU A 1 59 ? 3.776   -1.389  -10.323 1.00 10.00 ? 468 LEU A CG   8  
ATOM 9025  C CD1  . LEU A 1 59 ? 5.061   -0.786  -10.869 1.00 10.00 ? 468 LEU A CD1  8  
ATOM 9026  C CD2  . LEU A 1 59 ? 3.957   -2.874  -10.048 1.00 10.00 ? 468 LEU A CD2  8  
ATOM 9027  H H    . LEU A 1 59 ? 3.961   1.428   -7.776  1.00 10.00 ? 468 LEU A H    8  
ATOM 9028  H HA   . LEU A 1 59 ? 2.910   1.048   -10.267 1.00 10.00 ? 468 LEU A HA   8  
ATOM 9029  H HB2  . LEU A 1 59 ? 4.209   -0.510  -8.429  1.00 10.00 ? 468 LEU A HB2  8  
ATOM 9030  H HB3  . LEU A 1 59 ? 2.643   -1.294  -8.523  1.00 10.00 ? 468 LEU A HB3  8  
ATOM 9031  H HG   . LEU A 1 59 ? 3.009   -1.279  -11.077 1.00 10.00 ? 468 LEU A HG   8  
ATOM 9032  H HD11 . LEU A 1 59 ? 5.179   -1.065  -11.905 1.00 10.00 ? 468 LEU A HD11 8  
ATOM 9033  H HD12 . LEU A 1 59 ? 5.902   -1.155  -10.299 1.00 10.00 ? 468 LEU A HD12 8  
ATOM 9034  H HD13 . LEU A 1 59 ? 5.017   0.291   -10.789 1.00 10.00 ? 468 LEU A HD13 8  
ATOM 9035  H HD21 . LEU A 1 59 ? 4.621   -3.299  -10.787 1.00 10.00 ? 468 LEU A HD21 8  
ATOM 9036  H HD22 . LEU A 1 59 ? 2.999   -3.369  -10.101 1.00 10.00 ? 468 LEU A HD22 8  
ATOM 9037  H HD23 . LEU A 1 59 ? 4.379   -3.009  -9.064  1.00 10.00 ? 468 LEU A HD23 8  
ATOM 9038  N N    . TYR A 1 60 ? 0.703   0.518   -7.899  1.00 10.00 ? 469 TYR A N    8  
ATOM 9039  C CA   . TYR A 1 60 ? -0.717  0.387   -7.599  1.00 10.00 ? 469 TYR A CA   8  
ATOM 9040  C C    . TYR A 1 60 ? -1.476  1.695   -7.836  1.00 10.00 ? 469 TYR A C    8  
ATOM 9041  O O    . TYR A 1 60 ? -2.703  1.730   -7.760  1.00 10.00 ? 469 TYR A O    8  
ATOM 9042  C CB   . TYR A 1 60 ? -0.905  -0.116  -6.157  1.00 10.00 ? 469 TYR A CB   8  
ATOM 9043  C CG   . TYR A 1 60 ? -1.330  0.910   -5.130  1.00 10.00 ? 469 TYR A CG   8  
ATOM 9044  C CD1  . TYR A 1 60 ? -0.827  2.201   -5.166  1.00 10.00 ? 469 TYR A CD1  8  
ATOM 9045  C CD2  . TYR A 1 60 ? -2.230  0.581   -4.116  1.00 10.00 ? 469 TYR A CD2  8  
ATOM 9046  C CE1  . TYR A 1 60 ? -1.202  3.143   -4.232  1.00 10.00 ? 469 TYR A CE1  8  
ATOM 9047  C CE2  . TYR A 1 60 ? -2.610  1.523   -3.179  1.00 10.00 ? 469 TYR A CE2  8  
ATOM 9048  C CZ   . TYR A 1 60 ? -2.095  2.801   -3.243  1.00 10.00 ? 469 TYR A CZ   8  
ATOM 9049  O OH   . TYR A 1 60 ? -2.465  3.737   -2.308  1.00 10.00 ? 469 TYR A OH   8  
ATOM 9050  H H    . TYR A 1 60 ? 1.342   0.559   -7.164  1.00 10.00 ? 469 TYR A H    8  
ATOM 9051  H HA   . TYR A 1 60 ? -1.106  -0.362  -8.264  1.00 10.00 ? 469 TYR A HA   8  
ATOM 9052  H HB2  . TYR A 1 60 ? -1.650  -0.894  -6.158  1.00 10.00 ? 469 TYR A HB2  8  
ATOM 9053  H HB3  . TYR A 1 60 ? 0.029   -0.529  -5.824  1.00 10.00 ? 469 TYR A HB3  8  
ATOM 9054  H HD1  . TYR A 1 60 ? -0.130  2.463   -5.943  1.00 10.00 ? 469 TYR A HD1  8  
ATOM 9055  H HD2  . TYR A 1 60 ? -2.628  -0.437  -4.051  1.00 10.00 ? 469 TYR A HD2  8  
ATOM 9056  H HE1  . TYR A 1 60 ? -0.797  4.143   -4.280  1.00 10.00 ? 469 TYR A HE1  8  
ATOM 9057  H HE2  . TYR A 1 60 ? -3.311  1.253   -2.401  1.00 10.00 ? 469 TYR A HE2  8  
ATOM 9058  H HH   . TYR A 1 60 ? -2.644  4.573   -2.745  1.00 10.00 ? 469 TYR A HH   8  
ATOM 9059  N N    . TYR A 1 61 ? -0.742  2.773   -8.110  1.00 10.00 ? 470 TYR A N    8  
ATOM 9060  C CA   . TYR A 1 61 ? -1.356  4.073   -8.338  1.00 10.00 ? 470 TYR A CA   8  
ATOM 9061  C C    . TYR A 1 61 ? -1.745  4.249   -9.803  1.00 10.00 ? 470 TYR A C    8  
ATOM 9062  O O    . TYR A 1 61 ? -2.543  5.125   -10.137 1.00 10.00 ? 470 TYR A O    8  
ATOM 9063  C CB   . TYR A 1 61 ? -0.406  5.193   -7.873  1.00 10.00 ? 470 TYR A CB   8  
ATOM 9064  C CG   . TYR A 1 61 ? 0.141   6.083   -8.975  1.00 10.00 ? 470 TYR A CG   8  
ATOM 9065  C CD1  . TYR A 1 61 ? 0.755   5.542   -10.099 1.00 10.00 ? 470 TYR A CD1  8  
ATOM 9066  C CD2  . TYR A 1 61 ? 0.048   7.466   -8.884  1.00 10.00 ? 470 TYR A CD2  8  
ATOM 9067  C CE1  . TYR A 1 61 ? 1.258   6.350   -11.097 1.00 10.00 ? 470 TYR A CE1  8  
ATOM 9068  C CE2  . TYR A 1 61 ? 0.550   8.282   -9.879  1.00 10.00 ? 470 TYR A CE2  8  
ATOM 9069  C CZ   . TYR A 1 61 ? 1.155   7.720   -10.983 1.00 10.00 ? 470 TYR A CZ   8  
ATOM 9070  O OH   . TYR A 1 61 ? 1.656   8.530   -11.977 1.00 10.00 ? 470 TYR A OH   8  
ATOM 9071  H H    . TYR A 1 61 ? 0.233   2.695   -8.152  1.00 10.00 ? 470 TYR A H    8  
ATOM 9072  H HA   . TYR A 1 61 ? -2.255  4.114   -7.741  1.00 10.00 ? 470 TYR A HA   8  
ATOM 9073  H HB2  . TYR A 1 61 ? -0.933  5.827   -7.177  1.00 10.00 ? 470 TYR A HB2  8  
ATOM 9074  H HB3  . TYR A 1 61 ? 0.435   4.743   -7.364  1.00 10.00 ? 470 TYR A HB3  8  
ATOM 9075  H HD1  . TYR A 1 61 ? 0.832   4.472   -10.191 1.00 10.00 ? 470 TYR A HD1  8  
ATOM 9076  H HD2  . TYR A 1 61 ? -0.426  7.904   -8.018  1.00 10.00 ? 470 TYR A HD2  8  
ATOM 9077  H HE1  . TYR A 1 61 ? 1.730   5.906   -11.958 1.00 10.00 ? 470 TYR A HE1  8  
ATOM 9078  H HE2  . TYR A 1 61 ? 0.468   9.355   -9.790  1.00 10.00 ? 470 TYR A HE2  8  
ATOM 9079  H HH   . TYR A 1 61 ? 0.944   9.046   -12.360 1.00 10.00 ? 470 TYR A HH   8  
ATOM 9080  N N    . TYR A 1 62 ? -1.186  3.414   -10.676 1.00 10.00 ? 471 TYR A N    8  
ATOM 9081  C CA   . TYR A 1 62 ? -1.499  3.503   -12.096 1.00 10.00 ? 471 TYR A CA   8  
ATOM 9082  C C    . TYR A 1 62 ? -2.444  2.383   -12.516 1.00 10.00 ? 471 TYR A C    8  
ATOM 9083  O O    . TYR A 1 62 ? -3.057  2.444   -13.580 1.00 10.00 ? 471 TYR A O    8  
ATOM 9084  C CB   . TYR A 1 62 ? -0.218  3.490   -12.941 1.00 10.00 ? 471 TYR A CB   8  
ATOM 9085  C CG   . TYR A 1 62 ? 0.465   2.143   -13.039 1.00 10.00 ? 471 TYR A CG   8  
ATOM 9086  C CD1  . TYR A 1 62 ? -0.071  1.125   -13.821 1.00 10.00 ? 471 TYR A CD1  8  
ATOM 9087  C CD2  . TYR A 1 62 ? 1.654   1.895   -12.363 1.00 10.00 ? 471 TYR A CD2  8  
ATOM 9088  C CE1  . TYR A 1 62 ? 0.558   -0.101  -13.924 1.00 10.00 ? 471 TYR A CE1  8  
ATOM 9089  C CE2  . TYR A 1 62 ? 2.288   0.670   -12.466 1.00 10.00 ? 471 TYR A CE2  8  
ATOM 9090  C CZ   . TYR A 1 62 ? 1.735   -0.323  -13.247 1.00 10.00 ? 471 TYR A CZ   8  
ATOM 9091  O OH   . TYR A 1 62 ? 2.366   -1.542  -13.350 1.00 10.00 ? 471 TYR A OH   8  
ATOM 9092  H H    . TYR A 1 62 ? -0.557  2.723   -10.359 1.00 10.00 ? 471 TYR A H    8  
ATOM 9093  H HA   . TYR A 1 62 ? -2.005  4.445   -12.254 1.00 10.00 ? 471 TYR A HA   8  
ATOM 9094  H HB2  . TYR A 1 62 ? -0.458  3.807   -13.944 1.00 10.00 ? 471 TYR A HB2  8  
ATOM 9095  H HB3  . TYR A 1 62 ? 0.488   4.188   -12.513 1.00 10.00 ? 471 TYR A HB3  8  
ATOM 9096  H HD1  . TYR A 1 62 ? -0.995  1.299   -14.351 1.00 10.00 ? 471 TYR A HD1  8  
ATOM 9097  H HD2  . TYR A 1 62 ? 2.088   2.677   -11.747 1.00 10.00 ? 471 TYR A HD2  8  
ATOM 9098  H HE1  . TYR A 1 62 ? 0.126   -0.879  -14.536 1.00 10.00 ? 471 TYR A HE1  8  
ATOM 9099  H HE2  . TYR A 1 62 ? 3.211   0.494   -11.934 1.00 10.00 ? 471 TYR A HE2  8  
ATOM 9100  H HH   . TYR A 1 62 ? 3.288   -1.408  -13.579 1.00 10.00 ? 471 TYR A HH   8  
ATOM 9101  N N    . LEU A 1 63 ? -2.575  1.370   -11.663 1.00 10.00 ? 472 LEU A N    8  
ATOM 9102  C CA   . LEU A 1 63 ? -3.468  0.255   -11.944 1.00 10.00 ? 472 LEU A CA   8  
ATOM 9103  C C    . LEU A 1 63 ? -4.855  0.519   -11.359 1.00 10.00 ? 472 LEU A C    8  
ATOM 9104  O O    . LEU A 1 63 ? -5.840  -0.100  -11.763 1.00 10.00 ? 472 LEU A O    8  
ATOM 9105  C CB   . LEU A 1 63 ? -2.888  -1.040  -11.382 1.00 10.00 ? 472 LEU A CB   8  
ATOM 9106  C CG   . LEU A 1 63 ? -1.429  -1.289  -11.758 1.00 10.00 ? 472 LEU A CG   8  
ATOM 9107  C CD1  . LEU A 1 63 ? -0.669  -1.885  -10.588 1.00 10.00 ? 472 LEU A CD1  8  
ATOM 9108  C CD2  . LEU A 1 63 ? -1.341  -2.192  -12.978 1.00 10.00 ? 472 LEU A CD2  8  
ATOM 9109  H H    . LEU A 1 63 ? -2.070  1.379   -10.818 1.00 10.00 ? 472 LEU A H    8  
ATOM 9110  H HA   . LEU A 1 63 ? -3.556  0.164   -13.017 1.00 10.00 ? 472 LEU A HA   8  
ATOM 9111  H HB2  . LEU A 1 63 ? -2.966  -1.007  -10.305 1.00 10.00 ? 472 LEU A HB2  8  
ATOM 9112  H HB3  . LEU A 1 63 ? -3.479  -1.866  -11.747 1.00 10.00 ? 472 LEU A HB3  8  
ATOM 9113  H HG   . LEU A 1 63 ? -0.966  -0.346  -12.007 1.00 10.00 ? 472 LEU A HG   8  
ATOM 9114  H HD11 . LEU A 1 63 ? -1.157  -2.792  -10.263 1.00 10.00 ? 472 LEU A HD11 8  
ATOM 9115  H HD12 . LEU A 1 63 ? -0.652  -1.173  -9.778  1.00 10.00 ? 472 LEU A HD12 8  
ATOM 9116  H HD13 . LEU A 1 63 ? 0.343   -2.108  -10.893 1.00 10.00 ? 472 LEU A HD13 8  
ATOM 9117  H HD21 . LEU A 1 63 ? -2.052  -2.998  -12.882 1.00 10.00 ? 472 LEU A HD21 8  
ATOM 9118  H HD22 . LEU A 1 63 ? -0.343  -2.598  -13.054 1.00 10.00 ? 472 LEU A HD22 8  
ATOM 9119  H HD23 . LEU A 1 63 ? -1.565  -1.618  -13.865 1.00 10.00 ? 472 LEU A HD23 8  
ATOM 9120  N N    . THR A 1 64 ? -4.923  1.456   -10.416 1.00 10.00 ? 473 THR A N    8  
ATOM 9121  C CA   . THR A 1 64 ? -6.184  1.822   -9.785  1.00 10.00 ? 473 THR A CA   8  
ATOM 9122  C C    . THR A 1 64 ? -6.971  2.768   -10.683 1.00 10.00 ? 473 THR A C    8  
ATOM 9123  O O    . THR A 1 64 ? -8.202  2.787   -10.660 1.00 10.00 ? 473 THR A O    8  
ATOM 9124  C CB   . THR A 1 64 ? -5.928  2.486   -8.429  1.00 10.00 ? 473 THR A CB   8  
ATOM 9125  O OG1  . THR A 1 64 ? -4.985  3.538   -8.554  1.00 10.00 ? 473 THR A OG1  8  
ATOM 9126  C CG2  . THR A 1 64 ? -5.413  1.529   -7.375  1.00 10.00 ? 473 THR A CG2  8  
ATOM 9127  H H    . THR A 1 64 ? -4.106  1.921   -10.145 1.00 10.00 ? 473 THR A H    8  
ATOM 9128  H HA   . THR A 1 64 ? -6.761  0.925   -9.634  1.00 10.00 ? 473 THR A HA   8  
ATOM 9129  H HB   . THR A 1 64 ? -6.856  2.905   -8.066  1.00 10.00 ? 473 THR A HB   8  
ATOM 9130  H HG1  . THR A 1 64 ? -4.103  3.171   -8.639  1.00 10.00 ? 473 THR A HG1  8  
ATOM 9131  H HG21 . THR A 1 64 ? -6.230  1.228   -6.735  1.00 10.00 ? 473 THR A HG21 8  
ATOM 9132  H HG22 . THR A 1 64 ? -4.655  2.018   -6.783  1.00 10.00 ? 473 THR A HG22 8  
ATOM 9133  H HG23 . THR A 1 64 ? -4.991  0.658   -7.854  1.00 10.00 ? 473 THR A HG23 8  
ATOM 9134  N N    . LYS A 1 65 ? -6.249  3.558   -11.472 1.00 10.00 ? 474 LYS A N    8  
ATOM 9135  C CA   . LYS A 1 65 ? -6.871  4.516   -12.377 1.00 10.00 ? 474 LYS A CA   8  
ATOM 9136  C C    . LYS A 1 65 ? -7.101  3.909   -13.758 1.00 10.00 ? 474 LYS A C    8  
ATOM 9137  O O    . LYS A 1 65 ? -7.924  4.401   -14.531 1.00 10.00 ? 474 LYS A O    8  
ATOM 9138  C CB   . LYS A 1 65 ? -5.996  5.765   -12.496 1.00 10.00 ? 474 LYS A CB   8  
ATOM 9139  C CG   . LYS A 1 65 ? -4.661  5.512   -13.174 1.00 10.00 ? 474 LYS A CG   8  
ATOM 9140  C CD   . LYS A 1 65 ? -3.709  6.682   -12.985 1.00 10.00 ? 474 LYS A CD   8  
ATOM 9141  C CE   . LYS A 1 65 ? -2.435  6.500   -13.794 1.00 10.00 ? 474 LYS A CE   8  
ATOM 9142  N NZ   . LYS A 1 65 ? -2.479  7.255   -15.077 1.00 10.00 ? 474 LYS A NZ   8  
ATOM 9143  H H    . LYS A 1 65 ? -5.272  3.499   -11.440 1.00 10.00 ? 474 LYS A H    8  
ATOM 9144  H HA   . LYS A 1 65 ? -7.825  4.795   -11.958 1.00 10.00 ? 474 LYS A HA   8  
ATOM 9145  H HB2  . LYS A 1 65 ? -6.529  6.512   -13.065 1.00 10.00 ? 474 LYS A HB2  8  
ATOM 9146  H HB3  . LYS A 1 65 ? -5.804  6.150   -11.505 1.00 10.00 ? 474 LYS A HB3  8  
ATOM 9147  H HG2  . LYS A 1 65 ? -4.215  4.625   -12.750 1.00 10.00 ? 474 LYS A HG2  8  
ATOM 9148  H HG3  . LYS A 1 65 ? -4.828  5.362   -14.231 1.00 10.00 ? 474 LYS A HG3  8  
ATOM 9149  H HD2  . LYS A 1 65 ? -4.200  7.589   -13.304 1.00 10.00 ? 474 LYS A HD2  8  
ATOM 9150  H HD3  . LYS A 1 65 ? -3.452  6.758   -11.938 1.00 10.00 ? 474 LYS A HD3  8  
ATOM 9151  H HE2  . LYS A 1 65 ? -1.598  6.851   -13.209 1.00 10.00 ? 474 LYS A HE2  8  
ATOM 9152  H HE3  . LYS A 1 65 ? -2.307  5.449   -14.009 1.00 10.00 ? 474 LYS A HE3  8  
ATOM 9153  H HZ1  . LYS A 1 65 ? -3.442  7.235   -15.470 1.00 10.00 ? 474 LYS A HZ1  8  
ATOM 9154  H HZ2  . LYS A 1 65 ? -1.826  6.830   -15.765 1.00 10.00 ? 474 LYS A HZ2  8  
ATOM 9155  H HZ3  . LYS A 1 65 ? -2.201  8.245   -14.918 1.00 10.00 ? 474 LYS A HZ3  8  
ATOM 9156  N N    . LYS A 1 66 ? -6.375  2.839   -14.068 1.00 10.00 ? 475 LYS A N    8  
ATOM 9157  C CA   . LYS A 1 66 ? -6.510  2.176   -15.360 1.00 10.00 ? 475 LYS A CA   8  
ATOM 9158  C C    . LYS A 1 66 ? -7.959  1.768   -15.623 1.00 10.00 ? 475 LYS A C    8  
ATOM 9159  O O    . LYS A 1 66 ? -8.370  1.614   -16.773 1.00 10.00 ? 475 LYS A O    8  
ATOM 9160  C CB   . LYS A 1 66 ? -5.601  0.946   -15.423 1.00 10.00 ? 475 LYS A CB   8  
ATOM 9161  C CG   . LYS A 1 66 ? -6.029  -0.179  -14.493 1.00 10.00 ? 475 LYS A CG   8  
ATOM 9162  C CD   . LYS A 1 66 ? -6.661  -1.329  -15.261 1.00 10.00 ? 475 LYS A CD   8  
ATOM 9163  C CE   . LYS A 1 66 ? -7.105  -2.444  -14.327 1.00 10.00 ? 475 LYS A CE   8  
ATOM 9164  N NZ   . LYS A 1 66 ? -7.572  -3.643  -15.076 1.00 10.00 ? 475 LYS A NZ   8  
ATOM 9165  H H    . LYS A 1 66 ? -5.734  2.489   -13.416 1.00 10.00 ? 475 LYS A H    8  
ATOM 9166  H HA   . LYS A 1 66 ? -6.203  2.876   -16.124 1.00 10.00 ? 475 LYS A HA   8  
ATOM 9167  H HB2  . LYS A 1 66 ? -5.598  0.567   -16.435 1.00 10.00 ? 475 LYS A HB2  8  
ATOM 9168  H HB3  . LYS A 1 66 ? -4.597  1.242   -15.157 1.00 10.00 ? 475 LYS A HB3  8  
ATOM 9169  H HG2  . LYS A 1 66 ? -5.161  -0.546  -13.966 1.00 10.00 ? 475 LYS A HG2  8  
ATOM 9170  H HG3  . LYS A 1 66 ? -6.747  0.208   -13.785 1.00 10.00 ? 475 LYS A HG3  8  
ATOM 9171  H HD2  . LYS A 1 66 ? -7.522  -0.960  -15.799 1.00 10.00 ? 475 LYS A HD2  8  
ATOM 9172  H HD3  . LYS A 1 66 ? -5.938  -1.723  -15.960 1.00 10.00 ? 475 LYS A HD3  8  
ATOM 9173  H HE2  . LYS A 1 66 ? -6.272  -2.725  -13.701 1.00 10.00 ? 475 LYS A HE2  8  
ATOM 9174  H HE3  . LYS A 1 66 ? -7.912  -2.079  -13.709 1.00 10.00 ? 475 LYS A HE3  8  
ATOM 9175  H HZ1  . LYS A 1 66 ? -8.256  -3.363  -15.809 1.00 10.00 ? 475 LYS A HZ1  8  
ATOM 9176  H HZ2  . LYS A 1 66 ? -8.031  -4.314  -14.428 1.00 10.00 ? 475 LYS A HZ2  8  
ATOM 9177  H HZ3  . LYS A 1 66 ? -6.765  -4.116  -15.532 1.00 10.00 ? 475 LYS A HZ3  8  
ATOM 9178  N N    . ASN A 1 67 ? -8.728  1.589   -14.552 1.00 10.00 ? 476 ASN A N    8  
ATOM 9179  C CA   . ASN A 1 67 ? -10.127 1.191   -14.675 1.00 10.00 ? 476 ASN A CA   8  
ATOM 9180  C C    . ASN A 1 67 ? -11.061 2.185   -13.985 1.00 10.00 ? 476 ASN A C    8  
ATOM 9181  O O    . ASN A 1 67 ? -12.230 2.303   -14.352 1.00 10.00 ? 476 ASN A O    8  
ATOM 9182  C CB   . ASN A 1 67 ? -10.331 -0.206  -14.087 1.00 10.00 ? 476 ASN A CB   8  
ATOM 9183  C CG   . ASN A 1 67 ? -11.535 -0.912  -14.680 1.00 10.00 ? 476 ASN A CG   8  
ATOM 9184  O OD1  . ASN A 1 67 ? -11.432 -1.586  -15.705 1.00 10.00 ? 476 ASN A OD1  8  
ATOM 9185  N ND2  . ASN A 1 67 ? -12.686 -0.760  -14.035 1.00 10.00 ? 476 ASN A ND2  8  
ATOM 9186  H H    . ASN A 1 67 ? -8.343  1.719   -13.660 1.00 10.00 ? 476 ASN A H    8  
ATOM 9187  H HA   . ASN A 1 67 ? -10.369 1.163   -15.727 1.00 10.00 ? 476 ASN A HA   8  
ATOM 9188  H HB2  . ASN A 1 67 ? -9.455  -0.805  -14.283 1.00 10.00 ? 476 ASN A HB2  8  
ATOM 9189  H HB3  . ASN A 1 67 ? -10.474 -0.123  -13.020 1.00 10.00 ? 476 ASN A HB3  8  
ATOM 9190  H HD21 . ASN A 1 67 ? -12.695 -0.209  -13.225 1.00 10.00 ? 476 ASN A HD21 8  
ATOM 9191  H HD22 . ASN A 1 67 ? -13.481 -1.207  -14.397 1.00 10.00 ? 476 ASN A HD22 8  
ATOM 9192  N N    . GLU A 1 68 ? -10.549 2.893   -12.981 1.00 10.00 ? 477 GLU A N    8  
ATOM 9193  C CA   . GLU A 1 68 ? -11.355 3.864   -12.247 1.00 10.00 ? 477 GLU A CA   8  
ATOM 9194  C C    . GLU A 1 68 ? -11.179 5.269   -12.816 1.00 10.00 ? 477 GLU A C    8  
ATOM 9195  O O    . GLU A 1 68 ? -12.096 6.088   -12.767 1.00 10.00 ? 477 GLU A O    8  
ATOM 9196  C CB   . GLU A 1 68 ? -10.981 3.852   -10.765 1.00 10.00 ? 477 GLU A CB   8  
ATOM 9197  C CG   . GLU A 1 68 ? -11.119 2.485   -10.114 1.00 10.00 ? 477 GLU A CG   8  
ATOM 9198  C CD   . GLU A 1 68 ? -10.435 2.410   -8.764  1.00 10.00 ? 477 GLU A CD   8  
ATOM 9199  O OE1  . GLU A 1 68 ? -10.727 3.266   -7.902  1.00 10.00 ? 477 GLU A OE1  8  
ATOM 9200  O OE2  . GLU A 1 68 ? -9.607  1.496   -8.568  1.00 10.00 ? 477 GLU A OE2  8  
ATOM 9201  H H    . GLU A 1 68 ? -9.613  2.758   -12.725 1.00 10.00 ? 477 GLU A H    8  
ATOM 9202  H HA   . GLU A 1 68 ? -12.391 3.577   -12.350 1.00 10.00 ? 477 GLU A HA   8  
ATOM 9203  H HB2  . GLU A 1 68 ? -9.955  4.173   -10.661 1.00 10.00 ? 477 GLU A HB2  8  
ATOM 9204  H HB3  . GLU A 1 68 ? -11.621 4.543   -10.238 1.00 10.00 ? 477 GLU A HB3  8  
ATOM 9205  H HG2  . GLU A 1 68 ? -12.169 2.269   -9.981  1.00 10.00 ? 477 GLU A HG2  8  
ATOM 9206  H HG3  . GLU A 1 68 ? -10.680 1.744   -10.766 1.00 10.00 ? 477 GLU A HG3  8  
ATOM 9207  N N    . ASN A 1 69 ? -9.995  5.541   -13.352 1.00 10.00 ? 478 ASN A N    8  
ATOM 9208  C CA   . ASN A 1 69 ? -9.697  6.847   -13.927 1.00 10.00 ? 478 ASN A CA   8  
ATOM 9209  C C    . ASN A 1 69 ? -9.813  7.943   -12.871 1.00 10.00 ? 478 ASN A C    8  
ATOM 9210  O O    . ASN A 1 69 ? -10.835 8.622   -12.776 1.00 10.00 ? 478 ASN A O    8  
ATOM 9211  C CB   . ASN A 1 69 ? -10.643 7.144   -15.092 1.00 10.00 ? 478 ASN A CB   8  
ATOM 9212  C CG   . ASN A 1 69 ? -10.197 6.482   -16.381 1.00 10.00 ? 478 ASN A CG   8  
ATOM 9213  O OD1  . ASN A 1 69 ? -10.646 5.387   -16.717 1.00 10.00 ? 478 ASN A OD1  8  
ATOM 9214  N ND2  . ASN A 1 69 ? -9.308  7.146   -17.110 1.00 10.00 ? 478 ASN A ND2  8  
ATOM 9215  H H    . ASN A 1 69 ? -9.305  4.848   -13.359 1.00 10.00 ? 478 ASN A H    8  
ATOM 9216  H HA   . ASN A 1 69 ? -8.683  6.825   -14.295 1.00 10.00 ? 478 ASN A HA   8  
ATOM 9217  H HB2  . ASN A 1 69 ? -11.631 6.782   -14.847 1.00 10.00 ? 478 ASN A HB2  8  
ATOM 9218  H HB3  . ASN A 1 69 ? -10.684 8.212   -15.251 1.00 10.00 ? 478 ASN A HB3  8  
ATOM 9219  H HD21 . ASN A 1 69 ? -8.994  8.014   -16.780 1.00 10.00 ? 478 ASN A HD21 8  
ATOM 9220  H HD22 . ASN A 1 69 ? -9.002  6.742   -17.949 1.00 10.00 ? 478 ASN A HD22 8  
ATOM 9221  N N    . TYR A 1 70 ? -8.758  8.108   -12.079 1.00 10.00 ? 479 TYR A N    8  
ATOM 9222  C CA   . TYR A 1 70 ? -8.741  9.120   -11.030 1.00 10.00 ? 479 TYR A CA   8  
ATOM 9223  C C    . TYR A 1 70 ? -7.311  9.551   -10.713 1.00 10.00 ? 479 TYR A C    8  
ATOM 9224  O O    . TYR A 1 70 ? -6.488  8.742   -10.287 1.00 10.00 ? 479 TYR A O    8  
ATOM 9225  C CB   . TYR A 1 70 ? -9.424  8.585   -9.767  1.00 10.00 ? 479 TYR A CB   8  
ATOM 9226  C CG   . TYR A 1 70 ? -8.599  7.571   -9.004  1.00 10.00 ? 479 TYR A CG   8  
ATOM 9227  C CD1  . TYR A 1 70 ? -8.558  6.239   -9.399  1.00 10.00 ? 479 TYR A CD1  8  
ATOM 9228  C CD2  . TYR A 1 70 ? -7.864  7.948   -7.889  1.00 10.00 ? 479 TYR A CD2  8  
ATOM 9229  C CE1  . TYR A 1 70 ? -7.805  5.312   -8.701  1.00 10.00 ? 479 TYR A CE1  8  
ATOM 9230  C CE2  . TYR A 1 70 ? -7.108  7.027   -7.187  1.00 10.00 ? 479 TYR A CE2  8  
ATOM 9231  C CZ   . TYR A 1 70 ? -7.083  5.712   -7.597  1.00 10.00 ? 479 TYR A CZ   8  
ATOM 9232  O OH   . TYR A 1 70 ? -6.333  4.792   -6.901  1.00 10.00 ? 479 TYR A OH   8  
ATOM 9233  H H    . TYR A 1 70 ? -7.972  7.536   -12.203 1.00 10.00 ? 479 TYR A H    8  
ATOM 9234  H HA   . TYR A 1 70 ? -9.290  9.977   -11.390 1.00 10.00 ? 479 TYR A HA   8  
ATOM 9235  H HB2  . TYR A 1 70 ? -9.629  9.411   -9.102  1.00 10.00 ? 479 TYR A HB2  8  
ATOM 9236  H HB3  . TYR A 1 70 ? -10.357 8.114   -10.045 1.00 10.00 ? 479 TYR A HB3  8  
ATOM 9237  H HD1  . TYR A 1 70 ? -9.122  5.930   -10.266 1.00 10.00 ? 479 TYR A HD1  8  
ATOM 9238  H HD2  . TYR A 1 70 ? -7.886  8.979   -7.569  1.00 10.00 ? 479 TYR A HD2  8  
ATOM 9239  H HE1  . TYR A 1 70 ? -7.785  4.281   -9.024  1.00 10.00 ? 479 TYR A HE1  8  
ATOM 9240  H HE2  . TYR A 1 70 ? -6.543  7.342   -6.323  1.00 10.00 ? 479 TYR A HE2  8  
ATOM 9241  H HH   . TYR A 1 70 ? -6.343  5.010   -5.966  1.00 10.00 ? 479 TYR A HH   8  
ATOM 9242  N N    . LYS A 1 71 ? -7.026  10.831  -10.923 1.00 10.00 ? 480 LYS A N    8  
ATOM 9243  C CA   . LYS A 1 71 ? -5.696  11.369  -10.658 1.00 10.00 ? 480 LYS A CA   8  
ATOM 9244  C C    . LYS A 1 71 ? -5.785  12.769  -10.060 1.00 10.00 ? 480 LYS A C    8  
ATOM 9245  O O    . LYS A 1 71 ? -4.750  13.272  -9.576  1.00 10.00 ? 480 LYS A O    8  
ATOM 9246  C CB   . LYS A 1 71 ? -4.871  11.403  -11.946 1.00 10.00 ? 480 LYS A CB   8  
ATOM 9247  C CG   . LYS A 1 71 ? -4.975  10.130  -12.770 1.00 10.00 ? 480 LYS A CG   8  
ATOM 9248  C CD   . LYS A 1 71 ? -3.949  10.108  -13.892 1.00 10.00 ? 480 LYS A CD   8  
ATOM 9249  C CE   . LYS A 1 71 ? -4.536  9.536   -15.172 1.00 10.00 ? 480 LYS A CE   8  
ATOM 9250  N NZ   . LYS A 1 71 ? -5.325  10.552  -15.922 1.00 10.00 ? 480 LYS A NZ   8  
ATOM 9251  O OXT  . LYS A 1 71 ? -6.891  13.351  -10.081 1.00 10.00 ? 480 LYS A OXT  8  
ATOM 9252  H H    . LYS A 1 71 ? -7.724  11.427  -11.264 1.00 10.00 ? 480 LYS A H    8  
ATOM 9253  H HA   . LYS A 1 71 ? -5.211  10.716  -9.947  1.00 10.00 ? 480 LYS A HA   8  
ATOM 9254  H HB2  . LYS A 1 71 ? -5.208  12.229  -12.554 1.00 10.00 ? 480 LYS A HB2  8  
ATOM 9255  H HB3  . LYS A 1 71 ? -3.833  11.557  -11.690 1.00 10.00 ? 480 LYS A HB3  8  
ATOM 9256  H HG2  . LYS A 1 71 ? -4.807  9.281   -12.126 1.00 10.00 ? 480 LYS A HG2  8  
ATOM 9257  H HG3  . LYS A 1 71 ? -5.964  10.071  -13.198 1.00 10.00 ? 480 LYS A HG3  8  
ATOM 9258  H HD2  . LYS A 1 71 ? -3.613  11.117  -14.081 1.00 10.00 ? 480 LYS A HD2  8  
ATOM 9259  H HD3  . LYS A 1 71 ? -3.110  9.498   -13.587 1.00 10.00 ? 480 LYS A HD3  8  
ATOM 9260  H HE2  . LYS A 1 71 ? -3.728  9.187   -15.799 1.00 10.00 ? 480 LYS A HE2  8  
ATOM 9261  H HE3  . LYS A 1 71 ? -5.179  8.707   -14.920 1.00 10.00 ? 480 LYS A HE3  8  
ATOM 9262  H HZ1  . LYS A 1 71 ? -4.689  11.160  -16.478 1.00 10.00 ? 480 LYS A HZ1  8  
ATOM 9263  H HZ2  . LYS A 1 71 ? -5.864  11.146  -15.261 1.00 10.00 ? 480 LYS A HZ2  8  
ATOM 9264  H HZ3  . LYS A 1 71 ? -5.990  10.081  -16.569 1.00 10.00 ? 480 LYS A HZ3  8  
ATOM 9265  N N    . ASN A 1 4  ? 1.315   1.368   21.793  1.00 10.00 ? 413 ASN A N    9  
ATOM 9266  C CA   . ASN A 1 4  ? 2.610   0.992   21.235  1.00 10.00 ? 413 ASN A CA   9  
ATOM 9267  C C    . ASN A 1 4  ? 2.779   -0.524  21.227  1.00 10.00 ? 413 ASN A C    9  
ATOM 9268  O O    . ASN A 1 4  ? 2.825   -1.159  22.279  1.00 10.00 ? 413 ASN A O    9  
ATOM 9269  C CB   . ASN A 1 4  ? 3.741   1.639   22.037  1.00 10.00 ? 413 ASN A CB   9  
ATOM 9270  C CG   . ASN A 1 4  ? 5.005   1.808   21.218  1.00 10.00 ? 413 ASN A CG   9  
ATOM 9271  O OD1  . ASN A 1 4  ? 5.667   0.832   20.866  1.00 10.00 ? 413 ASN A OD1  9  
ATOM 9272  N ND2  . ASN A 1 4  ? 5.348   3.054   20.911  1.00 10.00 ? 413 ASN A ND2  9  
ATOM 9273  H H    . ASN A 1 4  ? 1.079   1.068   22.696  1.00 10.00 ? 413 ASN A H    9  
ATOM 9274  H HA   . ASN A 1 4  ? 2.650   1.352   20.218  1.00 10.00 ? 413 ASN A HA   9  
ATOM 9275  H HB2  . ASN A 1 4  ? 3.422   2.612   22.378  1.00 10.00 ? 413 ASN A HB2  9  
ATOM 9276  H HB3  . ASN A 1 4  ? 3.968   1.018   22.891  1.00 10.00 ? 413 ASN A HB3  9  
ATOM 9277  H HD21 . ASN A 1 4  ? 4.774   3.783   21.225  1.00 10.00 ? 413 ASN A HD21 9  
ATOM 9278  H HD22 . ASN A 1 4  ? 6.161   3.194   20.382  1.00 10.00 ? 413 ASN A HD22 9  
ATOM 9279  N N    . GLY A 1 5  ? 2.870   -1.097  20.031  1.00 10.00 ? 414 GLY A N    9  
ATOM 9280  C CA   . GLY A 1 5  ? 3.033   -2.533  19.908  1.00 10.00 ? 414 GLY A CA   9  
ATOM 9281  C C    . GLY A 1 5  ? 4.387   -3.008  20.397  1.00 10.00 ? 414 GLY A C    9  
ATOM 9282  O O    . GLY A 1 5  ? 5.237   -2.200  20.771  1.00 10.00 ? 414 GLY A O    9  
ATOM 9283  H H    . GLY A 1 5  ? 2.827   -0.539  19.226  1.00 10.00 ? 414 GLY A H    9  
ATOM 9284  H HA2  . GLY A 1 5  ? 2.262   -3.023  20.485  1.00 10.00 ? 414 GLY A HA2  9  
ATOM 9285  H HA3  . GLY A 1 5  ? 2.920   -2.810  18.870  1.00 10.00 ? 414 GLY A HA3  9  
ATOM 9286  N N    . LEU A 1 6  ? 4.588   -4.321  20.395  1.00 10.00 ? 415 LEU A N    9  
ATOM 9287  C CA   . LEU A 1 6  ? 5.849   -4.903  20.841  1.00 10.00 ? 415 LEU A CA   9  
ATOM 9288  C C    . LEU A 1 6  ? 6.312   -5.996  19.885  1.00 10.00 ? 415 LEU A C    9  
ATOM 9289  O O    . LEU A 1 6  ? 7.475   -6.031  19.482  1.00 10.00 ? 415 LEU A O    9  
ATOM 9290  C CB   . LEU A 1 6  ? 5.699   -5.472  22.253  1.00 10.00 ? 415 LEU A CB   9  
ATOM 9291  C CG   . LEU A 1 6  ? 5.554   -4.428  23.362  1.00 10.00 ? 415 LEU A CG   9  
ATOM 9292  C CD1  . LEU A 1 6  ? 4.816   -5.014  24.554  1.00 10.00 ? 415 LEU A CD1  9  
ATOM 9293  C CD2  . LEU A 1 6  ? 6.920   -3.905  23.782  1.00 10.00 ? 415 LEU A CD2  9  
ATOM 9294  H H    . LEU A 1 6  ? 3.872   -4.915  20.085  1.00 10.00 ? 415 LEU A H    9  
ATOM 9295  H HA   . LEU A 1 6  ? 6.589   -4.117  20.857  1.00 10.00 ? 415 LEU A HA   9  
ATOM 9296  H HB2  . LEU A 1 6  ? 4.827   -6.110  22.271  1.00 10.00 ? 415 LEU A HB2  9  
ATOM 9297  H HB3  . LEU A 1 6  ? 6.569   -6.075  22.470  1.00 10.00 ? 415 LEU A HB3  9  
ATOM 9298  H HG   . LEU A 1 6  ? 4.975   -3.595  22.988  1.00 10.00 ? 415 LEU A HG   9  
ATOM 9299  H HD11 . LEU A 1 6  ? 5.115   -6.043  24.693  1.00 10.00 ? 415 LEU A HD11 9  
ATOM 9300  H HD12 . LEU A 1 6  ? 3.752   -4.971  24.376  1.00 10.00 ? 415 LEU A HD12 9  
ATOM 9301  H HD13 . LEU A 1 6  ? 5.056   -4.446  25.441  1.00 10.00 ? 415 LEU A HD13 9  
ATOM 9302  H HD21 . LEU A 1 6  ? 6.804   -2.950  24.273  1.00 10.00 ? 415 LEU A HD21 9  
ATOM 9303  H HD22 . LEU A 1 6  ? 7.544   -3.788  22.909  1.00 10.00 ? 415 LEU A HD22 9  
ATOM 9304  H HD23 . LEU A 1 6  ? 7.380   -4.606  24.462  1.00 10.00 ? 415 LEU A HD23 9  
ATOM 9305  N N    . MET A 1 7  ? 5.396   -6.890  19.528  1.00 10.00 ? 416 MET A N    9  
ATOM 9306  C CA   . MET A 1 7  ? 5.712   -7.986  18.618  1.00 10.00 ? 416 MET A CA   9  
ATOM 9307  C C    . MET A 1 7  ? 5.133   -7.726  17.231  1.00 10.00 ? 416 MET A C    9  
ATOM 9308  O O    . MET A 1 7  ? 5.871   -7.494  16.273  1.00 10.00 ? 416 MET A O    9  
ATOM 9309  C CB   . MET A 1 7  ? 5.170   -9.306  19.170  1.00 10.00 ? 416 MET A CB   9  
ATOM 9310  C CG   . MET A 1 7  ? 6.071   -9.944  20.214  1.00 10.00 ? 416 MET A CG   9  
ATOM 9311  S SD   . MET A 1 7  ? 7.330   -11.010 19.486  1.00 10.00 ? 416 MET A SD   9  
ATOM 9312  C CE   . MET A 1 7  ? 6.426   -12.548 19.332  1.00 10.00 ? 416 MET A CE   9  
ATOM 9313  H H    . MET A 1 7  ? 4.486   -6.811  19.882  1.00 10.00 ? 416 MET A H    9  
ATOM 9314  H HA   . MET A 1 7  ? 6.787   -8.052  18.540  1.00 10.00 ? 416 MET A HA   9  
ATOM 9315  H HB2  . MET A 1 7  ? 4.205   -9.126  19.621  1.00 10.00 ? 416 MET A HB2  9  
ATOM 9316  H HB3  . MET A 1 7  ? 5.052   -10.002 18.353  1.00 10.00 ? 416 MET A HB3  9  
ATOM 9317  H HG2  . MET A 1 7  ? 6.563   -9.162  20.773  1.00 10.00 ? 416 MET A HG2  9  
ATOM 9318  H HG3  . MET A 1 7  ? 5.463   -10.534 20.883  1.00 10.00 ? 416 MET A HG3  9  
ATOM 9319  H HE1  . MET A 1 7  ? 7.104   -13.338 19.044  1.00 10.00 ? 416 MET A HE1  9  
ATOM 9320  H HE2  . MET A 1 7  ? 5.658   -12.440 18.582  1.00 10.00 ? 416 MET A HE2  9  
ATOM 9321  H HE3  . MET A 1 7  ? 5.970   -12.793 20.281  1.00 10.00 ? 416 MET A HE3  9  
ATOM 9322  N N    . ALA A 1 8  ? 3.808   -7.766  17.131  1.00 10.00 ? 417 ALA A N    9  
ATOM 9323  C CA   . ALA A 1 8  ? 3.130   -7.536  15.861  1.00 10.00 ? 417 ALA A CA   9  
ATOM 9324  C C    . ALA A 1 8  ? 2.542   -6.131  15.801  1.00 10.00 ? 417 ALA A C    9  
ATOM 9325  O O    . ALA A 1 8  ? 1.343   -5.940  16.006  1.00 10.00 ? 417 ALA A O    9  
ATOM 9326  C CB   . ALA A 1 8  ? 2.042   -8.576  15.648  1.00 10.00 ? 417 ALA A CB   9  
ATOM 9327  H H    . ALA A 1 8  ? 3.274   -7.957  17.931  1.00 10.00 ? 417 ALA A H    9  
ATOM 9328  H HA   . ALA A 1 8  ? 3.859   -7.643  15.070  1.00 10.00 ? 417 ALA A HA   9  
ATOM 9329  H HB1  . ALA A 1 8  ? 1.114   -8.219  16.070  1.00 10.00 ? 417 ALA A HB1  9  
ATOM 9330  H HB2  . ALA A 1 8  ? 2.325   -9.499  16.132  1.00 10.00 ? 417 ALA A HB2  9  
ATOM 9331  H HB3  . ALA A 1 8  ? 1.912   -8.750  14.589  1.00 10.00 ? 417 ALA A HB3  9  
ATOM 9332  N N    . ASP A 1 9  ? 3.392   -5.150  15.520  1.00 10.00 ? 418 ASP A N    9  
ATOM 9333  C CA   . ASP A 1 9  ? 2.956   -3.761  15.433  1.00 10.00 ? 418 ASP A CA   9  
ATOM 9334  C C    . ASP A 1 9  ? 2.110   -3.532  14.181  1.00 10.00 ? 418 ASP A C    9  
ATOM 9335  O O    . ASP A 1 9  ? 0.944   -3.151  14.273  1.00 10.00 ? 418 ASP A O    9  
ATOM 9336  C CB   . ASP A 1 9  ? 4.166   -2.822  15.429  1.00 10.00 ? 418 ASP A CB   9  
ATOM 9337  C CG   . ASP A 1 9  ? 4.160   -1.866  16.605  1.00 10.00 ? 418 ASP A CG   9  
ATOM 9338  O OD1  . ASP A 1 9  ? 3.101   -1.260  16.873  1.00 10.00 ? 418 ASP A OD1  9  
ATOM 9339  O OD2  . ASP A 1 9  ? 5.214   -1.722  17.259  1.00 10.00 ? 418 ASP A OD2  9  
ATOM 9340  H H    . ASP A 1 9  ? 4.337   -5.364  15.367  1.00 10.00 ? 418 ASP A H    9  
ATOM 9341  H HA   . ASP A 1 9  ? 2.351   -3.550  16.302  1.00 10.00 ? 418 ASP A HA   9  
ATOM 9342  H HB2  . ASP A 1 9  ? 5.070   -3.412  15.474  1.00 10.00 ? 418 ASP A HB2  9  
ATOM 9343  H HB3  . ASP A 1 9  ? 4.165   -2.244  14.518  1.00 10.00 ? 418 ASP A HB3  9  
ATOM 9344  N N    . PRO A 1 10 ? 2.690   -3.764  12.990  1.00 10.00 ? 419 PRO A N    9  
ATOM 9345  C CA   . PRO A 1 10 ? 1.982   -3.580  11.720  1.00 10.00 ? 419 PRO A CA   9  
ATOM 9346  C C    . PRO A 1 10 ? 0.933   -4.661  11.480  1.00 10.00 ? 419 PRO A C    9  
ATOM 9347  O O    . PRO A 1 10 ? 0.982   -5.732  12.085  1.00 10.00 ? 419 PRO A O    9  
ATOM 9348  C CB   . PRO A 1 10 ? 3.096   -3.676  10.677  1.00 10.00 ? 419 PRO A CB   9  
ATOM 9349  C CG   . PRO A 1 10 ? 4.139   -4.525  11.316  1.00 10.00 ? 419 PRO A CG   9  
ATOM 9350  C CD   . PRO A 1 10 ? 4.079   -4.221  12.788  1.00 10.00 ? 419 PRO A CD   9  
ATOM 9351  H HA   . PRO A 1 10 ? 1.514   -2.608  11.664  1.00 10.00 ? 419 PRO A HA   9  
ATOM 9352  H HB2  . PRO A 1 10 ? 2.712   -4.130  9.775   1.00 10.00 ? 419 PRO A HB2  9  
ATOM 9353  H HB3  . PRO A 1 10 ? 3.473   -2.687  10.457  1.00 10.00 ? 419 PRO A HB3  9  
ATOM 9354  H HG2  . PRO A 1 10 ? 3.921   -5.568  11.139  1.00 10.00 ? 419 PRO A HG2  9  
ATOM 9355  H HG3  . PRO A 1 10 ? 5.111   -4.272  10.921  1.00 10.00 ? 419 PRO A HG3  9  
ATOM 9356  H HD2  . PRO A 1 10 ? 4.278   -5.112  13.364  1.00 10.00 ? 419 PRO A HD2  9  
ATOM 9357  H HD3  . PRO A 1 10 ? 4.782   -3.441  13.041  1.00 10.00 ? 419 PRO A HD3  9  
ATOM 9358  N N    . MET A 1 11 ? -0.014  -4.373  10.593  1.00 10.00 ? 420 MET A N    9  
ATOM 9359  C CA   . MET A 1 11 ? -1.074  -5.318  10.272  1.00 10.00 ? 420 MET A CA   9  
ATOM 9360  C C    . MET A 1 11 ? -1.189  -5.503  8.768   1.00 10.00 ? 420 MET A C    9  
ATOM 9361  O O    . MET A 1 11 ? -0.615  -6.433  8.213   1.00 10.00 ? 420 MET A O    9  
ATOM 9362  C CB   . MET A 1 11 ? -2.405  -4.834  10.852  1.00 10.00 ? 420 MET A CB   9  
ATOM 9363  C CG   . MET A 1 11 ? -3.577  -5.753  10.543  1.00 10.00 ? 420 MET A CG   9  
ATOM 9364  S SD   . MET A 1 11 ? -4.862  -5.686  11.806  1.00 10.00 ? 420 MET A SD   9  
ATOM 9365  C CE   . MET A 1 11 ? -5.534  -7.343  11.692  1.00 10.00 ? 420 MET A CE   9  
ATOM 9366  H H    . MET A 1 11 ? -0.001  -3.503  10.142  1.00 10.00 ? 420 MET A H    9  
ATOM 9367  H HA   . MET A 1 11 ? -0.821  -6.273  10.711  1.00 10.00 ? 420 MET A HA   9  
ATOM 9368  H HB2  . MET A 1 11 ? -2.309  -4.755  11.924  1.00 10.00 ? 420 MET A HB2  9  
ATOM 9369  H HB3  . MET A 1 11 ? -2.625  -3.856  10.445  1.00 10.00 ? 420 MET A HB3  9  
ATOM 9370  H HG2  . MET A 1 11 ? -4.006  -5.461  9.596   1.00 10.00 ? 420 MET A HG2  9  
ATOM 9371  H HG3  . MET A 1 11 ? -3.212  -6.767  10.474  1.00 10.00 ? 420 MET A HG3  9  
ATOM 9372  H HE1  . MET A 1 11 ? -4.959  -7.916  10.981  1.00 10.00 ? 420 MET A HE1  9  
ATOM 9373  H HE2  . MET A 1 11 ? -6.563  -7.292  11.369  1.00 10.00 ? 420 MET A HE2  9  
ATOM 9374  H HE3  . MET A 1 11 ? -5.484  -7.817  12.661  1.00 10.00 ? 420 MET A HE3  9  
ATOM 9375  N N    . LYS A 1 12 ? -1.921  -4.613  8.107   1.00 10.00 ? 421 LYS A N    9  
ATOM 9376  C CA   . LYS A 1 12 ? -2.088  -4.704  6.662   1.00 10.00 ? 421 LYS A CA   9  
ATOM 9377  C C    . LYS A 1 12 ? -0.741  -4.878  5.979   1.00 10.00 ? 421 LYS A C    9  
ATOM 9378  O O    . LYS A 1 12 ? 0.005   -3.917  5.794   1.00 10.00 ? 421 LYS A O    9  
ATOM 9379  C CB   . LYS A 1 12 ? -2.796  -3.474  6.108   1.00 10.00 ? 421 LYS A CB   9  
ATOM 9380  C CG   . LYS A 1 12 ? -2.980  -3.540  4.602   1.00 10.00 ? 421 LYS A CG   9  
ATOM 9381  C CD   . LYS A 1 12 ? -4.072  -4.510  4.197   1.00 10.00 ? 421 LYS A CD   9  
ATOM 9382  C CE   . LYS A 1 12 ? -5.376  -4.247  4.935   1.00 10.00 ? 421 LYS A CE   9  
ATOM 9383  N NZ   . LYS A 1 12 ? -5.609  -5.238  6.022   1.00 10.00 ? 421 LYS A NZ   9  
ATOM 9384  H H    . LYS A 1 12 ? -2.350  -3.884  8.598   1.00 10.00 ? 421 LYS A H    9  
ATOM 9385  H HA   . LYS A 1 12 ? -2.691  -5.572  6.454   1.00 10.00 ? 421 LYS A HA   9  
ATOM 9386  H HB2  . LYS A 1 12 ? -3.767  -3.387  6.572   1.00 10.00 ? 421 LYS A HB2  9  
ATOM 9387  H HB3  . LYS A 1 12 ? -2.212  -2.597  6.341   1.00 10.00 ? 421 LYS A HB3  9  
ATOM 9388  H HG2  . LYS A 1 12 ? -3.232  -2.562  4.234   1.00 10.00 ? 421 LYS A HG2  9  
ATOM 9389  H HG3  . LYS A 1 12 ? -2.048  -3.867  4.159   1.00 10.00 ? 421 LYS A HG3  9  
ATOM 9390  H HD2  . LYS A 1 12 ? -4.244  -4.406  3.139   1.00 10.00 ? 421 LYS A HD2  9  
ATOM 9391  H HD3  . LYS A 1 12 ? -3.741  -5.514  4.413   1.00 10.00 ? 421 LYS A HD3  9  
ATOM 9392  H HE2  . LYS A 1 12 ? -5.339  -3.258  5.365   1.00 10.00 ? 421 LYS A HE2  9  
ATOM 9393  H HE3  . LYS A 1 12 ? -6.192  -4.302  4.229   1.00 10.00 ? 421 LYS A HE3  9  
ATOM 9394  H HZ1  . LYS A 1 12 ? -5.337  -6.189  5.703   1.00 10.00 ? 421 LYS A HZ1  9  
ATOM 9395  H HZ2  . LYS A 1 12 ? -6.615  -5.248  6.288   1.00 10.00 ? 421 LYS A HZ2  9  
ATOM 9396  H HZ3  . LYS A 1 12 ? -5.044  -4.990  6.860   1.00 10.00 ? 421 LYS A HZ3  9  
ATOM 9397  N N    . VAL A 1 13 ? -0.441  -6.117  5.618   1.00 10.00 ? 422 VAL A N    9  
ATOM 9398  C CA   . VAL A 1 13 ? 0.814   -6.444  4.968   1.00 10.00 ? 422 VAL A CA   9  
ATOM 9399  C C    . VAL A 1 13 ? 0.879   -7.942  4.676   1.00 10.00 ? 422 VAL A C    9  
ATOM 9400  O O    . VAL A 1 13 ? 1.183   -8.369  3.565   1.00 10.00 ? 422 VAL A O    9  
ATOM 9401  C CB   . VAL A 1 13 ? 2.003   -5.998  5.842   1.00 10.00 ? 422 VAL A CB   9  
ATOM 9402  C CG1  . VAL A 1 13 ? 2.289   -6.992  6.961   1.00 10.00 ? 422 VAL A CG1  9  
ATOM 9403  C CG2  . VAL A 1 13 ? 3.239   -5.768  4.990   1.00 10.00 ? 422 VAL A CG2  9  
ATOM 9404  H H    . VAL A 1 13 ? -1.082  -6.830  5.799   1.00 10.00 ? 422 VAL A H    9  
ATOM 9405  H HA   . VAL A 1 13 ? 0.847   -5.904  4.039   1.00 10.00 ? 422 VAL A HA   9  
ATOM 9406  H HB   . VAL A 1 13 ? 1.730   -5.059  6.301   1.00 10.00 ? 422 VAL A HB   9  
ATOM 9407  H HG11 . VAL A 1 13 ? 3.101   -6.623  7.570   1.00 10.00 ? 422 VAL A HG11 9  
ATOM 9408  H HG12 . VAL A 1 13 ? 2.562   -7.946  6.535   1.00 10.00 ? 422 VAL A HG12 9  
ATOM 9409  H HG13 . VAL A 1 13 ? 1.406   -7.109  7.572   1.00 10.00 ? 422 VAL A HG13 9  
ATOM 9410  H HG21 . VAL A 1 13 ? 3.816   -6.680  4.941   1.00 10.00 ? 422 VAL A HG21 9  
ATOM 9411  H HG22 . VAL A 1 13 ? 3.837   -4.985  5.429   1.00 10.00 ? 422 VAL A HG22 9  
ATOM 9412  H HG23 . VAL A 1 13 ? 2.939   -5.478  3.994   1.00 10.00 ? 422 VAL A HG23 9  
ATOM 9413  N N    . TYR A 1 14 ? 0.545   -8.720  5.693   1.00 10.00 ? 423 TYR A N    9  
ATOM 9414  C CA   . TYR A 1 14 ? 0.496   -10.174 5.613   1.00 10.00 ? 423 TYR A CA   9  
ATOM 9415  C C    . TYR A 1 14 ? -0.138  -10.620 4.298   1.00 10.00 ? 423 TYR A C    9  
ATOM 9416  O O    . TYR A 1 14 ? 0.229   -11.650 3.733   1.00 10.00 ? 423 TYR A O    9  
ATOM 9417  C CB   . TYR A 1 14 ? -0.334  -10.695 6.795   1.00 10.00 ? 423 TYR A CB   9  
ATOM 9418  C CG   . TYR A 1 14 ? -1.683  -10.014 6.906   1.00 10.00 ? 423 TYR A CG   9  
ATOM 9419  C CD1  . TYR A 1 14 ? -1.758  -8.649  7.125   1.00 10.00 ? 423 TYR A CD1  9  
ATOM 9420  C CD2  . TYR A 1 14 ? -2.873  -10.720 6.781   1.00 10.00 ? 423 TYR A CD2  9  
ATOM 9421  C CE1  . TYR A 1 14 ? -2.954  -7.996  7.217   1.00 10.00 ? 423 TYR A CE1  9  
ATOM 9422  C CE2  . TYR A 1 14 ? -4.094  -10.072 6.872   1.00 10.00 ? 423 TYR A CE2  9  
ATOM 9423  C CZ   . TYR A 1 14 ? -4.129  -8.707  7.088   1.00 10.00 ? 423 TYR A CZ   9  
ATOM 9424  O OH   . TYR A 1 14 ? -5.338  -8.057  7.180   1.00 10.00 ? 423 TYR A OH   9  
ATOM 9425  H H    . TYR A 1 14 ? 0.301   -8.296  6.534   1.00 10.00 ? 423 TYR A H    9  
ATOM 9426  H HA   . TYR A 1 14 ? 1.501   -10.561 5.674   1.00 10.00 ? 423 TYR A HA   9  
ATOM 9427  H HB2  . TYR A 1 14 ? -0.498  -11.755 6.681   1.00 10.00 ? 423 TYR A HB2  9  
ATOM 9428  H HB3  . TYR A 1 14 ? 0.205   -10.508 7.716   1.00 10.00 ? 423 TYR A HB3  9  
ATOM 9429  H HD1  . TYR A 1 14 ? -0.850  -8.088  7.227   1.00 10.00 ? 423 TYR A HD1  9  
ATOM 9430  H HD2  . TYR A 1 14 ? -2.838  -11.784 6.609   1.00 10.00 ? 423 TYR A HD2  9  
ATOM 9431  H HE1  . TYR A 1 14 ? -2.958  -6.928  7.379   1.00 10.00 ? 423 TYR A HE1  9  
ATOM 9432  H HE2  . TYR A 1 14 ? -5.011  -10.632 6.772   1.00 10.00 ? 423 TYR A HE2  9  
ATOM 9433  H HH   . TYR A 1 14 ? -5.468  -7.745  8.080   1.00 10.00 ? 423 TYR A HH   9  
ATOM 9434  N N    . LYS A 1 15 ? -1.090  -9.824  3.815   1.00 10.00 ? 424 LYS A N    9  
ATOM 9435  C CA   . LYS A 1 15 ? -1.776  -10.121 2.564   1.00 10.00 ? 424 LYS A CA   9  
ATOM 9436  C C    . LYS A 1 15 ? -1.109  -9.387  1.405   1.00 10.00 ? 424 LYS A C    9  
ATOM 9437  O O    . LYS A 1 15 ? -1.153  -9.839  0.261   1.00 10.00 ? 424 LYS A O    9  
ATOM 9438  C CB   . LYS A 1 15 ? -3.250  -9.723  2.657   1.00 10.00 ? 424 LYS A CB   9  
ATOM 9439  C CG   . LYS A 1 15 ? -4.162  -10.865 3.078   1.00 10.00 ? 424 LYS A CG   9  
ATOM 9440  C CD   . LYS A 1 15 ? -4.888  -11.468 1.886   1.00 10.00 ? 424 LYS A CD   9  
ATOM 9441  C CE   . LYS A 1 15 ? -3.911  -12.040 0.870   1.00 10.00 ? 424 LYS A CE   9  
ATOM 9442  N NZ   . LYS A 1 15 ? -4.502  -13.174 0.109   1.00 10.00 ? 424 LYS A NZ   9  
ATOM 9443  H H    . LYS A 1 15 ? -1.332  -9.012  4.311   1.00 10.00 ? 424 LYS A H    9  
ATOM 9444  H HA   . LYS A 1 15 ? -1.707  -11.184 2.390   1.00 10.00 ? 424 LYS A HA   9  
ATOM 9445  H HB2  . LYS A 1 15 ? -3.351  -8.926  3.379   1.00 10.00 ? 424 LYS A HB2  9  
ATOM 9446  H HB3  . LYS A 1 15 ? -3.578  -9.366  1.692   1.00 10.00 ? 424 LYS A HB3  9  
ATOM 9447  H HG2  . LYS A 1 15 ? -3.567  -11.633 3.550   1.00 10.00 ? 424 LYS A HG2  9  
ATOM 9448  H HG3  . LYS A 1 15 ? -4.892  -10.489 3.781   1.00 10.00 ? 424 LYS A HG3  9  
ATOM 9449  H HD2  . LYS A 1 15 ? -5.534  -12.260 2.233   1.00 10.00 ? 424 LYS A HD2  9  
ATOM 9450  H HD3  . LYS A 1 15 ? -5.479  -10.700 1.411   1.00 10.00 ? 424 LYS A HD3  9  
ATOM 9451  H HE2  . LYS A 1 15 ? -3.634  -11.259 0.178   1.00 10.00 ? 424 LYS A HE2  9  
ATOM 9452  H HE3  . LYS A 1 15 ? -3.031  -12.386 1.392   1.00 10.00 ? 424 LYS A HE3  9  
ATOM 9453  H HZ1  . LYS A 1 15 ? -4.603  -14.005 0.727   1.00 10.00 ? 424 LYS A HZ1  9  
ATOM 9454  H HZ2  . LYS A 1 15 ? -3.888  -13.425 -0.692  1.00 10.00 ? 424 LYS A HZ2  9  
ATOM 9455  H HZ3  . LYS A 1 15 ? -5.440  -12.910 -0.256  1.00 10.00 ? 424 LYS A HZ3  9  
ATOM 9456  N N    . ASP A 1 16 ? -0.488  -8.251  1.714   1.00 10.00 ? 425 ASP A N    9  
ATOM 9457  C CA   . ASP A 1 16 ? 0.196   -7.448  0.708   1.00 10.00 ? 425 ASP A CA   9  
ATOM 9458  C C    . ASP A 1 16 ? 1.192   -8.289  -0.085  1.00 10.00 ? 425 ASP A C    9  
ATOM 9459  O O    . ASP A 1 16 ? 1.489   -7.989  -1.239  1.00 10.00 ? 425 ASP A O    9  
ATOM 9460  C CB   . ASP A 1 16 ? 0.918   -6.271  1.364   1.00 10.00 ? 425 ASP A CB   9  
ATOM 9461  C CG   . ASP A 1 16 ? 0.004   -5.080  1.578   1.00 10.00 ? 425 ASP A CG   9  
ATOM 9462  O OD1  . ASP A 1 16 ? -0.652  -5.018  2.639   1.00 10.00 ? 425 ASP A OD1  9  
ATOM 9463  O OD2  . ASP A 1 16 ? -0.056  -4.210  0.685   1.00 10.00 ? 425 ASP A OD2  9  
ATOM 9464  H H    . ASP A 1 16 ? -0.488  -7.948  2.645   1.00 10.00 ? 425 ASP A H    9  
ATOM 9465  H HA   . ASP A 1 16 ? -0.549  -7.065  0.031   1.00 10.00 ? 425 ASP A HA   9  
ATOM 9466  H HB2  . ASP A 1 16 ? 1.305   -6.582  2.321   1.00 10.00 ? 425 ASP A HB2  9  
ATOM 9467  H HB3  . ASP A 1 16 ? 1.738   -5.963  0.732   1.00 10.00 ? 425 ASP A HB3  9  
ATOM 9468  N N    . ARG A 1 17 ? 1.705   -9.345  0.538   1.00 10.00 ? 426 ARG A N    9  
ATOM 9469  C CA   . ARG A 1 17 ? 2.664   -10.223 -0.124  1.00 10.00 ? 426 ARG A CA   9  
ATOM 9470  C C    . ARG A 1 17 ? 2.132   -10.669 -1.483  1.00 10.00 ? 426 ARG A C    9  
ATOM 9471  O O    . ARG A 1 17 ? 2.894   -10.857 -2.430  1.00 10.00 ? 426 ARG A O    9  
ATOM 9472  C CB   . ARG A 1 17 ? 2.979   -11.434 0.761   1.00 10.00 ? 426 ARG A CB   9  
ATOM 9473  C CG   . ARG A 1 17 ? 4.466   -11.655 0.981   1.00 10.00 ? 426 ARG A CG   9  
ATOM 9474  C CD   . ARG A 1 17 ? 5.104   -12.368 -0.201  1.00 10.00 ? 426 ARG A CD   9  
ATOM 9475  N NE   . ARG A 1 17 ? 4.603   -13.734 -0.350  1.00 10.00 ? 426 ARG A NE   9  
ATOM 9476  C CZ   . ARG A 1 17 ? 4.927   -14.736 0.464   1.00 10.00 ? 426 ARG A CZ   9  
ATOM 9477  N NH1  . ARG A 1 17 ? 5.751   -14.530 1.485   1.00 10.00 ? 426 ARG A NH1  9  
ATOM 9478  N NH2  . ARG A 1 17 ? 4.427   -15.945 0.258   1.00 10.00 ? 426 ARG A NH2  9  
ATOM 9479  H H    . ARG A 1 17 ? 1.431   -9.541  1.459   1.00 10.00 ? 426 ARG A H    9  
ATOM 9480  H HA   . ARG A 1 17 ? 3.570   -9.655  -0.284  1.00 10.00 ? 426 ARG A HA   9  
ATOM 9481  H HB2  . ARG A 1 17 ? 2.511   -11.291 1.727   1.00 10.00 ? 426 ARG A HB2  9  
ATOM 9482  H HB3  . ARG A 1 17 ? 2.570   -12.320 0.300   1.00 10.00 ? 426 ARG A HB3  9  
ATOM 9483  H HG2  . ARG A 1 17 ? 4.947   -10.697 1.110   1.00 10.00 ? 426 ARG A HG2  9  
ATOM 9484  H HG3  . ARG A 1 17 ? 4.603   -12.252 1.869   1.00 10.00 ? 426 ARG A HG3  9  
ATOM 9485  H HD2  . ARG A 1 17 ? 4.884   -11.814 -1.101  1.00 10.00 ? 426 ARG A HD2  9  
ATOM 9486  H HD3  . ARG A 1 17 ? 6.173   -12.401 -0.050  1.00 10.00 ? 426 ARG A HD3  9  
ATOM 9487  H HE   . ARG A 1 17 ? 3.993   -13.912 -1.095  1.00 10.00 ? 426 ARG A HE   9  
ATOM 9488  H HH11 . ARG A 1 17 ? 6.131   -13.620 1.647   1.00 10.00 ? 426 ARG A HH11 9  
ATOM 9489  H HH12 . ARG A 1 17 ? 5.991   -15.287 2.093   1.00 10.00 ? 426 ARG A HH12 9  
ATOM 9490  H HH21 . ARG A 1 17 ? 3.806   -16.106 -0.509  1.00 10.00 ? 426 ARG A HH21 9  
ATOM 9491  H HH22 . ARG A 1 17 ? 4.671   -16.699 0.869   1.00 10.00 ? 426 ARG A HH22 9  
ATOM 9492  N N    . GLN A 1 18 ? 0.813   -10.807 -1.575  1.00 10.00 ? 427 GLN A N    9  
ATOM 9493  C CA   . GLN A 1 18 ? 0.168   -11.194 -2.824  1.00 10.00 ? 427 GLN A CA   9  
ATOM 9494  C C    . GLN A 1 18 ? -0.524  -9.985  -3.435  1.00 10.00 ? 427 GLN A C    9  
ATOM 9495  O O    . GLN A 1 18 ? -1.541  -10.105 -4.118  1.00 10.00 ? 427 GLN A O    9  
ATOM 9496  C CB   . GLN A 1 18 ? -0.837  -12.323 -2.586  1.00 10.00 ? 427 GLN A CB   9  
ATOM 9497  C CG   . GLN A 1 18 ? -0.324  -13.409 -1.652  1.00 10.00 ? 427 GLN A CG   9  
ATOM 9498  C CD   . GLN A 1 18 ? -0.908  -13.304 -0.256  1.00 10.00 ? 427 GLN A CD   9  
ATOM 9499  O OE1  . GLN A 1 18 ? -1.980  -13.841 0.024   1.00 10.00 ? 427 GLN A OE1  9  
ATOM 9500  N NE2  . GLN A 1 18 ? -0.202  -12.609 0.630   1.00 10.00 ? 427 GLN A NE2  9  
ATOM 9501  H H    . GLN A 1 18 ? 0.257   -10.620 -0.789  1.00 10.00 ? 427 GLN A H    9  
ATOM 9502  H HA   . GLN A 1 18 ? 0.936   -11.530 -3.505  1.00 10.00 ? 427 GLN A HA   9  
ATOM 9503  H HB2  . GLN A 1 18 ? -1.736  -11.904 -2.157  1.00 10.00 ? 427 GLN A HB2  9  
ATOM 9504  H HB3  . GLN A 1 18 ? -1.080  -12.778 -3.535  1.00 10.00 ? 427 GLN A HB3  9  
ATOM 9505  H HG2  . GLN A 1 18 ? -0.588  -14.371 -2.064  1.00 10.00 ? 427 GLN A HG2  9  
ATOM 9506  H HG3  . GLN A 1 18 ? 0.750   -13.329 -1.585  1.00 10.00 ? 427 GLN A HG3  9  
ATOM 9507  H HE21 . GLN A 1 18 ? 0.641   -12.208 0.336   1.00 10.00 ? 427 GLN A HE21 9  
ATOM 9508  H HE22 . GLN A 1 18 ? -0.553  -12.528 1.542   1.00 10.00 ? 427 GLN A HE22 9  
ATOM 9509  N N    . VAL A 1 19 ? 0.053   -8.820  -3.173  1.00 10.00 ? 428 VAL A N    9  
ATOM 9510  C CA   . VAL A 1 19 ? -0.468  -7.558  -3.675  1.00 10.00 ? 428 VAL A CA   9  
ATOM 9511  C C    . VAL A 1 19 ? 0.560   -6.875  -4.560  1.00 10.00 ? 428 VAL A C    9  
ATOM 9512  O O    . VAL A 1 19 ? 0.205   -6.194  -5.521  1.00 10.00 ? 428 VAL A O    9  
ATOM 9513  C CB   . VAL A 1 19 ? -0.853  -6.617  -2.523  1.00 10.00 ? 428 VAL A CB   9  
ATOM 9514  C CG1  . VAL A 1 19 ? -1.078  -5.202  -3.029  1.00 10.00 ? 428 VAL A CG1  9  
ATOM 9515  C CG2  . VAL A 1 19 ? -2.085  -7.137  -1.806  1.00 10.00 ? 428 VAL A CG2  9  
ATOM 9516  H H    . VAL A 1 19 ? 0.862   -8.813  -2.623  1.00 10.00 ? 428 VAL A H    9  
ATOM 9517  H HA   . VAL A 1 19 ? -1.350  -7.763  -4.260  1.00 10.00 ? 428 VAL A HA   9  
ATOM 9518  H HB   . VAL A 1 19 ? -0.034  -6.596  -1.821  1.00 10.00 ? 428 VAL A HB   9  
ATOM 9519  H HG11 . VAL A 1 19 ? -0.203  -4.606  -2.820  1.00 10.00 ? 428 VAL A HG11 9  
ATOM 9520  H HG12 . VAL A 1 19 ? -1.935  -4.772  -2.533  1.00 10.00 ? 428 VAL A HG12 9  
ATOM 9521  H HG13 . VAL A 1 19 ? -1.251  -5.225  -4.095  1.00 10.00 ? 428 VAL A HG13 9  
ATOM 9522  H HG21 . VAL A 1 19 ? -2.218  -6.595  -0.882  1.00 10.00 ? 428 VAL A HG21 9  
ATOM 9523  H HG22 . VAL A 1 19 ? -1.961  -8.188  -1.593  1.00 10.00 ? 428 VAL A HG22 9  
ATOM 9524  H HG23 . VAL A 1 19 ? -2.953  -6.997  -2.434  1.00 10.00 ? 428 VAL A HG23 9  
ATOM 9525  N N    . MET A 1 20 ? 1.836   -7.073  -4.244  1.00 10.00 ? 429 MET A N    9  
ATOM 9526  C CA   . MET A 1 20 ? 2.911   -6.484  -5.037  1.00 10.00 ? 429 MET A CA   9  
ATOM 9527  C C    . MET A 1 20 ? 2.648   -6.702  -6.528  1.00 10.00 ? 429 MET A C    9  
ATOM 9528  O O    . MET A 1 20 ? 3.095   -5.925  -7.372  1.00 10.00 ? 429 MET A O    9  
ATOM 9529  C CB   . MET A 1 20 ? 4.259   -7.093  -4.649  1.00 10.00 ? 429 MET A CB   9  
ATOM 9530  C CG   . MET A 1 20 ? 4.263   -8.613  -4.652  1.00 10.00 ? 429 MET A CG   9  
ATOM 9531  S SD   . MET A 1 20 ? 5.730   -9.305  -3.863  1.00 10.00 ? 429 MET A SD   9  
ATOM 9532  C CE   . MET A 1 20 ? 6.951   -9.070  -5.151  1.00 10.00 ? 429 MET A CE   9  
ATOM 9533  H H    . MET A 1 20 ? 2.059   -7.633  -3.467  1.00 10.00 ? 429 MET A H    9  
ATOM 9534  H HA   . MET A 1 20 ? 2.931   -5.422  -4.836  1.00 10.00 ? 429 MET A HA   9  
ATOM 9535  H HB2  . MET A 1 20 ? 5.010   -6.752  -5.347  1.00 10.00 ? 429 MET A HB2  9  
ATOM 9536  H HB3  . MET A 1 20 ? 4.522   -6.756  -3.658  1.00 10.00 ? 429 MET A HB3  9  
ATOM 9537  H HG2  . MET A 1 20 ? 3.389   -8.963  -4.124  1.00 10.00 ? 429 MET A HG2  9  
ATOM 9538  H HG3  . MET A 1 20 ? 4.226   -8.958  -5.675  1.00 10.00 ? 429 MET A HG3  9  
ATOM 9539  H HE1  . MET A 1 20 ? 6.471   -9.131  -6.117  1.00 10.00 ? 429 MET A HE1  9  
ATOM 9540  H HE2  . MET A 1 20 ? 7.706   -9.838  -5.076  1.00 10.00 ? 429 MET A HE2  9  
ATOM 9541  H HE3  . MET A 1 20 ? 7.410   -8.099  -5.038  1.00 10.00 ? 429 MET A HE3  9  
ATOM 9542  N N    . ASN A 1 21 ? 1.908   -7.766  -6.835  1.00 10.00 ? 430 ASN A N    9  
ATOM 9543  C CA   . ASN A 1 21 ? 1.565   -8.100  -8.210  1.00 10.00 ? 430 ASN A CA   9  
ATOM 9544  C C    . ASN A 1 21 ? 0.052   -8.239  -8.376  1.00 10.00 ? 430 ASN A C    9  
ATOM 9545  O O    . ASN A 1 21 ? -0.420  -8.917  -9.288  1.00 10.00 ? 430 ASN A O    9  
ATOM 9546  C CB   . ASN A 1 21 ? 2.253   -9.404  -8.613  1.00 10.00 ? 430 ASN A CB   9  
ATOM 9547  C CG   . ASN A 1 21 ? 3.677   -9.187  -9.084  1.00 10.00 ? 430 ASN A CG   9  
ATOM 9548  O OD1  . ASN A 1 21 ? 4.514   -8.664  -8.347  1.00 10.00 ? 430 ASN A OD1  9  
ATOM 9549  N ND2  . ASN A 1 21 ? 3.960   -9.585  -10.319 1.00 10.00 ? 430 ASN A ND2  9  
ATOM 9550  H H    . ASN A 1 21 ? 1.581   -8.344  -6.115  1.00 10.00 ? 430 ASN A H    9  
ATOM 9551  H HA   . ASN A 1 21 ? 1.914   -7.300  -8.845  1.00 10.00 ? 430 ASN A HA   9  
ATOM 9552  H HB2  . ASN A 1 21 ? 2.272   -10.071 -7.760  1.00 10.00 ? 430 ASN A HB2  9  
ATOM 9553  H HB3  . ASN A 1 21 ? 1.693   -9.866  -9.414  1.00 10.00 ? 430 ASN A HB3  9  
ATOM 9554  H HD21 . ASN A 1 21 ? 3.244   -9.993  -10.849 1.00 10.00 ? 430 ASN A HD21 9  
ATOM 9555  H HD22 . ASN A 1 21 ? 4.874   -9.457  -10.649 1.00 10.00 ? 430 ASN A HD22 9  
ATOM 9556  N N    . MET A 1 22 ? -0.704  -7.590  -7.491  1.00 10.00 ? 431 MET A N    9  
ATOM 9557  C CA   . MET A 1 22 ? -2.164  -7.639  -7.538  1.00 10.00 ? 431 MET A CA   9  
ATOM 9558  C C    . MET A 1 22 ? -2.782  -7.038  -6.281  1.00 10.00 ? 431 MET A C    9  
ATOM 9559  O O    . MET A 1 22 ? -3.146  -7.759  -5.352  1.00 10.00 ? 431 MET A O    9  
ATOM 9560  C CB   . MET A 1 22 ? -2.657  -9.075  -7.693  1.00 10.00 ? 431 MET A CB   9  
ATOM 9561  C CG   . MET A 1 22 ? -3.097  -9.423  -9.106  1.00 10.00 ? 431 MET A CG   9  
ATOM 9562  S SD   . MET A 1 22 ? -2.678  -11.115 -9.566  1.00 10.00 ? 431 MET A SD   9  
ATOM 9563  C CE   . MET A 1 22 ? -4.172  -11.978 -9.085  1.00 10.00 ? 431 MET A CE   9  
ATOM 9564  H H    . MET A 1 22 ? -0.272  -7.065  -6.791  1.00 10.00 ? 431 MET A H    9  
ATOM 9565  H HA   . MET A 1 22 ? -2.487  -7.065  -8.393  1.00 10.00 ? 431 MET A HA   9  
ATOM 9566  H HB2  . MET A 1 22 ? -1.862  -9.747  -7.408  1.00 10.00 ? 431 MET A HB2  9  
ATOM 9567  H HB3  . MET A 1 22 ? -3.498  -9.222  -7.029  1.00 10.00 ? 431 MET A HB3  9  
ATOM 9568  H HG2  . MET A 1 22 ? -4.168  -9.302  -9.174  1.00 10.00 ? 431 MET A HG2  9  
ATOM 9569  H HG3  . MET A 1 22 ? -2.614  -8.747  -9.795  1.00 10.00 ? 431 MET A HG3  9  
ATOM 9570  H HE1  . MET A 1 22 ? -4.008  -12.488 -8.148  1.00 10.00 ? 431 MET A HE1  9  
ATOM 9571  H HE2  . MET A 1 22 ? -4.432  -12.698 -9.847  1.00 10.00 ? 431 MET A HE2  9  
ATOM 9572  H HE3  . MET A 1 22 ? -4.977  -11.267 -8.973  1.00 10.00 ? 431 MET A HE3  9  
ATOM 9573  N N    . TRP A 1 23 ? -2.931  -5.724  -6.271  1.00 10.00 ? 432 TRP A N    9  
ATOM 9574  C CA   . TRP A 1 23 ? -3.537  -5.038  -5.141  1.00 10.00 ? 432 TRP A CA   9  
ATOM 9575  C C    . TRP A 1 23 ? -5.046  -5.168  -5.239  1.00 10.00 ? 432 TRP A C    9  
ATOM 9576  O O    . TRP A 1 23 ? -5.698  -4.493  -6.035  1.00 10.00 ? 432 TRP A O    9  
ATOM 9577  C CB   . TRP A 1 23 ? -3.120  -3.566  -5.103  1.00 10.00 ? 432 TRP A CB   9  
ATOM 9578  C CG   . TRP A 1 23 ? -1.692  -3.307  -5.506  1.00 10.00 ? 432 TRP A CG   9  
ATOM 9579  C CD1  . TRP A 1 23 ? -1.127  -3.534  -6.726  1.00 10.00 ? 432 TRP A CD1  9  
ATOM 9580  C CD2  . TRP A 1 23 ? -0.649  -2.755  -4.687  1.00 10.00 ? 432 TRP A CD2  9  
ATOM 9581  N NE1  . TRP A 1 23 ? 0.181   -3.124  -6.727  1.00 10.00 ? 432 TRP A NE1  9  
ATOM 9582  C CE2  . TRP A 1 23 ? 0.501   -2.651  -5.489  1.00 10.00 ? 432 TRP A CE2  9  
ATOM 9583  C CE3  . TRP A 1 23 ? -0.578  -2.329  -3.364  1.00 10.00 ? 432 TRP A CE3  9  
ATOM 9584  C CZ2  . TRP A 1 23 ? 1.701   -2.133  -5.012  1.00 10.00 ? 432 TRP A CZ2  9  
ATOM 9585  C CZ3  . TRP A 1 23 ? 0.615   -1.824  -2.884  1.00 10.00 ? 432 TRP A CZ3  9  
ATOM 9586  C CH2  . TRP A 1 23 ? 1.739   -1.723  -3.709  1.00 10.00 ? 432 TRP A CH2  9  
ATOM 9587  H H    . TRP A 1 23 ? -2.653  -5.211  -7.052  1.00 10.00 ? 432 TRP A H    9  
ATOM 9588  H HA   . TRP A 1 23 ? -3.218  -5.525  -4.229  1.00 10.00 ? 432 TRP A HA   9  
ATOM 9589  H HB2  . TRP A 1 23 ? -3.755  -3.007  -5.772  1.00 10.00 ? 432 TRP A HB2  9  
ATOM 9590  H HB3  . TRP A 1 23 ? -3.254  -3.192  -4.101  1.00 10.00 ? 432 TRP A HB3  9  
ATOM 9591  H HD1  . TRP A 1 23 ? -1.648  -3.961  -7.565  1.00 10.00 ? 432 TRP A HD1  9  
ATOM 9592  H HE1  . TRP A 1 23 ? 0.786   -3.166  -7.486  1.00 10.00 ? 432 TRP A HE1  9  
ATOM 9593  H HE3  . TRP A 1 23 ? -1.428  -2.402  -2.719  1.00 10.00 ? 432 TRP A HE3  9  
ATOM 9594  H HZ2  . TRP A 1 23 ? 2.566   -2.031  -5.645  1.00 10.00 ? 432 TRP A HZ2  9  
ATOM 9595  H HZ3  . TRP A 1 23 ? 0.684   -1.490  -1.859  1.00 10.00 ? 432 TRP A HZ3  9  
ATOM 9596  H HH2  . TRP A 1 23 ? 2.652   -1.326  -3.291  1.00 10.00 ? 432 TRP A HH2  9  
ATOM 9597  N N    . SER A 1 24 ? -5.583  -6.073  -4.438  1.00 10.00 ? 433 SER A N    9  
ATOM 9598  C CA   . SER A 1 24 ? -7.016  -6.348  -4.432  1.00 10.00 ? 433 SER A CA   9  
ATOM 9599  C C    . SER A 1 24 ? -7.823  -5.106  -4.086  1.00 10.00 ? 433 SER A C    9  
ATOM 9600  O O    . SER A 1 24 ? -7.369  -4.248  -3.331  1.00 10.00 ? 433 SER A O    9  
ATOM 9601  C CB   . SER A 1 24 ? -7.334  -7.467  -3.439  1.00 10.00 ? 433 SER A CB   9  
ATOM 9602  O OG   . SER A 1 24 ? -6.359  -8.494  -3.498  1.00 10.00 ? 433 SER A OG   9  
ATOM 9603  H H    . SER A 1 24 ? -4.991  -6.583  -3.843  1.00 10.00 ? 433 SER A H    9  
ATOM 9604  H HA   . SER A 1 24 ? -7.291  -6.675  -5.422  1.00 10.00 ? 433 SER A HA   9  
ATOM 9605  H HB2  . SER A 1 24 ? -7.351  -7.064  -2.438  1.00 10.00 ? 433 SER A HB2  9  
ATOM 9606  H HB3  . SER A 1 24 ? -8.299  -7.890  -3.674  1.00 10.00 ? 433 SER A HB3  9  
ATOM 9607  H HG   . SER A 1 24 ? -6.783  -9.325  -3.726  1.00 10.00 ? 433 SER A HG   9  
ATOM 9608  N N    . GLU A 1 25 ? -9.036  -5.025  -4.631  1.00 10.00 ? 434 GLU A N    9  
ATOM 9609  C CA   . GLU A 1 25 ? -9.916  -3.893  -4.362  1.00 10.00 ? 434 GLU A CA   9  
ATOM 9610  C C    . GLU A 1 25 ? -10.012 -3.652  -2.860  1.00 10.00 ? 434 GLU A C    9  
ATOM 9611  O O    . GLU A 1 25 ? -10.206 -2.523  -2.409  1.00 10.00 ? 434 GLU A O    9  
ATOM 9612  C CB   . GLU A 1 25 ? -11.308 -4.149  -4.944  1.00 10.00 ? 434 GLU A CB   9  
ATOM 9613  C CG   . GLU A 1 25 ? -11.444 -3.734  -6.399  1.00 10.00 ? 434 GLU A CG   9  
ATOM 9614  C CD   . GLU A 1 25 ? -12.882 -3.456  -6.793  1.00 10.00 ? 434 GLU A CD   9  
ATOM 9615  O OE1  . GLU A 1 25 ? -13.698 -4.401  -6.764  1.00 10.00 ? 434 GLU A OE1  9  
ATOM 9616  O OE2  . GLU A 1 25 ? -13.191 -2.294  -7.131  1.00 10.00 ? 434 GLU A OE2  9  
ATOM 9617  H H    . GLU A 1 25 ? -9.348  -5.747  -5.214  1.00 10.00 ? 434 GLU A H    9  
ATOM 9618  H HA   . GLU A 1 25 ? -9.489  -3.019  -4.831  1.00 10.00 ? 434 GLU A HA   9  
ATOM 9619  H HB2  . GLU A 1 25 ? -11.527 -5.204  -4.869  1.00 10.00 ? 434 GLU A HB2  9  
ATOM 9620  H HB3  . GLU A 1 25 ? -12.034 -3.597  -4.364  1.00 10.00 ? 434 GLU A HB3  9  
ATOM 9621  H HG2  . GLU A 1 25 ? -10.864 -2.838  -6.561  1.00 10.00 ? 434 GLU A HG2  9  
ATOM 9622  H HG3  . GLU A 1 25 ? -11.062 -4.528  -7.024  1.00 10.00 ? 434 GLU A HG3  9  
ATOM 9623  N N    . GLN A 1 26 ? -9.857  -4.727  -2.093  1.00 10.00 ? 435 GLN A N    9  
ATOM 9624  C CA   . GLN A 1 26 ? -9.905  -4.648  -0.641  1.00 10.00 ? 435 GLN A CA   9  
ATOM 9625  C C    . GLN A 1 26 ? -8.524  -4.325  -0.086  1.00 10.00 ? 435 GLN A C    9  
ATOM 9626  O O    . GLN A 1 26 ? -8.398  -3.680  0.954   1.00 10.00 ? 435 GLN A O    9  
ATOM 9627  C CB   . GLN A 1 26 ? -10.414 -5.963  -0.050  1.00 10.00 ? 435 GLN A CB   9  
ATOM 9628  C CG   . GLN A 1 26 ? -11.787 -6.370  -0.561  1.00 10.00 ? 435 GLN A CG   9  
ATOM 9629  C CD   . GLN A 1 26 ? -12.881 -5.426  -0.105  1.00 10.00 ? 435 GLN A CD   9  
ATOM 9630  O OE1  . GLN A 1 26 ? -13.488 -5.624  0.949   1.00 10.00 ? 435 GLN A OE1  9  
ATOM 9631  N NE2  . GLN A 1 26 ? -13.141 -4.392  -0.897  1.00 10.00 ? 435 GLN A NE2  9  
ATOM 9632  H H    . GLN A 1 26 ? -9.695  -5.596  -2.515  1.00 10.00 ? 435 GLN A H    9  
ATOM 9633  H HA   . GLN A 1 26 ? -10.584 -3.851  -0.374  1.00 10.00 ? 435 GLN A HA   9  
ATOM 9634  H HB2  . GLN A 1 26 ? -9.715  -6.748  -0.297  1.00 10.00 ? 435 GLN A HB2  9  
ATOM 9635  H HB3  . GLN A 1 26 ? -10.468 -5.865  1.024   1.00 10.00 ? 435 GLN A HB3  9  
ATOM 9636  H HG2  . GLN A 1 26 ? -11.767 -6.377  -1.641  1.00 10.00 ? 435 GLN A HG2  9  
ATOM 9637  H HG3  . GLN A 1 26 ? -12.012 -7.362  -0.199  1.00 10.00 ? 435 GLN A HG3  9  
ATOM 9638  H HE21 . GLN A 1 26 ? -12.619 -4.298  -1.721  1.00 10.00 ? 435 GLN A HE21 9  
ATOM 9639  H HE22 . GLN A 1 26 ? -13.845 -3.767  -0.625  1.00 10.00 ? 435 GLN A HE22 9  
ATOM 9640  N N    . GLU A 1 27 ? -7.487  -4.765  -0.797  1.00 10.00 ? 436 GLU A N    9  
ATOM 9641  C CA   . GLU A 1 27 ? -6.125  -4.511  -0.388  1.00 10.00 ? 436 GLU A CA   9  
ATOM 9642  C C    . GLU A 1 27 ? -5.781  -3.062  -0.673  1.00 10.00 ? 436 GLU A C    9  
ATOM 9643  O O    . GLU A 1 27 ? -5.462  -2.300  0.240   1.00 10.00 ? 436 GLU A O    9  
ATOM 9644  C CB   . GLU A 1 27 ? -5.196  -5.479  -1.123  1.00 10.00 ? 436 GLU A CB   9  
ATOM 9645  C CG   . GLU A 1 27 ? -4.582  -6.544  -0.222  1.00 10.00 ? 436 GLU A CG   9  
ATOM 9646  C CD   . GLU A 1 27 ? -5.559  -7.088  0.805   1.00 10.00 ? 436 GLU A CD   9  
ATOM 9647  O OE1  . GLU A 1 27 ? -6.479  -7.836  0.411   1.00 10.00 ? 436 GLU A OE1  9  
ATOM 9648  O OE2  . GLU A 1 27 ? -5.405  -6.765  2.002   1.00 10.00 ? 436 GLU A OE2  9  
ATOM 9649  H H    . GLU A 1 27 ? -7.639  -5.264  -1.627  1.00 10.00 ? 436 GLU A H    9  
ATOM 9650  H HA   . GLU A 1 27 ? -6.054  -4.673  0.673   1.00 10.00 ? 436 GLU A HA   9  
ATOM 9651  H HB2  . GLU A 1 27 ? -5.764  -5.981  -1.893  1.00 10.00 ? 436 GLU A HB2  9  
ATOM 9652  H HB3  . GLU A 1 27 ? -4.400  -4.922  -1.588  1.00 10.00 ? 436 GLU A HB3  9  
ATOM 9653  H HG2  . GLU A 1 27 ? -4.247  -7.364  -0.837  1.00 10.00 ? 436 GLU A HG2  9  
ATOM 9654  H HG3  . GLU A 1 27 ? -3.739  -6.115  0.298   1.00 10.00 ? 436 GLU A HG3  9  
ATOM 9655  N N    . LYS A 1 28 ? -5.901  -2.666  -1.932  1.00 10.00 ? 437 LYS A N    9  
ATOM 9656  C CA   . LYS A 1 28 ? -5.656  -1.281  -2.319  1.00 10.00 ? 437 LYS A CA   9  
ATOM 9657  C C    . LYS A 1 28 ? -6.517  -0.364  -1.462  1.00 10.00 ? 437 LYS A C    9  
ATOM 9658  O O    . LYS A 1 28 ? -6.229  0.816   -1.309  1.00 10.00 ? 437 LYS A O    9  
ATOM 9659  C CB   . LYS A 1 28 ? -5.984  -1.078  -3.800  1.00 10.00 ? 437 LYS A CB   9  
ATOM 9660  C CG   . LYS A 1 28 ? -5.005  -0.169  -4.523  1.00 10.00 ? 437 LYS A CG   9  
ATOM 9661  C CD   . LYS A 1 28 ? -5.654  0.510   -5.718  1.00 10.00 ? 437 LYS A CD   9  
ATOM 9662  C CE   . LYS A 1 28 ? -5.523  -0.335  -6.976  1.00 10.00 ? 437 LYS A CE   9  
ATOM 9663  N NZ   . LYS A 1 28 ? -6.574  -1.388  -7.050  1.00 10.00 ? 437 LYS A NZ   9  
ATOM 9664  H H    . LYS A 1 28 ? -6.199  -3.309  -2.606  1.00 10.00 ? 437 LYS A H    9  
ATOM 9665  H HA   . LYS A 1 28 ? -4.618  -1.044  -2.146  1.00 10.00 ? 437 LYS A HA   9  
ATOM 9666  H HB2  . LYS A 1 28 ? -5.979  -2.040  -4.292  1.00 10.00 ? 437 LYS A HB2  9  
ATOM 9667  H HB3  . LYS A 1 28 ? -6.971  -0.647  -3.883  1.00 10.00 ? 437 LYS A HB3  9  
ATOM 9668  H HG2  . LYS A 1 28 ? -4.658  0.588   -3.837  1.00 10.00 ? 437 LYS A HG2  9  
ATOM 9669  H HG3  . LYS A 1 28 ? -4.168  -0.758  -4.866  1.00 10.00 ? 437 LYS A HG3  9  
ATOM 9670  H HD2  . LYS A 1 28 ? -6.702  0.664   -5.508  1.00 10.00 ? 437 LYS A HD2  9  
ATOM 9671  H HD3  . LYS A 1 28 ? -5.174  1.462   -5.882  1.00 10.00 ? 437 LYS A HD3  9  
ATOM 9672  H HE2  . LYS A 1 28 ? -5.612  0.310   -7.838  1.00 10.00 ? 437 LYS A HE2  9  
ATOM 9673  H HE3  . LYS A 1 28 ? -4.552  -0.806  -6.978  1.00 10.00 ? 437 LYS A HE3  9  
ATOM 9674  H HZ1  . LYS A 1 28 ? -6.778  -1.756  -6.100  1.00 10.00 ? 437 LYS A HZ1  9  
ATOM 9675  H HZ2  . LYS A 1 28 ? -6.252  -2.172  -7.653  1.00 10.00 ? 437 LYS A HZ2  9  
ATOM 9676  H HZ3  . LYS A 1 28 ? -7.448  -0.992  -7.453  1.00 10.00 ? 437 LYS A HZ3  9  
ATOM 9677  N N    . GLU A 1 29 ? -7.572  -0.934  -0.893  1.00 10.00 ? 438 GLU A N    9  
ATOM 9678  C CA   . GLU A 1 29 ? -8.479  -0.186  -0.042  1.00 10.00 ? 438 GLU A CA   9  
ATOM 9679  C C    . GLU A 1 29 ? -7.761  0.362   1.183   1.00 10.00 ? 438 GLU A C    9  
ATOM 9680  O O    . GLU A 1 29 ? -8.164  1.382   1.736   1.00 10.00 ? 438 GLU A O    9  
ATOM 9681  C CB   . GLU A 1 29 ? -9.638  -1.076  0.400   1.00 10.00 ? 438 GLU A CB   9  
ATOM 9682  C CG   . GLU A 1 29 ? -10.965 -0.343  0.504   1.00 10.00 ? 438 GLU A CG   9  
ATOM 9683  C CD   . GLU A 1 29 ? -10.896 0.860   1.424   1.00 10.00 ? 438 GLU A CD   9  
ATOM 9684  O OE1  . GLU A 1 29 ? -11.144 0.696   2.636   1.00 10.00 ? 438 GLU A OE1  9  
ATOM 9685  O OE2  . GLU A 1 29 ? -10.593 1.967   0.931   1.00 10.00 ? 438 GLU A OE2  9  
ATOM 9686  H H    . GLU A 1 29 ? -7.740  -1.889  -1.044  1.00 10.00 ? 438 GLU A H    9  
ATOM 9687  H HA   . GLU A 1 29 ? -8.867  0.640   -0.616  1.00 10.00 ? 438 GLU A HA   9  
ATOM 9688  H HB2  . GLU A 1 29 ? -9.749  -1.880  -0.312  1.00 10.00 ? 438 GLU A HB2  9  
ATOM 9689  H HB3  . GLU A 1 29 ? -9.404  -1.494  1.368   1.00 10.00 ? 438 GLU A HB3  9  
ATOM 9690  H HG2  . GLU A 1 29 ? -11.256 -0.008  -0.481  1.00 10.00 ? 438 GLU A HG2  9  
ATOM 9691  H HG3  . GLU A 1 29 ? -11.711 -1.026  0.885   1.00 10.00 ? 438 GLU A HG3  9  
ATOM 9692  N N    . THR A 1 30 ? -6.707  -0.319  1.618   1.00 10.00 ? 439 THR A N    9  
ATOM 9693  C CA   . THR A 1 30 ? -5.967  0.126   2.793   1.00 10.00 ? 439 THR A CA   9  
ATOM 9694  C C    . THR A 1 30 ? -4.839  1.086   2.420   1.00 10.00 ? 439 THR A C    9  
ATOM 9695  O O    . THR A 1 30 ? -4.722  2.167   2.995   1.00 10.00 ? 439 THR A O    9  
ATOM 9696  C CB   . THR A 1 30 ? -5.415  -1.072  3.564   1.00 10.00 ? 439 THR A CB   9  
ATOM 9697  O OG1  . THR A 1 30 ? -6.459  -1.959  3.921   1.00 10.00 ? 439 THR A OG1  9  
ATOM 9698  C CG2  . THR A 1 30 ? -4.691  -0.678  4.835   1.00 10.00 ? 439 THR A CG2  9  
ATOM 9699  H H    . THR A 1 30 ? -6.430  -1.141  1.150   1.00 10.00 ? 439 THR A H    9  
ATOM 9700  H HA   . THR A 1 30 ? -6.662  0.655   3.428   1.00 10.00 ? 439 THR A HA   9  
ATOM 9701  H HB   . THR A 1 30 ? -4.717  -1.606  2.933   1.00 10.00 ? 439 THR A HB   9  
ATOM 9702  H HG1  . THR A 1 30 ? -6.948  -2.212  3.134   1.00 10.00 ? 439 THR A HG1  9  
ATOM 9703  H HG21 . THR A 1 30 ? -4.958  -1.361  5.628   1.00 10.00 ? 439 THR A HG21 9  
ATOM 9704  H HG22 . THR A 1 30 ? -4.977  0.326   5.115   1.00 10.00 ? 439 THR A HG22 9  
ATOM 9705  H HG23 . THR A 1 30 ? -3.626  -0.715  4.671   1.00 10.00 ? 439 THR A HG23 9  
ATOM 9706  N N    . PHE A 1 31 ? -4.010  0.691   1.461   1.00 10.00 ? 440 PHE A N    9  
ATOM 9707  C CA   . PHE A 1 31 ? -2.899  1.522   1.025   1.00 10.00 ? 440 PHE A CA   9  
ATOM 9708  C C    . PHE A 1 31 ? -3.404  2.724   0.232   1.00 10.00 ? 440 PHE A C    9  
ATOM 9709  O O    . PHE A 1 31 ? -2.791  3.791   0.250   1.00 10.00 ? 440 PHE A O    9  
ATOM 9710  C CB   . PHE A 1 31 ? -1.916  0.704   0.180   1.00 10.00 ? 440 PHE A CB   9  
ATOM 9711  C CG   . PHE A 1 31 ? -2.288  -0.735  0.020   1.00 10.00 ? 440 PHE A CG   9  
ATOM 9712  C CD1  . PHE A 1 31 ? -2.248  -1.622  1.083   1.00 10.00 ? 440 PHE A CD1  9  
ATOM 9713  C CD2  . PHE A 1 31 ? -2.694  -1.193  -1.207  1.00 10.00 ? 440 PHE A CD2  9  
ATOM 9714  C CE1  . PHE A 1 31 ? -2.611  -2.937  0.905   1.00 10.00 ? 440 PHE A CE1  9  
ATOM 9715  C CE2  . PHE A 1 31 ? -3.053  -2.500  -1.390  1.00 10.00 ? 440 PHE A CE2  9  
ATOM 9716  C CZ   . PHE A 1 31 ? -3.012  -3.367  -0.340  1.00 10.00 ? 440 PHE A CZ   9  
ATOM 9717  H H    . PHE A 1 31 ? -4.145  -0.177  1.035   1.00 10.00 ? 440 PHE A H    9  
ATOM 9718  H HA   . PHE A 1 31 ? -2.390  1.880   1.907   1.00 10.00 ? 440 PHE A HA   9  
ATOM 9719  H HB2  . PHE A 1 31 ? -1.874  1.125   -0.808  1.00 10.00 ? 440 PHE A HB2  9  
ATOM 9720  H HB3  . PHE A 1 31 ? -0.939  0.747   0.628   1.00 10.00 ? 440 PHE A HB3  9  
ATOM 9721  H HD1  . PHE A 1 31 ? -1.933  -1.277  2.054   1.00 10.00 ? 440 PHE A HD1  9  
ATOM 9722  H HD2  . PHE A 1 31 ? -2.729  -0.515  -2.033  1.00 10.00 ? 440 PHE A HD2  9  
ATOM 9723  H HE1  . PHE A 1 31 ? -2.579  -3.627  1.734   1.00 10.00 ? 440 PHE A HE1  9  
ATOM 9724  H HE2  . PHE A 1 31 ? -3.374  -2.845  -2.363  1.00 10.00 ? 440 PHE A HE2  9  
ATOM 9725  H HZ   . PHE A 1 31 ? -3.303  -4.372  -0.495  1.00 10.00 ? 440 PHE A HZ   9  
ATOM 9726  N N    . ARG A 1 32 ? -4.528  2.552   -0.459  1.00 10.00 ? 441 ARG A N    9  
ATOM 9727  C CA   . ARG A 1 32 ? -5.106  3.638   -1.248  1.00 10.00 ? 441 ARG A CA   9  
ATOM 9728  C C    . ARG A 1 32 ? -5.924  4.572   -0.363  1.00 10.00 ? 441 ARG A C    9  
ATOM 9729  O O    . ARG A 1 32 ? -5.990  5.776   -0.615  1.00 10.00 ? 441 ARG A O    9  
ATOM 9730  C CB   . ARG A 1 32 ? -5.979  3.097   -2.381  1.00 10.00 ? 441 ARG A CB   9  
ATOM 9731  C CG   . ARG A 1 32 ? -6.234  4.109   -3.487  1.00 10.00 ? 441 ARG A CG   9  
ATOM 9732  C CD   . ARG A 1 32 ? -7.643  4.676   -3.412  1.00 10.00 ? 441 ARG A CD   9  
ATOM 9733  N NE   . ARG A 1 32 ? -8.211  4.910   -4.738  1.00 10.00 ? 441 ARG A NE   9  
ATOM 9734  C CZ   . ARG A 1 32 ? -8.480  3.942   -5.611  1.00 10.00 ? 441 ARG A CZ   9  
ATOM 9735  N NH1  . ARG A 1 32 ? -8.238  2.674   -5.302  1.00 10.00 ? 441 ARG A NH1  9  
ATOM 9736  N NH2  . ARG A 1 32 ? -8.994  4.241   -6.795  1.00 10.00 ? 441 ARG A NH2  9  
ATOM 9737  H H    . ARG A 1 32 ? -4.980  1.680   -0.435  1.00 10.00 ? 441 ARG A H    9  
ATOM 9738  H HA   . ARG A 1 32 ? -4.290  4.195   -1.678  1.00 10.00 ? 441 ARG A HA   9  
ATOM 9739  H HB2  . ARG A 1 32 ? -5.493  2.237   -2.817  1.00 10.00 ? 441 ARG A HB2  9  
ATOM 9740  H HB3  . ARG A 1 32 ? -6.933  2.794   -1.974  1.00 10.00 ? 441 ARG A HB3  9  
ATOM 9741  H HG2  . ARG A 1 32 ? -5.526  4.918   -3.391  1.00 10.00 ? 441 ARG A HG2  9  
ATOM 9742  H HG3  . ARG A 1 32 ? -6.101  3.623   -4.444  1.00 10.00 ? 441 ARG A HG3  9  
ATOM 9743  H HD2  . ARG A 1 32 ? -8.271  3.977   -2.882  1.00 10.00 ? 441 ARG A HD2  9  
ATOM 9744  H HD3  . ARG A 1 32 ? -7.613  5.612   -2.874  1.00 10.00 ? 441 ARG A HD3  9  
ATOM 9745  H HE   . ARG A 1 32 ? -8.400  5.837   -4.992  1.00 10.00 ? 441 ARG A HE   9  
ATOM 9746  H HH11 . ARG A 1 32 ? -7.850  2.441   -4.410  1.00 10.00 ? 441 ARG A HH11 9  
ATOM 9747  H HH12 . ARG A 1 32 ? -8.442  1.951   -5.962  1.00 10.00 ? 441 ARG A HH12 9  
ATOM 9748  H HH21 . ARG A 1 32 ? -9.179  5.196   -7.033  1.00 10.00 ? 441 ARG A HH21 9  
ATOM 9749  H HH22 . ARG A 1 32 ? -9.197  3.514   -7.451  1.00 10.00 ? 441 ARG A HH22 9  
ATOM 9750  N N    . GLU A 1 33 ? -6.542  4.018   0.679   1.00 10.00 ? 442 GLU A N    9  
ATOM 9751  C CA   . GLU A 1 33 ? -7.346  4.821   1.595   1.00 10.00 ? 442 GLU A CA   9  
ATOM 9752  C C    . GLU A 1 33 ? -6.452  5.578   2.563   1.00 10.00 ? 442 GLU A C    9  
ATOM 9753  O O    . GLU A 1 33 ? -6.747  6.715   2.936   1.00 10.00 ? 442 GLU A O    9  
ATOM 9754  C CB   . GLU A 1 33 ? -8.329  3.945   2.371   1.00 10.00 ? 442 GLU A CB   9  
ATOM 9755  C CG   . GLU A 1 33 ? -9.214  4.726   3.329   1.00 10.00 ? 442 GLU A CG   9  
ATOM 9756  C CD   . GLU A 1 33 ? -10.611 4.946   2.785   1.00 10.00 ? 442 GLU A CD   9  
ATOM 9757  O OE1  . GLU A 1 33 ? -11.233 3.962   2.331   1.00 10.00 ? 442 GLU A OE1  9  
ATOM 9758  O OE2  . GLU A 1 33 ? -11.085 6.101   2.813   1.00 10.00 ? 442 GLU A OE2  9  
ATOM 9759  H H    . GLU A 1 33 ? -6.451  3.054   0.838   1.00 10.00 ? 442 GLU A H    9  
ATOM 9760  H HA   . GLU A 1 33 ? -7.900  5.535   1.006   1.00 10.00 ? 442 GLU A HA   9  
ATOM 9761  H HB2  . GLU A 1 33 ? -8.966  3.429   1.668   1.00 10.00 ? 442 GLU A HB2  9  
ATOM 9762  H HB3  . GLU A 1 33 ? -7.773  3.217   2.941   1.00 10.00 ? 442 GLU A HB3  9  
ATOM 9763  H HG2  . GLU A 1 33 ? -9.287  4.180   4.258   1.00 10.00 ? 442 GLU A HG2  9  
ATOM 9764  H HG3  . GLU A 1 33 ? -8.760  5.689   3.515   1.00 10.00 ? 442 GLU A HG3  9  
ATOM 9765  N N    . LYS A 1 34 ? -5.349  4.952   2.961   1.00 10.00 ? 443 LYS A N    9  
ATOM 9766  C CA   . LYS A 1 34 ? -4.415  5.584   3.872   1.00 10.00 ? 443 LYS A CA   9  
ATOM 9767  C C    . LYS A 1 34 ? -3.768  6.779   3.194   1.00 10.00 ? 443 LYS A C    9  
ATOM 9768  O O    . LYS A 1 34 ? -3.583  7.828   3.804   1.00 10.00 ? 443 LYS A O    9  
ATOM 9769  C CB   . LYS A 1 34 ? -3.347  4.587   4.326   1.00 10.00 ? 443 LYS A CB   9  
ATOM 9770  C CG   . LYS A 1 34 ? -3.794  3.703   5.481   1.00 10.00 ? 443 LYS A CG   9  
ATOM 9771  C CD   . LYS A 1 34 ? -2.623  3.301   6.365   1.00 10.00 ? 443 LYS A CD   9  
ATOM 9772  C CE   . LYS A 1 34 ? -2.832  3.739   7.807   1.00 10.00 ? 443 LYS A CE   9  
ATOM 9773  N NZ   . LYS A 1 34 ? -3.209  2.597   8.684   1.00 10.00 ? 443 LYS A NZ   9  
ATOM 9774  H H    . LYS A 1 34 ? -5.155  4.053   2.625   1.00 10.00 ? 443 LYS A H    9  
ATOM 9775  H HA   . LYS A 1 34 ? -4.969  5.927   4.734   1.00 10.00 ? 443 LYS A HA   9  
ATOM 9776  H HB2  . LYS A 1 34 ? -3.087  3.951   3.493   1.00 10.00 ? 443 LYS A HB2  9  
ATOM 9777  H HB3  . LYS A 1 34 ? -2.469  5.133   4.637   1.00 10.00 ? 443 LYS A HB3  9  
ATOM 9778  H HG2  . LYS A 1 34 ? -4.514  4.245   6.076   1.00 10.00 ? 443 LYS A HG2  9  
ATOM 9779  H HG3  . LYS A 1 34 ? -4.254  2.812   5.081   1.00 10.00 ? 443 LYS A HG3  9  
ATOM 9780  H HD2  . LYS A 1 34 ? -2.518  2.228   6.339   1.00 10.00 ? 443 LYS A HD2  9  
ATOM 9781  H HD3  . LYS A 1 34 ? -1.721  3.762   5.986   1.00 10.00 ? 443 LYS A HD3  9  
ATOM 9782  H HE2  . LYS A 1 34 ? -1.914  4.175   8.174   1.00 10.00 ? 443 LYS A HE2  9  
ATOM 9783  H HE3  . LYS A 1 34 ? -3.618  4.479   7.835   1.00 10.00 ? 443 LYS A HE3  9  
ATOM 9784  H HZ1  . LYS A 1 34 ? -3.743  2.941   9.508   1.00 10.00 ? 443 LYS A HZ1  9  
ATOM 9785  H HZ2  . LYS A 1 34 ? -2.356  2.105   9.019   1.00 10.00 ? 443 LYS A HZ2  9  
ATOM 9786  H HZ3  . LYS A 1 34 ? -3.802  1.923   8.159   1.00 10.00 ? 443 LYS A HZ3  9  
ATOM 9787  N N    . PHE A 1 35 ? -3.451  6.624   1.911   1.00 10.00 ? 444 PHE A N    9  
ATOM 9788  C CA   . PHE A 1 35 ? -2.852  7.700   1.144   1.00 10.00 ? 444 PHE A CA   9  
ATOM 9789  C C    . PHE A 1 35 ? -3.851  8.834   1.023   1.00 10.00 ? 444 PHE A C    9  
ATOM 9790  O O    . PHE A 1 35 ? -3.480  10.005  0.959   1.00 10.00 ? 444 PHE A O    9  
ATOM 9791  C CB   . PHE A 1 35 ? -2.409  7.194   -0.227  1.00 10.00 ? 444 PHE A CB   9  
ATOM 9792  C CG   . PHE A 1 35 ? -1.700  8.226   -1.055  1.00 10.00 ? 444 PHE A CG   9  
ATOM 9793  C CD1  . PHE A 1 35 ? -2.378  9.328   -1.550  1.00 10.00 ? 444 PHE A CD1  9  
ATOM 9794  C CD2  . PHE A 1 35 ? -0.353  8.088   -1.339  1.00 10.00 ? 444 PHE A CD2  9  
ATOM 9795  C CE1  . PHE A 1 35 ? -1.722  10.276  -2.312  1.00 10.00 ? 444 PHE A CE1  9  
ATOM 9796  C CE2  . PHE A 1 35 ? 0.309   9.032   -2.100  1.00 10.00 ? 444 PHE A CE2  9  
ATOM 9797  C CZ   . PHE A 1 35 ? -0.376  10.128  -2.588  1.00 10.00 ? 444 PHE A CZ   9  
ATOM 9798  H H    . PHE A 1 35 ? -3.649  5.778   1.467   1.00 10.00 ? 444 PHE A H    9  
ATOM 9799  H HA   . PHE A 1 35 ? -1.991  8.059   1.686   1.00 10.00 ? 444 PHE A HA   9  
ATOM 9800  H HB2  . PHE A 1 35 ? -1.729  6.363   -0.086  1.00 10.00 ? 444 PHE A HB2  9  
ATOM 9801  H HB3  . PHE A 1 35 ? -3.274  6.856   -0.778  1.00 10.00 ? 444 PHE A HB3  9  
ATOM 9802  H HD1  . PHE A 1 35 ? -3.429  9.444   -1.335  1.00 10.00 ? 444 PHE A HD1  9  
ATOM 9803  H HD2  . PHE A 1 35 ? 0.182   7.230   -0.957  1.00 10.00 ? 444 PHE A HD2  9  
ATOM 9804  H HE1  . PHE A 1 35 ? -2.261  11.131  -2.692  1.00 10.00 ? 444 PHE A HE1  9  
ATOM 9805  H HE2  . PHE A 1 35 ? 1.361   8.914   -2.313  1.00 10.00 ? 444 PHE A HE2  9  
ATOM 9806  H HZ   . PHE A 1 35 ? 0.139   10.867  -3.183  1.00 10.00 ? 444 PHE A HZ   9  
ATOM 9807  N N    . MET A 1 36 ? -5.128  8.475   1.051   1.00 10.00 ? 445 MET A N    9  
ATOM 9808  C CA   . MET A 1 36 ? -6.184  9.462   1.010   1.00 10.00 ? 445 MET A CA   9  
ATOM 9809  C C    . MET A 1 36 ? -6.319  10.074  2.400   1.00 10.00 ? 445 MET A C    9  
ATOM 9810  O O    . MET A 1 36 ? -6.740  11.220  2.562   1.00 10.00 ? 445 MET A O    9  
ATOM 9811  C CB   . MET A 1 36 ? -7.505  8.826   0.573   1.00 10.00 ? 445 MET A CB   9  
ATOM 9812  C CG   . MET A 1 36 ? -8.596  9.839   0.265   1.00 10.00 ? 445 MET A CG   9  
ATOM 9813  S SD   . MET A 1 36 ? -8.100  11.031  -0.994  1.00 10.00 ? 445 MET A SD   9  
ATOM 9814  C CE   . MET A 1 36 ? -9.635  11.230  -1.896  1.00 10.00 ? 445 MET A CE   9  
ATOM 9815  H H    . MET A 1 36 ? -5.361  7.528   1.146   1.00 10.00 ? 445 MET A H    9  
ATOM 9816  H HA   . MET A 1 36 ? -5.896  10.222  0.307   1.00 10.00 ? 445 MET A HA   9  
ATOM 9817  H HB2  . MET A 1 36 ? -7.332  8.235   -0.313  1.00 10.00 ? 445 MET A HB2  9  
ATOM 9818  H HB3  . MET A 1 36 ? -7.858  8.179   1.363   1.00 10.00 ? 445 MET A HB3  9  
ATOM 9819  H HG2  . MET A 1 36 ? -9.470  9.311   -0.085  1.00 10.00 ? 445 MET A HG2  9  
ATOM 9820  H HG3  . MET A 1 36 ? -8.839  10.373  1.172   1.00 10.00 ? 445 MET A HG3  9  
ATOM 9821  H HE1  . MET A 1 36 ? -10.123 10.272  -1.989  1.00 10.00 ? 445 MET A HE1  9  
ATOM 9822  H HE2  . MET A 1 36 ? -9.426  11.625  -2.878  1.00 10.00 ? 445 MET A HE2  9  
ATOM 9823  H HE3  . MET A 1 36 ? -10.279 11.913  -1.362  1.00 10.00 ? 445 MET A HE3  9  
ATOM 9824  N N    . GLN A 1 37 ? -5.925  9.282   3.399   1.00 10.00 ? 446 GLN A N    9  
ATOM 9825  C CA   . GLN A 1 37 ? -5.952  9.690   4.795   1.00 10.00 ? 446 GLN A CA   9  
ATOM 9826  C C    . GLN A 1 37 ? -4.801  10.640  5.087   1.00 10.00 ? 446 GLN A C    9  
ATOM 9827  O O    . GLN A 1 37 ? -4.990  11.723  5.642   1.00 10.00 ? 446 GLN A O    9  
ATOM 9828  C CB   . GLN A 1 37 ? -5.818  8.451   5.687   1.00 10.00 ? 446 GLN A CB   9  
ATOM 9829  C CG   . GLN A 1 37 ? -6.233  8.688   7.129   1.00 10.00 ? 446 GLN A CG   9  
ATOM 9830  C CD   . GLN A 1 37 ? -7.302  7.717   7.595   1.00 10.00 ? 446 GLN A CD   9  
ATOM 9831  O OE1  . GLN A 1 37 ? -8.240  8.098   8.295   1.00 10.00 ? 446 GLN A OE1  9  
ATOM 9832  N NE2  . GLN A 1 37 ? -7.164  6.454   7.206   1.00 10.00 ? 446 GLN A NE2  9  
ATOM 9833  H H    . GLN A 1 37 ? -5.590  8.389   3.183   1.00 10.00 ? 446 GLN A H    9  
ATOM 9834  H HA   . GLN A 1 37 ? -6.891  10.181  4.995   1.00 10.00 ? 446 GLN A HA   9  
ATOM 9835  H HB2  . GLN A 1 37 ? -6.433  7.663   5.281   1.00 10.00 ? 446 GLN A HB2  9  
ATOM 9836  H HB3  . GLN A 1 37 ? -4.778  8.126   5.678   1.00 10.00 ? 446 GLN A HB3  9  
ATOM 9837  H HG2  . GLN A 1 37 ? -5.367  8.576   7.763   1.00 10.00 ? 446 GLN A HG2  9  
ATOM 9838  H HG3  . GLN A 1 37 ? -6.616  9.693   7.221   1.00 10.00 ? 446 GLN A HG3  9  
ATOM 9839  H HE21 . GLN A 1 37 ? -6.391  6.223   6.649   1.00 10.00 ? 446 GLN A HE21 9  
ATOM 9840  H HE22 . GLN A 1 37 ? -7.842  5.805   7.490   1.00 10.00 ? 446 GLN A HE22 9  
ATOM 9841  N N    . HIS A 1 38 ? -3.607  10.206  4.710   1.00 10.00 ? 447 HIS A N    9  
ATOM 9842  C CA   . HIS A 1 38 ? -2.395  10.980  4.920   1.00 10.00 ? 447 HIS A CA   9  
ATOM 9843  C C    . HIS A 1 38 ? -2.018  11.744  3.653   1.00 10.00 ? 447 HIS A C    9  
ATOM 9844  O O    . HIS A 1 38 ? -2.051  11.189  2.556   1.00 10.00 ? 447 HIS A O    9  
ATOM 9845  C CB   . HIS A 1 38 ? -1.253  10.043  5.329   1.00 10.00 ? 447 HIS A CB   9  
ATOM 9846  C CG   . HIS A 1 38 ? -1.685  8.948   6.260   1.00 10.00 ? 447 HIS A CG   9  
ATOM 9847  N ND1  . HIS A 1 38 ? -1.816  9.133   7.620   1.00 10.00 ? 447 HIS A ND1  9  
ATOM 9848  C CD2  . HIS A 1 38 ? -2.024  7.651   6.026   1.00 10.00 ? 447 HIS A CD2  9  
ATOM 9849  C CE1  . HIS A 1 38 ? -2.215  8.006   8.181   1.00 10.00 ? 447 HIS A CE1  9  
ATOM 9850  N NE2  . HIS A 1 38 ? -2.350  7.094   7.237   1.00 10.00 ? 447 HIS A NE2  9  
ATOM 9851  H H    . HIS A 1 38 ? -3.538  9.330   4.280   1.00 10.00 ? 447 HIS A H    9  
ATOM 9852  H HA   . HIS A 1 38 ? -2.579  11.683  5.717   1.00 10.00 ? 447 HIS A HA   9  
ATOM 9853  H HB2  . HIS A 1 38 ? -0.839  9.584   4.445   1.00 10.00 ? 447 HIS A HB2  9  
ATOM 9854  H HB3  . HIS A 1 38 ? -0.485  10.618  5.824   1.00 10.00 ? 447 HIS A HB3  9  
ATOM 9855  H HD1  . HIS A 1 38 ? -1.643  9.967   8.103   1.00 10.00 ? 447 HIS A HD1  9  
ATOM 9856  H HD2  . HIS A 1 38 ? -2.033  7.146   5.065   1.00 10.00 ? 447 HIS A HD2  9  
ATOM 9857  H HE1  . HIS A 1 38 ? -2.386  7.851   9.234   1.00 10.00 ? 447 HIS A HE1  9  
ATOM 9858  H HE2  . HIS A 1 38 ? -2.712  6.193   7.370   1.00 10.00 ? 447 HIS A HE2  9  
ATOM 9859  N N    . PRO A 1 39 ? -1.647  13.031  3.781   1.00 10.00 ? 448 PRO A N    9  
ATOM 9860  C CA   . PRO A 1 39 ? -1.262  13.857  2.634   1.00 10.00 ? 448 PRO A CA   9  
ATOM 9861  C C    . PRO A 1 39 ? -0.224  13.161  1.761   1.00 10.00 ? 448 PRO A C    9  
ATOM 9862  O O    . PRO A 1 39 ? 0.334   12.137  2.151   1.00 10.00 ? 448 PRO A O    9  
ATOM 9863  C CB   . PRO A 1 39 ? -0.673  15.127  3.268   1.00 10.00 ? 448 PRO A CB   9  
ATOM 9864  C CG   . PRO A 1 39 ? -0.532  14.826  4.726   1.00 10.00 ? 448 PRO A CG   9  
ATOM 9865  C CD   . PRO A 1 39 ? -1.564  13.782  5.039   1.00 10.00 ? 448 PRO A CD   9  
ATOM 9866  H HA   . PRO A 1 39 ? -2.119  14.116  2.029   1.00 10.00 ? 448 PRO A HA   9  
ATOM 9867  H HB2  . PRO A 1 39 ? 0.285   15.344  2.818   1.00 10.00 ? 448 PRO A HB2  9  
ATOM 9868  H HB3  . PRO A 1 39 ? -1.345  15.956  3.104   1.00 10.00 ? 448 PRO A HB3  9  
ATOM 9869  H HG2  . PRO A 1 39 ? 0.458   14.444  4.927   1.00 10.00 ? 448 PRO A HG2  9  
ATOM 9870  H HG3  . PRO A 1 39 ? -0.714  15.718  5.304   1.00 10.00 ? 448 PRO A HG3  9  
ATOM 9871  H HD2  . PRO A 1 39 ? -1.232  13.149  5.849   1.00 10.00 ? 448 PRO A HD2  9  
ATOM 9872  H HD3  . PRO A 1 39 ? -2.511  14.243  5.277   1.00 10.00 ? 448 PRO A HD3  9  
ATOM 9873  N N    . LYS A 1 40 ? 0.030   13.718  0.579   1.00 10.00 ? 449 LYS A N    9  
ATOM 9874  C CA   . LYS A 1 40 ? 1.005   13.142  -0.347  1.00 10.00 ? 449 LYS A CA   9  
ATOM 9875  C C    . LYS A 1 40 ? 2.298   12.775  0.375   1.00 10.00 ? 449 LYS A C    9  
ATOM 9876  O O    . LYS A 1 40 ? 3.176   13.617  0.562   1.00 10.00 ? 449 LYS A O    9  
ATOM 9877  C CB   . LYS A 1 40 ? 1.302   14.125  -1.481  1.00 10.00 ? 449 LYS A CB   9  
ATOM 9878  C CG   . LYS A 1 40 ? 0.310   14.047  -2.631  1.00 10.00 ? 449 LYS A CG   9  
ATOM 9879  C CD   . LYS A 1 40 ? 0.972   14.372  -3.960  1.00 10.00 ? 449 LYS A CD   9  
ATOM 9880  C CE   . LYS A 1 40 ? 1.375   15.836  -4.039  1.00 10.00 ? 449 LYS A CE   9  
ATOM 9881  N NZ   . LYS A 1 40 ? 2.611   16.029  -4.846  1.00 10.00 ? 449 LYS A NZ   9  
ATOM 9882  H H    . LYS A 1 40 ? -0.449  14.534  0.324   1.00 10.00 ? 449 LYS A H    9  
ATOM 9883  H HA   . LYS A 1 40 ? 0.573   12.246  -0.765  1.00 10.00 ? 449 LYS A HA   9  
ATOM 9884  H HB2  . LYS A 1 40 ? 1.283   15.130  -1.086  1.00 10.00 ? 449 LYS A HB2  9  
ATOM 9885  H HB3  . LYS A 1 40 ? 2.288   13.920  -1.871  1.00 10.00 ? 449 LYS A HB3  9  
ATOM 9886  H HG2  . LYS A 1 40 ? -0.095  13.048  -2.676  1.00 10.00 ? 449 LYS A HG2  9  
ATOM 9887  H HG3  . LYS A 1 40 ? -0.488  14.754  -2.452  1.00 10.00 ? 449 LYS A HG3  9  
ATOM 9888  H HD2  . LYS A 1 40 ? 1.854   13.760  -4.071  1.00 10.00 ? 449 LYS A HD2  9  
ATOM 9889  H HD3  . LYS A 1 40 ? 0.278   14.155  -4.758  1.00 10.00 ? 449 LYS A HD3  9  
ATOM 9890  H HE2  . LYS A 1 40 ? 0.569   16.393  -4.492  1.00 10.00 ? 449 LYS A HE2  9  
ATOM 9891  H HE3  . LYS A 1 40 ? 1.547   16.202  -3.038  1.00 10.00 ? 449 LYS A HE3  9  
ATOM 9892  H HZ1  . LYS A 1 40 ? 2.681   15.289  -5.574  1.00 10.00 ? 449 LYS A HZ1  9  
ATOM 9893  H HZ2  . LYS A 1 40 ? 3.449   15.977  -4.233  1.00 10.00 ? 449 LYS A HZ2  9  
ATOM 9894  H HZ3  . LYS A 1 40 ? 2.592   16.959  -5.310  1.00 10.00 ? 449 LYS A HZ3  9  
ATOM 9895  N N    . ASN A 1 41 ? 2.404   11.515  0.788   1.00 10.00 ? 450 ASN A N    9  
ATOM 9896  C CA   . ASN A 1 41 ? 3.587   11.043  1.498   1.00 10.00 ? 450 ASN A CA   9  
ATOM 9897  C C    . ASN A 1 41 ? 4.154   9.780   0.862   1.00 10.00 ? 450 ASN A C    9  
ATOM 9898  O O    . ASN A 1 41 ? 5.314   9.747   0.452   1.00 10.00 ? 450 ASN A O    9  
ATOM 9899  C CB   . ASN A 1 41 ? 3.260   10.785  2.975   1.00 10.00 ? 450 ASN A CB   9  
ATOM 9900  C CG   . ASN A 1 41 ? 1.999   9.958   3.165   1.00 10.00 ? 450 ASN A CG   9  
ATOM 9901  O OD1  . ASN A 1 41 ? 1.175   9.845   2.258   1.00 10.00 ? 450 ASN A OD1  9  
ATOM 9902  N ND2  . ASN A 1 41 ? 1.845   9.368   4.346   1.00 10.00 ? 450 ASN A ND2  9  
ATOM 9903  H H    . ASN A 1 41 ? 1.668   10.891  0.616   1.00 10.00 ? 450 ASN A H    9  
ATOM 9904  H HA   . ASN A 1 41 ? 4.331   11.817  1.439   1.00 10.00 ? 450 ASN A HA   9  
ATOM 9905  H HB2  . ASN A 1 41 ? 4.084   10.257  3.430   1.00 10.00 ? 450 ASN A HB2  9  
ATOM 9906  H HB3  . ASN A 1 41 ? 3.126   11.733  3.476   1.00 10.00 ? 450 ASN A HB3  9  
ATOM 9907  H HD21 . ASN A 1 41 ? 2.544   9.492   5.024   1.00 10.00 ? 450 ASN A HD21 9  
ATOM 9908  H HD22 . ASN A 1 41 ? 1.037   8.834   4.493   1.00 10.00 ? 450 ASN A HD22 9  
ATOM 9909  N N    . PHE A 1 42 ? 3.336   8.735   0.798   1.00 10.00 ? 451 PHE A N    9  
ATOM 9910  C CA   . PHE A 1 42 ? 3.759   7.459   0.232   1.00 10.00 ? 451 PHE A CA   9  
ATOM 9911  C C    . PHE A 1 42 ? 4.789   6.775   1.131   1.00 10.00 ? 451 PHE A C    9  
ATOM 9912  O O    . PHE A 1 42 ? 5.292   5.700   0.806   1.00 10.00 ? 451 PHE A O    9  
ATOM 9913  C CB   . PHE A 1 42 ? 4.318   7.656   -1.183  1.00 10.00 ? 451 PHE A CB   9  
ATOM 9914  C CG   . PHE A 1 42 ? 3.699   6.747   -2.211  1.00 10.00 ? 451 PHE A CG   9  
ATOM 9915  C CD1  . PHE A 1 42 ? 2.360   6.403   -2.131  1.00 10.00 ? 451 PHE A CD1  9  
ATOM 9916  C CD2  . PHE A 1 42 ? 4.453   6.242   -3.258  1.00 10.00 ? 451 PHE A CD2  9  
ATOM 9917  C CE1  . PHE A 1 42 ? 1.783   5.574   -3.070  1.00 10.00 ? 451 PHE A CE1  9  
ATOM 9918  C CE2  . PHE A 1 42 ? 3.882   5.409   -4.202  1.00 10.00 ? 451 PHE A CE2  9  
ATOM 9919  C CZ   . PHE A 1 42 ? 2.544   5.075   -4.108  1.00 10.00 ? 451 PHE A CZ   9  
ATOM 9920  H H    . PHE A 1 42 ? 2.428   8.820   1.151   1.00 10.00 ? 451 PHE A H    9  
ATOM 9921  H HA   . PHE A 1 42 ? 2.887   6.828   0.178   1.00 10.00 ? 451 PHE A HA   9  
ATOM 9922  H HB2  . PHE A 1 42 ? 4.134   8.673   -1.493  1.00 10.00 ? 451 PHE A HB2  9  
ATOM 9923  H HB3  . PHE A 1 42 ? 5.381   7.474   -1.172  1.00 10.00 ? 451 PHE A HB3  9  
ATOM 9924  H HD1  . PHE A 1 42 ? 1.767   6.791   -1.322  1.00 10.00 ? 451 PHE A HD1  9  
ATOM 9925  H HD2  . PHE A 1 42 ? 5.498   6.503   -3.333  1.00 10.00 ? 451 PHE A HD2  9  
ATOM 9926  H HE1  . PHE A 1 42 ? 0.736   5.318   -2.990  1.00 10.00 ? 451 PHE A HE1  9  
ATOM 9927  H HE2  . PHE A 1 42 ? 4.480   5.020   -5.012  1.00 10.00 ? 451 PHE A HE2  9  
ATOM 9928  H HZ   . PHE A 1 42 ? 2.096   4.424   -4.844  1.00 10.00 ? 451 PHE A HZ   9  
ATOM 9929  N N    . GLY A 1 43 ? 5.076   7.392   2.277   1.00 10.00 ? 452 GLY A N    9  
ATOM 9930  C CA   . GLY A 1 43 ? 6.015   6.821   3.219   1.00 10.00 ? 452 GLY A CA   9  
ATOM 9931  C C    . GLY A 1 43 ? 5.294   6.030   4.286   1.00 10.00 ? 452 GLY A C    9  
ATOM 9932  O O    . GLY A 1 43 ? 5.760   4.973   4.713   1.00 10.00 ? 452 GLY A O    9  
ATOM 9933  H H    . GLY A 1 43 ? 4.631   8.232   2.495   1.00 10.00 ? 452 GLY A H    9  
ATOM 9934  H HA2  . GLY A 1 43 ? 6.695   6.169   2.691   1.00 10.00 ? 452 GLY A HA2  9  
ATOM 9935  H HA3  . GLY A 1 43 ? 6.576   7.616   3.687   1.00 10.00 ? 452 GLY A HA3  9  
ATOM 9936  N N    . LEU A 1 44 ? 4.134   6.537   4.700   1.00 10.00 ? 453 LEU A N    9  
ATOM 9937  C CA   . LEU A 1 44 ? 3.324   5.864   5.703   1.00 10.00 ? 453 LEU A CA   9  
ATOM 9938  C C    . LEU A 1 44 ? 2.692   4.624   5.101   1.00 10.00 ? 453 LEU A C    9  
ATOM 9939  O O    . LEU A 1 44 ? 2.842   3.518   5.618   1.00 10.00 ? 453 LEU A O    9  
ATOM 9940  C CB   . LEU A 1 44 ? 2.226   6.791   6.234   1.00 10.00 ? 453 LEU A CB   9  
ATOM 9941  C CG   . LEU A 1 44 ? 1.152   6.099   7.077   1.00 10.00 ? 453 LEU A CG   9  
ATOM 9942  C CD1  . LEU A 1 44 ? 0.569   7.066   8.092   1.00 10.00 ? 453 LEU A CD1  9  
ATOM 9943  C CD2  . LEU A 1 44 ? 0.054   5.521   6.187   1.00 10.00 ? 453 LEU A CD2  9  
ATOM 9944  H H    . LEU A 1 44 ? 3.810   7.373   4.306   1.00 10.00 ? 453 LEU A H    9  
ATOM 9945  H HA   . LEU A 1 44 ? 3.967   5.572   6.515   1.00 10.00 ? 453 LEU A HA   9  
ATOM 9946  H HB2  . LEU A 1 44 ? 2.690   7.558   6.838   1.00 10.00 ? 453 LEU A HB2  9  
ATOM 9947  H HB3  . LEU A 1 44 ? 1.743   7.261   5.393   1.00 10.00 ? 453 LEU A HB3  9  
ATOM 9948  H HG   . LEU A 1 44 ? 1.605   5.285   7.621   1.00 10.00 ? 453 LEU A HG   9  
ATOM 9949  H HD11 . LEU A 1 44 ? -0.238  6.584   8.625   1.00 10.00 ? 453 LEU A HD11 9  
ATOM 9950  H HD12 . LEU A 1 44 ? 0.193   7.940   7.581   1.00 10.00 ? 453 LEU A HD12 9  
ATOM 9951  H HD13 . LEU A 1 44 ? 1.338   7.360   8.792   1.00 10.00 ? 453 LEU A HD13 9  
ATOM 9952  H HD21 . LEU A 1 44 ? 0.358   4.550   5.821   1.00 10.00 ? 453 LEU A HD21 9  
ATOM 9953  H HD22 . LEU A 1 44 ? -0.118  6.181   5.350   1.00 10.00 ? 453 LEU A HD22 9  
ATOM 9954  H HD23 . LEU A 1 44 ? -0.857  5.418   6.757   1.00 10.00 ? 453 LEU A HD23 9  
ATOM 9955  N N    . ILE A 1 45 ? 1.984   4.820   3.997   1.00 10.00 ? 454 ILE A N    9  
ATOM 9956  C CA   . ILE A 1 45 ? 1.330   3.723   3.313   1.00 10.00 ? 454 ILE A CA   9  
ATOM 9957  C C    . ILE A 1 45 ? 2.345   2.672   2.916   1.00 10.00 ? 454 ILE A C    9  
ATOM 9958  O O    . ILE A 1 45 ? 2.072   1.480   2.983   1.00 10.00 ? 454 ILE A O    9  
ATOM 9959  C CB   . ILE A 1 45 ? 0.550   4.231   2.093   1.00 10.00 ? 454 ILE A CB   9  
ATOM 9960  C CG1  . ILE A 1 45 ? -0.762  4.803   2.579   1.00 10.00 ? 454 ILE A CG1  9  
ATOM 9961  C CG2  . ILE A 1 45 ? 0.321   3.129   1.065   1.00 10.00 ? 454 ILE A CG2  9  
ATOM 9962  C CD1  . ILE A 1 45 ? -0.704  6.301   2.756   1.00 10.00 ? 454 ILE A CD1  9  
ATOM 9963  H H    . ILE A 1 45 ? 1.904   5.727   3.631   1.00 10.00 ? 454 ILE A H    9  
ATOM 9964  H HA   . ILE A 1 45 ? 0.627   3.284   4.001   1.00 10.00 ? 454 ILE A HA   9  
ATOM 9965  H HB   . ILE A 1 45 ? 1.118   5.025   1.633   1.00 10.00 ? 454 ILE A HB   9  
ATOM 9966  H HG12 . ILE A 1 45 ? -1.543  4.568   1.870   1.00 10.00 ? 454 ILE A HG12 9  
ATOM 9967  H HG13 . ILE A 1 45 ? -0.997  4.359   3.539   1.00 10.00 ? 454 ILE A HG13 9  
ATOM 9968  H HG21 . ILE A 1 45 ? 1.209   3.008   0.462   1.00 10.00 ? 454 ILE A HG21 9  
ATOM 9969  H HG22 . ILE A 1 45 ? -0.511  3.398   0.430   1.00 10.00 ? 454 ILE A HG22 9  
ATOM 9970  H HG23 . ILE A 1 45 ? 0.102   2.202   1.573   1.00 10.00 ? 454 ILE A HG23 9  
ATOM 9971  H HD11 . ILE A 1 45 ? 0.179   6.562   3.319   1.00 10.00 ? 454 ILE A HD11 9  
ATOM 9972  H HD12 . ILE A 1 45 ? -1.576  6.638   3.285   1.00 10.00 ? 454 ILE A HD12 9  
ATOM 9973  H HD13 . ILE A 1 45 ? -0.661  6.774   1.786   1.00 10.00 ? 454 ILE A HD13 9  
ATOM 9974  N N    . ALA A 1 46 ? 3.532   3.127   2.551   1.00 10.00 ? 455 ALA A N    9  
ATOM 9975  C CA   . ALA A 1 46 ? 4.609   2.223   2.199   1.00 10.00 ? 455 ALA A CA   9  
ATOM 9976  C C    . ALA A 1 46 ? 5.362   1.807   3.460   1.00 10.00 ? 455 ALA A C    9  
ATOM 9977  O O    . ALA A 1 46 ? 6.456   1.250   3.388   1.00 10.00 ? 455 ALA A O    9  
ATOM 9978  C CB   . ALA A 1 46 ? 5.553   2.883   1.209   1.00 10.00 ? 455 ALA A CB   9  
ATOM 9979  H H    . ALA A 1 46 ? 3.696   4.091   2.553   1.00 10.00 ? 455 ALA A H    9  
ATOM 9980  H HA   . ALA A 1 46 ? 4.180   1.348   1.734   1.00 10.00 ? 455 ALA A HA   9  
ATOM 9981  H HB1  . ALA A 1 46 ? 6.101   3.670   1.707   1.00 10.00 ? 455 ALA A HB1  9  
ATOM 9982  H HB2  . ALA A 1 46 ? 4.983   3.302   0.393   1.00 10.00 ? 455 ALA A HB2  9  
ATOM 9983  H HB3  . ALA A 1 46 ? 6.245   2.149   0.826   1.00 10.00 ? 455 ALA A HB3  9  
ATOM 9984  N N    . SER A 1 47 ? 4.763   2.094   4.620   1.00 10.00 ? 456 SER A N    9  
ATOM 9985  C CA   . SER A 1 47 ? 5.372   1.763   5.899   1.00 10.00 ? 456 SER A CA   9  
ATOM 9986  C C    . SER A 1 47 ? 4.514   0.779   6.688   1.00 10.00 ? 456 SER A C    9  
ATOM 9987  O O    . SER A 1 47 ? 5.043   -0.068  7.407   1.00 10.00 ? 456 SER A O    9  
ATOM 9988  C CB   . SER A 1 47 ? 5.599   3.033   6.723   1.00 10.00 ? 456 SER A CB   9  
ATOM 9989  O OG   . SER A 1 47 ? 6.915   3.526   6.547   1.00 10.00 ? 456 SER A OG   9  
ATOM 9990  H H    . SER A 1 47 ? 3.892   2.545   4.614   1.00 10.00 ? 456 SER A H    9  
ATOM 9991  H HA   . SER A 1 47 ? 6.328   1.303   5.700   1.00 10.00 ? 456 SER A HA   9  
ATOM 9992  H HB2  . SER A 1 47 ? 4.900   3.793   6.410   1.00 10.00 ? 456 SER A HB2  9  
ATOM 9993  H HB3  . SER A 1 47 ? 5.447   2.813   7.770   1.00 10.00 ? 456 SER A HB3  9  
ATOM 9994  H HG   . SER A 1 47 ? 7.141   3.512   5.614   1.00 10.00 ? 456 SER A HG   9  
ATOM 9995  N N    . PHE A 1 48 ? 3.188   0.879   6.557   1.00 10.00 ? 457 PHE A N    9  
ATOM 9996  C CA   . PHE A 1 48 ? 2.306   -0.036  7.278   1.00 10.00 ? 457 PHE A CA   9  
ATOM 9997  C C    . PHE A 1 48 ? 2.282   -1.401  6.591   1.00 10.00 ? 457 PHE A C    9  
ATOM 9998  O O    . PHE A 1 48 ? 2.004   -2.422  7.222   1.00 10.00 ? 457 PHE A O    9  
ATOM 9999  C CB   . PHE A 1 48 ? 0.893   0.550   7.422   1.00 10.00 ? 457 PHE A CB   9  
ATOM 10000 C CG   . PHE A 1 48 ? 0.049   0.469   6.183   1.00 10.00 ? 457 PHE A CG   9  
ATOM 10001 C CD1  . PHE A 1 48 ? -0.431  -0.752  5.733   1.00 10.00 ? 457 PHE A CD1  9  
ATOM 10002 C CD2  . PHE A 1 48 ? -0.271  1.616   5.473   1.00 10.00 ? 457 PHE A CD2  9  
ATOM 10003 C CE1  . PHE A 1 48 ? -1.209  -0.827  4.596   1.00 10.00 ? 457 PHE A CE1  9  
ATOM 10004 C CE2  . PHE A 1 48 ? -1.050  1.546   4.337   1.00 10.00 ? 457 PHE A CE2  9  
ATOM 10005 C CZ   . PHE A 1 48 ? -1.518  0.327   3.897   1.00 10.00 ? 457 PHE A CZ   9  
ATOM 10006 H H    . PHE A 1 48 ? 2.801   1.568   5.963   1.00 10.00 ? 457 PHE A H    9  
ATOM 10007 H HA   . PHE A 1 48 ? 2.726   -0.166  8.266   1.00 10.00 ? 457 PHE A HA   9  
ATOM 10008 H HB2  . PHE A 1 48 ? 0.374   0.019   8.205   1.00 10.00 ? 457 PHE A HB2  9  
ATOM 10009 H HB3  . PHE A 1 48 ? 0.974   1.591   7.701   1.00 10.00 ? 457 PHE A HB3  9  
ATOM 10010 H HD1  . PHE A 1 48 ? -0.195  -1.652  6.283   1.00 10.00 ? 457 PHE A HD1  9  
ATOM 10011 H HD2  . PHE A 1 48 ? 0.096   2.577   5.811   1.00 10.00 ? 457 PHE A HD2  9  
ATOM 10012 H HE1  . PHE A 1 48 ? -1.571  -1.786  4.249   1.00 10.00 ? 457 PHE A HE1  9  
ATOM 10013 H HE2  . PHE A 1 48 ? -1.294  2.445   3.792   1.00 10.00 ? 457 PHE A HE2  9  
ATOM 10014 H HZ   . PHE A 1 48 ? -2.128  0.277   3.013   1.00 10.00 ? 457 PHE A HZ   9  
ATOM 10015 N N    . LEU A 1 49 ? 2.611   -1.411  5.302   1.00 10.00 ? 458 LEU A N    9  
ATOM 10016 C CA   . LEU A 1 49 ? 2.667   -2.645  4.524   1.00 10.00 ? 458 LEU A CA   9  
ATOM 10017 C C    . LEU A 1 49 ? 4.111   -2.893  4.090   1.00 10.00 ? 458 LEU A C    9  
ATOM 10018 O O    . LEU A 1 49 ? 4.385   -3.213  2.935   1.00 10.00 ? 458 LEU A O    9  
ATOM 10019 C CB   . LEU A 1 49 ? 1.738   -2.561  3.309   1.00 10.00 ? 458 LEU A CB   9  
ATOM 10020 C CG   . LEU A 1 49 ? 1.640   -1.179  2.670   1.00 10.00 ? 458 LEU A CG   9  
ATOM 10021 C CD1  . LEU A 1 49 ? 2.981   -0.793  2.068   1.00 10.00 ? 458 LEU A CD1  9  
ATOM 10022 C CD2  . LEU A 1 49 ? 0.535   -1.139  1.616   1.00 10.00 ? 458 LEU A CD2  9  
ATOM 10023 H H    . LEU A 1 49 ? 2.845   -0.567  4.865   1.00 10.00 ? 458 LEU A H    9  
ATOM 10024 H HA   . LEU A 1 49 ? 2.352   -3.456  5.160   1.00 10.00 ? 458 LEU A HA   9  
ATOM 10025 H HB2  . LEU A 1 49 ? 2.091   -3.258  2.562   1.00 10.00 ? 458 LEU A HB2  9  
ATOM 10026 H HB3  . LEU A 1 49 ? 0.749   -2.860  3.618   1.00 10.00 ? 458 LEU A HB3  9  
ATOM 10027 H HG   . LEU A 1 49 ? 1.398   -0.458  3.437   1.00 10.00 ? 458 LEU A HG   9  
ATOM 10028 H HD11 . LEU A 1 49 ? 2.833   -0.031  1.317   1.00 10.00 ? 458 LEU A HD11 9  
ATOM 10029 H HD12 . LEU A 1 49 ? 3.436   -1.660  1.617   1.00 10.00 ? 458 LEU A HD12 9  
ATOM 10030 H HD13 . LEU A 1 49 ? 3.627   -0.412  2.846   1.00 10.00 ? 458 LEU A HD13 9  
ATOM 10031 H HD21 . LEU A 1 49 ? 0.128   -2.129  1.482   1.00 10.00 ? 458 LEU A HD21 9  
ATOM 10032 H HD22 . LEU A 1 49 ? 0.940   -0.787  0.680   1.00 10.00 ? 458 LEU A HD22 9  
ATOM 10033 H HD23 . LEU A 1 49 ? -0.253  -0.469  1.939   1.00 10.00 ? 458 LEU A HD23 9  
ATOM 10034 N N    . GLU A 1 50 ? 5.015   -2.709  5.055   1.00 10.00 ? 459 GLU A N    9  
ATOM 10035 C CA   . GLU A 1 50 ? 6.468   -2.868  4.875   1.00 10.00 ? 459 GLU A CA   9  
ATOM 10036 C C    . GLU A 1 50 ? 6.839   -3.795  3.721   1.00 10.00 ? 459 GLU A C    9  
ATOM 10037 O O    . GLU A 1 50 ? 7.754   -3.497  2.956   1.00 10.00 ? 459 GLU A O    9  
ATOM 10038 C CB   . GLU A 1 50 ? 7.095   -3.389  6.169   1.00 10.00 ? 459 GLU A CB   9  
ATOM 10039 C CG   . GLU A 1 50 ? 6.750   -2.554  7.391   1.00 10.00 ? 459 GLU A CG   9  
ATOM 10040 C CD   . GLU A 1 50 ? 7.630   -2.876  8.583   1.00 10.00 ? 459 GLU A CD   9  
ATOM 10041 O OE1  . GLU A 1 50 ? 8.107   -4.027  8.677   1.00 10.00 ? 459 GLU A OE1  9  
ATOM 10042 O OE2  . GLU A 1 50 ? 7.844   -1.976  9.423   1.00 10.00 ? 459 GLU A OE2  9  
ATOM 10043 H H    . GLU A 1 50 ? 4.691   -2.436  5.931   1.00 10.00 ? 459 GLU A H    9  
ATOM 10044 H HA   . GLU A 1 50 ? 6.876   -1.890  4.670   1.00 10.00 ? 459 GLU A HA   9  
ATOM 10045 H HB2  . GLU A 1 50 ? 6.753   -4.398  6.341   1.00 10.00 ? 459 GLU A HB2  9  
ATOM 10046 H HB3  . GLU A 1 50 ? 8.169   -3.397  6.056   1.00 10.00 ? 459 GLU A HB3  9  
ATOM 10047 H HG2  . GLU A 1 50 ? 6.873   -1.510  7.145   1.00 10.00 ? 459 GLU A HG2  9  
ATOM 10048 H HG3  . GLU A 1 50 ? 5.722   -2.741  7.661   1.00 10.00 ? 459 GLU A HG3  9  
ATOM 10049 N N    . ARG A 1 51 ? 6.133   -4.915  3.597   1.00 10.00 ? 460 ARG A N    9  
ATOM 10050 C CA   . ARG A 1 51 ? 6.402   -5.872  2.526   1.00 10.00 ? 460 ARG A CA   9  
ATOM 10051 C C    . ARG A 1 51 ? 6.598   -5.150  1.196   1.00 10.00 ? 460 ARG A C    9  
ATOM 10052 O O    . ARG A 1 51 ? 7.320   -5.622  0.317   1.00 10.00 ? 460 ARG A O    9  
ATOM 10053 C CB   . ARG A 1 51 ? 5.255   -6.880  2.412   1.00 10.00 ? 460 ARG A CB   9  
ATOM 10054 C CG   . ARG A 1 51 ? 5.554   -8.219  3.068   1.00 10.00 ? 460 ARG A CG   9  
ATOM 10055 C CD   . ARG A 1 51 ? 5.886   -8.057  4.542   1.00 10.00 ? 460 ARG A CD   9  
ATOM 10056 N NE   . ARG A 1 51 ? 6.963   -8.950  4.962   1.00 10.00 ? 460 ARG A NE   9  
ATOM 10057 C CZ   . ARG A 1 51 ? 6.860   -10.277 4.984   1.00 10.00 ? 460 ARG A CZ   9  
ATOM 10058 N NH1  . ARG A 1 51 ? 5.730   -10.867 4.613   1.00 10.00 ? 460 ARG A NH1  9  
ATOM 10059 N NH2  . ARG A 1 51 ? 7.888   -11.014 5.379   1.00 10.00 ? 460 ARG A NH2  9  
ATOM 10060 H H    . ARG A 1 51 ? 5.417   -5.101  4.235   1.00 10.00 ? 460 ARG A H    9  
ATOM 10061 H HA   . ARG A 1 51 ? 7.311   -6.400  2.774   1.00 10.00 ? 460 ARG A HA   9  
ATOM 10062 H HB2  . ARG A 1 51 ? 4.376   -6.462  2.881   1.00 10.00 ? 460 ARG A HB2  9  
ATOM 10063 H HB3  . ARG A 1 51 ? 5.045   -7.054  1.367   1.00 10.00 ? 460 ARG A HB3  9  
ATOM 10064 H HG2  . ARG A 1 51 ? 4.687   -8.856  2.972   1.00 10.00 ? 460 ARG A HG2  9  
ATOM 10065 H HG3  . ARG A 1 51 ? 6.395   -8.674  2.566   1.00 10.00 ? 460 ARG A HG3  9  
ATOM 10066 H HD2  . ARG A 1 51 ? 6.188   -7.035  4.720   1.00 10.00 ? 460 ARG A HD2  9  
ATOM 10067 H HD3  . ARG A 1 51 ? 5.002   -8.276  5.123   1.00 10.00 ? 460 ARG A HD3  9  
ATOM 10068 H HE   . ARG A 1 51 ? 7.808   -8.540  5.241   1.00 10.00 ? 460 ARG A HE   9  
ATOM 10069 H HH11 . ARG A 1 51 ? 4.951   -10.316 4.315   1.00 10.00 ? 460 ARG A HH11 9  
ATOM 10070 H HH12 . ARG A 1 51 ? 5.659   -11.864 4.632   1.00 10.00 ? 460 ARG A HH12 9  
ATOM 10071 H HH21 . ARG A 1 51 ? 8.741   -10.574 5.659   1.00 10.00 ? 460 ARG A HH21 9  
ATOM 10072 H HH22 . ARG A 1 51 ? 7.811   -12.012 5.396   1.00 10.00 ? 460 ARG A HH22 9  
ATOM 10073 N N    . LYS A 1 52 ? 5.952   -3.995  1.065   1.00 10.00 ? 461 LYS A N    9  
ATOM 10074 C CA   . LYS A 1 52 ? 6.048   -3.187  -0.143  1.00 10.00 ? 461 LYS A CA   9  
ATOM 10075 C C    . LYS A 1 52 ? 7.091   -2.084  0.034   1.00 10.00 ? 461 LYS A C    9  
ATOM 10076 O O    . LYS A 1 52 ? 7.939   -2.158  0.923   1.00 10.00 ? 461 LYS A O    9  
ATOM 10077 C CB   . LYS A 1 52 ? 4.685   -2.570  -0.483  1.00 10.00 ? 461 LYS A CB   9  
ATOM 10078 C CG   . LYS A 1 52 ? 3.493   -3.422  -0.067  1.00 10.00 ? 461 LYS A CG   9  
ATOM 10079 C CD   . LYS A 1 52 ? 3.121   -4.425  -1.150  1.00 10.00 ? 461 LYS A CD   9  
ATOM 10080 C CE   . LYS A 1 52 ? 4.234   -5.434  -1.388  1.00 10.00 ? 461 LYS A CE   9  
ATOM 10081 N NZ   . LYS A 1 52 ? 3.737   -6.835  -1.333  1.00 10.00 ? 461 LYS A NZ   9  
ATOM 10082 H H    . LYS A 1 52 ? 5.396   -3.675  1.808   1.00 10.00 ? 461 LYS A H    9  
ATOM 10083 H HA   . LYS A 1 52 ? 6.355   -3.832  -0.953  1.00 10.00 ? 461 LYS A HA   9  
ATOM 10084 H HB2  . LYS A 1 52 ? 4.604   -1.614  0.013   1.00 10.00 ? 461 LYS A HB2  9  
ATOM 10085 H HB3  . LYS A 1 52 ? 4.632   -2.414  -1.551  1.00 10.00 ? 461 LYS A HB3  9  
ATOM 10086 H HG2  . LYS A 1 52 ? 3.737   -3.956  0.841   1.00 10.00 ? 461 LYS A HG2  9  
ATOM 10087 H HG3  . LYS A 1 52 ? 2.648   -2.773  0.115   1.00 10.00 ? 461 LYS A HG3  9  
ATOM 10088 H HD2  . LYS A 1 52 ? 2.230   -4.953  -0.848  1.00 10.00 ? 461 LYS A HD2  9  
ATOM 10089 H HD3  . LYS A 1 52 ? 2.930   -3.891  -2.069  1.00 10.00 ? 461 LYS A HD3  9  
ATOM 10090 H HE2  . LYS A 1 52 ? 4.665   -5.253  -2.361  1.00 10.00 ? 461 LYS A HE2  9  
ATOM 10091 H HE3  . LYS A 1 52 ? 4.991   -5.303  -0.632  1.00 10.00 ? 461 LYS A HE3  9  
ATOM 10092 H HZ1  . LYS A 1 52 ? 3.642   -7.142  -0.343  1.00 10.00 ? 461 LYS A HZ1  9  
ATOM 10093 H HZ2  . LYS A 1 52 ? 4.401   -7.470  -1.817  1.00 10.00 ? 461 LYS A HZ2  9  
ATOM 10094 H HZ3  . LYS A 1 52 ? 2.809   -6.903  -1.796  1.00 10.00 ? 461 LYS A HZ3  9  
ATOM 10095 N N    . THR A 1 53 ? 7.023   -1.062  -0.811  1.00 10.00 ? 462 THR A N    9  
ATOM 10096 C CA   . THR A 1 53 ? 7.961   0.052   -0.737  1.00 10.00 ? 462 THR A CA   9  
ATOM 10097 C C    . THR A 1 53 ? 7.321   1.327   -1.275  1.00 10.00 ? 462 THR A C    9  
ATOM 10098 O O    . THR A 1 53 ? 6.290   1.277   -1.946  1.00 10.00 ? 462 THR A O    9  
ATOM 10099 C CB   . THR A 1 53 ? 9.238   -0.267  -1.520  1.00 10.00 ? 462 THR A CB   9  
ATOM 10100 O OG1  . THR A 1 53 ? 9.172   -1.564  -2.086  1.00 10.00 ? 462 THR A OG1  9  
ATOM 10101 C CG2  . THR A 1 53 ? 10.490  -0.201  -0.672  1.00 10.00 ? 462 THR A CG2  9  
ATOM 10102 H H    . THR A 1 53 ? 6.326   -1.054  -1.499  1.00 10.00 ? 462 THR A H    9  
ATOM 10103 H HA   . THR A 1 53 ? 8.213   0.204   0.302   1.00 10.00 ? 462 THR A HA   9  
ATOM 10104 H HB   . THR A 1 53 ? 9.346   0.448   -2.323  1.00 10.00 ? 462 THR A HB   9  
ATOM 10105 H HG1  . THR A 1 53 ? 9.974   -1.736  -2.586  1.00 10.00 ? 462 THR A HG1  9  
ATOM 10106 H HG21 . THR A 1 53 ? 11.345  -0.011  -1.304  1.00 10.00 ? 462 THR A HG21 9  
ATOM 10107 H HG22 . THR A 1 53 ? 10.625  -1.140  -0.156  1.00 10.00 ? 462 THR A HG22 9  
ATOM 10108 H HG23 . THR A 1 53 ? 10.394  0.596   0.050   1.00 10.00 ? 462 THR A HG23 9  
ATOM 10109 N N    . VAL A 1 54 ? 7.936   2.467   -0.983  1.00 10.00 ? 463 VAL A N    9  
ATOM 10110 C CA   . VAL A 1 54 ? 7.417   3.747   -1.446  1.00 10.00 ? 463 VAL A CA   9  
ATOM 10111 C C    . VAL A 1 54 ? 7.458   3.822   -2.967  1.00 10.00 ? 463 VAL A C    9  
ATOM 10112 O O    . VAL A 1 54 ? 6.453   4.127   -3.610  1.00 10.00 ? 463 VAL A O    9  
ATOM 10113 C CB   . VAL A 1 54 ? 8.209   4.930   -0.852  1.00 10.00 ? 463 VAL A CB   9  
ATOM 10114 C CG1  . VAL A 1 54 ? 7.540   6.251   -1.198  1.00 10.00 ? 463 VAL A CG1  9  
ATOM 10115 C CG2  . VAL A 1 54 ? 8.349   4.777   0.656   1.00 10.00 ? 463 VAL A CG2  9  
ATOM 10116 H H    . VAL A 1 54 ? 8.755   2.446   -0.446  1.00 10.00 ? 463 VAL A H    9  
ATOM 10117 H HA   . VAL A 1 54 ? 6.390   3.825   -1.123  1.00 10.00 ? 463 VAL A HA   9  
ATOM 10118 H HB   . VAL A 1 54 ? 9.198   4.928   -1.285  1.00 10.00 ? 463 VAL A HB   9  
ATOM 10119 H HG11 . VAL A 1 54 ? 6.872   6.108   -2.033  1.00 10.00 ? 463 VAL A HG11 9  
ATOM 10120 H HG12 . VAL A 1 54 ? 8.295   6.978   -1.461  1.00 10.00 ? 463 VAL A HG12 9  
ATOM 10121 H HG13 . VAL A 1 54 ? 6.980   6.607   -0.345  1.00 10.00 ? 463 VAL A HG13 9  
ATOM 10122 H HG21 . VAL A 1 54 ? 9.359   5.019   0.950   1.00 10.00 ? 463 VAL A HG21 9  
ATOM 10123 H HG22 . VAL A 1 54 ? 8.127   3.758   0.938   1.00 10.00 ? 463 VAL A HG22 9  
ATOM 10124 H HG23 . VAL A 1 54 ? 7.660   5.446   1.151   1.00 10.00 ? 463 VAL A HG23 9  
ATOM 10125 N N    . ALA A 1 55 ? 8.619   3.525   -3.538  1.00 10.00 ? 464 ALA A N    9  
ATOM 10126 C CA   . ALA A 1 55 ? 8.782   3.540   -4.984  1.00 10.00 ? 464 ALA A CA   9  
ATOM 10127 C C    . ALA A 1 55 ? 8.111   2.321   -5.607  1.00 10.00 ? 464 ALA A C    9  
ATOM 10128 O O    . ALA A 1 55 ? 7.714   2.343   -6.772  1.00 10.00 ? 464 ALA A O    9  
ATOM 10129 C CB   . ALA A 1 55 ? 10.257  3.585   -5.353  1.00 10.00 ? 464 ALA A CB   9  
ATOM 10130 H H    . ALA A 1 55 ? 9.380   3.276   -2.973  1.00 10.00 ? 464 ALA A H    9  
ATOM 10131 H HA   . ALA A 1 55 ? 8.308   4.434   -5.367  1.00 10.00 ? 464 ALA A HA   9  
ATOM 10132 H HB1  . ALA A 1 55 ? 10.785  2.809   -4.818  1.00 10.00 ? 464 ALA A HB1  9  
ATOM 10133 H HB2  . ALA A 1 55 ? 10.665  4.548   -5.087  1.00 10.00 ? 464 ALA A HB2  9  
ATOM 10134 H HB3  . ALA A 1 55 ? 10.367  3.429   -6.416  1.00 10.00 ? 464 ALA A HB3  9  
ATOM 10135 N N    . GLU A 1 56 ? 7.982   1.258   -4.817  1.00 10.00 ? 465 GLU A N    9  
ATOM 10136 C CA   . GLU A 1 56 ? 7.353   0.030   -5.280  1.00 10.00 ? 465 GLU A CA   9  
ATOM 10137 C C    . GLU A 1 56 ? 5.833   0.151   -5.232  1.00 10.00 ? 465 GLU A C    9  
ATOM 10138 O O    . GLU A 1 56 ? 5.128   -0.470  -6.026  1.00 10.00 ? 465 GLU A O    9  
ATOM 10139 C CB   . GLU A 1 56 ? 7.810   -1.157  -4.429  1.00 10.00 ? 465 GLU A CB   9  
ATOM 10140 C CG   . GLU A 1 56 ? 7.385   -2.505  -4.987  1.00 10.00 ? 465 GLU A CG   9  
ATOM 10141 C CD   . GLU A 1 56 ? 7.535   -3.627  -3.978  1.00 10.00 ? 465 GLU A CD   9  
ATOM 10142 O OE1  . GLU A 1 56 ? 8.621   -3.738  -3.371  1.00 10.00 ? 465 GLU A OE1  9  
ATOM 10143 O OE2  . GLU A 1 56 ? 6.568   -4.395  -3.794  1.00 10.00 ? 465 GLU A OE2  9  
ATOM 10144 H H    . GLU A 1 56 ? 8.313   1.304   -3.895  1.00 10.00 ? 465 GLU A H    9  
ATOM 10145 H HA   . GLU A 1 56 ? 7.658   -0.133  -6.303  1.00 10.00 ? 465 GLU A HA   9  
ATOM 10146 H HB2  . GLU A 1 56 ? 8.888   -1.143  -4.362  1.00 10.00 ? 465 GLU A HB2  9  
ATOM 10147 H HB3  . GLU A 1 56 ? 7.395   -1.055  -3.438  1.00 10.00 ? 465 GLU A HB3  9  
ATOM 10148 H HG2  . GLU A 1 56 ? 6.348   -2.447  -5.284  1.00 10.00 ? 465 GLU A HG2  9  
ATOM 10149 H HG3  . GLU A 1 56 ? 7.994   -2.732  -5.850  1.00 10.00 ? 465 GLU A HG3  9  
ATOM 10150 N N    . CYS A 1 57 ? 5.335   0.959   -4.300  1.00 10.00 ? 466 CYS A N    9  
ATOM 10151 C CA   . CYS A 1 57 ? 3.898   1.161   -4.162  1.00 10.00 ? 466 CYS A CA   9  
ATOM 10152 C C    . CYS A 1 57 ? 3.333   1.823   -5.413  1.00 10.00 ? 466 CYS A C    9  
ATOM 10153 O O    . CYS A 1 57 ? 2.152   1.672   -5.725  1.00 10.00 ? 466 CYS A O    9  
ATOM 10154 C CB   . CYS A 1 57 ? 3.587   2.005   -2.922  1.00 10.00 ? 466 CYS A CB   9  
ATOM 10155 S SG   . CYS A 1 57 ? 2.865   1.067   -1.555  1.00 10.00 ? 466 CYS A SG   9  
ATOM 10156 H H    . CYS A 1 57 ? 5.945   1.434   -3.698  1.00 10.00 ? 466 CYS A H    9  
ATOM 10157 H HA   . CYS A 1 57 ? 3.438   0.188   -4.054  1.00 10.00 ? 466 CYS A HA   9  
ATOM 10158 H HB2  . CYS A 1 57 ? 4.500   2.457   -2.562  1.00 10.00 ? 466 CYS A HB2  9  
ATOM 10159 H HB3  . CYS A 1 57 ? 2.889   2.785   -3.190  1.00 10.00 ? 466 CYS A HB3  9  
ATOM 10160 H HG   . CYS A 1 57 ? 3.523   0.439   -1.246  1.00 10.00 ? 466 CYS A HG   9  
ATOM 10161 N N    . VAL A 1 58 ? 4.191   2.534   -6.144  1.00 10.00 ? 467 VAL A N    9  
ATOM 10162 C CA   . VAL A 1 58 ? 3.776   3.188   -7.378  1.00 10.00 ? 467 VAL A CA   9  
ATOM 10163 C C    . VAL A 1 58 ? 3.126   2.174   -8.314  1.00 10.00 ? 467 VAL A C    9  
ATOM 10164 O O    . VAL A 1 58 ? 2.352   2.532   -9.200  1.00 10.00 ? 467 VAL A O    9  
ATOM 10165 C CB   . VAL A 1 58 ? 4.973   3.853   -8.095  1.00 10.00 ? 467 VAL A CB   9  
ATOM 10166 C CG1  . VAL A 1 58 ? 4.590   4.311   -9.499  1.00 10.00 ? 467 VAL A CG1  9  
ATOM 10167 C CG2  . VAL A 1 58 ? 5.500   5.021   -7.276  1.00 10.00 ? 467 VAL A CG2  9  
ATOM 10168 H H    . VAL A 1 58 ? 5.125   2.603   -5.857  1.00 10.00 ? 467 VAL A H    9  
ATOM 10169 H HA   . VAL A 1 58 ? 3.056   3.954   -7.129  1.00 10.00 ? 467 VAL A HA   9  
ATOM 10170 H HB   . VAL A 1 58 ? 5.764   3.122   -8.184  1.00 10.00 ? 467 VAL A HB   9  
ATOM 10171 H HG11 . VAL A 1 58 ? 4.193   3.475   -10.060 1.00 10.00 ? 467 VAL A HG11 9  
ATOM 10172 H HG12 . VAL A 1 58 ? 5.464   4.699   -10.002 1.00 10.00 ? 467 VAL A HG12 9  
ATOM 10173 H HG13 . VAL A 1 58 ? 3.841   5.086   -9.431  1.00 10.00 ? 467 VAL A HG13 9  
ATOM 10174 H HG21 . VAL A 1 58 ? 4.689   5.700   -7.053  1.00 10.00 ? 467 VAL A HG21 9  
ATOM 10175 H HG22 . VAL A 1 58 ? 6.261   5.541   -7.839  1.00 10.00 ? 467 VAL A HG22 9  
ATOM 10176 H HG23 . VAL A 1 58 ? 5.924   4.651   -6.353  1.00 10.00 ? 467 VAL A HG23 9  
ATOM 10177 N N    . LEU A 1 59 ? 3.448   0.902   -8.107  1.00 10.00 ? 468 LEU A N    9  
ATOM 10178 C CA   . LEU A 1 59 ? 2.900   -0.166  -8.925  1.00 10.00 ? 468 LEU A CA   9  
ATOM 10179 C C    . LEU A 1 59 ? 1.400   -0.340  -8.691  1.00 10.00 ? 468 LEU A C    9  
ATOM 10180 O O    . LEU A 1 59 ? 0.753   -1.120  -9.383  1.00 10.00 ? 468 LEU A O    9  
ATOM 10181 C CB   . LEU A 1 59 ? 3.637   -1.476  -8.635  1.00 10.00 ? 468 LEU A CB   9  
ATOM 10182 C CG   . LEU A 1 59 ? 4.138   -2.225  -9.871  1.00 10.00 ? 468 LEU A CG   9  
ATOM 10183 C CD1  . LEU A 1 59 ? 5.170   -1.394  -10.616 1.00 10.00 ? 468 LEU A CD1  9  
ATOM 10184 C CD2  . LEU A 1 59 ? 4.722   -3.573  -9.475  1.00 10.00 ? 468 LEU A CD2  9  
ATOM 10185 H H    . LEU A 1 59 ? 4.073   0.675   -7.388  1.00 10.00 ? 468 LEU A H    9  
ATOM 10186 H HA   . LEU A 1 59 ? 3.057   0.104   -9.957  1.00 10.00 ? 468 LEU A HA   9  
ATOM 10187 H HB2  . LEU A 1 59 ? 4.486   -1.253  -8.003  1.00 10.00 ? 468 LEU A HB2  9  
ATOM 10188 H HB3  . LEU A 1 59 ? 2.969   -2.129  -8.092  1.00 10.00 ? 468 LEU A HB3  9  
ATOM 10189 H HG   . LEU A 1 59 ? 3.307   -2.402  -10.539 1.00 10.00 ? 468 LEU A HG   9  
ATOM 10190 H HD11 . LEU A 1 59 ? 6.160   -1.656  -10.273 1.00 10.00 ? 468 LEU A HD11 9  
ATOM 10191 H HD12 . LEU A 1 59 ? 4.991   -0.345  -10.429 1.00 10.00 ? 468 LEU A HD12 9  
ATOM 10192 H HD13 . LEU A 1 59 ? 5.093   -1.588  -11.675 1.00 10.00 ? 468 LEU A HD13 9  
ATOM 10193 H HD21 . LEU A 1 59 ? 4.078   -4.045  -8.749  1.00 10.00 ? 468 LEU A HD21 9  
ATOM 10194 H HD22 . LEU A 1 59 ? 5.703   -3.429  -9.047  1.00 10.00 ? 468 LEU A HD22 9  
ATOM 10195 H HD23 . LEU A 1 59 ? 4.800   -4.202  -10.350 1.00 10.00 ? 468 LEU A HD23 9  
ATOM 10196 N N    . TYR A 1 60 ? 0.855   0.390   -7.718  1.00 10.00 ? 469 TYR A N    9  
ATOM 10197 C CA   . TYR A 1 60 ? -0.566  0.318   -7.404  1.00 10.00 ? 469 TYR A CA   9  
ATOM 10198 C C    . TYR A 1 60 ? -1.258  1.658   -7.668  1.00 10.00 ? 469 TYR A C    9  
ATOM 10199 O O    . TYR A 1 60 ? -2.485  1.751   -7.624  1.00 10.00 ? 469 TYR A O    9  
ATOM 10200 C CB   . TYR A 1 60 ? -0.760  -0.135  -5.945  1.00 10.00 ? 469 TYR A CB   9  
ATOM 10201 C CG   . TYR A 1 60 ? -1.211  0.917   -4.951  1.00 10.00 ? 469 TYR A CG   9  
ATOM 10202 C CD1  . TYR A 1 60 ? -0.723  2.215   -5.009  1.00 10.00 ? 469 TYR A CD1  9  
ATOM 10203 C CD2  . TYR A 1 60 ? -2.115  0.599   -3.938  1.00 10.00 ? 469 TYR A CD2  9  
ATOM 10204 C CE1  . TYR A 1 60 ? -1.120  3.171   -4.098  1.00 10.00 ? 469 TYR A CE1  9  
ATOM 10205 C CE2  . TYR A 1 60 ? -2.518  1.554   -3.026  1.00 10.00 ? 469 TYR A CE2  9  
ATOM 10206 C CZ   . TYR A 1 60 ? -2.018  2.838   -3.111  1.00 10.00 ? 469 TYR A CZ   9  
ATOM 10207 O OH   . TYR A 1 60 ? -2.409  3.788   -2.201  1.00 10.00 ? 469 TYR A OH   9  
ATOM 10208 H H    . TYR A 1 60 ? 1.418   0.987   -7.199  1.00 10.00 ? 469 TYR A H    9  
ATOM 10209 H HA   . TYR A 1 60 ? -0.996  -0.427  -8.051  1.00 10.00 ? 469 TYR A HA   9  
ATOM 10210 H HB2  . TYR A 1 60 ? -1.495  -0.921  -5.927  1.00 10.00 ? 469 TYR A HB2  9  
ATOM 10211 H HB3  . TYR A 1 60 ? 0.176   -0.525  -5.591  1.00 10.00 ? 469 TYR A HB3  9  
ATOM 10212 H HD1  . TYR A 1 60 ? -0.022  2.473   -5.782  1.00 10.00 ? 469 TYR A HD1  9  
ATOM 10213 H HD2  . TYR A 1 60 ? -2.503  -0.419  -3.857  1.00 10.00 ? 469 TYR A HD2  9  
ATOM 10214 H HE1  . TYR A 1 60 ? -0.727  4.174   -4.163  1.00 10.00 ? 469 TYR A HE1  9  
ATOM 10215 H HE2  . TYR A 1 60 ? -3.223  1.291   -2.251  1.00 10.00 ? 469 TYR A HE2  9  
ATOM 10216 H HH   . TYR A 1 60 ? -1.633  4.169   -1.782  1.00 10.00 ? 469 TYR A HH   9  
ATOM 10217 N N    . TYR A 1 61 ? -0.461  2.699   -7.923  1.00 10.00 ? 470 TYR A N    9  
ATOM 10218 C CA   . TYR A 1 61 ? -1.001  4.027   -8.168  1.00 10.00 ? 470 TYR A CA   9  
ATOM 10219 C C    . TYR A 1 61 ? -1.274  4.242   -9.653  1.00 10.00 ? 470 TYR A C    9  
ATOM 10220 O O    . TYR A 1 61 ? -2.184  4.988   -10.018 1.00 10.00 ? 470 TYR A O    9  
ATOM 10221 C CB   . TYR A 1 61 ? -0.046  5.099   -7.610  1.00 10.00 ? 470 TYR A CB   9  
ATOM 10222 C CG   . TYR A 1 61 ? 0.593   5.997   -8.650  1.00 10.00 ? 470 TYR A CG   9  
ATOM 10223 C CD1  . TYR A 1 61 ? 1.399   5.470   -9.649  1.00 10.00 ? 470 TYR A CD1  9  
ATOM 10224 C CD2  . TYR A 1 61 ? 0.391   7.370   -8.629  1.00 10.00 ? 470 TYR A CD2  9  
ATOM 10225 C CE1  . TYR A 1 61 ? 1.987   6.282   -10.596 1.00 10.00 ? 470 TYR A CE1  9  
ATOM 10226 C CE2  . TYR A 1 61 ? 0.976   8.193   -9.574  1.00 10.00 ? 470 TYR A CE2  9  
ATOM 10227 C CZ   . TYR A 1 61 ? 1.773   7.643   -10.556 1.00 10.00 ? 470 TYR A CZ   9  
ATOM 10228 O OH   . TYR A 1 61 ? 2.357   8.457   -11.499 1.00 10.00 ? 470 TYR A OH   9  
ATOM 10229 H H    . TYR A 1 61 ? 0.510   2.573   -7.934  1.00 10.00 ? 470 TYR A H    9  
ATOM 10230 H HA   . TYR A 1 61 ? -1.939  4.095   -7.639  1.00 10.00 ? 470 TYR A HA   9  
ATOM 10231 H HB2  . TYR A 1 61 ? -0.594  5.732   -6.929  1.00 10.00 ? 470 TYR A HB2  9  
ATOM 10232 H HB3  . TYR A 1 61 ? 0.749   4.606   -7.067  1.00 10.00 ? 470 TYR A HB3  9  
ATOM 10233 H HD1  . TYR A 1 61 ? 1.564   4.406   -9.681  1.00 10.00 ? 470 TYR A HD1  9  
ATOM 10234 H HD2  . TYR A 1 61 ? -0.234  7.797   -7.859  1.00 10.00 ? 470 TYR A HD2  9  
ATOM 10235 H HE1  . TYR A 1 61 ? 2.609   5.848   -11.363 1.00 10.00 ? 470 TYR A HE1  9  
ATOM 10236 H HE2  . TYR A 1 61 ? 0.806   9.258   -9.541  1.00 10.00 ? 470 TYR A HE2  9  
ATOM 10237 H HH   . TYR A 1 61 ? 3.250   8.677   -11.223 1.00 10.00 ? 470 TYR A HH   9  
ATOM 10238 N N    . TYR A 1 62 ? -0.494  3.587   -10.510 1.00 10.00 ? 471 TYR A N    9  
ATOM 10239 C CA   . TYR A 1 62 ? -0.695  3.731   -11.944 1.00 10.00 ? 471 TYR A CA   9  
ATOM 10240 C C    . TYR A 1 62 ? -2.003  3.071   -12.369 1.00 10.00 ? 471 TYR A C    9  
ATOM 10241 O O    . TYR A 1 62 ? -2.511  3.326   -13.460 1.00 10.00 ? 471 TYR A O    9  
ATOM 10242 C CB   . TYR A 1 62 ? 0.497   3.173   -12.731 1.00 10.00 ? 471 TYR A CB   9  
ATOM 10243 C CG   . TYR A 1 62 ? 0.622   1.665   -12.714 1.00 10.00 ? 471 TYR A CG   9  
ATOM 10244 C CD1  . TYR A 1 62 ? -0.289  0.862   -13.388 1.00 10.00 ? 471 TYR A CD1  9  
ATOM 10245 C CD2  . TYR A 1 62 ? 1.667   1.044   -12.038 1.00 10.00 ? 471 TYR A CD2  9  
ATOM 10246 C CE1  . TYR A 1 62 ? -0.168  -0.514  -13.387 1.00 10.00 ? 471 TYR A CE1  9  
ATOM 10247 C CE2  . TYR A 1 62 ? 1.796   -0.333  -12.037 1.00 10.00 ? 471 TYR A CE2  9  
ATOM 10248 C CZ   . TYR A 1 62 ? 0.876   -1.106  -12.711 1.00 10.00 ? 471 TYR A CZ   9  
ATOM 10249 O OH   . TYR A 1 62 ? 1.002   -2.477  -12.711 1.00 10.00 ? 471 TYR A OH   9  
ATOM 10250 H H    . TYR A 1 62 ? 0.217   2.997   -10.173 1.00 10.00 ? 471 TYR A H    9  
ATOM 10251 H HA   . TYR A 1 62 ? -0.779  4.790   -12.146 1.00 10.00 ? 471 TYR A HA   9  
ATOM 10252 H HB2  . TYR A 1 62 ? 0.408   3.478   -13.762 1.00 10.00 ? 471 TYR A HB2  9  
ATOM 10253 H HB3  . TYR A 1 62 ? 1.408   3.584   -12.321 1.00 10.00 ? 471 TYR A HB3  9  
ATOM 10254 H HD1  . TYR A 1 62 ? -1.108  1.328   -13.917 1.00 10.00 ? 471 TYR A HD1  9  
ATOM 10255 H HD2  . TYR A 1 62 ? 2.388   1.655   -11.507 1.00 10.00 ? 471 TYR A HD2  9  
ATOM 10256 H HE1  . TYR A 1 62 ? -0.889  -1.120  -13.916 1.00 10.00 ? 471 TYR A HE1  9  
ATOM 10257 H HE2  . TYR A 1 62 ? 2.614   -0.799  -11.510 1.00 10.00 ? 471 TYR A HE2  9  
ATOM 10258 H HH   . TYR A 1 62 ? 1.867   -2.719  -13.050 1.00 10.00 ? 471 TYR A HH   9  
ATOM 10259 N N    . LEU A 1 63 ? -2.565  2.251   -11.481 1.00 10.00 ? 472 LEU A N    9  
ATOM 10260 C CA   . LEU A 1 63 ? -3.838  1.594   -11.749 1.00 10.00 ? 472 LEU A CA   9  
ATOM 10261 C C    . LEU A 1 63 ? -4.973  2.457   -11.218 1.00 10.00 ? 472 LEU A C    9  
ATOM 10262 O O    . LEU A 1 63 ? -6.070  2.486   -11.776 1.00 10.00 ? 472 LEU A O    9  
ATOM 10263 C CB   . LEU A 1 63 ? -3.888  0.215   -11.091 1.00 10.00 ? 472 LEU A CB   9  
ATOM 10264 C CG   . LEU A 1 63 ? -2.693  -0.685  -11.384 1.00 10.00 ? 472 LEU A CG   9  
ATOM 10265 C CD1  . LEU A 1 63 ? -1.544  -0.371  -10.438 1.00 10.00 ? 472 LEU A CD1  9  
ATOM 10266 C CD2  . LEU A 1 63 ? -3.091  -2.150  -11.279 1.00 10.00 ? 472 LEU A CD2  9  
ATOM 10267 H H    . LEU A 1 63 ? -2.126  2.109   -10.615 1.00 10.00 ? 472 LEU A H    9  
ATOM 10268 H HA   . LEU A 1 63 ? -3.944  1.486   -12.818 1.00 10.00 ? 472 LEU A HA   9  
ATOM 10269 H HB2  . LEU A 1 63 ? -3.956  0.353   -10.021 1.00 10.00 ? 472 LEU A HB2  9  
ATOM 10270 H HB3  . LEU A 1 63 ? -4.781  -0.289  -11.428 1.00 10.00 ? 472 LEU A HB3  9  
ATOM 10271 H HG   . LEU A 1 63 ? -2.355  -0.501  -12.392 1.00 10.00 ? 472 LEU A HG   9  
ATOM 10272 H HD11 . LEU A 1 63 ? -1.843  0.400   -9.743  1.00 10.00 ? 472 LEU A HD11 9  
ATOM 10273 H HD12 . LEU A 1 63 ? -0.690  -0.030  -11.005 1.00 10.00 ? 472 LEU A HD12 9  
ATOM 10274 H HD13 . LEU A 1 63 ? -1.278  -1.261  -9.888  1.00 10.00 ? 472 LEU A HD13 9  
ATOM 10275 H HD21 . LEU A 1 63 ? -4.156  -2.245  -11.429 1.00 10.00 ? 472 LEU A HD21 9  
ATOM 10276 H HD22 . LEU A 1 63 ? -2.829  -2.524  -10.300 1.00 10.00 ? 472 LEU A HD22 9  
ATOM 10277 H HD23 . LEU A 1 63 ? -2.570  -2.720  -12.033 1.00 10.00 ? 472 LEU A HD23 9  
ATOM 10278 N N    . THR A 1 64 ? -4.687  3.167   -10.130 1.00 10.00 ? 473 THR A N    9  
ATOM 10279 C CA   . THR A 1 64 ? -5.657  4.048   -9.501  1.00 10.00 ? 473 THR A CA   9  
ATOM 10280 C C    . THR A 1 64 ? -6.008  5.211   -10.416 1.00 10.00 ? 473 THR A C    9  
ATOM 10281 O O    . THR A 1 64 ? -7.164  5.629   -10.483 1.00 10.00 ? 473 THR A O    9  
ATOM 10282 C CB   . THR A 1 64 ? -5.105  4.573   -8.173  1.00 10.00 ? 473 THR A CB   9  
ATOM 10283 O OG1  . THR A 1 64 ? -4.015  5.450   -8.395  1.00 10.00 ? 473 THR A OG1  9  
ATOM 10284 C CG2  . THR A 1 64 ? -4.628  3.474   -7.245  1.00 10.00 ? 473 THR A CG2  9  
ATOM 10285 H H    . THR A 1 64 ? -3.790  3.099   -9.742  1.00 10.00 ? 473 THR A H    9  
ATOM 10286 H HA   . THR A 1 64 ? -6.553  3.483   -9.308  1.00 10.00 ? 473 THR A HA   9  
ATOM 10287 H HB   . THR A 1 64 ? -5.884  5.121   -7.663  1.00 10.00 ? 473 THR A HB   9  
ATOM 10288 H HG1  . THR A 1 64 ? -3.692  5.778   -7.554  1.00 10.00 ? 473 THR A HG1  9  
ATOM 10289 H HG21 . THR A 1 64 ? -5.323  3.367   -6.426  1.00 10.00 ? 473 THR A HG21 9  
ATOM 10290 H HG22 . THR A 1 64 ? -3.651  3.726   -6.857  1.00 10.00 ? 473 THR A HG22 9  
ATOM 10291 H HG23 . THR A 1 64 ? -4.569  2.543   -7.790  1.00 10.00 ? 473 THR A HG23 9  
ATOM 10292 N N    . LYS A 1 65 ? -5.009  5.743   -11.113 1.00 10.00 ? 474 LYS A N    9  
ATOM 10293 C CA   . LYS A 1 65 ? -5.236  6.868   -12.009 1.00 10.00 ? 474 LYS A CA   9  
ATOM 10294 C C    . LYS A 1 65 ? -5.318  6.417   -13.466 1.00 10.00 ? 474 LYS A C    9  
ATOM 10295 O O    . LYS A 1 65 ? -5.347  7.245   -14.376 1.00 10.00 ? 474 LYS A O    9  
ATOM 10296 C CB   . LYS A 1 65 ? -4.134  7.921   -11.849 1.00 10.00 ? 474 LYS A CB   9  
ATOM 10297 C CG   . LYS A 1 65 ? -3.583  8.045   -10.434 1.00 10.00 ? 474 LYS A CG   9  
ATOM 10298 C CD   . LYS A 1 65 ? -2.079  8.268   -10.438 1.00 10.00 ? 474 LYS A CD   9  
ATOM 10299 C CE   . LYS A 1 65 ? -1.701  9.526   -11.205 1.00 10.00 ? 474 LYS A CE   9  
ATOM 10300 N NZ   . LYS A 1 65 ? -0.663  9.256   -12.239 1.00 10.00 ? 474 LYS A NZ   9  
ATOM 10301 H H    . LYS A 1 65 ? -4.101  5.376   -11.017 1.00 10.00 ? 474 LYS A H    9  
ATOM 10302 H HA   . LYS A 1 65 ? -6.182  7.313   -11.738 1.00 10.00 ? 474 LYS A HA   9  
ATOM 10303 H HB2  . LYS A 1 65 ? -3.318  7.671   -12.507 1.00 10.00 ? 474 LYS A HB2  9  
ATOM 10304 H HB3  . LYS A 1 65 ? -4.535  8.880   -12.136 1.00 10.00 ? 474 LYS A HB3  9  
ATOM 10305 H HG2  . LYS A 1 65 ? -4.057  8.884   -9.947  1.00 10.00 ? 474 LYS A HG2  9  
ATOM 10306 H HG3  . LYS A 1 65 ? -3.802  7.140   -9.887  1.00 10.00 ? 474 LYS A HG3  9  
ATOM 10307 H HD2  . LYS A 1 65 ? -1.738  8.364   -9.420  1.00 10.00 ? 474 LYS A HD2  9  
ATOM 10308 H HD3  . LYS A 1 65 ? -1.601  7.417   -10.902 1.00 10.00 ? 474 LYS A HD3  9  
ATOM 10309 H HE2  . LYS A 1 65 ? -2.583  9.918   -11.689 1.00 10.00 ? 474 LYS A HE2  9  
ATOM 10310 H HE3  . LYS A 1 65 ? -1.319  10.256  -10.507 1.00 10.00 ? 474 LYS A HE3  9  
ATOM 10311 H HZ1  . LYS A 1 65 ? -0.004  10.059  -12.302 1.00 10.00 ? 474 LYS A HZ1  9  
ATOM 10312 H HZ2  . LYS A 1 65 ? -1.111  9.116   -13.167 1.00 10.00 ? 474 LYS A HZ2  9  
ATOM 10313 H HZ3  . LYS A 1 65 ? -0.127  8.400   -11.992 1.00 10.00 ? 474 LYS A HZ3  9  
ATOM 10314 N N    . LYS A 1 66 ? -5.371  5.106   -13.683 1.00 10.00 ? 475 LYS A N    9  
ATOM 10315 C CA   . LYS A 1 66 ? -5.467  4.564   -15.031 1.00 10.00 ? 475 LYS A CA   9  
ATOM 10316 C C    . LYS A 1 66 ? -6.918  4.564   -15.498 1.00 10.00 ? 475 LYS A C    9  
ATOM 10317 O O    . LYS A 1 66 ? -7.198  4.658   -16.694 1.00 10.00 ? 475 LYS A O    9  
ATOM 10318 C CB   . LYS A 1 66 ? -4.900  3.142   -15.077 1.00 10.00 ? 475 LYS A CB   9  
ATOM 10319 C CG   . LYS A 1 66 ? -3.710  2.992   -16.012 1.00 10.00 ? 475 LYS A CG   9  
ATOM 10320 C CD   . LYS A 1 66 ? -3.244  1.548   -16.092 1.00 10.00 ? 475 LYS A CD   9  
ATOM 10321 C CE   . LYS A 1 66 ? -2.801  1.183   -17.500 1.00 10.00 ? 475 LYS A CE   9  
ATOM 10322 N NZ   . LYS A 1 66 ? -1.775  2.127   -18.022 1.00 10.00 ? 475 LYS A NZ   9  
ATOM 10323 H H    . LYS A 1 66 ? -5.355  4.491   -12.920 1.00 10.00 ? 475 LYS A H    9  
ATOM 10324 H HA   . LYS A 1 66 ? -4.888  5.196   -15.687 1.00 10.00 ? 475 LYS A HA   9  
ATOM 10325 H HB2  . LYS A 1 66 ? -4.586  2.861   -14.084 1.00 10.00 ? 475 LYS A HB2  9  
ATOM 10326 H HB3  . LYS A 1 66 ? -5.675  2.465   -15.406 1.00 10.00 ? 475 LYS A HB3  9  
ATOM 10327 H HG2  . LYS A 1 66 ? -3.998  3.322   -16.999 1.00 10.00 ? 475 LYS A HG2  9  
ATOM 10328 H HG3  . LYS A 1 66 ? -2.899  3.605   -15.648 1.00 10.00 ? 475 LYS A HG3  9  
ATOM 10329 H HD2  . LYS A 1 66 ? -2.412  1.410   -15.417 1.00 10.00 ? 475 LYS A HD2  9  
ATOM 10330 H HD3  . LYS A 1 66 ? -4.057  0.901   -15.800 1.00 10.00 ? 475 LYS A HD3  9  
ATOM 10331 H HE2  . LYS A 1 66 ? -2.385  0.186   -17.486 1.00 10.00 ? 475 LYS A HE2  9  
ATOM 10332 H HE3  . LYS A 1 66 ? -3.662  1.204   -18.151 1.00 10.00 ? 475 LYS A HE3  9  
ATOM 10333 H HZ1  . LYS A 1 66 ? -0.928  2.106   -17.418 1.00 10.00 ? 475 LYS A HZ1  9  
ATOM 10334 H HZ2  . LYS A 1 66 ? -2.152  3.096   -18.033 1.00 10.00 ? 475 LYS A HZ2  9  
ATOM 10335 H HZ3  . LYS A 1 66 ? -1.504  1.862   -18.990 1.00 10.00 ? 475 LYS A HZ3  9  
ATOM 10336 N N    . ASN A 1 67 ? -7.837  4.458   -14.543 1.00 10.00 ? 476 ASN A N    9  
ATOM 10337 C CA   . ASN A 1 67 ? -9.262  4.445   -14.847 1.00 10.00 ? 476 ASN A CA   9  
ATOM 10338 C C    . ASN A 1 67 ? -10.002 5.556   -14.100 1.00 10.00 ? 476 ASN A C    9  
ATOM 10339 O O    . ASN A 1 67 ? -11.206 5.737   -14.284 1.00 10.00 ? 476 ASN A O    9  
ATOM 10340 C CB   . ASN A 1 67 ? -9.863  3.087   -14.482 1.00 10.00 ? 476 ASN A CB   9  
ATOM 10341 C CG   . ASN A 1 67 ? -9.670  2.056   -15.576 1.00 10.00 ? 476 ASN A CG   9  
ATOM 10342 O OD1  . ASN A 1 67 ? -10.614 1.700   -16.283 1.00 10.00 ? 476 ASN A OD1  9  
ATOM 10343 N ND2  . ASN A 1 67 ? -8.443  1.571   -15.722 1.00 10.00 ? 476 ASN A ND2  9  
ATOM 10344 H H    . ASN A 1 67 ? -7.548  4.386   -13.610 1.00 10.00 ? 476 ASN A H    9  
ATOM 10345 H HA   . ASN A 1 67 ? -9.376  4.604   -15.908 1.00 10.00 ? 476 ASN A HA   9  
ATOM 10346 H HB2  . ASN A 1 67 ? -9.391  2.722   -13.581 1.00 10.00 ? 476 ASN A HB2  9  
ATOM 10347 H HB3  . ASN A 1 67 ? -10.922 3.206   -14.305 1.00 10.00 ? 476 ASN A HB3  9  
ATOM 10348 H HD21 . ASN A 1 67 ? -7.741  1.900   -15.124 1.00 10.00 ? 476 ASN A HD21 9  
ATOM 10349 H HD22 . ASN A 1 67 ? -8.290  0.903   -16.423 1.00 10.00 ? 476 ASN A HD22 9  
ATOM 10350 N N    . GLU A 1 68 ? -9.287  6.298   -13.255 1.00 10.00 ? 477 GLU A N    9  
ATOM 10351 C CA   . GLU A 1 68 ? -9.897  7.379   -12.489 1.00 10.00 ? 477 GLU A CA   9  
ATOM 10352 C C    . GLU A 1 68 ? -9.270  8.725   -12.837 1.00 10.00 ? 477 GLU A C    9  
ATOM 10353 O O    . GLU A 1 68 ? -9.947  9.754   -12.832 1.00 10.00 ? 477 GLU A O    9  
ATOM 10354 C CB   . GLU A 1 68 ? -9.756  7.112   -10.989 1.00 10.00 ? 477 GLU A CB   9  
ATOM 10355 C CG   . GLU A 1 68 ? -10.202 5.718   -10.575 1.00 10.00 ? 477 GLU A CG   9  
ATOM 10356 C CD   . GLU A 1 68 ? -10.767 5.680   -9.169  1.00 10.00 ? 477 GLU A CD   9  
ATOM 10357 O OE1  . GLU A 1 68 ? -11.137 6.754   -8.648  1.00 10.00 ? 477 GLU A OE1  9  
ATOM 10358 O OE2  . GLU A 1 68 ? -10.840 4.577   -8.588  1.00 10.00 ? 477 GLU A OE2  9  
ATOM 10359 H H    . GLU A 1 68 ? -8.331  6.112   -13.140 1.00 10.00 ? 477 GLU A H    9  
ATOM 10360 H HA   . GLU A 1 68 ? -10.946 7.409   -12.740 1.00 10.00 ? 477 GLU A HA   9  
ATOM 10361 H HB2  . GLU A 1 68 ? -8.720  7.232   -10.710 1.00 10.00 ? 477 GLU A HB2  9  
ATOM 10362 H HB3  . GLU A 1 68 ? -10.350 7.833   -10.449 1.00 10.00 ? 477 GLU A HB3  9  
ATOM 10363 H HG2  . GLU A 1 68 ? -10.963 5.380   -11.261 1.00 10.00 ? 477 GLU A HG2  9  
ATOM 10364 H HG3  . GLU A 1 68 ? -9.352  5.053   -10.625 1.00 10.00 ? 477 GLU A HG3  9  
ATOM 10365 N N    . ASN A 1 69 ? -7.975  8.716   -13.134 1.00 10.00 ? 478 ASN A N    9  
ATOM 10366 C CA   . ASN A 1 69 ? -7.263  9.941   -13.478 1.00 10.00 ? 478 ASN A CA   9  
ATOM 10367 C C    . ASN A 1 69 ? -7.310  10.933  -12.320 1.00 10.00 ? 478 ASN A C    9  
ATOM 10368 O O    . ASN A 1 69 ? -8.363  11.488  -12.008 1.00 10.00 ? 478 ASN A O    9  
ATOM 10369 C CB   . ASN A 1 69 ? -7.867  10.573  -14.733 1.00 10.00 ? 478 ASN A CB   9  
ATOM 10370 C CG   . ASN A 1 69 ? -6.845  11.352  -15.538 1.00 10.00 ? 478 ASN A CG   9  
ATOM 10371 O OD1  . ASN A 1 69 ? -5.737  11.615  -15.068 1.00 10.00 ? 478 ASN A OD1  9  
ATOM 10372 N ND2  . ASN A 1 69 ? -7.212  11.726  -16.758 1.00 10.00 ? 478 ASN A ND2  9  
ATOM 10373 H H    . ASN A 1 69 ? -7.486  7.867   -13.118 1.00 10.00 ? 478 ASN A H    9  
ATOM 10374 H HA   . ASN A 1 69 ? -6.233  9.682   -13.674 1.00 10.00 ? 478 ASN A HA   9  
ATOM 10375 H HB2  . ASN A 1 69 ? -8.274  9.795   -15.361 1.00 10.00 ? 478 ASN A HB2  9  
ATOM 10376 H HB3  . ASN A 1 69 ? -8.660  11.248  -14.443 1.00 10.00 ? 478 ASN A HB3  9  
ATOM 10377 H HD21 . ASN A 1 69 ? -8.109  11.481  -17.066 1.00 10.00 ? 478 ASN A HD21 9  
ATOM 10378 H HD22 . ASN A 1 69 ? -6.570  12.230  -17.300 1.00 10.00 ? 478 ASN A HD22 9  
ATOM 10379 N N    . TYR A 1 70 ? -6.163  11.148  -11.683 1.00 10.00 ? 479 TYR A N    9  
ATOM 10380 C CA   . TYR A 1 70 ? -6.078  12.070  -10.558 1.00 10.00 ? 479 TYR A CA   9  
ATOM 10381 C C    . TYR A 1 70 ? -4.635  12.212  -10.081 1.00 10.00 ? 479 TYR A C    9  
ATOM 10382 O O    . TYR A 1 70 ? -3.951  11.218  -9.840  1.00 10.00 ? 479 TYR A O    9  
ATOM 10383 C CB   . TYR A 1 70 ? -6.965  11.583  -9.408  1.00 10.00 ? 479 TYR A CB   9  
ATOM 10384 C CG   . TYR A 1 70 ? -6.419  10.369  -8.690  1.00 10.00 ? 479 TYR A CG   9  
ATOM 10385 C CD1  . TYR A 1 70 ? -6.454  9.112   -9.279  1.00 10.00 ? 479 TYR A CD1  9  
ATOM 10386 C CD2  . TYR A 1 70 ? -5.861  10.484  -7.422  1.00 10.00 ? 479 TYR A CD2  9  
ATOM 10387 C CE1  . TYR A 1 70 ? -5.952  8.003   -8.626  1.00 10.00 ? 479 TYR A CE1  9  
ATOM 10388 C CE2  . TYR A 1 70 ? -5.357  9.380   -6.762  1.00 10.00 ? 479 TYR A CE2  9  
ATOM 10389 C CZ   . TYR A 1 70 ? -5.404  8.142   -7.368  1.00 10.00 ? 479 TYR A CZ   9  
ATOM 10390 O OH   . TYR A 1 70 ? -4.903  7.041   -6.713  1.00 10.00 ? 479 TYR A OH   9  
ATOM 10391 H H    . TYR A 1 70 ? -5.357  10.675  -11.976 1.00 10.00 ? 479 TYR A H    9  
ATOM 10392 H HA   . TYR A 1 70 ? -6.431  13.034  -10.892 1.00 10.00 ? 479 TYR A HA   9  
ATOM 10393 H HB2  . TYR A 1 70 ? -7.071  12.378  -8.685  1.00 10.00 ? 479 TYR A HB2  9  
ATOM 10394 H HB3  . TYR A 1 70 ? -7.939  11.328  -9.798  1.00 10.00 ? 479 TYR A HB3  9  
ATOM 10395 H HD1  . TYR A 1 70 ? -6.884  9.006   -10.264 1.00 10.00 ? 479 TYR A HD1  9  
ATOM 10396 H HD2  . TYR A 1 70 ? -5.827  11.454  -6.950  1.00 10.00 ? 479 TYR A HD2  9  
ATOM 10397 H HE1  . TYR A 1 70 ? -5.986  7.033   -9.103  1.00 10.00 ? 479 TYR A HE1  9  
ATOM 10398 H HE2  . TYR A 1 70 ? -4.927  9.490   -5.778  1.00 10.00 ? 479 TYR A HE2  9  
ATOM 10399 H HH   . TYR A 1 70 ? -5.127  7.092   -5.781  1.00 10.00 ? 479 TYR A HH   9  
ATOM 10400 N N    . LYS A 1 71 ? -4.181  13.452  -9.947  1.00 10.00 ? 480 LYS A N    9  
ATOM 10401 C CA   . LYS A 1 71 ? -2.821  13.721  -9.496  1.00 10.00 ? 480 LYS A CA   9  
ATOM 10402 C C    . LYS A 1 71 ? -2.699  15.143  -8.955  1.00 10.00 ? 480 LYS A C    9  
ATOM 10403 O O    . LYS A 1 71 ? -3.609  15.955  -9.219  1.00 10.00 ? 480 LYS A O    9  
ATOM 10404 C CB   . LYS A 1 71 ? -1.830  13.511  -10.642 1.00 10.00 ? 480 LYS A CB   9  
ATOM 10405 C CG   . LYS A 1 71 ? -2.242  14.194  -11.936 1.00 10.00 ? 480 LYS A CG   9  
ATOM 10406 C CD   . LYS A 1 71 ? -1.649  15.590  -12.042 1.00 10.00 ? 480 LYS A CD   9  
ATOM 10407 C CE   . LYS A 1 71 ? -2.585  16.538  -12.777 1.00 10.00 ? 480 LYS A CE   9  
ATOM 10408 N NZ   . LYS A 1 71 ? -3.357  17.395  -11.836 1.00 10.00 ? 480 LYS A NZ   9  
ATOM 10409 O OXT  . LYS A 1 71 ? -1.693  15.430  -8.272  1.00 10.00 ? 480 LYS A OXT  9  
ATOM 10410 H H    . LYS A 1 71 ? -4.775  14.203  -10.153 1.00 10.00 ? 480 LYS A H    9  
ATOM 10411 H HA   . LYS A 1 71 ? -2.592  13.026  -8.702  1.00 10.00 ? 480 LYS A HA   9  
ATOM 10412 H HB2  . LYS A 1 71 ? -0.867  13.900  -10.346 1.00 10.00 ? 480 LYS A HB2  9  
ATOM 10413 H HB3  . LYS A 1 71 ? -1.737  12.453  -10.833 1.00 10.00 ? 480 LYS A HB3  9  
ATOM 10414 H HG2  . LYS A 1 71 ? -1.895  13.603  -12.771 1.00 10.00 ? 480 LYS A HG2  9  
ATOM 10415 H HG3  . LYS A 1 71 ? -3.320  14.267  -11.966 1.00 10.00 ? 480 LYS A HG3  9  
ATOM 10416 H HD2  . LYS A 1 71 ? -1.474  15.973  -11.049 1.00 10.00 ? 480 LYS A HD2  9  
ATOM 10417 H HD3  . LYS A 1 71 ? -0.714  15.533  -12.580 1.00 10.00 ? 480 LYS A HD3  9  
ATOM 10418 H HE2  . LYS A 1 71 ? -1.999  17.170  -13.426 1.00 10.00 ? 480 LYS A HE2  9  
ATOM 10419 H HE3  . LYS A 1 71 ? -3.275  15.955  -13.369 1.00 10.00 ? 480 LYS A HE3  9  
ATOM 10420 H HZ1  . LYS A 1 71 ? -4.197  16.885  -11.495 1.00 10.00 ? 480 LYS A HZ1  9  
ATOM 10421 H HZ2  . LYS A 1 71 ? -3.665  18.266  -12.316 1.00 10.00 ? 480 LYS A HZ2  9  
ATOM 10422 H HZ3  . LYS A 1 71 ? -2.766  17.654  -11.020 1.00 10.00 ? 480 LYS A HZ3  9  
ATOM 10423 N N    . ASN A 1 4  ? -3.348  -5.315  28.959  1.00 10.00 ? 413 ASN A N    10 
ATOM 10424 C CA   . ASN A 1 4  ? -2.543  -4.472  28.082  1.00 10.00 ? 413 ASN A CA   10 
ATOM 10425 C C    . ASN A 1 4  ? -2.064  -5.254  26.863  1.00 10.00 ? 413 ASN A C    10 
ATOM 10426 O O    . ASN A 1 4  ? -1.852  -4.685  25.792  1.00 10.00 ? 413 ASN A O    10 
ATOM 10427 C CB   . ASN A 1 4  ? -1.343  -3.906  28.843  1.00 10.00 ? 413 ASN A CB   10 
ATOM 10428 C CG   . ASN A 1 4  ? -1.020  -2.482  28.437  1.00 10.00 ? 413 ASN A CG   10 
ATOM 10429 O OD1  . ASN A 1 4  ? -1.729  -1.544  28.802  1.00 10.00 ? 413 ASN A OD1  10 
ATOM 10430 N ND2  . ASN A 1 4  ? 0.055   -2.313  27.676  1.00 10.00 ? 413 ASN A ND2  10 
ATOM 10431 H H    . ASN A 1 4  ? -3.054  -5.463  29.882  1.00 10.00 ? 413 ASN A H    10 
ATOM 10432 H HA   . ASN A 1 4  ? -3.164  -3.654  27.748  1.00 10.00 ? 413 ASN A HA   10 
ATOM 10433 H HB2  . ASN A 1 4  ? -1.558  -3.918  29.902  1.00 10.00 ? 413 ASN A HB2  10 
ATOM 10434 H HB3  . ASN A 1 4  ? -0.479  -4.522  28.649  1.00 10.00 ? 413 ASN A HB3  10 
ATOM 10435 H HD21 . ASN A 1 4  ? 0.573   -3.106  27.424  1.00 10.00 ? 413 ASN A HD21 10 
ATOM 10436 H HD22 . ASN A 1 4  ? 0.288   -1.403  27.398  1.00 10.00 ? 413 ASN A HD22 10 
ATOM 10437 N N    . GLY A 1 5  ? -1.893  -6.561  27.033  1.00 10.00 ? 414 GLY A N    10 
ATOM 10438 C CA   . GLY A 1 5  ? -1.439  -7.400  25.938  1.00 10.00 ? 414 GLY A CA   10 
ATOM 10439 C C    . GLY A 1 5  ? -2.367  -7.344  24.741  1.00 10.00 ? 414 GLY A C    10 
ATOM 10440 O O    . GLY A 1 5  ? -3.284  -8.154  24.618  1.00 10.00 ? 414 GLY A O    10 
ATOM 10441 H H    . GLY A 1 5  ? -2.077  -6.960  27.909  1.00 10.00 ? 414 GLY A H    10 
ATOM 10442 H HA2  . GLY A 1 5  ? -0.456  -7.072  25.635  1.00 10.00 ? 414 GLY A HA2  10 
ATOM 10443 H HA3  . GLY A 1 5  ? -1.377  -8.420  26.284  1.00 10.00 ? 414 GLY A HA3  10 
ATOM 10444 N N    . LEU A 1 6  ? -2.126  -6.384  23.853  1.00 10.00 ? 415 LEU A N    10 
ATOM 10445 C CA   . LEU A 1 6  ? -2.946  -6.224  22.657  1.00 10.00 ? 415 LEU A CA   10 
ATOM 10446 C C    . LEU A 1 6  ? -2.092  -5.798  21.467  1.00 10.00 ? 415 LEU A C    10 
ATOM 10447 O O    . LEU A 1 6  ? -1.904  -6.561  20.520  1.00 10.00 ? 415 LEU A O    10 
ATOM 10448 C CB   . LEU A 1 6  ? -4.048  -5.193  22.903  1.00 10.00 ? 415 LEU A CB   10 
ATOM 10449 C CG   . LEU A 1 6  ? -4.992  -5.517  24.062  1.00 10.00 ? 415 LEU A CG   10 
ATOM 10450 C CD1  . LEU A 1 6  ? -5.680  -4.256  24.559  1.00 10.00 ? 415 LEU A CD1  10 
ATOM 10451 C CD2  . LEU A 1 6  ? -6.021  -6.554  23.636  1.00 10.00 ? 415 LEU A CD2  10 
ATOM 10452 H H    . LEU A 1 6  ? -1.379  -5.768  24.007  1.00 10.00 ? 415 LEU A H    10 
ATOM 10453 H HA   . LEU A 1 6  ? -3.399  -7.179  22.437  1.00 10.00 ? 415 LEU A HA   10 
ATOM 10454 H HB2  . LEU A 1 6  ? -3.583  -4.239  23.101  1.00 10.00 ? 415 LEU A HB2  10 
ATOM 10455 H HB3  . LEU A 1 6  ? -4.638  -5.107  22.003  1.00 10.00 ? 415 LEU A HB3  10 
ATOM 10456 H HG   . LEU A 1 6  ? -4.419  -5.930  24.880  1.00 10.00 ? 415 LEU A HG   10 
ATOM 10457 H HD11 . LEU A 1 6  ? -5.026  -3.409  24.414  1.00 10.00 ? 415 LEU A HD11 10 
ATOM 10458 H HD12 . LEU A 1 6  ? -5.907  -4.360  25.611  1.00 10.00 ? 415 LEU A HD12 10 
ATOM 10459 H HD13 . LEU A 1 6  ? -6.595  -4.103  24.008  1.00 10.00 ? 415 LEU A HD13 10 
ATOM 10460 H HD21 . LEU A 1 6  ? -5.631  -7.131  22.810  1.00 10.00 ? 415 LEU A HD21 10 
ATOM 10461 H HD22 . LEU A 1 6  ? -6.929  -6.056  23.331  1.00 10.00 ? 415 LEU A HD22 10 
ATOM 10462 H HD23 . LEU A 1 6  ? -6.234  -7.213  24.465  1.00 10.00 ? 415 LEU A HD23 10 
ATOM 10463 N N    . MET A 1 7  ? -1.575  -4.575  21.525  1.00 10.00 ? 416 MET A N    10 
ATOM 10464 C CA   . MET A 1 7  ? -0.740  -4.046  20.454  1.00 10.00 ? 416 MET A CA   10 
ATOM 10465 C C    . MET A 1 7  ? -1.502  -4.009  19.133  1.00 10.00 ? 416 MET A C    10 
ATOM 10466 O O    . MET A 1 7  ? -1.254  -4.816  18.238  1.00 10.00 ? 416 MET A O    10 
ATOM 10467 C CB   . MET A 1 7  ? 0.527   -4.892  20.302  1.00 10.00 ? 416 MET A CB   10 
ATOM 10468 C CG   . MET A 1 7  ? 1.541   -4.672  21.414  1.00 10.00 ? 416 MET A CG   10 
ATOM 10469 S SD   . MET A 1 7  ? 2.886   -5.874  21.373  1.00 10.00 ? 416 MET A SD   10 
ATOM 10470 C CE   . MET A 1 7  ? 2.098   -7.290  22.134  1.00 10.00 ? 416 MET A CE   10 
ATOM 10471 H H    . MET A 1 7  ? -1.760  -4.015  22.308  1.00 10.00 ? 416 MET A H    10 
ATOM 10472 H HA   . MET A 1 7  ? -0.458  -3.039  20.721  1.00 10.00 ? 416 MET A HA   10 
ATOM 10473 H HB2  . MET A 1 7  ? 0.251   -5.936  20.299  1.00 10.00 ? 416 MET A HB2  10 
ATOM 10474 H HB3  . MET A 1 7  ? 0.997   -4.650  19.362  1.00 10.00 ? 416 MET A HB3  10 
ATOM 10475 H HG2  . MET A 1 7  ? 1.960   -3.682  21.310  1.00 10.00 ? 416 MET A HG2  10 
ATOM 10476 H HG3  . MET A 1 7  ? 1.036   -4.750  22.365  1.00 10.00 ? 416 MET A HG3  10 
ATOM 10477 H HE1  . MET A 1 7  ? 2.730   -7.676  22.919  1.00 10.00 ? 416 MET A HE1  10 
ATOM 10478 H HE2  . MET A 1 7  ? 1.939   -8.057  21.389  1.00 10.00 ? 416 MET A HE2  10 
ATOM 10479 H HE3  . MET A 1 7  ? 1.146   -6.992  22.551  1.00 10.00 ? 416 MET A HE3  10 
ATOM 10480 N N    . ALA A 1 8  ? -2.431  -3.066  19.019  1.00 10.00 ? 417 ALA A N    10 
ATOM 10481 C CA   . ALA A 1 8  ? -3.228  -2.922  17.807  1.00 10.00 ? 417 ALA A CA   10 
ATOM 10482 C C    . ALA A 1 8  ? -2.476  -2.120  16.751  1.00 10.00 ? 417 ALA A C    10 
ATOM 10483 O O    . ALA A 1 8  ? -2.189  -0.938  16.945  1.00 10.00 ? 417 ALA A O    10 
ATOM 10484 C CB   . ALA A 1 8  ? -4.560  -2.260  18.127  1.00 10.00 ? 417 ALA A CB   10 
ATOM 10485 H H    . ALA A 1 8  ? -2.583  -2.451  19.767  1.00 10.00 ? 417 ALA A H    10 
ATOM 10486 H HA   . ALA A 1 8  ? -3.428  -3.910  17.420  1.00 10.00 ? 417 ALA A HA   10 
ATOM 10487 H HB1  . ALA A 1 8  ? -5.146  -2.916  18.755  1.00 10.00 ? 417 ALA A HB1  10 
ATOM 10488 H HB2  . ALA A 1 8  ? -5.096  -2.066  17.210  1.00 10.00 ? 417 ALA A HB2  10 
ATOM 10489 H HB3  . ALA A 1 8  ? -4.384  -1.329  18.646  1.00 10.00 ? 417 ALA A HB3  10 
ATOM 10490 N N    . ASP A 1 9  ? -2.160  -2.768  15.635  1.00 10.00 ? 418 ASP A N    10 
ATOM 10491 C CA   . ASP A 1 9  ? -1.440  -2.114  14.548  1.00 10.00 ? 418 ASP A CA   10 
ATOM 10492 C C    . ASP A 1 9  ? -1.213  -3.075  13.378  1.00 10.00 ? 418 ASP A C    10 
ATOM 10493 O O    . ASP A 1 9  ? -1.645  -2.805  12.258  1.00 10.00 ? 418 ASP A O    10 
ATOM 10494 C CB   . ASP A 1 9  ? -0.102  -1.554  15.048  1.00 10.00 ? 418 ASP A CB   10 
ATOM 10495 C CG   . ASP A 1 9  ? 0.726   -0.940  13.935  1.00 10.00 ? 418 ASP A CG   10 
ATOM 10496 O OD1  . ASP A 1 9  ? 0.130   -0.403  12.978  1.00 10.00 ? 418 ASP A OD1  10 
ATOM 10497 O OD2  . ASP A 1 9  ? 1.971   -0.996  14.021  1.00 10.00 ? 418 ASP A OD2  10 
ATOM 10498 H H    . ASP A 1 9  ? -2.418  -3.708  15.540  1.00 10.00 ? 418 ASP A H    10 
ATOM 10499 H HA   . ASP A 1 9  ? -2.051  -1.294  14.201  1.00 10.00 ? 418 ASP A HA   10 
ATOM 10500 H HB2  . ASP A 1 9  ? -0.294  -0.791  15.787  1.00 10.00 ? 418 ASP A HB2  10 
ATOM 10501 H HB3  . ASP A 1 9  ? 0.469   -2.348  15.501  1.00 10.00 ? 418 ASP A HB3  10 
ATOM 10502 N N    . PRO A 1 10 ? -0.528  -4.214  13.613  1.00 10.00 ? 419 PRO A N    10 
ATOM 10503 C CA   . PRO A 1 10 ? -0.258  -5.197  12.558  1.00 10.00 ? 419 PRO A CA   10 
ATOM 10504 C C    . PRO A 1 10 ? -1.533  -5.682  11.877  1.00 10.00 ? 419 PRO A C    10 
ATOM 10505 O O    . PRO A 1 10 ? -2.460  -6.154  12.536  1.00 10.00 ? 419 PRO A O    10 
ATOM 10506 C CB   . PRO A 1 10 ? 0.432   -6.354  13.296  1.00 10.00 ? 419 PRO A CB   10 
ATOM 10507 C CG   . PRO A 1 10 ? 0.154   -6.123  14.743  1.00 10.00 ? 419 PRO A CG   10 
ATOM 10508 C CD   . PRO A 1 10 ? 0.033   -4.636  14.906  1.00 10.00 ? 419 PRO A CD   10 
ATOM 10509 H HA   . PRO A 1 10 ? 0.412   -4.794  11.812  1.00 10.00 ? 419 PRO A HA   10 
ATOM 10510 H HB2  . PRO A 1 10 ? 0.017   -7.294  12.961  1.00 10.00 ? 419 PRO A HB2  10 
ATOM 10511 H HB3  . PRO A 1 10 ? 1.492   -6.332  13.092  1.00 10.00 ? 419 PRO A HB3  10 
ATOM 10512 H HG2  . PRO A 1 10 ? -0.770  -6.608  15.021  1.00 10.00 ? 419 PRO A HG2  10 
ATOM 10513 H HG3  . PRO A 1 10 ? 0.971   -6.500  15.339  1.00 10.00 ? 419 PRO A HG3  10 
ATOM 10514 H HD2  . PRO A 1 10 ? -0.634  -4.400  15.720  1.00 10.00 ? 419 PRO A HD2  10 
ATOM 10515 H HD3  . PRO A 1 10 ? 1.004   -4.193  15.068  1.00 10.00 ? 419 PRO A HD3  10 
ATOM 10516 N N    . MET A 1 11 ? -1.573  -5.557  10.555  1.00 10.00 ? 420 MET A N    10 
ATOM 10517 C CA   . MET A 1 11 ? -2.736  -5.977  9.780   1.00 10.00 ? 420 MET A CA   10 
ATOM 10518 C C    . MET A 1 11 ? -2.397  -6.090  8.307   1.00 10.00 ? 420 MET A C    10 
ATOM 10519 O O    . MET A 1 11 ? -2.646  -7.117  7.675   1.00 10.00 ? 420 MET A O    10 
ATOM 10520 C CB   . MET A 1 11 ? -3.875  -4.975  9.958   1.00 10.00 ? 420 MET A CB   10 
ATOM 10521 C CG   . MET A 1 11 ? -5.214  -5.485  9.452   1.00 10.00 ? 420 MET A CG   10 
ATOM 10522 S SD   . MET A 1 11 ? -6.350  -5.907  10.788  1.00 10.00 ? 420 MET A SD   10 
ATOM 10523 C CE   . MET A 1 11 ? -5.664  -7.470  11.331  1.00 10.00 ? 420 MET A CE   10 
ATOM 10524 H H    . MET A 1 11 ? -0.804  -5.169  10.089  1.00 10.00 ? 420 MET A H    10 
ATOM 10525 H HA   . MET A 1 11 ? -3.048  -6.944  10.138  1.00 10.00 ? 420 MET A HA   10 
ATOM 10526 H HB2  . MET A 1 11 ? -3.972  -4.739  11.007  1.00 10.00 ? 420 MET A HB2  10 
ATOM 10527 H HB3  . MET A 1 11 ? -3.627  -4.071  9.413   1.00 10.00 ? 420 MET A HB3  10 
ATOM 10528 H HG2  . MET A 1 11 ? -5.668  -4.719  8.842   1.00 10.00 ? 420 MET A HG2  10 
ATOM 10529 H HG3  . MET A 1 11 ? -5.045  -6.366  8.851   1.00 10.00 ? 420 MET A HG3  10 
ATOM 10530 H HE1  . MET A 1 11 ? -4.803  -7.715  10.726  1.00 10.00 ? 420 MET A HE1  10 
ATOM 10531 H HE2  . MET A 1 11 ? -6.408  -8.245  11.229  1.00 10.00 ? 420 MET A HE2  10 
ATOM 10532 H HE3  . MET A 1 11 ? -5.365  -7.392  12.365  1.00 10.00 ? 420 MET A HE3  10 
ATOM 10533 N N    . LYS A 1 12 ? -1.826  -5.027  7.765   1.00 10.00 ? 421 LYS A N    10 
ATOM 10534 C CA   . LYS A 1 12 ? -1.451  -5.006  6.363   1.00 10.00 ? 421 LYS A CA   10 
ATOM 10535 C C    . LYS A 1 12 ? 0.045   -5.216  6.188   1.00 10.00 ? 421 LYS A C    10 
ATOM 10536 O O    . LYS A 1 12 ? 0.847   -4.366  6.566   1.00 10.00 ? 421 LYS A O    10 
ATOM 10537 C CB   . LYS A 1 12 ? -1.866  -3.700  5.713   1.00 10.00 ? 421 LYS A CB   10 
ATOM 10538 C CG   . LYS A 1 12 ? -2.359  -3.893  4.296   1.00 10.00 ? 421 LYS A CG   10 
ATOM 10539 C CD   . LYS A 1 12 ? -3.776  -4.425  4.285   1.00 10.00 ? 421 LYS A CD   10 
ATOM 10540 C CE   . LYS A 1 12 ? -4.253  -4.724  2.872   1.00 10.00 ? 421 LYS A CE   10 
ATOM 10541 N NZ   . LYS A 1 12 ? -5.711  -5.027  2.830   1.00 10.00 ? 421 LYS A NZ   10 
ATOM 10542 H H    . LYS A 1 12 ? -1.655  -4.241  8.321   1.00 10.00 ? 421 LYS A H    10 
ATOM 10543 H HA   . LYS A 1 12 ? -1.970  -5.817  5.875   1.00 10.00 ? 421 LYS A HA   10 
ATOM 10544 H HB2  . LYS A 1 12 ? -2.658  -3.251  6.296   1.00 10.00 ? 421 LYS A HB2  10 
ATOM 10545 H HB3  . LYS A 1 12 ? -1.019  -3.037  5.693   1.00 10.00 ? 421 LYS A HB3  10 
ATOM 10546 H HG2  . LYS A 1 12 ? -2.330  -2.947  3.781   1.00 10.00 ? 421 LYS A HG2  10 
ATOM 10547 H HG3  . LYS A 1 12 ? -1.714  -4.601  3.800   1.00 10.00 ? 421 LYS A HG3  10 
ATOM 10548 H HD2  . LYS A 1 12 ? -3.810  -5.334  4.868   1.00 10.00 ? 421 LYS A HD2  10 
ATOM 10549 H HD3  . LYS A 1 12 ? -4.426  -3.686  4.727   1.00 10.00 ? 421 LYS A HD3  10 
ATOM 10550 H HE2  . LYS A 1 12 ? -4.054  -3.865  2.250   1.00 10.00 ? 421 LYS A HE2  10 
ATOM 10551 H HE3  . LYS A 1 12 ? -3.706  -5.576  2.495   1.00 10.00 ? 421 LYS A HE3  10 
ATOM 10552 H HZ1  . LYS A 1 12 ? -5.886  -5.858  2.230   1.00 10.00 ? 421 LYS A HZ1  10 
ATOM 10553 H HZ2  . LYS A 1 12 ? -6.233  -4.216  2.439   1.00 10.00 ? 421 LYS A HZ2  10 
ATOM 10554 H HZ3  . LYS A 1 12 ? -6.065  -5.223  3.788   1.00 10.00 ? 421 LYS A HZ3  10 
ATOM 10555 N N    . VAL A 1 13 ? 0.382   -6.365  5.606   1.00 10.00 ? 422 VAL A N    10 
ATOM 10556 C CA   . VAL A 1 13 ? 1.762   -6.780  5.337   1.00 10.00 ? 422 VAL A CA   10 
ATOM 10557 C C    . VAL A 1 13 ? 1.923   -8.250  5.715   1.00 10.00 ? 422 VAL A C    10 
ATOM 10558 O O    . VAL A 1 13 ? 2.959   -8.675  6.228   1.00 10.00 ? 422 VAL A O    10 
ATOM 10559 C CB   . VAL A 1 13 ? 2.813   -5.923  6.084   1.00 10.00 ? 422 VAL A CB   10 
ATOM 10560 C CG1  . VAL A 1 13 ? 2.711   -6.107  7.591   1.00 10.00 ? 422 VAL A CG1  10 
ATOM 10561 C CG2  . VAL A 1 13 ? 4.215   -6.262  5.603   1.00 10.00 ? 422 VAL A CG2  10 
ATOM 10562 H H    . VAL A 1 13 ? -0.340  -6.970  5.342   1.00 10.00 ? 422 VAL A H    10 
ATOM 10563 H HA   . VAL A 1 13 ? 1.932   -6.679  4.273   1.00 10.00 ? 422 VAL A HA   10 
ATOM 10564 H HB   . VAL A 1 13 ? 2.620   -4.881  5.854   1.00 10.00 ? 422 VAL A HB   10 
ATOM 10565 H HG11 . VAL A 1 13 ? 3.620   -5.755  8.057   1.00 10.00 ? 422 VAL A HG11 10 
ATOM 10566 H HG12 . VAL A 1 13 ? 2.575   -7.153  7.819   1.00 10.00 ? 422 VAL A HG12 10 
ATOM 10567 H HG13 . VAL A 1 13 ? 1.873   -5.544  7.970   1.00 10.00 ? 422 VAL A HG13 10 
ATOM 10568 H HG21 . VAL A 1 13 ? 4.842   -5.387  5.677   1.00 10.00 ? 422 VAL A HG21 10 
ATOM 10569 H HG22 . VAL A 1 13 ? 4.173   -6.591  4.576   1.00 10.00 ? 422 VAL A HG22 10 
ATOM 10570 H HG23 . VAL A 1 13 ? 4.624   -7.051  6.216   1.00 10.00 ? 422 VAL A HG23 10 
ATOM 10571 N N    . TYR A 1 14 ? 0.859   -9.007  5.459   1.00 10.00 ? 423 TYR A N    10 
ATOM 10572 C CA   . TYR A 1 14 ? 0.799   -10.433 5.759   1.00 10.00 ? 423 TYR A CA   10 
ATOM 10573 C C    . TYR A 1 14 ? -0.123  -11.110 4.759   1.00 10.00 ? 423 TYR A C    10 
ATOM 10574 O O    . TYR A 1 14 ? 0.194   -12.162 4.205   1.00 10.00 ? 423 TYR A O    10 
ATOM 10575 C CB   . TYR A 1 14 ? 0.278   -10.657 7.189   1.00 10.00 ? 423 TYR A CB   10 
ATOM 10576 C CG   . TYR A 1 14 ? 0.597   -9.525  8.137   1.00 10.00 ? 423 TYR A CG   10 
ATOM 10577 C CD1  . TYR A 1 14 ? 0.015   -8.278  7.966   1.00 10.00 ? 423 TYR A CD1  10 
ATOM 10578 C CD2  . TYR A 1 14 ? 1.478   -9.701  9.196   1.00 10.00 ? 423 TYR A CD2  10 
ATOM 10579 C CE1  . TYR A 1 14 ? 0.301   -7.236  8.818   1.00 10.00 ? 423 TYR A CE1  10 
ATOM 10580 C CE2  . TYR A 1 14 ? 1.770   -8.660  10.056  1.00 10.00 ? 423 TYR A CE2  10 
ATOM 10581 C CZ   . TYR A 1 14 ? 1.181   -7.429  9.863   1.00 10.00 ? 423 TYR A CZ   10 
ATOM 10582 O OH   . TYR A 1 14 ? 1.469   -6.390  10.717  1.00 10.00 ? 423 TYR A OH   10 
ATOM 10583 H H    . TYR A 1 14 ? 0.075   -8.587  5.057   1.00 10.00 ? 423 TYR A H    10 
ATOM 10584 H HA   . TYR A 1 14 ? 1.790   -10.847 5.660   1.00 10.00 ? 423 TYR A HA   10 
ATOM 10585 H HB2  . TYR A 1 14 ? -0.798  -10.761 7.162   1.00 10.00 ? 423 TYR A HB2  10 
ATOM 10586 H HB3  . TYR A 1 14 ? 0.713   -11.560 7.589   1.00 10.00 ? 423 TYR A HB3  10 
ATOM 10587 H HD1  . TYR A 1 14 ? -0.676  -8.128  7.148   1.00 10.00 ? 423 TYR A HD1  10 
ATOM 10588 H HD2  . TYR A 1 14 ? 1.940   -10.665 9.341   1.00 10.00 ? 423 TYR A HD2  10 
ATOM 10589 H HE1  . TYR A 1 14 ? -0.158  -6.274  8.657   1.00 10.00 ? 423 TYR A HE1  10 
ATOM 10590 H HE2  . TYR A 1 14 ? 2.459   -8.813  10.874  1.00 10.00 ? 423 TYR A HE2  10 
ATOM 10591 H HH   . TYR A 1 14 ? 1.654   -5.598  10.206  1.00 10.00 ? 423 TYR A HH   10 
ATOM 10592 N N    . LYS A 1 15 ? -1.260  -10.470 4.522   1.00 10.00 ? 424 LYS A N    10 
ATOM 10593 C CA   . LYS A 1 15 ? -2.243  -10.966 3.572   1.00 10.00 ? 424 LYS A CA   10 
ATOM 10594 C C    . LYS A 1 15 ? -2.168  -10.160 2.276   1.00 10.00 ? 424 LYS A C    10 
ATOM 10595 O O    . LYS A 1 15 ? -2.917  -10.409 1.331   1.00 10.00 ? 424 LYS A O    10 
ATOM 10596 C CB   . LYS A 1 15 ? -3.656  -10.876 4.162   1.00 10.00 ? 424 LYS A CB   10 
ATOM 10597 C CG   . LYS A 1 15 ? -3.686  -10.756 5.679   1.00 10.00 ? 424 LYS A CG   10 
ATOM 10598 C CD   . LYS A 1 15 ? -5.112  -10.721 6.207   1.00 10.00 ? 424 LYS A CD   10 
ATOM 10599 C CE   . LYS A 1 15 ? -5.250  -9.759  7.376   1.00 10.00 ? 424 LYS A CE   10 
ATOM 10600 N NZ   . LYS A 1 15 ? -4.956  -10.419 8.677   1.00 10.00 ? 424 LYS A NZ   10 
ATOM 10601 H H    . LYS A 1 15 ? -1.437  -9.626  4.990   1.00 10.00 ? 424 LYS A H    10 
ATOM 10602 H HA   . LYS A 1 15 ? -2.012  -12.000 3.359   1.00 10.00 ? 424 LYS A HA   10 
ATOM 10603 H HB2  . LYS A 1 15 ? -4.150  -10.012 3.746   1.00 10.00 ? 424 LYS A HB2  10 
ATOM 10604 H HB3  . LYS A 1 15 ? -4.206  -11.763 3.882   1.00 10.00 ? 424 LYS A HB3  10 
ATOM 10605 H HG2  . LYS A 1 15 ? -3.176  -11.605 6.109   1.00 10.00 ? 424 LYS A HG2  10 
ATOM 10606 H HG3  . LYS A 1 15 ? -3.182  -9.844  5.970   1.00 10.00 ? 424 LYS A HG3  10 
ATOM 10607 H HD2  . LYS A 1 15 ? -5.771  -10.405 5.413   1.00 10.00 ? 424 LYS A HD2  10 
ATOM 10608 H HD3  . LYS A 1 15 ? -5.388  -11.713 6.534   1.00 10.00 ? 424 LYS A HD3  10 
ATOM 10609 H HE2  . LYS A 1 15 ? -4.560  -8.940  7.235   1.00 10.00 ? 424 LYS A HE2  10 
ATOM 10610 H HE3  . LYS A 1 15 ? -6.261  -9.378  7.394   1.00 10.00 ? 424 LYS A HE3  10 
ATOM 10611 H HZ1  . LYS A 1 15 ? -4.637  -9.715  9.372   1.00 10.00 ? 424 LYS A HZ1  10 
ATOM 10612 H HZ2  . LYS A 1 15 ? -4.211  -11.133 8.557   1.00 10.00 ? 424 LYS A HZ2  10 
ATOM 10613 H HZ3  . LYS A 1 15 ? -5.812  -10.887 9.041   1.00 10.00 ? 424 LYS A HZ3  10 
ATOM 10614 N N    . ASP A 1 16 ? -1.257  -9.186  2.245   1.00 10.00 ? 425 ASP A N    10 
ATOM 10615 C CA   . ASP A 1 16 ? -1.078  -8.331  1.077   1.00 10.00 ? 425 ASP A CA   10 
ATOM 10616 C C    . ASP A 1 16 ? 0.238   -8.625  0.356   1.00 10.00 ? 425 ASP A C    10 
ATOM 10617 O O    . ASP A 1 16 ? 0.573   -7.960  -0.623  1.00 10.00 ? 425 ASP A O    10 
ATOM 10618 C CB   . ASP A 1 16 ? -1.127  -6.850  1.479   1.00 10.00 ? 425 ASP A CB   10 
ATOM 10619 C CG   . ASP A 1 16 ? -0.658  -6.603  2.900   1.00 10.00 ? 425 ASP A CG   10 
ATOM 10620 O OD1  . ASP A 1 16 ? -1.257  -7.180  3.832   1.00 10.00 ? 425 ASP A OD1  10 
ATOM 10621 O OD2  . ASP A 1 16 ? 0.304   -5.828  3.078   1.00 10.00 ? 425 ASP A OD2  10 
ATOM 10622 H H    . ASP A 1 16 ? -0.696  -9.035  3.032   1.00 10.00 ? 425 ASP A H    10 
ATOM 10623 H HA   . ASP A 1 16 ? -1.893  -8.532  0.399   1.00 10.00 ? 425 ASP A HA   10 
ATOM 10624 H HB2  . ASP A 1 16 ? -0.494  -6.284  0.814   1.00 10.00 ? 425 ASP A HB2  10 
ATOM 10625 H HB3  . ASP A 1 16 ? -2.143  -6.495  1.389   1.00 10.00 ? 425 ASP A HB3  10 
ATOM 10626 N N    . ARG A 1 17 ? 0.980   -9.625  0.829   1.00 10.00 ? 426 ARG A N    10 
ATOM 10627 C CA   . ARG A 1 17 ? 2.248   -9.989  0.198   1.00 10.00 ? 426 ARG A CA   10 
ATOM 10628 C C    . ARG A 1 17 ? 2.039   -10.328 -1.273  1.00 10.00 ? 426 ARG A C    10 
ATOM 10629 O O    . ARG A 1 17 ? 2.975   -10.284 -2.072  1.00 10.00 ? 426 ARG A O    10 
ATOM 10630 C CB   . ARG A 1 17 ? 2.891   -11.171 0.925   1.00 10.00 ? 426 ARG A CB   10 
ATOM 10631 C CG   . ARG A 1 17 ? 4.347   -11.397 0.552   1.00 10.00 ? 426 ARG A CG   10 
ATOM 10632 C CD   . ARG A 1 17 ? 5.027   -12.356 1.515   1.00 10.00 ? 426 ARG A CD   10 
ATOM 10633 N NE   . ARG A 1 17 ? 6.359   -12.740 1.055   1.00 10.00 ? 426 ARG A NE   10 
ATOM 10634 C CZ   . ARG A 1 17 ? 7.142   -13.607 1.693   1.00 10.00 ? 426 ARG A CZ   10 
ATOM 10635 N NH1  . ARG A 1 17 ? 6.730   -14.184 2.815   1.00 10.00 ? 426 ARG A NH1  10 
ATOM 10636 N NH2  . ARG A 1 17 ? 8.340   -13.901 1.207   1.00 10.00 ? 426 ARG A NH2  10 
ATOM 10637 H H    . ARG A 1 17 ? 0.668   -10.133 1.606   1.00 10.00 ? 426 ARG A H    10 
ATOM 10638 H HA   . ARG A 1 17 ? 2.904   -9.134  0.258   1.00 10.00 ? 426 ARG A HA   10 
ATOM 10639 H HB2  . ARG A 1 17 ? 2.836   -10.997 1.990   1.00 10.00 ? 426 ARG A HB2  10 
ATOM 10640 H HB3  . ARG A 1 17 ? 2.337   -12.068 0.688   1.00 10.00 ? 426 ARG A HB3  10 
ATOM 10641 H HG2  . ARG A 1 17 ? 4.392   -11.811 -0.445  1.00 10.00 ? 426 ARG A HG2  10 
ATOM 10642 H HG3  . ARG A 1 17 ? 4.864   -10.449 0.574   1.00 10.00 ? 426 ARG A HG3  10 
ATOM 10643 H HD2  . ARG A 1 17 ? 5.113   -11.877 2.479   1.00 10.00 ? 426 ARG A HD2  10 
ATOM 10644 H HD3  . ARG A 1 17 ? 4.419   -13.244 1.608   1.00 10.00 ? 426 ARG A HD3  10 
ATOM 10645 H HE   . ARG A 1 17 ? 6.689   -12.329 0.229   1.00 10.00 ? 426 ARG A HE   10 
ATOM 10646 H HH11 . ARG A 1 17 ? 5.827   -13.967 3.188   1.00 10.00 ? 426 ARG A HH11 10 
ATOM 10647 H HH12 . ARG A 1 17 ? 7.322   -14.835 3.290   1.00 10.00 ? 426 ARG A HH12 10 
ATOM 10648 H HH21 . ARG A 1 17 ? 8.656   -13.470 0.361   1.00 10.00 ? 426 ARG A HH21 10 
ATOM 10649 H HH22 . ARG A 1 17 ? 8.928   -14.553 1.686   1.00 10.00 ? 426 ARG A HH22 10 
ATOM 10650 N N    . GLN A 1 18 ? 0.798   -10.637 -1.626  1.00 10.00 ? 427 GLN A N    10 
ATOM 10651 C CA   . GLN A 1 18 ? 0.447   -10.950 -3.002  1.00 10.00 ? 427 GLN A CA   10 
ATOM 10652 C C    . GLN A 1 18 ? -0.204  -9.732  -3.642  1.00 10.00 ? 427 GLN A C    10 
ATOM 10653 O O    . GLN A 1 18 ? -1.052  -9.845  -4.526  1.00 10.00 ? 427 GLN A O    10 
ATOM 10654 C CB   . GLN A 1 18 ? -0.490  -12.167 -3.067  1.00 10.00 ? 427 GLN A CB   10 
ATOM 10655 C CG   . GLN A 1 18 ? -1.267  -12.431 -1.779  1.00 10.00 ? 427 GLN A CG   10 
ATOM 10656 C CD   . GLN A 1 18 ? -0.395  -12.988 -0.664  1.00 10.00 ? 427 GLN A CD   10 
ATOM 10657 O OE1  . GLN A 1 18 ? 0.294   -13.992 -0.840  1.00 10.00 ? 427 GLN A OE1  10 
ATOM 10658 N NE2  . GLN A 1 18 ? -0.425  -12.332 0.496   1.00 10.00 ? 427 GLN A NE2  10 
ATOM 10659 H H    . GLN A 1 18 ? 0.095   -10.631 -0.949  1.00 10.00 ? 427 GLN A H    10 
ATOM 10660 H HA   . GLN A 1 18 ? 1.359   -11.170 -3.538  1.00 10.00 ? 427 GLN A HA   10 
ATOM 10661 H HB2  . GLN A 1 18 ? -1.203  -12.014 -3.862  1.00 10.00 ? 427 GLN A HB2  10 
ATOM 10662 H HB3  . GLN A 1 18 ? 0.098   -13.045 -3.291  1.00 10.00 ? 427 GLN A HB3  10 
ATOM 10663 H HG2  . GLN A 1 18 ? -1.704  -11.504 -1.443  1.00 10.00 ? 427 GLN A HG2  10 
ATOM 10664 H HG3  . GLN A 1 18 ? -2.054  -13.143 -1.989  1.00 10.00 ? 427 GLN A HG3  10 
ATOM 10665 H HE21 . GLN A 1 18 ? -0.999  -11.540 0.563   1.00 10.00 ? 427 GLN A HE21 10 
ATOM 10666 H HE22 . GLN A 1 18 ? 0.131   -12.663 1.236   1.00 10.00 ? 427 GLN A HE22 10 
ATOM 10667 N N    . VAL A 1 19 ? 0.223   -8.564  -3.173  1.00 10.00 ? 428 VAL A N    10 
ATOM 10668 C CA   . VAL A 1 19 ? -0.278  -7.292  -3.665  1.00 10.00 ? 428 VAL A CA   10 
ATOM 10669 C C    . VAL A 1 19 ? 0.783   -6.597  -4.494  1.00 10.00 ? 428 VAL A C    10 
ATOM 10670 O O    . VAL A 1 19 ? 0.468   -5.889  -5.451  1.00 10.00 ? 428 VAL A O    10 
ATOM 10671 C CB   . VAL A 1 19 ? -0.697  -6.375  -2.507  1.00 10.00 ? 428 VAL A CB   10 
ATOM 10672 C CG1  . VAL A 1 19 ? -1.150  -5.016  -3.019  1.00 10.00 ? 428 VAL A CG1  10 
ATOM 10673 C CG2  . VAL A 1 19 ? -1.788  -7.034  -1.685  1.00 10.00 ? 428 VAL A CG2  10 
ATOM 10674 H H    . VAL A 1 19 ? 0.904   -8.561  -2.472  1.00 10.00 ? 428 VAL A H    10 
ATOM 10675 H HA   . VAL A 1 19 ? -1.140  -7.482  -4.283  1.00 10.00 ? 428 VAL A HA   10 
ATOM 10676 H HB   . VAL A 1 19 ? 0.161   -6.223  -1.870  1.00 10.00 ? 428 VAL A HB   10 
ATOM 10677 H HG11 . VAL A 1 19 ? -0.990  -4.956  -4.088  1.00 10.00 ? 428 VAL A HG11 10 
ATOM 10678 H HG12 . VAL A 1 19 ? -0.578  -4.248  -2.527  1.00 10.00 ? 428 VAL A HG12 10 
ATOM 10679 H HG13 . VAL A 1 19 ? -2.198  -4.878  -2.802  1.00 10.00 ? 428 VAL A HG13 10 
ATOM 10680 H HG21 . VAL A 1 19 ? -2.716  -7.005  -2.233  1.00 10.00 ? 428 VAL A HG21 10 
ATOM 10681 H HG22 . VAL A 1 19 ? -1.902  -6.503  -0.754  1.00 10.00 ? 428 VAL A HG22 10 
ATOM 10682 H HG23 . VAL A 1 19 ? -1.518  -8.061  -1.485  1.00 10.00 ? 428 VAL A HG23 10 
ATOM 10683 N N    . MET A 1 20 ? 2.048   -6.816  -4.138  1.00 10.00 ? 429 MET A N    10 
ATOM 10684 C CA   . MET A 1 20 ? 3.154   -6.220  -4.880  1.00 10.00 ? 429 MET A CA   10 
ATOM 10685 C C    . MET A 1 20 ? 2.935   -6.388  -6.383  1.00 10.00 ? 429 MET A C    10 
ATOM 10686 O O    . MET A 1 20 ? 3.437   -5.605  -7.191  1.00 10.00 ? 429 MET A O    10 
ATOM 10687 C CB   . MET A 1 20 ? 4.481   -6.863  -4.467  1.00 10.00 ? 429 MET A CB   10 
ATOM 10688 C CG   . MET A 1 20 ? 5.703   -6.107  -4.962  1.00 10.00 ? 429 MET A CG   10 
ATOM 10689 S SD   . MET A 1 20 ? 7.116   -7.187  -5.252  1.00 10.00 ? 429 MET A SD   10 
ATOM 10690 C CE   . MET A 1 20 ? 7.265   -7.987  -3.657  1.00 10.00 ? 429 MET A CE   10 
ATOM 10691 H H    . MET A 1 20 ? 2.238   -7.403  -3.371  1.00 10.00 ? 429 MET A H    10 
ATOM 10692 H HA   . MET A 1 20 ? 3.183   -5.166  -4.646  1.00 10.00 ? 429 MET A HA   10 
ATOM 10693 H HB2  . MET A 1 20 ? 4.524   -6.910  -3.389  1.00 10.00 ? 429 MET A HB2  10 
ATOM 10694 H HB3  . MET A 1 20 ? 4.519   -7.866  -4.865  1.00 10.00 ? 429 MET A HB3  10 
ATOM 10695 H HG2  . MET A 1 20 ? 5.452   -5.610  -5.887  1.00 10.00 ? 429 MET A HG2  10 
ATOM 10696 H HG3  . MET A 1 20 ? 5.977   -5.368  -4.223  1.00 10.00 ? 429 MET A HG3  10 
ATOM 10697 H HE1  . MET A 1 20 ? 7.542   -7.255  -2.912  1.00 10.00 ? 429 MET A HE1  10 
ATOM 10698 H HE2  . MET A 1 20 ? 8.024   -8.753  -3.708  1.00 10.00 ? 429 MET A HE2  10 
ATOM 10699 H HE3  . MET A 1 20 ? 6.320   -8.434  -3.389  1.00 10.00 ? 429 MET A HE3  10 
ATOM 10700 N N    . ASN A 1 21 ? 2.170   -7.419  -6.746  1.00 10.00 ? 430 ASN A N    10 
ATOM 10701 C CA   . ASN A 1 21 ? 1.864   -7.703  -8.138  1.00 10.00 ? 430 ASN A CA   10 
ATOM 10702 C C    . ASN A 1 21 ? 0.360   -7.895  -8.339  1.00 10.00 ? 430 ASN A C    10 
ATOM 10703 O O    . ASN A 1 21 ? -0.068  -8.584  -9.265  1.00 10.00 ? 430 ASN A O    10 
ATOM 10704 C CB   . ASN A 1 21 ? 2.615   -8.958  -8.585  1.00 10.00 ? 430 ASN A CB   10 
ATOM 10705 C CG   . ASN A 1 21 ? 2.435   -9.253  -10.061 1.00 10.00 ? 430 ASN A CG   10 
ATOM 10706 O OD1  . ASN A 1 21 ? 3.035   -8.602  -10.915 1.00 10.00 ? 430 ASN A OD1  10 
ATOM 10707 N ND2  . ASN A 1 21 ? 1.602   -10.241 -10.369 1.00 10.00 ? 430 ASN A ND2  10 
ATOM 10708 H H    . ASN A 1 21 ? 1.800   -8.004  -6.054  1.00 10.00 ? 430 ASN A H    10 
ATOM 10709 H HA   . ASN A 1 21 ? 2.189   -6.861  -8.731  1.00 10.00 ? 430 ASN A HA   10 
ATOM 10710 H HB2  . ASN A 1 21 ? 3.669   -8.826  -8.390  1.00 10.00 ? 430 ASN A HB2  10 
ATOM 10711 H HB3  . ASN A 1 21 ? 2.253   -9.806  -8.016  1.00 10.00 ? 430 ASN A HB3  10 
ATOM 10712 H HD21 . ASN A 1 21 ? 1.157   -10.718 -9.637  1.00 10.00 ? 430 ASN A HD21 10 
ATOM 10713 H HD22 . ASN A 1 21 ? 1.466   -10.454 -11.316 1.00 10.00 ? 430 ASN A HD22 10 
ATOM 10714 N N    . MET A 1 22 ? -0.440  -7.278  -7.469  1.00 10.00 ? 431 MET A N    10 
ATOM 10715 C CA   . MET A 1 22 ? -1.897  -7.379  -7.555  1.00 10.00 ? 431 MET A CA   10 
ATOM 10716 C C    . MET A 1 22 ? -2.569  -6.794  -6.320  1.00 10.00 ? 431 MET A C    10 
ATOM 10717 O O    . MET A 1 22 ? -2.893  -7.519  -5.379  1.00 10.00 ? 431 MET A O    10 
ATOM 10718 C CB   . MET A 1 22 ? -2.335  -8.834  -7.714  1.00 10.00 ? 431 MET A CB   10 
ATOM 10719 C CG   . MET A 1 22 ? -2.721  -9.205  -9.136  1.00 10.00 ? 431 MET A CG   10 
ATOM 10720 S SD   . MET A 1 22 ? -4.503  -9.157  -9.406  1.00 10.00 ? 431 MET A SD   10 
ATOM 10721 C CE   . MET A 1 22 ? -4.594  -9.592  -11.142 1.00 10.00 ? 431 MET A CE   10 
ATOM 10722 H H    . MET A 1 22 ? -0.042  -6.739  -6.757  1.00 10.00 ? 431 MET A H    10 
ATOM 10723 H HA   . MET A 1 22 ? -2.217  -6.821  -8.423  1.00 10.00 ? 431 MET A HA   10 
ATOM 10724 H HB2  . MET A 1 22 ? -1.526  -9.477  -7.402  1.00 10.00 ? 431 MET A HB2  10 
ATOM 10725 H HB3  . MET A 1 22 ? -3.190  -9.006  -7.073  1.00 10.00 ? 431 MET A HB3  10 
ATOM 10726 H HG2  . MET A 1 22 ? -2.250  -8.510  -9.816  1.00 10.00 ? 431 MET A HG2  10 
ATOM 10727 H HG3  . MET A 1 22 ? -2.367  -10.204 -9.343  1.00 10.00 ? 431 MET A HG3  10 
ATOM 10728 H HE1  . MET A 1 22 ? -5.050  -8.782  -11.693 1.00 10.00 ? 431 MET A HE1  10 
ATOM 10729 H HE2  . MET A 1 22 ? -5.189  -10.486 -11.258 1.00 10.00 ? 431 MET A HE2  10 
ATOM 10730 H HE3  . MET A 1 22 ? -3.599  -9.770  -11.521 1.00 10.00 ? 431 MET A HE3  10 
ATOM 10731 N N    . TRP A 1 23 ? -2.815  -5.495  -6.341  1.00 10.00 ? 432 TRP A N    10 
ATOM 10732 C CA   . TRP A 1 23 ? -3.485  -4.837  -5.230  1.00 10.00 ? 432 TRP A CA   10 
ATOM 10733 C C    . TRP A 1 23 ? -4.987  -4.921  -5.442  1.00 10.00 ? 432 TRP A C    10 
ATOM 10734 O O    . TRP A 1 23 ? -5.566  -4.175  -6.233  1.00 10.00 ? 432 TRP A O    10 
ATOM 10735 C CB   . TRP A 1 23 ? -3.044  -3.376  -5.085  1.00 10.00 ? 432 TRP A CB   10 
ATOM 10736 C CG   . TRP A 1 23 ? -1.623  -3.094  -5.493  1.00 10.00 ? 432 TRP A CG   10 
ATOM 10737 C CD1  . TRP A 1 23 ? -1.067  -3.289  -6.722  1.00 10.00 ? 432 TRP A CD1  10 
ATOM 10738 C CD2  . TRP A 1 23 ? -0.578  -2.547  -4.671  1.00 10.00 ? 432 TRP A CD2  10 
ATOM 10739 N NE1  . TRP A 1 23 ? 0.235   -2.866  -6.723  1.00 10.00 ? 432 TRP A NE1  10 
ATOM 10740 C CE2  . TRP A 1 23 ? 0.562   -2.416  -5.480  1.00 10.00 ? 432 TRP A CE2  10 
ATOM 10741 C CE3  . TRP A 1 23 ? -0.496  -2.144  -3.338  1.00 10.00 ? 432 TRP A CE3  10 
ATOM 10742 C CZ2  . TRP A 1 23 ? 1.761   -1.900  -5.008  1.00 10.00 ? 432 TRP A CZ2  10 
ATOM 10743 C CZ3  . TRP A 1 23 ? 0.698   -1.638  -2.863  1.00 10.00 ? 432 TRP A CZ3  10 
ATOM 10744 C CH2  . TRP A 1 23 ? 1.812   -1.515  -3.698  1.00 10.00 ? 432 TRP A CH2  10 
ATOM 10745 H H    . TRP A 1 23 ? -2.569  -4.977  -7.130  1.00 10.00 ? 432 TRP A H    10 
ATOM 10746 H HA   . TRP A 1 23 ? -3.244  -5.374  -4.324  1.00 10.00 ? 432 TRP A HA   10 
ATOM 10747 H HB2  . TRP A 1 23 ? -3.686  -2.757  -5.691  1.00 10.00 ? 432 TRP A HB2  10 
ATOM 10748 H HB3  . TRP A 1 23 ? -3.152  -3.085  -4.054  1.00 10.00 ? 432 TRP A HB3  10 
ATOM 10749 H HD1  . TRP A 1 23 ? -1.589  -3.702  -7.567  1.00 10.00 ? 432 TRP A HD1  10 
ATOM 10750 H HE1  . TRP A 1 23 ? 0.832   -2.886  -7.486  1.00 10.00 ? 432 TRP A HE1  10 
ATOM 10751 H HE3  . TRP A 1 23 ? -1.338  -2.236  -2.682  1.00 10.00 ? 432 TRP A HE3  10 
ATOM 10752 H HZ2  . TRP A 1 23 ? 2.622   -1.785  -5.648  1.00 10.00 ? 432 TRP A HZ2  10 
ATOM 10753 H HZ3  . TRP A 1 23 ? 0.777   -1.323  -1.832  1.00 10.00 ? 432 TRP A HZ3  10 
ATOM 10754 H HH2  . TRP A 1 23 ? 2.726   -1.118  -3.284  1.00 10.00 ? 432 TRP A HH2  10 
ATOM 10755 N N    . SER A 1 24 ? -5.601  -5.861  -4.744  1.00 10.00 ? 433 SER A N    10 
ATOM 10756 C CA   . SER A 1 24 ? -7.037  -6.096  -4.855  1.00 10.00 ? 433 SER A CA   10 
ATOM 10757 C C    . SER A 1 24 ? -7.839  -4.867  -4.456  1.00 10.00 ? 433 SER A C    10 
ATOM 10758 O O    . SER A 1 24 ? -7.400  -4.069  -3.630  1.00 10.00 ? 433 SER A O    10 
ATOM 10759 C CB   . SER A 1 24 ? -7.445  -7.287  -3.984  1.00 10.00 ? 433 SER A CB   10 
ATOM 10760 O OG   . SER A 1 24 ? -6.547  -8.371  -4.147  1.00 10.00 ? 433 SER A OG   10 
ATOM 10761 H H    . SER A 1 24 ? -5.065  -6.424  -4.146  1.00 10.00 ? 433 SER A H    10 
ATOM 10762 H HA   . SER A 1 24 ? -7.253  -6.331  -5.886  1.00 10.00 ? 433 SER A HA   10 
ATOM 10763 H HB2  . SER A 1 24 ? -7.444  -6.988  -2.946  1.00 10.00 ? 433 SER A HB2  10 
ATOM 10764 H HB3  . SER A 1 24 ? -8.436  -7.611  -4.264  1.00 10.00 ? 433 SER A HB3  10 
ATOM 10765 H HG   . SER A 1 24 ? -6.293  -8.708  -3.285  1.00 10.00 ? 433 SER A HG   10 
ATOM 10766 N N    . GLU A 1 25 ? -9.027  -4.726  -5.041  1.00 10.00 ? 434 GLU A N    10 
ATOM 10767 C CA   . GLU A 1 25 ? -9.898  -3.596  -4.733  1.00 10.00 ? 434 GLU A CA   10 
ATOM 10768 C C    . GLU A 1 25 ? -10.042 -3.440  -3.224  1.00 10.00 ? 434 GLU A C    10 
ATOM 10769 O O    . GLU A 1 25 ? -10.204 -2.332  -2.713  1.00 10.00 ? 434 GLU A O    10 
ATOM 10770 C CB   . GLU A 1 25 ? -11.274 -3.794  -5.373  1.00 10.00 ? 434 GLU A CB   10 
ATOM 10771 C CG   . GLU A 1 25 ? -12.100 -2.520  -5.445  1.00 10.00 ? 434 GLU A CG   10 
ATOM 10772 C CD   . GLU A 1 25 ? -11.540 -1.518  -6.437  1.00 10.00 ? 434 GLU A CD   10 
ATOM 10773 O OE1  . GLU A 1 25 ? -11.652 -1.764  -7.656  1.00 10.00 ? 434 GLU A OE1  10 
ATOM 10774 O OE2  . GLU A 1 25 ? -10.989 -0.489  -5.994  1.00 10.00 ? 434 GLU A OE2  10 
ATOM 10775 H H    . GLU A 1 25 ? -9.328  -5.401  -5.686  1.00 10.00 ? 434 GLU A H    10 
ATOM 10776 H HA   . GLU A 1 25 ? -9.444  -2.704  -5.137  1.00 10.00 ? 434 GLU A HA   10 
ATOM 10777 H HB2  . GLU A 1 25 ? -11.141 -4.168  -6.377  1.00 10.00 ? 434 GLU A HB2  10 
ATOM 10778 H HB3  . GLU A 1 25 ? -11.826 -4.522  -4.797  1.00 10.00 ? 434 GLU A HB3  10 
ATOM 10779 H HG2  . GLU A 1 25 ? -13.106 -2.774  -5.743  1.00 10.00 ? 434 GLU A HG2  10 
ATOM 10780 H HG3  . GLU A 1 25 ? -12.120 -2.063  -4.467  1.00 10.00 ? 434 GLU A HG3  10 
ATOM 10781 N N    . GLN A 1 26 ? -9.963  -4.564  -2.517  1.00 10.00 ? 435 GLN A N    10 
ATOM 10782 C CA   . GLN A 1 26 ? -10.065 -4.565  -1.067  1.00 10.00 ? 435 GLN A CA   10 
ATOM 10783 C C    . GLN A 1 26 ? -8.707  -4.275  -0.443  1.00 10.00 ? 435 GLN A C    10 
ATOM 10784 O O    . GLN A 1 26 ? -8.621  -3.675  0.628   1.00 10.00 ? 435 GLN A O    10 
ATOM 10785 C CB   . GLN A 1 26 ? -10.596 -5.910  -0.570  1.00 10.00 ? 435 GLN A CB   10 
ATOM 10786 C CG   . GLN A 1 26 ? -11.374 -5.814  0.732   1.00 10.00 ? 435 GLN A CG   10 
ATOM 10787 C CD   . GLN A 1 26 ? -12.868 -5.670  0.512   1.00 10.00 ? 435 GLN A CD   10 
ATOM 10788 O OE1  . GLN A 1 26 ? -13.673 -6.256  1.235   1.00 10.00 ? 435 GLN A OE1  10 
ATOM 10789 N NE2  . GLN A 1 26 ? -13.247 -4.886  -0.491  1.00 10.00 ? 435 GLN A NE2  10 
ATOM 10790 H H    . GLN A 1 26 ? -9.823  -5.413  -2.986  1.00 10.00 ? 435 GLN A H    10 
ATOM 10791 H HA   . GLN A 1 26 ? -10.754 -3.784  -0.780  1.00 10.00 ? 435 GLN A HA   10 
ATOM 10792 H HB2  . GLN A 1 26 ? -11.247 -6.329  -1.324  1.00 10.00 ? 435 GLN A HB2  10 
ATOM 10793 H HB3  . GLN A 1 26 ? -9.761  -6.578  -0.418  1.00 10.00 ? 435 GLN A HB3  10 
ATOM 10794 H HG2  . GLN A 1 26 ? -11.197 -6.709  1.310   1.00 10.00 ? 435 GLN A HG2  10 
ATOM 10795 H HG3  . GLN A 1 26 ? -11.022 -4.954  1.284   1.00 10.00 ? 435 GLN A HG3  10 
ATOM 10796 H HE21 . GLN A 1 26 ? -12.553 -4.450  -1.028  1.00 10.00 ? 435 GLN A HE21 10 
ATOM 10797 H HE22 . GLN A 1 26 ? -14.206 -4.773  -0.655  1.00 10.00 ? 435 GLN A HE22 10 
ATOM 10798 N N    . GLU A 1 27 ? -7.645  -4.693  -1.128  1.00 10.00 ? 436 GLU A N    10 
ATOM 10799 C CA   . GLU A 1 27 ? -6.300  -4.466  -0.651  1.00 10.00 ? 436 GLU A CA   10 
ATOM 10800 C C    . GLU A 1 27 ? -5.944  -3.002  -0.832  1.00 10.00 ? 436 GLU A C    10 
ATOM 10801 O O    . GLU A 1 27 ? -5.526  -2.333  0.114   1.00 10.00 ? 436 GLU A O    10 
ATOM 10802 C CB   . GLU A 1 27 ? -5.341  -5.389  -1.399  1.00 10.00 ? 436 GLU A CB   10 
ATOM 10803 C CG   . GLU A 1 27 ? -4.672  -6.411  -0.496  1.00 10.00 ? 436 GLU A CG   10 
ATOM 10804 C CD   . GLU A 1 27 ? -4.716  -7.817  -1.067  1.00 10.00 ? 436 GLU A CD   10 
ATOM 10805 O OE1  . GLU A 1 27 ? -5.652  -8.114  -1.838  1.00 10.00 ? 436 GLU A OE1  10 
ATOM 10806 O OE2  . GLU A 1 27 ? -3.816  -8.618  -0.742  1.00 10.00 ? 436 GLU A OE2  10 
ATOM 10807 H H    . GLU A 1 27 ? -7.766  -5.156  -1.982  1.00 10.00 ? 436 GLU A H    10 
ATOM 10808 H HA   . GLU A 1 27 ? -6.273  -4.692  0.400   1.00 10.00 ? 436 GLU A HA   10 
ATOM 10809 H HB2  . GLU A 1 27 ? -5.896  -5.921  -2.159  1.00 10.00 ? 436 GLU A HB2  10 
ATOM 10810 H HB3  . GLU A 1 27 ? -4.578  -4.799  -1.878  1.00 10.00 ? 436 GLU A HB3  10 
ATOM 10811 H HG2  . GLU A 1 27 ? -3.642  -6.129  -0.353  1.00 10.00 ? 436 GLU A HG2  10 
ATOM 10812 H HG3  . GLU A 1 27 ? -5.177  -6.413  0.459   1.00 10.00 ? 436 GLU A HG3  10 
ATOM 10813 N N    . LYS A 1 28 ? -6.166  -2.488  -2.037  1.00 10.00 ? 437 LYS A N    10 
ATOM 10814 C CA   . LYS A 1 28 ? -5.926  -1.077  -2.321  1.00 10.00 ? 437 LYS A CA   10 
ATOM 10815 C C    . LYS A 1 28 ? -6.696  -0.227  -1.322  1.00 10.00 ? 437 LYS A C    10 
ATOM 10816 O O    . LYS A 1 28 ? -6.392  0.941   -1.113  1.00 10.00 ? 437 LYS A O    10 
ATOM 10817 C CB   . LYS A 1 28 ? -6.369  -0.742  -3.748  1.00 10.00 ? 437 LYS A CB   10 
ATOM 10818 C CG   . LYS A 1 28 ? -5.956  0.647   -4.206  1.00 10.00 ? 437 LYS A CG   10 
ATOM 10819 C CD   . LYS A 1 28 ? -5.598  0.664   -5.683  1.00 10.00 ? 437 LYS A CD   10 
ATOM 10820 C CE   . LYS A 1 28 ? -6.773  0.235   -6.547  1.00 10.00 ? 437 LYS A CE   10 
ATOM 10821 N NZ   . LYS A 1 28 ? -7.839  1.274   -6.590  1.00 10.00 ? 437 LYS A NZ   10 
ATOM 10822 H H    . LYS A 1 28 ? -6.538  -3.060  -2.736  1.00 10.00 ? 437 LYS A H    10 
ATOM 10823 H HA   . LYS A 1 28 ? -4.875  -0.868  -2.216  1.00 10.00 ? 437 LYS A HA   10 
ATOM 10824 H HB2  . LYS A 1 28 ? -5.937  -1.464  -4.424  1.00 10.00 ? 437 LYS A HB2  10 
ATOM 10825 H HB3  . LYS A 1 28 ? -7.446  -0.810  -3.802  1.00 10.00 ? 437 LYS A HB3  10 
ATOM 10826 H HG2  . LYS A 1 28 ? -6.775  1.329   -4.037  1.00 10.00 ? 437 LYS A HG2  10 
ATOM 10827 H HG3  . LYS A 1 28 ? -5.098  0.963   -3.632  1.00 10.00 ? 437 LYS A HG3  10 
ATOM 10828 H HD2  . LYS A 1 28 ? -5.306  1.666   -5.962  1.00 10.00 ? 437 LYS A HD2  10 
ATOM 10829 H HD3  . LYS A 1 28 ? -4.772  -0.014  -5.851  1.00 10.00 ? 437 LYS A HD3  10 
ATOM 10830 H HE2  . LYS A 1 28 ? -6.419  0.054   -7.550  1.00 10.00 ? 437 LYS A HE2  10 
ATOM 10831 H HE3  . LYS A 1 28 ? -7.186  -0.677  -6.142  1.00 10.00 ? 437 LYS A HE3  10 
ATOM 10832 H HZ1  . LYS A 1 28 ? -8.775  0.822   -6.653  1.00 10.00 ? 437 LYS A HZ1  10 
ATOM 10833 H HZ2  . LYS A 1 28 ? -7.707  1.888   -7.419  1.00 10.00 ? 437 LYS A HZ2  10 
ATOM 10834 H HZ3  . LYS A 1 28 ? -7.805  1.858   -5.730  1.00 10.00 ? 437 LYS A HZ3  10 
ATOM 10835 N N    . GLU A 1 29 ? -7.692  -0.841  -0.696  1.00 10.00 ? 438 GLU A N    10 
ATOM 10836 C CA   . GLU A 1 29 ? -8.513  -0.164  0.292   1.00 10.00 ? 438 GLU A CA   10 
ATOM 10837 C C    . GLU A 1 29 ? -7.696  0.245   1.505   1.00 10.00 ? 438 GLU A C    10 
ATOM 10838 O O    . GLU A 1 29 ? -8.072  1.167   2.221   1.00 10.00 ? 438 GLU A O    10 
ATOM 10839 C CB   . GLU A 1 29 ? -9.656  -1.073  0.730   1.00 10.00 ? 438 GLU A CB   10 
ATOM 10840 C CG   . GLU A 1 29 ? -10.906 -0.322  1.160   1.00 10.00 ? 438 GLU A CG   10 
ATOM 10841 C CD   . GLU A 1 29 ? -11.633 -1.005  2.301   1.00 10.00 ? 438 GLU A CD   10 
ATOM 10842 O OE1  . GLU A 1 29 ? -11.168 -0.891  3.455   1.00 10.00 ? 438 GLU A OE1  10 
ATOM 10843 O OE2  . GLU A 1 29 ? -12.669 -1.654  2.041   1.00 10.00 ? 438 GLU A OE2  10 
ATOM 10844 H H    . GLU A 1 29 ? -7.872  -1.783  -0.899  1.00 10.00 ? 438 GLU A H    10 
ATOM 10845 H HA   . GLU A 1 29 ? -8.920  0.724   -0.164  1.00 10.00 ? 438 GLU A HA   10 
ATOM 10846 H HB2  . GLU A 1 29 ? -9.916  -1.726  -0.090  1.00 10.00 ? 438 GLU A HB2  10 
ATOM 10847 H HB3  . GLU A 1 29 ? -9.317  -1.673  1.563   1.00 10.00 ? 438 GLU A HB3  10 
ATOM 10848 H HG2  . GLU A 1 29 ? -10.621 0.670   1.478   1.00 10.00 ? 438 GLU A HG2  10 
ATOM 10849 H HG3  . GLU A 1 29 ? -11.575 -0.250  0.316   1.00 10.00 ? 438 GLU A HG3  10 
ATOM 10850 N N    . THR A 1 30 ? -6.589  -0.447  1.747   1.00 10.00 ? 439 THR A N    10 
ATOM 10851 C CA   . THR A 1 30 ? -5.746  -0.132  2.894   1.00 10.00 ? 439 THR A CA   10 
ATOM 10852 C C    . THR A 1 30 ? -4.658  0.874   2.524   1.00 10.00 ? 439 THR A C    10 
ATOM 10853 O O    . THR A 1 30 ? -4.493  1.894   3.192   1.00 10.00 ? 439 THR A O    10 
ATOM 10854 C CB   . THR A 1 30 ? -5.122  -1.409  3.460   1.00 10.00 ? 439 THR A CB   10 
ATOM 10855 O OG1  . THR A 1 30 ? -6.130  -2.322  3.858   1.00 10.00 ? 439 THR A OG1  10 
ATOM 10856 C CG2  . THR A 1 30 ? -4.232  -1.160  4.658   1.00 10.00 ? 439 THR A CG2  10 
ATOM 10857 H H    . THR A 1 30 ? -6.338  -1.190  1.150   1.00 10.00 ? 439 THR A H    10 
ATOM 10858 H HA   . THR A 1 30 ? -6.378  0.313   3.646   1.00 10.00 ? 439 THR A HA   10 
ATOM 10859 H HB   . THR A 1 30 ? -4.524  -1.879  2.692   1.00 10.00 ? 439 THR A HB   10 
ATOM 10860 H HG1  . THR A 1 30 ? -6.802  -1.858  4.363   1.00 10.00 ? 439 THR A HG1  10 
ATOM 10861 H HG21 . THR A 1 30 ? -4.502  -1.837  5.455   1.00 10.00 ? 439 THR A HG21 10 
ATOM 10862 H HG22 . THR A 1 30 ? -4.356  -0.141  4.994   1.00 10.00 ? 439 THR A HG22 10 
ATOM 10863 H HG23 . THR A 1 30 ? -3.203  -1.324  4.381   1.00 10.00 ? 439 THR A HG23 10 
ATOM 10864 N N    . PHE A 1 31 ? -3.923  0.584   1.459   1.00 10.00 ? 440 PHE A N    10 
ATOM 10865 C CA   . PHE A 1 31 ? -2.857  1.463   1.000   1.00 10.00 ? 440 PHE A CA   10 
ATOM 10866 C C    . PHE A 1 31 ? -3.436  2.727   0.377   1.00 10.00 ? 440 PHE A C    10 
ATOM 10867 O O    . PHE A 1 31 ? -2.861  3.808   0.502   1.00 10.00 ? 440 PHE A O    10 
ATOM 10868 C CB   . PHE A 1 31 ? -1.967  0.741   -0.018  1.00 10.00 ? 440 PHE A CB   10 
ATOM 10869 C CG   . PHE A 1 31 ? -2.339  -0.684  -0.244  1.00 10.00 ? 440 PHE A CG   10 
ATOM 10870 C CD1  . PHE A 1 31 ? -2.128  -1.651  0.724   1.00 10.00 ? 440 PHE A CD1  10 
ATOM 10871 C CD2  . PHE A 1 31 ? -2.928  -1.046  -1.428  1.00 10.00 ? 440 PHE A CD2  10 
ATOM 10872 C CE1  . PHE A 1 31 ? -2.505  -2.955  0.494   1.00 10.00 ? 440 PHE A CE1  10 
ATOM 10873 C CE2  . PHE A 1 31 ? -3.302  -2.340  -1.664  1.00 10.00 ? 440 PHE A CE2  10 
ATOM 10874 C CZ   . PHE A 1 31 ? -3.094  -3.290  -0.706  1.00 10.00 ? 440 PHE A CZ   10 
ATOM 10875 H H    . PHE A 1 31 ? -4.101  -0.237  0.966   1.00 10.00 ? 440 PHE A H    10 
ATOM 10876 H HA   . PHE A 1 31 ? -2.261  1.738   1.856   1.00 10.00 ? 440 PHE A HA   10 
ATOM 10877 H HB2  . PHE A 1 31 ? -2.050  1.239   -0.970  1.00 10.00 ? 440 PHE A HB2  10 
ATOM 10878 H HB3  . PHE A 1 31 ? -0.943  0.770   0.314   1.00 10.00 ? 440 PHE A HB3  10 
ATOM 10879 H HD1  . PHE A 1 31 ? -1.672  -1.379  1.662   1.00 10.00 ? 440 PHE A HD1  10 
ATOM 10880 H HD2  . PHE A 1 31 ? -3.095  -0.299  -2.179  1.00 10.00 ? 440 PHE A HD2  10 
ATOM 10881 H HE1  . PHE A 1 31 ? -2.340  -3.709  1.249   1.00 10.00 ? 440 PHE A HE1  10 
ATOM 10882 H HE2  . PHE A 1 31 ? -3.771  -2.610  -2.601  1.00 10.00 ? 440 PHE A HE2  10 
ATOM 10883 H HZ   . PHE A 1 31 ? -3.399  -4.288  -0.894  1.00 10.00 ? 440 PHE A HZ   10 
ATOM 10884 N N    . ARG A 1 32 ? -4.580  2.592   -0.293  1.00 10.00 ? 441 ARG A N    10 
ATOM 10885 C CA   . ARG A 1 32 ? -5.217  3.740   -0.920  1.00 10.00 ? 441 ARG A CA   10 
ATOM 10886 C C    . ARG A 1 32 ? -5.928  4.591   0.129   1.00 10.00 ? 441 ARG A C    10 
ATOM 10887 O O    . ARG A 1 32 ? -6.100  5.796   -0.050  1.00 10.00 ? 441 ARG A O    10 
ATOM 10888 C CB   . ARG A 1 32 ? -6.212  3.306   -1.997  1.00 10.00 ? 441 ARG A CB   10 
ATOM 10889 C CG   . ARG A 1 32 ? -6.569  4.414   -2.975  1.00 10.00 ? 441 ARG A CG   10 
ATOM 10890 C CD   . ARG A 1 32 ? -7.766  5.218   -2.493  1.00 10.00 ? 441 ARG A CD   10 
ATOM 10891 N NE   . ARG A 1 32 ? -8.603  5.673   -3.601  1.00 10.00 ? 441 ARG A NE   10 
ATOM 10892 C CZ   . ARG A 1 32 ? -9.454  4.888   -4.259  1.00 10.00 ? 441 ARG A CZ   10 
ATOM 10893 N NH1  . ARG A 1 32 ? -9.584  3.610   -3.923  1.00 10.00 ? 441 ARG A NH1  10 
ATOM 10894 N NH2  . ARG A 1 32 ? -10.177 5.382   -5.255  1.00 10.00 ? 441 ARG A NH2  10 
ATOM 10895 H H    . ARG A 1 32 ? -5.004  1.707   -0.360  1.00 10.00 ? 441 ARG A H    10 
ATOM 10896 H HA   . ARG A 1 32 ? -4.439  4.325   -1.383  1.00 10.00 ? 441 ARG A HA   10 
ATOM 10897 H HB2  . ARG A 1 32 ? -5.785  2.488   -2.556  1.00 10.00 ? 441 ARG A HB2  10 
ATOM 10898 H HB3  . ARG A 1 32 ? -7.121  2.971   -1.519  1.00 10.00 ? 441 ARG A HB3  10 
ATOM 10899 H HG2  . ARG A 1 32 ? -5.723  5.077   -3.078  1.00 10.00 ? 441 ARG A HG2  10 
ATOM 10900 H HG3  . ARG A 1 32 ? -6.804  3.974   -3.933  1.00 10.00 ? 441 ARG A HG3  10 
ATOM 10901 H HD2  . ARG A 1 32 ? -8.361  4.596   -1.839  1.00 10.00 ? 441 ARG A HD2  10 
ATOM 10902 H HD3  . ARG A 1 32 ? -7.410  6.078   -1.946  1.00 10.00 ? 441 ARG A HD3  10 
ATOM 10903 H HE   . ARG A 1 32 ? -8.526  6.612   -3.870  1.00 10.00 ? 441 ARG A HE   10 
ATOM 10904 H HH11 . ARG A 1 32 ? -9.042  3.231   -3.174  1.00 10.00 ? 441 ARG A HH11 10 
ATOM 10905 H HH12 . ARG A 1 32 ? -10.225 3.026   -4.421  1.00 10.00 ? 441 ARG A HH12 10 
ATOM 10906 H HH21 . ARG A 1 32 ? -10.082 6.344   -5.512  1.00 10.00 ? 441 ARG A HH21 10 
ATOM 10907 H HH22 . ARG A 1 32 ? -10.816 4.792   -5.748  1.00 10.00 ? 441 ARG A HH22 10 
ATOM 10908 N N    . GLU A 1 33 ? -6.338  3.954   1.228   1.00 10.00 ? 442 GLU A N    10 
ATOM 10909 C CA   . GLU A 1 33 ? -7.027  4.659   2.302   1.00 10.00 ? 442 GLU A CA   10 
ATOM 10910 C C    . GLU A 1 33 ? -6.051  5.488   3.117   1.00 10.00 ? 442 GLU A C    10 
ATOM 10911 O O    . GLU A 1 33 ? -6.339  6.630   3.474   1.00 10.00 ? 442 GLU A O    10 
ATOM 10912 C CB   . GLU A 1 33 ? -7.754  3.675   3.218   1.00 10.00 ? 442 GLU A CB   10 
ATOM 10913 C CG   . GLU A 1 33 ? -9.245  3.577   2.946   1.00 10.00 ? 442 GLU A CG   10 
ATOM 10914 C CD   . GLU A 1 33 ? -9.916  2.484   3.755   1.00 10.00 ? 442 GLU A CD   10 
ATOM 10915 O OE1  . GLU A 1 33 ? -9.372  2.113   4.817   1.00 10.00 ? 442 GLU A OE1  10 
ATOM 10916 O OE2  . GLU A 1 33 ? -10.983 1.998   3.326   1.00 10.00 ? 442 GLU A OE2  10 
ATOM 10917 H H    . GLU A 1 33 ? -6.172  2.989   1.320   1.00 10.00 ? 442 GLU A H    10 
ATOM 10918 H HA   . GLU A 1 33 ? -7.750  5.319   1.853   1.00 10.00 ? 442 GLU A HA   10 
ATOM 10919 H HB2  . GLU A 1 33 ? -7.319  2.697   3.089   1.00 10.00 ? 442 GLU A HB2  10 
ATOM 10920 H HB3  . GLU A 1 33 ? -7.617  3.985   4.243   1.00 10.00 ? 442 GLU A HB3  10 
ATOM 10921 H HG2  . GLU A 1 33 ? -9.704  4.522   3.198   1.00 10.00 ? 442 GLU A HG2  10 
ATOM 10922 H HG3  . GLU A 1 33 ? -9.395  3.373   1.897   1.00 10.00 ? 442 GLU A HG3  10 
ATOM 10923 N N    . LYS A 1 34 ? -4.890  4.913   3.407   1.00 10.00 ? 443 LYS A N    10 
ATOM 10924 C CA   . LYS A 1 34 ? -3.880  5.615   4.175   1.00 10.00 ? 443 LYS A CA   10 
ATOM 10925 C C    . LYS A 1 34 ? -3.303  6.751   3.349   1.00 10.00 ? 443 LYS A C    10 
ATOM 10926 O O    . LYS A 1 34 ? -3.093  7.850   3.852   1.00 10.00 ? 443 LYS A O    10 
ATOM 10927 C CB   . LYS A 1 34 ? -2.772  4.659   4.616   1.00 10.00 ? 443 LYS A CB   10 
ATOM 10928 C CG   . LYS A 1 34 ? -2.991  4.074   6.002   1.00 10.00 ? 443 LYS A CG   10 
ATOM 10929 C CD   . LYS A 1 34 ? -3.656  2.708   5.933   1.00 10.00 ? 443 LYS A CD   10 
ATOM 10930 C CE   . LYS A 1 34 ? -5.170  2.828   5.869   1.00 10.00 ? 443 LYS A CE   10 
ATOM 10931 N NZ   . LYS A 1 34 ? -5.846  1.578   6.310   1.00 10.00 ? 443 LYS A NZ   10 
ATOM 10932 H H    . LYS A 1 34 ? -4.708  4.004   3.089   1.00 10.00 ? 443 LYS A H    10 
ATOM 10933 H HA   . LYS A 1 34 ? -4.359  6.029   5.050   1.00 10.00 ? 443 LYS A HA   10 
ATOM 10934 H HB2  . LYS A 1 34 ? -2.711  3.845   3.909   1.00 10.00 ? 443 LYS A HB2  10 
ATOM 10935 H HB3  . LYS A 1 34 ? -1.834  5.193   4.621   1.00 10.00 ? 443 LYS A HB3  10 
ATOM 10936 H HG2  . LYS A 1 34 ? -2.035  3.972   6.494   1.00 10.00 ? 443 LYS A HG2  10 
ATOM 10937 H HG3  . LYS A 1 34 ? -3.621  4.743   6.569   1.00 10.00 ? 443 LYS A HG3  10 
ATOM 10938 H HD2  . LYS A 1 34 ? -3.308  2.193   5.050   1.00 10.00 ? 443 LYS A HD2  10 
ATOM 10939 H HD3  . LYS A 1 34 ? -3.384  2.143   6.812   1.00 10.00 ? 443 LYS A HD3  10 
ATOM 10940 H HE2  . LYS A 1 34 ? -5.480  3.640   6.512   1.00 10.00 ? 443 LYS A HE2  10 
ATOM 10941 H HE3  . LYS A 1 34 ? -5.458  3.046   4.851   1.00 10.00 ? 443 LYS A HE3  10 
ATOM 10942 H HZ1  . LYS A 1 34 ? -5.963  0.931   5.502   1.00 10.00 ? 443 LYS A HZ1  10 
ATOM 10943 H HZ2  . LYS A 1 34 ? -6.783  1.796   6.703   1.00 10.00 ? 443 LYS A HZ2  10 
ATOM 10944 H HZ3  . LYS A 1 34 ? -5.278  1.102   7.040   1.00 10.00 ? 443 LYS A HZ3  10 
ATOM 10945 N N    . PHE A 1 35 ? -3.075  6.493   2.067   1.00 10.00 ? 444 PHE A N    10 
ATOM 10946 C CA   . PHE A 1 35 ? -2.550  7.512   1.179   1.00 10.00 ? 444 PHE A CA   10 
ATOM 10947 C C    . PHE A 1 35 ? -3.567  8.627   1.066   1.00 10.00 ? 444 PHE A C    10 
ATOM 10948 O O    . PHE A 1 35 ? -3.215  9.803   0.968   1.00 10.00 ? 444 PHE A O    10 
ATOM 10949 C CB   . PHE A 1 35 ? -2.217  6.911   -0.184  1.00 10.00 ? 444 PHE A CB   10 
ATOM 10950 C CG   . PHE A 1 35 ? -1.616  7.893   -1.145  1.00 10.00 ? 444 PHE A CG   10 
ATOM 10951 C CD1  . PHE A 1 35 ? -2.398  8.861   -1.753  1.00 10.00 ? 444 PHE A CD1  10 
ATOM 10952 C CD2  . PHE A 1 35 ? -0.265  7.845   -1.438  1.00 10.00 ? 444 PHE A CD2  10 
ATOM 10953 C CE1  . PHE A 1 35 ? -1.842  9.765   -2.637  1.00 10.00 ? 444 PHE A CE1  10 
ATOM 10954 C CE2  . PHE A 1 35 ? 0.298   8.745   -2.321  1.00 10.00 ? 444 PHE A CE2  10 
ATOM 10955 C CZ   . PHE A 1 35 ? -0.491  9.707   -2.922  1.00 10.00 ? 444 PHE A CZ   10 
ATOM 10956 H H    . PHE A 1 35 ? -3.288  5.612   1.707   1.00 10.00 ? 444 PHE A H    10 
ATOM 10957 H HA   . PHE A 1 35 ? -1.650  7.909   1.623   1.00 10.00 ? 444 PHE A HA   10 
ATOM 10958 H HB2  . PHE A 1 35 ? -1.501  6.109   -0.042  1.00 10.00 ? 444 PHE A HB2  10 
ATOM 10959 H HB3  . PHE A 1 35 ? -3.117  6.512   -0.627  1.00 10.00 ? 444 PHE A HB3  10 
ATOM 10960 H HD1  . PHE A 1 35 ? -3.454  8.906   -1.530  1.00 10.00 ? 444 PHE A HD1  10 
ATOM 10961 H HD2  . PHE A 1 35 ? 0.349   7.092   -0.966  1.00 10.00 ? 444 PHE A HD2  10 
ATOM 10962 H HE1  . PHE A 1 35 ? -2.461  10.516  -3.106  1.00 10.00 ? 444 PHE A HE1  10 
ATOM 10963 H HE2  . PHE A 1 35 ? 1.355   8.697   -2.541  1.00 10.00 ? 444 PHE A HE2  10 
ATOM 10964 H HZ   . PHE A 1 35 ? -0.052  10.412  -3.613  1.00 10.00 ? 444 PHE A HZ   10 
ATOM 10965 N N    . MET A 1 36 ? -4.836  8.249   1.150   1.00 10.00 ? 445 MET A N    10 
ATOM 10966 C CA   . MET A 1 36 ? -5.907  9.218   1.132   1.00 10.00 ? 445 MET A CA   10 
ATOM 10967 C C    . MET A 1 36 ? -5.960  9.882   2.504   1.00 10.00 ? 445 MET A C    10 
ATOM 10968 O O    . MET A 1 36 ? -6.327  11.048  2.645   1.00 10.00 ? 445 MET A O    10 
ATOM 10969 C CB   . MET A 1 36 ? -7.245  8.553   0.802   1.00 10.00 ? 445 MET A CB   10 
ATOM 10970 C CG   . MET A 1 36 ? -7.623  8.640   -0.667  1.00 10.00 ? 445 MET A CG   10 
ATOM 10971 S SD   . MET A 1 36 ? -8.321  10.242  -1.111  1.00 10.00 ? 445 MET A SD   10 
ATOM 10972 C CE   . MET A 1 36 ? -6.840  11.147  -1.553  1.00 10.00 ? 445 MET A CE   10 
ATOM 10973 H H    . MET A 1 36 ? -5.050  7.301   1.277   1.00 10.00 ? 445 MET A H    10 
ATOM 10974 H HA   . MET A 1 36 ? -5.670  9.954   0.385   1.00 10.00 ? 445 MET A HA   10 
ATOM 10975 H HB2  . MET A 1 36 ? -7.192  7.510   1.077   1.00 10.00 ? 445 MET A HB2  10 
ATOM 10976 H HB3  . MET A 1 36 ? -8.023  9.029   1.380   1.00 10.00 ? 445 MET A HB3  10 
ATOM 10977 H HG2  . MET A 1 36 ? -6.738  8.472   -1.263  1.00 10.00 ? 445 MET A HG2  10 
ATOM 10978 H HG3  . MET A 1 36 ? -8.352  7.873   -0.884  1.00 10.00 ? 445 MET A HG3  10 
ATOM 10979 H HE1  . MET A 1 36 ? -6.960  11.573  -2.537  1.00 10.00 ? 445 MET A HE1  10 
ATOM 10980 H HE2  . MET A 1 36 ? -5.994  10.475  -1.551  1.00 10.00 ? 445 MET A HE2  10 
ATOM 10981 H HE3  . MET A 1 36 ? -6.673  11.937  -0.835  1.00 10.00 ? 445 MET A HE3  10 
ATOM 10982 N N    . GLN A 1 37 ? -5.550  9.106   3.509   1.00 10.00 ? 446 GLN A N    10 
ATOM 10983 C CA   . GLN A 1 37 ? -5.490  9.558   4.890   1.00 10.00 ? 446 GLN A CA   10 
ATOM 10984 C C    . GLN A 1 37 ? -4.353  10.551  5.061   1.00 10.00 ? 446 GLN A C    10 
ATOM 10985 O O    . GLN A 1 37 ? -4.450  11.519  5.815   1.00 10.00 ? 446 GLN A O    10 
ATOM 10986 C CB   . GLN A 1 37 ? -5.242  8.357   5.808   1.00 10.00 ? 446 GLN A CB   10 
ATOM 10987 C CG   . GLN A 1 37 ? -5.652  8.594   7.251   1.00 10.00 ? 446 GLN A CG   10 
ATOM 10988 C CD   . GLN A 1 37 ? -6.297  7.375   7.882   1.00 10.00 ? 446 GLN A CD   10 
ATOM 10989 O OE1  . GLN A 1 37 ? -5.922  6.959   8.979   1.00 10.00 ? 446 GLN A OE1  10 
ATOM 10990 N NE2  . GLN A 1 37 ? -7.273  6.794   7.191   1.00 10.00 ? 446 GLN A NE2  10 
ATOM 10991 H H    . GLN A 1 37 ? -5.256  8.196   3.307   1.00 10.00 ? 446 GLN A H    10 
ATOM 10992 H HA   . GLN A 1 37 ? -6.428  10.027  5.147   1.00 10.00 ? 446 GLN A HA   10 
ATOM 10993 H HB2  . GLN A 1 37 ? -5.800  7.512   5.432   1.00 10.00 ? 446 GLN A HB2  10 
ATOM 10994 H HB3  . GLN A 1 37 ? -4.179  8.114   5.787   1.00 10.00 ? 446 GLN A HB3  10 
ATOM 10995 H HG2  . GLN A 1 37 ? -4.773  8.854   7.823   1.00 10.00 ? 446 GLN A HG2  10 
ATOM 10996 H HG3  . GLN A 1 37 ? -6.356  9.413   7.282   1.00 10.00 ? 446 GLN A HG3  10 
ATOM 10997 H HE21 . GLN A 1 37 ? -7.520  7.178   6.324   1.00 10.00 ? 446 GLN A HE21 10 
ATOM 10998 H HE22 . GLN A 1 37 ? -7.706  6.004   7.578   1.00 10.00 ? 446 GLN A HE22 10 
ATOM 10999 N N    . HIS A 1 38 ? -3.264  10.272  4.360   1.00 10.00 ? 447 HIS A N    10 
ATOM 11000 C CA   . HIS A 1 38 ? -2.069  11.092  4.412   1.00 10.00 ? 447 HIS A CA   10 
ATOM 11001 C C    . HIS A 1 38 ? -1.866  11.829  3.086   1.00 10.00 ? 447 HIS A C    10 
ATOM 11002 O O    . HIS A 1 38 ? -1.349  11.263  2.123   1.00 10.00 ? 447 HIS A O    10 
ATOM 11003 C CB   . HIS A 1 38 ? -0.872  10.194  4.735   1.00 10.00 ? 447 HIS A CB   10 
ATOM 11004 C CG   . HIS A 1 38 ? -1.152  9.239   5.863   1.00 10.00 ? 447 HIS A CG   10 
ATOM 11005 N ND1  . HIS A 1 38 ? -1.251  9.649   7.176   1.00 10.00 ? 447 HIS A ND1  10 
ATOM 11006 C CD2  . HIS A 1 38 ? -1.390  7.898   5.873   1.00 10.00 ? 447 HIS A CD2  10 
ATOM 11007 C CE1  . HIS A 1 38 ? -1.535  8.611   7.940   1.00 10.00 ? 447 HIS A CE1  10 
ATOM 11008 N NE2  . HIS A 1 38 ? -1.627  7.539   7.177   1.00 10.00 ? 447 HIS A NE2  10 
ATOM 11009 H H    . HIS A 1 38 ? -3.261  9.473   3.794   1.00 10.00 ? 447 HIS A H    10 
ATOM 11010 H HA   . HIS A 1 38 ? -2.192  11.814  5.204   1.00 10.00 ? 447 HIS A HA   10 
ATOM 11011 H HB2  . HIS A 1 38 ? -0.617  9.613   3.862   1.00 10.00 ? 447 HIS A HB2  10 
ATOM 11012 H HB3  . HIS A 1 38 ? -0.029  10.808  5.017   1.00 10.00 ? 447 HIS A HB3  10 
ATOM 11013 H HD1  . HIS A 1 38 ? -1.128  10.566  7.499   1.00 10.00 ? 447 HIS A HD1  10 
ATOM 11014 H HD2  . HIS A 1 38 ? -1.399  7.232   5.015   1.00 10.00 ? 447 HIS A HD2  10 
ATOM 11015 H HE1  . HIS A 1 38 ? -1.655  8.631   9.012   1.00 10.00 ? 447 HIS A HE1  10 
ATOM 11016 H HE2  . HIS A 1 38 ? -1.985  6.674   7.466   1.00 10.00 ? 447 HIS A HE2  10 
ATOM 11017 N N    . PRO A 1 39 ? -2.294  13.106  3.021   1.00 10.00 ? 448 PRO A N    10 
ATOM 11018 C CA   . PRO A 1 39 ? -2.185  13.934  1.815   1.00 10.00 ? 448 PRO A CA   10 
ATOM 11019 C C    . PRO A 1 39 ? -0.892  13.714  1.034   1.00 10.00 ? 448 PRO A C    10 
ATOM 11020 O O    . PRO A 1 39 ? 0.125   14.350  1.307   1.00 10.00 ? 448 PRO A O    10 
ATOM 11021 C CB   . PRO A 1 39 ? -2.235  15.348  2.381   1.00 10.00 ? 448 PRO A CB   10 
ATOM 11022 C CG   . PRO A 1 39 ? -3.126  15.240  3.572   1.00 10.00 ? 448 PRO A CG   10 
ATOM 11023 C CD   . PRO A 1 39 ? -2.939  13.848  4.125   1.00 10.00 ? 448 PRO A CD   10 
ATOM 11024 H HA   . PRO A 1 39 ? -3.028  13.781  1.158   1.00 10.00 ? 448 PRO A HA   10 
ATOM 11025 H HB2  . PRO A 1 39 ? -1.239  15.664  2.657   1.00 10.00 ? 448 PRO A HB2  10 
ATOM 11026 H HB3  . PRO A 1 39 ? -2.643  16.021  1.643   1.00 10.00 ? 448 PRO A HB3  10 
ATOM 11027 H HG2  . PRO A 1 39 ? -2.841  15.976  4.310   1.00 10.00 ? 448 PRO A HG2  10 
ATOM 11028 H HG3  . PRO A 1 39 ? -4.153  15.387  3.274   1.00 10.00 ? 448 PRO A HG3  10 
ATOM 11029 H HD2  . PRO A 1 39 ? -2.298  13.872  4.995   1.00 10.00 ? 448 PRO A HD2  10 
ATOM 11030 H HD3  . PRO A 1 39 ? -3.894  13.410  4.375   1.00 10.00 ? 448 PRO A HD3  10 
ATOM 11031 N N    . LYS A 1 40 ? -0.953  12.819  0.048   1.00 10.00 ? 449 LYS A N    10 
ATOM 11032 C CA   . LYS A 1 40 ? 0.197   12.511  -0.805  1.00 10.00 ? 449 LYS A CA   10 
ATOM 11033 C C    . LYS A 1 40 ? 1.492   12.412  -0.002  1.00 10.00 ? 449 LYS A C    10 
ATOM 11034 O O    . LYS A 1 40 ? 2.127   13.424  0.299   1.00 10.00 ? 449 LYS A O    10 
ATOM 11035 C CB   . LYS A 1 40 ? 0.345   13.574  -1.894  1.00 10.00 ? 449 LYS A CB   10 
ATOM 11036 C CG   . LYS A 1 40 ? 1.333   13.194  -2.984  1.00 10.00 ? 449 LYS A CG   10 
ATOM 11037 C CD   . LYS A 1 40 ? 2.695   13.826  -2.745  1.00 10.00 ? 449 LYS A CD   10 
ATOM 11038 C CE   . LYS A 1 40 ? 3.721   13.336  -3.754  1.00 10.00 ? 449 LYS A CE   10 
ATOM 11039 N NZ   . LYS A 1 40 ? 4.549   12.225  -3.209  1.00 10.00 ? 449 LYS A NZ   10 
ATOM 11040 H H    . LYS A 1 40 ? -1.802  12.360  -0.122  1.00 10.00 ? 449 LYS A H    10 
ATOM 11041 H HA   . LYS A 1 40 ? 0.010   11.557  -1.274  1.00 10.00 ? 449 LYS A HA   10 
ATOM 11042 H HB2  . LYS A 1 40 ? -0.620  13.737  -2.354  1.00 10.00 ? 449 LYS A HB2  10 
ATOM 11043 H HB3  . LYS A 1 40 ? 0.678   14.495  -1.440  1.00 10.00 ? 449 LYS A HB3  10 
ATOM 11044 H HG2  . LYS A 1 40 ? 1.444   12.120  -2.999  1.00 10.00 ? 449 LYS A HG2  10 
ATOM 11045 H HG3  . LYS A 1 40 ? 0.952   13.533  -3.937  1.00 10.00 ? 449 LYS A HG3  10 
ATOM 11046 H HD2  . LYS A 1 40 ? 2.605   14.898  -2.831  1.00 10.00 ? 449 LYS A HD2  10 
ATOM 11047 H HD3  . LYS A 1 40 ? 3.031   13.570  -1.751  1.00 10.00 ? 449 LYS A HD3  10 
ATOM 11048 H HE2  . LYS A 1 40 ? 3.203   12.988  -4.635  1.00 10.00 ? 449 LYS A HE2  10 
ATOM 11049 H HE3  . LYS A 1 40 ? 4.368   14.159  -4.020  1.00 10.00 ? 449 LYS A HE3  10 
ATOM 11050 H HZ1  . LYS A 1 40 ? 5.520   12.288  -3.578  1.00 10.00 ? 449 LYS A HZ1  10 
ATOM 11051 H HZ2  . LYS A 1 40 ? 4.146   11.308  -3.487  1.00 10.00 ? 449 LYS A HZ2  10 
ATOM 11052 H HZ3  . LYS A 1 40 ? 4.580   12.278  -2.171  1.00 10.00 ? 449 LYS A HZ3  10 
ATOM 11053 N N    . ASN A 1 41 ? 1.885   11.190  0.334   1.00 10.00 ? 450 ASN A N    10 
ATOM 11054 C CA   . ASN A 1 41 ? 3.109   10.969  1.093   1.00 10.00 ? 450 ASN A CA   10 
ATOM 11055 C C    . ASN A 1 41 ? 3.854   9.739   0.590   1.00 10.00 ? 450 ASN A C    10 
ATOM 11056 O O    . ASN A 1 41 ? 5.015   9.824   0.190   1.00 10.00 ? 450 ASN A O    10 
ATOM 11057 C CB   . ASN A 1 41 ? 2.799   10.825  2.586   1.00 10.00 ? 450 ASN A CB   10 
ATOM 11058 C CG   . ASN A 1 41 ? 1.644   9.880   2.858   1.00 10.00 ? 450 ASN A CG   10 
ATOM 11059 O OD1  . ASN A 1 41 ? 0.680   9.822   2.095   1.00 10.00 ? 450 ASN A OD1  10 
ATOM 11060 N ND2  . ASN A 1 41 ? 1.736   9.132   3.952   1.00 10.00 ? 450 ASN A ND2  10 
ATOM 11061 H H    . ASN A 1 41 ? 1.344   10.420  0.060   1.00 10.00 ? 450 ASN A H    10 
ATOM 11062 H HA   . ASN A 1 41 ? 3.739   11.829  0.951   1.00 10.00 ? 450 ASN A HA   10 
ATOM 11063 H HB2  . ASN A 1 41 ? 3.674   10.446  3.093   1.00 10.00 ? 450 ASN A HB2  10 
ATOM 11064 H HB3  . ASN A 1 41 ? 2.549   11.795  2.990   1.00 10.00 ? 450 ASN A HB3  10 
ATOM 11065 H HD21 . ASN A 1 41 ? 2.533   9.229   4.514   1.00 10.00 ? 450 ASN A HD21 10 
ATOM 11066 H HD22 . ASN A 1 41 ? 1.003   8.512   4.151   1.00 10.00 ? 450 ASN A HD22 10 
ATOM 11067 N N    . PHE A 1 42 ? 3.182   8.592   0.618   1.00 10.00 ? 451 PHE A N    10 
ATOM 11068 C CA   . PHE A 1 42 ? 3.779   7.335   0.172   1.00 10.00 ? 451 PHE A CA   10 
ATOM 11069 C C    . PHE A 1 42 ? 4.836   6.840   1.162   1.00 10.00 ? 451 PHE A C    10 
ATOM 11070 O O    . PHE A 1 42 ? 5.362   5.737   1.016   1.00 10.00 ? 451 PHE A O    10 
ATOM 11071 C CB   . PHE A 1 42 ? 4.392   7.499   -1.226  1.00 10.00 ? 451 PHE A CB   10 
ATOM 11072 C CG   . PHE A 1 42 ? 3.723   6.680   -2.301  1.00 10.00 ? 451 PHE A CG   10 
ATOM 11073 C CD1  . PHE A 1 42 ? 2.409   6.261   -2.165  1.00 10.00 ? 451 PHE A CD1  10 
ATOM 11074 C CD2  . PHE A 1 42 ? 4.412   6.337   -3.453  1.00 10.00 ? 451 PHE A CD2  10 
ATOM 11075 C CE1  . PHE A 1 42 ? 1.797   5.518   -3.154  1.00 10.00 ? 451 PHE A CE1  10 
ATOM 11076 C CE2  . PHE A 1 42 ? 3.806   5.593   -4.447  1.00 10.00 ? 451 PHE A CE2  10 
ATOM 11077 C CZ   . PHE A 1 42 ? 2.496   5.183   -4.297  1.00 10.00 ? 451 PHE A CZ   10 
ATOM 11078 H H    . PHE A 1 42 ? 2.263   8.591   0.950   1.00 10.00 ? 451 PHE A H    10 
ATOM 11079 H HA   . PHE A 1 42 ? 2.993   6.600   0.127   1.00 10.00 ? 451 PHE A HA   10 
ATOM 11080 H HB2  . PHE A 1 42 ? 4.321   8.536   -1.518  1.00 10.00 ? 451 PHE A HB2  10 
ATOM 11081 H HB3  . PHE A 1 42 ? 5.432   7.213   -1.190  1.00 10.00 ? 451 PHE A HB3  10 
ATOM 11082 H HD1  . PHE A 1 42 ? 1.863   6.519   -1.274  1.00 10.00 ? 451 PHE A HD1  10 
ATOM 11083 H HD2  . PHE A 1 42 ? 5.436   6.657   -3.573  1.00 10.00 ? 451 PHE A HD2  10 
ATOM 11084 H HE1  . PHE A 1 42 ? 0.772   5.200   -3.033  1.00 10.00 ? 451 PHE A HE1  10 
ATOM 11085 H HE2  . PHE A 1 42 ? 4.356   5.332   -5.339  1.00 10.00 ? 451 PHE A HE2  10 
ATOM 11086 H HZ   . PHE A 1 42 ? 2.021   4.599   -5.071  1.00 10.00 ? 451 PHE A HZ   10 
ATOM 11087 N N    . GLY A 1 43 ? 5.137   7.651   2.175   1.00 10.00 ? 452 GLY A N    10 
ATOM 11088 C CA   . GLY A 1 43 ? 6.115   7.265   3.170   1.00 10.00 ? 452 GLY A CA   10 
ATOM 11089 C C    . GLY A 1 43 ? 5.491   6.470   4.296   1.00 10.00 ? 452 GLY A C    10 
ATOM 11090 O O    . GLY A 1 43 ? 6.075   5.498   4.774   1.00 10.00 ? 452 GLY A O    10 
ATOM 11091 H H    . GLY A 1 43 ? 4.686   8.511   2.253   1.00 10.00 ? 452 GLY A H    10 
ATOM 11092 H HA2  . GLY A 1 43 ? 6.879   6.667   2.697   1.00 10.00 ? 452 GLY A HA2  10 
ATOM 11093 H HA3  . GLY A 1 43 ? 6.569   8.156   3.580   1.00 10.00 ? 452 GLY A HA3  10 
ATOM 11094 N N    . LEU A 1 44 ? 4.294   6.875   4.718   1.00 10.00 ? 453 LEU A N    10 
ATOM 11095 C CA   . LEU A 1 44 ? 3.598   6.175   5.789   1.00 10.00 ? 453 LEU A CA   10 
ATOM 11096 C C    . LEU A 1 44 ? 3.056   4.849   5.295   1.00 10.00 ? 453 LEU A C    10 
ATOM 11097 O O    . LEU A 1 44 ? 3.285   3.808   5.910   1.00 10.00 ? 453 LEU A O    10 
ATOM 11098 C CB   . LEU A 1 44 ? 2.451   7.010   6.355   1.00 10.00 ? 453 LEU A CB   10 
ATOM 11099 C CG   . LEU A 1 44 ? 1.536   6.250   7.318   1.00 10.00 ? 453 LEU A CG   10 
ATOM 11100 C CD1  . LEU A 1 44 ? 0.962   7.187   8.365   1.00 10.00 ? 453 LEU A CD1  10 
ATOM 11101 C CD2  . LEU A 1 44 ? 0.426   5.532   6.552   1.00 10.00 ? 453 LEU A CD2  10 
ATOM 11102 H H    . LEU A 1 44 ? 3.871   7.651   4.295   1.00 10.00 ? 453 LEU A H    10 
ATOM 11103 H HA   . LEU A 1 44 ? 4.310   5.984   6.572   1.00 10.00 ? 453 LEU A HA   10 
ATOM 11104 H HB2  . LEU A 1 44 ? 2.870   7.859   6.876   1.00 10.00 ? 453 LEU A HB2  10 
ATOM 11105 H HB3  . LEU A 1 44 ? 1.852   7.371   5.533   1.00 10.00 ? 453 LEU A HB3  10 
ATOM 11106 H HG   . LEU A 1 44 ? 2.116   5.503   7.836   1.00 10.00 ? 453 LEU A HG   10 
ATOM 11107 H HD11 . LEU A 1 44 ? 1.625   7.224   9.217   1.00 10.00 ? 453 LEU A HD11 10 
ATOM 11108 H HD12 . LEU A 1 44 ? -0.007  6.827   8.678   1.00 10.00 ? 453 LEU A HD12 10 
ATOM 11109 H HD13 . LEU A 1 44 ? 0.862   8.176   7.945   1.00 10.00 ? 453 LEU A HD13 10 
ATOM 11110 H HD21 . LEU A 1 44 ? 0.738   4.522   6.325   1.00 10.00 ? 453 LEU A HD21 10 
ATOM 11111 H HD22 . LEU A 1 44 ? 0.224   6.058   5.631   1.00 10.00 ? 453 LEU A HD22 10 
ATOM 11112 H HD23 . LEU A 1 44 ? -0.468  5.503   7.155   1.00 10.00 ? 453 LEU A HD23 10 
ATOM 11113 N N    . ILE A 1 45 ? 2.333   4.884   4.181   1.00 10.00 ? 454 ILE A N    10 
ATOM 11114 C CA   . ILE A 1 45 ? 1.770   3.672   3.619   1.00 10.00 ? 454 ILE A CA   10 
ATOM 11115 C C    . ILE A 1 45 ? 2.856   2.625   3.449   1.00 10.00 ? 454 ILE A C    10 
ATOM 11116 O O    . ILE A 1 45 ? 2.709   1.487   3.886   1.00 10.00 ? 454 ILE A O    10 
ATOM 11117 C CB   . ILE A 1 45 ? 1.068   3.958   2.281   1.00 10.00 ? 454 ILE A CB   10 
ATOM 11118 C CG1  . ILE A 1 45 ? -0.309  4.522   2.566   1.00 10.00 ? 454 ILE A CG1  10 
ATOM 11119 C CG2  . ILE A 1 45 ? 0.974   2.711   1.409   1.00 10.00 ? 454 ILE A CG2  10 
ATOM 11120 C CD1  . ILE A 1 45 ? -0.321  6.032   2.557   1.00 10.00 ? 454 ILE A CD1  10 
ATOM 11121 H H    . ILE A 1 45 ? 2.180   5.741   3.727   1.00 10.00 ? 454 ILE A H    10 
ATOM 11122 H HA   . ILE A 1 45 ? 1.036   3.302   4.313   1.00 10.00 ? 454 ILE A HA   10 
ATOM 11123 H HB   . ILE A 1 45 ? 1.639   4.706   1.755   1.00 10.00 ? 454 ILE A HB   10 
ATOM 11124 H HG12 . ILE A 1 45 ? -1.012  4.165   1.823   1.00 10.00 ? 454 ILE A HG12 10 
ATOM 11125 H HG13 . ILE A 1 45 ? -0.620  4.190   3.545   1.00 10.00 ? 454 ILE A HG13 10 
ATOM 11126 H HG21 . ILE A 1 45 ? 0.180   2.835   0.688   1.00 10.00 ? 454 ILE A HG21 10 
ATOM 11127 H HG22 . ILE A 1 45 ? 0.766   1.853   2.031   1.00 10.00 ? 454 ILE A HG22 10 
ATOM 11128 H HG23 . ILE A 1 45 ? 1.910   2.562   0.892   1.00 10.00 ? 454 ILE A HG23 10 
ATOM 11129 H HD11 . ILE A 1 45 ? -0.522  6.380   1.559   1.00 10.00 ? 454 ILE A HD11 10 
ATOM 11130 H HD12 . ILE A 1 45 ? 0.642   6.400   2.875   1.00 10.00 ? 454 ILE A HD12 10 
ATOM 11131 H HD13 . ILE A 1 45 ? -1.079  6.393   3.228   1.00 10.00 ? 454 ILE A HD13 10 
ATOM 11132 N N    . ALA A 1 46 ? 3.964   3.042   2.857   1.00 10.00 ? 455 ALA A N    10 
ATOM 11133 C CA   . ALA A 1 46 ? 5.107   2.162   2.664   1.00 10.00 ? 455 ALA A CA   10 
ATOM 11134 C C    . ALA A 1 46 ? 5.731   1.783   4.006   1.00 10.00 ? 455 ALA A C    10 
ATOM 11135 O O    . ALA A 1 46 ? 6.721   1.053   4.056   1.00 10.00 ? 455 ALA A O    10 
ATOM 11136 C CB   . ALA A 1 46 ? 6.141   2.831   1.770   1.00 10.00 ? 455 ALA A CB   10 
ATOM 11137 H H    . ALA A 1 46 ? 4.025   3.974   2.570   1.00 10.00 ? 455 ALA A H    10 
ATOM 11138 H HA   . ALA A 1 46 ? 4.764   1.267   2.169   1.00 10.00 ? 455 ALA A HA   10 
ATOM 11139 H HB1  . ALA A 1 46 ? 6.166   3.890   1.980   1.00 10.00 ? 455 ALA A HB1  10 
ATOM 11140 H HB2  . ALA A 1 46 ? 5.878   2.675   0.735   1.00 10.00 ? 455 ALA A HB2  10 
ATOM 11141 H HB3  . ALA A 1 46 ? 7.114   2.403   1.963   1.00 10.00 ? 455 ALA A HB3  10 
ATOM 11142 N N    . SER A 1 47 ? 5.148   2.288   5.094   1.00 10.00 ? 456 SER A N    10 
ATOM 11143 C CA   . SER A 1 47 ? 5.647   2.009   6.431   1.00 10.00 ? 456 SER A CA   10 
ATOM 11144 C C    . SER A 1 47 ? 4.809   0.937   7.120   1.00 10.00 ? 456 SER A C    10 
ATOM 11145 O O    . SER A 1 47 ? 5.336   0.127   7.883   1.00 10.00 ? 456 SER A O    10 
ATOM 11146 C CB   . SER A 1 47 ? 5.652   3.286   7.274   1.00 10.00 ? 456 SER A CB   10 
ATOM 11147 O OG   . SER A 1 47 ? 6.608   3.207   8.316   1.00 10.00 ? 456 SER A OG   10 
ATOM 11148 H H    . SER A 1 47 ? 4.364   2.867   4.995   1.00 10.00 ? 456 SER A H    10 
ATOM 11149 H HA   . SER A 1 47 ? 6.661   1.649   6.338   1.00 10.00 ? 456 SER A HA   10 
ATOM 11150 H HB2  . SER A 1 47 ? 5.894   4.128   6.644   1.00 10.00 ? 456 SER A HB2  10 
ATOM 11151 H HB3  . SER A 1 47 ? 4.673   3.431   7.708   1.00 10.00 ? 456 SER A HB3  10 
ATOM 11152 H HG   . SER A 1 47 ? 7.491   3.179   7.941   1.00 10.00 ? 456 SER A HG   10 
ATOM 11153 N N    . PHE A 1 48 ? 3.503   0.925   6.853   1.00 10.00 ? 457 PHE A N    10 
ATOM 11154 C CA   . PHE A 1 48 ? 2.626   -0.067  7.463   1.00 10.00 ? 457 PHE A CA   10 
ATOM 11155 C C    . PHE A 1 48 ? 2.632   -1.359  6.643   1.00 10.00 ? 457 PHE A C    10 
ATOM 11156 O O    . PHE A 1 48 ? 2.675   -2.456  7.201   1.00 10.00 ? 457 PHE A O    10 
ATOM 11157 C CB   . PHE A 1 48 ? 1.204   0.489   7.628   1.00 10.00 ? 457 PHE A CB   10 
ATOM 11158 C CG   . PHE A 1 48 ? 0.381   0.455   6.375   1.00 10.00 ? 457 PHE A CG   10 
ATOM 11159 C CD1  . PHE A 1 48 ? -0.116  -0.747  5.897   1.00 10.00 ? 457 PHE A CD1  10 
ATOM 11160 C CD2  . PHE A 1 48 ? 0.113   1.619   5.666   1.00 10.00 ? 457 PHE A CD2  10 
ATOM 11161 C CE1  . PHE A 1 48 ? -0.861  -0.790  4.743   1.00 10.00 ? 457 PHE A CE1  10 
ATOM 11162 C CE2  . PHE A 1 48 ? -0.638  1.576   4.511   1.00 10.00 ? 457 PHE A CE2  10 
ATOM 11163 C CZ   . PHE A 1 48 ? -1.124  0.375   4.050   1.00 10.00 ? 457 PHE A CZ   10 
ATOM 11164 H H    . PHE A 1 48 ? 3.124   1.589   6.232   1.00 10.00 ? 457 PHE A H    10 
ATOM 11165 H HA   . PHE A 1 48 ? 3.027   -0.287  8.443   1.00 10.00 ? 457 PHE A HA   10 
ATOM 11166 H HB2  . PHE A 1 48 ? 0.686   -0.089  8.377   1.00 10.00 ? 457 PHE A HB2  10 
ATOM 11167 H HB3  . PHE A 1 48 ? 1.265   1.517   7.957   1.00 10.00 ? 457 PHE A HB3  10 
ATOM 11168 H HD1  . PHE A 1 48 ? 0.077   -1.661  6.443   1.00 10.00 ? 457 PHE A HD1  10 
ATOM 11169 H HD2  . PHE A 1 48 ? 0.495   2.570   6.023   1.00 10.00 ? 457 PHE A HD2  10 
ATOM 11170 H HE1  . PHE A 1 48 ? -1.233  -1.736  4.381   1.00 10.00 ? 457 PHE A HE1  10 
ATOM 11171 H HE2  . PHE A 1 48 ? -0.844  2.483   3.969   1.00 10.00 ? 457 PHE A HE2  10 
ATOM 11172 H HZ   . PHE A 1 48 ? -1.708  0.348   3.146   1.00 10.00 ? 457 PHE A HZ   10 
ATOM 11173 N N    . LEU A 1 49 ? 2.617   -1.222  5.318   1.00 10.00 ? 458 LEU A N    10 
ATOM 11174 C CA   . LEU A 1 49 ? 2.650   -2.381  4.429   1.00 10.00 ? 458 LEU A CA   10 
ATOM 11175 C C    . LEU A 1 49 ? 4.078   -2.612  3.939   1.00 10.00 ? 458 LEU A C    10 
ATOM 11176 O O    . LEU A 1 49 ? 4.342   -2.689  2.741   1.00 10.00 ? 458 LEU A O    10 
ATOM 11177 C CB   . LEU A 1 49 ? 1.688   -2.201  3.249   1.00 10.00 ? 458 LEU A CB   10 
ATOM 11178 C CG   . LEU A 1 49 ? 1.636   -0.796  2.654   1.00 10.00 ? 458 LEU A CG   10 
ATOM 11179 C CD1  . LEU A 1 49 ? 3.018   -0.382  2.178   1.00 10.00 ? 458 LEU A CD1  10 
ATOM 11180 C CD2  . LEU A 1 49 ? 0.627   -0.732  1.512   1.00 10.00 ? 458 LEU A CD2  10 
ATOM 11181 H H    . LEU A 1 49 ? 2.604   -0.321  4.930   1.00 10.00 ? 458 LEU A H    10 
ATOM 11182 H HA   . LEU A 1 49 ? 2.346   -3.242  5.001   1.00 10.00 ? 458 LEU A HA   10 
ATOM 11183 H HB2  . LEU A 1 49 ? 1.977   -2.889  2.469   1.00 10.00 ? 458 LEU A HB2  10 
ATOM 11184 H HB3  . LEU A 1 49 ? 0.696   -2.460  3.583   1.00 10.00 ? 458 LEU A HB3  10 
ATOM 11185 H HG   . LEU A 1 49 ? 1.323   -0.101  3.418   1.00 10.00 ? 458 LEU A HG   10 
ATOM 11186 H HD11 . LEU A 1 49 ? 3.395   -1.115  1.487   1.00 10.00 ? 458 LEU A HD11 10 
ATOM 11187 H HD12 . LEU A 1 49 ? 3.684   -0.315  3.028   1.00 10.00 ? 458 LEU A HD12 10 
ATOM 11188 H HD13 . LEU A 1 49 ? 2.958   0.578   1.689   1.00 10.00 ? 458 LEU A HD13 10 
ATOM 11189 H HD21 . LEU A 1 49 ? -0.252  -0.186  1.832   1.00 10.00 ? 458 LEU A HD21 10 
ATOM 11190 H HD22 . LEU A 1 49 ? 0.340   -1.733  1.225   1.00 10.00 ? 458 LEU A HD22 10 
ATOM 11191 H HD23 . LEU A 1 49 ? 1.071   -0.230  0.664   1.00 10.00 ? 458 LEU A HD23 10 
ATOM 11192 N N    . GLU A 1 50 ? 4.988   -2.705  4.906   1.00 10.00 ? 459 GLU A N    10 
ATOM 11193 C CA   . GLU A 1 50 ? 6.418   -2.911  4.660   1.00 10.00 ? 459 GLU A CA   10 
ATOM 11194 C C    . GLU A 1 50 ? 6.689   -3.793  3.445   1.00 10.00 ? 459 GLU A C    10 
ATOM 11195 O O    . GLU A 1 50 ? 7.680   -3.595  2.742   1.00 10.00 ? 459 GLU A O    10 
ATOM 11196 C CB   . GLU A 1 50 ? 7.078   -3.525  5.895   1.00 10.00 ? 459 GLU A CB   10 
ATOM 11197 C CG   . GLU A 1 50 ? 7.043   -2.621  7.116   1.00 10.00 ? 459 GLU A CG   10 
ATOM 11198 C CD   . GLU A 1 50 ? 8.256   -1.715  7.205   1.00 10.00 ? 459 GLU A CD   10 
ATOM 11199 O OE1  . GLU A 1 50 ? 8.406   -0.836  6.330   1.00 10.00 ? 459 GLU A OE1  10 
ATOM 11200 O OE2  . GLU A 1 50 ? 9.056   -1.883  8.149   1.00 10.00 ? 459 GLU A OE2  10 
ATOM 11201 H H    . GLU A 1 50 ? 4.686   -2.619  5.829   1.00 10.00 ? 459 GLU A H    10 
ATOM 11202 H HA   . GLU A 1 50 ? 6.860   -1.943  4.482   1.00 10.00 ? 459 GLU A HA   10 
ATOM 11203 H HB2  . GLU A 1 50 ? 6.569   -4.445  6.141   1.00 10.00 ? 459 GLU A HB2  10 
ATOM 11204 H HB3  . GLU A 1 50 ? 8.111   -3.746  5.666   1.00 10.00 ? 459 GLU A HB3  10 
ATOM 11205 H HG2  . GLU A 1 50 ? 6.158   -2.006  7.068   1.00 10.00 ? 459 GLU A HG2  10 
ATOM 11206 H HG3  . GLU A 1 50 ? 7.007   -3.236  8.003   1.00 10.00 ? 459 GLU A HG3  10 
ATOM 11207 N N    . ARG A 1 51 ? 5.812   -4.765  3.192   1.00 10.00 ? 460 ARG A N    10 
ATOM 11208 C CA   . ARG A 1 51 ? 5.984   -5.658  2.049   1.00 10.00 ? 460 ARG A CA   10 
ATOM 11209 C C    . ARG A 1 51 ? 6.299   -4.851  0.792   1.00 10.00 ? 460 ARG A C    10 
ATOM 11210 O O    . ARG A 1 51 ? 6.985   -5.327  -0.112  1.00 10.00 ? 460 ARG A O    10 
ATOM 11211 C CB   . ARG A 1 51 ? 4.734   -6.512  1.836   1.00 10.00 ? 460 ARG A CB   10 
ATOM 11212 C CG   . ARG A 1 51 ? 5.023   -8.004  1.808   1.00 10.00 ? 460 ARG A CG   10 
ATOM 11213 C CD   . ARG A 1 51 ? 4.464   -8.707  3.035   1.00 10.00 ? 460 ARG A CD   10 
ATOM 11214 N NE   . ARG A 1 51 ? 5.471   -8.863  4.084   1.00 10.00 ? 460 ARG A NE   10 
ATOM 11215 C CZ   . ARG A 1 51 ? 6.569   -9.604  3.954   1.00 10.00 ? 460 ARG A CZ   10 
ATOM 11216 N NH1  . ARG A 1 51 ? 6.807   -10.261 2.826   1.00 10.00 ? 460 ARG A NH1  10 
ATOM 11217 N NH2  . ARG A 1 51 ? 7.432   -9.690  4.958   1.00 10.00 ? 460 ARG A NH2  10 
ATOM 11218 H H    . ARG A 1 51 ? 5.038   -4.879  3.780   1.00 10.00 ? 460 ARG A H    10 
ATOM 11219 H HA   . ARG A 1 51 ? 6.821   -6.306  2.262   1.00 10.00 ? 460 ARG A HA   10 
ATOM 11220 H HB2  . ARG A 1 51 ? 4.034   -6.314  2.635   1.00 10.00 ? 460 ARG A HB2  10 
ATOM 11221 H HB3  . ARG A 1 51 ? 4.279   -6.240  0.896   1.00 10.00 ? 460 ARG A HB3  10 
ATOM 11222 H HG2  . ARG A 1 51 ? 4.575   -8.432  0.926   1.00 10.00 ? 460 ARG A HG2  10 
ATOM 11223 H HG3  . ARG A 1 51 ? 6.093   -8.152  1.778   1.00 10.00 ? 460 ARG A HG3  10 
ATOM 11224 H HD2  . ARG A 1 51 ? 3.641   -8.127  3.424   1.00 10.00 ? 460 ARG A HD2  10 
ATOM 11225 H HD3  . ARG A 1 51 ? 4.109   -9.684  2.744   1.00 10.00 ? 460 ARG A HD3  10 
ATOM 11226 H HE   . ARG A 1 51 ? 5.320   -8.391  4.929   1.00 10.00 ? 460 ARG A HE   10 
ATOM 11227 H HH11 . ARG A 1 51 ? 6.160   -10.202 2.066   1.00 10.00 ? 460 ARG A HH11 10 
ATOM 11228 H HH12 . ARG A 1 51 ? 7.634   -10.816 2.736   1.00 10.00 ? 460 ARG A HH12 10 
ATOM 11229 H HH21 . ARG A 1 51 ? 7.258   -9.197  5.811   1.00 10.00 ? 460 ARG A HH21 10 
ATOM 11230 H HH22 . ARG A 1 51 ? 8.257   -10.246 4.861   1.00 10.00 ? 460 ARG A HH22 10 
ATOM 11231 N N    . LYS A 1 52 ? 5.811   -3.615  0.764   1.00 10.00 ? 461 LYS A N    10 
ATOM 11232 C CA   . LYS A 1 52 ? 6.054   -2.718  -0.358  1.00 10.00 ? 461 LYS A CA   10 
ATOM 11233 C C    . LYS A 1 52 ? 6.599   -1.388  0.148   1.00 10.00 ? 461 LYS A C    10 
ATOM 11234 O O    . LYS A 1 52 ? 6.586   -1.120  1.351   1.00 10.00 ? 461 LYS A O    10 
ATOM 11235 C CB   . LYS A 1 52 ? 4.779   -2.491  -1.180  1.00 10.00 ? 461 LYS A CB   10 
ATOM 11236 C CG   . LYS A 1 52 ? 3.486   -2.564  -0.378  1.00 10.00 ? 461 LYS A CG   10 
ATOM 11237 C CD   . LYS A 1 52 ? 2.499   -3.531  -1.009  1.00 10.00 ? 461 LYS A CD   10 
ATOM 11238 C CE   . LYS A 1 52 ? 2.973   -4.970  -0.893  1.00 10.00 ? 461 LYS A CE   10 
ATOM 11239 N NZ   . LYS A 1 52 ? 2.159   -5.746  0.082   1.00 10.00 ? 461 LYS A NZ   10 
ATOM 11240 H H    . LYS A 1 52 ? 5.286   -3.291  1.529   1.00 10.00 ? 461 LYS A H    10 
ATOM 11241 H HA   . LYS A 1 52 ? 6.801   -3.178  -0.989  1.00 10.00 ? 461 LYS A HA   10 
ATOM 11242 H HB2  . LYS A 1 52 ? 4.834   -1.515  -1.638  1.00 10.00 ? 461 LYS A HB2  10 
ATOM 11243 H HB3  . LYS A 1 52 ? 4.735   -3.238  -1.960  1.00 10.00 ? 461 LYS A HB3  10 
ATOM 11244 H HG2  . LYS A 1 52 ? 3.706   -2.893  0.628   1.00 10.00 ? 461 LYS A HG2  10 
ATOM 11245 H HG3  . LYS A 1 52 ? 3.041   -1.581  -0.346  1.00 10.00 ? 461 LYS A HG3  10 
ATOM 11246 H HD2  . LYS A 1 52 ? 1.546   -3.434  -0.510  1.00 10.00 ? 461 LYS A HD2  10 
ATOM 11247 H HD3  . LYS A 1 52 ? 2.388   -3.281  -2.054  1.00 10.00 ? 461 LYS A HD3  10 
ATOM 11248 H HE2  . LYS A 1 52 ? 2.898   -5.439  -1.863  1.00 10.00 ? 461 LYS A HE2  10 
ATOM 11249 H HE3  . LYS A 1 52 ? 4.004   -4.972  -0.573  1.00 10.00 ? 461 LYS A HE3  10 
ATOM 11250 H HZ1  . LYS A 1 52 ? 1.147   -5.648  -0.137  1.00 10.00 ? 461 LYS A HZ1  10 
ATOM 11251 H HZ2  . LYS A 1 52 ? 2.327   -5.395  1.047   1.00 10.00 ? 461 LYS A HZ2  10 
ATOM 11252 H HZ3  . LYS A 1 52 ? 2.417   -6.753  0.042   1.00 10.00 ? 461 LYS A HZ3  10 
ATOM 11253 N N    . THR A 1 53 ? 7.088   -0.560  -0.767  1.00 10.00 ? 462 THR A N    10 
ATOM 11254 C CA   . THR A 1 53 ? 7.646   0.737   -0.396  1.00 10.00 ? 462 THR A CA   10 
ATOM 11255 C C    . THR A 1 53 ? 7.178   1.832   -1.349  1.00 10.00 ? 462 THR A C    10 
ATOM 11256 O O    . THR A 1 53 ? 6.354   1.593   -2.227  1.00 10.00 ? 462 THR A O    10 
ATOM 11257 C CB   . THR A 1 53 ? 9.175   0.670   -0.387  1.00 10.00 ? 462 THR A CB   10 
ATOM 11258 O OG1  . THR A 1 53 ? 9.636   -0.353  -1.253  1.00 10.00 ? 462 THR A OG1  10 
ATOM 11259 C CG2  . THR A 1 53 ? 9.753   0.405   0.985   1.00 10.00 ? 462 THR A CG2  10 
ATOM 11260 H H    . THR A 1 53 ? 7.077   -0.829  -1.709  1.00 10.00 ? 462 THR A H    10 
ATOM 11261 H HA   . THR A 1 53 ? 7.301   0.971   0.598   1.00 10.00 ? 462 THR A HA   10 
ATOM 11262 H HB   . THR A 1 53 ? 9.570   1.613   -0.736  1.00 10.00 ? 462 THR A HB   10 
ATOM 11263 H HG1  . THR A 1 53 ? 9.376   -1.209  -0.905  1.00 10.00 ? 462 THR A HG1  10 
ATOM 11264 H HG21 . THR A 1 53 ? 10.438  1.198   1.246   1.00 10.00 ? 462 THR A HG21 10 
ATOM 11265 H HG22 . THR A 1 53 ? 10.280  -0.539  0.978   1.00 10.00 ? 462 THR A HG22 10 
ATOM 11266 H HG23 . THR A 1 53 ? 8.955   0.366   1.711   1.00 10.00 ? 462 THR A HG23 10 
ATOM 11267 N N    . VAL A 1 54 ? 7.714   3.035   -1.165  1.00 10.00 ? 463 VAL A N    10 
ATOM 11268 C CA   . VAL A 1 54 ? 7.355   4.172   -2.005  1.00 10.00 ? 463 VAL A CA   10 
ATOM 11269 C C    . VAL A 1 54 ? 7.620   3.868   -3.479  1.00 10.00 ? 463 VAL A C    10 
ATOM 11270 O O    . VAL A 1 54 ? 6.873   4.304   -4.355  1.00 10.00 ? 463 VAL A O    10 
ATOM 11271 C CB   . VAL A 1 54 ? 8.137   5.439   -1.588  1.00 10.00 ? 463 VAL A CB   10 
ATOM 11272 C CG1  . VAL A 1 54 ? 7.822   6.613   -2.506  1.00 10.00 ? 463 VAL A CG1  10 
ATOM 11273 C CG2  . VAL A 1 54 ? 7.835   5.796   -0.139  1.00 10.00 ? 463 VAL A CG2  10 
ATOM 11274 H H    . VAL A 1 54 ? 8.366   3.162   -0.444  1.00 10.00 ? 463 VAL A H    10 
ATOM 11275 H HA   . VAL A 1 54 ? 6.300   4.363   -1.872  1.00 10.00 ? 463 VAL A HA   10 
ATOM 11276 H HB   . VAL A 1 54 ? 9.193   5.225   -1.667  1.00 10.00 ? 463 VAL A HB   10 
ATOM 11277 H HG11 . VAL A 1 54 ? 7.203   7.325   -1.983  1.00 10.00 ? 463 VAL A HG11 10 
ATOM 11278 H HG12 . VAL A 1 54 ? 7.301   6.259   -3.382  1.00 10.00 ? 463 VAL A HG12 10 
ATOM 11279 H HG13 . VAL A 1 54 ? 8.743   7.091   -2.807  1.00 10.00 ? 463 VAL A HG13 10 
ATOM 11280 H HG21 . VAL A 1 54 ? 8.741   6.128   0.347   1.00 10.00 ? 463 VAL A HG21 10 
ATOM 11281 H HG22 . VAL A 1 54 ? 7.451   4.926   0.374   1.00 10.00 ? 463 VAL A HG22 10 
ATOM 11282 H HG23 . VAL A 1 54 ? 7.099   6.587   -0.106  1.00 10.00 ? 463 VAL A HG23 10 
ATOM 11283 N N    . ALA A 1 55 ? 8.682   3.116   -3.744  1.00 10.00 ? 464 ALA A N    10 
ATOM 11284 C CA   . ALA A 1 55 ? 9.039   2.756   -5.111  1.00 10.00 ? 464 ALA A CA   10 
ATOM 11285 C C    . ALA A 1 55 ? 8.204   1.579   -5.605  1.00 10.00 ? 464 ALA A C    10 
ATOM 11286 O O    . ALA A 1 55 ? 7.931   1.458   -6.799  1.00 10.00 ? 464 ALA A O    10 
ATOM 11287 C CB   . ALA A 1 55 ? 10.521  2.428   -5.202  1.00 10.00 ? 464 ALA A CB   10 
ATOM 11288 H H    . ALA A 1 55 ? 9.239   2.796   -3.004  1.00 10.00 ? 464 ALA A H    10 
ATOM 11289 H HA   . ALA A 1 55 ? 8.843   3.611   -5.743  1.00 10.00 ? 464 ALA A HA   10 
ATOM 11290 H HB1  . ALA A 1 55 ? 11.093  3.344   -5.204  1.00 10.00 ? 464 ALA A HB1  10 
ATOM 11291 H HB2  . ALA A 1 55 ? 10.715  1.881   -6.113  1.00 10.00 ? 464 ALA A HB2  10 
ATOM 11292 H HB3  . ALA A 1 55 ? 10.809  1.826   -4.352  1.00 10.00 ? 464 ALA A HB3  10 
ATOM 11293 N N    . GLU A 1 56 ? 7.799   0.715   -4.680  1.00 10.00 ? 465 GLU A N    10 
ATOM 11294 C CA   . GLU A 1 56 ? 6.993   -0.450  -5.027  1.00 10.00 ? 465 GLU A CA   10 
ATOM 11295 C C    . GLU A 1 56 ? 5.503   -0.118  -5.002  1.00 10.00 ? 465 GLU A C    10 
ATOM 11296 O O    . GLU A 1 56 ? 4.689   -0.847  -5.569  1.00 10.00 ? 465 GLU A O    10 
ATOM 11297 C CB   . GLU A 1 56 ? 7.285   -1.607  -4.070  1.00 10.00 ? 465 GLU A CB   10 
ATOM 11298 C CG   . GLU A 1 56 ? 7.403   -2.953  -4.764  1.00 10.00 ? 465 GLU A CG   10 
ATOM 11299 C CD   . GLU A 1 56 ? 8.538   -2.993  -5.769  1.00 10.00 ? 465 GLU A CD   10 
ATOM 11300 O OE1  . GLU A 1 56 ? 8.317   -2.592  -6.931  1.00 10.00 ? 465 GLU A OE1  10 
ATOM 11301 O OE2  . GLU A 1 56 ? 9.648   -3.426  -5.394  1.00 10.00 ? 465 GLU A OE2  10 
ATOM 11302 H H    . GLU A 1 56 ? 8.046   0.864   -3.744  1.00 10.00 ? 465 GLU A H    10 
ATOM 11303 H HA   . GLU A 1 56 ? 7.263   -0.750  -6.028  1.00 10.00 ? 465 GLU A HA   10 
ATOM 11304 H HB2  . GLU A 1 56 ? 8.213   -1.408  -3.554  1.00 10.00 ? 465 GLU A HB2  10 
ATOM 11305 H HB3  . GLU A 1 56 ? 6.487   -1.671  -3.345  1.00 10.00 ? 465 GLU A HB3  10 
ATOM 11306 H HG2  . GLU A 1 56 ? 7.577   -3.715  -4.019  1.00 10.00 ? 465 GLU A HG2  10 
ATOM 11307 H HG3  . GLU A 1 56 ? 6.477   -3.160  -5.281  1.00 10.00 ? 465 GLU A HG3  10 
ATOM 11308 N N    . CYS A 1 57 ? 5.146   0.984   -4.346  1.00 10.00 ? 466 CYS A N    10 
ATOM 11309 C CA   . CYS A 1 57 ? 3.754   1.397   -4.261  1.00 10.00 ? 466 CYS A CA   10 
ATOM 11310 C C    . CYS A 1 57 ? 3.308   2.038   -5.569  1.00 10.00 ? 466 CYS A C    10 
ATOM 11311 O O    . CYS A 1 57 ? 2.121   2.043   -5.895  1.00 10.00 ? 466 CYS A O    10 
ATOM 11312 C CB   . CYS A 1 57 ? 3.552   2.361   -3.093  1.00 10.00 ? 466 CYS A CB   10 
ATOM 11313 S SG   . CYS A 1 57 ? 1.849   2.438   -2.488  1.00 10.00 ? 466 CYS A SG   10 
ATOM 11314 H H    . CYS A 1 57 ? 5.832   1.533   -3.914  1.00 10.00 ? 466 CYS A H    10 
ATOM 11315 H HA   . CYS A 1 57 ? 3.160   0.512   -4.093  1.00 10.00 ? 466 CYS A HA   10 
ATOM 11316 H HB2  . CYS A 1 57 ? 4.177   2.053   -2.269  1.00 10.00 ? 466 CYS A HB2  10 
ATOM 11317 H HB3  . CYS A 1 57 ? 3.838   3.355   -3.401  1.00 10.00 ? 466 CYS A HB3  10 
ATOM 11318 H HG   . CYS A 1 57 ? 1.758   1.796   -1.780  1.00 10.00 ? 466 CYS A HG   10 
ATOM 11319 N N    . VAL A 1 58 ? 4.270   2.557   -6.329  1.00 10.00 ? 467 VAL A N    10 
ATOM 11320 C CA   . VAL A 1 58 ? 3.970   3.172   -7.614  1.00 10.00 ? 467 VAL A CA   10 
ATOM 11321 C C    . VAL A 1 58 ? 3.275   2.165   -8.528  1.00 10.00 ? 467 VAL A C    10 
ATOM 11322 O O    . VAL A 1 58 ? 2.598   2.541   -9.483  1.00 10.00 ? 467 VAL A O    10 
ATOM 11323 C CB   . VAL A 1 58 ? 5.250   3.693   -8.303  1.00 10.00 ? 467 VAL A CB   10 
ATOM 11324 C CG1  . VAL A 1 58 ? 4.936   4.238   -9.692  1.00 10.00 ? 467 VAL A CG1  10 
ATOM 11325 C CG2  . VAL A 1 58 ? 5.919   4.757   -7.447  1.00 10.00 ? 467 VAL A CG2  10 
ATOM 11326 H H    . VAL A 1 58 ? 5.201   2.508   -6.028  1.00 10.00 ? 467 VAL A H    10 
ATOM 11327 H HA   . VAL A 1 58 ? 3.308   4.008   -7.440  1.00 10.00 ? 467 VAL A HA   10 
ATOM 11328 H HB   . VAL A 1 58 ? 5.938   2.867   -8.412  1.00 10.00 ? 467 VAL A HB   10 
ATOM 11329 H HG11 . VAL A 1 58 ? 4.456   3.469   -10.281 1.00 10.00 ? 467 VAL A HG11 10 
ATOM 11330 H HG12 . VAL A 1 58 ? 5.853   4.542   -10.174 1.00 10.00 ? 467 VAL A HG12 10 
ATOM 11331 H HG13 . VAL A 1 58 ? 4.276   5.088   -9.604  1.00 10.00 ? 467 VAL A HG13 10 
ATOM 11332 H HG21 . VAL A 1 58 ? 5.873   4.465   -6.408  1.00 10.00 ? 467 VAL A HG21 10 
ATOM 11333 H HG22 . VAL A 1 58 ? 5.406   5.698   -7.578  1.00 10.00 ? 467 VAL A HG22 10 
ATOM 11334 H HG23 . VAL A 1 58 ? 6.950   4.863   -7.746  1.00 10.00 ? 467 VAL A HG23 10 
ATOM 11335 N N    . LEU A 1 59 ? 3.442   0.881   -8.220  1.00 10.00 ? 468 LEU A N    10 
ATOM 11336 C CA   . LEU A 1 59 ? 2.827   -0.179  -9.003  1.00 10.00 ? 468 LEU A CA   10 
ATOM 11337 C C    . LEU A 1 59 ? 1.339   -0.308  -8.681  1.00 10.00 ? 468 LEU A C    10 
ATOM 11338 O O    . LEU A 1 59 ? 0.644   -1.141  -9.260  1.00 10.00 ? 468 LEU A O    10 
ATOM 11339 C CB   . LEU A 1 59 ? 3.544   -1.509  -8.742  1.00 10.00 ? 468 LEU A CB   10 
ATOM 11340 C CG   . LEU A 1 59 ? 4.336   -2.070  -9.926  1.00 10.00 ? 468 LEU A CG   10 
ATOM 11341 C CD1  . LEU A 1 59 ? 3.397   -2.669  -10.962 1.00 10.00 ? 468 LEU A CD1  10 
ATOM 11342 C CD2  . LEU A 1 59 ? 5.208   -0.990  -10.553 1.00 10.00 ? 468 LEU A CD2  10 
ATOM 11343 H H    . LEU A 1 59 ? 3.990   0.642   -7.445  1.00 10.00 ? 468 LEU A H    10 
ATOM 11344 H HA   . LEU A 1 59 ? 2.930   0.083   -10.045 1.00 10.00 ? 468 LEU A HA   10 
ATOM 11345 H HB2  . LEU A 1 59 ? 4.226   -1.366  -7.916  1.00 10.00 ? 468 LEU A HB2  10 
ATOM 11346 H HB3  . LEU A 1 59 ? 2.805   -2.241  -8.453  1.00 10.00 ? 468 LEU A HB3  10 
ATOM 11347 H HG   . LEU A 1 59 ? 4.985   -2.858  -9.572  1.00 10.00 ? 468 LEU A HG   10 
ATOM 11348 H HD11 . LEU A 1 59 ? 3.273   -3.725  -10.767 1.00 10.00 ? 468 LEU A HD11 10 
ATOM 11349 H HD12 . LEU A 1 59 ? 3.814   -2.532  -11.948 1.00 10.00 ? 468 LEU A HD12 10 
ATOM 11350 H HD13 . LEU A 1 59 ? 2.437   -2.179  -10.905 1.00 10.00 ? 468 LEU A HD13 10 
ATOM 11351 H HD21 . LEU A 1 59 ? 6.181   -1.398  -10.778 1.00 10.00 ? 468 LEU A HD21 10 
ATOM 11352 H HD22 . LEU A 1 59 ? 5.313   -0.167  -9.862  1.00 10.00 ? 468 LEU A HD22 10 
ATOM 11353 H HD23 . LEU A 1 59 ? 4.746   -0.638  -11.464 1.00 10.00 ? 468 LEU A HD23 10 
ATOM 11354 N N    . TYR A 1 60 ? 0.856   0.518   -7.756  1.00 10.00 ? 469 TYR A N    10 
ATOM 11355 C CA   . TYR A 1 60 ? -0.548  0.497   -7.369  1.00 10.00 ? 469 TYR A CA   10 
ATOM 11356 C C    . TYR A 1 60 ? -1.227  1.829   -7.690  1.00 10.00 ? 469 TYR A C    10 
ATOM 11357 O O    . TYR A 1 60 ? -2.452  1.927   -7.674  1.00 10.00 ? 469 TYR A O    10 
ATOM 11358 C CB   . TYR A 1 60 ? -0.677  0.146   -5.873  1.00 10.00 ? 469 TYR A CB   10 
ATOM 11359 C CG   . TYR A 1 60 ? -1.288  1.203   -4.971  1.00 10.00 ? 469 TYR A CG   10 
ATOM 11360 C CD1  . TYR A 1 60 ? -0.888  2.530   -5.046  1.00 10.00 ? 469 TYR A CD1  10 
ATOM 11361 C CD2  . TYR A 1 60 ? -2.259  0.864   -4.031  1.00 10.00 ? 469 TYR A CD2  10 
ATOM 11362 C CE1  . TYR A 1 60 ? -1.435  3.490   -4.222  1.00 10.00 ? 469 TYR A CE1  10 
ATOM 11363 C CE2  . TYR A 1 60 ? -2.809  1.820   -3.203  1.00 10.00 ? 469 TYR A CE2  10 
ATOM 11364 C CZ   . TYR A 1 60 ? -2.392  3.131   -3.303  1.00 10.00 ? 469 TYR A CZ   10 
ATOM 11365 O OH   . TYR A 1 60 ? -2.931  4.088   -2.481  1.00 10.00 ? 469 TYR A OH   10 
ATOM 11366 H H    . TYR A 1 60 ? 1.455   1.151   -7.323  1.00 10.00 ? 469 TYR A H    10 
ATOM 11367 H HA   . TYR A 1 60 ? -1.027  -0.281  -7.944  1.00 10.00 ? 469 TYR A HA   10 
ATOM 11368 H HB2  . TYR A 1 60 ? -1.290  -0.730  -5.785  1.00 10.00 ? 469 TYR A HB2  10 
ATOM 11369 H HB3  . TYR A 1 60 ? 0.307   -0.075  -5.490  1.00 10.00 ? 469 TYR A HB3  10 
ATOM 11370 H HD1  . TYR A 1 60 ? -0.139  2.807   -5.764  1.00 10.00 ? 469 TYR A HD1  10 
ATOM 11371 H HD2  . TYR A 1 60 ? -2.584  -0.171  -3.943  1.00 10.00 ? 469 TYR A HD2  10 
ATOM 11372 H HE1  . TYR A 1 60 ? -1.109  4.516   -4.300  1.00 10.00 ? 469 TYR A HE1  10 
ATOM 11373 H HE2  . TYR A 1 60 ? -3.561  1.534   -2.480  1.00 10.00 ? 469 TYR A HE2  10 
ATOM 11374 H HH   . TYR A 1 60 ? -2.377  4.192   -1.704  1.00 10.00 ? 469 TYR A HH   10 
ATOM 11375 N N    . TYR A 1 61 ? -0.422  2.861   -7.959  1.00 10.00 ? 470 TYR A N    10 
ATOM 11376 C CA   . TYR A 1 61 ? -0.953  4.186   -8.251  1.00 10.00 ? 470 TYR A CA   10 
ATOM 11377 C C    . TYR A 1 61 ? -1.281  4.352   -9.734  1.00 10.00 ? 470 TYR A C    10 
ATOM 11378 O O    . TYR A 1 61 ? -2.204  5.087   -10.085 1.00 10.00 ? 470 TYR A O    10 
ATOM 11379 C CB   . TYR A 1 61 ? 0.035   5.268   -7.778  1.00 10.00 ? 470 TYR A CB   10 
ATOM 11380 C CG   . TYR A 1 61 ? 0.667   6.083   -8.888  1.00 10.00 ? 470 TYR A CG   10 
ATOM 11381 C CD1  . TYR A 1 61 ? 1.482   5.482   -9.836  1.00 10.00 ? 470 TYR A CD1  10 
ATOM 11382 C CD2  . TYR A 1 61 ? 0.450   7.452   -8.982  1.00 10.00 ? 470 TYR A CD2  10 
ATOM 11383 C CE1  . TYR A 1 61 ? 2.061   6.219   -10.848 1.00 10.00 ? 470 TYR A CE1  10 
ATOM 11384 C CE2  . TYR A 1 61 ? 1.027   8.197   -9.992  1.00 10.00 ? 470 TYR A CE2  10 
ATOM 11385 C CZ   . TYR A 1 61 ? 1.833   7.576   -10.923 1.00 10.00 ? 470 TYR A CZ   10 
ATOM 11386 O OH   . TYR A 1 61 ? 2.410   8.314   -11.930 1.00 10.00 ? 470 TYR A OH   10 
ATOM 11387 H H    . TYR A 1 61 ? 0.549   2.733   -7.943  1.00 10.00 ? 470 TYR A H    10 
ATOM 11388 H HA   . TYR A 1 61 ? -1.868  4.293   -7.690  1.00 10.00 ? 470 TYR A HA   10 
ATOM 11389 H HB2  . TYR A 1 61 ? -0.486  5.953   -7.126  1.00 10.00 ? 470 TYR A HB2  10 
ATOM 11390 H HB3  . TYR A 1 61 ? 0.831   4.792   -7.222  1.00 10.00 ? 470 TYR A HB3  10 
ATOM 11391 H HD1  . TYR A 1 61 ? 1.658   4.420   -9.777  1.00 10.00 ? 470 TYR A HD1  10 
ATOM 11392 H HD2  . TYR A 1 61 ? -0.181  7.936   -8.251  1.00 10.00 ? 470 TYR A HD2  10 
ATOM 11393 H HE1  . TYR A 1 61 ? 2.692   5.730   -11.576 1.00 10.00 ? 470 TYR A HE1  10 
ATOM 11394 H HE2  . TYR A 1 61 ? 0.847   9.260   -10.048 1.00 10.00 ? 470 TYR A HE2  10 
ATOM 11395 H HH   . TYR A 1 61 ? 2.976   8.989   -11.549 1.00 10.00 ? 470 TYR A HH   10 
ATOM 11396 N N    . TYR A 1 62 ? -0.535  3.675   -10.605 1.00 10.00 ? 471 TYR A N    10 
ATOM 11397 C CA   . TYR A 1 62 ? -0.796  3.783   -12.037 1.00 10.00 ? 471 TYR A CA   10 
ATOM 11398 C C    . TYR A 1 62 ? -1.982  2.911   -12.447 1.00 10.00 ? 471 TYR A C    10 
ATOM 11399 O O    . TYR A 1 62 ? -2.387  2.905   -13.608 1.00 10.00 ? 471 TYR A O    10 
ATOM 11400 C CB   . TYR A 1 62 ? 0.459   3.440   -12.855 1.00 10.00 ? 471 TYR A CB   10 
ATOM 11401 C CG   . TYR A 1 62 ? 0.734   1.960   -13.010 1.00 10.00 ? 471 TYR A CG   10 
ATOM 11402 C CD1  . TYR A 1 62 ? -0.021  1.179   -13.876 1.00 10.00 ? 471 TYR A CD1  10 
ATOM 11403 C CD2  . TYR A 1 62 ? 1.756   1.348   -12.296 1.00 10.00 ? 471 TYR A CD2  10 
ATOM 11404 C CE1  . TYR A 1 62 ? 0.232   -0.171  -14.024 1.00 10.00 ? 471 TYR A CE1  10 
ATOM 11405 C CE2  . TYR A 1 62 ? 2.016   -0.003  -12.442 1.00 10.00 ? 471 TYR A CE2  10 
ATOM 11406 C CZ   . TYR A 1 62 ? 1.251   -0.756  -13.305 1.00 10.00 ? 471 TYR A CZ   10 
ATOM 11407 O OH   . TYR A 1 62 ? 1.507   -2.101  -13.452 1.00 10.00 ? 471 TYR A OH   10 
ATOM 11408 H H    . TYR A 1 62 ? 0.192   3.094   -10.283 1.00 10.00 ? 471 TYR A H    10 
ATOM 11409 H HA   . TYR A 1 62 ? -1.061  4.813   -12.231 1.00 10.00 ? 471 TYR A HA   10 
ATOM 11410 H HB2  . TYR A 1 62 ? 0.355   3.857   -13.845 1.00 10.00 ? 471 TYR A HB2  10 
ATOM 11411 H HB3  . TYR A 1 62 ? 1.319   3.888   -12.376 1.00 10.00 ? 471 TYR A HB3  10 
ATOM 11412 H HD1  . TYR A 1 62 ? -0.818  1.640   -14.440 1.00 10.00 ? 471 TYR A HD1  10 
ATOM 11413 H HD2  . TYR A 1 62 ? 2.354   1.941   -11.618 1.00 10.00 ? 471 TYR A HD2  10 
ATOM 11414 H HE1  . TYR A 1 62 ? -0.368  -0.761  -14.702 1.00 10.00 ? 471 TYR A HE1  10 
ATOM 11415 H HE2  . TYR A 1 62 ? 2.815   -0.461  -11.880 1.00 10.00 ? 471 TYR A HE2  10 
ATOM 11416 H HH   . TYR A 1 62 ? 1.130   -2.581  -12.711 1.00 10.00 ? 471 TYR A HH   10 
ATOM 11417 N N    . LEU A 1 63 ? -2.551  2.196   -11.478 1.00 10.00 ? 472 LEU A N    10 
ATOM 11418 C CA   . LEU A 1 63 ? -3.705  1.345   -11.729 1.00 10.00 ? 472 LEU A CA   10 
ATOM 11419 C C    . LEU A 1 63 ? -4.972  2.014   -11.206 1.00 10.00 ? 472 LEU A C    10 
ATOM 11420 O O    . LEU A 1 63 ? -6.066  1.794   -11.726 1.00 10.00 ? 472 LEU A O    10 
ATOM 11421 C CB   . LEU A 1 63 ? -3.522  -0.019  -11.061 1.00 10.00 ? 472 LEU A CB   10 
ATOM 11422 C CG   . LEU A 1 63 ? -2.321  -0.826  -11.557 1.00 10.00 ? 472 LEU A CG   10 
ATOM 11423 C CD1  . LEU A 1 63 ? -1.023  -0.197  -11.078 1.00 10.00 ? 472 LEU A CD1  10 
ATOM 11424 C CD2  . LEU A 1 63 ? -2.421  -2.270  -11.088 1.00 10.00 ? 472 LEU A CD2  10 
ATOM 11425 H H    . LEU A 1 63 ? -2.197  2.254   -10.568 1.00 10.00 ? 472 LEU A H    10 
ATOM 11426 H HA   . LEU A 1 63 ? -3.795  1.209   -12.797 1.00 10.00 ? 472 LEU A HA   10 
ATOM 11427 H HB2  . LEU A 1 63 ? -3.411  0.137   -9.998  1.00 10.00 ? 472 LEU A HB2  10 
ATOM 11428 H HB3  . LEU A 1 63 ? -4.413  -0.603  -11.231 1.00 10.00 ? 472 LEU A HB3  10 
ATOM 11429 H HG   . LEU A 1 63 ? -2.315  -0.824  -12.637 1.00 10.00 ? 472 LEU A HG   10 
ATOM 11430 H HD11 . LEU A 1 63 ? -0.203  -0.875  -11.268 1.00 10.00 ? 472 LEU A HD11 10 
ATOM 11431 H HD12 . LEU A 1 63 ? -1.086  0.002   -10.017 1.00 10.00 ? 472 LEU A HD12 10 
ATOM 11432 H HD13 . LEU A 1 63 ? -0.853  0.726   -11.606 1.00 10.00 ? 472 LEU A HD13 10 
ATOM 11433 H HD21 . LEU A 1 63 ? -2.051  -2.926  -11.862 1.00 10.00 ? 472 LEU A HD21 10 
ATOM 11434 H HD22 . LEU A 1 63 ? -3.453  -2.509  -10.875 1.00 10.00 ? 472 LEU A HD22 10 
ATOM 11435 H HD23 . LEU A 1 63 ? -1.829  -2.399  -10.193 1.00 10.00 ? 472 LEU A HD23 10 
ATOM 11436 N N    . THR A 1 64 ? -4.810  2.838   -10.172 1.00 10.00 ? 473 THR A N    10 
ATOM 11437 C CA   . THR A 1 64 ? -5.934  3.548   -9.575  1.00 10.00 ? 473 THR A CA   10 
ATOM 11438 C C    . THR A 1 64 ? -6.153  4.906   -10.235 1.00 10.00 ? 473 THR A C    10 
ATOM 11439 O O    . THR A 1 64 ? -7.134  5.589   -9.943  1.00 10.00 ? 473 THR A O    10 
ATOM 11440 C CB   . THR A 1 64 ? -5.733  3.712   -8.062  1.00 10.00 ? 473 THR A CB   10 
ATOM 11441 O OG1  . THR A 1 64 ? -6.653  4.650   -7.535  1.00 10.00 ? 473 THR A OG1  10 
ATOM 11442 C CG2  . THR A 1 64 ? -4.342  4.165   -7.668  1.00 10.00 ? 473 THR A CG2  10 
ATOM 11443 H H    . THR A 1 64 ? -3.912  2.971   -9.805  1.00 10.00 ? 473 THR A H    10 
ATOM 11444 H HA   . THR A 1 64 ? -6.814  2.958   -9.736  1.00 10.00 ? 473 THR A HA   10 
ATOM 11445 H HB   . THR A 1 64 ? -5.916  2.760   -7.584  1.00 10.00 ? 473 THR A HB   10 
ATOM 11446 H HG1  . THR A 1 64 ? -6.820  4.452   -6.610  1.00 10.00 ? 473 THR A HG1  10 
ATOM 11447 H HG21 . THR A 1 64 ? -4.415  5.062   -7.071  1.00 10.00 ? 473 THR A HG21 10 
ATOM 11448 H HG22 . THR A 1 64 ? -3.762  4.370   -8.554  1.00 10.00 ? 473 THR A HG22 10 
ATOM 11449 H HG23 . THR A 1 64 ? -3.859  3.390   -7.090  1.00 10.00 ? 473 THR A HG23 10 
ATOM 11450 N N    . LYS A 1 65 ? -5.245  5.303   -11.126 1.00 10.00 ? 474 LYS A N    10 
ATOM 11451 C CA   . LYS A 1 65 ? -5.371  6.586   -11.809 1.00 10.00 ? 474 LYS A CA   10 
ATOM 11452 C C    . LYS A 1 65 ? -5.644  6.393   -13.296 1.00 10.00 ? 474 LYS A C    10 
ATOM 11453 O O    . LYS A 1 65 ? -6.366  7.178   -13.910 1.00 10.00 ? 474 LYS A O    10 
ATOM 11454 C CB   . LYS A 1 65 ? -4.107  7.425   -11.611 1.00 10.00 ? 474 LYS A CB   10 
ATOM 11455 C CG   . LYS A 1 65 ? -2.876  6.843   -12.288 1.00 10.00 ? 474 LYS A CG   10 
ATOM 11456 C CD   . LYS A 1 65 ? -1.598  7.466   -11.750 1.00 10.00 ? 474 LYS A CD   10 
ATOM 11457 C CE   . LYS A 1 65 ? -1.205  8.702   -12.541 1.00 10.00 ? 474 LYS A CE   10 
ATOM 11458 N NZ   . LYS A 1 65 ? -2.063  9.873   -12.207 1.00 10.00 ? 474 LYS A NZ   10 
ATOM 11459 H H    . LYS A 1 65 ? -4.477  4.726   -11.326 1.00 10.00 ? 474 LYS A H    10 
ATOM 11460 H HA   . LYS A 1 65 ? -6.211  7.107   -11.371 1.00 10.00 ? 474 LYS A HA   10 
ATOM 11461 H HB2  . LYS A 1 65 ? -4.278  8.413   -12.011 1.00 10.00 ? 474 LYS A HB2  10 
ATOM 11462 H HB3  . LYS A 1 65 ? -3.904  7.505   -10.553 1.00 10.00 ? 474 LYS A HB3  10 
ATOM 11463 H HG2  . LYS A 1 65 ? -2.848  5.779   -12.111 1.00 10.00 ? 474 LYS A HG2  10 
ATOM 11464 H HG3  . LYS A 1 65 ? -2.939  7.033   -13.350 1.00 10.00 ? 474 LYS A HG3  10 
ATOM 11465 H HD2  . LYS A 1 65 ? -1.752  7.745   -10.718 1.00 10.00 ? 474 LYS A HD2  10 
ATOM 11466 H HD3  . LYS A 1 65 ? -0.800  6.740   -11.813 1.00 10.00 ? 474 LYS A HD3  10 
ATOM 11467 H HE2  . LYS A 1 65 ? -0.176  8.946   -12.317 1.00 10.00 ? 474 LYS A HE2  10 
ATOM 11468 H HE3  . LYS A 1 65 ? -1.301  8.486   -13.594 1.00 10.00 ? 474 LYS A HE3  10 
ATOM 11469 H HZ1  . LYS A 1 65 ? -2.260  9.891   -11.185 1.00 10.00 ? 474 LYS A HZ1  10 
ATOM 11470 H HZ2  . LYS A 1 65 ? -2.964  9.814   -12.721 1.00 10.00 ? 474 LYS A HZ2  10 
ATOM 11471 H HZ3  . LYS A 1 65 ? -1.581  10.756  -12.472 1.00 10.00 ? 474 LYS A HZ3  10 
ATOM 11472 N N    . LYS A 1 66 ? -5.069  5.344   -13.869 1.00 10.00 ? 475 LYS A N    10 
ATOM 11473 C CA   . LYS A 1 66 ? -5.262  5.054   -15.284 1.00 10.00 ? 475 LYS A CA   10 
ATOM 11474 C C    . LYS A 1 66 ? -6.733  4.787   -15.593 1.00 10.00 ? 475 LYS A C    10 
ATOM 11475 O O    . LYS A 1 66 ? -7.158  4.863   -16.746 1.00 10.00 ? 475 LYS A O    10 
ATOM 11476 C CB   . LYS A 1 66 ? -4.413  3.851   -15.702 1.00 10.00 ? 475 LYS A CB   10 
ATOM 11477 C CG   . LYS A 1 66 ? -3.093  4.233   -16.354 1.00 10.00 ? 475 LYS A CG   10 
ATOM 11478 C CD   . LYS A 1 66 ? -2.300  5.201   -15.491 1.00 10.00 ? 475 LYS A CD   10 
ATOM 11479 C CE   . LYS A 1 66 ? -0.809  5.097   -15.762 1.00 10.00 ? 475 LYS A CE   10 
ATOM 11480 N NZ   . LYS A 1 66 ? -0.014  5.956   -14.842 1.00 10.00 ? 475 LYS A NZ   10 
ATOM 11481 H H    . LYS A 1 66 ? -4.507  4.749   -13.330 1.00 10.00 ? 475 LYS A H    10 
ATOM 11482 H HA   . LYS A 1 66 ? -4.942  5.920   -15.845 1.00 10.00 ? 475 LYS A HA   10 
ATOM 11483 H HB2  . LYS A 1 66 ? -4.199  3.257   -14.827 1.00 10.00 ? 475 LYS A HB2  10 
ATOM 11484 H HB3  . LYS A 1 66 ? -4.976  3.253   -16.403 1.00 10.00 ? 475 LYS A HB3  10 
ATOM 11485 H HG2  . LYS A 1 66 ? -2.506  3.339   -16.506 1.00 10.00 ? 475 LYS A HG2  10 
ATOM 11486 H HG3  . LYS A 1 66 ? -3.296  4.698   -17.308 1.00 10.00 ? 475 LYS A HG3  10 
ATOM 11487 H HD2  . LYS A 1 66 ? -2.625  6.208   -15.705 1.00 10.00 ? 475 LYS A HD2  10 
ATOM 11488 H HD3  . LYS A 1 66 ? -2.484  4.974   -14.450 1.00 10.00 ? 475 LYS A HD3  10 
ATOM 11489 H HE2  . LYS A 1 66 ? -0.503  4.070   -15.635 1.00 10.00 ? 475 LYS A HE2  10 
ATOM 11490 H HE3  . LYS A 1 66 ? -0.619  5.404   -16.781 1.00 10.00 ? 475 LYS A HE3  10 
ATOM 11491 H HZ1  . LYS A 1 66 ? 0.995   5.711   -14.905 1.00 10.00 ? 475 LYS A HZ1  10 
ATOM 11492 H HZ2  . LYS A 1 66 ? -0.331  5.818   -13.861 1.00 10.00 ? 475 LYS A HZ2  10 
ATOM 11493 H HZ3  . LYS A 1 66 ? -0.133  6.958   -15.094 1.00 10.00 ? 475 LYS A HZ3  10 
ATOM 11494 N N    . ASN A 1 67 ? -7.509  4.463   -14.559 1.00 10.00 ? 476 ASN A N    10 
ATOM 11495 C CA   . ASN A 1 67 ? -8.929  4.177   -14.735 1.00 10.00 ? 476 ASN A CA   10 
ATOM 11496 C C    . ASN A 1 67 ? -9.807  5.026   -13.811 1.00 10.00 ? 476 ASN A C    10 
ATOM 11497 O O    . ASN A 1 67 ? -11.022 5.082   -13.992 1.00 10.00 ? 476 ASN A O    10 
ATOM 11498 C CB   . ASN A 1 67 ? -9.200  2.693   -14.483 1.00 10.00 ? 476 ASN A CB   10 
ATOM 11499 C CG   . ASN A 1 67 ? -8.834  1.828   -15.673 1.00 10.00 ? 476 ASN A CG   10 
ATOM 11500 O OD1  . ASN A 1 67 ? -9.706  1.316   -16.375 1.00 10.00 ? 476 ASN A OD1  10 
ATOM 11501 N ND2  . ASN A 1 67 ? -7.537  1.660   -15.905 1.00 10.00 ? 476 ASN A ND2  10 
ATOM 11502 H H    . ASN A 1 67 ? -7.117  4.409   -13.664 1.00 10.00 ? 476 ASN A H    10 
ATOM 11503 H HA   . ASN A 1 67 ? -9.185  4.406   -15.758 1.00 10.00 ? 476 ASN A HA   10 
ATOM 11504 H HB2  . ASN A 1 67 ? -8.620  2.366   -13.632 1.00 10.00 ? 476 ASN A HB2  10 
ATOM 11505 H HB3  . ASN A 1 67 ? -10.250 2.556   -14.271 1.00 10.00 ? 476 ASN A HB3  10 
ATOM 11506 H HD21 . ASN A 1 67 ? -6.898  2.097   -15.305 1.00 10.00 ? 476 ASN A HD21 10 
ATOM 11507 H HD22 . ASN A 1 67 ? -7.272  1.105   -16.669 1.00 10.00 ? 476 ASN A HD22 10 
ATOM 11508 N N    . GLU A 1 68 ? -9.200  5.680   -12.821 1.00 10.00 ? 477 GLU A N    10 
ATOM 11509 C CA   . GLU A 1 68 ? -9.961  6.508   -11.889 1.00 10.00 ? 477 GLU A CA   10 
ATOM 11510 C C    . GLU A 1 68 ? -9.555  7.975   -11.990 1.00 10.00 ? 477 GLU A C    10 
ATOM 11511 O O    . GLU A 1 68 ? -10.355 8.869   -11.712 1.00 10.00 ? 477 GLU A O    10 
ATOM 11512 C CB   . GLU A 1 68 ? -9.767  6.010   -10.456 1.00 10.00 ? 477 GLU A CB   10 
ATOM 11513 C CG   . GLU A 1 68 ? -11.059 5.935   -9.658  1.00 10.00 ? 477 GLU A CG   10 
ATOM 11514 C CD   . GLU A 1 68 ? -10.839 5.456   -8.236  1.00 10.00 ? 477 GLU A CD   10 
ATOM 11515 O OE1  . GLU A 1 68 ? -9.869  4.705   -8.006  1.00 10.00 ? 477 GLU A OE1  10 
ATOM 11516 O OE2  . GLU A 1 68 ? -11.638 5.833   -7.353  1.00 10.00 ? 477 GLU A OE2  10 
ATOM 11517 H H    . GLU A 1 68 ? -8.228  5.604   -12.710 1.00 10.00 ? 477 GLU A H    10 
ATOM 11518 H HA   . GLU A 1 68 ? -11.005 6.421   -12.149 1.00 10.00 ? 477 GLU A HA   10 
ATOM 11519 H HB2  . GLU A 1 68 ? -9.331  5.022   -10.486 1.00 10.00 ? 477 GLU A HB2  10 
ATOM 11520 H HB3  . GLU A 1 68 ? -9.090  6.676   -9.942  1.00 10.00 ? 477 GLU A HB3  10 
ATOM 11521 H HG2  . GLU A 1 68 ? -11.503 6.919   -9.625  1.00 10.00 ? 477 GLU A HG2  10 
ATOM 11522 H HG3  . GLU A 1 68 ? -11.733 5.253   -10.153 1.00 10.00 ? 477 GLU A HG3  10 
ATOM 11523 N N    . ASN A 1 69 ? -8.311  8.218   -12.385 1.00 10.00 ? 478 ASN A N    10 
ATOM 11524 C CA   . ASN A 1 69 ? -7.802  9.577   -12.518 1.00 10.00 ? 478 ASN A CA   10 
ATOM 11525 C C    . ASN A 1 69 ? -7.774  10.280  -11.164 1.00 10.00 ? 478 ASN A C    10 
ATOM 11526 O O    . ASN A 1 69 ? -8.775  10.308  -10.448 1.00 10.00 ? 478 ASN A O    10 
ATOM 11527 C CB   . ASN A 1 69 ? -8.658  10.374  -13.504 1.00 10.00 ? 478 ASN A CB   10 
ATOM 11528 C CG   . ASN A 1 69 ? -7.885  11.499  -14.164 1.00 10.00 ? 478 ASN A CG   10 
ATOM 11529 O OD1  . ASN A 1 69 ? -6.700  11.360  -14.467 1.00 10.00 ? 478 ASN A OD1  10 
ATOM 11530 N ND2  . ASN A 1 69 ? -8.555  12.624  -14.391 1.00 10.00 ? 478 ASN A ND2  10 
ATOM 11531 H H    . ASN A 1 69 ? -7.720  7.466   -12.591 1.00 10.00 ? 478 ASN A H    10 
ATOM 11532 H HA   . ASN A 1 69 ? -6.792  9.517   -12.899 1.00 10.00 ? 478 ASN A HA   10 
ATOM 11533 H HB2  . ASN A 1 69 ? -9.020  9.712   -14.275 1.00 10.00 ? 478 ASN A HB2  10 
ATOM 11534 H HB3  . ASN A 1 69 ? -9.499  10.800  -12.977 1.00 10.00 ? 478 ASN A HB3  10 
ATOM 11535 H HD21 . ASN A 1 69 ? -9.497  12.664  -14.124 1.00 10.00 ? 478 ASN A HD21 10 
ATOM 11536 H HD22 . ASN A 1 69 ? -8.079  13.368  -14.816 1.00 10.00 ? 478 ASN A HD22 10 
ATOM 11537 N N    . TYR A 1 70 ? -6.623  10.849  -10.823 1.00 10.00 ? 479 TYR A N    10 
ATOM 11538 C CA   . TYR A 1 70 ? -6.465  11.555  -9.562  1.00 10.00 ? 479 TYR A CA   10 
ATOM 11539 C C    . TYR A 1 70 ? -5.080  12.183  -9.470  1.00 10.00 ? 479 TYR A C    10 
ATOM 11540 O O    . TYR A 1 70 ? -4.072  11.550  -9.785  1.00 10.00 ? 479 TYR A O    10 
ATOM 11541 C CB   . TYR A 1 70 ? -6.705  10.607  -8.378  1.00 10.00 ? 479 TYR A CB   10 
ATOM 11542 C CG   . TYR A 1 70 ? -5.690  9.490   -8.256  1.00 10.00 ? 479 TYR A CG   10 
ATOM 11543 C CD1  . TYR A 1 70 ? -4.381  9.753   -7.870  1.00 10.00 ? 479 TYR A CD1  10 
ATOM 11544 C CD2  . TYR A 1 70 ? -6.043  8.170   -8.521  1.00 10.00 ? 479 TYR A CD2  10 
ATOM 11545 C CE1  . TYR A 1 70 ? -3.453  8.738   -7.754  1.00 10.00 ? 479 TYR A CE1  10 
ATOM 11546 C CE2  . TYR A 1 70 ? -5.119  7.147   -8.405  1.00 10.00 ? 479 TYR A CE2  10 
ATOM 11547 C CZ   . TYR A 1 70 ? -3.825  7.438   -8.022  1.00 10.00 ? 479 TYR A CZ   10 
ATOM 11548 O OH   . TYR A 1 70 ? -2.899  6.428   -7.908  1.00 10.00 ? 479 TYR A OH   10 
ATOM 11549 H H    . TYR A 1 70 ? -5.863  10.798  -11.437 1.00 10.00 ? 479 TYR A H    10 
ATOM 11550 H HA   . TYR A 1 70 ? -7.203  12.342  -9.533  1.00 10.00 ? 479 TYR A HA   10 
ATOM 11551 H HB2  . TYR A 1 70 ? -6.676  11.178  -7.462  1.00 10.00 ? 479 TYR A HB2  10 
ATOM 11552 H HB3  . TYR A 1 70 ? -7.682  10.158  -8.482  1.00 10.00 ? 479 TYR A HB3  10 
ATOM 11553 H HD1  . TYR A 1 70 ? -4.091  10.772  -7.661  1.00 10.00 ? 479 TYR A HD1  10 
ATOM 11554 H HD2  . TYR A 1 70 ? -7.056  7.949   -8.823  1.00 10.00 ? 479 TYR A HD2  10 
ATOM 11555 H HE1  . TYR A 1 70 ? -2.442  8.964   -7.452  1.00 10.00 ? 479 TYR A HE1  10 
ATOM 11556 H HE2  . TYR A 1 70 ? -5.414  6.126   -8.613  1.00 10.00 ? 479 TYR A HE2  10 
ATOM 11557 H HH   . TYR A 1 70 ? -2.629  6.342   -6.991  1.00 10.00 ? 479 TYR A HH   10 
ATOM 11558 N N    . LYS A 1 71 ? -5.040  13.440  -9.049  1.00 10.00 ? 480 LYS A N    10 
ATOM 11559 C CA   . LYS A 1 71 ? -3.781  14.167  -8.920  1.00 10.00 ? 480 LYS A CA   10 
ATOM 11560 C C    . LYS A 1 71 ? -3.644  14.774  -7.528  1.00 10.00 ? 480 LYS A C    10 
ATOM 11561 O O    . LYS A 1 71 ? -2.517  15.172  -7.166  1.00 10.00 ? 480 LYS A O    10 
ATOM 11562 C CB   . LYS A 1 71 ? -3.694  15.267  -9.980  1.00 10.00 ? 480 LYS A CB   10 
ATOM 11563 C CG   . LYS A 1 71 ? -2.296  15.458  -10.545 1.00 10.00 ? 480 LYS A CG   10 
ATOM 11564 C CD   . LYS A 1 71 ? -1