data_1XC8
# 
_entry.id   1XC8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1XC8         
NDB   PD0592       
RCSB  RCSB030194   
WWPDB D_1000030194 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1TDZ 
_pdbx_database_related.details        'mutant enzyme' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1XC8 
_pdbx_database_status.recvd_initial_deposition_date   2004-09-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Coste, F.'    1 
'Ober, M.'     2 
'Carell, T.'   3 
'Boiteux, S.'  4 
'Zelwer, C.'   5 
'Castaing, B.' 6 
# 
_citation.id                        primary 
_citation.title                     
;Structural basis for the recognition of the FapydG lesion (2,6-diamino-4-hydroxy-5-formamidopyrimidine) by formamidopyrimidine-DNA glycosylase.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            279 
_citation.page_first                44074 
_citation.page_last                 44083 
_citation.year                      2004 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15249553 
_citation.pdbx_database_id_DOI      10.1074/jbc.M405928200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Coste, F.'    1 
primary 'Ober, M.'     2 
primary 'Carell, T.'   3 
primary 'Boiteux, S.'  4 
primary 'Zelwer, C.'   5 
primary 'Castaing, B.' 6 
# 
_cell.entry_id           1XC8 
_cell.length_a           92.513 
_cell.length_b           92.513 
_cell.length_c           142.867 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1XC8 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.cell_setting                     tetragonal 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*CP*TP*CP*TP*TP*TP*(FOX)P*TP*TP*TP*CP*TP*CP*G)-3'" 4219.767  1   ?        ? ? ? 
2 polymer     syn "5'-D(*GP*CP*GP*AP*GP*AP*AP*AP*CP*AP*AP*AP*GP*A)-3'"     4355.884  1   ?        ? ? ? 
3 polymer     man 'Formamidopyrimidine-DNA glycosylase'                    31116.217 1   3.2.2.23 ? ? ? 
4 non-polymer syn 'ZINC ION'                                               65.409    1   ?        ? ? ? 
5 non-polymer syn GLYCEROL                                                 92.094    1   ?        ? ? ? 
6 water       nat water                                                    18.015    397 ?        ? ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'FAPY-DNA glycosylase' 
# 
_entity_name_sys.entity_id   3 
_entity_name_sys.name        E.C.3.2.2.23 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes '(DC)(DT)(DC)(DT)(DT)(DT)(FOX)(DT)(DT)(DT)(DC)(DT)(DC)(DG)' CTCTTTGTTTCTCG B ? 
2 polydeoxyribonucleotide no no  '(DG)(DC)(DG)(DA)(DG)(DA)(DA)(DA)(DC)(DA)(DA)(DA)(DG)(DA)' GCGAGAAACAAAGA C ? 
3 'polypeptide(L)'        no no  
;PELPEVETVRRELEKRIVGQKIISIEATYPRMVLTGFEQLKKELTGKTIQGISRRGKYLIFEIGDDFRLISHLRMEGKYR
LATLDAPREKHDHLTMKFADGQLIYADVRKFGTWELISTDQVLPYFLKKKIGPEPTYEDFDEKLFREKLRKSTKKIKPYL
LEQTLVAGLGNIYVDEVLWLAKIHPEKETNQLIESSIHLLHDSIIEILQKAIKLGGSSIRTYSALGSTGKMQNELQVYGK
TGEKCSRCGAEIQKIKVAGRGTHFCPVCQQK
;
;PELPEVETVRRELEKRIVGQKIISIEATYPRMVLTGFEQLKKELTGKTIQGISRRGKYLIFEIGDDFRLISHLRMEGKYR
LATLDAPREKHDHLTMKFADGQLIYADVRKFGTWELISTDQVLPYFLKKKIGPEPTYEDFDEKLFREKLRKSTKKIKPYL
LEQTLVAGLGNIYVDEVLWLAKIHPEKETNQLIESSIHLLHDSIIEILQKAIKLGGSSIRTYSALGSTGKMQNELQVYGK
TGEKCSRCGAEIQKIKVAGRGTHFCPVCQQK
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DT  n 
1 3   DC  n 
1 4   DT  n 
1 5   DT  n 
1 6   DT  n 
1 7   FOX n 
1 8   DT  n 
1 9   DT  n 
1 10  DT  n 
1 11  DC  n 
1 12  DT  n 
1 13  DC  n 
1 14  DG  n 
2 1   DG  n 
2 2   DC  n 
2 3   DG  n 
2 4   DA  n 
2 5   DG  n 
2 6   DA  n 
2 7   DA  n 
2 8   DA  n 
2 9   DC  n 
2 10  DA  n 
2 11  DA  n 
2 12  DA  n 
2 13  DG  n 
2 14  DA  n 
3 1   PRO n 
3 2   GLU n 
3 3   LEU n 
3 4   PRO n 
3 5   GLU n 
3 6   VAL n 
3 7   GLU n 
3 8   THR n 
3 9   VAL n 
3 10  ARG n 
3 11  ARG n 
3 12  GLU n 
3 13  LEU n 
3 14  GLU n 
3 15  LYS n 
3 16  ARG n 
3 17  ILE n 
3 18  VAL n 
3 19  GLY n 
3 20  GLN n 
3 21  LYS n 
3 22  ILE n 
3 23  ILE n 
3 24  SER n 
3 25  ILE n 
3 26  GLU n 
3 27  ALA n 
3 28  THR n 
3 29  TYR n 
3 30  PRO n 
3 31  ARG n 
3 32  MET n 
3 33  VAL n 
3 34  LEU n 
3 35  THR n 
3 36  GLY n 
3 37  PHE n 
3 38  GLU n 
3 39  GLN n 
3 40  LEU n 
3 41  LYS n 
3 42  LYS n 
3 43  GLU n 
3 44  LEU n 
3 45  THR n 
3 46  GLY n 
3 47  LYS n 
3 48  THR n 
3 49  ILE n 
3 50  GLN n 
3 51  GLY n 
3 52  ILE n 
3 53  SER n 
3 54  ARG n 
3 55  ARG n 
3 56  GLY n 
3 57  LYS n 
3 58  TYR n 
3 59  LEU n 
3 60  ILE n 
3 61  PHE n 
3 62  GLU n 
3 63  ILE n 
3 64  GLY n 
3 65  ASP n 
3 66  ASP n 
3 67  PHE n 
3 68  ARG n 
3 69  LEU n 
3 70  ILE n 
3 71  SER n 
3 72  HIS n 
3 73  LEU n 
3 74  ARG n 
3 75  MET n 
3 76  GLU n 
3 77  GLY n 
3 78  LYS n 
3 79  TYR n 
3 80  ARG n 
3 81  LEU n 
3 82  ALA n 
3 83  THR n 
3 84  LEU n 
3 85  ASP n 
3 86  ALA n 
3 87  PRO n 
3 88  ARG n 
3 89  GLU n 
3 90  LYS n 
3 91  HIS n 
3 92  ASP n 
3 93  HIS n 
3 94  LEU n 
3 95  THR n 
3 96  MET n 
3 97  LYS n 
3 98  PHE n 
3 99  ALA n 
3 100 ASP n 
3 101 GLY n 
3 102 GLN n 
3 103 LEU n 
3 104 ILE n 
3 105 TYR n 
3 106 ALA n 
3 107 ASP n 
3 108 VAL n 
3 109 ARG n 
3 110 LYS n 
3 111 PHE n 
3 112 GLY n 
3 113 THR n 
3 114 TRP n 
3 115 GLU n 
3 116 LEU n 
3 117 ILE n 
3 118 SER n 
3 119 THR n 
3 120 ASP n 
3 121 GLN n 
3 122 VAL n 
3 123 LEU n 
3 124 PRO n 
3 125 TYR n 
3 126 PHE n 
3 127 LEU n 
3 128 LYS n 
3 129 LYS n 
3 130 LYS n 
3 131 ILE n 
3 132 GLY n 
3 133 PRO n 
3 134 GLU n 
3 135 PRO n 
3 136 THR n 
3 137 TYR n 
3 138 GLU n 
3 139 ASP n 
3 140 PHE n 
3 141 ASP n 
3 142 GLU n 
3 143 LYS n 
3 144 LEU n 
3 145 PHE n 
3 146 ARG n 
3 147 GLU n 
3 148 LYS n 
3 149 LEU n 
3 150 ARG n 
3 151 LYS n 
3 152 SER n 
3 153 THR n 
3 154 LYS n 
3 155 LYS n 
3 156 ILE n 
3 157 LYS n 
3 158 PRO n 
3 159 TYR n 
3 160 LEU n 
3 161 LEU n 
3 162 GLU n 
3 163 GLN n 
3 164 THR n 
3 165 LEU n 
3 166 VAL n 
3 167 ALA n 
3 168 GLY n 
3 169 LEU n 
3 170 GLY n 
3 171 ASN n 
3 172 ILE n 
3 173 TYR n 
3 174 VAL n 
3 175 ASP n 
3 176 GLU n 
3 177 VAL n 
3 178 LEU n 
3 179 TRP n 
3 180 LEU n 
3 181 ALA n 
3 182 LYS n 
3 183 ILE n 
3 184 HIS n 
3 185 PRO n 
3 186 GLU n 
3 187 LYS n 
3 188 GLU n 
3 189 THR n 
3 190 ASN n 
3 191 GLN n 
3 192 LEU n 
3 193 ILE n 
3 194 GLU n 
3 195 SER n 
3 196 SER n 
3 197 ILE n 
3 198 HIS n 
3 199 LEU n 
3 200 LEU n 
3 201 HIS n 
3 202 ASP n 
3 203 SER n 
3 204 ILE n 
3 205 ILE n 
3 206 GLU n 
3 207 ILE n 
3 208 LEU n 
3 209 GLN n 
3 210 LYS n 
3 211 ALA n 
3 212 ILE n 
3 213 LYS n 
3 214 LEU n 
3 215 GLY n 
3 216 GLY n 
3 217 SER n 
3 218 SER n 
3 219 ILE n 
3 220 ARG n 
3 221 THR n 
3 222 TYR n 
3 223 SER n 
3 224 ALA n 
3 225 LEU n 
3 226 GLY n 
3 227 SER n 
3 228 THR n 
3 229 GLY n 
3 230 LYS n 
3 231 MET n 
3 232 GLN n 
3 233 ASN n 
3 234 GLU n 
3 235 LEU n 
3 236 GLN n 
3 237 VAL n 
3 238 TYR n 
3 239 GLY n 
3 240 LYS n 
3 241 THR n 
3 242 GLY n 
3 243 GLU n 
3 244 LYS n 
3 245 CYS n 
3 246 SER n 
3 247 ARG n 
3 248 CYS n 
3 249 GLY n 
3 250 ALA n 
3 251 GLU n 
3 252 ILE n 
3 253 GLN n 
3 254 LYS n 
3 255 ILE n 
3 256 LYS n 
3 257 VAL n 
3 258 ALA n 
3 259 GLY n 
3 260 ARG n 
3 261 GLY n 
3 262 THR n 
3 263 HIS n 
3 264 PHE n 
3 265 CYS n 
3 266 PRO n 
3 267 VAL n 
3 268 CYS n 
3 269 GLN n 
3 270 GLN n 
3 271 LYS n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Lactococcus 
_entity_src_gen.pdbx_gene_src_gene                 'mutm, fpg' 
_entity_src_gen.gene_src_species                   'Lactococcus lactis' 
_entity_src_gen.gene_src_strain                    'subsp. cremoris' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Lactococcus lactis subsp. cremoris' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1359 
_entity_src_gen.pdbx_gene_src_variant              'subsp. cremoris' 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PMAL-C 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.entity_id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 3 UNP FPG_LACLC P42371 2 
;PELPEVETVRRELEKRIVGQKIISIEATYPRMVLTGFEQLKKELTGKTIQGISRRGKYLIFEIGDDFRLISHLRMEGKYR
LATLDAPREKHDHLTMKFADGQLIYADVRKFGTWELISTDQVLPYFLKKKIGPEPTYDEDFDEKLFREKLRKSTKKIKPY
LLEQTLVAGLGNIYVDEVLWLAKIHPEKETNQLIESSIHLLHDSIIEILQKAIKLGGSSIRTYSALGSTGKMQNELQVYG
KTGEKCSRCGAEIQKIKVAGRGTHFCPVCQQK
;
? 
2 1 PDB 1XC8      1XC8   ? ? ? 
3 2 PDB 1XC8      1XC8   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1XC8 A 1 ? 271 ? P42371 2  ? 273 ? 1  271 
2 2 1XC8 B 1 ? 14  ? 1XC8   1  ? 14  ? 1  14  
3 3 1XC8 C 1 ? 14  ? 1XC8   15 ? 28  ? 15 28  
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1XC8 
_struct_ref_seq_dif.mon_id                       ? 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      ? 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P42371 
_struct_ref_seq_dif.db_mon_id                    ASP 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          139 
_struct_ref_seq_dif.details                      DELETION 
_struct_ref_seq_dif.pdbx_auth_seq_num            ? 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                               'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ?                               'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                               'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE ?                               'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ?                               'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE" ?                               'C10 H15 N2 O8 P' 322.208 
FOX 'DNA linking'       n 
;((1R,2S,4R)-4-{[2-AMINO-5-(FORMYLAMINO)-6-OXO-3,6-DIHYDROPYRIMIDIN-4-YL]AMINO}-2-HYDROXYCYCLOPENTYL)METHYL 5'-PHOSPHATE
;
?                               'C11 H18 N5 O7 P' 363.264 
GLN 'L-peptide linking' y GLUTAMINE ?                               'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ?                               'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE ?                               'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER ?                               'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                               'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE ?                               'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE ?                               'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ?                               'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE ?                               'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE ?                               'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE ?                               'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE ?                               'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                               'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE ?                               'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE ?                               'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION' ?                               'Zn 2'            65.409  
# 
_exptl.entry_id          1XC8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_percent_sol   64.8 
_exptl_crystal.density_Matthews      3.52 
_exptl_crystal.density_meas          ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            303 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    'HEPES, SODIUM CITRATE, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 303K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 HEPES            ? ? ? 
1 2 1 'SODIUM CITRATE' ? ? ? 
1 3 2 'SODIUM CITRATE' ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2004-07-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'double crystal monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.92004 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE BM30A' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   BM30A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.92004 
# 
_reflns.entry_id                     1XC8 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            1.95 
_reflns.d_resolution_low             17.247 
_reflns.number_all                   45806 
_reflns.number_obs                   41650 
_reflns.percent_possible_obs         91.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.069 
_reflns.pdbx_netI_over_sigmaI        7.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.95 
_reflns_shell.d_res_low              2.06 
_reflns_shell.percent_possible_all   91.4 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.284 
_reflns_shell.meanI_over_sigI_obs    2.6 
_reflns_shell.pdbx_redundancy        4.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      6134 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1XC8 
_refine.ls_number_reflns_obs                     39561 
_refine.ls_number_reflns_all                     39561 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             17.247 
_refine.ls_d_res_high                            1.95 
_refine.ls_percent_reflns_obs                    90.87 
_refine.ls_R_factor_obs                          0.17805 
_refine.ls_R_factor_all                          0.17805 
_refine.ls_R_factor_R_work                       0.1764 
_refine.ls_R_factor_R_free                       0.20932 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2089 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.963 
_refine.correlation_coeff_Fo_to_Fc_free          0.950 
_refine.B_iso_mean                               35.412 
_refine.aniso_B[1][1]                            0.33 
_refine.aniso_B[2][2]                            0.33 
_refine.aniso_B[3][3]                            -0.67 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1TDZ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.122 
_refine.pdbx_overall_ESU_R_Free                  0.120 
_refine.overall_SU_ML                            0.073 
_refine.overall_SU_B                             2.496 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2128 
_refine_hist.pdbx_number_atoms_nucleic_acid   569 
_refine_hist.pdbx_number_atoms_ligand         7 
_refine_hist.number_atoms_solvent             397 
_refine_hist.number_atoms_total               3101 
_refine_hist.d_res_high                       1.95 
_refine_hist.d_res_low                        17.247 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.020  0.022  ? 2808 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.776  2.239  ? 3900 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   5.971  5.000  ? 270  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   35.416 23.953 ? 86   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   11.965 15.000 ? 413  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   17.948 15.000 ? 12   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.119  0.200  ? 442  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.008  0.020  ? 1852 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.211  0.200  ? 1173 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.303  0.200  ? 1844 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.161  0.200  ? 306  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.133  0.200  ? 28   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.207  0.200  ? 16   'X-RAY DIFFRACTION' ? 
r_mcbond_it              1.223  1.500  ? 1420 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.745  2.000  ? 2168 'X-RAY DIFFRACTION' ? 
r_scbond_it              2.727  3.000  ? 1776 'X-RAY DIFFRACTION' ? 
r_scangle_it             3.962  4.500  ? 1732 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.950 
_refine_ls_shell.d_res_low                        2.000 
_refine_ls_shell.number_reflns_R_work             2920 
_refine_ls_shell.R_factor_R_work                  0.213 
_refine_ls_shell.percent_reflns_obs               93.25 
_refine_ls_shell.R_factor_R_free                  0.233 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             148 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1XC8 
_struct.title                     
'CRYSTAL STRUCTURE COMPLEX BETWEEN THE WILD-TYPE LACTOCOCCUS LACTIS FPG (MUTM) AND A FAPY-DG CONTAINING DNA' 
_struct.pdbx_descriptor           'Formamidopyrimidine-DNA glycosylase (E.C.3.2.2.23)/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1XC8 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA 
_struct_keywords.text            'PROTEIN-DNA COMPLEX; GLYCOSYLASE; FAPY, HYDROLASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 6 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU C 2   ? VAL C 18  ? GLU A 2   VAL A 18  1 ? 17 
HELX_P HELX_P2  2  TYR C 29  ? VAL C 33  ? TYR A 29  VAL A 33  5 ? 5  
HELX_P HELX_P3  3  GLY C 36  ? THR C 45  ? GLY A 36  THR A 45  1 ? 10 
HELX_P HELX_P4  4  GLN C 121 ? LYS C 130 ? GLN A 121 LYS A 130 1 ? 10 
HELX_P HELX_P5  5  ASP C 141 ? LYS C 151 ? ASP A 141 LYS A 151 1 ? 11 
HELX_P HELX_P6  6  LYS C 155 ? GLU C 162 ? LYS A 155 GLU A 162 1 ? 8  
HELX_P HELX_P7  7  GLY C 170 ? ALA C 181 ? GLY A 170 ALA A 181 1 ? 12 
HELX_P HELX_P8  8  GLU C 188 ? LEU C 192 ? GLU A 188 LEU A 192 5 ? 5  
HELX_P HELX_P9  9  ILE C 193 ? LEU C 214 ? ILE A 193 LEU A 214 1 ? 22 
HELX_P HELX_P10 10 LYS C 230 ? LEU C 235 ? LYS A 230 LEU A 235 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D ZN  .  ZN    ? ? ? 1_555 C CYS 268 SG ? ? A ZN  5001 A CYS 268 1_555 ? ? ? ? ? ? ?            2.409 ? 
metalc2  metalc ? ? D ZN  .  ZN    ? ? ? 1_555 C CYS 248 SG ? ? A ZN  5001 A CYS 248 1_555 ? ? ? ? ? ? ?            2.436 ? 
metalc3  metalc ? ? D ZN  .  ZN    ? ? ? 1_555 C CYS 265 SG ? ? A ZN  5001 A CYS 265 1_555 ? ? ? ? ? ? ?            1.956 ? 
metalc4  metalc ? ? D ZN  .  ZN    ? ? ? 1_555 C CYS 245 SG ? ? A ZN  5001 A CYS 245 1_555 ? ? ? ? ? ? ?            2.423 ? 
covale1  covale ? ? A DT  6  "O3'" ? ? ? 1_555 A FOX 7   P  ? ? B DT  6    B FOX 7   1_555 ? ? ? ? ? ? ?            1.598 ? 
covale2  covale ? ? A FOX 7  "O3'" ? ? ? 1_555 A DT  8   P  ? ? B FOX 7    B DT  8   1_555 ? ? ? ? ? ? ?            1.569 ? 
hydrog1  hydrog ? ? A DT  2  N3    ? ? ? 1_555 B DA  14  N1 ? ? B DT  2    C DA  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DT  2  O4    ? ? ? 1_555 B DA  14  N6 ? ? B DT  2    C DA  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DC  3  N3    ? ? ? 1_555 B DG  13  N1 ? ? B DC  3    C DG  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DC  3  N4    ? ? ? 1_555 B DG  13  O6 ? ? B DC  3    C DG  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DC  3  O2    ? ? ? 1_555 B DG  13  N2 ? ? B DC  3    C DG  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DT  4  N3    ? ? ? 1_555 B DA  12  N1 ? ? B DT  4    C DA  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DT  4  O4    ? ? ? 1_555 B DA  12  N6 ? ? B DT  4    C DA  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DT  5  N3    ? ? ? 1_555 B DA  11  N1 ? ? B DT  5    C DA  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DT  5  O4    ? ? ? 1_555 B DA  11  N6 ? ? B DT  5    C DA  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DT  6  N3    ? ? ? 1_555 B DA  10  N1 ? ? B DT  6    C DA  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DT  6  O4    ? ? ? 1_555 B DA  10  N6 ? ? B DT  6    C DA  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DT  8  N3    ? ? ? 1_555 B DA  8   N1 ? ? B DT  8    C DA  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DT  8  O4    ? ? ? 1_555 B DA  8   N6 ? ? B DT  8    C DA  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DT  9  N3    ? ? ? 1_555 B DA  7   N1 ? ? B DT  9    C DA  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DT  9  O4    ? ? ? 1_555 B DA  7   N6 ? ? B DT  9    C DA  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DT  10 N3    ? ? ? 1_555 B DA  6   N1 ? ? B DT  10   C DA  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DT  10 O4    ? ? ? 1_555 B DA  6   N6 ? ? B DT  10   C DA  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DC  11 N3    ? ? ? 1_555 B DG  5   N1 ? ? B DC  11   C DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DC  11 N4    ? ? ? 1_555 B DG  5   O6 ? ? B DC  11   C DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DC  11 O2    ? ? ? 1_555 B DG  5   N2 ? ? B DC  11   C DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DT  12 N3    ? ? ? 1_555 B DA  4   N1 ? ? B DT  12   C DA  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DT  12 O4    ? ? ? 1_555 B DA  4   N6 ? ? B DT  12   C DA  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DC  13 N3    ? ? ? 1_555 B DG  3   N1 ? ? B DC  13   C DG  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DC  13 N4    ? ? ? 1_555 B DG  3   O6 ? ? B DC  13   C DG  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DC  13 O2    ? ? ? 1_555 B DG  3   N2 ? ? B DC  13   C DG  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A DG  14 N1    ? ? ? 1_555 B DC  2   N3 ? ? B DG  14   C DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A DG  14 N2    ? ? ? 1_555 B DC  2   O2 ? ? B DG  14   C DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A DG  14 O6    ? ? ? 1_555 B DC  2   N4 ? ? B DG  14   C DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER C 24  ? ALA C 27  ? SER A 24  ALA A 27  
A 2 ASP C 92  ? LYS C 97  ? ASP A 92  LYS A 97  
A 3 GLN C 102 ? ALA C 106 ? GLN A 102 ALA A 106 
A 4 LYS C 78  ? ALA C 82  ? LYS A 78  ALA A 82  
B 1 ILE C 49  ? ARG C 55  ? ILE A 49  ARG A 55  
B 2 TYR C 58  ? ILE C 63  ? TYR A 58  ILE A 63  
B 3 PHE C 67  ? HIS C 72  ? PHE A 67  HIS A 72  
B 4 THR C 113 ? SER C 118 ? THR A 113 SER A 118 
C 1 GLN C 253 ? VAL C 257 ? GLN A 253 VAL A 257 
C 2 ARG C 260 ? PHE C 264 ? ARG A 260 PHE A 264 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER C 24  ? N SER A 24  O LYS C 97  ? O LYS A 97  
A 2 3 N HIS C 93  ? N HIS A 93  O TYR C 105 ? O TYR A 105 
A 3 4 O GLN C 102 ? O GLN A 102 N ALA C 82  ? N ALA A 82  
B 1 2 N SER C 53  ? N SER A 53  O ILE C 60  ? O ILE A 60  
B 2 3 N LEU C 59  ? N LEU A 59  O SER C 71  ? O SER A 71  
B 3 4 N ILE C 70  ? N ILE A 70  O GLU C 115 ? O GLU A 115 
C 1 2 N GLN C 253 ? N GLN A 253 O PHE C 264 ? O PHE A 264 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 5001'  
AC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL A 1001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  CYS C 245 ? CYS A 245  . ? 1_555 ? 
2  AC1 4  CYS C 248 ? CYS A 248  . ? 1_555 ? 
3  AC1 4  CYS C 265 ? CYS A 265  . ? 1_555 ? 
4  AC1 4  CYS C 268 ? CYS A 268  . ? 1_555 ? 
5  AC2 10 TYR C 58  ? TYR A 58   . ? 1_555 ? 
6  AC2 10 HIS C 72  ? HIS A 72   . ? 1_555 ? 
7  AC2 10 ARG C 74  ? ARG A 74   . ? 1_555 ? 
8  AC2 10 THR C 113 ? THR A 113  . ? 1_555 ? 
9  AC2 10 GLU C 115 ? GLU A 115  . ? 1_555 ? 
10 AC2 10 TYR C 125 ? TYR A 125  . ? 1_555 ? 
11 AC2 10 LYS C 129 ? LYS A 129  . ? 1_555 ? 
12 AC2 10 HOH H .   ? HOH A 5055 . ? 1_555 ? 
13 AC2 10 DT  A 9   ? DT  B 9    . ? 1_555 ? 
14 AC2 10 DT  A 10  ? DT  B 10   . ? 1_555 ? 
# 
_atom_sites.entry_id                    1XC8 
_atom_sites.fract_transf_matrix[1][1]   0.010809 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010809 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DC  A 1 1   ? 11.006 45.526 44.739  1.00 58.82 ? 1    DC  B "O5'" 1 
ATOM   2    C  "C5'" . DC  A 1 1   ? 9.614  45.138 44.766  1.00 55.79 ? 1    DC  B "C5'" 1 
ATOM   3    C  "C4'" . DC  A 1 1   ? 8.685  46.225 44.254  1.00 53.34 ? 1    DC  B "C4'" 1 
ATOM   4    O  "O4'" . DC  A 1 1   ? 8.956  47.515 44.863  1.00 52.52 ? 1    DC  B "O4'" 1 
ATOM   5    C  "C3'" . DC  A 1 1   ? 8.809  46.499 42.776  1.00 53.89 ? 1    DC  B "C3'" 1 
ATOM   6    O  "O3'" . DC  A 1 1   ? 8.012  45.532 42.107  1.00 56.07 ? 1    DC  B "O3'" 1 
ATOM   7    C  "C2'" . DC  A 1 1   ? 8.209  47.906 42.653  1.00 51.39 ? 1    DC  B "C2'" 1 
ATOM   8    C  "C1'" . DC  A 1 1   ? 8.731  48.564 43.928  1.00 48.74 ? 1    DC  B "C1'" 1 
ATOM   9    N  N1    . DC  A 1 1   ? 10.011 49.386 43.804  1.00 45.70 ? 1    DC  B N1    1 
ATOM   10   C  C2    . DC  A 1 1   ? 10.015 50.642 43.156  1.00 43.60 ? 1    DC  B C2    1 
ATOM   11   O  O2    . DC  A 1 1   ? 8.969  51.073 42.669  1.00 42.90 ? 1    DC  B O2    1 
ATOM   12   N  N3    . DC  A 1 1   ? 11.176 51.342 43.074  1.00 42.99 ? 1    DC  B N3    1 
ATOM   13   C  C4    . DC  A 1 1   ? 12.278 50.830 43.622  1.00 44.46 ? 1    DC  B C4    1 
ATOM   14   N  N4    . DC  A 1 1   ? 13.392 51.536 43.549  1.00 45.15 ? 1    DC  B N4    1 
ATOM   15   C  C5    . DC  A 1 1   ? 12.306 49.566 44.299  1.00 43.69 ? 1    DC  B C5    1 
ATOM   16   C  C6    . DC  A 1 1   ? 11.165 48.884 44.340  1.00 44.57 ? 1    DC  B C6    1 
ATOM   17   P  P     . DT  A 1 2   ? 8.392  45.108 40.617  1.00 55.98 ? 2    DT  B P     1 
ATOM   18   O  OP1   . DT  A 1 2   ? 7.406  44.094 40.187  1.00 55.19 ? 2    DT  B OP1   1 
ATOM   19   O  OP2   . DT  A 1 2   ? 9.856  44.833 40.626  1.00 54.34 ? 2    DT  B OP2   1 
ATOM   20   O  "O5'" . DT  A 1 2   ? 8.070  46.420 39.784  1.00 53.78 ? 2    DT  B "O5'" 1 
ATOM   21   C  "C5'" . DT  A 1 2   ? 6.706  46.743 39.556  1.00 52.84 ? 2    DT  B "C5'" 1 
ATOM   22   C  "C4'" . DT  A 1 2   ? 6.657  47.961 38.657  1.00 53.82 ? 2    DT  B "C4'" 1 
ATOM   23   O  "O4'" . DT  A 1 2   ? 7.545  49.004 39.140  1.00 52.36 ? 2    DT  B "O4'" 1 
ATOM   24   C  "C3'" . DT  A 1 2   ? 7.105  47.636 37.234  1.00 54.27 ? 2    DT  B "C3'" 1 
ATOM   25   O  "O3'" . DT  A 1 2   ? 6.234  48.244 36.321  1.00 56.17 ? 2    DT  B "O3'" 1 
ATOM   26   C  "C2'" . DT  A 1 2   ? 8.510  48.214 37.113  1.00 52.87 ? 2    DT  B "C2'" 1 
ATOM   27   C  "C1'" . DT  A 1 2   ? 8.481  49.362 38.114  1.00 48.90 ? 2    DT  B "C1'" 1 
ATOM   28   N  N1    . DT  A 1 2   ? 9.832  49.624 38.713  1.00 46.11 ? 2    DT  B N1    1 
ATOM   29   C  C2    . DT  A 1 2   ? 10.478 50.825 38.407  1.00 44.45 ? 2    DT  B C2    1 
ATOM   30   O  O2    . DT  A 1 2   ? 10.016 51.677 37.687  1.00 45.57 ? 2    DT  B O2    1 
ATOM   31   N  N3    . DT  A 1 2   ? 11.700 51.006 38.982  1.00 42.53 ? 2    DT  B N3    1 
ATOM   32   C  C4    . DT  A 1 2   ? 12.332 50.120 39.816  1.00 42.98 ? 2    DT  B C4    1 
ATOM   33   O  O4    . DT  A 1 2   ? 13.434 50.387 40.289  1.00 45.31 ? 2    DT  B O4    1 
ATOM   34   C  C5    . DT  A 1 2   ? 11.623 48.885 40.096  1.00 42.87 ? 2    DT  B C5    1 
ATOM   35   C  C7    . DT  A 1 2   ? 12.294 47.782 40.867  1.00 40.56 ? 2    DT  B C7    1 
ATOM   36   C  C6    . DT  A 1 2   ? 10.415 48.694 39.541  1.00 42.71 ? 2    DT  B C6    1 
ATOM   37   P  P     . DC  A 1 3   ? 6.207  47.639 34.837  1.00 60.06 ? 3    DC  B P     1 
ATOM   38   O  OP1   . DC  A 1 3   ? 4.786  47.765 34.404  1.00 59.40 ? 3    DC  B OP1   1 
ATOM   39   O  OP2   . DC  A 1 3   ? 6.952  46.344 34.777  1.00 57.84 ? 3    DC  B OP2   1 
ATOM   40   O  "O5'" . DC  A 1 3   ? 7.131  48.675 34.062  1.00 57.44 ? 3    DC  B "O5'" 1 
ATOM   41   C  "C5'" . DC  A 1 3   ? 6.760  50.043 34.015  1.00 55.44 ? 3    DC  B "C5'" 1 
ATOM   42   C  "C4'" . DC  A 1 3   ? 7.933  50.823 33.465  1.00 53.55 ? 3    DC  B "C4'" 1 
ATOM   43   O  "O4'" . DC  A 1 3   ? 9.028  50.772 34.402  1.00 51.72 ? 3    DC  B "O4'" 1 
ATOM   44   C  "C3'" . DC  A 1 3   ? 8.469  50.195 32.183  1.00 54.02 ? 3    DC  B "C3'" 1 
ATOM   45   O  "O3'" . DC  A 1 3   ? 8.372  51.167 31.169  1.00 56.57 ? 3    DC  B "O3'" 1 
ATOM   46   C  "C2'" . DC  A 1 3   ? 9.912  49.813 32.492  1.00 51.86 ? 3    DC  B "C2'" 1 
ATOM   47   C  "C1'" . DC  A 1 3   ? 10.239 50.708 33.669  1.00 47.90 ? 3    DC  B "C1'" 1 
ATOM   48   N  N1    . DC  A 1 3   ? 11.277 50.185 34.611  1.00 47.10 ? 3    DC  B N1    1 
ATOM   49   C  C2    . DC  A 1 3   ? 12.347 51.014 34.941  1.00 44.72 ? 3    DC  B C2    1 
ATOM   50   O  O2    . DC  A 1 3   ? 12.398 52.155 34.429  1.00 45.90 ? 3    DC  B O2    1 
ATOM   51   N  N3    . DC  A 1 3   ? 13.270 50.554 35.817  1.00 43.05 ? 3    DC  B N3    1 
ATOM   52   C  C4    . DC  A 1 3   ? 13.164 49.334 36.347  1.00 43.44 ? 3    DC  B C4    1 
ATOM   53   N  N4    . DC  A 1 3   ? 14.104 48.920 37.194  1.00 42.55 ? 3    DC  B N4    1 
ATOM   54   C  C5    . DC  A 1 3   ? 12.077 48.470 36.032  1.00 44.46 ? 3    DC  B C5    1 
ATOM   55   C  C6    . DC  A 1 3   ? 11.165 48.928 35.161  1.00 46.69 ? 3    DC  B C6    1 
ATOM   56   P  P     . DT  A 1 4   ? 8.853  50.893 29.657  1.00 57.64 ? 4    DT  B P     1 
ATOM   57   O  OP1   . DT  A 1 4   ? 8.026  51.859 28.904  1.00 57.24 ? 4    DT  B OP1   1 
ATOM   58   O  OP2   . DT  A 1 4   ? 8.907  49.436 29.356  1.00 54.14 ? 4    DT  B OP2   1 
ATOM   59   O  "O5'" . DT  A 1 4   ? 10.376 51.421 29.696  1.00 52.65 ? 4    DT  B "O5'" 1 
ATOM   60   C  "C5'" . DT  A 1 4   ? 10.582 52.807 29.910  1.00 48.31 ? 4    DT  B "C5'" 1 
ATOM   61   C  "C4'" . DT  A 1 4   ? 12.049 53.160 29.896  1.00 45.18 ? 4    DT  B "C4'" 1 
ATOM   62   O  "O4'" . DT  A 1 4   ? 12.700 52.559 31.030  1.00 44.54 ? 4    DT  B "O4'" 1 
ATOM   63   C  "C3'" . DT  A 1 4   ? 12.764 52.656 28.644  1.00 43.94 ? 4    DT  B "C3'" 1 
ATOM   64   O  "O3'" . DT  A 1 4   ? 13.289 53.767 27.929  1.00 43.67 ? 4    DT  B "O3'" 1 
ATOM   65   C  "C2'" . DT  A 1 4   ? 13.856 51.727 29.157  1.00 41.30 ? 4    DT  B "C2'" 1 
ATOM   66   C  "C1'" . DT  A 1 4   ? 13.996 52.136 30.617  1.00 43.31 ? 4    DT  B "C1'" 1 
ATOM   67   N  N1    . DT  A 1 4   ? 14.400 50.996 31.502  1.00 42.68 ? 4    DT  B N1    1 
ATOM   68   C  C2    . DT  A 1 4   ? 15.557 51.075 32.271  1.00 41.29 ? 4    DT  B C2    1 
ATOM   69   O  O2    . DT  A 1 4   ? 16.320 52.021 32.292  1.00 43.83 ? 4    DT  B O2    1 
ATOM   70   N  N3    . DT  A 1 4   ? 15.807 49.984 33.050  1.00 38.80 ? 4    DT  B N3    1 
ATOM   71   C  C4    . DT  A 1 4   ? 15.046 48.842 33.133  1.00 41.75 ? 4    DT  B C4    1 
ATOM   72   O  O4    . DT  A 1 4   ? 15.379 47.919 33.867  1.00 43.16 ? 4    DT  B O4    1 
ATOM   73   C  C5    . DT  A 1 4   ? 13.856 48.810 32.322  1.00 40.54 ? 4    DT  B C5    1 
ATOM   74   C  C7    . DT  A 1 4   ? 13.052 47.550 32.237  1.00 43.79 ? 4    DT  B C7    1 
ATOM   75   C  C6    . DT  A 1 4   ? 13.585 49.869 31.551  1.00 41.90 ? 4    DT  B C6    1 
ATOM   76   P  P     . DT  A 1 5   ? 13.945 53.601 26.469  1.00 44.88 ? 5    DT  B P     1 
ATOM   77   O  OP1   . DT  A 1 5   ? 13.677 54.912 25.806  1.00 45.08 ? 5    DT  B OP1   1 
ATOM   78   O  OP2   . DT  A 1 5   ? 13.434 52.358 25.863  1.00 43.61 ? 5    DT  B OP2   1 
ATOM   79   O  "O5'" . DT  A 1 5   ? 15.512 53.414 26.761  1.00 41.50 ? 5    DT  B "O5'" 1 
ATOM   80   C  "C5'" . DT  A 1 5   ? 16.261 54.472 27.326  1.00 40.07 ? 5    DT  B "C5'" 1 
ATOM   81   C  "C4'" . DT  A 1 5   ? 17.624 53.958 27.757  1.00 38.92 ? 5    DT  B "C4'" 1 
ATOM   82   O  "O4'" . DT  A 1 5   ? 17.498 53.032 28.867  1.00 41.07 ? 5    DT  B "O4'" 1 
ATOM   83   C  "C3'" . DT  A 1 5   ? 18.322 53.125 26.676  1.00 37.68 ? 5    DT  B "C3'" 1 
ATOM   84   O  "O3'" . DT  A 1 5   ? 19.078 53.958 25.796  1.00 36.54 ? 5    DT  B "O3'" 1 
ATOM   85   C  "C2'" . DT  A 1 5   ? 19.211 52.165 27.470  1.00 37.65 ? 5    DT  B "C2'" 1 
ATOM   86   C  "C1'" . DT  A 1 5   ? 18.646 52.179 28.900  1.00 39.59 ? 5    DT  B "C1'" 1 
ATOM   87   N  N1    . DT  A 1 5   ? 18.220 50.849 29.446  1.00 36.79 ? 5    DT  B N1    1 
ATOM   88   C  C2    . DT  A 1 5   ? 18.945 50.308 30.493  1.00 35.96 ? 5    DT  B C2    1 
ATOM   89   O  O2    . DT  A 1 5   ? 19.935 50.798 30.990  1.00 36.34 ? 5    DT  B O2    1 
ATOM   90   N  N3    . DT  A 1 5   ? 18.457 49.136 30.970  1.00 35.63 ? 5    DT  B N3    1 
ATOM   91   C  C4    . DT  A 1 5   ? 17.369 48.429 30.522  1.00 37.93 ? 5    DT  B C4    1 
ATOM   92   O  O4    . DT  A 1 5   ? 17.045 47.356 31.033  1.00 38.44 ? 5    DT  B O4    1 
ATOM   93   C  C5    . DT  A 1 5   ? 16.649 49.015 29.410  1.00 37.59 ? 5    DT  B C5    1 
ATOM   94   C  C7    . DT  A 1 5   ? 15.563 48.203 28.751  1.00 38.08 ? 5    DT  B C7    1 
ATOM   95   C  C6    . DT  A 1 5   ? 17.099 50.189 28.928  1.00 35.36 ? 5    DT  B C6    1 
ATOM   96   P  P     . DT  A 1 6   ? 19.720 53.366 24.424  1.00 34.12 ? 6    DT  B P     1 
ATOM   97   O  OP1   . DT  A 1 6   ? 20.347 54.540 23.774  1.00 33.46 ? 6    DT  B OP1   1 
ATOM   98   O  OP2   . DT  A 1 6   ? 18.665 52.536 23.845  1.00 34.99 ? 6    DT  B OP2   1 
ATOM   99   O  "O5'" . DT  A 1 6   ? 20.908 52.455 24.981  1.00 28.46 ? 6    DT  B "O5'" 1 
ATOM   100  C  "C5'" . DT  A 1 6   ? 22.169 53.057 25.234  1.00 28.69 ? 6    DT  B "C5'" 1 
ATOM   101  C  "C4'" . DT  A 1 6   ? 23.128 51.996 25.747  1.00 29.06 ? 6    DT  B "C4'" 1 
ATOM   102  O  "O4'" . DT  A 1 6   ? 22.571 51.413 26.948  1.00 30.51 ? 6    DT  B "O4'" 1 
ATOM   103  C  "C3'" . DT  A 1 6   ? 23.301 50.757 24.834  1.00 25.70 ? 6    DT  B "C3'" 1 
ATOM   104  O  "O3'" . DT  A 1 6   ? 24.344 51.034 23.911  1.00 26.66 ? 6    DT  B "O3'" 1 
ATOM   105  C  "C2'" . DT  A 1 6   ? 23.756 49.649 25.832  1.00 29.01 ? 6    DT  B "C2'" 1 
ATOM   106  C  "C1'" . DT  A 1 6   ? 23.077 50.082 27.146  1.00 29.18 ? 6    DT  B "C1'" 1 
ATOM   107  N  N1    . DT  A 1 6   ? 21.971 49.163 27.510  1.00 29.72 ? 6    DT  B N1    1 
ATOM   108  C  C2    . DT  A 1 6   ? 22.091 48.359 28.649  1.00 30.71 ? 6    DT  B C2    1 
ATOM   109  O  O2    . DT  A 1 6   ? 23.077 48.339 29.376  1.00 32.04 ? 6    DT  B O2    1 
ATOM   110  N  N3    . DT  A 1 6   ? 21.028 47.556 28.891  1.00 29.56 ? 6    DT  B N3    1 
ATOM   111  C  C4    . DT  A 1 6   ? 19.871 47.448 28.142  1.00 32.14 ? 6    DT  B C4    1 
ATOM   112  O  O4    . DT  A 1 6   ? 18.991 46.663 28.486  1.00 32.12 ? 6    DT  B O4    1 
ATOM   113  C  C5    . DT  A 1 6   ? 19.780 48.304 26.971  1.00 32.09 ? 6    DT  B C5    1 
ATOM   114  C  C7    . DT  A 1 6   ? 18.622 48.257 25.995  1.00 32.45 ? 6    DT  B C7    1 
ATOM   115  C  C6    . DT  A 1 6   ? 20.831 49.100 26.718  1.00 29.19 ? 6    DT  B C6    1 
HETATM 116  O  O1P   . FOX A 1 7   ? 24.075 52.691 22.022  1.00 27.04 ? 7    FOX B O1P   1 
HETATM 117  P  P     . FOX A 1 7   ? 23.963 51.227 22.371  1.00 27.69 ? 7    FOX B P     1 
HETATM 118  O  O2P   . FOX A 1 7   ? 22.772 50.490 21.992  1.00 28.76 ? 7    FOX B O2P   1 
HETATM 119  O  "O5'" . FOX A 1 7   ? 25.223 50.449 21.737  1.00 28.21 ? 7    FOX B "O5'" 1 
HETATM 120  C  "C5'" . FOX A 1 7   ? 26.531 50.872 21.971  1.00 28.82 ? 7    FOX B "C5'" 1 
HETATM 121  C  "C4'" . FOX A 1 7   ? 27.516 50.253 20.959  1.00 29.33 ? 7    FOX B "C4'" 1 
HETATM 122  C  "C6'" . FOX A 1 7   ? 28.954 50.623 21.364  1.00 27.23 ? 7    FOX B "C6'" 1 
HETATM 123  C  "C3'" . FOX A 1 7   ? 27.571 48.716 20.971  1.00 25.39 ? 7    FOX B "C3'" 1 
HETATM 124  O  "O3'" . FOX A 1 7   ? 28.214 48.258 19.743  1.00 24.71 ? 7    FOX B "O3'" 1 
HETATM 125  C  "C2'" . FOX A 1 7   ? 28.466 48.409 22.202  1.00 26.54 ? 7    FOX B "C2'" 1 
HETATM 126  C  "C1'" . FOX A 1 7   ? 29.594 49.437 22.113  1.00 33.51 ? 7    FOX B "C1'" 1 
HETATM 127  N  N9    . FOX A 1 7   ? 30.066 49.878 23.454  1.00 35.07 ? 7    FOX B N9    1 
HETATM 128  C  C4    . FOX A 1 7   ? 31.090 50.828 23.621  1.00 38.09 ? 7    FOX B C4    1 
HETATM 129  N  N3    . FOX A 1 7   ? 31.852 51.181 22.535  1.00 32.55 ? 7    FOX B N3    1 
HETATM 130  C  C2    . FOX A 1 7   ? 32.902 51.980 22.661  1.00 36.02 ? 7    FOX B C2    1 
HETATM 131  N  N2    . FOX A 1 7   ? 33.633 52.350 21.603  1.00 35.08 ? 7    FOX B N2    1 
HETATM 132  N  N1    . FOX A 1 7   ? 33.247 52.494 23.889  1.00 37.59 ? 7    FOX B N1    1 
HETATM 133  C  C6    . FOX A 1 7   ? 32.554 52.184 25.049  1.00 39.43 ? 7    FOX B C6    1 
HETATM 134  O  O6    . FOX A 1 7   ? 32.951 52.655 26.165  1.00 37.19 ? 7    FOX B O6    1 
HETATM 135  C  C5    . FOX A 1 7   ? 31.430 51.314 24.909  1.00 38.62 ? 7    FOX B C5    1 
HETATM 136  N  N7    . FOX A 1 7   ? 30.892 50.777 26.023  1.00 43.35 ? 7    FOX B N7    1 
HETATM 137  C  C8    . FOX A 1 7   ? 29.918 51.441 26.665  1.00 48.45 ? 7    FOX B C8    1 
HETATM 138  O  O8    . FOX A 1 7   ? 29.075 52.109 26.026  1.00 51.88 ? 7    FOX B O8    1 
ATOM   139  P  P     . DT  A 1 8   ? 27.384 47.433 18.698  1.00 25.24 ? 8    DT  B P     1 
ATOM   140  O  OP1   . DT  A 1 8   ? 28.358 47.081 17.631  1.00 26.04 ? 8    DT  B OP1   1 
ATOM   141  O  OP2   . DT  A 1 8   ? 26.116 48.129 18.335  1.00 24.99 ? 8    DT  B OP2   1 
ATOM   142  O  "O5'" . DT  A 1 8   ? 26.948 46.100 19.493  1.00 24.99 ? 8    DT  B "O5'" 1 
ATOM   143  C  "C5'" . DT  A 1 8   ? 28.066 45.240 19.828  1.00 24.81 ? 8    DT  B "C5'" 1 
ATOM   144  C  "C4'" . DT  A 1 8   ? 27.744 43.772 19.449  1.00 24.06 ? 8    DT  B "C4'" 1 
ATOM   145  O  "O4'" . DT  A 1 8   ? 26.746 43.192 20.343  1.00 24.95 ? 8    DT  B "O4'" 1 
ATOM   146  C  "C3'" . DT  A 1 8   ? 27.218 43.600 18.042  1.00 23.66 ? 8    DT  B "C3'" 1 
ATOM   147  O  "O3'" . DT  A 1 8   ? 28.029 42.617 17.338  1.00 25.82 ? 8    DT  B "O3'" 1 
ATOM   148  C  "C2'" . DT  A 1 8   ? 25.771 43.207 18.217  1.00 24.92 ? 8    DT  B "C2'" 1 
ATOM   149  C  "C1'" . DT  A 1 8   ? 25.702 42.570 19.584  1.00 24.76 ? 8    DT  B "C1'" 1 
ATOM   150  N  N1    . DT  A 1 8   ? 24.467 42.895 20.353  1.00 27.74 ? 8    DT  B N1    1 
ATOM   151  C  C2    . DT  A 1 8   ? 23.876 41.908 21.121  1.00 28.33 ? 8    DT  B C2    1 
ATOM   152  O  O2    . DT  A 1 8   ? 24.257 40.745 21.178  1.00 27.59 ? 8    DT  B O2    1 
ATOM   153  N  N3    . DT  A 1 8   ? 22.731 42.293 21.785  1.00 24.52 ? 8    DT  B N3    1 
ATOM   154  C  C4    . DT  A 1 8   ? 22.168 43.555 21.856  1.00 28.13 ? 8    DT  B C4    1 
ATOM   155  O  O4    . DT  A 1 8   ? 21.173 43.773 22.580  1.00 28.33 ? 8    DT  B O4    1 
ATOM   156  C  C5    . DT  A 1 8   ? 22.822 44.571 21.063  1.00 26.27 ? 8    DT  B C5    1 
ATOM   157  C  C7    . DT  A 1 8   ? 22.334 46.024 21.139  1.00 27.67 ? 8    DT  B C7    1 
ATOM   158  C  C6    . DT  A 1 8   ? 23.930 44.195 20.362  1.00 30.57 ? 8    DT  B C6    1 
ATOM   159  P  P     . DT  A 1 9   ? 27.663 42.128 15.806  1.00 27.34 ? 9    DT  B P     1 
ATOM   160  O  OP1   . DT  A 1 9   ? 28.968 41.595 15.283  1.00 23.84 ? 9    DT  B OP1   1 
ATOM   161  O  OP2   . DT  A 1 9   ? 27.052 43.239 15.056  1.00 29.37 ? 9    DT  B OP2   1 
ATOM   162  O  "O5'" . DT  A 1 9   ? 26.683 40.922 15.989  1.00 27.27 ? 9    DT  B "O5'" 1 
ATOM   163  C  "C5'" . DT  A 1 9   ? 27.149 39.741 16.664  1.00 24.84 ? 9    DT  B "C5'" 1 
ATOM   164  C  "C4'" . DT  A 1 9   ? 25.964 38.893 17.010  1.00 28.66 ? 9    DT  B "C4'" 1 
ATOM   165  O  "O4'" . DT  A 1 9   ? 24.969 39.612 17.782  1.00 28.31 ? 9    DT  B "O4'" 1 
ATOM   166  C  "C3'" . DT  A 1 9   ? 25.238 38.254 15.808  1.00 28.21 ? 9    DT  B "C3'" 1 
ATOM   167  O  "O3'" . DT  A 1 9   ? 25.482 36.835 15.951  1.00 31.11 ? 9    DT  B "O3'" 1 
ATOM   168  C  "C2'" . DT  A 1 9   ? 23.766 38.644 16.042  1.00 27.17 ? 9    DT  B "C2'" 1 
ATOM   169  C  "C1'" . DT  A 1 9   ? 23.730 38.971 17.549  1.00 28.27 ? 9    DT  B "C1'" 1 
ATOM   170  N  N1    . DT  A 1 9   ? 22.675 39.936 18.051  1.00 26.94 ? 9    DT  B N1    1 
ATOM   171  C  C2    . DT  A 1 9   ? 21.772 39.563 19.031  1.00 30.22 ? 9    DT  B C2    1 
ATOM   172  O  O2    . DT  A 1 9   ? 21.713 38.461 19.546  1.00 30.27 ? 9    DT  B O2    1 
ATOM   173  N  N3    . DT  A 1 9   ? 20.911 40.547 19.444  1.00 29.61 ? 9    DT  B N3    1 
ATOM   174  C  C4    . DT  A 1 9   ? 20.845 41.836 18.982  1.00 30.48 ? 9    DT  B C4    1 
ATOM   175  O  O4    . DT  A 1 9   ? 20.024 42.626 19.436  1.00 32.25 ? 9    DT  B O4    1 
ATOM   176  C  C5    . DT  A 1 9   ? 21.789 42.193 17.948  1.00 29.65 ? 9    DT  B C5    1 
ATOM   177  C  C7    . DT  A 1 9   ? 21.793 43.606 17.419  1.00 30.27 ? 9    DT  B C7    1 
ATOM   178  C  C6    . DT  A 1 9   ? 22.673 41.252 17.550  1.00 29.57 ? 9    DT  B C6    1 
ATOM   179  P  P     . DT  A 1 10  ? 25.096 35.772 14.800  1.00 33.79 ? 10   DT  B P     1 
ATOM   180  O  OP1   . DT  A 1 10  ? 25.907 34.560 15.118  1.00 32.27 ? 10   DT  B OP1   1 
ATOM   181  O  OP2   . DT  A 1 10  ? 24.981 36.377 13.482  1.00 30.42 ? 10   DT  B OP2   1 
ATOM   182  O  "O5'" . DT  A 1 10  ? 23.581 35.459 15.243  1.00 34.00 ? 10   DT  B "O5'" 1 
ATOM   183  C  "C5'" . DT  A 1 10  ? 23.369 34.688 16.455  1.00 36.95 ? 10   DT  B "C5'" 1 
ATOM   184  C  "C4'" . DT  A 1 10  ? 21.894 34.558 16.711  1.00 37.28 ? 10   DT  B "C4'" 1 
ATOM   185  O  "O4'" . DT  A 1 10  ? 21.344 35.841 17.092  1.00 36.54 ? 10   DT  B "O4'" 1 
ATOM   186  C  "C3'" . DT  A 1 10  ? 21.079 34.071 15.502  1.00 41.94 ? 10   DT  B "C3'" 1 
ATOM   187  O  "O3'" . DT  A 1 10  ? 20.277 32.952 15.871  1.00 49.88 ? 10   DT  B "O3'" 1 
ATOM   188  C  "C2'" . DT  A 1 10  ? 20.206 35.264 15.139  1.00 38.02 ? 10   DT  B "C2'" 1 
ATOM   189  C  "C1'" . DT  A 1 10  ? 20.054 35.896 16.522  1.00 35.66 ? 10   DT  B "C1'" 1 
ATOM   190  N  N1    . DT  A 1 10  ? 19.635 37.286 16.516  1.00 33.18 ? 10   DT  B N1    1 
ATOM   191  C  C2    . DT  A 1 10  ? 18.678 37.694 17.428  1.00 34.87 ? 10   DT  B C2    1 
ATOM   192  O  O2    . DT  A 1 10  ? 18.154 36.962 18.245  1.00 31.85 ? 10   DT  B O2    1 
ATOM   193  N  N3    . DT  A 1 10  ? 18.362 39.015 17.355  1.00 31.78 ? 10   DT  B N3    1 
ATOM   194  C  C4    . DT  A 1 10  ? 18.931 39.927 16.492  1.00 33.67 ? 10   DT  B C4    1 
ATOM   195  O  O4    . DT  A 1 10  ? 18.571 41.084 16.536  1.00 32.29 ? 10   DT  B O4    1 
ATOM   196  C  C5    . DT  A 1 10  ? 19.916 39.435 15.550  1.00 33.16 ? 10   DT  B C5    1 
ATOM   197  C  C7    . DT  A 1 10  ? 20.643 40.367 14.587  1.00 35.87 ? 10   DT  B C7    1 
ATOM   198  C  C6    . DT  A 1 10  ? 20.228 38.148 15.610  1.00 33.80 ? 10   DT  B C6    1 
ATOM   199  P  P     . DC  A 1 11  ? 19.628 31.993 14.752  1.00 58.87 ? 11   DC  B P     1 
ATOM   200  O  OP1   . DC  A 1 11  ? 20.476 30.769 14.796  1.00 58.42 ? 11   DC  B OP1   1 
ATOM   201  O  OP2   . DC  A 1 11  ? 19.345 32.640 13.429  1.00 54.15 ? 11   DC  B OP2   1 
ATOM   202  O  "O5'" . DC  A 1 11  ? 18.189 31.793 15.436  1.00 57.03 ? 11   DC  B "O5'" 1 
ATOM   203  C  "C5'" . DC  A 1 11  ? 18.052 31.251 16.740  1.00 53.47 ? 11   DC  B "C5'" 1 
ATOM   204  C  "C4'" . DC  A 1 11  ? 16.848 31.890 17.419  1.00 48.49 ? 11   DC  B "C4'" 1 
ATOM   205  O  "O4'" . DC  A 1 11  ? 17.041 33.328 17.393  1.00 45.04 ? 11   DC  B "O4'" 1 
ATOM   206  C  "C3'" . DC  A 1 11  ? 15.471 31.713 16.759  1.00 47.88 ? 11   DC  B "C3'" 1 
ATOM   207  O  "O3'" . DC  A 1 11  ? 14.776 30.462 17.065  1.00 50.90 ? 11   DC  B "O3'" 1 
ATOM   208  C  "C2'" . DC  A 1 11  ? 14.691 32.890 17.326  1.00 43.94 ? 11   DC  B "C2'" 1 
ATOM   209  C  "C1'" . DC  A 1 11  ? 15.769 33.937 17.552  1.00 41.63 ? 11   DC  B "C1'" 1 
ATOM   210  N  N1    . DC  A 1 11  ? 15.738 35.159 16.719  1.00 38.09 ? 11   DC  B N1    1 
ATOM   211  C  C2    . DC  A 1 11  ? 14.926 36.236 17.073  1.00 38.00 ? 11   DC  B C2    1 
ATOM   212  O  O2    . DC  A 1 11  ? 14.172 36.161 18.032  1.00 39.22 ? 11   DC  B O2    1 
ATOM   213  N  N3    . DC  A 1 11  ? 14.953 37.373 16.359  1.00 38.10 ? 11   DC  B N3    1 
ATOM   214  C  C4    . DC  A 1 11  ? 15.759 37.462 15.297  1.00 38.95 ? 11   DC  B C4    1 
ATOM   215  N  N4    . DC  A 1 11  ? 15.760 38.627 14.626  1.00 37.33 ? 11   DC  B N4    1 
ATOM   216  C  C5    . DC  A 1 11  ? 16.600 36.384 14.899  1.00 37.56 ? 11   DC  B C5    1 
ATOM   217  C  C6    . DC  A 1 11  ? 16.566 35.271 15.642  1.00 39.78 ? 11   DC  B C6    1 
ATOM   218  P  P     . DT  A 1 12  ? 13.544 29.972 16.140  1.00 51.97 ? 12   DT  B P     1 
ATOM   219  O  OP1   . DT  A 1 12  ? 13.398 28.514 16.333  1.00 55.71 ? 12   DT  B OP1   1 
ATOM   220  O  OP2   . DT  A 1 12  ? 13.627 30.470 14.736  1.00 49.69 ? 12   DT  B OP2   1 
ATOM   221  O  "O5'" . DT  A 1 12  ? 12.322 30.734 16.819  1.00 51.34 ? 12   DT  B "O5'" 1 
ATOM   222  C  "C5'" . DT  A 1 12  ? 12.246 30.946 18.226  1.00 50.56 ? 12   DT  B "C5'" 1 
ATOM   223  C  "C4'" . DT  A 1 12  ? 10.988 31.745 18.520  1.00 49.62 ? 12   DT  B "C4'" 1 
ATOM   224  O  "O4'" . DT  A 1 12  ? 11.137 33.135 18.124  1.00 48.97 ? 12   DT  B "O4'" 1 
ATOM   225  C  "C3'" . DT  A 1 12  ? 9.714  31.276 17.818  1.00 51.12 ? 12   DT  B "C3'" 1 
ATOM   226  O  "O3'" . DT  A 1 12  ? 8.629  31.507 18.726  1.00 57.04 ? 12   DT  B "O3'" 1 
ATOM   227  C  "C2'" . DT  A 1 12  ? 9.595  32.188 16.590  1.00 47.66 ? 12   DT  B "C2'" 1 
ATOM   228  C  "C1'" . DT  A 1 12  ? 10.128 33.501 17.184  1.00 44.58 ? 12   DT  B "C1'" 1 
ATOM   229  N  N1    . DT  A 1 12  ? 10.790 34.452 16.224  1.00 42.49 ? 12   DT  B N1    1 
ATOM   230  C  C2    . DT  A 1 12  ? 10.417 35.788 16.156  1.00 41.10 ? 12   DT  B C2    1 
ATOM   231  O  O2    . DT  A 1 12  ? 9.503  36.277 16.812  1.00 41.75 ? 12   DT  B O2    1 
ATOM   232  N  N3    . DT  A 1 12  ? 11.141 36.525 15.234  1.00 40.15 ? 12   DT  B N3    1 
ATOM   233  C  C4    . DT  A 1 12  ? 12.170 36.045 14.431  1.00 39.17 ? 12   DT  B C4    1 
ATOM   234  O  O4    . DT  A 1 12  ? 12.770 36.752 13.658  1.00 41.03 ? 12   DT  B O4    1 
ATOM   235  C  C5    . DT  A 1 12  ? 12.518 34.657 14.567  1.00 41.75 ? 12   DT  B C5    1 
ATOM   236  C  C7    . DT  A 1 12  ? 13.592 34.012 13.719  1.00 41.40 ? 12   DT  B C7    1 
ATOM   237  C  C6    . DT  A 1 12  ? 11.820 33.938 15.454  1.00 41.46 ? 12   DT  B C6    1 
ATOM   238  P  P     . DC  A 1 13  ? 7.163  30.917 18.461  1.00 59.64 ? 13   DC  B P     1 
ATOM   239  O  OP1   . DC  A 1 13  ? 6.733  30.599 19.854  1.00 62.14 ? 13   DC  B OP1   1 
ATOM   240  O  OP2   . DC  A 1 13  ? 7.174  29.899 17.373  1.00 56.03 ? 13   DC  B OP2   1 
ATOM   241  O  "O5'" . DC  A 1 13  ? 6.310  32.149 17.899  1.00 54.28 ? 13   DC  B "O5'" 1 
ATOM   242  C  "C5'" . DC  A 1 13  ? 6.107  33.338 18.660  1.00 54.59 ? 13   DC  B "C5'" 1 
ATOM   243  C  "C4'" . DC  A 1 13  ? 5.522  34.411 17.745  1.00 52.41 ? 13   DC  B "C4'" 1 
ATOM   244  O  "O4'" . DC  A 1 13  ? 6.491  34.787 16.741  1.00 51.09 ? 13   DC  B "O4'" 1 
ATOM   245  C  "C3'" . DC  A 1 13  ? 4.333  33.967 16.904  1.00 52.59 ? 13   DC  B "C3'" 1 
ATOM   246  O  "O3'" . DC  A 1 13  ? 3.260  34.814 17.250  1.00 54.47 ? 13   DC  B "O3'" 1 
ATOM   247  C  "C2'" . DC  A 1 13  ? 4.769  34.134 15.432  1.00 49.91 ? 13   DC  B "C2'" 1 
ATOM   248  C  "C1'" . DC  A 1 13  ? 5.837  35.202 15.554  1.00 46.69 ? 13   DC  B "C1'" 1 
ATOM   249  N  N1    . DC  A 1 13  ? 6.958  35.238 14.531  1.00 44.32 ? 13   DC  B N1    1 
ATOM   250  C  C2    . DC  A 1 13  ? 7.323  36.435 13.918  1.00 44.03 ? 13   DC  B C2    1 
ATOM   251  O  O2    . DC  A 1 13  ? 6.697  37.478 14.161  1.00 44.83 ? 13   DC  B O2    1 
ATOM   252  N  N3    . DC  A 1 13  ? 8.353  36.416 13.035  1.00 41.79 ? 13   DC  B N3    1 
ATOM   253  C  C4    . DC  A 1 13  ? 9.014  35.284 12.776  1.00 42.49 ? 13   DC  B C4    1 
ATOM   254  N  N4    . DC  A 1 13  ? 10.014 35.337 11.904  1.00 43.22 ? 13   DC  B N4    1 
ATOM   255  C  C5    . DC  A 1 13  ? 8.676  34.047 13.384  1.00 43.03 ? 13   DC  B C5    1 
ATOM   256  C  C6    . DC  A 1 13  ? 7.654  34.086 14.248  1.00 45.05 ? 13   DC  B C6    1 
ATOM   257  P  P     . DG  A 1 14  ? 1.747  34.409 16.907  1.00 57.80 ? 14   DG  B P     1 
ATOM   258  O  OP1   . DG  A 1 14  ? 0.980  35.034 18.026  1.00 58.11 ? 14   DG  B OP1   1 
ATOM   259  O  OP2   . DG  A 1 14  ? 1.652  32.980 16.495  1.00 53.96 ? 14   DG  B OP2   1 
ATOM   260  O  "O5'" . DG  A 1 14  ? 1.410  35.258 15.591  1.00 54.55 ? 14   DG  B "O5'" 1 
ATOM   261  C  "C5'" . DG  A 1 14  ? 1.386  36.688 15.646  1.00 50.37 ? 14   DG  B "C5'" 1 
ATOM   262  C  "C4'" . DG  A 1 14  ? 1.379  37.185 14.213  1.00 49.59 ? 14   DG  B "C4'" 1 
ATOM   263  O  "O4'" . DG  A 1 14  ? 2.667  36.871 13.610  1.00 47.72 ? 14   DG  B "O4'" 1 
ATOM   264  C  "C3'" . DG  A 1 14  ? 0.319  36.500 13.333  1.00 49.37 ? 14   DG  B "C3'" 1 
ATOM   265  O  "O3'" . DG  A 1 14  ? -0.437 37.505 12.664  1.00 50.00 ? 14   DG  B "O3'" 1 
ATOM   266  C  "C2'" . DG  A 1 14  ? 1.118  35.596 12.381  1.00 47.89 ? 14   DG  B "C2'" 1 
ATOM   267  C  "C1'" . DG  A 1 14  ? 2.414  36.416 12.296  1.00 44.14 ? 14   DG  B "C1'" 1 
ATOM   268  N  N9    . DG  A 1 14  ? 3.604  35.711 11.825  1.00 43.19 ? 14   DG  B N9    1 
ATOM   269  C  C8    . DG  A 1 14  ? 3.942  34.391 12.024  1.00 41.43 ? 14   DG  B C8    1 
ATOM   270  N  N7    . DG  A 1 14  ? 5.101  34.080 11.480  1.00 42.51 ? 14   DG  B N7    1 
ATOM   271  C  C5    . DG  A 1 14  ? 5.549  35.261 10.898  1.00 41.47 ? 14   DG  B C5    1 
ATOM   272  C  C6    . DG  A 1 14  ? 6.731  35.532 10.179  1.00 40.87 ? 14   DG  B C6    1 
ATOM   273  O  O6    . DG  A 1 14  ? 7.616  34.723 9.918   1.00 41.45 ? 14   DG  B O6    1 
ATOM   274  N  N1    . DG  A 1 14  ? 6.818  36.859 9.739   1.00 40.63 ? 14   DG  B N1    1 
ATOM   275  C  C2    . DG  A 1 14  ? 5.854  37.816 10.009  1.00 41.51 ? 14   DG  B C2    1 
ATOM   276  N  N2    . DG  A 1 14  ? 6.046  39.055 9.538   1.00 40.73 ? 14   DG  B N2    1 
ATOM   277  N  N3    . DG  A 1 14  ? 4.735  37.561 10.691  1.00 39.98 ? 14   DG  B N3    1 
ATOM   278  C  C4    . DG  A 1 14  ? 4.638  36.277 11.098  1.00 41.62 ? 14   DG  B C4    1 
ATOM   279  O  "O5'" . DG  B 2 1   ? 15.770 35.227 2.432   1.00 69.55 ? 15   DG  C "O5'" 1 
ATOM   280  C  "C5'" . DG  B 2 1   ? 14.409 34.779 2.477   1.00 66.39 ? 15   DG  C "C5'" 1 
ATOM   281  C  "C4'" . DG  B 2 1   ? 13.483 35.855 1.938   1.00 64.66 ? 15   DG  C "C4'" 1 
ATOM   282  O  "O4'" . DG  B 2 1   ? 12.174 35.253 1.723   1.00 63.00 ? 15   DG  C "O4'" 1 
ATOM   283  C  "C3'" . DG  B 2 1   ? 13.274 37.054 2.875   1.00 64.73 ? 15   DG  C "C3'" 1 
ATOM   284  O  "O3'" . DG  B 2 1   ? 13.882 38.263 2.392   1.00 67.85 ? 15   DG  C "O3'" 1 
ATOM   285  C  "C2'" . DG  B 2 1   ? 11.760 37.226 2.987   1.00 61.36 ? 15   DG  C "C2'" 1 
ATOM   286  C  "C1'" . DG  B 2 1   ? 11.202 35.877 2.566   1.00 55.24 ? 15   DG  C "C1'" 1 
ATOM   287  N  N9    . DG  B 2 1   ? 10.713 34.964 3.632   1.00 53.09 ? 15   DG  C N9    1 
ATOM   288  C  C8    . DG  B 2 1   ? 11.241 33.778 4.096   1.00 51.29 ? 15   DG  C C8    1 
ATOM   289  N  N7    . DG  B 2 1   ? 10.522 33.192 5.022   1.00 51.39 ? 15   DG  C N7    1 
ATOM   290  C  C5    . DG  B 2 1   ? 9.424  34.039 5.180   1.00 51.28 ? 15   DG  C C5    1 
ATOM   291  C  C6    . DG  B 2 1   ? 8.296  33.950 6.041   1.00 50.51 ? 15   DG  C C6    1 
ATOM   292  O  O6    . DG  B 2 1   ? 8.022  33.066 6.872   1.00 50.67 ? 15   DG  C O6    1 
ATOM   293  N  N1    . DG  B 2 1   ? 7.444  35.033 5.878   1.00 50.82 ? 15   DG  C N1    1 
ATOM   294  C  C2    . DG  B 2 1   ? 7.640  36.069 5.000   1.00 51.29 ? 15   DG  C C2    1 
ATOM   295  N  N2    . DG  B 2 1   ? 6.719  37.040 4.953   1.00 51.36 ? 15   DG  C N2    1 
ATOM   296  N  N3    . DG  B 2 1   ? 8.686  36.154 4.193   1.00 51.22 ? 15   DG  C N3    1 
ATOM   297  C  C4    . DG  B 2 1   ? 9.536  35.118 4.335   1.00 51.08 ? 15   DG  C C4    1 
ATOM   298  P  P     . DC  B 2 2   ? 14.466 39.318 3.469   1.00 71.42 ? 16   DC  C P     1 
ATOM   299  O  OP1   . DC  B 2 2   ? 15.116 40.466 2.776   1.00 70.30 ? 16   DC  C OP1   1 
ATOM   300  O  OP2   . DC  B 2 2   ? 15.182 38.571 4.535   1.00 69.27 ? 16   DC  C OP2   1 
ATOM   301  O  "O5'" . DC  B 2 2   ? 13.104 39.883 4.101   1.00 68.60 ? 16   DC  C "O5'" 1 
ATOM   302  C  "C5'" . DC  B 2 2   ? 12.356 40.879 3.412   1.00 64.61 ? 16   DC  C "C5'" 1 
ATOM   303  C  "C4'" . DC  B 2 2   ? 11.262 41.374 4.326   1.00 60.76 ? 16   DC  C "C4'" 1 
ATOM   304  O  "O4'" . DC  B 2 2   ? 10.460 40.217 4.648   1.00 59.73 ? 16   DC  C "O4'" 1 
ATOM   305  C  "C3'" . DC  B 2 2   ? 11.772 41.966 5.634   1.00 61.12 ? 16   DC  C "C3'" 1 
ATOM   306  O  "O3'" . DC  B 2 2   ? 11.880 43.395 5.451   1.00 61.08 ? 16   DC  C "O3'" 1 
ATOM   307  C  "C2'" . DC  B 2 2   ? 10.695 41.524 6.629   1.00 59.25 ? 16   DC  C "C2'" 1 
ATOM   308  C  "C1'" . DC  B 2 2   ? 9.967  40.351 5.964   1.00 54.55 ? 16   DC  C "C1'" 1 
ATOM   309  N  N1    . DC  B 2 2   ? 10.017 38.998 6.656   1.00 50.69 ? 16   DC  C N1    1 
ATOM   310  C  C2    . DC  B 2 2   ? 8.940  38.656 7.482   1.00 48.35 ? 16   DC  C C2    1 
ATOM   311  O  O2    . DC  B 2 2   ? 8.027  39.485 7.596   1.00 48.08 ? 16   DC  C O2    1 
ATOM   312  N  N3    . DC  B 2 2   ? 8.925  37.444 8.096   1.00 47.20 ? 16   DC  C N3    1 
ATOM   313  C  C4    . DC  B 2 2   ? 9.950  36.603 7.918   1.00 48.46 ? 16   DC  C C4    1 
ATOM   314  N  N4    . DC  B 2 2   ? 9.914  35.431 8.545   1.00 48.65 ? 16   DC  C N4    1 
ATOM   315  C  C5    . DC  B 2 2   ? 11.065 36.937 7.088   1.00 48.70 ? 16   DC  C C5    1 
ATOM   316  C  C6    . DC  B 2 2   ? 11.052 38.129 6.484   1.00 49.24 ? 16   DC  C C6    1 
ATOM   317  P  P     . DG  B 2 3   ? 12.381 44.465 6.531   1.00 63.94 ? 17   DG  C P     1 
ATOM   318  O  OP1   . DG  B 2 3   ? 12.537 45.720 5.741   1.00 65.38 ? 17   DG  C OP1   1 
ATOM   319  O  OP2   . DG  B 2 3   ? 13.516 44.002 7.381   1.00 59.06 ? 17   DG  C OP2   1 
ATOM   320  O  "O5'" . DG  B 2 3   ? 11.125 44.600 7.510   1.00 60.82 ? 17   DG  C "O5'" 1 
ATOM   321  C  "C5'" . DG  B 2 3   ? 9.927  45.264 7.197   1.00 56.89 ? 17   DG  C "C5'" 1 
ATOM   322  C  "C4'" . DG  B 2 3   ? 9.185  45.281 8.509   1.00 55.00 ? 17   DG  C "C4'" 1 
ATOM   323  O  "O4'" . DG  B 2 3   ? 9.032  43.907 8.959   1.00 52.88 ? 17   DG  C "O4'" 1 
ATOM   324  C  "C3'" . DG  B 2 3   ? 9.904  46.012 9.638   1.00 55.72 ? 17   DG  C "C3'" 1 
ATOM   325  O  "O3'" . DG  B 2 3   ? 8.889  46.773 10.275  1.00 57.25 ? 17   DG  C "O3'" 1 
ATOM   326  C  "C2'" . DG  B 2 3   ? 10.526 44.907 10.513  1.00 52.06 ? 17   DG  C "C2'" 1 
ATOM   327  C  "C1'" . DG  B 2 3   ? 9.618  43.694 10.226  1.00 46.88 ? 17   DG  C "C1'" 1 
ATOM   328  N  N9    . DG  B 2 3   ? 10.206 42.344 10.186  1.00 45.15 ? 17   DG  C N9    1 
ATOM   329  C  C8    . DG  B 2 3   ? 11.358 41.897 9.572   1.00 43.82 ? 17   DG  C C8    1 
ATOM   330  N  N7    . DG  B 2 3   ? 11.564 40.608 9.745   1.00 43.00 ? 17   DG  C N7    1 
ATOM   331  C  C5    . DG  B 2 3   ? 10.494 40.176 10.520  1.00 43.34 ? 17   DG  C C5    1 
ATOM   332  C  C6    . DG  B 2 3   ? 10.188 38.887 11.029  1.00 41.92 ? 17   DG  C C6    1 
ATOM   333  O  O6    . DG  B 2 3   ? 10.809 37.818 10.881  1.00 42.58 ? 17   DG  C O6    1 
ATOM   334  N  N1    . DG  B 2 3   ? 9.022  38.916 11.776  1.00 42.63 ? 17   DG  C N1    1 
ATOM   335  C  C2    . DG  B 2 3   ? 8.225  40.031 11.985  1.00 43.62 ? 17   DG  C C2    1 
ATOM   336  N  N2    . DG  B 2 3   ? 7.120  39.874 12.721  1.00 42.82 ? 17   DG  C N2    1 
ATOM   337  N  N3    . DG  B 2 3   ? 8.503  41.245 11.526  1.00 43.32 ? 17   DG  C N3    1 
ATOM   338  C  C4    . DG  B 2 3   ? 9.651  41.233 10.794  1.00 43.66 ? 17   DG  C C4    1 
ATOM   339  P  P     . DA  B 2 4   ? 9.142  47.628 11.599  1.00 59.70 ? 18   DA  C P     1 
ATOM   340  O  OP1   . DA  B 2 4   ? 8.202  48.791 11.557  1.00 60.97 ? 18   DA  C OP1   1 
ATOM   341  O  OP2   . DA  B 2 4   ? 10.606 47.801 11.729  1.00 59.70 ? 18   DA  C OP2   1 
ATOM   342  O  "O5'" . DA  B 2 4   ? 8.654  46.686 12.783  1.00 57.01 ? 18   DA  C "O5'" 1 
ATOM   343  C  "C5'" . DA  B 2 4   ? 7.358  46.207 12.764  1.00 53.06 ? 18   DA  C "C5'" 1 
ATOM   344  C  "C4'" . DA  B 2 4   ? 7.182  45.528 14.083  1.00 51.33 ? 18   DA  C "C4'" 1 
ATOM   345  O  "O4'" . DA  B 2 4   ? 7.783  44.212 13.998  1.00 49.23 ? 18   DA  C "O4'" 1 
ATOM   346  C  "C3'" . DA  B 2 4   ? 7.848  46.279 15.230  1.00 50.85 ? 18   DA  C "C3'" 1 
ATOM   347  O  "O3'" . DA  B 2 4   ? 6.841  46.408 16.188  1.00 53.63 ? 18   DA  C "O3'" 1 
ATOM   348  C  "C2'" . DA  B 2 4   ? 9.012  45.371 15.647  1.00 49.17 ? 18   DA  C "C2'" 1 
ATOM   349  C  "C1'" . DA  B 2 4   ? 8.582  43.982 15.149  1.00 45.82 ? 18   DA  C "C1'" 1 
ATOM   350  N  N9    . DA  B 2 4   ? 9.662  43.141 14.648  1.00 44.51 ? 18   DA  C N9    1 
ATOM   351  C  C8    . DA  B 2 4   ? 10.703 43.541 13.846  1.00 44.53 ? 18   DA  C C8    1 
ATOM   352  N  N7    . DA  B 2 4   ? 11.524 42.575 13.497  1.00 44.39 ? 18   DA  C N7    1 
ATOM   353  C  C5    . DA  B 2 4   ? 10.971 41.457 14.105  1.00 43.11 ? 18   DA  C C5    1 
ATOM   354  C  C6    . DA  B 2 4   ? 11.400 40.122 14.118  1.00 43.72 ? 18   DA  C C6    1 
ATOM   355  N  N6    . DA  B 2 4   ? 12.510 39.694 13.482  1.00 41.70 ? 18   DA  C N6    1 
ATOM   356  N  N1    . DA  B 2 4   ? 10.634 39.268 14.823  1.00 42.90 ? 18   DA  C N1    1 
ATOM   357  C  C2    . DA  B 2 4   ? 9.531  39.711 15.461  1.00 44.72 ? 18   DA  C C2    1 
ATOM   358  N  N3    . DA  B 2 4   ? 9.018  40.937 15.523  1.00 42.08 ? 18   DA  C N3    1 
ATOM   359  C  C4    . DA  B 2 4   ? 9.821  41.776 14.824  1.00 44.26 ? 18   DA  C C4    1 
ATOM   360  P  P     . DG  B 2 5   ? 7.094  47.036 17.628  1.00 57.47 ? 19   DG  C P     1 
ATOM   361  O  OP1   . DG  B 2 5   ? 5.783  47.331 18.268  1.00 57.30 ? 19   DG  C OP1   1 
ATOM   362  O  OP2   . DG  B 2 5   ? 8.101  48.095 17.364  1.00 58.08 ? 19   DG  C OP2   1 
ATOM   363  O  "O5'" . DG  B 2 5   ? 7.724  45.824 18.452  1.00 56.70 ? 19   DG  C "O5'" 1 
ATOM   364  C  "C5'" . DG  B 2 5   ? 6.864  44.750 18.797  1.00 53.78 ? 19   DG  C "C5'" 1 
ATOM   365  C  "C4'" . DG  B 2 5   ? 7.688  43.639 19.400  1.00 51.65 ? 19   DG  C "C4'" 1 
ATOM   366  O  "O4'" . DG  B 2 5   ? 8.680  43.193 18.441  1.00 49.33 ? 19   DG  C "O4'" 1 
ATOM   367  C  "C3'" . DG  B 2 5   ? 8.486  44.061 20.633  1.00 51.11 ? 19   DG  C "C3'" 1 
ATOM   368  O  "O3'" . DG  B 2 5   ? 7.927  43.387 21.744  1.00 53.29 ? 19   DG  C "O3'" 1 
ATOM   369  C  "C2'" . DG  B 2 5   ? 9.928  43.600 20.369  1.00 48.27 ? 19   DG  C "C2'" 1 
ATOM   370  C  "C1'" . DG  B 2 5   ? 9.753  42.657 19.185  1.00 43.69 ? 19   DG  C "C1'" 1 
ATOM   371  N  N9    . DG  B 2 5   ? 10.918 42.547 18.302  1.00 42.13 ? 19   DG  C N9    1 
ATOM   372  C  C8    . DG  B 2 5   ? 11.533 43.543 17.585  1.00 42.22 ? 19   DG  C C8    1 
ATOM   373  N  N7    . DG  B 2 5   ? 12.546 43.117 16.867  1.00 43.73 ? 19   DG  C N7    1 
ATOM   374  C  C5    . DG  B 2 5   ? 12.593 41.746 17.125  1.00 39.94 ? 19   DG  C C5    1 
ATOM   375  C  C6    . DG  B 2 5   ? 13.466 40.753 16.651  1.00 41.23 ? 19   DG  C C6    1 
ATOM   376  O  O6    . DG  B 2 5   ? 14.422 40.880 15.880  1.00 40.94 ? 19   DG  C O6    1 
ATOM   377  N  N1    . DG  B 2 5   ? 13.164 39.485 17.156  1.00 41.48 ? 19   DG  C N1    1 
ATOM   378  C  C2    . DG  B 2 5   ? 12.130 39.223 18.037  1.00 42.57 ? 19   DG  C C2    1 
ATOM   379  N  N2    . DG  B 2 5   ? 11.957 37.951 18.449  1.00 41.17 ? 19   DG  C N2    1 
ATOM   380  N  N3    . DG  B 2 5   ? 11.305 40.145 18.491  1.00 41.70 ? 19   DG  C N3    1 
ATOM   381  C  C4    . DG  B 2 5   ? 11.598 41.384 18.000  1.00 42.55 ? 19   DG  C C4    1 
ATOM   382  P  P     . DA  B 2 6   ? 8.521  43.623 23.218  1.00 56.54 ? 20   DA  C P     1 
ATOM   383  O  OP1   . DA  B 2 6   ? 7.402  43.402 24.162  1.00 57.17 ? 20   DA  C OP1   1 
ATOM   384  O  OP2   . DA  B 2 6   ? 9.269  44.900 23.260  1.00 56.40 ? 20   DA  C OP2   1 
ATOM   385  O  "O5'" . DA  B 2 6   ? 9.516  42.383 23.346  1.00 54.45 ? 20   DA  C "O5'" 1 
ATOM   386  C  "C5'" . DA  B 2 6   ? 8.987  41.085 23.117  1.00 55.01 ? 20   DA  C "C5'" 1 
ATOM   387  C  "C4'" . DA  B 2 6   ? 10.124 40.090 23.128  1.00 54.29 ? 20   DA  C "C4'" 1 
ATOM   388  O  "O4'" . DA  B 2 6   ? 10.927 40.271 21.920  1.00 50.89 ? 20   DA  C "O4'" 1 
ATOM   389  C  "C3'" . DA  B 2 6   ? 11.062 40.326 24.303  1.00 55.78 ? 20   DA  C "C3'" 1 
ATOM   390  O  "O3'" . DA  B 2 6   ? 11.382 39.086 24.901  1.00 62.81 ? 20   DA  C "O3'" 1 
ATOM   391  C  "C2'" . DA  B 2 6   ? 12.305 40.926 23.655  1.00 51.55 ? 20   DA  C "C2'" 1 
ATOM   392  C  "C1'" . DA  B 2 6   ? 12.275 40.243 22.287  1.00 42.66 ? 20   DA  C "C1'" 1 
ATOM   393  N  N9    . DA  B 2 6   ? 13.140 40.957 21.339  1.00 40.91 ? 20   DA  C N9    1 
ATOM   394  C  C8    . DA  B 2 6   ? 13.139 42.293 21.065  1.00 38.88 ? 20   DA  C C8    1 
ATOM   395  N  N7    . DA  B 2 6   ? 14.058 42.661 20.203  1.00 41.30 ? 20   DA  C N7    1 
ATOM   396  C  C5    . DA  B 2 6   ? 14.719 41.484 19.905  1.00 37.99 ? 20   DA  C C5    1 
ATOM   397  C  C6    . DA  B 2 6   ? 15.789 41.223 19.040  1.00 37.07 ? 20   DA  C C6    1 
ATOM   398  N  N6    . DA  B 2 6   ? 16.378 42.192 18.330  1.00 34.58 ? 20   DA  C N6    1 
ATOM   399  N  N1    . DA  B 2 6   ? 16.214 39.942 18.976  1.00 37.14 ? 20   DA  C N1    1 
ATOM   400  C  C2    . DA  B 2 6   ? 15.581 39.010 19.712  1.00 38.60 ? 20   DA  C C2    1 
ATOM   401  N  N3    . DA  B 2 6   ? 14.541 39.144 20.558  1.00 34.67 ? 20   DA  C N3    1 
ATOM   402  C  C4    . DA  B 2 6   ? 14.167 40.418 20.601  1.00 37.34 ? 20   DA  C C4    1 
ATOM   403  P  P     . DA  B 2 7   ? 11.714 38.969 26.476  1.00 65.78 ? 21   DA  C P     1 
ATOM   404  O  OP1   . DA  B 2 7   ? 10.391 38.777 27.119  1.00 65.05 ? 21   DA  C OP1   1 
ATOM   405  O  OP2   . DA  B 2 7   ? 12.647 40.059 26.903  1.00 63.77 ? 21   DA  C OP2   1 
ATOM   406  O  "O5'" . DA  B 2 7   ? 12.517 37.569 26.491  1.00 62.11 ? 21   DA  C "O5'" 1 
ATOM   407  C  "C5'" . DA  B 2 7   ? 12.445 36.591 25.427  1.00 57.11 ? 21   DA  C "C5'" 1 
ATOM   408  C  "C4'" . DA  B 2 7   ? 13.830 36.012 25.158  1.00 54.36 ? 21   DA  C "C4'" 1 
ATOM   409  O  "O4'" . DA  B 2 7   ? 14.531 36.774 24.135  1.00 52.23 ? 21   DA  C "O4'" 1 
ATOM   410  C  "C3'" . DA  B 2 7   ? 14.763 35.990 26.374  1.00 53.96 ? 21   DA  C "C3'" 1 
ATOM   411  O  "O3'" . DA  B 2 7   ? 15.349 34.702 26.513  1.00 56.17 ? 21   DA  C "O3'" 1 
ATOM   412  C  "C2'" . DA  B 2 7   ? 15.830 37.047 26.086  1.00 51.05 ? 21   DA  C "C2'" 1 
ATOM   413  C  "C1'" . DA  B 2 7   ? 15.860 37.075 24.566  1.00 44.28 ? 21   DA  C "C1'" 1 
ATOM   414  N  N9    . DA  B 2 7   ? 16.195 38.394 24.012  1.00 42.17 ? 21   DA  C N9    1 
ATOM   415  C  C8    . DA  B 2 7   ? 15.624 39.585 24.315  1.00 40.62 ? 21   DA  C C8    1 
ATOM   416  N  N7    . DA  B 2 7   ? 16.121 40.592 23.635  1.00 42.24 ? 21   DA  C N7    1 
ATOM   417  C  C5    . DA  B 2 7   ? 17.095 40.010 22.824  1.00 40.99 ? 21   DA  C C5    1 
ATOM   418  C  C6    . DA  B 2 7   ? 17.991 40.532 21.857  1.00 39.66 ? 21   DA  C C6    1 
ATOM   419  N  N6    . DA  B 2 7   ? 18.048 41.831 21.528  1.00 38.05 ? 21   DA  C N6    1 
ATOM   420  N  N1    . DA  B 2 7   ? 18.813 39.658 21.232  1.00 37.57 ? 21   DA  C N1    1 
ATOM   421  C  C2    . DA  B 2 7   ? 18.755 38.363 21.539  1.00 39.79 ? 21   DA  C C2    1 
ATOM   422  N  N3    . DA  B 2 7   ? 17.946 37.768 22.419  1.00 40.13 ? 21   DA  C N3    1 
ATOM   423  C  C4    . DA  B 2 7   ? 17.144 38.655 23.038  1.00 40.58 ? 21   DA  C C4    1 
ATOM   424  P  P     . DA  B 2 8   ? 15.938 34.237 27.944  1.00 59.00 ? 22   DA  C P     1 
ATOM   425  O  OP1   . DA  B 2 8   ? 15.628 32.785 28.018  1.00 54.97 ? 22   DA  C OP1   1 
ATOM   426  O  OP2   . DA  B 2 8   ? 15.520 35.234 28.974  1.00 55.96 ? 22   DA  C OP2   1 
ATOM   427  O  "O5'" . DA  B 2 8   ? 17.533 34.434 27.807  1.00 50.67 ? 22   DA  C "O5'" 1 
ATOM   428  C  "C5'" . DA  B 2 8   ? 18.325 33.457 27.191  1.00 44.35 ? 22   DA  C "C5'" 1 
ATOM   429  C  "C4'" . DA  B 2 8   ? 19.683 34.096 26.952  1.00 40.70 ? 22   DA  C "C4'" 1 
ATOM   430  O  "O4'" . DA  B 2 8   ? 19.495 35.201 26.030  1.00 38.38 ? 22   DA  C "O4'" 1 
ATOM   431  C  "C3'" . DA  B 2 8   ? 20.279 34.767 28.183  1.00 37.05 ? 22   DA  C "C3'" 1 
ATOM   432  O  "O3'" . DA  B 2 8   ? 20.963 33.789 28.935  1.00 37.03 ? 22   DA  C "O3'" 1 
ATOM   433  C  "C2'" . DA  B 2 8   ? 21.230 35.801 27.567  1.00 34.72 ? 22   DA  C "C2'" 1 
ATOM   434  C  "C1'" . DA  B 2 8   ? 20.598 36.052 26.183  1.00 32.95 ? 22   DA  C "C1'" 1 
ATOM   435  N  N9    . DA  B 2 8   ? 20.177 37.426 25.967  1.00 31.73 ? 22   DA  C N9    1 
ATOM   436  C  C8    . DA  B 2 8   ? 19.232 38.162 26.639  1.00 31.54 ? 22   DA  C C8    1 
ATOM   437  N  N7    . DA  B 2 8   ? 19.141 39.397 26.201  1.00 32.26 ? 22   DA  C N7    1 
ATOM   438  C  C5    . DA  B 2 8   ? 20.076 39.469 25.169  1.00 30.09 ? 22   DA  C C5    1 
ATOM   439  C  C6    . DA  B 2 8   ? 20.438 40.508 24.299  1.00 29.22 ? 22   DA  C C6    1 
ATOM   440  N  N6    . DA  B 2 8   ? 19.879 41.726 24.394  1.00 30.02 ? 22   DA  C N6    1 
ATOM   441  N  N1    . DA  B 2 8   ? 21.445 40.261 23.400  1.00 30.38 ? 22   DA  C N1    1 
ATOM   442  C  C2    . DA  B 2 8   ? 21.997 39.019 23.354  1.00 31.06 ? 22   DA  C C2    1 
ATOM   443  N  N3    . DA  B 2 8   ? 21.712 37.957 24.126  1.00 29.99 ? 22   DA  C N3    1 
ATOM   444  C  C4    . DA  B 2 8   ? 20.734 38.263 25.019  1.00 31.10 ? 22   DA  C C4    1 
ATOM   445  P  P     . DC  B 2 9   ? 20.810 33.733 30.540  1.00 41.96 ? 23   DC  C P     1 
ATOM   446  O  OP1   . DC  B 2 9   ? 21.743 32.670 30.964  1.00 41.38 ? 23   DC  C OP1   1 
ATOM   447  O  OP2   . DC  B 2 9   ? 19.421 33.894 30.988  1.00 41.44 ? 23   DC  C OP2   1 
ATOM   448  O  "O5'" . DC  B 2 9   ? 21.419 35.115 31.059  1.00 37.41 ? 23   DC  C "O5'" 1 
ATOM   449  C  "C5'" . DC  B 2 9   ? 22.843 35.399 30.888  1.00 31.62 ? 23   DC  C "C5'" 1 
ATOM   450  C  "C4'" . DC  B 2 9   ? 23.079 36.856 31.247  1.00 30.40 ? 23   DC  C "C4'" 1 
ATOM   451  O  "O4'" . DC  B 2 9   ? 22.288 37.708 30.384  1.00 29.86 ? 23   DC  C "O4'" 1 
ATOM   452  C  "C3'" . DC  B 2 9   ? 22.618 37.292 32.635  1.00 30.82 ? 23   DC  C "C3'" 1 
ATOM   453  O  "O3'" . DC  B 2 9   ? 23.659 36.998 33.584  1.00 30.74 ? 23   DC  C "O3'" 1 
ATOM   454  C  "C2'" . DC  B 2 9   ? 22.425 38.811 32.499  1.00 30.57 ? 23   DC  C "C2'" 1 
ATOM   455  C  "C1'" . DC  B 2 9   ? 22.415 39.012 30.982  1.00 31.62 ? 23   DC  C "C1'" 1 
ATOM   456  N  N1    . DC  B 2 9   ? 21.305 39.793 30.376  1.00 32.49 ? 23   DC  C N1    1 
ATOM   457  C  C2    . DC  B 2 9   ? 21.520 41.105 29.927  1.00 32.48 ? 23   DC  C C2    1 
ATOM   458  O  O2    . DC  B 2 9   ? 22.586 41.688 30.108  1.00 31.08 ? 23   DC  C O2    1 
ATOM   459  N  N3    . DC  B 2 9   ? 20.498 41.745 29.346  1.00 32.10 ? 23   DC  C N3    1 
ATOM   460  C  C4    . DC  B 2 9   ? 19.313 41.148 29.172  1.00 31.09 ? 23   DC  C C4    1 
ATOM   461  N  N4    . DC  B 2 9   ? 18.360 41.873 28.576  1.00 30.35 ? 23   DC  C N4    1 
ATOM   462  C  C5    . DC  B 2 9   ? 19.068 39.818 29.620  1.00 33.32 ? 23   DC  C C5    1 
ATOM   463  C  C6    . DC  B 2 9   ? 20.095 39.180 30.208  1.00 32.16 ? 23   DC  C C6    1 
ATOM   464  P  P     . DA  B 2 10  ? 23.488 37.277 35.138  1.00 37.04 ? 24   DA  C P     1 
ATOM   465  O  OP1   . DA  B 2 10  ? 24.595 36.435 35.656  1.00 35.14 ? 24   DA  C OP1   1 
ATOM   466  O  OP2   . DA  B 2 10  ? 22.079 37.136 35.554  1.00 35.12 ? 24   DA  C OP2   1 
ATOM   467  O  "O5'" . DA  B 2 10  ? 23.838 38.815 35.283  1.00 32.99 ? 24   DA  C "O5'" 1 
ATOM   468  C  "C5'" . DA  B 2 10  ? 25.144 39.347 34.998  1.00 34.08 ? 24   DA  C "C5'" 1 
ATOM   469  C  "C4'" . DA  B 2 10  ? 25.111 40.869 35.065  1.00 33.27 ? 24   DA  C "C4'" 1 
ATOM   470  O  "O4'" . DA  B 2 10  ? 24.272 41.419 34.017  1.00 34.16 ? 24   DA  C "O4'" 1 
ATOM   471  C  "C3'" . DA  B 2 10  ? 24.538 41.437 36.387  1.00 35.44 ? 24   DA  C "C3'" 1 
ATOM   472  O  "O3'" . DA  B 2 10  ? 25.634 42.009 37.049  1.00 39.24 ? 24   DA  C "O3'" 1 
ATOM   473  C  "C2'" . DA  B 2 10  ? 23.494 42.474 35.967  1.00 34.38 ? 24   DA  C "C2'" 1 
ATOM   474  C  "C1'" . DA  B 2 10  ? 23.769 42.656 34.446  1.00 30.29 ? 24   DA  C "C1'" 1 
ATOM   475  N  N9    . DA  B 2 10  ? 22.576 42.906 33.634  1.00 32.44 ? 24   DA  C N9    1 
ATOM   476  C  C8    . DA  B 2 10  ? 21.412 42.188 33.608  1.00 30.57 ? 24   DA  C C8    1 
ATOM   477  N  N7    . DA  B 2 10  ? 20.519 42.645 32.770  1.00 32.29 ? 24   DA  C N7    1 
ATOM   478  C  C5    . DA  B 2 10  ? 21.128 43.746 32.223  1.00 29.85 ? 24   DA  C C5    1 
ATOM   479  C  C6    . DA  B 2 10  ? 20.696 44.662 31.269  1.00 28.43 ? 24   DA  C C6    1 
ATOM   480  N  N6    . DA  B 2 10  ? 19.483 44.591 30.702  1.00 30.05 ? 24   DA  C N6    1 
ATOM   481  N  N1    . DA  B 2 10  ? 21.542 45.652 30.929  1.00 29.02 ? 24   DA  C N1    1 
ATOM   482  C  C2    . DA  B 2 10  ? 22.756 45.711 31.500  1.00 29.85 ? 24   DA  C C2    1 
ATOM   483  N  N3    . DA  B 2 10  ? 23.289 44.870 32.413  1.00 27.08 ? 24   DA  C N3    1 
ATOM   484  C  C4    . DA  B 2 10  ? 22.406 43.911 32.724  1.00 29.72 ? 24   DA  C C4    1 
ATOM   485  P  P     . DA  B 2 11  ? 25.543 42.737 38.497  1.00 39.26 ? 25   DA  C P     1 
ATOM   486  O  OP1   . DA  B 2 11  ? 26.903 42.580 39.109  1.00 38.69 ? 25   DA  C OP1   1 
ATOM   487  O  OP2   . DA  B 2 11  ? 24.349 42.190 39.123  1.00 38.00 ? 25   DA  C OP2   1 
ATOM   488  O  "O5'" . DA  B 2 11  ? 25.308 44.241 38.086  1.00 35.94 ? 25   DA  C "O5'" 1 
ATOM   489  C  "C5'" . DA  B 2 11  ? 26.315 44.926 37.346  1.00 41.26 ? 25   DA  C "C5'" 1 
ATOM   490  C  "C4'" . DA  B 2 11  ? 25.838 46.302 36.967  1.00 43.54 ? 25   DA  C "C4'" 1 
ATOM   491  O  "O4'" . DA  B 2 11  ? 24.729 46.117 36.056  1.00 42.57 ? 25   DA  C "O4'" 1 
ATOM   492  C  "C3'" . DA  B 2 11  ? 25.298 47.127 38.141  1.00 46.92 ? 25   DA  C "C3'" 1 
ATOM   493  O  "O3'" . DA  B 2 11  ? 26.030 48.332 38.163  1.00 53.95 ? 25   DA  C "O3'" 1 
ATOM   494  C  "C2'" . DA  B 2 11  ? 23.838 47.422 37.805  1.00 43.43 ? 25   DA  C "C2'" 1 
ATOM   495  C  "C1'" . DA  B 2 11  ? 23.757 47.107 36.305  1.00 40.44 ? 25   DA  C "C1'" 1 
ATOM   496  N  N9    . DA  B 2 11  ? 22.453 46.634 35.804  1.00 39.15 ? 25   DA  C N9    1 
ATOM   497  C  C8    . DA  B 2 11  ? 21.713 45.559 36.199  1.00 37.05 ? 25   DA  C C8    1 
ATOM   498  N  N7    . DA  B 2 11  ? 20.596 45.399 35.535  1.00 36.23 ? 25   DA  C N7    1 
ATOM   499  C  C5    . DA  B 2 11  ? 20.600 46.438 34.624  1.00 37.06 ? 25   DA  C C5    1 
ATOM   500  C  C6    . DA  B 2 11  ? 19.684 46.834 33.637  1.00 35.87 ? 25   DA  C C6    1 
ATOM   501  N  N6    . DA  B 2 11  ? 18.547 46.190 33.393  1.00 37.56 ? 25   DA  C N6    1 
ATOM   502  N  N1    . DA  B 2 11  ? 19.990 47.926 32.910  1.00 38.87 ? 25   DA  C N1    1 
ATOM   503  C  C2    . DA  B 2 11  ? 21.144 48.573 33.149  1.00 38.61 ? 25   DA  C C2    1 
ATOM   504  N  N3    . DA  B 2 11  ? 22.080 48.281 34.050  1.00 38.38 ? 25   DA  C N3    1 
ATOM   505  C  C4    . DA  B 2 11  ? 21.736 47.201 34.760  1.00 37.91 ? 25   DA  C C4    1 
ATOM   506  P  P     . DA  B 2 12  ? 26.019 49.340 39.427  1.00 56.51 ? 26   DA  C P     1 
ATOM   507  O  OP1   . DA  B 2 12  ? 27.453 49.662 39.630  1.00 54.58 ? 26   DA  C OP1   1 
ATOM   508  O  OP2   . DA  B 2 12  ? 25.129 48.869 40.508  1.00 54.95 ? 26   DA  C OP2   1 
ATOM   509  O  "O5'" . DA  B 2 12  ? 25.321 50.602 38.747  1.00 55.06 ? 26   DA  C "O5'" 1 
ATOM   510  C  "C5'" . DA  B 2 12  ? 25.843 51.085 37.514  1.00 56.81 ? 26   DA  C "C5'" 1 
ATOM   511  C  "C4'" . DA  B 2 12  ? 24.751 51.912 36.881  1.00 59.11 ? 26   DA  C "C4'" 1 
ATOM   512  O  "O4'" . DA  B 2 12  ? 23.662 51.015 36.563  1.00 57.54 ? 26   DA  C "O4'" 1 
ATOM   513  C  "C3'" . DA  B 2 12  ? 24.166 52.938 37.848  1.00 60.84 ? 26   DA  C "C3'" 1 
ATOM   514  O  "O3'" . DA  B 2 12  ? 24.247 54.257 37.266  1.00 67.10 ? 26   DA  C "O3'" 1 
ATOM   515  C  "C2'" . DA  B 2 12  ? 22.738 52.446 38.098  1.00 58.18 ? 26   DA  C "C2'" 1 
ATOM   516  C  "C1'" . DA  B 2 12  ? 22.453 51.694 36.795  1.00 52.39 ? 26   DA  C "C1'" 1 
ATOM   517  N  N9    . DA  B 2 12  ? 21.360 50.719 36.836  1.00 49.64 ? 26   DA  C N9    1 
ATOM   518  C  C8    . DA  B 2 12  ? 21.186 49.699 37.724  1.00 47.78 ? 26   DA  C C8    1 
ATOM   519  N  N7    . DA  B 2 12  ? 20.103 48.987 37.495  1.00 48.83 ? 26   DA  C N7    1 
ATOM   520  C  C5    . DA  B 2 12  ? 19.537 49.580 36.367  1.00 47.43 ? 26   DA  C C5    1 
ATOM   521  C  C6    . DA  B 2 12  ? 18.372 49.311 35.614  1.00 48.15 ? 26   DA  C C6    1 
ATOM   522  N  N6    . DA  B 2 12  ? 17.516 48.317 35.877  1.00 46.71 ? 26   DA  C N6    1 
ATOM   523  N  N1    . DA  B 2 12  ? 18.107 50.119 34.568  1.00 48.51 ? 26   DA  C N1    1 
ATOM   524  C  C2    . DA  B 2 12  ? 18.943 51.110 34.275  1.00 48.89 ? 26   DA  C C2    1 
ATOM   525  N  N3    . DA  B 2 12  ? 20.067 51.461 34.905  1.00 47.68 ? 26   DA  C N3    1 
ATOM   526  C  C4    . DA  B 2 12  ? 20.295 50.656 35.960  1.00 48.23 ? 26   DA  C C4    1 
ATOM   527  P  P     . DG  B 2 13  ? 24.184 55.585 38.187  1.00 70.97 ? 27   DG  C P     1 
ATOM   528  O  OP1   . DG  B 2 13  ? 25.325 56.442 37.738  1.00 70.70 ? 27   DG  C OP1   1 
ATOM   529  O  OP2   . DG  B 2 13  ? 24.006 55.178 39.619  1.00 68.87 ? 27   DG  C OP2   1 
ATOM   530  O  "O5'" . DG  B 2 13  ? 22.820 56.285 37.701  1.00 69.33 ? 27   DG  C "O5'" 1 
ATOM   531  C  "C5'" . DG  B 2 13  ? 22.742 56.761 36.355  1.00 68.62 ? 27   DG  C "C5'" 1 
ATOM   532  C  "C4'" . DG  B 2 13  ? 21.298 57.034 36.002  1.00 67.63 ? 27   DG  C "C4'" 1 
ATOM   533  O  "O4'" . DG  B 2 13  ? 20.585 55.773 35.862  1.00 65.90 ? 27   DG  C "O4'" 1 
ATOM   534  C  "C3'" . DG  B 2 13  ? 20.561 57.876 37.051  1.00 69.37 ? 27   DG  C "C3'" 1 
ATOM   535  O  "O3'" . DG  B 2 13  ? 20.022 59.077 36.424  1.00 74.32 ? 27   DG  C "O3'" 1 
ATOM   536  C  "C2'" . DG  B 2 13  ? 19.510 56.920 37.623  1.00 65.86 ? 27   DG  C "C2'" 1 
ATOM   537  C  "C1'" . DG  B 2 13  ? 19.331 55.877 36.512  1.00 59.57 ? 27   DG  C "C1'" 1 
ATOM   538  N  N9    . DG  B 2 13  ? 18.846 54.581 37.010  1.00 57.59 ? 27   DG  C N9    1 
ATOM   539  C  C8    . DG  B 2 13  ? 19.380 53.797 38.008  1.00 56.72 ? 27   DG  C C8    1 
ATOM   540  N  N7    . DG  B 2 13  ? 18.700 52.705 38.241  1.00 56.05 ? 27   DG  C N7    1 
ATOM   541  C  C5    . DG  B 2 13  ? 17.646 52.762 37.343  1.00 55.44 ? 27   DG  C C5    1 
ATOM   542  C  C6    . DG  B 2 13  ? 16.577 51.860 37.129  1.00 54.77 ? 27   DG  C C6    1 
ATOM   543  O  O6    . DG  B 2 13  ? 16.347 50.796 37.705  1.00 55.58 ? 27   DG  C O6    1 
ATOM   544  N  N1    . DG  B 2 13  ? 15.716 52.296 36.135  1.00 55.64 ? 27   DG  C N1    1 
ATOM   545  C  C2    . DG  B 2 13  ? 15.857 53.463 35.422  1.00 55.98 ? 27   DG  C C2    1 
ATOM   546  N  N2    . DG  B 2 13  ? 14.920 53.725 34.497  1.00 56.80 ? 27   DG  C N2    1 
ATOM   547  N  N3    . DG  B 2 13  ? 16.846 54.321 35.604  1.00 55.81 ? 27   DG  C N3    1 
ATOM   548  C  C4    . DG  B 2 13  ? 17.710 53.911 36.583  1.00 56.98 ? 27   DG  C C4    1 
ATOM   549  P  P     . DA  B 2 14  ? 19.011 60.101 37.151  1.00 77.03 ? 28   DA  C P     1 
ATOM   550  O  OP1   . DA  B 2 14  ? 19.214 61.441 36.533  1.00 76.64 ? 28   DA  C OP1   1 
ATOM   551  O  OP2   . DA  B 2 14  ? 19.094 59.899 38.621  1.00 76.48 ? 28   DA  C OP2   1 
ATOM   552  O  "O5'" . DA  B 2 14  ? 17.577 59.567 36.678  1.00 74.85 ? 28   DA  C "O5'" 1 
ATOM   553  C  "C5'" . DA  B 2 14  ? 17.186 59.611 35.291  1.00 72.23 ? 28   DA  C "C5'" 1 
ATOM   554  C  "C4'" . DA  B 2 14  ? 15.688 59.363 35.157  1.00 69.21 ? 28   DA  C "C4'" 1 
ATOM   555  O  "O4'" . DA  B 2 14  ? 15.377 57.975 35.483  1.00 67.60 ? 28   DA  C "O4'" 1 
ATOM   556  C  "C3'" . DA  B 2 14  ? 14.831 60.217 36.092  1.00 68.86 ? 28   DA  C "C3'" 1 
ATOM   557  O  "O3'" . DA  B 2 14  ? 13.575 60.561 35.456  1.00 70.15 ? 28   DA  C "O3'" 1 
ATOM   558  C  "C2'" . DA  B 2 14  ? 14.668 59.308 37.313  1.00 65.74 ? 28   DA  C "C2'" 1 
ATOM   559  C  "C1'" . DA  B 2 14  ? 14.559 57.935 36.643  1.00 61.32 ? 28   DA  C "C1'" 1 
ATOM   560  N  N9    . DA  B 2 14  ? 14.891 56.814 37.538  1.00 58.26 ? 28   DA  C N9    1 
ATOM   561  C  C8    . DA  B 2 14  ? 15.958 56.705 38.386  1.00 57.26 ? 28   DA  C C8    1 
ATOM   562  N  N7    . DA  B 2 14  ? 15.966 55.591 39.085  1.00 57.74 ? 28   DA  C N7    1 
ATOM   563  C  C5    . DA  B 2 14  ? 14.831 54.921 38.656  1.00 56.39 ? 28   DA  C C5    1 
ATOM   564  C  C6    . DA  B 2 14  ? 14.272 53.675 39.019  1.00 56.86 ? 28   DA  C C6    1 
ATOM   565  N  N6    . DA  B 2 14  ? 14.837 52.881 39.927  1.00 54.83 ? 28   DA  C N6    1 
ATOM   566  N  N1    . DA  B 2 14  ? 13.114 53.298 38.417  1.00 56.38 ? 28   DA  C N1    1 
ATOM   567  C  C2    . DA  B 2 14  ? 12.555 54.120 37.508  1.00 57.56 ? 28   DA  C C2    1 
ATOM   568  N  N3    . DA  B 2 14  ? 12.985 55.319 37.083  1.00 55.96 ? 28   DA  C N3    1 
ATOM   569  C  C4    . DA  B 2 14  ? 14.143 55.665 37.708  1.00 56.94 ? 28   DA  C C4    1 
ATOM   570  N  N     . PRO C 3 1   ? 31.990 46.539 21.929  1.00 31.13 ? 1    PRO A N     1 
ATOM   571  C  CA    . PRO C 3 1   ? 32.810 47.316 21.010  1.00 31.20 ? 1    PRO A CA    1 
ATOM   572  C  C     . PRO C 3 1   ? 32.523 47.137 19.511  1.00 29.85 ? 1    PRO A C     1 
ATOM   573  O  O     . PRO C 3 1   ? 31.965 46.115 19.090  1.00 32.07 ? 1    PRO A O     1 
ATOM   574  C  CB    . PRO C 3 1   ? 34.220 46.747 21.267  1.00 33.78 ? 1    PRO A CB    1 
ATOM   575  C  CG    . PRO C 3 1   ? 33.973 45.320 21.804  1.00 32.96 ? 1    PRO A CG    1 
ATOM   576  C  CD    . PRO C 3 1   ? 32.814 45.638 22.753  1.00 33.39 ? 1    PRO A CD    1 
ATOM   577  N  N     . GLU C 3 2   ? 32.979 48.083 18.693  1.00 25.46 ? 2    GLU A N     1 
ATOM   578  C  CA    . GLU C 3 2   ? 32.803 47.992 17.238  1.00 25.86 ? 2    GLU A CA    1 
ATOM   579  C  C     . GLU C 3 2   ? 34.168 47.667 16.616  1.00 24.64 ? 2    GLU A C     1 
ATOM   580  O  O     . GLU C 3 2   ? 35.141 47.460 17.352  1.00 24.42 ? 2    GLU A O     1 
ATOM   581  C  CB    . GLU C 3 2   ? 32.182 49.311 16.683  1.00 24.00 ? 2    GLU A CB    1 
ATOM   582  C  CG    . GLU C 3 2   ? 30.821 49.530 17.374  1.00 26.04 ? 2    GLU A CG    1 
ATOM   583  C  CD    . GLU C 3 2   ? 30.197 50.901 17.149  1.00 27.76 ? 2    GLU A CD    1 
ATOM   584  O  OE1   . GLU C 3 2   ? 30.097 51.384 15.996  1.00 30.12 ? 2    GLU A OE1   1 
ATOM   585  O  OE2   . GLU C 3 2   ? 29.779 51.473 18.155  1.00 32.17 ? 2    GLU A OE2   1 
ATOM   586  N  N     . LEU C 3 3   ? 34.238 47.609 15.293  1.00 23.59 ? 3    LEU A N     1 
ATOM   587  C  CA    . LEU C 3 3   ? 35.516 47.293 14.646  1.00 25.33 ? 3    LEU A CA    1 
ATOM   588  C  C     . LEU C 3 3   ? 36.776 48.055 15.138  1.00 25.85 ? 3    LEU A C     1 
ATOM   589  O  O     . LEU C 3 3   ? 37.778 47.406 15.400  1.00 26.73 ? 3    LEU A O     1 
ATOM   590  C  CB    . LEU C 3 3   ? 35.377 47.313 13.118  1.00 24.28 ? 3    LEU A CB    1 
ATOM   591  C  CG    . LEU C 3 3   ? 36.577 46.941 12.255  1.00 25.01 ? 3    LEU A CG    1 
ATOM   592  C  CD1   . LEU C 3 3   ? 36.071 46.443 10.880  1.00 25.27 ? 3    LEU A CD1   1 
ATOM   593  C  CD2   . LEU C 3 3   ? 37.487 48.140 12.058  1.00 27.32 ? 3    LEU A CD2   1 
ATOM   594  N  N     . PRO C 3 4   ? 36.746 49.428 15.246  1.00 26.31 ? 4    PRO A N     1 
ATOM   595  C  CA    . PRO C 3 4   ? 37.947 50.164 15.711  1.00 25.76 ? 4    PRO A CA    1 
ATOM   596  C  C     . PRO C 3 4   ? 38.495 49.691 17.058  1.00 25.95 ? 4    PRO A C     1 
ATOM   597  O  O     . PRO C 3 4   ? 39.736 49.564 17.229  1.00 24.83 ? 4    PRO A O     1 
ATOM   598  C  CB    . PRO C 3 4   ? 37.456 51.635 15.791  1.00 26.36 ? 4    PRO A CB    1 
ATOM   599  C  CG    . PRO C 3 4   ? 36.372 51.690 14.669  1.00 25.16 ? 4    PRO A CG    1 
ATOM   600  C  CD    . PRO C 3 4   ? 35.651 50.352 14.891  1.00 26.12 ? 4    PRO A CD    1 
ATOM   601  N  N     . GLU C 3 5   ? 37.587 49.461 18.006  1.00 25.00 ? 5    GLU A N     1 
ATOM   602  C  CA    . GLU C 3 5   ? 37.956 49.015 19.346  1.00 26.04 ? 5    GLU A CA    1 
ATOM   603  C  C     . GLU C 3 5   ? 38.521 47.579 19.310  1.00 25.78 ? 5    GLU A C     1 
ATOM   604  O  O     . GLU C 3 5   ? 39.502 47.263 20.006  1.00 24.45 ? 5    GLU A O     1 
ATOM   605  C  CB    . GLU C 3 5   ? 36.726 49.090 20.261  1.00 25.90 ? 5    GLU A CB    1 
ATOM   606  C  CG    . GLU C 3 5   ? 36.273 50.521 20.603  1.00 26.35 ? 5    GLU A CG    1 
ATOM   607  C  CD    . GLU C 3 5   ? 35.598 51.244 19.447  1.00 29.01 ? 5    GLU A CD    1 
ATOM   608  O  OE1   . GLU C 3 5   ? 34.945 50.573 18.590  1.00 30.32 ? 5    GLU A OE1   1 
ATOM   609  O  OE2   . GLU C 3 5   ? 35.714 52.485 19.365  1.00 28.31 ? 5    GLU A OE2   1 
ATOM   610  N  N     . VAL C 3 6   ? 37.876 46.709 18.519  1.00 24.63 ? 6    VAL A N     1 
ATOM   611  C  CA    . VAL C 3 6   ? 38.367 45.320 18.379  1.00 23.84 ? 6    VAL A CA    1 
ATOM   612  C  C     . VAL C 3 6   ? 39.757 45.292 17.704  1.00 24.47 ? 6    VAL A C     1 
ATOM   613  O  O     . VAL C 3 6   ? 40.683 44.551 18.134  1.00 22.85 ? 6    VAL A O     1 
ATOM   614  C  CB    . VAL C 3 6   ? 37.357 44.409 17.618  1.00 24.27 ? 6    VAL A CB    1 
ATOM   615  C  CG1   . VAL C 3 6   ? 37.930 42.958 17.492  1.00 22.70 ? 6    VAL A CG1   1 
ATOM   616  C  CG2   . VAL C 3 6   ? 36.028 44.359 18.413  1.00 21.58 ? 6    VAL A CG2   1 
ATOM   617  N  N     . GLU C 3 7   ? 39.932 46.126 16.682  1.00 23.25 ? 7    GLU A N     1 
ATOM   618  C  CA    . GLU C 3 7   ? 41.269 46.225 16.038  1.00 24.88 ? 7    GLU A CA    1 
ATOM   619  C  C     . GLU C 3 7   ? 42.349 46.694 17.008  1.00 25.03 ? 7    GLU A C     1 
ATOM   620  O  O     . GLU C 3 7   ? 43.480 46.199 16.986  1.00 25.58 ? 7    GLU A O     1 
ATOM   621  C  CB    . GLU C 3 7   ? 41.191 47.165 14.813  1.00 23.68 ? 7    GLU A CB    1 
ATOM   622  C  CG    . GLU C 3 7   ? 42.530 47.360 14.008  1.00 25.38 ? 7    GLU A CG    1 
ATOM   623  C  CD    . GLU C 3 7   ? 43.197 46.082 13.525  1.00 27.26 ? 7    GLU A CD    1 
ATOM   624  O  OE1   . GLU C 3 7   ? 42.493 45.066 13.267  1.00 26.39 ? 7    GLU A OE1   1 
ATOM   625  O  OE2   . GLU C 3 7   ? 44.462 46.122 13.377  1.00 28.30 ? 7    GLU A OE2   1 
ATOM   626  N  N     . THR C 3 8   ? 42.007 47.634 17.880  1.00 24.09 ? 8    THR A N     1 
ATOM   627  C  CA    . THR C 3 8   ? 42.982 48.160 18.843  1.00 25.90 ? 8    THR A CA    1 
ATOM   628  C  C     . THR C 3 8   ? 43.412 47.055 19.792  1.00 25.66 ? 8    THR A C     1 
ATOM   629  O  O     . THR C 3 8   ? 44.606 46.917 20.122  1.00 27.36 ? 8    THR A O     1 
ATOM   630  C  CB    . THR C 3 8   ? 42.323 49.321 19.654  1.00 25.05 ? 8    THR A CB    1 
ATOM   631  O  OG1   . THR C 3 8   ? 41.927 50.330 18.723  1.00 27.31 ? 8    THR A OG1   1 
ATOM   632  C  CG2   . THR C 3 8   ? 43.317 50.003 20.650  1.00 27.58 ? 8    THR A CG2   1 
ATOM   633  N  N     . VAL C 3 9   ? 42.429 46.316 20.297  1.00 25.34 ? 9    VAL A N     1 
ATOM   634  C  CA    . VAL C 3 9   ? 42.706 45.148 21.142  1.00 26.07 ? 9    VAL A CA    1 
ATOM   635  C  C     . VAL C 3 9   ? 43.578 44.137 20.356  1.00 25.66 ? 9    VAL A C     1 
ATOM   636  O  O     . VAL C 3 9   ? 44.583 43.634 20.892  1.00 27.80 ? 9    VAL A O     1 
ATOM   637  C  CB    . VAL C 3 9   ? 41.402 44.498 21.625  1.00 25.27 ? 9    VAL A CB    1 
ATOM   638  C  CG1   . VAL C 3 9   ? 41.643 43.082 22.310  1.00 27.23 ? 9    VAL A CG1   1 
ATOM   639  C  CG2   . VAL C 3 9   ? 40.677 45.437 22.628  1.00 26.87 ? 9    VAL A CG2   1 
ATOM   640  N  N     . ARG C 3 10  ? 43.198 43.830 19.115  1.00 25.17 ? 10   ARG A N     1 
ATOM   641  C  CA    . ARG C 3 10  ? 43.989 42.916 18.271  1.00 26.00 ? 10   ARG A CA    1 
ATOM   642  C  C     . ARG C 3 10  ? 45.460 43.349 18.202  1.00 28.50 ? 10   ARG A C     1 
ATOM   643  O  O     . ARG C 3 10  ? 46.392 42.511 18.341  1.00 29.15 ? 10   ARG A O     1 
ATOM   644  C  CB    . ARG C 3 10  ? 43.433 42.820 16.833  1.00 25.94 ? 10   ARG A CB    1 
ATOM   645  C  CG    . ARG C 3 10  ? 44.106 41.707 15.978  1.00 25.46 ? 10   ARG A CG    1 
ATOM   646  C  CD    . ARG C 3 10  ? 44.079 42.063 14.475  1.00 27.47 ? 10   ARG A CD    1 
ATOM   647  N  NE    . ARG C 3 10  ? 44.957 43.189 14.140  1.00 28.54 ? 10   ARG A NE    1 
ATOM   648  C  CZ    . ARG C 3 10  ? 46.285 43.119 14.005  1.00 33.52 ? 10   ARG A CZ    1 
ATOM   649  N  NH1   . ARG C 3 10  ? 46.937 41.972 14.175  1.00 30.63 ? 10   ARG A NH1   1 
ATOM   650  N  NH2   . ARG C 3 10  ? 46.971 44.216 13.686  1.00 32.81 ? 10   ARG A NH2   1 
ATOM   651  N  N     . ARG C 3 11  ? 45.691 44.643 17.948  1.00 29.20 ? 11   ARG A N     1 
ATOM   652  C  CA    . ARG C 3 11  ? 47.060 45.126 17.780  1.00 31.86 ? 11   ARG A CA    1 
ATOM   653  C  C     . ARG C 3 11  ? 47.873 44.976 19.065  1.00 32.54 ? 11   ARG A C     1 
ATOM   654  O  O     . ARG C 3 11  ? 49.044 44.562 19.017  1.00 33.02 ? 11   ARG A O     1 
ATOM   655  C  CB    . ARG C 3 11  ? 47.073 46.589 17.310  1.00 31.61 ? 11   ARG A CB    1 
ATOM   656  C  CG    . ARG C 3 11  ? 46.648 46.716 15.871  1.00 32.54 ? 11   ARG A CG    1 
ATOM   657  C  CD    . ARG C 3 11  ? 46.462 48.213 15.427  1.00 33.33 ? 11   ARG A CD    1 
ATOM   658  N  NE    . ARG C 3 11  ? 46.020 48.235 14.026  1.00 34.42 ? 11   ARG A NE    1 
ATOM   659  C  CZ    . ARG C 3 11  ? 46.031 49.314 13.242  1.00 38.29 ? 11   ARG A CZ    1 
ATOM   660  N  NH1   . ARG C 3 11  ? 46.464 50.485 13.720  1.00 37.37 ? 11   ARG A NH1   1 
ATOM   661  N  NH2   . ARG C 3 11  ? 45.615 49.216 11.975  1.00 35.43 ? 11   ARG A NH2   1 
ATOM   662  N  N     . GLU C 3 12  ? 47.267 45.313 20.196  1.00 32.41 ? 12   GLU A N     1 
ATOM   663  C  CA    . GLU C 3 12  ? 47.942 45.209 21.489  1.00 35.79 ? 12   GLU A CA    1 
ATOM   664  C  C     . GLU C 3 12  ? 48.277 43.742 21.842  1.00 33.86 ? 12   GLU A C     1 
ATOM   665  O  O     . GLU C 3 12  ? 49.388 43.458 22.299  1.00 33.90 ? 12   GLU A O     1 
ATOM   666  C  CB    . GLU C 3 12  ? 47.096 45.840 22.621  1.00 35.31 ? 12   GLU A CB    1 
ATOM   667  C  CG    . GLU C 3 12  ? 46.716 47.324 22.396  1.00 41.13 ? 12   GLU A CG    1 
ATOM   668  C  CD    . GLU C 3 12  ? 46.205 48.023 23.664  1.00 43.25 ? 12   GLU A CD    1 
ATOM   669  O  OE1   . GLU C 3 12  ? 45.895 47.312 24.644  1.00 53.12 ? 12   GLU A OE1   1 
ATOM   670  O  OE2   . GLU C 3 12  ? 46.133 49.283 23.717  1.00 52.09 ? 12   GLU A OE2   1 
ATOM   671  N  N     . LEU C 3 13  ? 47.334 42.822 21.616  1.00 32.53 ? 13   LEU A N     1 
ATOM   672  C  CA    . LEU C 3 13  ? 47.603 41.379 21.827  1.00 32.41 ? 13   LEU A CA    1 
ATOM   673  C  C     . LEU C 3 13  ? 48.729 40.867 20.914  1.00 33.54 ? 13   LEU A C     1 
ATOM   674  O  O     . LEU C 3 13  ? 49.621 40.095 21.353  1.00 34.30 ? 13   LEU A O     1 
ATOM   675  C  CB    . LEU C 3 13  ? 46.326 40.540 21.640  1.00 30.41 ? 13   LEU A CB    1 
ATOM   676  C  CG    . LEU C 3 13  ? 45.232 40.752 22.702  1.00 33.55 ? 13   LEU A CG    1 
ATOM   677  C  CD1   . LEU C 3 13  ? 43.952 39.994 22.275  1.00 29.52 ? 13   LEU A CD1   1 
ATOM   678  C  CD2   . LEU C 3 13  ? 45.692 40.283 24.115  1.00 34.69 ? 13   LEU A CD2   1 
ATOM   679  N  N     . GLU C 3 14  ? 48.719 41.308 19.662  1.00 33.25 ? 14   GLU A N     1 
ATOM   680  C  CA    . GLU C 3 14  ? 49.740 40.900 18.710  1.00 34.40 ? 14   GLU A CA    1 
ATOM   681  C  C     . GLU C 3 14  ? 51.128 41.259 19.260  1.00 35.40 ? 14   GLU A C     1 
ATOM   682  O  O     . GLU C 3 14  ? 52.068 40.441 19.212  1.00 35.24 ? 14   GLU A O     1 
ATOM   683  C  CB    . GLU C 3 14  ? 49.545 41.634 17.397  1.00 34.71 ? 14   GLU A CB    1 
ATOM   684  C  CG    . GLU C 3 14  ? 50.503 41.176 16.340  1.00 35.67 ? 14   GLU A CG    1 
ATOM   685  C  CD    . GLU C 3 14  ? 50.168 41.791 14.996  1.00 38.77 ? 14   GLU A CD    1 
ATOM   686  O  OE1   . GLU C 3 14  ? 50.511 42.976 14.805  1.00 40.00 ? 14   GLU A OE1   1 
ATOM   687  O  OE2   . GLU C 3 14  ? 49.558 41.073 14.155  1.00 38.56 ? 14   GLU A OE2   1 
ATOM   688  N  N     . LYS C 3 15  ? 51.234 42.478 19.771  1.00 34.94 ? 15   LYS A N     1 
ATOM   689  C  CA    . LYS C 3 15  ? 52.490 42.992 20.264  1.00 36.78 ? 15   LYS A CA    1 
ATOM   690  C  C     . LYS C 3 15  ? 52.943 42.202 21.490  1.00 36.60 ? 15   LYS A C     1 
ATOM   691  O  O     . LYS C 3 15  ? 54.146 41.934 21.662  1.00 38.90 ? 15   LYS A O     1 
ATOM   692  C  CB    . LYS C 3 15  ? 52.350 44.506 20.513  1.00 37.06 ? 15   LYS A CB    1 
ATOM   693  C  CG    . LYS C 3 15  ? 53.468 45.151 21.334  1.00 40.57 ? 15   LYS A CG    1 
ATOM   694  N  N     . ARG C 3 16  ? 52.000 41.771 22.318  1.00 35.64 ? 16   ARG A N     1 
ATOM   695  C  CA    . ARG C 3 16  ? 52.350 41.227 23.615  1.00 35.53 ? 16   ARG A CA    1 
ATOM   696  C  C     . ARG C 3 16  ? 52.311 39.724 23.835  1.00 34.80 ? 16   ARG A C     1 
ATOM   697  O  O     . ARG C 3 16  ? 53.106 39.216 24.653  1.00 32.76 ? 16   ARG A O     1 
ATOM   698  C  CB    . ARG C 3 16  ? 51.539 41.930 24.701  1.00 36.03 ? 16   ARG A CB    1 
ATOM   699  C  CG    . ARG C 3 16  ? 52.220 43.317 24.959  1.00 39.70 ? 16   ARG A CG    1 
ATOM   700  C  CD    . ARG C 3 16  ? 51.446 44.208 25.847  1.00 40.19 ? 16   ARG A CD    1 
ATOM   701  N  NE    . ARG C 3 16  ? 51.535 43.826 27.242  1.00 36.71 ? 16   ARG A NE    1 
ATOM   702  C  CZ    . ARG C 3 16  ? 50.748 44.368 28.162  1.00 36.94 ? 16   ARG A CZ    1 
ATOM   703  N  NH1   . ARG C 3 16  ? 49.880 45.297 27.789  1.00 34.94 ? 16   ARG A NH1   1 
ATOM   704  N  NH2   . ARG C 3 16  ? 50.820 43.999 29.426  1.00 34.79 ? 16   ARG A NH2   1 
ATOM   705  N  N     . ILE C 3 17  ? 51.381 39.000 23.192  1.00 32.23 ? 17   ILE A N     1 
ATOM   706  C  CA    . ILE C 3 17  ? 51.251 37.567 23.527  1.00 32.38 ? 17   ILE A CA    1 
ATOM   707  C  C     . ILE C 3 17  ? 51.730 36.610 22.417  1.00 32.97 ? 17   ILE A C     1 
ATOM   708  O  O     . ILE C 3 17  ? 51.747 35.391 22.621  1.00 33.55 ? 17   ILE A O     1 
ATOM   709  C  CB    . ILE C 3 17  ? 49.817 37.192 24.006  1.00 31.91 ? 17   ILE A CB    1 
ATOM   710  C  CG1   . ILE C 3 17  ? 48.812 37.300 22.836  1.00 31.89 ? 17   ILE A CG1   1 
ATOM   711  C  CG2   . ILE C 3 17  ? 49.378 38.083 25.155  1.00 30.96 ? 17   ILE A CG2   1 
ATOM   712  C  CD1   . ILE C 3 17  ? 47.423 36.752 23.168  1.00 32.69 ? 17   ILE A CD1   1 
ATOM   713  N  N     . VAL C 3 18  ? 52.098 37.146 21.267  1.00 32.94 ? 18   VAL A N     1 
ATOM   714  C  CA    . VAL C 3 18  ? 52.557 36.274 20.175  1.00 34.08 ? 18   VAL A CA    1 
ATOM   715  C  C     . VAL C 3 18  ? 53.893 35.643 20.605  1.00 34.71 ? 18   VAL A C     1 
ATOM   716  O  O     . VAL C 3 18  ? 54.782 36.337 21.125  1.00 33.73 ? 18   VAL A O     1 
ATOM   717  C  CB    . VAL C 3 18  ? 52.638 37.008 18.811  1.00 34.43 ? 18   VAL A CB    1 
ATOM   718  C  CG1   . VAL C 3 18  ? 53.428 36.184 17.745  1.00 34.87 ? 18   VAL A CG1   1 
ATOM   719  C  CG2   . VAL C 3 18  ? 51.193 37.312 18.281  1.00 32.16 ? 18   VAL A CG2   1 
ATOM   720  N  N     . GLY C 3 19  ? 54.007 34.328 20.420  1.00 34.94 ? 19   GLY A N     1 
ATOM   721  C  CA    . GLY C 3 19  ? 55.159 33.591 20.927  1.00 36.07 ? 19   GLY A CA    1 
ATOM   722  C  C     . GLY C 3 19  ? 54.989 32.959 22.304  1.00 36.67 ? 19   GLY A C     1 
ATOM   723  O  O     . GLY C 3 19  ? 55.889 32.208 22.756  1.00 36.20 ? 19   GLY A O     1 
ATOM   724  N  N     . GLN C 3 20  ? 53.854 33.207 22.984  1.00 35.66 ? 20   GLN A N     1 
ATOM   725  C  CA    . GLN C 3 20  ? 53.658 32.688 24.348  1.00 36.57 ? 20   GLN A CA    1 
ATOM   726  C  C     . GLN C 3 20  ? 53.053 31.299 24.345  1.00 36.46 ? 20   GLN A C     1 
ATOM   727  O  O     . GLN C 3 20  ? 52.039 31.058 23.680  1.00 35.07 ? 20   GLN A O     1 
ATOM   728  C  CB    . GLN C 3 20  ? 52.691 33.567 25.168  1.00 37.03 ? 20   GLN A CB    1 
ATOM   729  C  CG    . GLN C 3 20  ? 53.153 34.960 25.404  1.00 40.70 ? 20   GLN A CG    1 
ATOM   730  C  CD    . GLN C 3 20  ? 54.212 34.995 26.442  1.00 48.19 ? 20   GLN A CD    1 
ATOM   731  O  OE1   . GLN C 3 20  ? 53.980 34.608 27.585  1.00 48.83 ? 20   GLN A OE1   1 
ATOM   732  N  NE2   . GLN C 3 20  ? 55.406 35.438 26.055  1.00 50.43 ? 20   GLN A NE2   1 
ATOM   733  N  N     . LYS C 3 21  ? 53.637 30.414 25.143  1.00 35.32 ? 21   LYS A N     1 
ATOM   734  C  CA    . LYS C 3 21  ? 53.097 29.086 25.361  1.00 34.97 ? 21   LYS A CA    1 
ATOM   735  C  C     . LYS C 3 21  ? 52.007 29.195 26.419  1.00 33.22 ? 21   LYS A C     1 
ATOM   736  O  O     . LYS C 3 21  ? 52.206 29.788 27.470  1.00 32.08 ? 21   LYS A O     1 
ATOM   737  C  CB    . LYS C 3 21  ? 54.227 28.155 25.845  1.00 35.30 ? 21   LYS A CB    1 
ATOM   738  C  CG    . LYS C 3 21  ? 53.839 26.683 25.982  1.00 39.12 ? 21   LYS A CG    1 
ATOM   739  C  CD    . LYS C 3 21  ? 55.065 25.780 26.331  1.00 39.62 ? 21   LYS A CD    1 
ATOM   740  C  CE    . LYS C 3 21  ? 54.588 24.387 26.699  1.00 47.93 ? 21   LYS A CE    1 
ATOM   741  N  NZ    . LYS C 3 21  ? 53.866 24.365 28.037  1.00 53.43 ? 21   LYS A NZ    1 
ATOM   742  N  N     . ILE C 3 22  ? 50.843 28.618 26.138  1.00 32.11 ? 22   ILE A N     1 
ATOM   743  C  CA    . ILE C 3 22  ? 49.744 28.570 27.073  1.00 31.17 ? 22   ILE A CA    1 
ATOM   744  C  C     . ILE C 3 22  ? 50.057 27.453 28.079  1.00 33.54 ? 22   ILE A C     1 
ATOM   745  O  O     . ILE C 3 22  ? 50.149 26.281 27.689  1.00 33.05 ? 22   ILE A O     1 
ATOM   746  C  CB    . ILE C 3 22  ? 48.388 28.244 26.320  1.00 30.77 ? 22   ILE A CB    1 
ATOM   747  C  CG1   . ILE C 3 22  ? 48.058 29.351 25.296  1.00 30.27 ? 22   ILE A CG1   1 
ATOM   748  C  CG2   . ILE C 3 22  ? 47.249 28.048 27.323  1.00 31.78 ? 22   ILE A CG2   1 
ATOM   749  C  CD1   . ILE C 3 22  ? 46.914 29.018 24.307  1.00 30.63 ? 22   ILE A CD1   1 
ATOM   750  N  N     . ILE C 3 23  ? 50.253 27.802 29.356  1.00 33.84 ? 23   ILE A N     1 
ATOM   751  C  CA    . ILE C 3 23  ? 50.545 26.784 30.396  1.00 34.41 ? 23   ILE A CA    1 
ATOM   752  C  C     . ILE C 3 23  ? 49.291 26.071 30.910  1.00 33.99 ? 23   ILE A C     1 
ATOM   753  O  O     . ILE C 3 23  ? 49.273 24.841 31.104  1.00 34.97 ? 23   ILE A O     1 
ATOM   754  C  CB    . ILE C 3 23  ? 51.357 27.394 31.586  1.00 34.51 ? 23   ILE A CB    1 
ATOM   755  C  CG1   . ILE C 3 23  ? 52.593 28.150 31.092  1.00 35.81 ? 23   ILE A CG1   1 
ATOM   756  C  CG2   . ILE C 3 23  ? 51.656 26.321 32.705  1.00 35.75 ? 23   ILE A CG2   1 
ATOM   757  C  CD1   . ILE C 3 23  ? 53.620 27.377 30.232  1.00 42.38 ? 23   ILE A CD1   1 
ATOM   758  N  N     . SER C 3 24  ? 48.236 26.839 31.154  1.00 33.21 ? 24   SER A N     1 
ATOM   759  C  CA    . SER C 3 24  ? 46.947 26.309 31.551  1.00 32.65 ? 24   SER A CA    1 
ATOM   760  C  C     . SER C 3 24  ? 45.856 27.281 31.154  1.00 32.73 ? 24   SER A C     1 
ATOM   761  O  O     . SER C 3 24  ? 46.138 28.451 30.806  1.00 30.32 ? 24   SER A O     1 
ATOM   762  C  CB    . SER C 3 24  ? 46.859 26.018 33.047  1.00 32.77 ? 24   SER A CB    1 
ATOM   763  O  OG    . SER C 3 24  ? 46.949 27.200 33.818  1.00 35.12 ? 24   SER A OG    1 
ATOM   764  N  N     . ILE C 3 25  ? 44.626 26.764 31.184  1.00 32.02 ? 25   ILE A N     1 
ATOM   765  C  CA    . ILE C 3 25  ? 43.418 27.531 30.880  1.00 33.51 ? 25   ILE A CA    1 
ATOM   766  C  C     . ILE C 3 25  ? 42.389 27.194 31.928  1.00 32.74 ? 25   ILE A C     1 
ATOM   767  O  O     . ILE C 3 25  ? 42.207 26.003 32.240  1.00 33.73 ? 25   ILE A O     1 
ATOM   768  C  CB    . ILE C 3 25  ? 42.875 27.181 29.468  1.00 33.12 ? 25   ILE A CB    1 
ATOM   769  C  CG1   . ILE C 3 25  ? 43.992 27.418 28.427  1.00 35.42 ? 25   ILE A CG1   1 
ATOM   770  C  CG2   . ILE C 3 25  ? 41.601 28.018 29.153  1.00 35.27 ? 25   ILE A CG2   1 
ATOM   771  C  CD1   . ILE C 3 25  ? 43.755 26.780 27.048  1.00 33.93 ? 25   ILE A CD1   1 
ATOM   772  N  N     . GLU C 3 26  ? 41.751 28.210 32.516  1.00 32.51 ? 26   GLU A N     1 
ATOM   773  C  CA    . GLU C 3 26  ? 40.708 28.009 33.553  1.00 32.89 ? 26   GLU A CA    1 
ATOM   774  C  C     . GLU C 3 26  ? 39.429 28.804 33.220  1.00 32.20 ? 26   GLU A C     1 
ATOM   775  O  O     . GLU C 3 26  ? 39.516 29.859 32.598  1.00 31.99 ? 26   GLU A O     1 
ATOM   776  C  CB    . GLU C 3 26  ? 41.217 28.460 34.954  1.00 32.37 ? 26   GLU A CB    1 
ATOM   777  C  CG    . GLU C 3 26  ? 42.590 27.895 35.340  1.00 35.63 ? 26   GLU A CG    1 
ATOM   778  C  CD    . GLU C 3 26  ? 43.099 28.414 36.717  1.00 39.58 ? 26   GLU A CD    1 
ATOM   779  O  OE1   . GLU C 3 26  ? 42.474 29.345 37.350  1.00 46.29 ? 26   GLU A OE1   1 
ATOM   780  O  OE2   . GLU C 3 26  ? 44.134 27.867 37.167  1.00 45.95 ? 26   GLU A OE2   1 
ATOM   781  N  N     . ALA C 3 27  ? 38.269 28.320 33.679  1.00 30.68 ? 27   ALA A N     1 
ATOM   782  C  CA    . ALA C 3 27  ? 36.968 28.970 33.463  1.00 30.70 ? 27   ALA A CA    1 
ATOM   783  C  C     . ALA C 3 27  ? 36.193 28.987 34.737  1.00 31.78 ? 27   ALA A C     1 
ATOM   784  O  O     . ALA C 3 27  ? 36.150 27.988 35.450  1.00 31.76 ? 27   ALA A O     1 
ATOM   785  C  CB    . ALA C 3 27  ? 36.126 28.229 32.409  1.00 31.20 ? 27   ALA A CB    1 
ATOM   786  N  N     . THR C 3 28  ? 35.550 30.106 35.018  1.00 31.18 ? 28   THR A N     1 
ATOM   787  C  CA    . THR C 3 28  ? 34.524 30.117 36.035  1.00 30.73 ? 28   THR A CA    1 
ATOM   788  C  C     . THR C 3 28  ? 33.183 30.173 35.337  1.00 31.39 ? 28   THR A C     1 
ATOM   789  O  O     . THR C 3 28  ? 32.166 29.893 35.955  1.00 30.46 ? 28   THR A O     1 
ATOM   790  C  CB    . THR C 3 28  ? 34.672 31.293 37.013  1.00 31.94 ? 28   THR A CB    1 
ATOM   791  O  OG1   . THR C 3 28  ? 34.752 32.513 36.282  1.00 31.06 ? 28   THR A OG1   1 
ATOM   792  C  CG2   . THR C 3 28  ? 35.919 31.132 37.838  1.00 29.40 ? 28   THR A CG2   1 
ATOM   793  N  N     . TYR C 3 29  ? 33.202 30.517 34.041  1.00 29.62 ? 29   TYR A N     1 
ATOM   794  C  CA    . TYR C 3 29  ? 32.000 30.514 33.207  1.00 30.24 ? 29   TYR A CA    1 
ATOM   795  C  C     . TYR C 3 29  ? 32.237 29.707 31.904  1.00 30.59 ? 29   TYR A C     1 
ATOM   796  O  O     . TYR C 3 29  ? 32.291 30.264 30.787  1.00 28.80 ? 29   TYR A O     1 
ATOM   797  C  CB    . TYR C 3 29  ? 31.519 31.941 32.908  1.00 31.09 ? 29   TYR A CB    1 
ATOM   798  C  CG    . TYR C 3 29  ? 30.136 31.999 32.278  1.00 32.99 ? 29   TYR A CG    1 
ATOM   799  C  CD1   . TYR C 3 29  ? 29.013 31.481 32.931  1.00 35.28 ? 29   TYR A CD1   1 
ATOM   800  C  CD2   . TYR C 3 29  ? 29.961 32.603 31.044  1.00 33.79 ? 29   TYR A CD2   1 
ATOM   801  C  CE1   . TYR C 3 29  ? 27.758 31.521 32.325  1.00 37.75 ? 29   TYR A CE1   1 
ATOM   802  C  CE2   . TYR C 3 29  ? 28.728 32.672 30.434  1.00 35.71 ? 29   TYR A CE2   1 
ATOM   803  C  CZ    . TYR C 3 29  ? 27.645 32.133 31.054  1.00 37.56 ? 29   TYR A CZ    1 
ATOM   804  O  OH    . TYR C 3 29  ? 26.444 32.249 30.413  1.00 39.03 ? 29   TYR A OH    1 
ATOM   805  N  N     . PRO C 3 30  ? 32.397 28.380 32.047  1.00 29.46 ? 30   PRO A N     1 
ATOM   806  C  CA    . PRO C 3 30  ? 32.692 27.548 30.894  1.00 29.77 ? 30   PRO A CA    1 
ATOM   807  C  C     . PRO C 3 30  ? 31.626 27.521 29.775  1.00 30.05 ? 30   PRO A C     1 
ATOM   808  O  O     . PRO C 3 30  ? 32.008 27.269 28.624  1.00 29.55 ? 30   PRO A O     1 
ATOM   809  C  CB    . PRO C 3 30  ? 32.887 26.143 31.512  1.00 30.34 ? 30   PRO A CB    1 
ATOM   810  C  CG    . PRO C 3 30  ? 32.068 26.178 32.803  1.00 31.22 ? 30   PRO A CG    1 
ATOM   811  C  CD    . PRO C 3 30  ? 32.329 27.580 33.302  1.00 29.78 ? 30   PRO A CD    1 
ATOM   812  N  N     . ARG C 3 31  ? 30.370 27.824 30.084  1.00 28.16 ? 31   ARG A N     1 
ATOM   813  C  CA    . ARG C 3 31  ? 29.296 27.833 29.103  1.00 31.08 ? 31   ARG A CA    1 
ATOM   814  C  C     . ARG C 3 31  ? 29.396 28.882 27.947  1.00 29.56 ? 31   ARG A C     1 
ATOM   815  O  O     . ARG C 3 31  ? 28.680 28.772 26.957  1.00 28.46 ? 31   ARG A O     1 
ATOM   816  C  CB    . ARG C 3 31  ? 27.954 27.984 29.795  1.00 30.70 ? 31   ARG A CB    1 
ATOM   817  C  CG    . ARG C 3 31  ? 27.516 26.694 30.559  1.00 36.29 ? 31   ARG A CG    1 
ATOM   818  C  CD    . ARG C 3 31  ? 26.007 26.668 30.857  1.00 36.95 ? 31   ARG A CD    1 
ATOM   819  N  NE    . ARG C 3 31  ? 25.548 27.749 31.740  1.00 45.95 ? 31   ARG A NE    1 
ATOM   820  N  N     . MET C 3 32  ? 30.251 29.900 28.097  1.00 27.15 ? 32   MET A N     1 
ATOM   821  C  CA    . MET C 3 32  ? 30.506 30.851 26.972  1.00 25.20 ? 32   MET A CA    1 
ATOM   822  C  C     . MET C 3 32  ? 31.457 30.274 25.907  1.00 25.71 ? 32   MET A C     1 
ATOM   823  O  O     . MET C 3 32  ? 31.663 30.918 24.856  1.00 24.41 ? 32   MET A O     1 
ATOM   824  C  CB    . MET C 3 32  ? 31.055 32.198 27.512  1.00 25.83 ? 32   MET A CB    1 
ATOM   825  C  CG    . MET C 3 32  ? 32.497 32.085 28.097  1.00 25.64 ? 32   MET A CG    1 
ATOM   826  S  SD    . MET C 3 32  ? 33.253 33.797 28.182  1.00 25.22 ? 32   MET A SD    1 
ATOM   827  C  CE    . MET C 3 32  ? 33.603 34.133 26.405  1.00 23.76 ? 32   MET A CE    1 
ATOM   828  N  N     . VAL C 3 33  ? 32.059 29.089 26.165  1.00 23.42 ? 33   VAL A N     1 
ATOM   829  C  CA    . VAL C 3 33  ? 32.805 28.406 25.111  1.00 24.88 ? 33   VAL A CA    1 
ATOM   830  C  C     . VAL C 3 33  ? 31.863 27.501 24.299  1.00 25.61 ? 33   VAL A C     1 
ATOM   831  O  O     . VAL C 3 33  ? 31.519 26.386 24.764  1.00 26.44 ? 33   VAL A O     1 
ATOM   832  C  CB    . VAL C 3 33  ? 34.032 27.607 25.674  1.00 24.27 ? 33   VAL A CB    1 
ATOM   833  C  CG1   . VAL C 3 33  ? 34.852 26.978 24.507  1.00 22.50 ? 33   VAL A CG1   1 
ATOM   834  C  CG2   . VAL C 3 33  ? 34.922 28.581 26.530  1.00 26.07 ? 33   VAL A CG2   1 
ATOM   835  N  N     . LEU C 3 34  ? 31.444 27.981 23.139  1.00 25.74 ? 34   LEU A N     1 
ATOM   836  C  CA    . LEU C 3 34  ? 30.301 27.382 22.411  1.00 27.24 ? 34   LEU A CA    1 
ATOM   837  C  C     . LEU C 3 34  ? 30.625 26.002 21.820  1.00 27.64 ? 34   LEU A C     1 
ATOM   838  O  O     . LEU C 3 34  ? 29.713 25.215 21.576  1.00 27.85 ? 34   LEU A O     1 
ATOM   839  C  CB    . LEU C 3 34  ? 29.693 28.329 21.336  1.00 25.96 ? 34   LEU A CB    1 
ATOM   840  C  CG    . LEU C 3 34  ? 29.260 29.746 21.810  1.00 28.84 ? 34   LEU A CG    1 
ATOM   841  C  CD1   . LEU C 3 34  ? 28.546 30.445 20.682  1.00 27.78 ? 34   LEU A CD1   1 
ATOM   842  C  CD2   . LEU C 3 34  ? 28.330 29.717 23.066  1.00 31.90 ? 34   LEU A CD2   1 
ATOM   843  N  N     . THR C 3 35  ? 31.918 25.725 21.669  1.00 27.00 ? 35   THR A N     1 
ATOM   844  C  CA    . THR C 3 35  ? 32.406 24.479 21.183  1.00 27.38 ? 35   THR A CA    1 
ATOM   845  C  C     . THR C 3 35  ? 32.763 23.478 22.301  1.00 28.59 ? 35   THR A C     1 
ATOM   846  O  O     . THR C 3 35  ? 33.154 22.388 22.000  1.00 29.05 ? 35   THR A O     1 
ATOM   847  C  CB    . THR C 3 35  ? 33.600 24.699 20.226  1.00 27.53 ? 35   THR A CB    1 
ATOM   848  O  OG1   . THR C 3 35  ? 34.607 25.516 20.867  1.00 28.75 ? 35   THR A OG1   1 
ATOM   849  C  CG2   . THR C 3 35  ? 33.118 25.361 18.888  1.00 27.62 ? 35   THR A CG2   1 
ATOM   850  N  N     . GLY C 3 36  ? 32.592 23.856 23.564  1.00 27.96 ? 36   GLY A N     1 
ATOM   851  C  CA    . GLY C 3 36  ? 32.936 23.002 24.698  1.00 28.22 ? 36   GLY A CA    1 
ATOM   852  C  C     . GLY C 3 36  ? 34.223 23.372 25.414  1.00 27.08 ? 36   GLY A C     1 
ATOM   853  O  O     . GLY C 3 36  ? 35.309 23.269 24.863  1.00 26.74 ? 36   GLY A O     1 
ATOM   854  N  N     . PHE C 3 37  ? 34.086 23.773 26.676  1.00 29.02 ? 37   PHE A N     1 
ATOM   855  C  CA    . PHE C 3 37  ? 35.270 24.270 27.411  1.00 30.31 ? 37   PHE A CA    1 
ATOM   856  C  C     . PHE C 3 37  ? 36.346 23.173 27.678  1.00 30.87 ? 37   PHE A C     1 
ATOM   857  O  O     . PHE C 3 37  ? 37.557 23.346 27.428  1.00 30.30 ? 37   PHE A O     1 
ATOM   858  C  CB    . PHE C 3 37  ? 34.895 24.950 28.737  1.00 30.67 ? 37   PHE A CB    1 
ATOM   859  C  CG    . PHE C 3 37  ? 36.130 25.259 29.580  1.00 33.53 ? 37   PHE A CG    1 
ATOM   860  C  CD1   . PHE C 3 37  ? 36.984 26.289 29.203  1.00 32.90 ? 37   PHE A CD1   1 
ATOM   861  C  CD2   . PHE C 3 37  ? 36.512 24.420 30.646  1.00 35.16 ? 37   PHE A CD2   1 
ATOM   862  C  CE1   . PHE C 3 37  ? 38.186 26.535 29.924  1.00 31.55 ? 37   PHE A CE1   1 
ATOM   863  C  CE2   . PHE C 3 37  ? 37.718 24.648 31.362  1.00 33.10 ? 37   PHE A CE2   1 
ATOM   864  C  CZ    . PHE C 3 37  ? 38.544 25.710 30.980  1.00 31.47 ? 37   PHE A CZ    1 
ATOM   865  N  N     . GLU C 3 38  ? 35.907 22.023 28.183  1.00 32.46 ? 38   GLU A N     1 
ATOM   866  C  CA    . GLU C 3 38  ? 36.880 20.965 28.462  1.00 33.80 ? 38   GLU A CA    1 
ATOM   867  C  C     . GLU C 3 38  ? 37.557 20.520 27.213  1.00 33.17 ? 38   GLU A C     1 
ATOM   868  O  O     . GLU C 3 38  ? 38.738 20.207 27.241  1.00 34.60 ? 38   GLU A O     1 
ATOM   869  C  CB    . GLU C 3 38  ? 36.249 19.771 29.177  1.00 34.29 ? 38   GLU A CB    1 
ATOM   870  C  CG    . GLU C 3 38  ? 35.860 20.075 30.628  1.00 36.42 ? 38   GLU A CG    1 
ATOM   871  C  CD    . GLU C 3 38  ? 37.057 20.347 31.572  1.00 38.93 ? 38   GLU A CD    1 
ATOM   872  O  OE1   . GLU C 3 38  ? 38.198 19.920 31.301  1.00 39.46 ? 38   GLU A OE1   1 
ATOM   873  O  OE2   . GLU C 3 38  ? 36.829 21.031 32.586  1.00 41.62 ? 38   GLU A OE2   1 
ATOM   874  N  N     . GLN C 3 39  ? 36.847 20.559 26.091  1.00 32.81 ? 39   GLN A N     1 
ATOM   875  C  CA    . GLN C 3 39  ? 37.478 20.232 24.808  1.00 34.35 ? 39   GLN A CA    1 
ATOM   876  C  C     . GLN C 3 39  ? 38.566 21.257 24.401  1.00 34.25 ? 39   GLN A C     1 
ATOM   877  O  O     . GLN C 3 39  ? 39.658 20.911 23.927  1.00 33.58 ? 39   GLN A O     1 
ATOM   878  C  CB    . GLN C 3 39  ? 36.406 20.049 23.717  1.00 33.82 ? 39   GLN A CB    1 
ATOM   879  C  CG    . GLN C 3 39  ? 35.357 18.919 24.076  1.00 36.21 ? 39   GLN A CG    1 
ATOM   880  C  CD    . GLN C 3 39  ? 34.125 19.407 24.866  1.00 38.14 ? 39   GLN A CD    1 
ATOM   881  O  OE1   . GLN C 3 39  ? 34.194 20.316 25.719  1.00 33.83 ? 39   GLN A OE1   1 
ATOM   882  N  NE2   . GLN C 3 39  ? 32.983 18.794 24.576  1.00 38.54 ? 39   GLN A NE2   1 
ATOM   883  N  N     . LEU C 3 40  ? 38.252 22.539 24.548  1.00 34.03 ? 40   LEU A N     1 
ATOM   884  C  CA    . LEU C 3 40  ? 39.214 23.613 24.255  1.00 33.34 ? 40   LEU A CA    1 
ATOM   885  C  C     . LEU C 3 40  ? 40.427 23.522 25.179  1.00 32.14 ? 40   LEU A C     1 
ATOM   886  O  O     . LEU C 3 40  ? 41.575 23.663 24.731  1.00 32.61 ? 40   LEU A O     1 
ATOM   887  C  CB    . LEU C 3 40  ? 38.496 24.978 24.401  1.00 32.28 ? 40   LEU A CB    1 
ATOM   888  C  CG    . LEU C 3 40  ? 38.989 26.423 24.639  1.00 35.24 ? 40   LEU A CG    1 
ATOM   889  C  CD1   . LEU C 3 40  ? 40.216 26.616 25.518  1.00 32.59 ? 40   LEU A CD1   1 
ATOM   890  C  CD2   . LEU C 3 40  ? 38.995 27.300 23.407  1.00 30.92 ? 40   LEU A CD2   1 
ATOM   891  N  N     . LYS C 3 41  ? 40.184 23.264 26.455  1.00 33.29 ? 41   LYS A N     1 
ATOM   892  C  CA    . LYS C 3 41  ? 41.295 23.163 27.441  1.00 35.05 ? 41   LYS A CA    1 
ATOM   893  C  C     . LYS C 3 41  ? 42.266 22.068 27.018  1.00 35.86 ? 41   LYS A C     1 
ATOM   894  O  O     . LYS C 3 41  ? 43.485 22.259 27.018  1.00 36.76 ? 41   LYS A O     1 
ATOM   895  C  CB    . LYS C 3 41  ? 40.747 22.889 28.850  1.00 33.86 ? 41   LYS A CB    1 
ATOM   896  C  CG    . LYS C 3 41  ? 41.781 22.680 29.968  1.00 34.12 ? 41   LYS A CG    1 
ATOM   897  C  CD    . LYS C 3 41  ? 41.039 22.314 31.289  1.00 37.13 ? 41   LYS A CD    1 
ATOM   898  C  CE    . LYS C 3 41  ? 42.048 21.920 32.391  1.00 41.98 ? 41   LYS A CE    1 
ATOM   899  N  NZ    . LYS C 3 41  ? 42.802 23.134 32.814  1.00 45.15 ? 41   LYS A NZ    1 
ATOM   900  N  N     . LYS C 3 42  ? 41.718 20.927 26.608  1.00 37.42 ? 42   LYS A N     1 
ATOM   901  C  CA    . LYS C 3 42  ? 42.530 19.764 26.231  1.00 37.90 ? 42   LYS A CA    1 
ATOM   902  C  C     . LYS C 3 42  ? 43.303 20.060 24.959  1.00 38.03 ? 42   LYS A C     1 
ATOM   903  O  O     . LYS C 3 42  ? 44.490 19.778 24.877  1.00 38.16 ? 42   LYS A O     1 
ATOM   904  C  CB    . LYS C 3 42  ? 41.622 18.528 26.070  1.00 38.92 ? 42   LYS A CB    1 
ATOM   905  C  CG    . LYS C 3 42  ? 42.360 17.206 25.687  1.00 42.09 ? 42   LYS A CG    1 
ATOM   906  N  N     . GLU C 3 43  ? 42.651 20.656 23.955  1.00 37.99 ? 43   GLU A N     1 
ATOM   907  C  CA    . GLU C 3 43  ? 43.336 20.941 22.705  1.00 37.53 ? 43   GLU A CA    1 
ATOM   908  C  C     . GLU C 3 43  ? 44.396 22.020 22.769  1.00 36.74 ? 43   GLU A C     1 
ATOM   909  O  O     . GLU C 3 43  ? 45.403 21.920 22.072  1.00 36.43 ? 43   GLU A O     1 
ATOM   910  C  CB    . GLU C 3 43  ? 42.336 21.292 21.607  1.00 38.97 ? 43   GLU A CB    1 
ATOM   911  C  CG    . GLU C 3 43  ? 41.379 20.119 21.254  1.00 42.51 ? 43   GLU A CG    1 
ATOM   912  C  CD    . GLU C 3 43  ? 41.917 19.232 20.145  1.00 49.50 ? 43   GLU A CD    1 
ATOM   913  O  OE1   . GLU C 3 43  ? 43.116 18.870 20.174  1.00 50.79 ? 43   GLU A OE1   1 
ATOM   914  O  OE2   . GLU C 3 43  ? 41.133 18.900 19.233  1.00 53.09 ? 43   GLU A OE2   1 
ATOM   915  N  N     . LEU C 3 44  ? 44.173 23.077 23.558  1.00 34.93 ? 44   LEU A N     1 
ATOM   916  C  CA    . LEU C 3 44  ? 45.072 24.247 23.519  1.00 33.91 ? 44   LEU A CA    1 
ATOM   917  C  C     . LEU C 3 44  ? 46.169 24.341 24.597  1.00 32.74 ? 44   LEU A C     1 
ATOM   918  O  O     . LEU C 3 44  ? 47.132 25.083 24.439  1.00 31.20 ? 44   LEU A O     1 
ATOM   919  C  CB    . LEU C 3 44  ? 44.270 25.548 23.494  1.00 34.35 ? 44   LEU A CB    1 
ATOM   920  C  CG    . LEU C 3 44  ? 43.306 25.783 22.327  1.00 35.43 ? 44   LEU A CG    1 
ATOM   921  C  CD1   . LEU C 3 44  ? 42.618 27.148 22.562  1.00 35.74 ? 44   LEU A CD1   1 
ATOM   922  C  CD2   . LEU C 3 44  ? 44.013 25.747 20.951  1.00 34.92 ? 44   LEU A CD2   1 
ATOM   923  N  N     . THR C 3 45  ? 46.010 23.621 25.692  1.00 33.16 ? 45   THR A N     1 
ATOM   924  C  CA    . THR C 3 45  ? 47.035 23.626 26.751  1.00 33.45 ? 45   THR A CA    1 
ATOM   925  C  C     . THR C 3 45  ? 48.345 23.120 26.176  1.00 34.38 ? 45   THR A C     1 
ATOM   926  O  O     . THR C 3 45  ? 48.369 22.070 25.501  1.00 33.77 ? 45   THR A O     1 
ATOM   927  C  CB    . THR C 3 45  ? 46.579 22.761 27.925  1.00 33.86 ? 45   THR A CB    1 
ATOM   928  O  OG1   . THR C 3 45  ? 45.377 23.339 28.459  1.00 33.77 ? 45   THR A OG1   1 
ATOM   929  C  CG2   . THR C 3 45  ? 47.636 22.711 29.028  1.00 35.85 ? 45   THR A CG2   1 
ATOM   930  N  N     . GLY C 3 46  ? 49.417 23.884 26.412  1.00 33.67 ? 46   GLY A N     1 
ATOM   931  C  CA    . GLY C 3 46  ? 50.736 23.575 25.899  1.00 33.90 ? 46   GLY A CA    1 
ATOM   932  C  C     . GLY C 3 46  ? 51.037 24.103 24.511  1.00 33.97 ? 46   GLY A C     1 
ATOM   933  O  O     . GLY C 3 46  ? 52.190 24.008 24.061  1.00 32.57 ? 46   GLY A O     1 
ATOM   934  N  N     . LYS C 3 47  ? 50.027 24.670 23.816  1.00 32.98 ? 47   LYS A N     1 
ATOM   935  C  CA    . LYS C 3 47  ? 50.276 25.292 22.483  1.00 33.14 ? 47   LYS A CA    1 
ATOM   936  C  C     . LYS C 3 47  ? 50.741 26.754 22.580  1.00 32.70 ? 47   LYS A C     1 
ATOM   937  O  O     . LYS C 3 47  ? 50.493 27.427 23.576  1.00 32.24 ? 47   LYS A O     1 
ATOM   938  C  CB    . LYS C 3 47  ? 49.050 25.210 21.545  1.00 32.90 ? 47   LYS A CB    1 
ATOM   939  C  CG    . LYS C 3 47  ? 48.397 23.843 21.485  1.00 38.47 ? 47   LYS A CG    1 
ATOM   940  C  CD    . LYS C 3 47  ? 49.258 22.865 20.709  1.00 45.27 ? 47   LYS A CD    1 
ATOM   941  C  CE    . LYS C 3 47  ? 48.465 21.614 20.313  1.00 49.53 ? 47   LYS A CE    1 
ATOM   942  N  NZ    . LYS C 3 47  ? 48.403 20.728 21.511  1.00 50.31 ? 47   LYS A NZ    1 
ATOM   943  N  N     . THR C 3 48  ? 51.377 27.226 21.512  1.00 32.74 ? 48   THR A N     1 
ATOM   944  C  CA    . THR C 3 48  ? 51.940 28.576 21.463  1.00 33.45 ? 48   THR A CA    1 
ATOM   945  C  C     . THR C 3 48  ? 51.105 29.493 20.574  1.00 33.06 ? 48   THR A C     1 
ATOM   946  O  O     . THR C 3 48  ? 50.693 29.094 19.497  1.00 32.32 ? 48   THR A O     1 
ATOM   947  C  CB    . THR C 3 48  ? 53.368 28.479 20.966  1.00 34.75 ? 48   THR A CB    1 
ATOM   948  O  OG1   . THR C 3 48  ? 54.117 27.771 21.980  1.00 34.24 ? 48   THR A OG1   1 
ATOM   949  C  CG2   . THR C 3 48  ? 53.966 29.851 20.688  1.00 32.76 ? 48   THR A CG2   1 
ATOM   950  N  N     . ILE C 3 49  ? 50.851 30.715 21.031  1.00 31.82 ? 49   ILE A N     1 
ATOM   951  C  CA    . ILE C 3 49  ? 50.090 31.674 20.205  1.00 32.73 ? 49   ILE A CA    1 
ATOM   952  C  C     . ILE C 3 49  ? 50.967 32.190 19.061  1.00 33.03 ? 49   ILE A C     1 
ATOM   953  O  O     . ILE C 3 49  ? 52.048 32.745 19.286  1.00 35.29 ? 49   ILE A O     1 
ATOM   954  C  CB    . ILE C 3 49  ? 49.533 32.839 21.094  1.00 33.31 ? 49   ILE A CB    1 
ATOM   955  C  CG1   . ILE C 3 49  ? 48.644 32.232 22.176  1.00 32.96 ? 49   ILE A CG1   1 
ATOM   956  C  CG2   . ILE C 3 49  ? 48.772 33.939 20.221  1.00 30.74 ? 49   ILE A CG2   1 
ATOM   957  C  CD1   . ILE C 3 49  ? 48.210 33.211 23.226  1.00 37.12 ? 49   ILE A CD1   1 
ATOM   958  N  N     . GLN C 3 50  ? 50.535 31.984 17.827  1.00 32.56 ? 50   GLN A N     1 
ATOM   959  C  CA    . GLN C 3 50  ? 51.339 32.391 16.671  1.00 33.44 ? 50   GLN A CA    1 
ATOM   960  C  C     . GLN C 3 50  ? 50.939 33.736 16.083  1.00 31.91 ? 50   GLN A C     1 
ATOM   961  O  O     . GLN C 3 50  ? 51.707 34.359 15.332  1.00 31.29 ? 50   GLN A O     1 
ATOM   962  C  CB    . GLN C 3 50  ? 51.222 31.331 15.545  1.00 35.35 ? 50   GLN A CB    1 
ATOM   963  C  CG    . GLN C 3 50  ? 51.319 29.859 16.013  1.00 40.98 ? 50   GLN A CG    1 
ATOM   964  C  CD    . GLN C 3 50  ? 52.683 29.432 16.609  1.00 51.54 ? 50   GLN A CD    1 
ATOM   965  O  OE1   . GLN C 3 50  ? 52.807 28.326 17.188  1.00 54.83 ? 50   GLN A OE1   1 
ATOM   966  N  NE2   . GLN C 3 50  ? 53.704 30.283 16.460  1.00 54.63 ? 50   GLN A NE2   1 
ATOM   967  N  N     . GLY C 3 51  ? 49.728 34.187 16.398  1.00 29.54 ? 51   GLY A N     1 
ATOM   968  C  CA    . GLY C 3 51  ? 49.181 35.332 15.687  1.00 28.45 ? 51   GLY A CA    1 
ATOM   969  C  C     . GLY C 3 51  ? 47.811 35.727 16.219  1.00 25.90 ? 51   GLY A C     1 
ATOM   970  O  O     . GLY C 3 51  ? 47.157 34.944 16.909  1.00 25.86 ? 51   GLY A O     1 
ATOM   971  N  N     . ILE C 3 52  ? 47.396 36.951 15.927  1.00 26.67 ? 52   ILE A N     1 
ATOM   972  C  CA    . ILE C 3 52  ? 46.007 37.373 16.224  1.00 26.67 ? 52   ILE A CA    1 
ATOM   973  C  C     . ILE C 3 52  ? 45.460 38.172 15.044  1.00 26.84 ? 52   ILE A C     1 
ATOM   974  O  O     . ILE C 3 52  ? 46.024 39.192 14.666  1.00 26.40 ? 52   ILE A O     1 
ATOM   975  C  CB    . ILE C 3 52  ? 45.866 38.243 17.534  1.00 27.83 ? 52   ILE A CB    1 
ATOM   976  C  CG1   . ILE C 3 52  ? 46.443 37.517 18.759  1.00 29.39 ? 52   ILE A CG1   1 
ATOM   977  C  CG2   . ILE C 3 52  ? 44.382 38.478 17.861  1.00 25.63 ? 52   ILE A CG2   1 
ATOM   978  C  CD1   . ILE C 3 52  ? 47.716 38.055 19.121  1.00 37.06 ? 52   ILE A CD1   1 
ATOM   979  N  N     . SER C 3 53  ? 44.352 37.696 14.478  1.00 27.12 ? 53   SER A N     1 
ATOM   980  C  CA    . SER C 3 53  ? 43.691 38.379 13.350  1.00 27.76 ? 53   SER A CA    1 
ATOM   981  C  C     . SER C 3 53  ? 42.316 38.918 13.750  1.00 26.64 ? 53   SER A C     1 
ATOM   982  O  O     . SER C 3 53  ? 41.909 38.783 14.922  1.00 26.32 ? 53   SER A O     1 
ATOM   983  C  CB    . SER C 3 53  ? 43.541 37.405 12.174  1.00 28.20 ? 53   SER A CB    1 
ATOM   984  O  OG    . SER C 3 53  ? 44.830 37.178 11.636  1.00 33.94 ? 53   SER A OG    1 
ATOM   985  N  N     . ARG C 3 54  ? 41.607 39.539 12.794  1.00 25.25 ? 54   ARG A N     1 
ATOM   986  C  CA    . ARG C 3 54  ? 40.273 40.053 13.080  1.00 24.21 ? 54   ARG A CA    1 
ATOM   987  C  C     . ARG C 3 54  ? 39.484 39.943 11.796  1.00 24.28 ? 54   ARG A C     1 
ATOM   988  O  O     . ARG C 3 54  ? 40.067 40.056 10.704  1.00 22.86 ? 54   ARG A O     1 
ATOM   989  C  CB    . ARG C 3 54  ? 40.354 41.530 13.539  1.00 24.38 ? 54   ARG A CB    1 
ATOM   990  C  CG    . ARG C 3 54  ? 38.968 42.167 13.870  1.00 23.64 ? 54   ARG A CG    1 
ATOM   991  C  CD    . ARG C 3 54  ? 39.064 43.697 14.075  1.00 23.93 ? 54   ARG A CD    1 
ATOM   992  N  NE    . ARG C 3 54  ? 39.797 44.378 12.961  1.00 22.43 ? 54   ARG A NE    1 
ATOM   993  C  CZ    . ARG C 3 54  ? 39.367 44.475 11.698  1.00 26.70 ? 54   ARG A CZ    1 
ATOM   994  N  NH1   . ARG C 3 54  ? 38.203 43.949 11.320  1.00 24.45 ? 54   ARG A NH1   1 
ATOM   995  N  NH2   . ARG C 3 54  ? 40.132 45.083 10.783  1.00 28.88 ? 54   ARG A NH2   1 
ATOM   996  N  N     . ARG C 3 55  ? 38.191 39.677 11.919  1.00 23.18 ? 55   ARG A N     1 
ATOM   997  C  CA    . ARG C 3 55  ? 37.287 39.785 10.777  1.00 24.25 ? 55   ARG A CA    1 
ATOM   998  C  C     . ARG C 3 55  ? 36.085 40.523 11.315  1.00 24.25 ? 55   ARG A C     1 
ATOM   999  O  O     . ARG C 3 55  ? 35.466 40.017 12.257  1.00 23.96 ? 55   ARG A O     1 
ATOM   1000 C  CB    . ARG C 3 55  ? 36.879 38.383 10.276  1.00 23.25 ? 55   ARG A CB    1 
ATOM   1001 C  CG    . ARG C 3 55  ? 35.948 38.401 9.056   1.00 24.54 ? 55   ARG A CG    1 
ATOM   1002 C  CD    . ARG C 3 55  ? 36.653 38.821 7.716   1.00 27.03 ? 55   ARG A CD    1 
ATOM   1003 N  NE    . ARG C 3 55  ? 35.712 38.557 6.606   1.00 26.14 ? 55   ARG A NE    1 
ATOM   1004 C  CZ    . ARG C 3 55  ? 34.874 39.449 6.079   1.00 25.99 ? 55   ARG A CZ    1 
ATOM   1005 N  NH1   . ARG C 3 55  ? 34.864 40.699 6.538   1.00 23.67 ? 55   ARG A NH1   1 
ATOM   1006 N  NH2   . ARG C 3 55  ? 34.007 39.070 5.125   1.00 25.34 ? 55   ARG A NH2   1 
ATOM   1007 N  N     . GLY C 3 56  ? 35.711 41.679 10.742  1.00 23.44 ? 56   GLY A N     1 
ATOM   1008 C  CA    . GLY C 3 56  ? 34.616 42.450 11.343  1.00 24.02 ? 56   GLY A CA    1 
ATOM   1009 C  C     . GLY C 3 56  ? 34.843 42.753 12.815  1.00 24.02 ? 56   GLY A C     1 
ATOM   1010 O  O     . GLY C 3 56  ? 35.944 43.184 13.181  1.00 24.12 ? 56   GLY A O     1 
ATOM   1011 N  N     . LYS C 3 57  ? 33.834 42.510 13.674  1.00 23.25 ? 57   LYS A N     1 
ATOM   1012 C  CA    . LYS C 3 57  ? 34.021 42.715 15.132  1.00 23.02 ? 57   LYS A CA    1 
ATOM   1013 C  C     . LYS C 3 57  ? 34.590 41.444 15.823  1.00 24.04 ? 57   LYS A C     1 
ATOM   1014 O  O     . LYS C 3 57  ? 34.606 41.391 17.057  1.00 23.55 ? 57   LYS A O     1 
ATOM   1015 C  CB    . LYS C 3 57  ? 32.682 43.112 15.808  1.00 23.01 ? 57   LYS A CB    1 
ATOM   1016 C  CG    . LYS C 3 57  ? 31.999 44.289 15.099  1.00 25.01 ? 57   LYS A CG    1 
ATOM   1017 C  CD    . LYS C 3 57  ? 30.697 44.721 15.776  1.00 22.17 ? 57   LYS A CD    1 
ATOM   1018 C  CE    . LYS C 3 57  ? 30.050 45.760 14.849  1.00 23.07 ? 57   LYS A CE    1 
ATOM   1019 N  NZ    . LYS C 3 57  ? 28.592 45.932 15.169  1.00 24.40 ? 57   LYS A NZ    1 
ATOM   1020 N  N     . TYR C 3 58  ? 34.973 40.413 15.040  1.00 23.22 ? 58   TYR A N     1 
ATOM   1021 C  CA    . TYR C 3 58  ? 35.451 39.137 15.636  1.00 23.34 ? 58   TYR A CA    1 
ATOM   1022 C  C     . TYR C 3 58  ? 36.973 39.094 15.786  1.00 24.29 ? 58   TYR A C     1 
ATOM   1023 O  O     . TYR C 3 58  ? 37.699 39.328 14.785  1.00 24.71 ? 58   TYR A O     1 
ATOM   1024 C  CB    . TYR C 3 58  ? 35.096 37.930 14.722  1.00 24.79 ? 58   TYR A CB    1 
ATOM   1025 C  CG    . TYR C 3 58  ? 33.642 37.596 14.629  1.00 24.85 ? 58   TYR A CG    1 
ATOM   1026 C  CD1   . TYR C 3 58  ? 32.791 38.336 13.800  1.00 28.92 ? 58   TYR A CD1   1 
ATOM   1027 C  CD2   . TYR C 3 58  ? 33.115 36.543 15.340  1.00 27.02 ? 58   TYR A CD2   1 
ATOM   1028 C  CE1   . TYR C 3 58  ? 31.425 38.009 13.698  1.00 28.01 ? 58   TYR A CE1   1 
ATOM   1029 C  CE2   . TYR C 3 58  ? 31.746 36.183 15.203  1.00 26.64 ? 58   TYR A CE2   1 
ATOM   1030 C  CZ    . TYR C 3 58  ? 30.941 36.923 14.367  1.00 26.89 ? 58   TYR A CZ    1 
ATOM   1031 O  OH    . TYR C 3 58  ? 29.600 36.634 14.289  1.00 29.47 ? 58   TYR A OH    1 
ATOM   1032 N  N     . LEU C 3 59  ? 37.455 38.701 16.973  1.00 23.93 ? 59   LEU A N     1 
ATOM   1033 C  CA    . LEU C 3 59  ? 38.897 38.387 17.173  1.00 25.67 ? 59   LEU A CA    1 
ATOM   1034 C  C     . LEU C 3 59  ? 39.198 36.957 16.853  1.00 26.23 ? 59   LEU A C     1 
ATOM   1035 O  O     . LEU C 3 59  ? 38.424 36.077 17.211  1.00 27.34 ? 59   LEU A O     1 
ATOM   1036 C  CB    . LEU C 3 59  ? 39.341 38.578 18.621  1.00 26.69 ? 59   LEU A CB    1 
ATOM   1037 C  CG    . LEU C 3 59  ? 39.765 39.891 19.208  1.00 30.56 ? 59   LEU A CG    1 
ATOM   1038 C  CD1   . LEU C 3 59  ? 40.163 39.673 20.697  1.00 30.12 ? 59   LEU A CD1   1 
ATOM   1039 C  CD2   . LEU C 3 59  ? 40.956 40.554 18.390  1.00 28.71 ? 59   LEU A CD2   1 
ATOM   1040 N  N     . ILE C 3 60  ? 40.353 36.718 16.223  1.00 26.58 ? 60   ILE A N     1 
ATOM   1041 C  CA    . ILE C 3 60  ? 40.764 35.348 15.853  1.00 26.96 ? 60   ILE A CA    1 
ATOM   1042 C  C     . ILE C 3 60  ? 42.174 35.068 16.407  1.00 26.51 ? 60   ILE A C     1 
ATOM   1043 O  O     . ILE C 3 60  ? 43.157 35.601 15.883  1.00 26.93 ? 60   ILE A O     1 
ATOM   1044 C  CB    . ILE C 3 60  ? 40.790 35.181 14.322  1.00 28.07 ? 60   ILE A CB    1 
ATOM   1045 C  CG1   . ILE C 3 60  ? 39.432 35.586 13.706  1.00 27.96 ? 60   ILE A CG1   1 
ATOM   1046 C  CG2   . ILE C 3 60  ? 41.156 33.642 13.909  1.00 27.03 ? 60   ILE A CG2   1 
ATOM   1047 C  CD1   . ILE C 3 60  ? 39.497 35.925 12.228  1.00 30.95 ? 60   ILE A CD1   1 
ATOM   1048 N  N     . PHE C 3 61  ? 42.266 34.242 17.439  1.00 24.52 ? 61   PHE A N     1 
ATOM   1049 C  CA    . PHE C 3 61  ? 43.574 33.809 17.967  1.00 25.27 ? 61   PHE A CA    1 
ATOM   1050 C  C     . PHE C 3 61  ? 44.073 32.646 17.113  1.00 25.71 ? 61   PHE A C     1 
ATOM   1051 O  O     . PHE C 3 61  ? 43.340 31.695 16.918  1.00 25.76 ? 61   PHE A O     1 
ATOM   1052 C  CB    . PHE C 3 61  ? 43.439 33.316 19.406  1.00 25.80 ? 61   PHE A CB    1 
ATOM   1053 C  CG    . PHE C 3 61  ? 43.037 34.413 20.406  1.00 26.63 ? 61   PHE A CG    1 
ATOM   1054 C  CD1   . PHE C 3 61  ? 41.683 34.743 20.593  1.00 28.38 ? 61   PHE A CD1   1 
ATOM   1055 C  CD2   . PHE C 3 61  ? 44.035 35.089 21.163  1.00 25.03 ? 61   PHE A CD2   1 
ATOM   1056 C  CE1   . PHE C 3 61  ? 41.304 35.725 21.551  1.00 27.88 ? 61   PHE A CE1   1 
ATOM   1057 C  CE2   . PHE C 3 61  ? 43.686 36.073 22.113  1.00 28.08 ? 61   PHE A CE2   1 
ATOM   1058 C  CZ    . PHE C 3 61  ? 42.311 36.393 22.301  1.00 26.62 ? 61   PHE A CZ    1 
ATOM   1059 N  N     . GLU C 3 62  ? 45.321 32.739 16.651  1.00 26.24 ? 62   GLU A N     1 
ATOM   1060 C  CA    . GLU C 3 62  ? 45.960 31.682 15.828  1.00 27.05 ? 62   GLU A CA    1 
ATOM   1061 C  C     . GLU C 3 62  ? 46.883 30.937 16.759  1.00 26.38 ? 62   GLU A C     1 
ATOM   1062 O  O     . GLU C 3 62  ? 47.847 31.513 17.284  1.00 25.82 ? 62   GLU A O     1 
ATOM   1063 C  CB    . GLU C 3 62  ? 46.697 32.319 14.621  1.00 27.57 ? 62   GLU A CB    1 
ATOM   1064 C  CG    . GLU C 3 62  ? 45.715 33.127 13.746  1.00 29.70 ? 62   GLU A CG    1 
ATOM   1065 C  CD    . GLU C 3 62  ? 46.374 34.122 12.818  1.00 36.49 ? 62   GLU A CD    1 
ATOM   1066 O  OE1   . GLU C 3 62  ? 47.578 34.346 12.955  1.00 35.45 ? 62   GLU A OE1   1 
ATOM   1067 O  OE2   . GLU C 3 62  ? 45.673 34.679 11.942  1.00 37.44 ? 62   GLU A OE2   1 
ATOM   1068 N  N     . ILE C 3 63  ? 46.531 29.687 17.059  1.00 28.76 ? 63   ILE A N     1 
ATOM   1069 C  CA    . ILE C 3 63  ? 47.215 28.941 18.162  1.00 30.02 ? 63   ILE A CA    1 
ATOM   1070 C  C     . ILE C 3 63  ? 47.677 27.558 17.663  1.00 31.85 ? 63   ILE A C     1 
ATOM   1071 O  O     . ILE C 3 63  ? 46.880 26.787 17.214  1.00 32.80 ? 63   ILE A O     1 
ATOM   1072 C  CB    . ILE C 3 63  ? 46.287 28.789 19.373  1.00 28.74 ? 63   ILE A CB    1 
ATOM   1073 C  CG1   . ILE C 3 63  ? 45.804 30.189 19.836  1.00 27.50 ? 63   ILE A CG1   1 
ATOM   1074 C  CG2   . ILE C 3 63  ? 46.996 27.972 20.556  1.00 29.38 ? 63   ILE A CG2   1 
ATOM   1075 C  CD1   . ILE C 3 63  ? 44.771 30.152 20.941  1.00 25.41 ? 63   ILE A CD1   1 
ATOM   1076 N  N     . GLY C 3 64  ? 48.961 27.265 17.749  1.00 34.56 ? 64   GLY A N     1 
ATOM   1077 C  CA    . GLY C 3 64  ? 49.554 26.200 16.897  1.00 38.09 ? 64   GLY A CA    1 
ATOM   1078 C  C     . GLY C 3 64  ? 49.298 26.418 15.421  1.00 40.07 ? 64   GLY A C     1 
ATOM   1079 O  O     . GLY C 3 64  ? 48.779 27.481 14.985  1.00 43.13 ? 64   GLY A O     1 
ATOM   1080 N  N     . ASP C 3 65  ? 49.560 25.389 14.618  1.00 42.19 ? 65   ASP A N     1 
ATOM   1081 C  CA    . ASP C 3 65  ? 49.412 25.522 13.167  1.00 41.15 ? 65   ASP A CA    1 
ATOM   1082 C  C     . ASP C 3 65  ? 47.999 25.422 12.732  1.00 40.14 ? 65   ASP A C     1 
ATOM   1083 O  O     . ASP C 3 65  ? 47.611 25.993 11.678  1.00 42.00 ? 65   ASP A O     1 
ATOM   1084 C  CB    . ASP C 3 65  ? 50.194 24.408 12.462  1.00 43.69 ? 65   ASP A CB    1 
ATOM   1085 N  N     . ASP C 3 66  ? 47.203 24.677 13.494  1.00 37.71 ? 66   ASP A N     1 
ATOM   1086 C  CA    . ASP C 3 66  ? 45.876 24.321 12.969  1.00 36.09 ? 66   ASP A CA    1 
ATOM   1087 C  C     . ASP C 3 66  ? 44.652 24.721 13.807  1.00 34.80 ? 66   ASP A C     1 
ATOM   1088 O  O     . ASP C 3 66  ? 43.535 24.291 13.482  1.00 34.53 ? 66   ASP A O     1 
ATOM   1089 C  CB    . ASP C 3 66  ? 45.804 22.820 12.696  1.00 37.55 ? 66   ASP A CB    1 
ATOM   1090 N  N     . PHE C 3 67  ? 44.839 25.512 14.867  1.00 33.32 ? 67   PHE A N     1 
ATOM   1091 C  CA    . PHE C 3 67  ? 43.718 25.938 15.707  1.00 33.49 ? 67   PHE A CA    1 
ATOM   1092 C  C     . PHE C 3 67  ? 43.472 27.440 15.581  1.00 31.18 ? 67   PHE A C     1 
ATOM   1093 O  O     . PHE C 3 67  ? 44.405 28.212 15.529  1.00 29.98 ? 67   PHE A O     1 
ATOM   1094 C  CB    . PHE C 3 67  ? 43.975 25.653 17.185  1.00 35.76 ? 67   PHE A CB    1 
ATOM   1095 C  CG    . PHE C 3 67  ? 43.897 24.198 17.546  1.00 40.15 ? 67   PHE A CG    1 
ATOM   1096 C  CD1   . PHE C 3 67  ? 42.772 23.435 17.198  1.00 42.92 ? 67   PHE A CD1   1 
ATOM   1097 C  CD2   . PHE C 3 67  ? 44.960 23.588 18.217  1.00 43.70 ? 67   PHE A CD2   1 
ATOM   1098 C  CE1   . PHE C 3 67  ? 42.704 22.070 17.537  1.00 46.82 ? 67   PHE A CE1   1 
ATOM   1099 C  CE2   . PHE C 3 67  ? 44.905 22.232 18.562  1.00 46.75 ? 67   PHE A CE2   1 
ATOM   1100 C  CZ    . PHE C 3 67  ? 43.773 21.467 18.215  1.00 45.66 ? 67   PHE A CZ    1 
ATOM   1101 N  N     . ARG C 3 68  ? 42.207 27.805 15.550  1.00 29.80 ? 68   ARG A N     1 
ATOM   1102 C  CA    . ARG C 3 68  ? 41.780 29.197 15.564  1.00 29.26 ? 68   ARG A CA    1 
ATOM   1103 C  C     . ARG C 3 68  ? 40.677 29.363 16.617  1.00 27.53 ? 68   ARG A C     1 
ATOM   1104 O  O     . ARG C 3 68  ? 39.612 28.716 16.552  1.00 27.78 ? 68   ARG A O     1 
ATOM   1105 C  CB    . ARG C 3 68  ? 41.258 29.588 14.184  1.00 30.33 ? 68   ARG A CB    1 
ATOM   1106 C  CG    . ARG C 3 68  ? 42.216 29.279 13.000  1.00 31.29 ? 68   ARG A CG    1 
ATOM   1107 C  CD    . ARG C 3 68  ? 43.272 30.271 13.040  1.00 30.13 ? 68   ARG A CD    1 
ATOM   1108 N  NE    . ARG C 3 68  ? 44.255 30.291 11.954  1.00 29.23 ? 68   ARG A NE    1 
ATOM   1109 C  CZ    . ARG C 3 68  ? 45.504 29.824 12.038  1.00 32.04 ? 68   ARG A CZ    1 
ATOM   1110 N  NH1   . ARG C 3 68  ? 45.888 29.151 13.123  1.00 29.24 ? 68   ARG A NH1   1 
ATOM   1111 N  NH2   . ARG C 3 68  ? 46.383 30.046 11.032  1.00 28.58 ? 68   ARG A NH2   1 
ATOM   1112 N  N     . LEU C 3 69  ? 40.927 30.276 17.560  1.00 26.45 ? 69   LEU A N     1 
ATOM   1113 C  CA    . LEU C 3 69  ? 39.961 30.572 18.612  1.00 24.43 ? 69   LEU A CA    1 
ATOM   1114 C  C     . LEU C 3 69  ? 39.227 31.861 18.172  1.00 23.99 ? 69   LEU A C     1 
ATOM   1115 O  O     . LEU C 3 69  ? 39.824 32.922 18.096  1.00 25.30 ? 69   LEU A O     1 
ATOM   1116 C  CB    . LEU C 3 69  ? 40.694 30.779 19.939  1.00 23.46 ? 69   LEU A CB    1 
ATOM   1117 C  CG    . LEU C 3 69  ? 39.849 31.178 21.171  1.00 24.51 ? 69   LEU A CG    1 
ATOM   1118 C  CD1   . LEU C 3 69  ? 38.594 30.310 21.318  1.00 27.64 ? 69   LEU A CD1   1 
ATOM   1119 C  CD2   . LEU C 3 69  ? 40.738 31.167 22.483  1.00 24.97 ? 69   LEU A CD2   1 
ATOM   1120 N  N     . ILE C 3 70  ? 37.941 31.765 17.902  1.00 23.91 ? 70   ILE A N     1 
ATOM   1121 C  CA    . ILE C 3 70  ? 37.154 32.941 17.441  1.00 24.11 ? 70   ILE A CA    1 
ATOM   1122 C  C     . ILE C 3 70  ? 36.412 33.504 18.645  1.00 22.64 ? 70   ILE A C     1 
ATOM   1123 O  O     . ILE C 3 70  ? 35.583 32.786 19.258  1.00 23.53 ? 70   ILE A O     1 
ATOM   1124 C  CB    . ILE C 3 70  ? 36.101 32.523 16.357  1.00 25.08 ? 70   ILE A CB    1 
ATOM   1125 C  CG1   . ILE C 3 70  ? 36.766 31.681 15.238  1.00 27.54 ? 70   ILE A CG1   1 
ATOM   1126 C  CG2   . ILE C 3 70  ? 35.296 33.756 15.826  1.00 24.78 ? 70   ILE A CG2   1 
ATOM   1127 C  CD1   . ILE C 3 70  ? 37.402 32.438 14.281  1.00 32.67 ? 70   ILE A CD1   1 
ATOM   1128 N  N     . SER C 3 71  ? 36.710 34.763 18.969  1.00 23.07 ? 71   SER A N     1 
ATOM   1129 C  CA    . SER C 3 71  ? 36.174 35.472 20.152  1.00 22.09 ? 71   SER A CA    1 
ATOM   1130 C  C     . SER C 3 71  ? 35.354 36.688 19.725  1.00 23.98 ? 71   SER A C     1 
ATOM   1131 O  O     . SER C 3 71  ? 35.825 37.454 18.889  1.00 22.65 ? 71   SER A O     1 
ATOM   1132 C  CB    . SER C 3 71  ? 37.326 35.934 21.051  1.00 23.88 ? 71   SER A CB    1 
ATOM   1133 O  OG    . SER C 3 71  ? 36.882 36.917 22.012  1.00 22.10 ? 71   SER A OG    1 
ATOM   1134 N  N     . HIS C 3 72  ? 34.121 36.807 20.250  1.00 22.48 ? 72   HIS A N     1 
ATOM   1135 C  CA    . HIS C 3 72  ? 33.296 37.966 20.005  1.00 24.88 ? 72   HIS A CA    1 
ATOM   1136 C  C     . HIS C 3 72  ? 33.014 38.590 21.367  1.00 24.05 ? 72   HIS A C     1 
ATOM   1137 O  O     . HIS C 3 72  ? 32.682 37.884 22.314  1.00 26.23 ? 72   HIS A O     1 
ATOM   1138 C  CB    . HIS C 3 72  ? 31.999 37.583 19.308  1.00 24.75 ? 72   HIS A CB    1 
ATOM   1139 C  CG    . HIS C 3 72  ? 31.346 38.757 18.629  1.00 28.21 ? 72   HIS A CG    1 
ATOM   1140 N  ND1   . HIS C 3 72  ? 30.857 39.851 19.332  1.00 24.57 ? 72   HIS A ND1   1 
ATOM   1141 C  CD2   . HIS C 3 72  ? 31.190 39.046 17.309  1.00 24.39 ? 72   HIS A CD2   1 
ATOM   1142 C  CE1   . HIS C 3 72  ? 30.382 40.736 18.469  1.00 27.03 ? 72   HIS A CE1   1 
ATOM   1143 N  NE2   . HIS C 3 72  ? 30.557 40.271 17.239  1.00 23.79 ? 72   HIS A NE2   1 
ATOM   1144 N  N     . LEU C 3 73  ? 33.244 39.884 21.490  1.00 23.73 ? 73   LEU A N     1 
ATOM   1145 C  CA    . LEU C 3 73  ? 33.108 40.568 22.800  1.00 23.09 ? 73   LEU A CA    1 
ATOM   1146 C  C     . LEU C 3 73  ? 31.720 41.133 23.057  1.00 23.07 ? 73   LEU A C     1 
ATOM   1147 O  O     . LEU C 3 73  ? 31.442 41.671 24.153  1.00 23.19 ? 73   LEU A O     1 
ATOM   1148 C  CB    . LEU C 3 73  ? 34.179 41.671 22.868  1.00 23.75 ? 73   LEU A CB    1 
ATOM   1149 C  CG    . LEU C 3 73  ? 35.643 41.141 22.870  1.00 24.30 ? 73   LEU A CG    1 
ATOM   1150 C  CD1   . LEU C 3 73  ? 36.281 40.830 21.470  1.00 26.47 ? 73   LEU A CD1   1 
ATOM   1151 C  CD2   . LEU C 3 73  ? 36.534 42.099 23.550  1.00 31.15 ? 73   LEU A CD2   1 
ATOM   1152 N  N     . ARG C 3 74  ? 30.852 41.050 22.033  1.00 22.67 ? 74   ARG A N     1 
ATOM   1153 C  CA    . ARG C 3 74  ? 29.488 41.594 22.083  1.00 22.39 ? 74   ARG A CA    1 
ATOM   1154 C  C     . ARG C 3 74  ? 29.449 43.047 22.687  1.00 23.13 ? 74   ARG A C     1 
ATOM   1155 O  O     . ARG C 3 74  ? 30.069 43.969 22.134  1.00 22.49 ? 74   ARG A O     1 
ATOM   1156 C  CB    . ARG C 3 74  ? 28.490 40.608 22.769  1.00 22.64 ? 74   ARG A CB    1 
ATOM   1157 C  CG    . ARG C 3 74  ? 28.415 39.196 21.982  1.00 21.87 ? 74   ARG A CG    1 
ATOM   1158 C  CD    . ARG C 3 74  ? 27.593 39.316 20.649  1.00 25.66 ? 74   ARG A CD    1 
ATOM   1159 N  NE    . ARG C 3 74  ? 27.283 37.965 20.170  1.00 28.86 ? 74   ARG A NE    1 
ATOM   1160 C  CZ    . ARG C 3 74  ? 26.101 37.349 20.332  1.00 30.45 ? 74   ARG A CZ    1 
ATOM   1161 N  NH1   . ARG C 3 74  ? 25.080 37.988 20.865  1.00 24.92 ? 74   ARG A NH1   1 
ATOM   1162 N  NH2   . ARG C 3 74  ? 25.920 36.087 19.892  1.00 28.85 ? 74   ARG A NH2   1 
ATOM   1163 N  N     . MET C 3 75  ? 28.652 43.247 23.744  1.00 23.65 ? 75   MET A N     1 
ATOM   1164 C  CA    . MET C 3 75  ? 28.403 44.612 24.246  1.00 24.10 ? 75   MET A CA    1 
ATOM   1165 C  C     . MET C 3 75  ? 29.456 45.093 25.230  1.00 25.44 ? 75   MET A C     1 
ATOM   1166 O  O     . MET C 3 75  ? 29.799 46.313 25.251  1.00 26.25 ? 75   MET A O     1 
ATOM   1167 C  CB    . MET C 3 75  ? 26.987 44.725 24.884  1.00 23.27 ? 75   MET A CB    1 
ATOM   1168 C  CG    . MET C 3 75  ? 25.835 44.562 23.857  1.00 24.32 ? 75   MET A CG    1 
ATOM   1169 S  SD    . MET C 3 75  ? 25.802 45.996 22.738  1.00 26.19 ? 75   MET A SD    1 
ATOM   1170 C  CE    . MET C 3 75  ? 25.150 47.277 23.875  1.00 24.44 ? 75   MET A CE    1 
ATOM   1171 N  N     . GLU C 3 76  ? 29.957 44.185 26.064  1.00 25.30 ? 76   GLU A N     1 
ATOM   1172 C  CA    . GLU C 3 76  ? 30.765 44.614 27.257  1.00 26.78 ? 76   GLU A CA    1 
ATOM   1173 C  C     . GLU C 3 76  ? 32.025 43.770 27.492  1.00 25.86 ? 76   GLU A C     1 
ATOM   1174 O  O     . GLU C 3 76  ? 32.693 43.940 28.517  1.00 25.55 ? 76   GLU A O     1 
ATOM   1175 C  CB    . GLU C 3 76  ? 29.906 44.543 28.559  1.00 26.62 ? 76   GLU A CB    1 
ATOM   1176 C  CG    . GLU C 3 76  ? 28.708 45.450 28.581  1.00 31.86 ? 76   GLU A CG    1 
ATOM   1177 C  CD    . GLU C 3 76  ? 29.087 46.940 28.585  1.00 42.02 ? 76   GLU A CD    1 
ATOM   1178 O  OE1   . GLU C 3 76  ? 30.156 47.299 29.140  1.00 45.74 ? 76   GLU A OE1   1 
ATOM   1179 O  OE2   . GLU C 3 76  ? 28.318 47.760 28.036  1.00 42.03 ? 76   GLU A OE2   1 
ATOM   1180 N  N     . GLY C 3 77  ? 32.347 42.846 26.580  1.00 25.05 ? 77   GLY A N     1 
ATOM   1181 C  CA    . GLY C 3 77  ? 33.500 41.972 26.814  1.00 24.26 ? 77   GLY A CA    1 
ATOM   1182 C  C     . GLY C 3 77  ? 34.803 42.784 26.898  1.00 24.27 ? 77   GLY A C     1 
ATOM   1183 O  O     . GLY C 3 77  ? 34.981 43.766 26.146  1.00 23.49 ? 77   GLY A O     1 
ATOM   1184 N  N     . LYS C 3 78  ? 35.700 42.374 27.786  1.00 24.21 ? 78   LYS A N     1 
ATOM   1185 C  CA    . LYS C 3 78  ? 37.014 43.052 27.976  1.00 26.13 ? 78   LYS A CA    1 
ATOM   1186 C  C     . LYS C 3 78  ? 38.104 42.098 28.335  1.00 25.62 ? 78   LYS A C     1 
ATOM   1187 O  O     . LYS C 3 78  ? 37.948 41.309 29.291  1.00 25.94 ? 78   LYS A O     1 
ATOM   1188 C  CB    . LYS C 3 78  ? 36.994 44.102 29.114  1.00 26.41 ? 78   LYS A CB    1 
ATOM   1189 C  CG    . LYS C 3 78  ? 35.929 45.149 28.985  1.00 35.90 ? 78   LYS A CG    1 
ATOM   1190 N  N     . TYR C 3 79  ? 39.235 42.235 27.641  1.00 24.44 ? 79   TYR A N     1 
ATOM   1191 C  CA    . TYR C 3 79  ? 40.446 41.489 27.961  1.00 24.91 ? 79   TYR A CA    1 
ATOM   1192 C  C     . TYR C 3 79  ? 41.424 42.331 28.782  1.00 25.52 ? 79   TYR A C     1 
ATOM   1193 O  O     . TYR C 3 79  ? 41.514 43.553 28.573  1.00 25.66 ? 79   TYR A O     1 
ATOM   1194 C  CB    . TYR C 3 79  ? 41.192 41.114 26.692  1.00 25.10 ? 79   TYR A CB    1 
ATOM   1195 C  CG    . TYR C 3 79  ? 40.545 39.959 25.933  1.00 26.12 ? 79   TYR A CG    1 
ATOM   1196 C  CD1   . TYR C 3 79  ? 40.814 38.636 26.308  1.00 27.44 ? 79   TYR A CD1   1 
ATOM   1197 C  CD2   . TYR C 3 79  ? 39.672 40.201 24.868  1.00 24.78 ? 79   TYR A CD2   1 
ATOM   1198 C  CE1   . TYR C 3 79  ? 40.240 37.546 25.623  1.00 25.13 ? 79   TYR A CE1   1 
ATOM   1199 C  CE2   . TYR C 3 79  ? 39.073 39.096 24.147  1.00 23.36 ? 79   TYR A CE2   1 
ATOM   1200 C  CZ    . TYR C 3 79  ? 39.366 37.795 24.566  1.00 23.85 ? 79   TYR A CZ    1 
ATOM   1201 O  OH    . TYR C 3 79  ? 38.789 36.714 23.947  1.00 24.88 ? 79   TYR A OH    1 
ATOM   1202 N  N     . ARG C 3 80  ? 42.194 41.676 29.647  1.00 25.58 ? 80   ARG A N     1 
ATOM   1203 C  CA    . ARG C 3 80  ? 43.336 42.369 30.306  1.00 27.35 ? 80   ARG A CA    1 
ATOM   1204 C  C     . ARG C 3 80  ? 44.486 41.396 30.475  1.00 28.29 ? 80   ARG A C     1 
ATOM   1205 O  O     . ARG C 3 80  ? 44.251 40.177 30.657  1.00 28.15 ? 80   ARG A O     1 
ATOM   1206 C  CB    . ARG C 3 80  ? 42.918 42.998 31.639  1.00 25.70 ? 80   ARG A CB    1 
ATOM   1207 C  CG    . ARG C 3 80  ? 42.849 42.072 32.838  1.00 27.71 ? 80   ARG A CG    1 
ATOM   1208 C  CD    . ARG C 3 80  ? 42.316 42.845 34.081  1.00 28.67 ? 80   ARG A CD    1 
ATOM   1209 N  NE    . ARG C 3 80  ? 42.171 42.028 35.290  1.00 28.93 ? 80   ARG A NE    1 
ATOM   1210 C  CZ    . ARG C 3 80  ? 41.113 41.268 35.574  1.00 31.63 ? 80   ARG A CZ    1 
ATOM   1211 N  NH1   . ARG C 3 80  ? 40.111 41.145 34.707  1.00 30.84 ? 80   ARG A NH1   1 
ATOM   1212 N  NH2   . ARG C 3 80  ? 41.064 40.600 36.726  1.00 26.49 ? 80   ARG A NH2   1 
ATOM   1213 N  N     . LEU C 3 81  ? 45.714 41.933 30.397  1.00 29.01 ? 81   LEU A N     1 
ATOM   1214 C  CA    . LEU C 3 81  ? 46.923 41.197 30.737  1.00 29.08 ? 81   LEU A CA    1 
ATOM   1215 C  C     . LEU C 3 81  ? 47.283 41.456 32.209  1.00 30.26 ? 81   LEU A C     1 
ATOM   1216 O  O     . LEU C 3 81  ? 47.542 42.599 32.595  1.00 30.14 ? 81   LEU A O     1 
ATOM   1217 C  CB    . LEU C 3 81  ? 48.064 41.537 29.788  1.00 29.03 ? 81   LEU A CB    1 
ATOM   1218 C  CG    . LEU C 3 81  ? 47.874 40.883 28.399  1.00 31.43 ? 81   LEU A CG    1 
ATOM   1219 C  CD1   . LEU C 3 81  ? 48.812 41.475 27.327  1.00 33.98 ? 81   LEU A CD1   1 
ATOM   1220 C  CD2   . LEU C 3 81  ? 48.015 39.347 28.515  1.00 31.54 ? 81   LEU A CD2   1 
ATOM   1221 N  N     . ALA C 3 82  ? 47.272 40.388 33.021  1.00 29.81 ? 82   ALA A N     1 
ATOM   1222 C  CA    . ALA C 3 82  ? 47.439 40.508 34.455  1.00 29.31 ? 82   ALA A CA    1 
ATOM   1223 C  C     . ALA C 3 82  ? 48.572 39.617 35.009  1.00 29.82 ? 82   ALA A C     1 
ATOM   1224 O  O     . ALA C 3 82  ? 49.031 38.691 34.330  1.00 27.74 ? 82   ALA A O     1 
ATOM   1225 C  CB    . ALA C 3 82  ? 46.104 40.208 35.167  1.00 29.92 ? 82   ALA A CB    1 
ATOM   1226 N  N     . THR C 3 83  ? 49.069 39.934 36.220  1.00 30.68 ? 83   THR A N     1 
ATOM   1227 C  CA    . THR C 3 83  ? 50.078 39.076 36.857  1.00 30.49 ? 83   THR A CA    1 
ATOM   1228 C  C     . THR C 3 83  ? 49.433 37.756 37.235  1.00 31.41 ? 83   THR A C     1 
ATOM   1229 O  O     . THR C 3 83  ? 48.199 37.676 37.371  1.00 31.39 ? 83   THR A O     1 
ATOM   1230 C  CB    . THR C 3 83  ? 50.648 39.708 38.158  1.00 31.53 ? 83   THR A CB    1 
ATOM   1231 O  OG1   . THR C 3 83  ? 49.555 40.067 39.006  1.00 31.25 ? 83   THR A OG1   1 
ATOM   1232 C  CG2   . THR C 3 83  ? 51.491 40.988 37.837  1.00 29.23 ? 83   THR A CG2   1 
ATOM   1233 N  N     . LEU C 3 84  ? 50.254 36.717 37.413  1.00 31.75 ? 84   LEU A N     1 
ATOM   1234 C  CA    . LEU C 3 84  ? 49.749 35.407 37.813  1.00 33.12 ? 84   LEU A CA    1 
ATOM   1235 C  C     . LEU C 3 84  ? 49.070 35.428 39.166  1.00 33.40 ? 84   LEU A C     1 
ATOM   1236 O  O     . LEU C 3 84  ? 48.162 34.640 39.416  1.00 33.55 ? 84   LEU A O     1 
ATOM   1237 C  CB    . LEU C 3 84  ? 50.872 34.346 37.775  1.00 33.43 ? 84   LEU A CB    1 
ATOM   1238 C  CG    . LEU C 3 84  ? 51.401 33.953 36.383  1.00 36.10 ? 84   LEU A CG    1 
ATOM   1239 C  CD1   . LEU C 3 84  ? 52.467 32.839 36.427  1.00 36.63 ? 84   LEU A CD1   1 
ATOM   1240 C  CD2   . LEU C 3 84  ? 50.227 33.465 35.518  1.00 36.08 ? 84   LEU A CD2   1 
ATOM   1241 N  N     . ASP C 3 85  ? 49.473 36.352 40.045  1.00 34.31 ? 85   ASP A N     1 
ATOM   1242 C  CA    . ASP C 3 85  ? 48.864 36.428 41.370  1.00 35.42 ? 85   ASP A CA    1 
ATOM   1243 C  C     . ASP C 3 85  ? 47.702 37.409 41.406  1.00 35.96 ? 85   ASP A C     1 
ATOM   1244 O  O     . ASP C 3 85  ? 47.186 37.687 42.484  1.00 36.42 ? 85   ASP A O     1 
ATOM   1245 C  CB    . ASP C 3 85  ? 49.921 36.799 42.467  1.00 36.13 ? 85   ASP A CB    1 
ATOM   1246 C  CG    . ASP C 3 85  ? 50.342 38.279 42.426  1.00 37.19 ? 85   ASP A CG    1 
ATOM   1247 O  OD1   . ASP C 3 85  ? 50.169 38.970 41.396  1.00 38.90 ? 85   ASP A OD1   1 
ATOM   1248 O  OD2   . ASP C 3 85  ? 50.848 38.778 43.454  1.00 38.81 ? 85   ASP A OD2   1 
ATOM   1249 N  N     . ALA C 3 86  ? 47.274 37.958 40.263  1.00 34.76 ? 86   ALA A N     1 
ATOM   1250 C  CA    . ALA C 3 86  ? 46.185 38.963 40.321  1.00 34.36 ? 86   ALA A CA    1 
ATOM   1251 C  C     . ALA C 3 86  ? 44.902 38.379 40.950  1.00 34.46 ? 86   ALA A C     1 
ATOM   1252 O  O     . ALA C 3 86  ? 44.547 37.216 40.681  1.00 33.39 ? 86   ALA A O     1 
ATOM   1253 C  CB    . ALA C 3 86  ? 45.884 39.517 38.910  1.00 34.50 ? 86   ALA A CB    1 
ATOM   1254 N  N     . PRO C 3 87  ? 44.205 39.179 41.772  1.00 34.08 ? 87   PRO A N     1 
ATOM   1255 C  CA    . PRO C 3 87  ? 42.991 38.681 42.385  1.00 34.80 ? 87   PRO A CA    1 
ATOM   1256 C  C     . PRO C 3 87  ? 41.826 38.635 41.370  1.00 34.47 ? 87   PRO A C     1 
ATOM   1257 O  O     . PRO C 3 87  ? 41.801 39.415 40.413  1.00 33.11 ? 87   PRO A O     1 
ATOM   1258 C  CB    . PRO C 3 87  ? 42.742 39.666 43.522  1.00 35.48 ? 87   PRO A CB    1 
ATOM   1259 C  CG    . PRO C 3 87  ? 43.347 40.956 43.069  1.00 35.08 ? 87   PRO A CG    1 
ATOM   1260 C  CD    . PRO C 3 87  ? 44.507 40.571 42.167  1.00 35.66 ? 87   PRO A CD    1 
ATOM   1261 N  N     . ARG C 3 88  ? 40.913 37.699 41.588  1.00 33.28 ? 88   ARG A N     1 
ATOM   1262 C  CA    . ARG C 3 88  ? 39.707 37.562 40.761  1.00 34.97 ? 88   ARG A CA    1 
ATOM   1263 C  C     . ARG C 3 88  ? 38.862 38.835 40.865  1.00 34.96 ? 88   ARG A C     1 
ATOM   1264 O  O     . ARG C 3 88  ? 38.786 39.437 41.947  1.00 33.85 ? 88   ARG A O     1 
ATOM   1265 C  CB    . ARG C 3 88  ? 38.872 36.351 41.224  1.00 35.19 ? 88   ARG A CB    1 
ATOM   1266 N  N     . GLU C 3 89  ? 38.262 39.256 39.747  1.00 33.21 ? 89   GLU A N     1 
ATOM   1267 C  CA    . GLU C 3 89  ? 37.253 40.306 39.749  1.00 33.40 ? 89   GLU A CA    1 
ATOM   1268 C  C     . GLU C 3 89  ? 35.916 39.670 39.420  1.00 33.74 ? 89   GLU A C     1 
ATOM   1269 O  O     . GLU C 3 89  ? 35.846 38.579 38.812  1.00 31.26 ? 89   GLU A O     1 
ATOM   1270 C  CB    . GLU C 3 89  ? 37.604 41.448 38.778  1.00 32.73 ? 89   GLU A CB    1 
ATOM   1271 C  CG    . GLU C 3 89  ? 38.817 42.268 39.286  1.00 35.64 ? 89   GLU A CG    1 
ATOM   1272 C  CD    . GLU C 3 89  ? 39.309 43.327 38.312  1.00 36.94 ? 89   GLU A CD    1 
ATOM   1273 O  OE1   . GLU C 3 89  ? 38.661 43.545 37.264  1.00 40.59 ? 89   GLU A OE1   1 
ATOM   1274 O  OE2   . GLU C 3 89  ? 40.349 43.958 38.602  1.00 41.08 ? 89   GLU A OE2   1 
ATOM   1275 N  N     . LYS C 3 90  ? 34.863 40.336 39.851  1.00 32.82 ? 90   LYS A N     1 
ATOM   1276 C  CA    . LYS C 3 90  ? 33.534 39.796 39.833  1.00 35.67 ? 90   LYS A CA    1 
ATOM   1277 C  C     . LYS C 3 90  ? 33.119 39.166 38.486  1.00 34.01 ? 90   LYS A C     1 
ATOM   1278 O  O     . LYS C 3 90  ? 32.559 38.048 38.465  1.00 33.83 ? 90   LYS A O     1 
ATOM   1279 C  CB    . LYS C 3 90  ? 32.525 40.893 40.228  1.00 34.95 ? 90   LYS A CB    1 
ATOM   1280 C  CG    . LYS C 3 90  ? 31.097 40.417 40.380  1.00 39.58 ? 90   LYS A CG    1 
ATOM   1281 C  CD    . LYS C 3 90  ? 30.240 41.550 40.991  1.00 39.96 ? 90   LYS A CD    1 
ATOM   1282 C  CE    . LYS C 3 90  ? 28.778 41.109 41.237  1.00 47.03 ? 90   LYS A CE    1 
ATOM   1283 N  NZ    . LYS C 3 90  ? 28.680 39.722 41.722  1.00 50.64 ? 90   LYS A NZ    1 
ATOM   1284 N  N     . HIS C 3 91  ? 33.407 39.853 37.388  1.00 31.57 ? 91   HIS A N     1 
ATOM   1285 C  CA    . HIS C 3 91  ? 32.870 39.391 36.064  1.00 29.83 ? 91   HIS A CA    1 
ATOM   1286 C  C     . HIS C 3 91  ? 33.906 38.715 35.144  1.00 28.59 ? 91   HIS A C     1 
ATOM   1287 O  O     . HIS C 3 91  ? 33.672 38.555 33.938  1.00 27.21 ? 91   HIS A O     1 
ATOM   1288 C  CB    . HIS C 3 91  ? 32.117 40.539 35.373  1.00 30.27 ? 91   HIS A CB    1 
ATOM   1289 C  CG    . HIS C 3 91  ? 30.931 41.027 36.162  1.00 29.46 ? 91   HIS A CG    1 
ATOM   1290 N  ND1   . HIS C 3 91  ? 29.837 40.230 36.427  1.00 33.90 ? 91   HIS A ND1   1 
ATOM   1291 C  CD2   . HIS C 3 91  ? 30.725 42.181 36.834  1.00 31.19 ? 91   HIS A CD2   1 
ATOM   1292 C  CE1   . HIS C 3 91  ? 28.976 40.900 37.175  1.00 32.99 ? 91   HIS A CE1   1 
ATOM   1293 N  NE2   . HIS C 3 91  ? 29.484 42.096 37.414  1.00 33.24 ? 91   HIS A NE2   1 
ATOM   1294 N  N     . ASP C 3 92  ? 34.995 38.246 35.754  1.00 26.37 ? 92   ASP A N     1 
ATOM   1295 C  CA    . ASP C 3 92  ? 36.022 37.467 35.082  1.00 27.29 ? 92   ASP A CA    1 
ATOM   1296 C  C     . ASP C 3 92  ? 35.484 36.098 34.788  1.00 27.29 ? 92   ASP A C     1 
ATOM   1297 O  O     . ASP C 3 92  ? 34.936 35.458 35.697  1.00 25.54 ? 92   ASP A O     1 
ATOM   1298 C  CB    . ASP C 3 92  ? 37.233 37.306 36.019  1.00 26.21 ? 92   ASP A CB    1 
ATOM   1299 C  CG    . ASP C 3 92  ? 38.048 38.594 36.164  1.00 28.01 ? 92   ASP A CG    1 
ATOM   1300 O  OD1   . ASP C 3 92  ? 37.765 39.588 35.456  1.00 25.34 ? 92   ASP A OD1   1 
ATOM   1301 O  OD2   . ASP C 3 92  ? 38.993 38.596 36.982  1.00 26.15 ? 92   ASP A OD2   1 
ATOM   1302 N  N     . HIS C 3 93  ? 35.669 35.602 33.552  1.00 27.19 ? 93   HIS A N     1 
ATOM   1303 C  CA    . HIS C 3 93  ? 35.069 34.300 33.174  1.00 26.08 ? 93   HIS A CA    1 
ATOM   1304 C  C     . HIS C 3 93  ? 36.050 33.228 32.751  1.00 27.38 ? 93   HIS A C     1 
ATOM   1305 O  O     . HIS C 3 93  ? 35.807 32.034 32.976  1.00 28.18 ? 93   HIS A O     1 
ATOM   1306 C  CB    . HIS C 3 93  ? 34.027 34.519 32.025  1.00 26.97 ? 93   HIS A CB    1 
ATOM   1307 C  CG    . HIS C 3 93  ? 32.892 35.415 32.406  1.00 25.65 ? 93   HIS A CG    1 
ATOM   1308 N  ND1   . HIS C 3 93  ? 32.208 35.281 33.599  1.00 26.75 ? 93   HIS A ND1   1 
ATOM   1309 C  CD2   . HIS C 3 93  ? 32.340 36.468 31.766  1.00 25.13 ? 93   HIS A CD2   1 
ATOM   1310 C  CE1   . HIS C 3 93  ? 31.268 36.211 33.663  1.00 29.87 ? 93   HIS A CE1   1 
ATOM   1311 N  NE2   . HIS C 3 93  ? 31.325 36.942 32.560  1.00 27.91 ? 93   HIS A NE2   1 
ATOM   1312 N  N     . LEU C 3 94  ? 37.140 33.621 32.107  1.00 27.46 ? 94   LEU A N     1 
ATOM   1313 C  CA    . LEU C 3 94  ? 38.125 32.697 31.537  1.00 28.06 ? 94   LEU A CA    1 
ATOM   1314 C  C     . LEU C 3 94  ? 39.499 33.327 31.623  1.00 28.14 ? 94   LEU A C     1 
ATOM   1315 O  O     . LEU C 3 94  ? 39.617 34.566 31.557  1.00 27.20 ? 94   LEU A O     1 
ATOM   1316 C  CB    . LEU C 3 94  ? 37.879 32.465 30.039  1.00 28.40 ? 94   LEU A CB    1 
ATOM   1317 C  CG    . LEU C 3 94  ? 36.483 32.118 29.539  1.00 30.99 ? 94   LEU A CG    1 
ATOM   1318 C  CD1   . LEU C 3 94  ? 36.400 32.157 27.999  1.00 29.99 ? 94   LEU A CD1   1 
ATOM   1319 C  CD2   . LEU C 3 94  ? 36.049 30.741 30.029  1.00 31.78 ? 94   LEU A CD2   1 
ATOM   1320 N  N     . THR C 3 95  ? 40.518 32.481 31.732  1.00 27.90 ? 95   THR A N     1 
ATOM   1321 C  CA    . THR C 3 95  ? 41.900 32.928 31.644  1.00 28.85 ? 95   THR A CA    1 
ATOM   1322 C  C     . THR C 3 95  ? 42.780 31.921 30.935  1.00 29.72 ? 95   THR A C     1 
ATOM   1323 O  O     . THR C 3 95  ? 42.586 30.720 31.087  1.00 30.65 ? 95   THR A O     1 
ATOM   1324 C  CB    . THR C 3 95  ? 42.515 33.243 33.054  1.00 30.45 ? 95   THR A CB    1 
ATOM   1325 O  OG1   . THR C 3 95  ? 43.851 33.718 32.870  1.00 30.93 ? 95   THR A OG1   1 
ATOM   1326 C  CG2   . THR C 3 95  ? 42.567 31.981 33.952  1.00 26.30 ? 95   THR A CG2   1 
ATOM   1327 N  N     . MET C 3 96  ? 43.731 32.434 30.150  1.00 29.80 ? 96   MET A N     1 
ATOM   1328 C  CA    . MET C 3 96  ? 44.842 31.665 29.609  1.00 32.24 ? 96   MET A CA    1 
ATOM   1329 C  C     . MET C 3 96  ? 46.077 32.117 30.372  1.00 31.37 ? 96   MET A C     1 
ATOM   1330 O  O     . MET C 3 96  ? 46.446 33.297 30.297  1.00 29.46 ? 96   MET A O     1 
ATOM   1331 C  CB    . MET C 3 96  ? 45.145 32.012 28.146  1.00 30.90 ? 96   MET A CB    1 
ATOM   1332 C  CG    . MET C 3 96  ? 44.005 31.996 27.226  1.00 35.78 ? 96   MET A CG    1 
ATOM   1333 S  SD    . MET C 3 96  ? 44.466 32.137 25.462  1.00 38.76 ? 96   MET A SD    1 
ATOM   1334 C  CE    . MET C 3 96  ? 46.100 32.612 25.409  1.00 36.27 ? 96   MET A CE    1 
ATOM   1335 N  N     . LYS C 3 97  ? 46.735 31.170 31.036  1.00 31.72 ? 97   LYS A N     1 
ATOM   1336 C  CA    . LYS C 3 97  ? 47.939 31.455 31.816  1.00 31.98 ? 97   LYS A CA    1 
ATOM   1337 C  C     . LYS C 3 97  ? 49.198 31.162 31.046  1.00 32.71 ? 97   LYS A C     1 
ATOM   1338 O  O     . LYS C 3 97  ? 49.333 30.097 30.436  1.00 33.66 ? 97   LYS A O     1 
ATOM   1339 C  CB    . LYS C 3 97  ? 47.898 30.660 33.112  1.00 32.47 ? 97   LYS A CB    1 
ATOM   1340 C  CG    . LYS C 3 97  ? 46.682 31.023 33.933  1.00 33.74 ? 97   LYS A CG    1 
ATOM   1341 C  CD    . LYS C 3 97  ? 46.758 30.440 35.366  1.00 38.85 ? 97   LYS A CD    1 
ATOM   1342 C  CE    . LYS C 3 97  ? 45.639 31.026 36.189  1.00 41.76 ? 97   LYS A CE    1 
ATOM   1343 N  NZ    . LYS C 3 97  ? 45.760 30.678 37.618  1.00 44.41 ? 97   LYS A NZ    1 
ATOM   1344 N  N     . PHE C 3 98  ? 50.128 32.116 31.082  1.00 32.67 ? 98   PHE A N     1 
ATOM   1345 C  CA    . PHE C 3 98  ? 51.428 31.976 30.478  1.00 33.78 ? 98   PHE A CA    1 
ATOM   1346 C  C     . PHE C 3 98  ? 52.453 31.893 31.614  1.00 34.72 ? 98   PHE A C     1 
ATOM   1347 O  O     . PHE C 3 98  ? 52.081 31.911 32.777  1.00 34.24 ? 98   PHE A O     1 
ATOM   1348 C  CB    . PHE C 3 98  ? 51.727 33.198 29.613  1.00 32.87 ? 98   PHE A CB    1 
ATOM   1349 C  CG    . PHE C 3 98  ? 50.620 33.548 28.651  1.00 33.55 ? 98   PHE A CG    1 
ATOM   1350 C  CD1   . PHE C 3 98  ? 50.281 32.682 27.618  1.00 32.92 ? 98   PHE A CD1   1 
ATOM   1351 C  CD2   . PHE C 3 98  ? 49.949 34.771 28.753  1.00 33.10 ? 98   PHE A CD2   1 
ATOM   1352 C  CE1   . PHE C 3 98  ? 49.242 33.019 26.688  1.00 33.31 ? 98   PHE A CE1   1 
ATOM   1353 C  CE2   . PHE C 3 98  ? 48.909 35.094 27.855  1.00 33.92 ? 98   PHE A CE2   1 
ATOM   1354 C  CZ    . PHE C 3 98  ? 48.573 34.216 26.830  1.00 32.67 ? 98   PHE A CZ    1 
ATOM   1355 N  N     . ALA C 3 99  ? 53.733 31.825 31.264  1.00 35.48 ? 99   ALA A N     1 
ATOM   1356 C  CA    . ALA C 3 99  ? 54.811 31.739 32.283  1.00 37.26 ? 99   ALA A CA    1 
ATOM   1357 C  C     . ALA C 3 99  ? 54.951 33.026 33.098  1.00 37.89 ? 99   ALA A C     1 
ATOM   1358 O  O     . ALA C 3 99  ? 55.234 32.976 34.300  1.00 38.26 ? 99   ALA A O     1 
ATOM   1359 C  CB    . ALA C 3 99  ? 56.141 31.390 31.623  1.00 37.39 ? 99   ALA A CB    1 
ATOM   1360 N  N     . ASP C 3 100 ? 54.716 34.167 32.440  1.00 37.54 ? 100  ASP A N     1 
ATOM   1361 C  CA    . ASP C 3 100 ? 55.010 35.472 33.017  1.00 37.38 ? 100  ASP A CA    1 
ATOM   1362 C  C     . ASP C 3 100 ? 53.752 36.326 33.260  1.00 36.77 ? 100  ASP A C     1 
ATOM   1363 O  O     . ASP C 3 100 ? 53.887 37.508 33.620  1.00 36.86 ? 100  ASP A O     1 
ATOM   1364 C  CB    . ASP C 3 100 ? 55.945 36.237 32.097  1.00 38.36 ? 100  ASP A CB    1 
ATOM   1365 N  N     . GLY C 3 101 ? 52.559 35.748 33.044  1.00 34.17 ? 101  GLY A N     1 
ATOM   1366 C  CA    . GLY C 3 101 ? 51.299 36.435 33.311  1.00 33.17 ? 101  GLY A CA    1 
ATOM   1367 C  C     . GLY C 3 101 ? 50.132 35.674 32.685  1.00 32.48 ? 101  GLY A C     1 
ATOM   1368 O  O     . GLY C 3 101 ? 50.272 34.503 32.293  1.00 31.45 ? 101  GLY A O     1 
ATOM   1369 N  N     . GLN C 3 102 ? 48.977 36.338 32.618  1.00 31.45 ? 102  GLN A N     1 
ATOM   1370 C  CA    . GLN C 3 102 ? 47.734 35.681 32.176  1.00 30.44 ? 102  GLN A CA    1 
ATOM   1371 C  C     . GLN C 3 102 ? 46.827 36.645 31.432  1.00 30.58 ? 102  GLN A C     1 
ATOM   1372 O  O     . GLN C 3 102 ? 46.806 37.865 31.737  1.00 29.54 ? 102  GLN A O     1 
ATOM   1373 C  CB    . GLN C 3 102 ? 46.964 35.087 33.353  1.00 30.75 ? 102  GLN A CB    1 
ATOM   1374 C  CG    . GLN C 3 102 ? 46.532 36.082 34.436  1.00 29.74 ? 102  GLN A CG    1 
ATOM   1375 C  CD    . GLN C 3 102 ? 45.778 35.383 35.572  1.00 32.32 ? 102  GLN A CD    1 
ATOM   1376 O  OE1   . GLN C 3 102 ? 44.983 34.465 35.318  1.00 32.61 ? 102  GLN A OE1   1 
ATOM   1377 N  NE2   . GLN C 3 102 ? 45.983 35.839 36.818  1.00 29.29 ? 102  GLN A NE2   1 
ATOM   1378 N  N     . LEU C 3 103 ? 46.063 36.083 30.489  1.00 28.12 ? 103  LEU A N     1 
ATOM   1379 C  CA    . LEU C 3 103 ? 45.140 36.873 29.683  1.00 27.68 ? 103  LEU A CA    1 
ATOM   1380 C  C     . LEU C 3 103 ? 43.740 36.548 30.179  1.00 26.96 ? 103  LEU A C     1 
ATOM   1381 O  O     . LEU C 3 103 ? 43.263 35.405 30.038  1.00 27.91 ? 103  LEU A O     1 
ATOM   1382 C  CB    . LEU C 3 103 ? 45.279 36.555 28.182  1.00 26.55 ? 103  LEU A CB    1 
ATOM   1383 C  CG    . LEU C 3 103 ? 44.149 37.187 27.342  1.00 27.44 ? 103  LEU A CG    1 
ATOM   1384 C  CD1   . LEU C 3 103 ? 44.305 38.704 27.299  1.00 27.76 ? 103  LEU A CD1   1 
ATOM   1385 C  CD2   . LEU C 3 103 ? 44.156 36.593 25.925  1.00 29.89 ? 103  LEU A CD2   1 
ATOM   1386 N  N     . ILE C 3 104 ? 43.099 37.525 30.797  1.00 24.62 ? 104  ILE A N     1 
ATOM   1387 C  CA    . ILE C 3 104 ? 41.785 37.322 31.404  1.00 24.84 ? 104  ILE A CA    1 
ATOM   1388 C  C     . ILE C 3 104 ? 40.687 37.976 30.559  1.00 25.71 ? 104  ILE A C     1 
ATOM   1389 O  O     . ILE C 3 104 ? 40.827 39.144 30.114  1.00 25.85 ? 104  ILE A O     1 
ATOM   1390 C  CB    . ILE C 3 104 ? 41.741 37.900 32.865  1.00 25.03 ? 104  ILE A CB    1 
ATOM   1391 C  CG1   . ILE C 3 104 ? 42.805 37.196 33.747  1.00 25.65 ? 104  ILE A CG1   1 
ATOM   1392 C  CG2   . ILE C 3 104 ? 40.378 37.723 33.510  1.00 22.73 ? 104  ILE A CG2   1 
ATOM   1393 C  CD1   . ILE C 3 104 ? 43.043 37.939 35.141  1.00 25.37 ? 104  ILE A CD1   1 
ATOM   1394 N  N     . TYR C 3 105 ? 39.605 37.214 30.346  1.00 24.85 ? 105  TYR A N     1 
ATOM   1395 C  CA    . TYR C 3 105 ? 38.381 37.701 29.690  1.00 24.38 ? 105  TYR A CA    1 
ATOM   1396 C  C     . TYR C 3 105 ? 37.271 37.941 30.684  1.00 24.11 ? 105  TYR A C     1 
ATOM   1397 O  O     . TYR C 3 105 ? 36.901 37.068 31.476  1.00 25.03 ? 105  TYR A O     1 
ATOM   1398 C  CB    . TYR C 3 105 ? 37.876 36.711 28.616  1.00 23.45 ? 105  TYR A CB    1 
ATOM   1399 C  CG    . TYR C 3 105 ? 36.649 37.269 27.904  1.00 22.56 ? 105  TYR A CG    1 
ATOM   1400 C  CD1   . TYR C 3 105 ? 36.780 38.281 26.978  1.00 20.86 ? 105  TYR A CD1   1 
ATOM   1401 C  CD2   . TYR C 3 105 ? 35.363 36.787 28.202  1.00 23.74 ? 105  TYR A CD2   1 
ATOM   1402 C  CE1   . TYR C 3 105 ? 35.638 38.835 26.327  1.00 25.34 ? 105  TYR A CE1   1 
ATOM   1403 C  CE2   . TYR C 3 105 ? 34.236 37.310 27.568  1.00 23.42 ? 105  TYR A CE2   1 
ATOM   1404 C  CZ    . TYR C 3 105 ? 34.391 38.357 26.619  1.00 22.21 ? 105  TYR A CZ    1 
ATOM   1405 O  OH    . TYR C 3 105 ? 33.250 38.872 25.984  1.00 23.74 ? 105  TYR A OH    1 
ATOM   1406 N  N     . ALA C 3 106 ? 36.744 39.164 30.683  1.00 24.01 ? 106  ALA A N     1 
ATOM   1407 C  CA    . ALA C 3 106 ? 35.633 39.495 31.576  1.00 23.82 ? 106  ALA A CA    1 
ATOM   1408 C  C     . ALA C 3 106 ? 34.450 40.019 30.744  1.00 24.00 ? 106  ALA A C     1 
ATOM   1409 O  O     . ALA C 3 106 ? 34.653 40.656 29.706  1.00 25.05 ? 106  ALA A O     1 
ATOM   1410 C  CB    . ALA C 3 106 ? 36.060 40.584 32.572  1.00 23.98 ? 106  ALA A CB    1 
ATOM   1411 N  N     . ASP C 3 107 ? 33.230 39.801 31.212  1.00 23.57 ? 107  ASP A N     1 
ATOM   1412 C  CA    . ASP C 3 107 ? 32.048 40.251 30.458  1.00 24.93 ? 107  ASP A CA    1 
ATOM   1413 C  C     . ASP C 3 107 ? 30.883 40.349 31.413  1.00 24.99 ? 107  ASP A C     1 
ATOM   1414 O  O     . ASP C 3 107 ? 30.275 39.336 31.758  1.00 28.23 ? 107  ASP A O     1 
ATOM   1415 C  CB    . ASP C 3 107 ? 31.730 39.222 29.346  1.00 23.63 ? 107  ASP A CB    1 
ATOM   1416 C  CG    . ASP C 3 107 ? 30.785 39.762 28.286  1.00 25.21 ? 107  ASP A CG    1 
ATOM   1417 O  OD1   . ASP C 3 107 ? 29.846 40.481 28.651  1.00 25.03 ? 107  ASP A OD1   1 
ATOM   1418 O  OD2   . ASP C 3 107 ? 30.944 39.402 27.084  1.00 25.36 ? 107  ASP A OD2   1 
ATOM   1419 N  N     . VAL C 3 108 ? 30.527 41.564 31.823  1.00 26.79 ? 108  VAL A N     1 
ATOM   1420 C  CA    . VAL C 3 108 ? 29.446 41.730 32.818  1.00 26.79 ? 108  VAL A CA    1 
ATOM   1421 C  C     . VAL C 3 108 ? 28.154 41.042 32.364  1.00 27.19 ? 108  VAL A C     1 
ATOM   1422 O  O     . VAL C 3 108 ? 27.515 40.290 33.148  1.00 26.76 ? 108  VAL A O     1 
ATOM   1423 C  CB    . VAL C 3 108 ? 29.141 43.228 33.095  1.00 28.18 ? 108  VAL A CB    1 
ATOM   1424 C  CG1   . VAL C 3 108 ? 27.874 43.373 34.000  1.00 25.94 ? 108  VAL A CG1   1 
ATOM   1425 C  CG2   . VAL C 3 108 ? 30.346 43.915 33.746  1.00 30.95 ? 108  VAL A CG2   1 
ATOM   1426 N  N     . ARG C 3 109 ? 27.783 41.237 31.090  1.00 25.33 ? 109  ARG A N     1 
ATOM   1427 C  CA    . ARG C 3 109 ? 26.484 40.748 30.595  1.00 26.04 ? 109  ARG A CA    1 
ATOM   1428 C  C     . ARG C 3 109 ? 26.477 39.276 30.132  1.00 26.67 ? 109  ARG A C     1 
ATOM   1429 O  O     . ARG C 3 109 ? 25.399 38.731 29.800  1.00 26.77 ? 109  ARG A O     1 
ATOM   1430 C  CB    . ARG C 3 109 ? 25.923 41.682 29.477  1.00 26.19 ? 109  ARG A CB    1 
ATOM   1431 C  CG    . ARG C 3 109 ? 25.710 43.110 30.003  1.00 26.90 ? 109  ARG A CG    1 
ATOM   1432 C  CD    . ARG C 3 109 ? 25.043 44.091 29.001  1.00 27.65 ? 109  ARG A CD    1 
ATOM   1433 N  NE    . ARG C 3 109 ? 23.630 43.781 28.756  1.00 27.36 ? 109  ARG A NE    1 
ATOM   1434 C  CZ    . ARG C 3 109 ? 22.891 44.397 27.832  1.00 28.69 ? 109  ARG A CZ    1 
ATOM   1435 N  NH1   . ARG C 3 109 ? 23.430 45.344 27.088  1.00 26.86 ? 109  ARG A NH1   1 
ATOM   1436 N  NH2   . ARG C 3 109 ? 21.632 44.040 27.625  1.00 27.42 ? 109  ARG A NH2   1 
ATOM   1437 N  N     . LYS C 3 110 ? 27.649 38.651 30.139  1.00 24.72 ? 110  LYS A N     1 
ATOM   1438 C  CA    . LYS C 3 110 ? 27.828 37.265 29.719  1.00 25.95 ? 110  LYS A CA    1 
ATOM   1439 C  C     . LYS C 3 110 ? 27.421 37.033 28.234  1.00 25.42 ? 110  LYS A C     1 
ATOM   1440 O  O     . LYS C 3 110 ? 26.990 35.948 27.889  1.00 23.29 ? 110  LYS A O     1 
ATOM   1441 C  CB    . LYS C 3 110 ? 27.103 36.293 30.694  1.00 26.53 ? 110  LYS A CB    1 
ATOM   1442 C  CG    . LYS C 3 110 ? 27.723 36.212 32.088  1.00 27.24 ? 110  LYS A CG    1 
ATOM   1443 C  CD    . LYS C 3 110 ? 26.816 35.316 33.015  1.00 28.13 ? 110  LYS A CD    1 
ATOM   1444 C  CE    . LYS C 3 110 ? 27.572 34.925 34.278  1.00 34.50 ? 110  LYS A CE    1 
ATOM   1445 N  NZ    . LYS C 3 110 ? 27.405 36.035 35.223  1.00 34.83 ? 110  LYS A NZ    1 
ATOM   1446 N  N     . PHE C 3 111 ? 27.592 38.043 27.357  1.00 23.19 ? 111  PHE A N     1 
ATOM   1447 C  CA    . PHE C 3 111 ? 27.137 37.877 25.967  1.00 23.88 ? 111  PHE A CA    1 
ATOM   1448 C  C     . PHE C 3 111 ? 28.218 37.336 25.061  1.00 24.53 ? 111  PHE A C     1 
ATOM   1449 O  O     . PHE C 3 111 ? 27.919 36.650 24.071  1.00 24.90 ? 111  PHE A O     1 
ATOM   1450 C  CB    . PHE C 3 111 ? 26.634 39.205 25.330  1.00 25.05 ? 111  PHE A CB    1 
ATOM   1451 C  CG    . PHE C 3 111 ? 25.301 39.730 25.875  1.00 24.05 ? 111  PHE A CG    1 
ATOM   1452 C  CD1   . PHE C 3 111 ? 24.519 38.988 26.732  1.00 23.91 ? 111  PHE A CD1   1 
ATOM   1453 C  CD2   . PHE C 3 111 ? 24.857 41.026 25.479  1.00 26.80 ? 111  PHE A CD2   1 
ATOM   1454 C  CE1   . PHE C 3 111 ? 23.295 39.487 27.224  1.00 23.12 ? 111  PHE A CE1   1 
ATOM   1455 C  CE2   . PHE C 3 111 ? 23.615 41.542 25.920  1.00 23.80 ? 111  PHE A CE2   1 
ATOM   1456 C  CZ    . PHE C 3 111 ? 22.822 40.766 26.799  1.00 24.58 ? 111  PHE A CZ    1 
ATOM   1457 N  N     . GLY C 3 112 ? 29.463 37.643 25.399  1.00 23.90 ? 112  GLY A N     1 
ATOM   1458 C  CA    . GLY C 3 112 ? 30.637 37.294 24.565  1.00 24.07 ? 112  GLY A CA    1 
ATOM   1459 C  C     . GLY C 3 112 ? 30.754 35.787 24.414  1.00 24.40 ? 112  GLY A C     1 
ATOM   1460 O  O     . GLY C 3 112 ? 30.278 35.036 25.272  1.00 23.21 ? 112  GLY A O     1 
ATOM   1461 N  N     . THR C 3 113 ? 31.422 35.348 23.344  1.00 23.84 ? 113  THR A N     1 
ATOM   1462 C  CA    . THR C 3 113 ? 31.508 33.922 23.008  1.00 24.40 ? 113  THR A CA    1 
ATOM   1463 C  C     . THR C 3 113 ? 32.916 33.536 22.559  1.00 24.24 ? 113  THR A C     1 
ATOM   1464 O  O     . THR C 3 113 ? 33.624 34.366 21.975  1.00 23.55 ? 113  THR A O     1 
ATOM   1465 C  CB    . THR C 3 113 ? 30.542 33.582 21.828  1.00 24.16 ? 113  THR A CB    1 
ATOM   1466 O  OG1   . THR C 3 113 ? 30.931 34.348 20.681  1.00 24.43 ? 113  THR A OG1   1 
ATOM   1467 C  CG2   . THR C 3 113 ? 29.123 33.966 22.143  1.00 25.72 ? 113  THR A CG2   1 
ATOM   1468 N  N     . TRP C 3 114 ? 33.308 32.280 22.816  1.00 22.93 ? 114  TRP A N     1 
ATOM   1469 C  CA    . TRP C 3 114 ? 34.511 31.695 22.261  1.00 23.86 ? 114  TRP A CA    1 
ATOM   1470 C  C     . TRP C 3 114 ? 34.113 30.418 21.478  1.00 23.47 ? 114  TRP A C     1 
ATOM   1471 O  O     . TRP C 3 114 ? 33.257 29.644 21.956  1.00 24.24 ? 114  TRP A O     1 
ATOM   1472 C  CB    . TRP C 3 114 ? 35.432 31.247 23.394  1.00 23.74 ? 114  TRP A CB    1 
ATOM   1473 C  CG    . TRP C 3 114 ? 36.397 32.271 23.985  1.00 25.24 ? 114  TRP A CG    1 
ATOM   1474 C  CD1   . TRP C 3 114 ? 36.361 33.656 23.895  1.00 25.31 ? 114  TRP A CD1   1 
ATOM   1475 C  CD2   . TRP C 3 114 ? 37.545 31.939 24.770  1.00 24.46 ? 114  TRP A CD2   1 
ATOM   1476 N  NE1   . TRP C 3 114 ? 37.469 34.189 24.592  1.00 24.53 ? 114  TRP A NE1   1 
ATOM   1477 C  CE2   . TRP C 3 114 ? 38.198 33.150 25.119  1.00 23.60 ? 114  TRP A CE2   1 
ATOM   1478 C  CE3   . TRP C 3 114 ? 38.090 30.709 25.214  1.00 23.73 ? 114  TRP A CE3   1 
ATOM   1479 C  CZ2   . TRP C 3 114 ? 39.373 33.171 25.916  1.00 24.54 ? 114  TRP A CZ2   1 
ATOM   1480 C  CZ3   . TRP C 3 114 ? 39.264 30.717 25.985  1.00 25.78 ? 114  TRP A CZ3   1 
ATOM   1481 C  CH2   . TRP C 3 114 ? 39.890 31.955 26.342  1.00 26.66 ? 114  TRP A CH2   1 
ATOM   1482 N  N     . GLU C 3 115 ? 34.765 30.178 20.341  1.00 23.23 ? 115  GLU A N     1 
ATOM   1483 C  CA    . GLU C 3 115 ? 34.509 28.953 19.528  1.00 24.49 ? 115  GLU A CA    1 
ATOM   1484 C  C     . GLU C 3 115 ? 35.816 28.493 18.950  1.00 25.80 ? 115  GLU A C     1 
ATOM   1485 O  O     . GLU C 3 115 ? 36.535 29.293 18.306  1.00 24.22 ? 115  GLU A O     1 
ATOM   1486 C  CB    . GLU C 3 115 ? 33.549 29.271 18.384  1.00 25.50 ? 115  GLU A CB    1 
ATOM   1487 C  CG    . GLU C 3 115 ? 32.087 29.424 18.765  1.00 25.32 ? 115  GLU A CG    1 
ATOM   1488 C  CD    . GLU C 3 115 ? 31.302 30.100 17.684  1.00 29.41 ? 115  GLU A CD    1 
ATOM   1489 O  OE1   . GLU C 3 115 ? 31.510 31.309 17.501  1.00 31.30 ? 115  GLU A OE1   1 
ATOM   1490 O  OE2   . GLU C 3 115 ? 30.524 29.415 16.983  1.00 32.42 ? 115  GLU A OE2   1 
ATOM   1491 N  N     . LEU C 3 116 ? 36.151 27.210 19.178  1.00 26.02 ? 116  LEU A N     1 
ATOM   1492 C  CA    . LEU C 3 116 ? 37.389 26.666 18.704  1.00 28.29 ? 116  LEU A CA    1 
ATOM   1493 C  C     . LEU C 3 116 ? 37.131 25.939 17.378  1.00 29.47 ? 116  LEU A C     1 
ATOM   1494 O  O     . LEU C 3 116 ? 36.343 25.007 17.337  1.00 29.84 ? 116  LEU A O     1 
ATOM   1495 C  CB    . LEU C 3 116 ? 38.022 25.690 19.729  1.00 29.15 ? 116  LEU A CB    1 
ATOM   1496 C  CG    . LEU C 3 116 ? 39.423 25.115 19.403  1.00 29.71 ? 116  LEU A CG    1 
ATOM   1497 C  CD1   . LEU C 3 116 ? 40.442 26.243 19.142  1.00 30.58 ? 116  LEU A CD1   1 
ATOM   1498 C  CD2   . LEU C 3 116 ? 39.935 24.186 20.596  1.00 31.33 ? 116  LEU A CD2   1 
ATOM   1499 N  N     . ILE C 3 117 ? 37.794 26.374 16.310  1.00 29.91 ? 117  ILE A N     1 
ATOM   1500 C  CA    . ILE C 3 117 ? 37.646 25.739 15.011  1.00 31.71 ? 117  ILE A CA    1 
ATOM   1501 C  C     . ILE C 3 117 ? 39.008 25.553 14.329  1.00 32.61 ? 117  ILE A C     1 
ATOM   1502 O  O     . ILE C 3 117 ? 40.008 26.090 14.788  1.00 33.49 ? 117  ILE A O     1 
ATOM   1503 C  CB    . ILE C 3 117 ? 36.663 26.491 14.131  1.00 32.86 ? 117  ILE A CB    1 
ATOM   1504 C  CG1   . ILE C 3 117 ? 37.216 27.849 13.746  1.00 29.94 ? 117  ILE A CG1   1 
ATOM   1505 C  CG2   . ILE C 3 117 ? 35.233 26.645 14.821  1.00 33.70 ? 117  ILE A CG2   1 
ATOM   1506 C  CD1   . ILE C 3 117 ? 36.318 28.507 12.693  1.00 34.07 ? 117  ILE A CD1   1 
ATOM   1507 N  N     . SER C 3 118 ? 39.080 24.746 13.267  1.00 32.67 ? 118  SER A N     1 
ATOM   1508 C  CA    . SER C 3 118 ? 40.369 24.544 12.632  1.00 32.45 ? 118  SER A CA    1 
ATOM   1509 C  C     . SER C 3 118 ? 40.671 25.629 11.567  1.00 31.53 ? 118  SER A C     1 
ATOM   1510 O  O     . SER C 3 118 ? 39.790 26.324 11.094  1.00 30.57 ? 118  SER A O     1 
ATOM   1511 C  CB    . SER C 3 118 ? 40.457 23.121 12.072  1.00 32.86 ? 118  SER A CB    1 
ATOM   1512 O  OG    . SER C 3 118 ? 39.782 23.142 10.872  1.00 37.78 ? 118  SER A OG    1 
ATOM   1513 N  N     . THR C 3 119 ? 41.944 25.797 11.236  1.00 32.04 ? 119  THR A N     1 
ATOM   1514 C  CA    . THR C 3 119 ? 42.380 26.799 10.279  1.00 31.99 ? 119  THR A CA    1 
ATOM   1515 C  C     . THR C 3 119 ? 41.534 26.757 8.998   1.00 31.84 ? 119  THR A C     1 
ATOM   1516 O  O     . THR C 3 119 ? 41.110 27.793 8.498   1.00 31.06 ? 119  THR A O     1 
ATOM   1517 C  CB    . THR C 3 119 ? 43.873 26.596 9.943   1.00 31.58 ? 119  THR A CB    1 
ATOM   1518 O  OG1   . THR C 3 119 ? 44.618 26.683 11.157  1.00 34.79 ? 119  THR A OG1   1 
ATOM   1519 C  CG2   . THR C 3 119 ? 44.358 27.620 8.940   1.00 31.30 ? 119  THR A CG2   1 
ATOM   1520 N  N     . ASP C 3 120 ? 41.301 25.569 8.458   1.00 31.87 ? 120  ASP A N     1 
ATOM   1521 C  CA    . ASP C 3 120 ? 40.548 25.495 7.194   1.00 33.46 ? 120  ASP A CA    1 
ATOM   1522 C  C     . ASP C 3 120 ? 39.033 25.735 7.309   1.00 32.61 ? 120  ASP A C     1 
ATOM   1523 O  O     . ASP C 3 120 ? 38.346 25.787 6.294   1.00 32.98 ? 120  ASP A O     1 
ATOM   1524 C  CB    . ASP C 3 120 ? 40.877 24.211 6.400   1.00 34.53 ? 120  ASP A CB    1 
ATOM   1525 C  CG    . ASP C 3 120 ? 40.309 22.943 7.024   1.00 39.40 ? 120  ASP A CG    1 
ATOM   1526 O  OD1   . ASP C 3 120 ? 39.771 22.935 8.155   1.00 41.53 ? 120  ASP A OD1   1 
ATOM   1527 O  OD2   . ASP C 3 120 ? 40.399 21.907 6.333   1.00 46.08 ? 120  ASP A OD2   1 
ATOM   1528 N  N     . GLN C 3 121 ? 38.532 25.893 8.537   1.00 30.47 ? 121  GLN A N     1 
ATOM   1529 C  CA    . GLN C 3 121 ? 37.105 26.140 8.780   1.00 30.45 ? 121  GLN A CA    1 
ATOM   1530 C  C     . GLN C 3 121 ? 36.776 27.627 9.010   1.00 29.19 ? 121  GLN A C     1 
ATOM   1531 O  O     . GLN C 3 121 ? 35.614 27.973 9.140   1.00 27.29 ? 121  GLN A O     1 
ATOM   1532 C  CB    . GLN C 3 121 ? 36.619 25.300 9.971   1.00 30.94 ? 121  GLN A CB    1 
ATOM   1533 C  CG    . GLN C 3 121 ? 36.710 23.802 9.710   1.00 34.12 ? 121  GLN A CG    1 
ATOM   1534 N  N     . VAL C 3 122 ? 37.810 28.478 9.063   1.00 28.60 ? 122  VAL A N     1 
ATOM   1535 C  CA    . VAL C 3 122 ? 37.648 29.939 9.335   1.00 27.94 ? 122  VAL A CA    1 
ATOM   1536 C  C     . VAL C 3 122 ? 36.968 30.646 8.203   1.00 27.85 ? 122  VAL A C     1 
ATOM   1537 O  O     . VAL C 3 122 ? 35.935 31.327 8.411   1.00 26.90 ? 122  VAL A O     1 
ATOM   1538 C  CB    . VAL C 3 122 ? 39.024 30.615 9.664   1.00 28.17 ? 122  VAL A CB    1 
ATOM   1539 C  CG1   . VAL C 3 122 ? 38.895 32.187 9.762   1.00 28.22 ? 122  VAL A CG1   1 
ATOM   1540 C  CG2   . VAL C 3 122 ? 39.527 30.025 10.948  1.00 28.85 ? 122  VAL A CG2   1 
ATOM   1541 N  N     . LEU C 3 123 ? 37.481 30.473 6.974   1.00 27.44 ? 123  LEU A N     1 
ATOM   1542 C  CA    . LEU C 3 123 ? 36.718 31.015 5.837   1.00 28.54 ? 123  LEU A CA    1 
ATOM   1543 C  C     . LEU C 3 123 ? 35.234 30.536 5.739   1.00 28.17 ? 123  LEU A C     1 
ATOM   1544 O  O     . LEU C 3 123 ? 34.339 31.379 5.672   1.00 29.25 ? 123  LEU A O     1 
ATOM   1545 C  CB    . LEU C 3 123 ? 37.504 30.920 4.494   1.00 29.40 ? 123  LEU A CB    1 
ATOM   1546 C  CG    . LEU C 3 123 ? 38.823 31.680 4.447   1.00 30.89 ? 123  LEU A CG    1 
ATOM   1547 C  CD1   . LEU C 3 123 ? 39.535 31.376 3.055   1.00 34.47 ? 123  LEU A CD1   1 
ATOM   1548 C  CD2   . LEU C 3 123 ? 38.753 33.199 4.726   1.00 31.53 ? 123  LEU A CD2   1 
ATOM   1549 N  N     . PRO C 3 124 ? 34.936 29.208 5.763   1.00 28.11 ? 124  PRO A N     1 
ATOM   1550 C  CA    . PRO C 3 124 ? 33.503 28.790 5.813   1.00 28.14 ? 124  PRO A CA    1 
ATOM   1551 C  C     . PRO C 3 124 ? 32.669 29.382 6.983   1.00 27.45 ? 124  PRO A C     1 
ATOM   1552 O  O     . PRO C 3 124 ? 31.520 29.753 6.822   1.00 27.29 ? 124  PRO A O     1 
ATOM   1553 C  CB    . PRO C 3 124 ? 33.584 27.265 5.991   1.00 27.83 ? 124  PRO A CB    1 
ATOM   1554 C  CG    . PRO C 3 124 ? 34.934 26.891 5.259   1.00 29.98 ? 124  PRO A CG    1 
ATOM   1555 C  CD    . PRO C 3 124 ? 35.850 28.053 5.661   1.00 29.29 ? 124  PRO A CD    1 
ATOM   1556 N  N     . TYR C 3 125 ? 33.279 29.475 8.158   1.00 27.65 ? 125  TYR A N     1 
ATOM   1557 C  CA    . TYR C 3 125 ? 32.605 30.057 9.331   1.00 26.83 ? 125  TYR A CA    1 
ATOM   1558 C  C     . TYR C 3 125 ? 32.071 31.475 9.019   1.00 26.28 ? 125  TYR A C     1 
ATOM   1559 O  O     . TYR C 3 125 ? 30.896 31.809 9.291   1.00 26.68 ? 125  TYR A O     1 
ATOM   1560 C  CB    . TYR C 3 125 ? 33.602 30.085 10.494  1.00 26.42 ? 125  TYR A CB    1 
ATOM   1561 C  CG    . TYR C 3 125 ? 33.094 30.795 11.767  1.00 28.70 ? 125  TYR A CG    1 
ATOM   1562 C  CD1   . TYR C 3 125 ? 33.086 32.187 11.855  1.00 29.10 ? 125  TYR A CD1   1 
ATOM   1563 C  CD2   . TYR C 3 125 ? 32.602 30.057 12.858  1.00 28.70 ? 125  TYR A CD2   1 
ATOM   1564 C  CE1   . TYR C 3 125 ? 32.604 32.854 13.027  1.00 29.18 ? 125  TYR A CE1   1 
ATOM   1565 C  CE2   . TYR C 3 125 ? 32.123 30.722 14.030  1.00 28.43 ? 125  TYR A CE2   1 
ATOM   1566 C  CZ    . TYR C 3 125 ? 32.136 32.101 14.105  1.00 28.74 ? 125  TYR A CZ    1 
ATOM   1567 O  OH    . TYR C 3 125 ? 31.686 32.750 15.267  1.00 28.72 ? 125  TYR A OH    1 
ATOM   1568 N  N     . PHE C 3 126 ? 32.909 32.312 8.440   1.00 26.15 ? 126  PHE A N     1 
ATOM   1569 C  CA    . PHE C 3 126 ? 32.466 33.675 8.158   1.00 26.53 ? 126  PHE A CA    1 
ATOM   1570 C  C     . PHE C 3 126 ? 31.542 33.787 6.945   1.00 27.34 ? 126  PHE A C     1 
ATOM   1571 O  O     . PHE C 3 126 ? 30.697 34.659 6.888   1.00 26.56 ? 126  PHE A O     1 
ATOM   1572 C  CB    . PHE C 3 126 ? 33.636 34.637 8.054   1.00 26.96 ? 126  PHE A CB    1 
ATOM   1573 C  CG    . PHE C 3 126 ? 34.302 34.890 9.377   1.00 25.95 ? 126  PHE A CG    1 
ATOM   1574 C  CD1   . PHE C 3 126 ? 33.630 35.613 10.376  1.00 25.61 ? 126  PHE A CD1   1 
ATOM   1575 C  CD2   . PHE C 3 126 ? 35.574 34.376 9.646   1.00 23.96 ? 126  PHE A CD2   1 
ATOM   1576 C  CE1   . PHE C 3 126 ? 34.224 35.843 11.645  1.00 25.43 ? 126  PHE A CE1   1 
ATOM   1577 C  CE2   . PHE C 3 126 ? 36.183 34.587 10.927  1.00 25.90 ? 126  PHE A CE2   1 
ATOM   1578 C  CZ    . PHE C 3 126 ? 35.480 35.310 11.923  1.00 26.99 ? 126  PHE A CZ    1 
ATOM   1579 N  N     . LEU C 3 127 ? 31.710 32.906 5.972   1.00 27.73 ? 127  LEU A N     1 
ATOM   1580 C  CA    . LEU C 3 127 ? 30.716 32.824 4.896   1.00 29.09 ? 127  LEU A CA    1 
ATOM   1581 C  C     . LEU C 3 127 ? 29.330 32.473 5.473   1.00 28.50 ? 127  LEU A C     1 
ATOM   1582 O  O     . LEU C 3 127 ? 28.331 33.052 5.086   1.00 29.30 ? 127  LEU A O     1 
ATOM   1583 C  CB    . LEU C 3 127 ? 31.181 31.791 3.841   1.00 29.52 ? 127  LEU A CB    1 
ATOM   1584 C  CG    . LEU C 3 127 ? 32.407 32.135 2.985   1.00 31.92 ? 127  LEU A CG    1 
ATOM   1585 C  CD1   . LEU C 3 127 ? 32.864 30.923 2.162   1.00 38.12 ? 127  LEU A CD1   1 
ATOM   1586 C  CD2   . LEU C 3 127 ? 32.055 33.272 2.006   1.00 37.13 ? 127  LEU A CD2   1 
ATOM   1587 N  N     . LYS C 3 128 ? 29.268 31.546 6.434   1.00 29.18 ? 128  LYS A N     1 
ATOM   1588 C  CA    . LYS C 3 128 ? 27.994 31.129 6.997   1.00 30.49 ? 128  LYS A CA    1 
ATOM   1589 C  C     . LYS C 3 128 ? 27.351 32.271 7.798   1.00 30.80 ? 128  LYS A C     1 
ATOM   1590 O  O     . LYS C 3 128 ? 26.140 32.441 7.767   1.00 31.07 ? 128  LYS A O     1 
ATOM   1591 C  CB    . LYS C 3 128 ? 28.173 29.861 7.847   1.00 31.32 ? 128  LYS A CB    1 
ATOM   1592 C  CG    . LYS C 3 128 ? 26.909 29.206 8.393   1.00 34.03 ? 128  LYS A CG    1 
ATOM   1593 C  CD    . LYS C 3 128 ? 27.324 28.053 9.336   1.00 32.90 ? 128  LYS A CD    1 
ATOM   1594 C  CE    . LYS C 3 128 ? 26.142 27.189 9.896   1.00 38.35 ? 128  LYS A CE    1 
ATOM   1595 N  NZ    . LYS C 3 128 ? 24.944 27.978 10.245  1.00 46.27 ? 128  LYS A NZ    1 
ATOM   1596 N  N     . LYS C 3 129 ? 28.182 33.077 8.468   1.00 30.90 ? 129  LYS A N     1 
ATOM   1597 C  CA    . LYS C 3 129 ? 27.717 34.271 9.166   1.00 31.14 ? 129  LYS A CA    1 
ATOM   1598 C  C     . LYS C 3 129 ? 27.234 35.363 8.168   1.00 31.73 ? 129  LYS A C     1 
ATOM   1599 O  O     . LYS C 3 129 ? 26.563 36.294 8.574   1.00 32.56 ? 129  LYS A O     1 
ATOM   1600 C  CB    . LYS C 3 129 ? 28.835 34.873 10.016  1.00 29.99 ? 129  LYS A CB    1 
ATOM   1601 C  CG    . LYS C 3 129 ? 29.362 34.046 11.213  1.00 31.80 ? 129  LYS A CG    1 
ATOM   1602 C  CD    . LYS C 3 129 ? 28.376 33.839 12.319  1.00 30.59 ? 129  LYS A CD    1 
ATOM   1603 C  CE    . LYS C 3 129 ? 28.969 32.872 13.377  1.00 30.68 ? 129  LYS A CE    1 
ATOM   1604 N  NZ    . LYS C 3 129 ? 27.831 32.566 14.314  1.00 33.78 ? 129  LYS A NZ    1 
ATOM   1605 N  N     . LYS C 3 130 ? 27.640 35.286 6.904   1.00 31.48 ? 130  LYS A N     1 
ATOM   1606 C  CA    . LYS C 3 130 ? 27.250 36.296 5.892   1.00 32.49 ? 130  LYS A CA    1 
ATOM   1607 C  C     . LYS C 3 130 ? 27.868 37.706 6.108   1.00 31.47 ? 130  LYS A C     1 
ATOM   1608 O  O     . LYS C 3 130 ? 27.312 38.724 5.658   1.00 30.04 ? 130  LYS A O     1 
ATOM   1609 C  CB    . LYS C 3 130 ? 25.715 36.358 5.742   1.00 32.91 ? 130  LYS A CB    1 
ATOM   1610 C  CG    . LYS C 3 130 ? 25.110 35.049 5.157   1.00 33.50 ? 130  LYS A CG    1 
ATOM   1611 C  CD    . LYS C 3 130 ? 23.591 35.175 4.995   1.00 37.39 ? 130  LYS A CD    1 
ATOM   1612 N  N     . ILE C 3 131 ? 29.054 37.740 6.724   1.00 28.42 ? 131  ILE A N     1 
ATOM   1613 C  CA    . ILE C 3 131 ? 29.734 38.997 7.000   1.00 28.77 ? 131  ILE A CA    1 
ATOM   1614 C  C     . ILE C 3 131 ? 30.115 39.647 5.685   1.00 28.32 ? 131  ILE A C     1 
ATOM   1615 O  O     . ILE C 3 131 ? 30.659 38.972 4.829   1.00 27.30 ? 131  ILE A O     1 
ATOM   1616 C  CB    . ILE C 3 131 ? 31.019 38.738 7.823   1.00 28.85 ? 131  ILE A CB    1 
ATOM   1617 C  CG1   . ILE C 3 131 ? 30.650 37.974 9.097   1.00 32.34 ? 131  ILE A CG1   1 
ATOM   1618 C  CG2   . ILE C 3 131 ? 31.690 40.053 8.212   1.00 30.84 ? 131  ILE A CG2   1 
ATOM   1619 C  CD1   . ILE C 3 131 ? 29.467 38.629 9.920   1.00 35.97 ? 131  ILE A CD1   1 
ATOM   1620 N  N     . GLY C 3 132 ? 29.826 40.947 5.534   1.00 27.83 ? 132  GLY A N     1 
ATOM   1621 C  CA    . GLY C 3 132 ? 30.266 41.696 4.381   1.00 27.68 ? 132  GLY A CA    1 
ATOM   1622 C  C     . GLY C 3 132 ? 31.745 42.084 4.368   1.00 27.04 ? 132  GLY A C     1 
ATOM   1623 O  O     . GLY C 3 132 ? 32.537 41.646 5.205   1.00 26.63 ? 132  GLY A O     1 
ATOM   1624 N  N     . PRO C 3 133 ? 32.130 42.940 3.396   1.00 26.44 ? 133  PRO A N     1 
ATOM   1625 C  CA    . PRO C 3 133 ? 33.535 43.270 3.198   1.00 25.90 ? 133  PRO A CA    1 
ATOM   1626 C  C     . PRO C 3 133 ? 34.100 44.093 4.318   1.00 25.46 ? 133  PRO A C     1 
ATOM   1627 O  O     . PRO C 3 133 ? 33.364 44.898 4.941   1.00 25.95 ? 133  PRO A O     1 
ATOM   1628 C  CB    . PRO C 3 133 ? 33.537 44.134 1.895   1.00 27.08 ? 133  PRO A CB    1 
ATOM   1629 C  CG    . PRO C 3 133 ? 32.107 44.570 1.687   1.00 25.72 ? 133  PRO A CG    1 
ATOM   1630 C  CD    . PRO C 3 133 ? 31.232 43.532 2.385   1.00 25.50 ? 133  PRO A CD    1 
ATOM   1631 N  N     . GLU C 3 134 ? 35.400 43.942 4.571   1.00 24.63 ? 134  GLU A N     1 
ATOM   1632 C  CA    . GLU C 3 134 ? 36.087 44.909 5.462   1.00 24.18 ? 134  GLU A CA    1 
ATOM   1633 C  C     . GLU C 3 134 ? 35.967 46.345 4.899   1.00 24.31 ? 134  GLU A C     1 
ATOM   1634 O  O     . GLU C 3 134 ? 35.865 46.495 3.676   1.00 24.73 ? 134  GLU A O     1 
ATOM   1635 C  CB    . GLU C 3 134 ? 37.578 44.523 5.627   1.00 23.92 ? 134  GLU A CB    1 
ATOM   1636 C  CG    . GLU C 3 134 ? 37.820 43.211 6.326   1.00 25.57 ? 134  GLU A CG    1 
ATOM   1637 C  CD    . GLU C 3 134 ? 37.347 43.254 7.782   1.00 26.43 ? 134  GLU A CD    1 
ATOM   1638 O  OE1   . GLU C 3 134 ? 37.733 44.214 8.499   1.00 27.91 ? 134  GLU A OE1   1 
ATOM   1639 O  OE2   . GLU C 3 134 ? 36.646 42.306 8.216   1.00 25.38 ? 134  GLU A OE2   1 
ATOM   1640 N  N     . PRO C 3 135 ? 35.898 47.385 5.788   1.00 24.89 ? 135  PRO A N     1 
ATOM   1641 C  CA    . PRO C 3 135 ? 35.717 48.819 5.450   1.00 25.26 ? 135  PRO A CA    1 
ATOM   1642 C  C     . PRO C 3 135 ? 37.031 49.475 5.014   1.00 26.20 ? 135  PRO A C     1 
ATOM   1643 O  O     . PRO C 3 135 ? 37.582 50.326 5.728   1.00 26.08 ? 135  PRO A O     1 
ATOM   1644 C  CB    . PRO C 3 135 ? 35.241 49.439 6.771   1.00 26.32 ? 135  PRO A CB    1 
ATOM   1645 C  CG    . PRO C 3 135 ? 35.931 48.574 7.872   1.00 25.72 ? 135  PRO A CG    1 
ATOM   1646 C  CD    . PRO C 3 135 ? 35.926 47.149 7.256   1.00 25.85 ? 135  PRO A CD    1 
ATOM   1647 N  N     . THR C 3 136 ? 37.577 48.976 3.915   1.00 27.45 ? 136  THR A N     1 
ATOM   1648 C  CA    . THR C 3 136 ? 38.803 49.530 3.328   1.00 28.44 ? 136  THR A CA    1 
ATOM   1649 C  C     . THR C 3 136 ? 38.553 49.886 1.873   1.00 28.72 ? 136  THR A C     1 
ATOM   1650 O  O     . THR C 3 136 ? 37.660 49.322 1.234   1.00 27.14 ? 136  THR A O     1 
ATOM   1651 C  CB    . THR C 3 136 ? 39.991 48.509 3.364   1.00 28.74 ? 136  THR A CB    1 
ATOM   1652 O  OG1   . THR C 3 136 ? 39.698 47.369 2.546   1.00 31.01 ? 136  THR A OG1   1 
ATOM   1653 C  CG2   . THR C 3 136 ? 40.238 47.965 4.828   1.00 29.92 ? 136  THR A CG2   1 
ATOM   1654 N  N     . TYR C 3 137 ? 39.378 50.782 1.313   1.00 29.99 ? 137  TYR A N     1 
ATOM   1655 C  CA    . TYR C 3 137 ? 39.195 51.098 -0.115  1.00 31.64 ? 137  TYR A CA    1 
ATOM   1656 C  C     . TYR C 3 137 ? 39.366 49.833 -0.985  1.00 31.40 ? 137  TYR A C     1 
ATOM   1657 O  O     . TYR C 3 137 ? 38.625 49.618 -1.953  1.00 30.14 ? 137  TYR A O     1 
ATOM   1658 C  CB    . TYR C 3 137 ? 40.113 52.272 -0.557  1.00 32.17 ? 137  TYR A CB    1 
ATOM   1659 C  CG    . TYR C 3 137 ? 39.618 53.592 -0.051  1.00 34.29 ? 137  TYR A CG    1 
ATOM   1660 C  CD1   . TYR C 3 137 ? 38.465 54.178 -0.602  1.00 36.12 ? 137  TYR A CD1   1 
ATOM   1661 C  CD2   . TYR C 3 137 ? 40.274 54.272 0.974   1.00 37.23 ? 137  TYR A CD2   1 
ATOM   1662 C  CE1   . TYR C 3 137 ? 37.981 55.410 -0.119  1.00 37.80 ? 137  TYR A CE1   1 
ATOM   1663 C  CE2   . TYR C 3 137 ? 39.783 55.515 1.467   1.00 37.62 ? 137  TYR A CE2   1 
ATOM   1664 C  CZ    . TYR C 3 137 ? 38.656 56.062 0.910   1.00 38.71 ? 137  TYR A CZ    1 
ATOM   1665 O  OH    . TYR C 3 137 ? 38.178 57.291 1.368   1.00 42.69 ? 137  TYR A OH    1 
ATOM   1666 N  N     . GLU C 3 138 ? 40.290 48.942 -0.597  1.00 32.81 ? 138  GLU A N     1 
ATOM   1667 C  CA    . GLU C 3 138 ? 40.595 47.765 -1.409  1.00 31.94 ? 138  GLU A CA    1 
ATOM   1668 C  C     . GLU C 3 138 ? 39.468 46.713 -1.382  1.00 32.70 ? 138  GLU A C     1 
ATOM   1669 O  O     . GLU C 3 138 ? 39.204 46.050 -2.392  1.00 32.42 ? 138  GLU A O     1 
ATOM   1670 C  CB    . GLU C 3 138 ? 41.919 47.113 -0.941  1.00 34.69 ? 138  GLU A CB    1 
ATOM   1671 N  N     . ASP C 3 139 ? 38.824 46.520 -0.224  1.00 30.58 ? 139  ASP A N     1 
ATOM   1672 C  CA    . ASP C 3 139 ? 37.839 45.446 -0.113  1.00 31.32 ? 139  ASP A CA    1 
ATOM   1673 C  C     . ASP C 3 139 ? 36.385 45.897 -0.249  1.00 29.58 ? 139  ASP A C     1 
ATOM   1674 O  O     . ASP C 3 139 ? 35.534 45.094 -0.595  1.00 29.31 ? 139  ASP A O     1 
ATOM   1675 C  CB    . ASP C 3 139 ? 38.001 44.724 1.225   1.00 32.08 ? 139  ASP A CB    1 
ATOM   1676 C  CG    . ASP C 3 139 ? 39.180 43.728 1.244   1.00 37.85 ? 139  ASP A CG    1 
ATOM   1677 O  OD1   . ASP C 3 139 ? 39.971 43.591 0.259   1.00 41.44 ? 139  ASP A OD1   1 
ATOM   1678 O  OD2   . ASP C 3 139 ? 39.308 43.067 2.293   1.00 44.43 ? 139  ASP A OD2   1 
ATOM   1679 N  N     . PHE C 3 140 ? 36.084 47.163 0.065   1.00 28.61 ? 140  PHE A N     1 
ATOM   1680 C  CA    . PHE C 3 140 ? 34.678 47.625 0.092   1.00 27.89 ? 140  PHE A CA    1 
ATOM   1681 C  C     . PHE C 3 140 ? 34.356 48.259 -1.276  1.00 27.86 ? 140  PHE A C     1 
ATOM   1682 O  O     . PHE C 3 140 ? 34.678 49.417 -1.510  1.00 27.55 ? 140  PHE A O     1 
ATOM   1683 C  CB    . PHE C 3 140 ? 34.540 48.646 1.248   1.00 27.60 ? 140  PHE A CB    1 
ATOM   1684 C  CG    . PHE C 3 140 ? 33.130 49.171 1.481   1.00 27.29 ? 140  PHE A CG    1 
ATOM   1685 C  CD1   . PHE C 3 140 ? 32.007 48.510 1.000   1.00 25.98 ? 140  PHE A CD1   1 
ATOM   1686 C  CD2   . PHE C 3 140 ? 32.961 50.345 2.231   1.00 27.96 ? 140  PHE A CD2   1 
ATOM   1687 C  CE1   . PHE C 3 140 ? 30.723 49.019 1.234   1.00 26.14 ? 140  PHE A CE1   1 
ATOM   1688 C  CE2   . PHE C 3 140 ? 31.692 50.867 2.472   1.00 24.58 ? 140  PHE A CE2   1 
ATOM   1689 C  CZ    . PHE C 3 140 ? 30.569 50.190 1.986   1.00 27.04 ? 140  PHE A CZ    1 
ATOM   1690 N  N     . ASP C 3 141 ? 33.780 47.468 -2.177  1.00 27.21 ? 141  ASP A N     1 
ATOM   1691 C  CA    . ASP C 3 141 ? 33.502 47.892 -3.541  1.00 27.68 ? 141  ASP A CA    1 
ATOM   1692 C  C     . ASP C 3 141 ? 32.195 48.707 -3.540  1.00 26.53 ? 141  ASP A C     1 
ATOM   1693 O  O     . ASP C 3 141 ? 31.117 48.181 -3.203  1.00 27.18 ? 141  ASP A O     1 
ATOM   1694 C  CB    . ASP C 3 141 ? 33.384 46.665 -4.463  1.00 27.43 ? 141  ASP A CB    1 
ATOM   1695 C  CG    . ASP C 3 141 ? 32.676 46.992 -5.801  1.00 29.00 ? 141  ASP A CG    1 
ATOM   1696 O  OD1   . ASP C 3 141 ? 32.967 48.060 -6.372  1.00 26.44 ? 141  ASP A OD1   1 
ATOM   1697 O  OD2   . ASP C 3 141 ? 31.824 46.184 -6.238  1.00 32.21 ? 141  ASP A OD2   1 
ATOM   1698 N  N     . GLU C 3 142 ? 32.317 49.981 -3.884  1.00 26.12 ? 142  GLU A N     1 
ATOM   1699 C  CA    . GLU C 3 142 ? 31.147 50.879 -3.994  1.00 28.19 ? 142  GLU A CA    1 
ATOM   1700 C  C     . GLU C 3 142 ? 30.130 50.407 -5.005  1.00 28.67 ? 142  GLU A C     1 
ATOM   1701 O  O     . GLU C 3 142 ? 28.951 50.671 -4.827  1.00 27.78 ? 142  GLU A O     1 
ATOM   1702 C  CB    . GLU C 3 142 ? 31.585 52.301 -4.395  1.00 28.30 ? 142  GLU A CB    1 
ATOM   1703 C  CG    . GLU C 3 142 ? 30.419 53.322 -4.429  1.00 29.70 ? 142  GLU A CG    1 
ATOM   1704 C  CD    . GLU C 3 142 ? 30.896 54.745 -4.570  1.00 29.33 ? 142  GLU A CD    1 
ATOM   1705 O  OE1   . GLU C 3 142 ? 31.965 55.088 -4.047  1.00 33.88 ? 142  GLU A OE1   1 
ATOM   1706 O  OE2   . GLU C 3 142 ? 30.184 55.529 -5.220  1.00 34.22 ? 142  GLU A OE2   1 
ATOM   1707 N  N     . LYS C 3 143 ? 30.562 49.725 -6.087  1.00 28.37 ? 143  LYS A N     1 
ATOM   1708 C  CA    . LYS C 3 143 ? 29.575 49.303 -7.098  1.00 29.25 ? 143  LYS A CA    1 
ATOM   1709 C  C     . LYS C 3 143 ? 28.567 48.297 -6.588  1.00 28.59 ? 143  LYS A C     1 
ATOM   1710 O  O     . LYS C 3 143 ? 27.371 48.442 -6.829  1.00 29.02 ? 143  LYS A O     1 
ATOM   1711 C  CB    . LYS C 3 143 ? 30.258 48.764 -8.390  1.00 30.58 ? 143  LYS A CB    1 
ATOM   1712 C  CG    . LYS C 3 143 ? 31.077 49.816 -9.048  1.00 33.50 ? 143  LYS A CG    1 
ATOM   1713 C  CD    . LYS C 3 143 ? 31.892 49.162 -10.183 1.00 39.07 ? 143  LYS A CD    1 
ATOM   1714 C  CE    . LYS C 3 143 ? 33.334 49.557 -10.049 1.00 43.11 ? 143  LYS A CE    1 
ATOM   1715 N  NZ    . LYS C 3 143 ? 33.595 50.613 -11.024 1.00 49.20 ? 143  LYS A NZ    1 
ATOM   1716 N  N     . LEU C 3 144 ? 29.024 47.229 -5.933  1.00 27.65 ? 144  LEU A N     1 
ATOM   1717 C  CA    . LEU C 3 144 ? 28.106 46.267 -5.341  1.00 28.63 ? 144  LEU A CA    1 
ATOM   1718 C  C     . LEU C 3 144 ? 27.273 46.920 -4.214  1.00 27.56 ? 144  LEU A C     1 
ATOM   1719 O  O     . LEU C 3 144 ? 26.103 46.613 -4.043  1.00 28.11 ? 144  LEU A O     1 
ATOM   1720 C  CB    . LEU C 3 144 ? 28.889 45.046 -4.759  1.00 28.51 ? 144  LEU A CB    1 
ATOM   1721 C  CG    . LEU C 3 144 ? 28.064 43.905 -4.161  1.00 31.21 ? 144  LEU A CG    1 
ATOM   1722 C  CD1   . LEU C 3 144 ? 26.989 43.341 -5.134  1.00 36.03 ? 144  LEU A CD1   1 
ATOM   1723 C  CD2   . LEU C 3 144 ? 28.972 42.758 -3.610  1.00 32.00 ? 144  LEU A CD2   1 
ATOM   1724 N  N     . PHE C 3 145 ? 27.898 47.768 -3.415  1.00 25.87 ? 145  PHE A N     1 
ATOM   1725 C  CA    . PHE C 3 145 ? 27.176 48.466 -2.307  1.00 26.31 ? 145  PHE A CA    1 
ATOM   1726 C  C     . PHE C 3 145 ? 25.976 49.237 -2.892  1.00 26.78 ? 145  PHE A C     1 
ATOM   1727 O  O     . PHE C 3 145 ? 24.817 49.118 -2.422  1.00 26.71 ? 145  PHE A O     1 
ATOM   1728 C  CB    . PHE C 3 145 ? 28.194 49.420 -1.700  1.00 24.23 ? 145  PHE A CB    1 
ATOM   1729 C  CG    . PHE C 3 145 ? 27.723 50.220 -0.531  1.00 24.52 ? 145  PHE A CG    1 
ATOM   1730 C  CD1   . PHE C 3 145 ? 27.202 49.613 0.610   1.00 23.55 ? 145  PHE A CD1   1 
ATOM   1731 C  CD2   . PHE C 3 145 ? 27.929 51.630 -0.540  1.00 22.01 ? 145  PHE A CD2   1 
ATOM   1732 C  CE1   . PHE C 3 145 ? 26.808 50.451 1.759   1.00 23.10 ? 145  PHE A CE1   1 
ATOM   1733 C  CE2   . PHE C 3 145 ? 27.570 52.455 0.575   1.00 21.90 ? 145  PHE A CE2   1 
ATOM   1734 C  CZ    . PHE C 3 145 ? 27.014 51.855 1.713   1.00 24.43 ? 145  PHE A CZ    1 
ATOM   1735 N  N     . ARG C 3 146 ? 26.249 50.007 -3.937  1.00 26.62 ? 146  ARG A N     1 
ATOM   1736 C  CA    . ARG C 3 146 ? 25.176 50.790 -4.612  1.00 27.98 ? 146  ARG A CA    1 
ATOM   1737 C  C     . ARG C 3 146 ? 24.044 49.870 -5.111  1.00 29.22 ? 146  ARG A C     1 
ATOM   1738 O  O     . ARG C 3 146 ? 22.835 50.180 -4.993  1.00 29.46 ? 146  ARG A O     1 
ATOM   1739 C  CB    . ARG C 3 146 ? 25.786 51.623 -5.739  1.00 27.76 ? 146  ARG A CB    1 
ATOM   1740 C  CG    . ARG C 3 146 ? 24.758 52.407 -6.633  1.00 28.22 ? 146  ARG A CG    1 
ATOM   1741 C  CD    . ARG C 3 146 ? 25.485 53.395 -7.511  1.00 31.22 ? 146  ARG A CD    1 
ATOM   1742 N  NE    . ARG C 3 146 ? 26.307 52.804 -8.562  1.00 37.36 ? 146  ARG A NE    1 
ATOM   1743 C  CZ    . ARG C 3 146 ? 27.621 53.004 -8.687  1.00 40.13 ? 146  ARG A CZ    1 
ATOM   1744 N  NH1   . ARG C 3 146 ? 28.289 53.751 -7.796  1.00 42.33 ? 146  ARG A NH1   1 
ATOM   1745 N  NH2   . ARG C 3 146 ? 28.268 52.456 -9.698  1.00 37.07 ? 146  ARG A NH2   1 
ATOM   1746 N  N     . GLU C 3 147 ? 24.401 48.732 -5.693  1.00 29.55 ? 147  GLU A N     1 
ATOM   1747 C  CA    . GLU C 3 147 ? 23.375 47.904 -6.280  1.00 31.58 ? 147  GLU A CA    1 
ATOM   1748 C  C     . GLU C 3 147 ? 22.530 47.282 -5.178  1.00 31.53 ? 147  GLU A C     1 
ATOM   1749 O  O     . GLU C 3 147 ? 21.298 47.138 -5.311  1.00 31.19 ? 147  GLU A O     1 
ATOM   1750 C  CB    . GLU C 3 147 ? 23.976 46.858 -7.245  1.00 32.27 ? 147  GLU A CB    1 
ATOM   1751 C  CG    . GLU C 3 147 ? 24.338 47.472 -8.677  1.00 37.95 ? 147  GLU A CG    1 
ATOM   1752 C  CD    . GLU C 3 147 ? 23.256 48.444 -9.264  1.00 43.39 ? 147  GLU A CD    1 
ATOM   1753 O  OE1   . GLU C 3 147 ? 22.136 47.978 -9.553  1.00 46.86 ? 147  GLU A OE1   1 
ATOM   1754 O  OE2   . GLU C 3 147 ? 23.527 49.670 -9.452  1.00 43.91 ? 147  GLU A OE2   1 
ATOM   1755 N  N     . LYS C 3 148 ? 23.166 46.944 -4.070  1.00 30.08 ? 148  LYS A N     1 
ATOM   1756 C  CA    . LYS C 3 148 ? 22.403 46.399 -2.945  1.00 31.50 ? 148  LYS A CA    1 
ATOM   1757 C  C     . LYS C 3 148 ? 21.478 47.442 -2.343  1.00 29.58 ? 148  LYS A C     1 
ATOM   1758 O  O     . LYS C 3 148 ? 20.325 47.140 -1.992  1.00 30.73 ? 148  LYS A O     1 
ATOM   1759 C  CB    . LYS C 3 148 ? 23.341 45.810 -1.876  1.00 30.69 ? 148  LYS A CB    1 
ATOM   1760 C  CG    . LYS C 3 148 ? 23.941 44.456 -2.313  1.00 33.21 ? 148  LYS A CG    1 
ATOM   1761 C  CD    . LYS C 3 148 ? 24.673 43.774 -1.144  1.00 34.53 ? 148  LYS A CD    1 
ATOM   1762 C  CE    . LYS C 3 148 ? 25.142 42.368 -1.577  1.00 41.55 ? 148  LYS A CE    1 
ATOM   1763 N  NZ    . LYS C 3 148 ? 26.110 41.813 -0.567  1.00 44.30 ? 148  LYS A NZ    1 
ATOM   1764 N  N     . LEU C 3 149 ? 21.965 48.666 -2.204  1.00 28.17 ? 149  LEU A N     1 
ATOM   1765 C  CA    . LEU C 3 149 ? 21.093 49.702 -1.664  1.00 27.52 ? 149  LEU A CA    1 
ATOM   1766 C  C     . LEU C 3 149 ? 19.885 49.926 -2.621  1.00 29.75 ? 149  LEU A C     1 
ATOM   1767 O  O     . LEU C 3 149 ? 18.767 50.201 -2.167  1.00 28.53 ? 149  LEU A O     1 
ATOM   1768 C  CB    . LEU C 3 149 ? 21.877 50.996 -1.467  1.00 26.76 ? 149  LEU A CB    1 
ATOM   1769 C  CG    . LEU C 3 149 ? 23.030 50.847 -0.464  1.00 23.32 ? 149  LEU A CG    1 
ATOM   1770 C  CD1   . LEU C 3 149 ? 23.895 52.110 -0.529  1.00 25.92 ? 149  LEU A CD1   1 
ATOM   1771 C  CD2   . LEU C 3 149 ? 22.454 50.567 0.985   1.00 23.13 ? 149  LEU A CD2   1 
ATOM   1772 N  N     . ARG C 3 150 ? 20.137 49.851 -3.930  1.00 31.71 ? 150  ARG A N     1 
ATOM   1773 C  CA    . ARG C 3 150 ? 19.112 50.144 -4.957  1.00 33.96 ? 150  ARG A CA    1 
ATOM   1774 C  C     . ARG C 3 150 ? 17.946 49.214 -4.872  1.00 36.68 ? 150  ARG A C     1 
ATOM   1775 O  O     . ARG C 3 150 ? 16.805 49.615 -5.161  1.00 37.94 ? 150  ARG A O     1 
ATOM   1776 C  CB    . ARG C 3 150 ? 19.672 50.066 -6.394  1.00 33.95 ? 150  ARG A CB    1 
ATOM   1777 C  CG    . ARG C 3 150 ? 18.583 50.025 -7.534  1.00 34.61 ? 150  ARG A CG    1 
ATOM   1778 N  N     . LYS C 3 151 ? 18.205 47.961 -4.552  1.00 38.43 ? 151  LYS A N     1 
ATOM   1779 C  CA    . LYS C 3 151 ? 17.130 47.015 -4.586  1.00 42.84 ? 151  LYS A CA    1 
ATOM   1780 C  C     . LYS C 3 151 ? 16.372 46.826 -3.241  1.00 42.47 ? 151  LYS A C     1 
ATOM   1781 O  O     . LYS C 3 151 ? 15.429 46.049 -3.167  1.00 43.29 ? 151  LYS A O     1 
ATOM   1782 C  CB    . LYS C 3 151 ? 17.592 45.695 -5.208  1.00 42.96 ? 151  LYS A CB    1 
ATOM   1783 C  CG    . LYS C 3 151 ? 18.674 44.940 -4.495  1.00 45.83 ? 151  LYS A CG    1 
ATOM   1784 C  CD    . LYS C 3 151 ? 19.261 43.832 -5.396  1.00 47.00 ? 151  LYS A CD    1 
ATOM   1785 C  CE    . LYS C 3 151 ? 19.349 44.249 -6.855  1.00 52.45 ? 151  LYS A CE    1 
ATOM   1786 N  NZ    . LYS C 3 151 ? 19.703 43.069 -7.726  1.00 55.16 ? 151  LYS A NZ    1 
ATOM   1787 N  N     . SER C 3 152 ? 16.742 47.577 -2.214  1.00 41.75 ? 152  SER A N     1 
ATOM   1788 C  CA    . SER C 3 152 ? 16.127 47.385 -0.913  1.00 41.33 ? 152  SER A CA    1 
ATOM   1789 C  C     . SER C 3 152 ? 15.174 48.512 -0.505  1.00 41.07 ? 152  SER A C     1 
ATOM   1790 O  O     . SER C 3 152 ? 15.376 49.669 -0.854  1.00 40.48 ? 152  SER A O     1 
ATOM   1791 C  CB    . SER C 3 152 ? 17.238 47.217 0.146   1.00 41.45 ? 152  SER A CB    1 
ATOM   1792 O  OG    . SER C 3 152 ? 16.696 46.799 1.388   1.00 42.00 ? 152  SER A OG    1 
ATOM   1793 N  N     . THR C 3 153 ? 14.167 48.183 0.311   1.00 40.84 ? 153  THR A N     1 
ATOM   1794 C  CA    . THR C 3 153 ? 13.365 49.212 0.942   1.00 40.34 ? 153  THR A CA    1 
ATOM   1795 C  C     . THR C 3 153 ? 13.640 49.241 2.440   1.00 39.95 ? 153  THR A C     1 
ATOM   1796 O  O     . THR C 3 153 ? 12.876 49.874 3.182   1.00 40.26 ? 153  THR A O     1 
ATOM   1797 C  CB    . THR C 3 153 ? 11.822 48.986 0.756   1.00 42.04 ? 153  THR A CB    1 
ATOM   1798 O  OG1   . THR C 3 153 ? 11.462 47.700 1.290   1.00 43.07 ? 153  THR A OG1   1 
ATOM   1799 C  CG2   . THR C 3 153 ? 11.404 49.079 -0.722  1.00 42.22 ? 153  THR A CG2   1 
ATOM   1800 N  N     . LYS C 3 154 ? 14.732 48.594 2.886   1.00 37.56 ? 154  LYS A N     1 
ATOM   1801 C  CA    . LYS C 3 154 ? 15.175 48.716 4.277   1.00 35.35 ? 154  LYS A CA    1 
ATOM   1802 C  C     . LYS C 3 154 ? 15.631 50.141 4.562   1.00 34.44 ? 154  LYS A C     1 
ATOM   1803 O  O     . LYS C 3 154 ? 16.118 50.856 3.654   1.00 33.32 ? 154  LYS A O     1 
ATOM   1804 C  CB    . LYS C 3 154 ? 16.318 47.722 4.582   1.00 34.38 ? 154  LYS A CB    1 
ATOM   1805 C  CG    . LYS C 3 154 ? 15.925 46.244 4.677   1.00 36.22 ? 154  LYS A CG    1 
ATOM   1806 C  CD    . LYS C 3 154 ? 17.171 45.357 4.795   1.00 36.04 ? 154  LYS A CD    1 
ATOM   1807 C  CE    . LYS C 3 154 ? 16.813 43.876 4.873   1.00 40.73 ? 154  LYS A CE    1 
ATOM   1808 N  NZ    . LYS C 3 154 ? 18.070 43.047 4.955   1.00 38.87 ? 154  LYS A NZ    1 
ATOM   1809 N  N     . LYS C 3 155 ? 15.463 50.550 5.820   1.00 32.95 ? 155  LYS A N     1 
ATOM   1810 C  CA    . LYS C 3 155 ? 15.936 51.822 6.296   1.00 31.84 ? 155  LYS A CA    1 
ATOM   1811 C  C     . LYS C 3 155 ? 17.457 51.705 6.414   1.00 30.46 ? 155  LYS A C     1 
ATOM   1812 O  O     . LYS C 3 155 ? 17.964 50.635 6.797   1.00 28.54 ? 155  LYS A O     1 
ATOM   1813 C  CB    . LYS C 3 155 ? 15.326 52.149 7.676   1.00 31.02 ? 155  LYS A CB    1 
ATOM   1814 C  CG    . LYS C 3 155 ? 13.778 52.339 7.664   1.00 33.58 ? 155  LYS A CG    1 
ATOM   1815 C  CD    . LYS C 3 155 ? 13.283 52.675 9.052   1.00 36.44 ? 155  LYS A CD    1 
ATOM   1816 C  CE    . LYS C 3 155 ? 11.760 52.856 9.035   1.00 42.69 ? 155  LYS A CE    1 
ATOM   1817 N  NZ    . LYS C 3 155 ? 11.270 52.758 10.450  1.00 46.08 ? 155  LYS A NZ    1 
ATOM   1818 N  N     . ILE C 3 156 ? 18.159 52.796 6.117   1.00 27.75 ? 156  ILE A N     1 
ATOM   1819 C  CA    . ILE C 3 156 ? 19.630 52.767 6.004   1.00 27.46 ? 156  ILE A CA    1 
ATOM   1820 C  C     . ILE C 3 156 ? 20.346 52.384 7.307   1.00 26.61 ? 156  ILE A C     1 
ATOM   1821 O  O     . ILE C 3 156 ? 21.305 51.616 7.271   1.00 25.56 ? 156  ILE A O     1 
ATOM   1822 C  CB    . ILE C 3 156 ? 20.236 54.064 5.366   1.00 27.08 ? 156  ILE A CB    1 
ATOM   1823 C  CG1   . ILE C 3 156 ? 21.764 53.951 5.158   1.00 28.37 ? 156  ILE A CG1   1 
ATOM   1824 C  CG2   . ILE C 3 156 ? 19.877 55.349 6.195   1.00 25.52 ? 156  ILE A CG2   1 
ATOM   1825 C  CD1   . ILE C 3 156 ? 22.223 52.861 4.146   1.00 26.03 ? 156  ILE A CD1   1 
ATOM   1826 N  N     . LYS C 3 157 ? 19.924 52.927 8.448   1.00 25.41 ? 157  LYS A N     1 
ATOM   1827 C  CA    . LYS C 3 157 ? 20.627 52.573 9.701   1.00 25.45 ? 157  LYS A CA    1 
ATOM   1828 C  C     . LYS C 3 157 ? 20.556 51.054 10.047  1.00 26.01 ? 157  LYS A C     1 
ATOM   1829 O  O     . LYS C 3 157 ? 21.611 50.446 10.298  1.00 25.29 ? 157  LYS A O     1 
ATOM   1830 C  CB    . LYS C 3 157 ? 20.167 53.481 10.891  1.00 25.11 ? 157  LYS A CB    1 
ATOM   1831 C  CG    . LYS C 3 157 ? 20.768 53.031 12.230  1.00 25.80 ? 157  LYS A CG    1 
ATOM   1832 C  CD    . LYS C 3 157 ? 20.597 54.016 13.352  1.00 24.56 ? 157  LYS A CD    1 
ATOM   1833 C  CE    . LYS C 3 157 ? 21.060 53.314 14.672  1.00 22.99 ? 157  LYS A CE    1 
ATOM   1834 N  NZ    . LYS C 3 157 ? 21.158 54.198 15.836  1.00 25.61 ? 157  LYS A NZ    1 
ATOM   1835 N  N     . PRO C 3 158 ? 19.329 50.458 10.134  1.00 27.47 ? 158  PRO A N     1 
ATOM   1836 C  CA    . PRO C 3 158 ? 19.172 49.021 10.407  1.00 26.71 ? 158  PRO A CA    1 
ATOM   1837 C  C     . PRO C 3 158 ? 19.955 48.180 9.362   1.00 27.45 ? 158  PRO A C     1 
ATOM   1838 O  O     . PRO C 3 158 ? 20.622 47.202 9.724   1.00 26.14 ? 158  PRO A O     1 
ATOM   1839 C  CB    . PRO C 3 158 ? 17.655 48.792 10.280  1.00 28.08 ? 158  PRO A CB    1 
ATOM   1840 C  CG    . PRO C 3 158 ? 17.027 50.158 10.547  1.00 29.15 ? 158  PRO A CG    1 
ATOM   1841 C  CD    . PRO C 3 158 ? 18.015 51.171 10.089  1.00 27.36 ? 158  PRO A CD    1 
ATOM   1842 N  N     . TYR C 3 159 ? 19.895 48.561 8.085   1.00 27.12 ? 159  TYR A N     1 
ATOM   1843 C  CA    . TYR C 3 159 ? 20.593 47.799 7.020   1.00 26.36 ? 159  TYR A CA    1 
ATOM   1844 C  C     . TYR C 3 159 ? 22.121 47.782 7.268   1.00 26.48 ? 159  TYR A C     1 
ATOM   1845 O  O     . TYR C 3 159 ? 22.768 46.694 7.277   1.00 24.97 ? 159  TYR A O     1 
ATOM   1846 C  CB    . TYR C 3 159 ? 20.233 48.336 5.603   1.00 26.93 ? 159  TYR A CB    1 
ATOM   1847 C  CG    . TYR C 3 159 ? 20.412 47.288 4.484   1.00 27.15 ? 159  TYR A CG    1 
ATOM   1848 C  CD1   . TYR C 3 159 ? 20.984 46.008 4.750   1.00 25.27 ? 159  TYR A CD1   1 
ATOM   1849 C  CD2   . TYR C 3 159 ? 20.082 47.602 3.174   1.00 30.18 ? 159  TYR A CD2   1 
ATOM   1850 C  CE1   . TYR C 3 159 ? 21.157 45.081 3.746   1.00 29.03 ? 159  TYR A CE1   1 
ATOM   1851 C  CE2   . TYR C 3 159 ? 20.252 46.671 2.129   1.00 33.90 ? 159  TYR A CE2   1 
ATOM   1852 C  CZ    . TYR C 3 159 ? 20.778 45.415 2.412   1.00 31.14 ? 159  TYR A CZ    1 
ATOM   1853 O  OH    . TYR C 3 159 ? 20.928 44.522 1.352   1.00 31.76 ? 159  TYR A OH    1 
ATOM   1854 N  N     . LEU C 3 160 ? 22.692 48.957 7.524   1.00 25.52 ? 160  LEU A N     1 
ATOM   1855 C  CA    . LEU C 3 160 ? 24.124 49.058 7.839   1.00 25.74 ? 160  LEU A CA    1 
ATOM   1856 C  C     . LEU C 3 160 ? 24.522 48.240 9.072   1.00 26.77 ? 160  LEU A C     1 
ATOM   1857 O  O     . LEU C 3 160 ? 25.630 47.688 9.128   1.00 26.37 ? 160  LEU A O     1 
ATOM   1858 C  CB    . LEU C 3 160 ? 24.557 50.518 8.050   1.00 24.98 ? 160  LEU A CB    1 
ATOM   1859 C  CG    . LEU C 3 160 ? 24.692 51.335 6.736   1.00 26.59 ? 160  LEU A CG    1 
ATOM   1860 C  CD1   . LEU C 3 160 ? 24.861 52.808 7.064   1.00 25.80 ? 160  LEU A CD1   1 
ATOM   1861 C  CD2   . LEU C 3 160 ? 25.904 50.887 5.865   1.00 25.90 ? 160  LEU A CD2   1 
ATOM   1862 N  N     . LEU C 3 161 ? 23.650 48.203 10.074  1.00 24.75 ? 161  LEU A N     1 
ATOM   1863 C  CA    . LEU C 3 161 ? 23.962 47.438 11.301  1.00 25.47 ? 161  LEU A CA    1 
ATOM   1864 C  C     . LEU C 3 161 ? 23.999 45.913 11.109  1.00 25.75 ? 161  LEU A C     1 
ATOM   1865 O  O     . LEU C 3 161 ? 24.495 45.172 11.971  1.00 26.93 ? 161  LEU A O     1 
ATOM   1866 C  CB    . LEU C 3 161 ? 22.945 47.828 12.393  1.00 25.45 ? 161  LEU A CB    1 
ATOM   1867 C  CG    . LEU C 3 161 ? 23.127 49.210 13.041  1.00 26.06 ? 161  LEU A CG    1 
ATOM   1868 C  CD1   . LEU C 3 161 ? 21.955 49.480 14.054  1.00 25.93 ? 161  LEU A CD1   1 
ATOM   1869 C  CD2   . LEU C 3 161 ? 24.430 49.247 13.841  1.00 23.47 ? 161  LEU A CD2   1 
ATOM   1870 N  N     . GLU C 3 162 ? 23.415 45.432 10.015  1.00 26.52 ? 162  GLU A N     1 
ATOM   1871 C  CA    . GLU C 3 162 ? 23.402 44.002 9.728   1.00 28.67 ? 162  GLU A CA    1 
ATOM   1872 C  C     . GLU C 3 162 ? 24.756 43.334 9.465   1.00 27.72 ? 162  GLU A C     1 
ATOM   1873 O  O     . GLU C 3 162 ? 24.826 42.095 9.512   1.00 29.78 ? 162  GLU A O     1 
ATOM   1874 C  CB    . GLU C 3 162 ? 22.539 43.718 8.504   1.00 28.06 ? 162  GLU A CB    1 
ATOM   1875 C  CG    . GLU C 3 162 ? 21.049 43.755 8.680   1.00 30.71 ? 162  GLU A CG    1 
ATOM   1876 C  CD    . GLU C 3 162 ? 20.340 43.442 7.351   1.00 31.64 ? 162  GLU A CD    1 
ATOM   1877 O  OE1   . GLU C 3 162 ? 20.964 42.782 6.446   1.00 39.58 ? 162  GLU A OE1   1 
ATOM   1878 O  OE2   . GLU C 3 162 ? 19.193 43.868 7.200   1.00 36.13 ? 162  GLU A OE2   1 
ATOM   1879 N  N     . GLN C 3 163 ? 25.780 44.114 9.132   1.00 25.89 ? 163  GLN A N     1 
ATOM   1880 C  CA    . GLN C 3 163 ? 27.161 43.628 8.876   1.00 26.87 ? 163  GLN A CA    1 
ATOM   1881 C  C     . GLN C 3 163 ? 27.281 43.016 7.484   1.00 27.34 ? 163  GLN A C     1 
ATOM   1882 O  O     . GLN C 3 163 ? 28.361 42.513 7.121   1.00 28.55 ? 163  GLN A O     1 
ATOM   1883 C  CB    . GLN C 3 163 ? 27.603 42.548 9.908   1.00 26.41 ? 163  GLN A CB    1 
ATOM   1884 C  CG    . GLN C 3 163 ? 27.521 42.985 11.392  1.00 26.97 ? 163  GLN A CG    1 
ATOM   1885 C  CD    . GLN C 3 163 ? 28.323 44.212 11.656  1.00 27.25 ? 163  GLN A CD    1 
ATOM   1886 O  OE1   . GLN C 3 163 ? 29.571 44.174 11.636  1.00 21.23 ? 163  GLN A OE1   1 
ATOM   1887 N  NE2   . GLN C 3 163 ? 27.622 45.346 11.902  1.00 27.35 ? 163  GLN A NE2   1 
ATOM   1888 N  N     . THR C 3 164 ? 26.195 43.041 6.709   1.00 26.95 ? 164  THR A N     1 
ATOM   1889 C  CA    . THR C 3 164 ? 26.157 42.360 5.406   1.00 26.81 ? 164  THR A CA    1 
ATOM   1890 C  C     . THR C 3 164 ? 26.594 43.274 4.243   1.00 27.19 ? 164  THR A C     1 
ATOM   1891 O  O     . THR C 3 164 ? 27.198 42.786 3.281   1.00 26.58 ? 164  THR A O     1 
ATOM   1892 C  CB    . THR C 3 164 ? 24.765 41.829 5.084   1.00 26.58 ? 164  THR A CB    1 
ATOM   1893 O  OG1   . THR C 3 164 ? 23.841 42.908 5.153   1.00 29.16 ? 164  THR A OG1   1 
ATOM   1894 C  CG2   . THR C 3 164 ? 24.329 40.682 6.087   1.00 26.79 ? 164  THR A CG2   1 
ATOM   1895 N  N     . LEU C 3 165 ? 26.284 44.578 4.328   1.00 25.54 ? 165  LEU A N     1 
ATOM   1896 C  CA    . LEU C 3 165 ? 26.764 45.545 3.287   1.00 26.03 ? 165  LEU A CA    1 
ATOM   1897 C  C     . LEU C 3 165 ? 28.270 45.876 3.433   1.00 26.66 ? 165  LEU A C     1 
ATOM   1898 O  O     . LEU C 3 165 ? 28.953 46.174 2.431   1.00 26.31 ? 165  LEU A O     1 
ATOM   1899 C  CB    . LEU C 3 165 ? 25.968 46.863 3.352   1.00 25.11 ? 165  LEU A CB    1 
ATOM   1900 C  CG    . LEU C 3 165 ? 24.438 46.763 3.078   1.00 26.01 ? 165  LEU A CG    1 
ATOM   1901 C  CD1   . LEU C 3 165 ? 23.783 48.042 3.624   1.00 26.93 ? 165  LEU A CD1   1 
ATOM   1902 C  CD2   . LEU C 3 165 ? 24.159 46.621 1.574   1.00 27.89 ? 165  LEU A CD2   1 
ATOM   1903 N  N     . VAL C 3 166 ? 28.756 45.834 4.684   1.00 25.82 ? 166  VAL A N     1 
ATOM   1904 C  CA    . VAL C 3 166 ? 30.140 46.202 5.056   1.00 25.82 ? 166  VAL A CA    1 
ATOM   1905 C  C     . VAL C 3 166 ? 30.238 45.756 6.522   1.00 25.74 ? 166  VAL A C     1 
ATOM   1906 O  O     . VAL C 3 166 ? 29.254 45.850 7.256   1.00 24.38 ? 166  VAL A O     1 
ATOM   1907 C  CB    . VAL C 3 166 ? 30.429 47.743 4.885   1.00 26.53 ? 166  VAL A CB    1 
ATOM   1908 C  CG1   . VAL C 3 166 ? 29.443 48.622 5.773   1.00 27.16 ? 166  VAL A CG1   1 
ATOM   1909 C  CG2   . VAL C 3 166 ? 31.886 48.086 5.224   1.00 24.87 ? 166  VAL A CG2   1 
ATOM   1910 N  N     . ALA C 3 167 ? 31.391 45.242 6.941   1.00 24.81 ? 167  ALA A N     1 
ATOM   1911 C  CA    . ALA C 3 167 ? 31.511 44.705 8.320   1.00 25.61 ? 167  ALA A CA    1 
ATOM   1912 C  C     . ALA C 3 167 ? 32.045 45.795 9.268   1.00 25.08 ? 167  ALA A C     1 
ATOM   1913 O  O     . ALA C 3 167 ? 32.923 46.595 8.865   1.00 26.34 ? 167  ALA A O     1 
ATOM   1914 C  CB    . ALA C 3 167 ? 32.469 43.465 8.320   1.00 24.13 ? 167  ALA A CB    1 
ATOM   1915 N  N     . GLY C 3 168 ? 31.525 45.842 10.507  1.00 24.41 ? 168  GLY A N     1 
ATOM   1916 C  CA    . GLY C 3 168 ? 32.209 46.567 11.576  1.00 22.66 ? 168  GLY A CA    1 
ATOM   1917 C  C     . GLY C 3 168 ? 31.469 47.746 12.233  1.00 23.81 ? 168  GLY A C     1 
ATOM   1918 O  O     . GLY C 3 168 ? 31.907 48.230 13.272  1.00 22.23 ? 168  GLY A O     1 
ATOM   1919 N  N     . LEU C 3 169 ? 30.387 48.229 11.624  1.00 22.26 ? 169  LEU A N     1 
ATOM   1920 C  CA    . LEU C 3 169 ? 29.673 49.408 12.214  1.00 23.31 ? 169  LEU A CA    1 
ATOM   1921 C  C     . LEU C 3 169 ? 28.764 48.898 13.308  1.00 23.60 ? 169  LEU A C     1 
ATOM   1922 O  O     . LEU C 3 169 ? 28.108 47.847 13.138  1.00 23.90 ? 169  LEU A O     1 
ATOM   1923 C  CB    . LEU C 3 169 ? 28.760 50.118 11.177  1.00 22.52 ? 169  LEU A CB    1 
ATOM   1924 C  CG    . LEU C 3 169 ? 29.486 50.737 9.980   1.00 22.40 ? 169  LEU A CG    1 
ATOM   1925 C  CD1   . LEU C 3 169 ? 28.465 51.044 8.884   1.00 22.56 ? 169  LEU A CD1   1 
ATOM   1926 C  CD2   . LEU C 3 169 ? 30.196 52.020 10.477  1.00 21.79 ? 169  LEU A CD2   1 
ATOM   1927 N  N     . GLY C 3 170 ? 28.706 49.639 14.409  1.00 23.21 ? 170  GLY A N     1 
ATOM   1928 C  CA    . GLY C 3 170 ? 27.669 49.399 15.403  1.00 24.39 ? 170  GLY A CA    1 
ATOM   1929 C  C     . GLY C 3 170 ? 27.028 50.736 15.720  1.00 25.92 ? 170  GLY A C     1 
ATOM   1930 O  O     . GLY C 3 170 ? 27.098 51.669 14.911  1.00 25.17 ? 170  GLY A O     1 
ATOM   1931 N  N     . ASN C 3 171 ? 26.389 50.831 16.887  1.00 26.15 ? 171  ASN A N     1 
ATOM   1932 C  CA    . ASN C 3 171 ? 25.533 51.988 17.134  1.00 26.86 ? 171  ASN A CA    1 
ATOM   1933 C  C     . ASN C 3 171 ? 26.277 53.305 17.121  1.00 26.59 ? 171  ASN A C     1 
ATOM   1934 O  O     . ASN C 3 171 ? 25.739 54.302 16.633  1.00 26.61 ? 171  ASN A O     1 
ATOM   1935 C  CB    . ASN C 3 171 ? 24.679 51.812 18.406  1.00 27.25 ? 171  ASN A CB    1 
ATOM   1936 C  CG    . ASN C 3 171 ? 23.323 52.545 18.312  1.00 29.43 ? 171  ASN A CG    1 
ATOM   1937 O  OD1   . ASN C 3 171 ? 22.696 52.570 17.237  1.00 27.24 ? 171  ASN A OD1   1 
ATOM   1938 N  ND2   . ASN C 3 171 ? 22.865 53.133 19.445  1.00 27.96 ? 171  ASN A ND2   1 
ATOM   1939 N  N     . ILE C 3 172 ? 27.500 53.340 17.658  1.00 25.96 ? 172  ILE A N     1 
ATOM   1940 C  CA    . ILE C 3 172 ? 28.228 54.616 17.705  1.00 27.37 ? 172  ILE A CA    1 
ATOM   1941 C  C     . ILE C 3 172 ? 28.624 55.050 16.309  1.00 27.38 ? 172  ILE A C     1 
ATOM   1942 O  O     . ILE C 3 172 ? 28.287 56.183 15.873  1.00 28.15 ? 172  ILE A O     1 
ATOM   1943 C  CB    . ILE C 3 172 ? 29.506 54.564 18.587  1.00 26.85 ? 172  ILE A CB    1 
ATOM   1944 C  CG1   . ILE C 3 172 ? 29.144 54.249 20.071  1.00 26.71 ? 172  ILE A CG1   1 
ATOM   1945 C  CG2   . ILE C 3 172 ? 30.355 55.862 18.413  1.00 29.30 ? 172  ILE A CG2   1 
ATOM   1946 C  CD1   . ILE C 3 172 ? 30.428 54.179 20.984  1.00 29.40 ? 172  ILE A CD1   1 
ATOM   1947 N  N     . TYR C 3 173 ? 29.337 54.178 15.586  1.00 26.45 ? 173  TYR A N     1 
ATOM   1948 C  CA    . TYR C 3 173 ? 29.879 54.617 14.305  1.00 25.62 ? 173  TYR A CA    1 
ATOM   1949 C  C     . TYR C 3 173 ? 28.804 54.711 13.218  1.00 25.19 ? 173  TYR A C     1 
ATOM   1950 O  O     . TYR C 3 173 ? 28.994 55.490 12.274  1.00 25.52 ? 173  TYR A O     1 
ATOM   1951 C  CB    . TYR C 3 173 ? 31.135 53.841 13.842  1.00 24.96 ? 173  TYR A CB    1 
ATOM   1952 C  CG    . TYR C 3 173 ? 32.243 54.000 14.879  1.00 26.95 ? 173  TYR A CG    1 
ATOM   1953 C  CD1   . TYR C 3 173 ? 32.790 55.274 15.164  1.00 26.80 ? 173  TYR A CD1   1 
ATOM   1954 C  CD2   . TYR C 3 173 ? 32.690 52.895 15.612  1.00 24.38 ? 173  TYR A CD2   1 
ATOM   1955 C  CE1   . TYR C 3 173 ? 33.769 55.436 16.205  1.00 27.14 ? 173  TYR A CE1   1 
ATOM   1956 C  CE2   . TYR C 3 173 ? 33.656 53.030 16.634  1.00 24.80 ? 173  TYR A CE2   1 
ATOM   1957 C  CZ    . TYR C 3 173 ? 34.189 54.305 16.926  1.00 26.50 ? 173  TYR A CZ    1 
ATOM   1958 O  OH    . TYR C 3 173 ? 35.187 54.397 17.906  1.00 27.23 ? 173  TYR A OH    1 
ATOM   1959 N  N     . VAL C 3 174 ? 27.725 53.934 13.309  1.00 25.31 ? 174  VAL A N     1 
ATOM   1960 C  CA    . VAL C 3 174 ? 26.656 54.097 12.276  1.00 25.97 ? 174  VAL A CA    1 
ATOM   1961 C  C     . VAL C 3 174 ? 26.043 55.535 12.429  1.00 25.65 ? 174  VAL A C     1 
ATOM   1962 O  O     . VAL C 3 174 ? 25.799 56.241 11.446  1.00 24.57 ? 174  VAL A O     1 
ATOM   1963 C  CB    . VAL C 3 174 ? 25.594 52.954 12.264  1.00 26.41 ? 174  VAL A CB    1 
ATOM   1964 C  CG1   . VAL C 3 174 ? 24.587 53.034 13.432  1.00 23.91 ? 174  VAL A CG1   1 
ATOM   1965 C  CG2   . VAL C 3 174 ? 24.768 52.954 10.924  1.00 27.76 ? 174  VAL A CG2   1 
ATOM   1966 N  N     . ASP C 3 175 ? 25.859 55.981 13.671  1.00 26.17 ? 175  ASP A N     1 
ATOM   1967 C  CA    . ASP C 3 175 ? 25.325 57.345 13.896  1.00 25.82 ? 175  ASP A CA    1 
ATOM   1968 C  C     . ASP C 3 175 ? 26.284 58.399 13.384  1.00 26.56 ? 175  ASP A C     1 
ATOM   1969 O  O     . ASP C 3 175 ? 25.853 59.349 12.708  1.00 26.63 ? 175  ASP A O     1 
ATOM   1970 C  CB    . ASP C 3 175 ? 24.973 57.574 15.383  1.00 26.45 ? 175  ASP A CB    1 
ATOM   1971 C  CG    . ASP C 3 175 ? 23.567 56.990 15.787  1.00 27.70 ? 175  ASP A CG    1 
ATOM   1972 O  OD1   . ASP C 3 175 ? 22.906 56.297 14.988  1.00 29.85 ? 175  ASP A OD1   1 
ATOM   1973 O  OD2   . ASP C 3 175 ? 23.103 57.240 16.944  1.00 26.45 ? 175  ASP A OD2   1 
ATOM   1974 N  N     . GLU C 3 176 ? 27.574 58.257 13.682  1.00 26.06 ? 176  GLU A N     1 
ATOM   1975 C  CA    . GLU C 3 176 ? 28.598 59.212 13.237  1.00 26.58 ? 176  GLU A CA    1 
ATOM   1976 C  C     . GLU C 3 176 ? 28.709 59.274 11.733  1.00 27.61 ? 176  GLU A C     1 
ATOM   1977 O  O     . GLU C 3 176 ? 28.911 60.348 11.153  1.00 28.24 ? 176  GLU A O     1 
ATOM   1978 C  CB    . GLU C 3 176 ? 29.976 58.876 13.844  1.00 26.99 ? 176  GLU A CB    1 
ATOM   1979 C  CG    . GLU C 3 176 ? 29.963 58.980 15.357  1.00 27.31 ? 176  GLU A CG    1 
ATOM   1980 C  CD    . GLU C 3 176 ? 29.814 60.457 15.829  1.00 29.90 ? 176  GLU A CD    1 
ATOM   1981 O  OE1   . GLU C 3 176 ? 30.458 61.318 15.214  1.00 30.96 ? 176  GLU A OE1   1 
ATOM   1982 O  OE2   . GLU C 3 176 ? 29.083 60.732 16.804  1.00 30.53 ? 176  GLU A OE2   1 
ATOM   1983 N  N     . VAL C 3 177 ? 28.612 58.105 11.098  1.00 26.86 ? 177  VAL A N     1 
ATOM   1984 C  CA    . VAL C 3 177 ? 28.774 57.996 9.669   1.00 27.76 ? 177  VAL A CA    1 
ATOM   1985 C  C     . VAL C 3 177 ? 27.593 58.684 8.961   1.00 26.71 ? 177  VAL A C     1 
ATOM   1986 O  O     . VAL C 3 177 ? 27.789 59.427 7.970   1.00 27.71 ? 177  VAL A O     1 
ATOM   1987 C  CB    . VAL C 3 177 ? 28.879 56.476 9.281   1.00 28.26 ? 177  VAL A CB    1 
ATOM   1988 C  CG1   . VAL C 3 177 ? 28.344 56.202 7.936   1.00 32.44 ? 177  VAL A CG1   1 
ATOM   1989 C  CG2   . VAL C 3 177 ? 30.347 56.004 9.390   1.00 29.81 ? 177  VAL A CG2   1 
ATOM   1990 N  N     . LEU C 3 178 ? 26.383 58.438 9.448   1.00 25.72 ? 178  LEU A N     1 
ATOM   1991 C  CA    . LEU C 3 178 ? 25.189 59.031 8.803   1.00 26.14 ? 178  LEU A CA    1 
ATOM   1992 C  C     . LEU C 3 178 ? 25.138 60.552 8.968   1.00 27.14 ? 178  LEU A C     1 
ATOM   1993 O  O     . LEU C 3 178 ? 24.746 61.280 8.036   1.00 28.39 ? 178  LEU A O     1 
ATOM   1994 C  CB    . LEU C 3 178 ? 23.903 58.365 9.288   1.00 25.65 ? 178  LEU A CB    1 
ATOM   1995 C  CG    . LEU C 3 178 ? 23.811 56.890 8.812   1.00 24.09 ? 178  LEU A CG    1 
ATOM   1996 C  CD1   . LEU C 3 178 ? 22.588 56.201 9.434   1.00 24.49 ? 178  LEU A CD1   1 
ATOM   1997 C  CD2   . LEU C 3 178 ? 23.699 56.795 7.319   1.00 24.08 ? 178  LEU A CD2   1 
ATOM   1998 N  N     . TRP C 3 179 ? 25.626 61.043 10.100  1.00 26.66 ? 179  TRP A N     1 
ATOM   1999 C  CA    . TRP C 3 179 ? 25.735 62.494 10.289  1.00 28.35 ? 179  TRP A CA    1 
ATOM   2000 C  C     . TRP C 3 179 ? 26.807 63.056 9.335   1.00 30.26 ? 179  TRP A C     1 
ATOM   2001 O  O     . TRP C 3 179 ? 26.607 64.143 8.710   1.00 30.39 ? 179  TRP A O     1 
ATOM   2002 C  CB    . TRP C 3 179 ? 26.092 62.839 11.745  1.00 28.00 ? 179  TRP A CB    1 
ATOM   2003 C  CG    . TRP C 3 179 ? 26.318 64.344 11.988  1.00 26.17 ? 179  TRP A CG    1 
ATOM   2004 C  CD1   . TRP C 3 179 ? 25.361 65.275 12.387  1.00 29.26 ? 179  TRP A CD1   1 
ATOM   2005 C  CD2   . TRP C 3 179 ? 27.543 65.082 11.848  1.00 30.23 ? 179  TRP A CD2   1 
ATOM   2006 N  NE1   . TRP C 3 179 ? 25.943 66.527 12.516  1.00 28.92 ? 179  TRP A NE1   1 
ATOM   2007 C  CE2   . TRP C 3 179 ? 27.262 66.445 12.171  1.00 29.21 ? 179  TRP A CE2   1 
ATOM   2008 C  CE3   . TRP C 3 179 ? 28.846 64.743 11.454  1.00 28.50 ? 179  TRP A CE3   1 
ATOM   2009 C  CZ2   . TRP C 3 179 ? 28.231 67.432 12.137  1.00 27.03 ? 179  TRP A CZ2   1 
ATOM   2010 C  CZ3   . TRP C 3 179 ? 29.792 65.726 11.407  1.00 29.89 ? 179  TRP A CZ3   1 
ATOM   2011 C  CH2   . TRP C 3 179 ? 29.475 67.076 11.757  1.00 28.91 ? 179  TRP A CH2   1 
ATOM   2012 N  N     . LEU C 3 180 ? 27.946 62.360 9.219   1.00 30.11 ? 180  LEU A N     1 
ATOM   2013 C  CA    . LEU C 3 180 ? 28.988 62.858 8.297   1.00 29.56 ? 180  LEU A CA    1 
ATOM   2014 C  C     . LEU C 3 180 ? 28.515 62.898 6.850   1.00 30.03 ? 180  LEU A C     1 
ATOM   2015 O  O     . LEU C 3 180 ? 28.853 63.841 6.077   1.00 30.34 ? 180  LEU A O     1 
ATOM   2016 C  CB    . LEU C 3 180 ? 30.307 62.052 8.391   1.00 30.79 ? 180  LEU A CB    1 
ATOM   2017 C  CG    . LEU C 3 180 ? 31.543 62.474 7.558   1.00 30.77 ? 180  LEU A CG    1 
ATOM   2018 C  CD1   . LEU C 3 180 ? 31.956 63.911 7.942   1.00 32.36 ? 180  LEU A CD1   1 
ATOM   2019 C  CD2   . LEU C 3 180 ? 32.746 61.565 7.810   1.00 29.35 ? 180  LEU A CD2   1 
ATOM   2020 N  N     . ALA C 3 181 ? 27.768 61.875 6.455   1.00 28.00 ? 181  ALA A N     1 
ATOM   2021 C  CA    . ALA C 3 181 ? 27.302 61.776 5.061   1.00 28.22 ? 181  ALA A CA    1 
ATOM   2022 C  C     . ALA C 3 181 ? 25.954 62.480 4.825   1.00 27.53 ? 181  ALA A C     1 
ATOM   2023 O  O     . ALA C 3 181 ? 25.405 62.396 3.721   1.00 27.12 ? 181  ALA A O     1 
ATOM   2024 C  CB    . ALA C 3 181 ? 27.226 60.295 4.640   1.00 26.72 ? 181  ALA A CB    1 
ATOM   2025 N  N     . LYS C 3 182 ? 25.414 63.144 5.867   1.00 28.94 ? 182  LYS A N     1 
ATOM   2026 C  CA    . LYS C 3 182 ? 24.159 63.914 5.776   1.00 30.39 ? 182  LYS A CA    1 
ATOM   2027 C  C     . LYS C 3 182 ? 22.940 63.109 5.319   1.00 30.20 ? 182  LYS A C     1 
ATOM   2028 O  O     . LYS C 3 182 ? 22.157 63.561 4.468   1.00 30.00 ? 182  LYS A O     1 
ATOM   2029 C  CB    . LYS C 3 182 ? 24.362 65.154 4.865   1.00 31.65 ? 182  LYS A CB    1 
ATOM   2030 C  CG    . LYS C 3 182 ? 25.472 66.104 5.406   1.00 34.41 ? 182  LYS A CG    1 
ATOM   2031 C  CD    . LYS C 3 182 ? 25.655 67.371 4.523   1.00 35.60 ? 182  LYS A CD    1 
ATOM   2032 C  CE    . LYS C 3 182 ? 26.551 68.380 5.222   1.00 40.48 ? 182  LYS A CE    1 
ATOM   2033 N  NZ    . LYS C 3 182 ? 26.570 69.787 4.578   1.00 44.94 ? 182  LYS A NZ    1 
ATOM   2034 N  N     . ILE C 3 183 ? 22.788 61.919 5.887   1.00 27.85 ? 183  ILE A N     1 
ATOM   2035 C  CA    . ILE C 3 183 ? 21.689 61.045 5.586   1.00 27.44 ? 183  ILE A CA    1 
ATOM   2036 C  C     . ILE C 3 183 ? 20.874 60.743 6.851   1.00 28.33 ? 183  ILE A C     1 
ATOM   2037 O  O     . ILE C 3 183 ? 21.442 60.446 7.927   1.00 28.93 ? 183  ILE A O     1 
ATOM   2038 C  CB    . ILE C 3 183 ? 22.234 59.692 4.973   1.00 27.21 ? 183  ILE A CB    1 
ATOM   2039 C  CG1   . ILE C 3 183 ? 23.015 59.972 3.664   1.00 27.62 ? 183  ILE A CG1   1 
ATOM   2040 C  CG2   . ILE C 3 183 ? 21.083 58.671 4.792   1.00 23.99 ? 183  ILE A CG2   1 
ATOM   2041 C  CD1   . ILE C 3 183 ? 23.809 58.761 3.066   1.00 26.48 ? 183  ILE A CD1   1 
ATOM   2042 N  N     . HIS C 3 184 ? 19.557 60.805 6.723   1.00 28.98 ? 184  HIS A N     1 
ATOM   2043 C  CA    . HIS C 3 184 ? 18.674 60.509 7.852   1.00 30.58 ? 184  HIS A CA    1 
ATOM   2044 C  C     . HIS C 3 184 ? 18.633 58.988 8.096   1.00 29.25 ? 184  HIS A C     1 
ATOM   2045 O  O     . HIS C 3 184 ? 18.527 58.218 7.153   1.00 29.98 ? 184  HIS A O     1 
ATOM   2046 C  CB    . HIS C 3 184 ? 17.257 61.052 7.616   1.00 31.01 ? 184  HIS A CB    1 
ATOM   2047 C  CG    . HIS C 3 184 ? 16.396 61.000 8.844   1.00 32.03 ? 184  HIS A CG    1 
ATOM   2048 N  ND1   . HIS C 3 184 ? 15.713 59.863 9.233   1.00 34.05 ? 184  HIS A ND1   1 
ATOM   2049 C  CD2   . HIS C 3 184 ? 16.142 61.936 9.789   1.00 33.09 ? 184  HIS A CD2   1 
ATOM   2050 C  CE1   . HIS C 3 184 ? 15.052 60.113 10.353  1.00 35.52 ? 184  HIS A CE1   1 
ATOM   2051 N  NE2   . HIS C 3 184 ? 15.283 61.367 10.705  1.00 34.76 ? 184  HIS A NE2   1 
ATOM   2052 N  N     . PRO C 3 185 ? 18.746 58.552 9.355   1.00 29.34 ? 185  PRO A N     1 
ATOM   2053 C  CA    . PRO C 3 185 ? 18.817 57.075 9.616   1.00 28.89 ? 185  PRO A CA    1 
ATOM   2054 C  C     . PRO C 3 185 ? 17.597 56.260 9.166   1.00 29.79 ? 185  PRO A C     1 
ATOM   2055 O  O     . PRO C 3 185 ? 17.704 55.022 8.995   1.00 28.89 ? 185  PRO A O     1 
ATOM   2056 C  CB    . PRO C 3 185 ? 18.989 56.994 11.152  1.00 29.77 ? 185  PRO A CB    1 
ATOM   2057 C  CG    . PRO C 3 185 ? 18.458 58.348 11.681  1.00 29.30 ? 185  PRO A CG    1 
ATOM   2058 C  CD    . PRO C 3 185 ? 18.847 59.353 10.597  1.00 28.70 ? 185  PRO A CD    1 
ATOM   2059 N  N     . GLU C 3 186 ? 16.448 56.926 8.944   1.00 29.26 ? 186  GLU A N     1 
ATOM   2060 C  CA    . GLU C 3 186 ? 15.240 56.238 8.496   1.00 30.57 ? 186  GLU A CA    1 
ATOM   2061 C  C     . GLU C 3 186 ? 15.056 56.281 6.982   1.00 31.11 ? 186  GLU A C     1 
ATOM   2062 O  O     . GLU C 3 186 ? 14.072 55.754 6.440   1.00 30.98 ? 186  GLU A O     1 
ATOM   2063 C  CB    . GLU C 3 186 ? 13.983 56.831 9.196   1.00 30.48 ? 186  GLU A CB    1 
ATOM   2064 C  CG    . GLU C 3 186 ? 13.977 56.517 10.680  1.00 31.68 ? 186  GLU A CG    1 
ATOM   2065 C  CD    . GLU C 3 186 ? 12.778 57.125 11.418  1.00 33.44 ? 186  GLU A CD    1 
ATOM   2066 O  OE1   . GLU C 3 186 ? 12.487 58.324 11.223  1.00 38.52 ? 186  GLU A OE1   1 
ATOM   2067 O  OE2   . GLU C 3 186 ? 12.155 56.386 12.181  1.00 38.76 ? 186  GLU A OE2   1 
ATOM   2068 N  N     . LYS C 3 187 ? 16.021 56.859 6.288   1.00 30.55 ? 187  LYS A N     1 
ATOM   2069 C  CA    . LYS C 3 187 ? 15.942 56.937 4.815   1.00 31.61 ? 187  LYS A CA    1 
ATOM   2070 C  C     . LYS C 3 187 ? 15.935 55.533 4.192   1.00 31.08 ? 187  LYS A C     1 
ATOM   2071 O  O     . LYS C 3 187 ? 16.816 54.717 4.502   1.00 29.78 ? 187  LYS A O     1 
ATOM   2072 C  CB    . LYS C 3 187 ? 17.141 57.771 4.325   1.00 31.68 ? 187  LYS A CB    1 
ATOM   2073 C  CG    . LYS C 3 187 ? 17.250 57.994 2.813   1.00 36.78 ? 187  LYS A CG    1 
ATOM   2074 C  CD    . LYS C 3 187 ? 16.428 59.196 2.358   1.00 41.11 ? 187  LYS A CD    1 
ATOM   2075 C  CE    . LYS C 3 187 ? 16.697 59.499 0.865   1.00 43.87 ? 187  LYS A CE    1 
ATOM   2076 N  N     . GLU C 3 188 ? 14.932 55.220 3.364   1.00 31.09 ? 188  GLU A N     1 
ATOM   2077 C  CA    . GLU C 3 188 ? 14.854 53.898 2.686   1.00 33.36 ? 188  GLU A CA    1 
ATOM   2078 C  C     . GLU C 3 188 ? 15.986 53.877 1.658   1.00 32.00 ? 188  GLU A C     1 
ATOM   2079 O  O     . GLU C 3 188 ? 16.187 54.876 0.940   1.00 32.54 ? 188  GLU A O     1 
ATOM   2080 C  CB    . GLU C 3 188 ? 13.486 53.638 2.002   1.00 32.97 ? 188  GLU A CB    1 
ATOM   2081 C  CG    . GLU C 3 188 ? 12.342 53.407 3.033   1.00 37.85 ? 188  GLU A CG    1 
ATOM   2082 C  CD    . GLU C 3 188 ? 10.957 53.259 2.394   1.00 40.02 ? 188  GLU A CD    1 
ATOM   2083 O  OE1   . GLU C 3 188 ? 10.862 53.117 1.147   1.00 47.33 ? 188  GLU A OE1   1 
ATOM   2084 O  OE2   . GLU C 3 188 ? 9.970  53.238 3.167   1.00 49.82 ? 188  GLU A OE2   1 
ATOM   2085 N  N     . THR C 3 189 ? 16.722 52.769 1.580   1.00 30.78 ? 189  THR A N     1 
ATOM   2086 C  CA    . THR C 3 189 ? 17.982 52.784 0.830   1.00 30.23 ? 189  THR A CA    1 
ATOM   2087 C  C     . THR C 3 189 ? 17.773 52.986 -0.671  1.00 31.27 ? 189  THR A C     1 
ATOM   2088 O  O     . THR C 3 189 ? 18.634 53.575 -1.348  1.00 29.16 ? 189  THR A O     1 
ATOM   2089 C  CB    . THR C 3 189 ? 18.904 51.553 1.111   1.00 30.51 ? 189  THR A CB    1 
ATOM   2090 O  OG1   . THR C 3 189 ? 18.340 50.361 0.545   1.00 30.35 ? 189  THR A OG1   1 
ATOM   2091 C  CG2   . THR C 3 189 ? 19.155 51.375 2.665   1.00 28.86 ? 189  THR A CG2   1 
ATOM   2092 N  N     . ASN C 3 190 ? 16.650 52.485 -1.201  1.00 32.99 ? 190  ASN A N     1 
ATOM   2093 C  CA    . ASN C 3 190 ? 16.373 52.682 -2.642  1.00 35.29 ? 190  ASN A CA    1 
ATOM   2094 C  C     . ASN C 3 190 ? 16.100 54.152 -3.041  1.00 35.53 ? 190  ASN A C     1 
ATOM   2095 O  O     . ASN C 3 190 ? 16.058 54.484 -4.234  1.00 36.19 ? 190  ASN A O     1 
ATOM   2096 C  CB    . ASN C 3 190 ? 15.312 51.710 -3.187  1.00 36.40 ? 190  ASN A CB    1 
ATOM   2097 C  CG    . ASN C 3 190 ? 13.942 51.937 -2.606  1.00 39.71 ? 190  ASN A CG    1 
ATOM   2098 O  OD1   . ASN C 3 190 ? 13.652 52.986 -2.041  1.00 40.27 ? 190  ASN A OD1   1 
ATOM   2099 N  ND2   . ASN C 3 190 ? 13.062 50.967 -2.801  1.00 44.32 ? 190  ASN A ND2   1 
ATOM   2100 N  N     . GLN C 3 191 ? 15.982 55.032 -2.055  1.00 34.58 ? 191  GLN A N     1 
ATOM   2101 C  CA    . GLN C 3 191 ? 15.812 56.470 -2.306  1.00 35.57 ? 191  GLN A CA    1 
ATOM   2102 C  C     . GLN C 3 191 ? 17.141 57.194 -2.402  1.00 35.86 ? 191  GLN A C     1 
ATOM   2103 O  O     . GLN C 3 191 ? 17.196 58.363 -2.812  1.00 36.05 ? 191  GLN A O     1 
ATOM   2104 C  CB    . GLN C 3 191 ? 14.944 57.136 -1.210  1.00 35.30 ? 191  GLN A CB    1 
ATOM   2105 C  CG    . GLN C 3 191 ? 13.484 56.765 -1.277  1.00 37.54 ? 191  GLN A CG    1 
ATOM   2106 N  N     . LEU C 3 192 ? 18.242 56.531 -2.021  1.00 34.37 ? 192  LEU A N     1 
ATOM   2107 C  CA    . LEU C 3 192 ? 19.549 57.229 -2.038  1.00 33.23 ? 192  LEU A CA    1 
ATOM   2108 C  C     . LEU C 3 192 ? 20.075 57.381 -3.466  1.00 33.80 ? 192  LEU A C     1 
ATOM   2109 O  O     . LEU C 3 192 ? 20.100 56.402 -4.228  1.00 33.00 ? 192  LEU A O     1 
ATOM   2110 C  CB    . LEU C 3 192 ? 20.608 56.477 -1.193  1.00 31.17 ? 192  LEU A CB    1 
ATOM   2111 C  CG    . LEU C 3 192 ? 20.271 56.336 0.302   1.00 30.61 ? 192  LEU A CG    1 
ATOM   2112 C  CD1   . LEU C 3 192 ? 21.158 55.214 1.021   1.00 32.01 ? 192  LEU A CD1   1 
ATOM   2113 C  CD2   . LEU C 3 192 ? 20.440 57.689 0.994   1.00 32.94 ? 192  LEU A CD2   1 
ATOM   2114 N  N     . ILE C 3 193 ? 20.535 58.591 -3.786  1.00 33.92 ? 193  ILE A N     1 
ATOM   2115 C  CA    . ILE C 3 193 ? 21.082 58.891 -5.106  1.00 34.92 ? 193  ILE A CA    1 
ATOM   2116 C  C     . ILE C 3 193 ? 22.571 58.558 -5.124  1.00 35.48 ? 193  ILE A C     1 
ATOM   2117 O  O     . ILE C 3 193 ? 23.216 58.389 -4.062  1.00 33.49 ? 193  ILE A O     1 
ATOM   2118 C  CB    . ILE C 3 193 ? 20.792 60.395 -5.559  1.00 35.37 ? 193  ILE A CB    1 
ATOM   2119 C  CG1   . ILE C 3 193 ? 21.607 61.429 -4.743  1.00 34.76 ? 193  ILE A CG1   1 
ATOM   2120 C  CG2   . ILE C 3 193 ? 19.268 60.672 -5.531  1.00 36.46 ? 193  ILE A CG2   1 
ATOM   2121 C  CD1   . ILE C 3 193 ? 21.490 62.956 -5.289  1.00 35.90 ? 193  ILE A CD1   1 
ATOM   2122 N  N     . GLU C 3 194 ? 23.118 58.454 -6.331  1.00 34.77 ? 194  GLU A N     1 
ATOM   2123 C  CA    . GLU C 3 194 ? 24.471 57.958 -6.502  1.00 36.79 ? 194  GLU A CA    1 
ATOM   2124 C  C     . GLU C 3 194 ? 25.487 58.775 -5.720  1.00 35.23 ? 194  GLU A C     1 
ATOM   2125 O  O     . GLU C 3 194 ? 26.426 58.202 -5.139  1.00 35.31 ? 194  GLU A O     1 
ATOM   2126 C  CB    . GLU C 3 194 ? 24.838 57.876 -8.007  1.00 36.67 ? 194  GLU A CB    1 
ATOM   2127 C  CG    . GLU C 3 194 ? 26.092 57.034 -8.308  1.00 40.07 ? 194  GLU A CG    1 
ATOM   2128 C  CD    . GLU C 3 194 ? 26.469 56.970 -9.804  1.00 41.86 ? 194  GLU A CD    1 
ATOM   2129 O  OE1   . GLU C 3 194 ? 25.574 56.849 -10.682 1.00 46.63 ? 194  GLU A OE1   1 
ATOM   2130 O  OE2   . GLU C 3 194 ? 27.679 57.044 -10.101 1.00 47.42 ? 194  GLU A OE2   1 
ATOM   2131 N  N     . SER C 3 195 ? 25.354 60.101 -5.725  1.00 34.26 ? 195  SER A N     1 
ATOM   2132 C  CA    . SER C 3 195 ? 26.334 60.962 -5.053  1.00 34.44 ? 195  SER A CA    1 
ATOM   2133 C  C     . SER C 3 195 ? 26.263 60.779 -3.516  1.00 33.30 ? 195  SER A C     1 
ATOM   2134 O  O     . SER C 3 195 ? 27.252 60.913 -2.813  1.00 32.62 ? 195  SER A O     1 
ATOM   2135 C  CB    . SER C 3 195 ? 26.127 62.457 -5.426  1.00 35.09 ? 195  SER A CB    1 
ATOM   2136 O  OG    . SER C 3 195 ? 24.862 62.945 -4.980  1.00 35.92 ? 195  SER A OG    1 
ATOM   2137 N  N     . SER C 3 196 ? 25.076 60.511 -3.003  1.00 33.02 ? 196  SER A N     1 
ATOM   2138 C  CA    . SER C 3 196 ? 24.936 60.253 -1.559  1.00 33.22 ? 196  SER A CA    1 
ATOM   2139 C  C     . SER C 3 196 ? 25.548 58.884 -1.186  1.00 31.81 ? 196  SER A C     1 
ATOM   2140 O  O     . SER C 3 196 ? 26.198 58.741 -0.147  1.00 31.07 ? 196  SER A O     1 
ATOM   2141 C  CB    . SER C 3 196 ? 23.466 60.269 -1.182  1.00 33.34 ? 196  SER A CB    1 
ATOM   2142 O  OG    . SER C 3 196 ? 23.000 61.606 -1.180  1.00 40.44 ? 196  SER A OG    1 
ATOM   2143 N  N     . ILE C 3 197 ? 25.345 57.893 -2.061  1.00 30.94 ? 197  ILE A N     1 
ATOM   2144 C  CA    . ILE C 3 197 ? 25.970 56.583 -1.865  1.00 29.11 ? 197  ILE A CA    1 
ATOM   2145 C  C     . ILE C 3 197 ? 27.486 56.696 -1.861  1.00 29.55 ? 197  ILE A C     1 
ATOM   2146 O  O     . ILE C 3 197 ? 28.183 56.098 -1.002  1.00 29.52 ? 197  ILE A O     1 
ATOM   2147 C  CB    . ILE C 3 197 ? 25.416 55.561 -2.869  1.00 29.75 ? 197  ILE A CB    1 
ATOM   2148 C  CG1   . ILE C 3 197 ? 23.898 55.391 -2.591  1.00 28.17 ? 197  ILE A CG1   1 
ATOM   2149 C  CG2   . ILE C 3 197 ? 26.214 54.192 -2.805  1.00 27.28 ? 197  ILE A CG2   1 
ATOM   2150 C  CD1   . ILE C 3 197 ? 23.097 54.546 -3.658  1.00 28.35 ? 197  ILE A CD1   1 
ATOM   2151 N  N     . HIS C 3 198 ? 28.019 57.518 -2.761  1.00 29.13 ? 198  HIS A N     1 
ATOM   2152 C  CA    . HIS C 3 198 ? 29.462 57.718 -2.801  1.00 28.38 ? 198  HIS A CA    1 
ATOM   2153 C  C     . HIS C 3 198 ? 29.973 58.381 -1.514  1.00 27.90 ? 198  HIS A C     1 
ATOM   2154 O  O     . HIS C 3 198 ? 30.964 57.931 -0.941  1.00 28.46 ? 198  HIS A O     1 
ATOM   2155 C  CB    . HIS C 3 198 ? 29.874 58.559 -4.057  1.00 29.49 ? 198  HIS A CB    1 
ATOM   2156 C  CG    . HIS C 3 198 ? 31.346 58.844 -4.131  1.00 30.13 ? 198  HIS A CG    1 
ATOM   2157 N  ND1   . HIS C 3 198 ? 32.294 57.843 -4.225  1.00 32.54 ? 198  HIS A ND1   1 
ATOM   2158 C  CD2   . HIS C 3 198 ? 32.035 60.012 -4.138  1.00 33.61 ? 198  HIS A CD2   1 
ATOM   2159 C  CE1   . HIS C 3 198 ? 33.500 58.378 -4.274  1.00 32.66 ? 198  HIS A CE1   1 
ATOM   2160 N  NE2   . HIS C 3 198 ? 33.373 59.692 -4.219  1.00 31.89 ? 198  HIS A NE2   1 
ATOM   2161 N  N     . LEU C 3 199 ? 29.305 59.422 -1.024  1.00 25.84 ? 199  LEU A N     1 
ATOM   2162 C  CA    . LEU C 3 199 ? 29.762 60.055 0.231   1.00 26.37 ? 199  LEU A CA    1 
ATOM   2163 C  C     . LEU C 3 199 ? 29.631 59.074 1.417   1.00 26.34 ? 199  LEU A C     1 
ATOM   2164 O  O     . LEU C 3 199 ? 30.447 59.057 2.341   1.00 27.02 ? 199  LEU A O     1 
ATOM   2165 C  CB    . LEU C 3 199 ? 28.910 61.317 0.518   1.00 26.31 ? 199  LEU A CB    1 
ATOM   2166 C  CG    . LEU C 3 199 ? 29.280 62.153 1.735   1.00 25.44 ? 199  LEU A CG    1 
ATOM   2167 C  CD1   . LEU C 3 199 ? 30.759 62.493 1.773   1.00 27.47 ? 199  LEU A CD1   1 
ATOM   2168 C  CD2   . LEU C 3 199 ? 28.450 63.460 1.833   1.00 28.16 ? 199  LEU A CD2   1 
ATOM   2169 N  N     . LEU C 3 200 ? 28.567 58.294 1.404   1.00 26.53 ? 200  LEU A N     1 
ATOM   2170 C  CA    . LEU C 3 200 ? 28.366 57.314 2.498   1.00 26.11 ? 200  LEU A CA    1 
ATOM   2171 C  C     . LEU C 3 200 ? 29.510 56.287 2.476   1.00 26.04 ? 200  LEU A C     1 
ATOM   2172 O  O     . LEU C 3 200 ? 30.146 56.041 3.500   1.00 27.06 ? 200  LEU A O     1 
ATOM   2173 C  CB    . LEU C 3 200 ? 27.006 56.646 2.356   1.00 26.20 ? 200  LEU A CB    1 
ATOM   2174 C  CG    . LEU C 3 200 ? 26.728 55.466 3.325   1.00 26.76 ? 200  LEU A CG    1 
ATOM   2175 C  CD1   . LEU C 3 200 ? 26.749 55.965 4.785   1.00 25.79 ? 200  LEU A CD1   1 
ATOM   2176 C  CD2   . LEU C 3 200 ? 25.403 54.887 3.004   1.00 25.12 ? 200  LEU A CD2   1 
ATOM   2177 N  N     . HIS C 3 201 ? 29.770 55.690 1.305   1.00 26.48 ? 201  HIS A N     1 
ATOM   2178 C  CA    . HIS C 3 201 ? 30.857 54.731 1.130   1.00 26.50 ? 201  HIS A CA    1 
ATOM   2179 C  C     . HIS C 3 201 ? 32.200 55.258 1.697   1.00 26.72 ? 201  HIS A C     1 
ATOM   2180 O  O     . HIS C 3 201 ? 32.851 54.611 2.543   1.00 23.32 ? 201  HIS A O     1 
ATOM   2181 C  CB    . HIS C 3 201 ? 30.965 54.341 -0.359  1.00 26.62 ? 201  HIS A CB    1 
ATOM   2182 C  CG    . HIS C 3 201 ? 32.201 53.571 -0.700  1.00 28.85 ? 201  HIS A CG    1 
ATOM   2183 N  ND1   . HIS C 3 201 ? 33.401 54.184 -1.012  1.00 28.71 ? 201  HIS A ND1   1 
ATOM   2184 C  CD2   . HIS C 3 201 ? 32.421 52.236 -0.809  1.00 29.55 ? 201  HIS A CD2   1 
ATOM   2185 C  CE1   . HIS C 3 201 ? 34.312 53.258 -1.281  1.00 28.71 ? 201  HIS A CE1   1 
ATOM   2186 N  NE2   . HIS C 3 201 ? 33.746 52.069 -1.160  1.00 29.17 ? 201  HIS A NE2   1 
ATOM   2187 N  N     . ASP C 3 202 ? 32.616 56.436 1.230   1.00 26.29 ? 202  ASP A N     1 
ATOM   2188 C  CA    . ASP C 3 202 ? 33.853 57.033 1.704   1.00 27.00 ? 202  ASP A CA    1 
ATOM   2189 C  C     . ASP C 3 202 ? 33.795 57.420 3.169   1.00 26.61 ? 202  ASP A C     1 
ATOM   2190 O  O     . ASP C 3 202 ? 34.812 57.303 3.854   1.00 28.23 ? 202  ASP A O     1 
ATOM   2191 C  CB    . ASP C 3 202 ? 34.261 58.266 0.853   1.00 27.59 ? 202  ASP A CB    1 
ATOM   2192 C  CG    . ASP C 3 202 ? 34.602 57.907 -0.602  1.00 32.35 ? 202  ASP A CG    1 
ATOM   2193 O  OD1   . ASP C 3 202 ? 34.539 56.703 -1.027  1.00 31.87 ? 202  ASP A OD1   1 
ATOM   2194 O  OD2   . ASP C 3 202 ? 34.897 58.863 -1.347  1.00 35.84 ? 202  ASP A OD2   1 
ATOM   2195 N  N     . SER C 3 203 ? 32.635 57.852 3.678   1.00 25.49 ? 203  SER A N     1 
ATOM   2196 C  CA    . SER C 3 203 ? 32.566 58.267 5.068   1.00 26.60 ? 203  SER A CA    1 
ATOM   2197 C  C     . SER C 3 203 ? 32.692 57.039 6.031   1.00 27.17 ? 203  SER A C     1 
ATOM   2198 O  O     . SER C 3 203 ? 33.302 57.153 7.098   1.00 27.97 ? 203  SER A O     1 
ATOM   2199 C  CB    . SER C 3 203 ? 31.275 59.066 5.356   1.00 27.98 ? 203  SER A CB    1 
ATOM   2200 O  OG    . SER C 3 203 ? 31.168 60.207 4.470   1.00 29.34 ? 203  SER A OG    1 
ATOM   2201 N  N     . ILE C 3 204 ? 32.113 55.903 5.655   1.00 25.64 ? 204  ILE A N     1 
ATOM   2202 C  CA    . ILE C 3 204 ? 32.286 54.649 6.415   1.00 25.60 ? 204  ILE A CA    1 
ATOM   2203 C  C     . ILE C 3 204 ? 33.775 54.291 6.572   1.00 26.57 ? 204  ILE A C     1 
ATOM   2204 O  O     . ILE C 3 204 ? 34.232 54.022 7.689   1.00 26.23 ? 204  ILE A O     1 
ATOM   2205 C  CB    . ILE C 3 204 ? 31.514 53.477 5.746   1.00 25.54 ? 204  ILE A CB    1 
ATOM   2206 C  CG1   . ILE C 3 204 ? 29.986 53.659 5.879   1.00 21.72 ? 204  ILE A CG1   1 
ATOM   2207 C  CG2   . ILE C 3 204 ? 31.968 52.081 6.350   1.00 24.89 ? 204  ILE A CG2   1 
ATOM   2208 C  CD1   . ILE C 3 204 ? 29.212 52.756 4.868   1.00 23.07 ? 204  ILE A CD1   1 
ATOM   2209 N  N     . ILE C 3 205 ? 34.517 54.293 5.455   1.00 26.84 ? 205  ILE A N     1 
ATOM   2210 C  CA    . ILE C 3 205 ? 35.958 54.000 5.454   1.00 27.17 ? 205  ILE A CA    1 
ATOM   2211 C  C     . ILE C 3 205 ? 36.732 55.036 6.269   1.00 29.61 ? 205  ILE A C     1 
ATOM   2212 O  O     . ILE C 3 205 ? 37.552 54.677 7.146   1.00 27.15 ? 205  ILE A O     1 
ATOM   2213 C  CB    . ILE C 3 205 ? 36.571 53.885 4.015   1.00 27.03 ? 205  ILE A CB    1 
ATOM   2214 C  CG1   . ILE C 3 205 ? 35.924 52.718 3.251   1.00 25.95 ? 205  ILE A CG1   1 
ATOM   2215 C  CG2   . ILE C 3 205 ? 38.130 53.662 4.071   1.00 27.83 ? 205  ILE A CG2   1 
ATOM   2216 C  CD1   . ILE C 3 205 ? 36.108 52.725 1.734   1.00 26.84 ? 205  ILE A CD1   1 
ATOM   2217 N  N     . GLU C 3 206 ? 36.450 56.312 6.015   1.00 29.36 ? 206  GLU A N     1 
ATOM   2218 C  CA    . GLU C 3 206 ? 37.173 57.392 6.750   1.00 31.66 ? 206  GLU A CA    1 
ATOM   2219 C  C     . GLU C 3 206 ? 36.986 57.425 8.260   1.00 31.25 ? 206  GLU A C     1 
ATOM   2220 O  O     . GLU C 3 206 ? 37.969 57.545 9.007   1.00 32.84 ? 206  GLU A O     1 
ATOM   2221 C  CB    . GLU C 3 206 ? 36.859 58.776 6.149   1.00 31.89 ? 206  GLU A CB    1 
ATOM   2222 C  CG    . GLU C 3 206 ? 37.211 58.855 4.645   1.00 36.78 ? 206  GLU A CG    1 
ATOM   2223 C  CD    . GLU C 3 206 ? 38.690 58.632 4.355   1.00 47.43 ? 206  GLU A CD    1 
ATOM   2224 O  OE1   . GLU C 3 206 ? 39.501 58.653 5.307   1.00 52.57 ? 206  GLU A OE1   1 
ATOM   2225 O  OE2   . GLU C 3 206 ? 39.061 58.470 3.169   1.00 52.62 ? 206  GLU A OE2   1 
ATOM   2226 N  N     . ILE C 3 207 ? 35.749 57.337 8.712   1.00 30.90 ? 207  ILE A N     1 
ATOM   2227 C  CA    . ILE C 3 207 ? 35.477 57.383 10.115  1.00 32.53 ? 207  ILE A CA    1 
ATOM   2228 C  C     . ILE C 3 207 ? 36.106 56.161 10.849  1.00 31.17 ? 207  ILE A C     1 
ATOM   2229 O  O     . ILE C 3 207 ? 36.649 56.304 11.928  1.00 29.83 ? 207  ILE A O     1 
ATOM   2230 C  CB    . ILE C 3 207 ? 33.961 57.515 10.379  1.00 32.98 ? 207  ILE A CB    1 
ATOM   2231 C  CG1   . ILE C 3 207 ? 33.614 59.006 10.504  1.00 38.02 ? 207  ILE A CG1   1 
ATOM   2232 C  CG2   . ILE C 3 207 ? 33.571 57.013 11.781  1.00 36.76 ? 207  ILE A CG2   1 
ATOM   2233 C  CD1   . ILE C 3 207 ? 32.157 59.296 10.240  1.00 42.48 ? 207  ILE A CD1   1 
ATOM   2234 N  N     . LEU C 3 208 ? 36.004 54.967 10.258  1.00 30.56 ? 208  LEU A N     1 
ATOM   2235 C  CA    . LEU C 3 208 ? 36.508 53.753 10.963  1.00 30.21 ? 208  LEU A CA    1 
ATOM   2236 C  C     . LEU C 3 208 ? 38.025 53.793 11.011  1.00 30.29 ? 208  LEU A C     1 
ATOM   2237 O  O     . LEU C 3 208 ? 38.627 53.394 11.996  1.00 29.95 ? 208  LEU A O     1 
ATOM   2238 C  CB    . LEU C 3 208 ? 35.967 52.465 10.302  1.00 29.29 ? 208  LEU A CB    1 
ATOM   2239 C  CG    . LEU C 3 208 ? 34.445 52.315 10.493  1.00 26.24 ? 208  LEU A CG    1 
ATOM   2240 C  CD1   . LEU C 3 208 ? 33.896 51.104 9.747   1.00 27.08 ? 208  LEU A CD1   1 
ATOM   2241 C  CD2   . LEU C 3 208 ? 34.066 52.209 11.996  1.00 28.25 ? 208  LEU A CD2   1 
ATOM   2242 N  N     . GLN C 3 209 ? 38.646 54.293 9.936   1.00 30.61 ? 209  GLN A N     1 
ATOM   2243 C  CA    . GLN C 3 209 ? 40.104 54.381 9.877   1.00 32.20 ? 209  GLN A CA    1 
ATOM   2244 C  C     . GLN C 3 209 ? 40.611 55.452 10.864  1.00 32.15 ? 209  GLN A C     1 
ATOM   2245 O  O     . GLN C 3 209 ? 41.614 55.241 11.554  1.00 31.63 ? 209  GLN A O     1 
ATOM   2246 C  CB    . GLN C 3 209 ? 40.615 54.629 8.438   1.00 33.18 ? 209  GLN A CB    1 
ATOM   2247 C  CG    . GLN C 3 209 ? 40.240 53.594 7.271   1.00 38.88 ? 209  GLN A CG    1 
ATOM   2248 C  CD    . GLN C 3 209 ? 39.841 52.113 7.638   1.00 47.57 ? 209  GLN A CD    1 
ATOM   2249 O  OE1   . GLN C 3 209 ? 40.684 51.247 8.008   1.00 46.11 ? 209  GLN A OE1   1 
ATOM   2250 N  NE2   . GLN C 3 209 ? 38.551 51.808 7.432   1.00 46.10 ? 209  GLN A NE2   1 
ATOM   2251 N  N     . LYS C 3 210 ? 39.916 56.588 10.952  1.00 31.36 ? 210  LYS A N     1 
ATOM   2252 C  CA    . LYS C 3 210 ? 40.189 57.610 12.006  1.00 31.88 ? 210  LYS A CA    1 
ATOM   2253 C  C     . LYS C 3 210 ? 40.028 56.995 13.412  1.00 31.90 ? 210  LYS A C     1 
ATOM   2254 O  O     . LYS C 3 210 ? 40.894 57.163 14.274  1.00 32.67 ? 210  LYS A O     1 
ATOM   2255 C  CB    . LYS C 3 210 ? 39.236 58.806 11.871  1.00 32.41 ? 210  LYS A CB    1 
ATOM   2256 C  CG    . LYS C 3 210 ? 39.484 60.015 12.836  1.00 31.19 ? 210  LYS A CG    1 
ATOM   2257 C  CD    . LYS C 3 210 ? 38.387 61.073 12.643  1.00 33.82 ? 210  LYS A CD    1 
ATOM   2258 C  CE    . LYS C 3 210 ? 38.547 62.243 13.600  1.00 38.00 ? 210  LYS A CE    1 
ATOM   2259 N  NZ    . LYS C 3 210 ? 37.598 63.388 13.226  1.00 42.89 ? 210  LYS A NZ    1 
ATOM   2260 N  N     . ALA C 3 211 ? 38.924 56.281 13.648  1.00 31.10 ? 211  ALA A N     1 
ATOM   2261 C  CA    . ALA C 3 211 ? 38.712 55.655 14.949  1.00 30.75 ? 211  ALA A CA    1 
ATOM   2262 C  C     . ALA C 3 211 ? 39.871 54.706 15.273  1.00 30.08 ? 211  ALA A C     1 
ATOM   2263 O  O     . ALA C 3 211 ? 40.347 54.666 16.404  1.00 32.48 ? 211  ALA A O     1 
ATOM   2264 C  CB    . ALA C 3 211 ? 37.393 54.950 14.967  1.00 30.46 ? 211  ALA A CB    1 
ATOM   2265 N  N     . ILE C 3 212 ? 40.337 53.964 14.284  1.00 30.85 ? 212  ILE A N     1 
ATOM   2266 C  CA    . ILE C 3 212 ? 41.430 53.016 14.503  1.00 30.91 ? 212  ILE A CA    1 
ATOM   2267 C  C     . ILE C 3 212 ? 42.701 53.775 14.841  1.00 31.74 ? 212  ILE A C     1 
ATOM   2268 O  O     . ILE C 3 212 ? 43.383 53.450 15.825  1.00 31.75 ? 212  ILE A O     1 
ATOM   2269 C  CB    . ILE C 3 212 ? 41.674 52.079 13.302  1.00 30.57 ? 212  ILE A CB    1 
ATOM   2270 C  CG1   . ILE C 3 212 ? 40.526 51.074 13.153  1.00 28.33 ? 212  ILE A CG1   1 
ATOM   2271 C  CG2   . ILE C 3 212 ? 43.066 51.398 13.425  1.00 30.54 ? 212  ILE A CG2   1 
ATOM   2272 C  CD1   . ILE C 3 212 ? 40.514 50.299 11.825  1.00 30.15 ? 212  ILE A CD1   1 
ATOM   2273 N  N     . LYS C 3 213 ? 43.057 54.777 14.030  1.00 31.74 ? 213  LYS A N     1 
ATOM   2274 C  CA    . LYS C 3 213 ? 44.206 55.614 14.373  1.00 32.30 ? 213  LYS A CA    1 
ATOM   2275 C  C     . LYS C 3 213 ? 44.128 56.163 15.786  1.00 32.76 ? 213  LYS A C     1 
ATOM   2276 O  O     . LYS C 3 213 ? 45.176 56.233 16.479  1.00 34.04 ? 213  LYS A O     1 
ATOM   2277 C  CB    . LYS C 3 213 ? 44.444 56.759 13.317  1.00 32.72 ? 213  LYS A CB    1 
ATOM   2278 N  N     . LEU C 3 214 ? 42.923 56.506 16.270  1.00 31.43 ? 214  LEU A N     1 
ATOM   2279 C  CA    . LEU C 3 214 ? 42.832 57.142 17.602  1.00 32.09 ? 214  LEU A CA    1 
ATOM   2280 C  C     . LEU C 3 214 ? 42.641 56.133 18.753  1.00 31.56 ? 214  LEU A C     1 
ATOM   2281 O  O     . LEU C 3 214 ? 42.358 56.515 19.884  1.00 30.20 ? 214  LEU A O     1 
ATOM   2282 C  CB    . LEU C 3 214 ? 41.732 58.191 17.637  1.00 32.34 ? 214  LEU A CB    1 
ATOM   2283 C  CG    . LEU C 3 214 ? 41.964 59.410 16.685  1.00 35.47 ? 214  LEU A CG    1 
ATOM   2284 C  CD1   . LEU C 3 214 ? 40.904 60.454 16.921  1.00 35.72 ? 214  LEU A CD1   1 
ATOM   2285 C  CD2   . LEU C 3 214 ? 43.319 60.061 16.951  1.00 40.96 ? 214  LEU A CD2   1 
ATOM   2286 N  N     . GLY C 3 215 ? 42.765 54.847 18.429  1.00 30.24 ? 215  GLY A N     1 
ATOM   2287 C  CA    . GLY C 3 215 ? 42.677 53.801 19.486  1.00 29.94 ? 215  GLY A CA    1 
ATOM   2288 C  C     . GLY C 3 215 ? 41.282 53.499 20.015  1.00 29.30 ? 215  GLY A C     1 
ATOM   2289 O  O     . GLY C 3 215 ? 41.133 53.006 21.138  1.00 28.56 ? 215  GLY A O     1 
ATOM   2290 N  N     . GLY C 3 216 ? 40.259 53.741 19.192  1.00 29.32 ? 216  GLY A N     1 
ATOM   2291 C  CA    . GLY C 3 216 ? 38.866 53.498 19.596  1.00 30.04 ? 216  GLY A CA    1 
ATOM   2292 C  C     . GLY C 3 216 ? 38.255 54.611 20.443  1.00 31.71 ? 216  GLY A C     1 
ATOM   2293 O  O     . GLY C 3 216 ? 38.941 55.588 20.789  1.00 31.02 ? 216  GLY A O     1 
ATOM   2294 N  N     . SER C 3 217 ? 36.964 54.463 20.757  1.00 31.65 ? 217  SER A N     1 
ATOM   2295 C  CA    . SER C 3 217 ? 36.233 55.407 21.596  1.00 33.88 ? 217  SER A CA    1 
ATOM   2296 C  C     . SER C 3 217 ? 36.043 54.840 22.989  1.00 36.16 ? 217  SER A C     1 
ATOM   2297 O  O     . SER C 3 217 ? 35.448 53.779 23.135  1.00 36.23 ? 217  SER A O     1 
ATOM   2298 C  CB    . SER C 3 217 ? 34.853 55.713 20.989  1.00 33.18 ? 217  SER A CB    1 
ATOM   2299 O  OG    . SER C 3 217 ? 34.993 56.500 19.797  1.00 32.45 ? 217  SER A OG    1 
ATOM   2300 N  N     . SER C 3 218 ? 36.549 55.537 24.010  1.00 38.90 ? 218  SER A N     1 
ATOM   2301 C  CA    . SER C 3 218 ? 36.263 55.158 25.402  1.00 41.43 ? 218  SER A CA    1 
ATOM   2302 C  C     . SER C 3 218 ? 35.128 56.024 25.949  1.00 43.82 ? 218  SER A C     1 
ATOM   2303 O  O     . SER C 3 218 ? 35.282 57.240 26.121  1.00 43.81 ? 218  SER A O     1 
ATOM   2304 C  CB    . SER C 3 218 ? 37.526 55.221 26.260  1.00 41.55 ? 218  SER A CB    1 
ATOM   2305 O  OG    . SER C 3 218 ? 38.504 54.298 25.761  1.00 41.75 ? 218  SER A OG    1 
ATOM   2306 N  N     . ILE C 3 219 ? 33.976 55.392 26.179  1.00 46.27 ? 219  ILE A N     1 
ATOM   2307 C  CA    . ILE C 3 219 ? 32.734 56.091 26.529  1.00 48.64 ? 219  ILE A CA    1 
ATOM   2308 C  C     . ILE C 3 219 ? 32.383 55.775 27.976  1.00 50.02 ? 219  ILE A C     1 
ATOM   2309 O  O     . ILE C 3 219 ? 32.232 56.670 28.795  1.00 50.69 ? 219  ILE A O     1 
ATOM   2310 C  CB    . ILE C 3 219 ? 31.553 55.663 25.624  1.00 49.09 ? 219  ILE A CB    1 
ATOM   2311 C  CG1   . ILE C 3 219 ? 31.865 55.894 24.133  1.00 48.75 ? 219  ILE A CG1   1 
ATOM   2312 C  CG2   . ILE C 3 219 ? 30.249 56.348 26.067  1.00 51.03 ? 219  ILE A CG2   1 
ATOM   2313 C  CD1   . ILE C 3 219 ? 31.928 57.342 23.715  1.00 51.08 ? 219  ILE A CD1   1 
ATOM   2314 N  N     . ARG C 3 220 ? 32.273 54.493 28.293  1.00 51.31 ? 220  ARG A N     1 
ATOM   2315 C  CA    . ARG C 3 220 ? 31.892 54.078 29.640  1.00 52.32 ? 220  ARG A CA    1 
ATOM   2316 C  C     . ARG C 3 220 ? 32.808 52.987 30.127  1.00 52.96 ? 220  ARG A C     1 
ATOM   2317 O  O     . ARG C 3 220 ? 33.222 52.990 31.288  1.00 53.39 ? 220  ARG A O     1 
ATOM   2318 C  CB    . ARG C 3 220 ? 30.438 53.574 29.681  1.00 52.32 ? 220  ARG A CB    1 
ATOM   2319 N  N     . THR C 3 221 ? 33.104 52.045 29.233  1.00 53.11 ? 221  THR A N     1 
ATOM   2320 C  CA    . THR C 3 221 ? 33.671 50.768 29.640  1.00 53.08 ? 221  THR A CA    1 
ATOM   2321 C  C     . THR C 3 221 ? 34.879 50.350 28.809  1.00 52.71 ? 221  THR A C     1 
ATOM   2322 O  O     . THR C 3 221 ? 35.776 49.645 29.313  1.00 53.15 ? 221  THR A O     1 
ATOM   2323 C  CB    . THR C 3 221 ? 32.581 49.657 29.671  1.00 53.34 ? 221  THR A CB    1 
ATOM   2324 O  OG1   . THR C 3 221 ? 31.919 49.551 28.393  1.00 53.48 ? 221  THR A OG1   1 
ATOM   2325 C  CG2   . THR C 3 221 ? 31.536 49.959 30.782  1.00 54.71 ? 221  THR A CG2   1 
ATOM   2326 N  N     . TYR C 3 222 ? 34.939 50.815 27.563  1.00 51.27 ? 222  TYR A N     1 
ATOM   2327 C  CA    . TYR C 3 222 ? 36.021 50.391 26.663  1.00 50.34 ? 222  TYR A CA    1 
ATOM   2328 C  C     . TYR C 3 222 ? 37.439 50.857 27.050  1.00 50.38 ? 222  TYR A C     1 
ATOM   2329 O  O     . TYR C 3 222 ? 37.676 52.061 27.256  1.00 50.01 ? 222  TYR A O     1 
ATOM   2330 C  CB    . TYR C 3 222 ? 35.738 50.840 25.224  1.00 49.50 ? 222  TYR A CB    1 
ATOM   2331 C  CG    . TYR C 3 222 ? 36.936 50.733 24.321  1.00 47.43 ? 222  TYR A CG    1 
ATOM   2332 C  CD1   . TYR C 3 222 ? 37.427 49.474 23.926  1.00 49.84 ? 222  TYR A CD1   1 
ATOM   2333 C  CD2   . TYR C 3 222 ? 37.581 51.878 23.848  1.00 47.27 ? 222  TYR A CD2   1 
ATOM   2334 C  CE1   . TYR C 3 222 ? 38.554 49.369 23.071  1.00 49.77 ? 222  TYR A CE1   1 
ATOM   2335 C  CE2   . TYR C 3 222 ? 38.691 51.790 22.985  1.00 45.75 ? 222  TYR A CE2   1 
ATOM   2336 C  CZ    . TYR C 3 222 ? 39.164 50.550 22.618  1.00 47.44 ? 222  TYR A CZ    1 
ATOM   2337 O  OH    . TYR C 3 222 ? 40.237 50.453 21.798  1.00 48.72 ? 222  TYR A OH    1 
ATOM   2338 N  N     . SER C 3 223 ? 38.375 49.911 27.112  1.00 49.81 ? 223  SER A N     1 
ATOM   2339 C  CA    . SER C 3 223 ? 39.795 50.252 26.914  1.00 50.03 ? 223  SER A CA    1 
ATOM   2340 C  C     . SER C 3 223 ? 40.575 49.080 26.285  1.00 50.22 ? 223  SER A C     1 
ATOM   2341 O  O     . SER C 3 223 ? 40.231 47.892 26.463  1.00 48.66 ? 223  SER A O     1 
ATOM   2342 C  CB    . SER C 3 223 ? 40.475 50.841 28.175  1.00 49.00 ? 223  SER A CB    1 
ATOM   2343 O  OG    . SER C 3 223 ? 40.696 49.864 29.165  1.00 50.11 ? 223  SER A OG    1 
ATOM   2344 N  N     . ALA C 3 224 ? 41.618 49.417 25.532  1.00 49.89 ? 224  ALA A N     1 
ATOM   2345 C  CA    . ALA C 3 224 ? 42.425 48.368 24.915  1.00 49.82 ? 224  ALA A CA    1 
ATOM   2346 C  C     . ALA C 3 224 ? 43.567 48.001 25.863  1.00 50.43 ? 224  ALA A C     1 
ATOM   2347 O  O     . ALA C 3 224 ? 44.559 48.741 25.981  1.00 51.03 ? 224  ALA A O     1 
ATOM   2348 C  CB    . ALA C 3 224 ? 42.944 48.833 23.588  1.00 49.36 ? 224  ALA A CB    1 
ATOM   2349 N  N     . LEU C 3 225 ? 43.408 46.885 26.574  1.00 50.18 ? 225  LEU A N     1 
ATOM   2350 C  CA    . LEU C 3 225 ? 44.370 46.471 27.583  1.00 50.77 ? 225  LEU A CA    1 
ATOM   2351 C  C     . LEU C 3 225 ? 44.785 47.642 28.502  1.00 51.42 ? 225  LEU A C     1 
ATOM   2352 O  O     . LEU C 3 225 ? 45.990 47.971 28.633  1.00 50.87 ? 225  LEU A O     1 
ATOM   2353 C  CB    . LEU C 3 225 ? 45.595 45.776 26.941  1.00 50.36 ? 225  LEU A CB    1 
ATOM   2354 C  CG    . LEU C 3 225 ? 45.432 44.434 26.210  1.00 50.16 ? 225  LEU A CG    1 
ATOM   2355 C  CD1   . LEU C 3 225 ? 44.755 43.412 27.024  1.00 47.36 ? 225  LEU A CD1   1 
ATOM   2356 C  CD2   . LEU C 3 225 ? 44.646 44.599 24.911  1.00 50.88 ? 225  LEU A CD2   1 
ATOM   2357 N  N     . GLY C 3 226 ? 43.777 48.284 29.104  1.00 51.61 ? 226  GLY A N     1 
ATOM   2358 C  CA    . GLY C 3 226 ? 44.018 49.401 30.036  1.00 53.17 ? 226  GLY A CA    1 
ATOM   2359 C  C     . GLY C 3 226 ? 44.332 50.756 29.395  1.00 53.99 ? 226  GLY A C     1 
ATOM   2360 O  O     . GLY C 3 226 ? 44.585 51.742 30.109  1.00 54.80 ? 226  GLY A O     1 
ATOM   2361 N  N     . SER C 3 227 ? 44.305 50.820 28.061  1.00 54.01 ? 227  SER A N     1 
ATOM   2362 C  CA    . SER C 3 227 ? 44.574 52.072 27.345  1.00 53.65 ? 227  SER A CA    1 
ATOM   2363 C  C     . SER C 3 227 ? 43.327 52.750 26.763  1.00 53.22 ? 227  SER A C     1 
ATOM   2364 O  O     . SER C 3 227 ? 42.635 52.201 25.898  1.00 53.57 ? 227  SER A O     1 
ATOM   2365 C  CB    . SER C 3 227 ? 45.601 51.865 26.236  1.00 53.71 ? 227  SER A CB    1 
ATOM   2366 O  OG    . SER C 3 227 ? 45.612 53.016 25.400  1.00 54.53 ? 227  SER A OG    1 
ATOM   2367 N  N     . THR C 3 228 ? 43.079 53.965 27.223  1.00 51.40 ? 228  THR A N     1 
ATOM   2368 C  CA    . THR C 3 228 ? 41.981 54.768 26.731  1.00 50.20 ? 228  THR A CA    1 
ATOM   2369 C  C     . THR C 3 228 ? 42.209 55.226 25.270  1.00 47.85 ? 228  THR A C     1 
ATOM   2370 O  O     . THR C 3 228 ? 43.296 55.685 24.896  1.00 46.07 ? 228  THR A O     1 
ATOM   2371 C  CB    . THR C 3 228 ? 41.784 56.035 27.610  1.00 50.46 ? 228  THR A CB    1 
ATOM   2372 O  OG1   . THR C 3 228 ? 42.251 55.786 28.939  1.00 52.75 ? 228  THR A OG1   1 
ATOM   2373 C  CG2   . THR C 3 228 ? 40.330 56.424 27.670  1.00 51.77 ? 228  THR A CG2   1 
ATOM   2374 N  N     . GLY C 3 229 ? 41.160 55.109 24.458  1.00 45.86 ? 229  GLY A N     1 
ATOM   2375 C  CA    . GLY C 3 229 ? 41.200 55.663 23.116  1.00 43.71 ? 229  GLY A CA    1 
ATOM   2376 C  C     . GLY C 3 229 ? 40.988 57.169 23.203  1.00 42.45 ? 229  GLY A C     1 
ATOM   2377 O  O     . GLY C 3 229 ? 40.714 57.716 24.285  1.00 41.72 ? 229  GLY A O     1 
ATOM   2378 N  N     . LYS C 3 230 ? 41.119 57.828 22.059  1.00 41.53 ? 230  LYS A N     1 
ATOM   2379 C  CA    . LYS C 3 230 ? 40.865 59.260 21.959  1.00 40.35 ? 230  LYS A CA    1 
ATOM   2380 C  C     . LYS C 3 230 ? 39.733 59.610 20.972  1.00 39.59 ? 230  LYS A C     1 
ATOM   2381 O  O     . LYS C 3 230 ? 39.383 60.787 20.817  1.00 38.91 ? 230  LYS A O     1 
ATOM   2382 C  CB    . LYS C 3 230 ? 42.150 60.003 21.553  1.00 41.38 ? 230  LYS A CB    1 
ATOM   2383 C  CG    . LYS C 3 230 ? 43.323 59.846 22.522  1.00 43.60 ? 230  LYS A CG    1 
ATOM   2384 C  CD    . LYS C 3 230 ? 43.005 60.461 23.889  1.00 48.49 ? 230  LYS A CD    1 
ATOM   2385 N  N     . MET C 3 231 ? 39.162 58.607 20.305  1.00 36.57 ? 231  MET A N     1 
ATOM   2386 C  CA    . MET C 3 231 ? 38.042 58.869 19.361  1.00 35.37 ? 231  MET A CA    1 
ATOM   2387 C  C     . MET C 3 231 ? 36.807 59.487 20.028  1.00 35.52 ? 231  MET A C     1 
ATOM   2388 O  O     . MET C 3 231 ? 36.059 60.224 19.352  1.00 35.19 ? 231  MET A O     1 
ATOM   2389 C  CB    . MET C 3 231 ? 37.663 57.604 18.537  1.00 34.30 ? 231  MET A CB    1 
ATOM   2390 C  CG    . MET C 3 231 ? 36.592 57.894 17.434  1.00 33.75 ? 231  MET A CG    1 
ATOM   2391 S  SD    . MET C 3 231 ? 37.333 58.888 16.115  1.00 32.38 ? 231  MET A SD    1 
ATOM   2392 C  CE    . MET C 3 231 ? 35.900 58.916 15.025  1.00 34.26 ? 231  MET A CE    1 
ATOM   2393 N  N     . GLN C 3 232 ? 36.568 59.206 21.323  1.00 35.16 ? 232  GLN A N     1 
ATOM   2394 C  CA    . GLN C 3 232 ? 35.364 59.772 21.987  1.00 36.55 ? 232  GLN A CA    1 
ATOM   2395 C  C     . GLN C 3 232 ? 35.317 61.308 21.895  1.00 37.84 ? 232  GLN A C     1 
ATOM   2396 O  O     . GLN C 3 232 ? 34.217 61.890 21.862  1.00 37.77 ? 232  GLN A O     1 
ATOM   2397 C  CB    . GLN C 3 232 ? 35.170 59.311 23.434  1.00 36.28 ? 232  GLN A CB    1 
ATOM   2398 C  CG    . GLN C 3 232 ? 36.246 59.802 24.453  1.00 39.51 ? 232  GLN A CG    1 
ATOM   2399 C  CD    . GLN C 3 232 ? 37.574 59.028 24.416  1.00 40.07 ? 232  GLN A CD    1 
ATOM   2400 O  OE1   . GLN C 3 232 ? 37.789 58.113 23.594  1.00 34.51 ? 232  GLN A OE1   1 
ATOM   2401 N  NE2   . GLN C 3 232 ? 38.492 59.421 25.305  1.00 39.64 ? 232  GLN A NE2   1 
ATOM   2402 N  N     . ASN C 3 233 ? 36.495 61.940 21.835  1.00 38.35 ? 233  ASN A N     1 
ATOM   2403 C  CA    . ASN C 3 233 ? 36.608 63.418 21.720  1.00 40.38 ? 233  ASN A CA    1 
ATOM   2404 C  C     . ASN C 3 233 ? 36.249 63.951 20.328  1.00 40.58 ? 233  ASN A C     1 
ATOM   2405 O  O     . ASN C 3 233 ? 36.240 65.173 20.109  1.00 41.48 ? 233  ASN A O     1 
ATOM   2406 C  CB    . ASN C 3 233 ? 38.039 63.885 22.072  1.00 41.29 ? 233  ASN A CB    1 
ATOM   2407 C  CG    . ASN C 3 233 ? 38.457 63.461 23.478  1.00 43.96 ? 233  ASN A CG    1 
ATOM   2408 O  OD1   . ASN C 3 233 ? 37.613 63.367 24.388  1.00 45.95 ? 233  ASN A OD1   1 
ATOM   2409 N  ND2   . ASN C 3 233 ? 39.749 63.172 23.657  1.00 46.32 ? 233  ASN A ND2   1 
ATOM   2410 N  N     . GLU C 3 234 ? 36.002 63.048 19.375  1.00 38.50 ? 234  GLU A N     1 
ATOM   2411 C  CA    . GLU C 3 234 ? 35.723 63.462 18.003  1.00 37.99 ? 234  GLU A CA    1 
ATOM   2412 C  C     . GLU C 3 234 ? 34.294 63.156 17.607  1.00 36.22 ? 234  GLU A C     1 
ATOM   2413 O  O     . GLU C 3 234 ? 33.875 63.466 16.466  1.00 35.37 ? 234  GLU A O     1 
ATOM   2414 C  CB    . GLU C 3 234 ? 36.677 62.788 17.004  1.00 38.18 ? 234  GLU A CB    1 
ATOM   2415 C  CG    . GLU C 3 234 ? 38.136 62.922 17.364  1.00 42.00 ? 234  GLU A CG    1 
ATOM   2416 C  CD    . GLU C 3 234 ? 38.666 64.339 17.155  1.00 49.42 ? 234  GLU A CD    1 
ATOM   2417 O  OE1   . GLU C 3 234 ? 38.374 64.935 16.087  1.00 47.72 ? 234  GLU A OE1   1 
ATOM   2418 O  OE2   . GLU C 3 234 ? 39.383 64.837 18.065  1.00 52.03 ? 234  GLU A OE2   1 
ATOM   2419 N  N     . LEU C 3 235 ? 33.542 62.544 18.515  1.00 34.46 ? 235  LEU A N     1 
ATOM   2420 C  CA    . LEU C 3 235 ? 32.141 62.199 18.199  1.00 34.48 ? 235  LEU A CA    1 
ATOM   2421 C  C     . LEU C 3 235 ? 31.295 63.475 18.003  1.00 35.28 ? 235  LEU A C     1 
ATOM   2422 O  O     . LEU C 3 235 ? 31.369 64.400 18.823  1.00 35.39 ? 235  LEU A O     1 
ATOM   2423 C  CB    . LEU C 3 235 ? 31.508 61.334 19.300  1.00 33.28 ? 235  LEU A CB    1 
ATOM   2424 C  CG    . LEU C 3 235 ? 32.261 60.026 19.607  1.00 32.35 ? 235  LEU A CG    1 
ATOM   2425 C  CD1   . LEU C 3 235 ? 31.590 59.326 20.748  1.00 32.35 ? 235  LEU A CD1   1 
ATOM   2426 C  CD2   . LEU C 3 235 ? 32.293 59.106 18.395  1.00 30.92 ? 235  LEU A CD2   1 
ATOM   2427 N  N     . GLN C 3 236 ? 30.487 63.499 16.954  1.00 34.21 ? 236  GLN A N     1 
ATOM   2428 C  CA    . GLN C 3 236 ? 29.693 64.679 16.615  1.00 34.65 ? 236  GLN A CA    1 
ATOM   2429 C  C     . GLN C 3 236 ? 28.260 64.533 17.053  1.00 33.57 ? 236  GLN A C     1 
ATOM   2430 O  O     . GLN C 3 236 ? 27.612 65.545 17.297  1.00 33.30 ? 236  GLN A O     1 
ATOM   2431 C  CB    . GLN C 3 236 ? 29.751 64.966 15.111  1.00 34.20 ? 236  GLN A CB    1 
ATOM   2432 C  CG    . GLN C 3 236 ? 31.127 65.253 14.631  1.00 36.47 ? 236  GLN A CG    1 
ATOM   2433 C  CD    . GLN C 3 236 ? 31.690 66.538 15.182  1.00 42.74 ? 236  GLN A CD    1 
ATOM   2434 O  OE1   . GLN C 3 236 ? 31.000 67.559 15.261  1.00 41.87 ? 236  GLN A OE1   1 
ATOM   2435 N  NE2   . GLN C 3 236 ? 32.938 66.481 15.624  1.00 46.91 ? 236  GLN A NE2   1 
ATOM   2436 N  N     . VAL C 3 237 ? 27.758 63.296 17.188  1.00 31.14 ? 237  VAL A N     1 
ATOM   2437 C  CA    . VAL C 3 237 ? 26.348 63.077 17.537  1.00 30.73 ? 237  VAL A CA    1 
ATOM   2438 C  C     . VAL C 3 237 ? 26.051 62.030 18.635  1.00 30.58 ? 237  VAL A C     1 
ATOM   2439 O  O     . VAL C 3 237 ? 25.110 62.189 19.426  1.00 28.05 ? 237  VAL A O     1 
ATOM   2440 C  CB    . VAL C 3 237 ? 25.464 62.763 16.292  1.00 30.14 ? 237  VAL A CB    1 
ATOM   2441 C  CG1   . VAL C 3 237 ? 25.387 63.990 15.367  1.00 33.14 ? 237  VAL A CG1   1 
ATOM   2442 C  CG2   . VAL C 3 237 ? 26.009 61.532 15.479  1.00 28.73 ? 237  VAL A CG2   1 
ATOM   2443 N  N     . TYR C 3 238 ? 26.814 60.921 18.647  1.00 31.04 ? 238  TYR A N     1 
ATOM   2444 C  CA    . TYR C 3 238 ? 26.451 59.821 19.532  1.00 30.08 ? 238  TYR A CA    1 
ATOM   2445 C  C     . TYR C 3 238 ? 26.534 60.313 20.982  1.00 30.23 ? 238  TYR A C     1 
ATOM   2446 O  O     . TYR C 3 238 ? 27.579 60.779 21.409  1.00 32.68 ? 238  TYR A O     1 
ATOM   2447 C  CB    . TYR C 3 238 ? 27.389 58.609 19.344  1.00 29.35 ? 238  TYR A CB    1 
ATOM   2448 C  CG    . TYR C 3 238 ? 26.991 57.486 20.284  1.00 27.32 ? 238  TYR A CG    1 
ATOM   2449 C  CD1   . TYR C 3 238 ? 25.933 56.621 19.959  1.00 27.39 ? 238  TYR A CD1   1 
ATOM   2450 C  CD2   . TYR C 3 238 ? 27.618 57.330 21.518  1.00 26.33 ? 238  TYR A CD2   1 
ATOM   2451 C  CE1   . TYR C 3 238 ? 25.544 55.578 20.840  1.00 27.14 ? 238  TYR A CE1   1 
ATOM   2452 C  CE2   . TYR C 3 238 ? 27.229 56.310 22.407  1.00 29.16 ? 238  TYR A CE2   1 
ATOM   2453 C  CZ    . TYR C 3 238 ? 26.188 55.447 22.062  1.00 27.70 ? 238  TYR A CZ    1 
ATOM   2454 O  OH    . TYR C 3 238 ? 25.777 54.419 22.929  1.00 28.44 ? 238  TYR A OH    1 
ATOM   2455 N  N     . GLY C 3 239 ? 25.453 60.166 21.717  1.00 30.96 ? 239  GLY A N     1 
ATOM   2456 C  CA    . GLY C 3 239 ? 25.389 60.591 23.117  1.00 33.62 ? 239  GLY A CA    1 
ATOM   2457 C  C     . GLY C 3 239 ? 25.364 62.102 23.297  1.00 34.77 ? 239  GLY A C     1 
ATOM   2458 O  O     . GLY C 3 239 ? 25.598 62.603 24.413  1.00 35.47 ? 239  GLY A O     1 
ATOM   2459 N  N     . LYS C 3 240 ? 25.048 62.848 22.229  1.00 34.26 ? 240  LYS A N     1 
ATOM   2460 C  CA    . LYS C 3 240 ? 25.158 64.295 22.295  1.00 35.12 ? 240  LYS A CA    1 
ATOM   2461 C  C     . LYS C 3 240 ? 23.791 64.977 22.250  1.00 35.03 ? 240  LYS A C     1 
ATOM   2462 O  O     . LYS C 3 240 ? 23.728 66.133 21.890  1.00 35.36 ? 240  LYS A O     1 
ATOM   2463 C  CB    . LYS C 3 240 ? 26.042 64.849 21.147  1.00 35.83 ? 240  LYS A CB    1 
ATOM   2464 C  CG    . LYS C 3 240 ? 27.479 64.309 21.022  1.00 37.39 ? 240  LYS A CG    1 
ATOM   2465 C  CD    . LYS C 3 240 ? 28.294 64.542 22.275  1.00 39.75 ? 240  LYS A CD    1 
ATOM   2466 C  CE    . LYS C 3 240 ? 29.742 64.095 22.057  1.00 42.03 ? 240  LYS A CE    1 
ATOM   2467 N  NZ    . LYS C 3 240 ? 30.559 64.227 23.310  1.00 42.32 ? 240  LYS A NZ    1 
ATOM   2468 N  N     . THR C 3 241 ? 22.728 64.249 22.587  1.00 35.76 ? 241  THR A N     1 
ATOM   2469 C  CA    . THR C 3 241 ? 21.356 64.739 22.626  1.00 37.11 ? 241  THR A CA    1 
ATOM   2470 C  C     . THR C 3 241 ? 21.354 66.097 23.334  1.00 38.41 ? 241  THR A C     1 
ATOM   2471 O  O     . THR C 3 241 ? 21.883 66.228 24.453  1.00 37.49 ? 241  THR A O     1 
ATOM   2472 C  CB    . THR C 3 241 ? 20.493 63.761 23.407  1.00 37.30 ? 241  THR A CB    1 
ATOM   2473 O  OG1   . THR C 3 241 ? 20.747 62.439 22.906  1.00 37.41 ? 241  THR A OG1   1 
ATOM   2474 C  CG2   . THR C 3 241 ? 18.994 64.060 23.264  1.00 37.57 ? 241  THR A CG2   1 
ATOM   2475 N  N     . GLY C 3 242 ? 20.850 67.113 22.631  1.00 39.19 ? 242  GLY A N     1 
ATOM   2476 C  CA    . GLY C 3 242 ? 20.555 68.413 23.233  1.00 38.69 ? 242  GLY A CA    1 
ATOM   2477 C  C     . GLY C 3 242 ? 21.670 69.389 23.023  1.00 39.01 ? 242  GLY A C     1 
ATOM   2478 O  O     . GLY C 3 242 ? 21.453 70.599 23.214  1.00 39.74 ? 242  GLY A O     1 
ATOM   2479 N  N     . GLU C 3 243 ? 22.848 68.904 22.601  1.00 36.52 ? 243  GLU A N     1 
ATOM   2480 C  CA    . GLU C 3 243 ? 23.955 69.778 22.262  1.00 37.00 ? 243  GLU A CA    1 
ATOM   2481 C  C     . GLU C 3 243 ? 23.799 70.276 20.828  1.00 36.37 ? 243  GLU A C     1 
ATOM   2482 O  O     . GLU C 3 243 ? 22.951 69.788 20.120  1.00 35.92 ? 243  GLU A O     1 
ATOM   2483 C  CB    . GLU C 3 243 ? 25.324 69.088 22.418  1.00 37.36 ? 243  GLU A CB    1 
ATOM   2484 C  CG    . GLU C 3 243 ? 25.579 68.581 23.855  1.00 38.83 ? 243  GLU A CG    1 
ATOM   2485 C  CD    . GLU C 3 243 ? 26.901 67.868 24.034  1.00 39.68 ? 243  GLU A CD    1 
ATOM   2486 O  OE1   . GLU C 3 243 ? 27.955 68.362 23.572  1.00 43.56 ? 243  GLU A OE1   1 
ATOM   2487 O  OE2   . GLU C 3 243 ? 26.879 66.805 24.676  1.00 44.10 ? 243  GLU A OE2   1 
ATOM   2488 N  N     . LYS C 3 244 ? 24.645 71.205 20.400  1.00 36.55 ? 244  LYS A N     1 
ATOM   2489 C  CA    . LYS C 3 244 ? 24.422 71.843 19.100  1.00 38.13 ? 244  LYS A CA    1 
ATOM   2490 C  C     . LYS C 3 244 ? 25.319 71.202 18.057  1.00 37.57 ? 244  LYS A C     1 
ATOM   2491 O  O     . LYS C 3 244 ? 26.509 70.975 18.321  1.00 38.81 ? 244  LYS A O     1 
ATOM   2492 C  CB    . LYS C 3 244 ? 24.654 73.369 19.163  1.00 38.77 ? 244  LYS A CB    1 
ATOM   2493 C  CG    . LYS C 3 244 ? 23.969 74.139 20.360  1.00 40.75 ? 244  LYS A CG    1 
ATOM   2494 C  CD    . LYS C 3 244 ? 22.395 74.108 20.359  1.00 42.32 ? 244  LYS A CD    1 
ATOM   2495 C  CE    . LYS C 3 244 ? 21.772 74.872 21.591  1.00 43.04 ? 244  LYS A CE    1 
ATOM   2496 N  NZ    . LYS C 3 244 ? 20.206 74.755 21.685  1.00 41.31 ? 244  LYS A NZ    1 
ATOM   2497 N  N     . CYS C 3 245 ? 24.742 70.873 16.898  1.00 36.54 ? 245  CYS A N     1 
ATOM   2498 C  CA    . CYS C 3 245 ? 25.502 70.401 15.728  1.00 36.65 ? 245  CYS A CA    1 
ATOM   2499 C  C     . CYS C 3 245 ? 26.636 71.347 15.411  1.00 38.42 ? 245  CYS A C     1 
ATOM   2500 O  O     . CYS C 3 245 ? 26.422 72.543 15.310  1.00 38.98 ? 245  CYS A O     1 
ATOM   2501 C  CB    . CYS C 3 245 ? 24.578 70.277 14.521  1.00 36.57 ? 245  CYS A CB    1 
ATOM   2502 S  SG    . CYS C 3 245 ? 25.412 69.781 13.016  1.00 33.15 ? 245  CYS A SG    1 
ATOM   2503 N  N     . SER C 3 246 ? 27.843 70.812 15.248  1.00 38.40 ? 246  SER A N     1 
ATOM   2504 C  CA    . SER C 3 246 ? 29.027 71.591 14.924  1.00 39.58 ? 246  SER A CA    1 
ATOM   2505 C  C     . SER C 3 246 ? 28.993 72.276 13.532  1.00 40.95 ? 246  SER A C     1 
ATOM   2506 O  O     . SER C 3 246 ? 29.826 73.170 13.259  1.00 41.24 ? 246  SER A O     1 
ATOM   2507 C  CB    . SER C 3 246 ? 30.274 70.697 15.033  1.00 40.12 ? 246  SER A CB    1 
ATOM   2508 O  OG    . SER C 3 246 ? 30.363 69.782 13.923  1.00 40.01 ? 246  SER A OG    1 
ATOM   2509 N  N     . ARG C 3 247 ? 28.071 71.844 12.664  1.00 39.64 ? 247  ARG A N     1 
ATOM   2510 C  CA    . ARG C 3 247 ? 27.958 72.389 11.296  1.00 40.49 ? 247  ARG A CA    1 
ATOM   2511 C  C     . ARG C 3 247 ? 26.924 73.488 11.201  1.00 40.63 ? 247  ARG A C     1 
ATOM   2512 O  O     . ARG C 3 247 ? 27.159 74.508 10.581  1.00 43.15 ? 247  ARG A O     1 
ATOM   2513 C  CB    . ARG C 3 247 ? 27.623 71.301 10.241  1.00 39.38 ? 247  ARG A CB    1 
ATOM   2514 C  CG    . ARG C 3 247 ? 28.852 70.471 9.817   1.00 40.06 ? 247  ARG A CG    1 
ATOM   2515 C  CD    . ARG C 3 247 ? 28.552 69.476 8.633   1.00 39.36 ? 247  ARG A CD    1 
ATOM   2516 N  NE    . ARG C 3 247 ? 27.391 68.664 8.982   1.00 39.00 ? 247  ARG A NE    1 
ATOM   2517 C  CZ    . ARG C 3 247 ? 27.246 67.376 8.689   1.00 36.20 ? 247  ARG A CZ    1 
ATOM   2518 N  NH1   . ARG C 3 247 ? 28.175 66.728 7.983   1.00 36.08 ? 247  ARG A NH1   1 
ATOM   2519 N  NH2   . ARG C 3 247 ? 26.160 66.754 9.089   1.00 33.95 ? 247  ARG A NH2   1 
ATOM   2520 N  N     . CYS C 3 248 ? 25.775 73.288 11.811  1.00 40.26 ? 248  CYS A N     1 
ATOM   2521 C  CA    . CYS C 3 248 ? 24.662 74.192 11.585  1.00 39.77 ? 248  CYS A CA    1 
ATOM   2522 C  C     . CYS C 3 248 ? 24.140 74.887 12.859  1.00 40.66 ? 248  CYS A C     1 
ATOM   2523 O  O     . CYS C 3 248 ? 23.402 75.869 12.741  1.00 41.28 ? 248  CYS A O     1 
ATOM   2524 C  CB    . CYS C 3 248 ? 23.527 73.450 10.873  1.00 37.46 ? 248  CYS A CB    1 
ATOM   2525 S  SG    . CYS C 3 248 ? 22.565 72.436 11.887  1.00 34.58 ? 248  CYS A SG    1 
ATOM   2526 N  N     . GLY C 3 249 ? 24.482 74.360 14.052  1.00 39.41 ? 249  GLY A N     1 
ATOM   2527 C  CA    . GLY C 3 249 ? 24.018 74.928 15.316  1.00 37.95 ? 249  GLY A CA    1 
ATOM   2528 C  C     . GLY C 3 249 ? 22.678 74.406 15.766  1.00 37.94 ? 249  GLY A C     1 
ATOM   2529 O  O     . GLY C 3 249 ? 22.230 74.729 16.857  1.00 38.77 ? 249  GLY A O     1 
ATOM   2530 N  N     . ALA C 3 250 ? 22.017 73.551 14.980  1.00 36.69 ? 250  ALA A N     1 
ATOM   2531 C  CA    . ALA C 3 250 ? 20.772 72.961 15.484  1.00 36.69 ? 250  ALA A CA    1 
ATOM   2532 C  C     . ALA C 3 250 ? 21.103 71.992 16.633  1.00 37.17 ? 250  ALA A C     1 
ATOM   2533 O  O     . ALA C 3 250 ? 22.250 71.527 16.695  1.00 37.90 ? 250  ALA A O     1 
ATOM   2534 C  CB    . ALA C 3 250 ? 20.037 72.219 14.394  1.00 35.36 ? 250  ALA A CB    1 
ATOM   2535 N  N     . GLU C 3 251 ? 20.113 71.694 17.489  1.00 37.35 ? 251  GLU A N     1 
ATOM   2536 C  CA    . GLU C 3 251 ? 20.254 70.733 18.616  1.00 37.15 ? 251  GLU A CA    1 
ATOM   2537 C  C     . GLU C 3 251 ? 20.152 69.294 18.110  1.00 36.81 ? 251  GLU A C     1 
ATOM   2538 O  O     . GLU C 3 251 ? 19.184 68.939 17.433  1.00 34.55 ? 251  GLU A O     1 
ATOM   2539 C  CB    . GLU C 3 251 ? 19.169 70.917 19.691  1.00 38.01 ? 251  GLU A CB    1 
ATOM   2540 C  CG    . GLU C 3 251 ? 19.541 71.897 20.745  1.00 39.22 ? 251  GLU A CG    1 
ATOM   2541 C  CD    . GLU C 3 251 ? 18.597 71.962 21.956  1.00 38.06 ? 251  GLU A CD    1 
ATOM   2542 O  OE1   . GLU C 3 251 ? 17.796 71.026 22.269  1.00 37.70 ? 251  GLU A OE1   1 
ATOM   2543 O  OE2   . GLU C 3 251 ? 18.697 73.010 22.615  1.00 41.78 ? 251  GLU A OE2   1 
ATOM   2544 N  N     . ILE C 3 252 ? 21.131 68.466 18.477  1.00 35.79 ? 252  ILE A N     1 
ATOM   2545 C  CA    . ILE C 3 252 ? 21.052 67.034 18.189  1.00 34.77 ? 252  ILE A CA    1 
ATOM   2546 C  C     . ILE C 3 252 ? 19.864 66.422 18.880  1.00 35.37 ? 252  ILE A C     1 
ATOM   2547 O  O     . ILE C 3 252 ? 19.604 66.648 20.095  1.00 36.39 ? 252  ILE A O     1 
ATOM   2548 C  CB    . ILE C 3 252 ? 22.389 66.277 18.629  1.00 34.34 ? 252  ILE A CB    1 
ATOM   2549 C  CG1   . ILE C 3 252 ? 23.622 66.923 18.005  1.00 32.68 ? 252  ILE A CG1   1 
ATOM   2550 C  CG2   . ILE C 3 252 ? 22.303 64.767 18.361  1.00 33.71 ? 252  ILE A CG2   1 
ATOM   2551 C  CD1   . ILE C 3 252 ? 23.571 67.126 16.415  1.00 33.65 ? 252  ILE A CD1   1 
ATOM   2552 N  N     . GLN C 3 253 ? 19.141 65.621 18.131  1.00 33.57 ? 253  GLN A N     1 
ATOM   2553 C  CA    . GLN C 3 253 ? 17.993 64.969 18.650  1.00 35.02 ? 253  GLN A CA    1 
ATOM   2554 C  C     . GLN C 3 253 ? 18.275 63.473 18.838  1.00 35.03 ? 253  GLN A C     1 
ATOM   2555 O  O     . GLN C 3 253 ? 19.182 62.950 18.206  1.00 34.49 ? 253  GLN A O     1 
ATOM   2556 C  CB    . GLN C 3 253 ? 16.846 65.205 17.677  1.00 36.12 ? 253  GLN A CB    1 
ATOM   2557 C  CG    . GLN C 3 253 ? 16.614 66.749 17.399  1.00 38.18 ? 253  GLN A CG    1 
ATOM   2558 C  CD    . GLN C 3 253 ? 16.008 67.511 18.593  1.00 45.61 ? 253  GLN A CD    1 
ATOM   2559 O  OE1   . GLN C 3 253 ? 16.070 68.759 18.668  1.00 50.26 ? 253  GLN A OE1   1 
ATOM   2560 N  NE2   . GLN C 3 253 ? 15.390 66.772 19.506  1.00 46.05 ? 253  GLN A NE2   1 
ATOM   2561 N  N     . LYS C 3 254 ? 17.497 62.800 19.689  1.00 34.17 ? 254  LYS A N     1 
ATOM   2562 C  CA    . LYS C 3 254 ? 17.602 61.337 19.825  1.00 33.50 ? 254  LYS A CA    1 
ATOM   2563 C  C     . LYS C 3 254 ? 16.255 60.753 19.618  1.00 34.55 ? 254  LYS A C     1 
ATOM   2564 O  O     . LYS C 3 254 ? 15.284 61.230 20.225  1.00 34.44 ? 254  LYS A O     1 
ATOM   2565 C  CB    . LYS C 3 254 ? 18.091 60.944 21.242  1.00 34.14 ? 254  LYS A CB    1 
ATOM   2566 C  CG    . LYS C 3 254 ? 18.251 59.436 21.450  1.00 31.33 ? 254  LYS A CG    1 
ATOM   2567 C  CD    . LYS C 3 254 ? 18.962 59.132 22.792  1.00 31.39 ? 254  LYS A CD    1 
ATOM   2568 C  CE    . LYS C 3 254 ? 19.064 57.602 22.958  1.00 28.15 ? 254  LYS A CE    1 
ATOM   2569 N  NZ    . LYS C 3 254 ? 19.536 57.200 24.357  1.00 28.97 ? 254  LYS A NZ    1 
ATOM   2570 N  N     . ILE C 3 255 ? 16.170 59.721 18.777  1.00 33.06 ? 255  ILE A N     1 
ATOM   2571 C  CA    . ILE C 3 255 ? 14.941 58.979 18.539  1.00 33.30 ? 255  ILE A CA    1 
ATOM   2572 C  C     . ILE C 3 255 ? 15.260 57.491 18.646  1.00 33.20 ? 255  ILE A C     1 
ATOM   2573 O  O     . ILE C 3 255 ? 16.443 57.135 18.884  1.00 32.65 ? 255  ILE A O     1 
ATOM   2574 C  CB    . ILE C 3 255 ? 14.312 59.303 17.140  1.00 33.97 ? 255  ILE A CB    1 
ATOM   2575 C  CG1   . ILE C 3 255 ? 15.308 58.966 16.017  1.00 34.48 ? 255  ILE A CG1   1 
ATOM   2576 C  CG2   . ILE C 3 255 ? 13.860 60.815 17.086  1.00 34.27 ? 255  ILE A CG2   1 
ATOM   2577 C  CD1   . ILE C 3 255 ? 14.755 59.111 14.568  1.00 34.29 ? 255  ILE A CD1   1 
ATOM   2578 N  N     . LYS C 3 256 ? 14.235 56.649 18.488  1.00 33.31 ? 256  LYS A N     1 
ATOM   2579 C  CA    . LYS C 3 256 ? 14.374 55.189 18.435  1.00 35.24 ? 256  LYS A CA    1 
ATOM   2580 C  C     . LYS C 3 256 ? 14.150 54.692 17.019  1.00 35.71 ? 256  LYS A C     1 
ATOM   2581 O  O     . LYS C 3 256 ? 13.072 54.909 16.442  1.00 35.48 ? 256  LYS A O     1 
ATOM   2582 C  CB    . LYS C 3 256 ? 13.321 54.492 19.277  1.00 35.59 ? 256  LYS A CB    1 
ATOM   2583 C  CG    . LYS C 3 256 ? 13.724 54.172 20.681  1.00 40.89 ? 256  LYS A CG    1 
ATOM   2584 C  CD    . LYS C 3 256 ? 12.864 52.980 21.192  1.00 47.04 ? 256  LYS A CD    1 
ATOM   2585 C  CE    . LYS C 3 256 ? 13.129 52.675 22.666  1.00 49.43 ? 256  LYS A CE    1 
ATOM   2586 N  NZ    . LYS C 3 256 ? 14.503 52.067 22.898  1.00 48.71 ? 256  LYS A NZ    1 
ATOM   2587 N  N     . VAL C 3 257 ? 15.147 54.010 16.454  1.00 34.51 ? 257  VAL A N     1 
ATOM   2588 C  CA    . VAL C 3 257 ? 14.987 53.411 15.116  1.00 33.97 ? 257  VAL A CA    1 
ATOM   2589 C  C     . VAL C 3 257 ? 15.293 51.913 15.201  1.00 33.61 ? 257  VAL A C     1 
ATOM   2590 O  O     . VAL C 3 257 ? 16.395 51.517 15.599  1.00 32.99 ? 257  VAL A O     1 
ATOM   2591 C  CB    . VAL C 3 257 ? 15.924 54.085 14.078  1.00 33.62 ? 257  VAL A CB    1 
ATOM   2592 C  CG1   . VAL C 3 257 ? 15.901 53.336 12.706  1.00 33.47 ? 257  VAL A CG1   1 
ATOM   2593 C  CG2   . VAL C 3 257 ? 15.568 55.572 13.897  1.00 33.49 ? 257  VAL A CG2   1 
ATOM   2594 N  N     . ALA C 3 258 ? 14.318 51.095 14.826  1.00 33.60 ? 258  ALA A N     1 
ATOM   2595 C  CA    . ALA C 3 258 ? 14.405 49.635 14.944  1.00 34.40 ? 258  ALA A CA    1 
ATOM   2596 C  C     . ALA C 3 258 ? 15.006 49.160 16.300  1.00 35.59 ? 258  ALA A C     1 
ATOM   2597 O  O     . ALA C 3 258 ? 15.917 48.326 16.347  1.00 36.11 ? 258  ALA A O     1 
ATOM   2598 C  CB    . ALA C 3 258 ? 15.162 49.035 13.704  1.00 33.49 ? 258  ALA A CB    1 
ATOM   2599 N  N     . GLY C 3 259 ? 14.492 49.705 17.405  1.00 35.30 ? 259  GLY A N     1 
ATOM   2600 C  CA    . GLY C 3 259 ? 14.914 49.268 18.730  1.00 35.20 ? 259  GLY A CA    1 
ATOM   2601 C  C     . GLY C 3 259 ? 16.159 49.935 19.253  1.00 35.11 ? 259  GLY A C     1 
ATOM   2602 O  O     . GLY C 3 259 ? 16.525 49.702 20.419  1.00 37.21 ? 259  GLY A O     1 
ATOM   2603 N  N     . ARG C 3 260 ? 16.830 50.765 18.441  1.00 32.28 ? 260  ARG A N     1 
ATOM   2604 C  CA    . ARG C 3 260 ? 18.105 51.374 18.856  1.00 30.23 ? 260  ARG A CA    1 
ATOM   2605 C  C     . ARG C 3 260 ? 18.048 52.867 19.048  1.00 29.96 ? 260  ARG A C     1 
ATOM   2606 O  O     . ARG C 3 260 ? 17.432 53.572 18.242  1.00 30.03 ? 260  ARG A O     1 
ATOM   2607 C  CB    . ARG C 3 260 ? 19.242 51.071 17.826  1.00 29.06 ? 260  ARG A CB    1 
ATOM   2608 C  CG    . ARG C 3 260 ? 19.426 49.586 17.496  1.00 28.59 ? 260  ARG A CG    1 
ATOM   2609 C  CD    . ARG C 3 260 ? 19.796 48.708 18.747  1.00 28.01 ? 260  ARG A CD    1 
ATOM   2610 N  NE    . ARG C 3 260 ? 21.139 49.009 19.290  1.00 27.89 ? 260  ARG A NE    1 
ATOM   2611 C  CZ    . ARG C 3 260 ? 22.272 48.512 18.800  1.00 27.68 ? 260  ARG A CZ    1 
ATOM   2612 N  NH1   . ARG C 3 260 ? 22.239 47.687 17.732  1.00 25.04 ? 260  ARG A NH1   1 
ATOM   2613 N  NH2   . ARG C 3 260 ? 23.426 48.812 19.390  1.00 27.03 ? 260  ARG A NH2   1 
ATOM   2614 N  N     . GLY C 3 261 ? 18.713 53.350 20.095  1.00 29.73 ? 261  GLY A N     1 
ATOM   2615 C  CA    . GLY C 3 261 ? 18.906 54.774 20.339  1.00 29.63 ? 261  GLY A CA    1 
ATOM   2616 C  C     . GLY C 3 261 ? 19.655 55.418 19.176  1.00 30.40 ? 261  GLY A C     1 
ATOM   2617 O  O     . GLY C 3 261 ? 20.671 54.877 18.687  1.00 29.54 ? 261  GLY A O     1 
ATOM   2618 N  N     . THR C 3 262 ? 19.181 56.580 18.709  1.00 29.58 ? 262  THR A N     1 
ATOM   2619 C  CA    . THR C 3 262 ? 19.644 57.065 17.403  1.00 29.18 ? 262  THR A CA    1 
ATOM   2620 C  C     . THR C 3 262 ? 19.774 58.573 17.476  1.00 30.20 ? 262  THR A C     1 
ATOM   2621 O  O     . THR C 3 262 ? 18.779 59.244 17.753  1.00 30.41 ? 262  THR A O     1 
ATOM   2622 C  CB    . THR C 3 262 ? 18.645 56.696 16.294  1.00 28.97 ? 262  THR A CB    1 
ATOM   2623 O  OG1   . THR C 3 262 ? 18.544 55.286 16.184  1.00 27.26 ? 262  THR A OG1   1 
ATOM   2624 C  CG2   . THR C 3 262 ? 19.075 57.291 14.884  1.00 28.27 ? 262  THR A CG2   1 
ATOM   2625 N  N     . HIS C 3 263 ? 20.968 59.081 17.217  1.00 29.40 ? 263  HIS A N     1 
ATOM   2626 C  CA    . HIS C 3 263 ? 21.308 60.468 17.437  1.00 30.72 ? 263  HIS A CA    1 
ATOM   2627 C  C     . HIS C 3 263 ? 21.577 61.122 16.076  1.00 32.13 ? 263  HIS A C     1 
ATOM   2628 O  O     . HIS C 3 263 ? 22.331 60.570 15.246  1.00 32.27 ? 263  HIS A O     1 
ATOM   2629 C  CB    . HIS C 3 263 ? 22.550 60.562 18.325  1.00 30.22 ? 263  HIS A CB    1 
ATOM   2630 C  CG    . HIS C 3 263 ? 22.476 59.725 19.570  1.00 31.22 ? 263  HIS A CG    1 
ATOM   2631 N  ND1   . HIS C 3 263 ? 22.737 58.367 19.568  1.00 31.06 ? 263  HIS A ND1   1 
ATOM   2632 C  CD2   . HIS C 3 263 ? 22.228 60.058 20.866  1.00 33.42 ? 263  HIS A CD2   1 
ATOM   2633 C  CE1   . HIS C 3 263 ? 22.578 57.887 20.793  1.00 34.75 ? 263  HIS A CE1   1 
ATOM   2634 N  NE2   . HIS C 3 263 ? 22.291 58.893 21.607  1.00 32.33 ? 263  HIS A NE2   1 
ATOM   2635 N  N     . PHE C 3 264 ? 20.951 62.275 15.812  1.00 32.00 ? 264  PHE A N     1 
ATOM   2636 C  CA    . PHE C 3 264 ? 21.085 62.926 14.491  1.00 31.82 ? 264  PHE A CA    1 
ATOM   2637 C  C     . PHE C 3 264 ? 20.821 64.459 14.556  1.00 32.64 ? 264  PHE A C     1 
ATOM   2638 O  O     . PHE C 3 264 ? 20.171 64.922 15.502  1.00 30.77 ? 264  PHE A O     1 
ATOM   2639 C  CB    . PHE C 3 264 ? 20.119 62.242 13.498  1.00 32.34 ? 264  PHE A CB    1 
ATOM   2640 C  CG    . PHE C 3 264 ? 18.669 62.630 13.691  1.00 34.75 ? 264  PHE A CG    1 
ATOM   2641 C  CD1   . PHE C 3 264 ? 17.945 62.185 14.811  1.00 35.72 ? 264  PHE A CD1   1 
ATOM   2642 C  CD2   . PHE C 3 264 ? 18.030 63.492 12.781  1.00 34.34 ? 264  PHE A CD2   1 
ATOM   2643 C  CE1   . PHE C 3 264 ? 16.590 62.577 15.016  1.00 37.00 ? 264  PHE A CE1   1 
ATOM   2644 C  CE2   . PHE C 3 264 ? 16.700 63.861 12.966  1.00 35.87 ? 264  PHE A CE2   1 
ATOM   2645 C  CZ    . PHE C 3 264 ? 15.973 63.420 14.075  1.00 36.08 ? 264  PHE A CZ    1 
ATOM   2646 N  N     . CYS C 3 265 ? 21.365 65.221 13.585  1.00 31.92 ? 265  CYS A N     1 
ATOM   2647 C  CA    . CYS C 3 265 ? 20.987 66.620 13.356  1.00 32.23 ? 265  CYS A CA    1 
ATOM   2648 C  C     . CYS C 3 265 ? 19.827 66.672 12.319  1.00 31.60 ? 265  CYS A C     1 
ATOM   2649 O  O     . CYS C 3 265 ? 19.972 66.179 11.192  1.00 30.97 ? 265  CYS A O     1 
ATOM   2650 C  CB    . CYS C 3 265 ? 22.187 67.466 12.888  1.00 31.41 ? 265  CYS A CB    1 
ATOM   2651 S  SG    . CYS C 3 265 ? 21.876 69.256 12.248  1.00 31.59 ? 265  CYS A SG    1 
ATOM   2652 N  N     . PRO C 3 266 ? 18.677 67.231 12.735  1.00 30.95 ? 266  PRO A N     1 
ATOM   2653 C  CA    . PRO C 3 266 ? 17.453 67.302 11.944  1.00 30.94 ? 266  PRO A CA    1 
ATOM   2654 C  C     . PRO C 3 266 ? 17.565 68.289 10.787  1.00 30.25 ? 266  PRO A C     1 
ATOM   2655 O  O     . PRO C 3 266 ? 16.752 68.188 9.865   1.00 31.00 ? 266  PRO A O     1 
ATOM   2656 C  CB    . PRO C 3 266 ? 16.392 67.792 12.942  1.00 31.10 ? 266  PRO A CB    1 
ATOM   2657 C  CG    . PRO C 3 266 ? 17.034 67.703 14.294  1.00 29.87 ? 266  PRO A CG    1 
ATOM   2658 C  CD    . PRO C 3 266 ? 18.505 67.884 14.051  1.00 31.10 ? 266  PRO A CD    1 
ATOM   2659 N  N     . VAL C 3 267 ? 18.561 69.176 10.813  1.00 30.06 ? 267  VAL A N     1 
ATOM   2660 C  CA    . VAL C 3 267 ? 18.819 70.130 9.710   1.00 30.74 ? 267  VAL A CA    1 
ATOM   2661 C  C     . VAL C 3 267 ? 19.728 69.478 8.648   1.00 32.03 ? 267  VAL A C     1 
ATOM   2662 O  O     . VAL C 3 267 ? 19.411 69.462 7.453   1.00 32.25 ? 267  VAL A O     1 
ATOM   2663 C  CB    . VAL C 3 267 ? 19.462 71.436 10.222  1.00 31.02 ? 267  VAL A CB    1 
ATOM   2664 C  CG1   . VAL C 3 267 ? 20.066 72.280 9.078   1.00 29.11 ? 267  VAL A CG1   1 
ATOM   2665 C  CG2   . VAL C 3 267 ? 18.393 72.270 10.999  1.00 29.05 ? 267  VAL A CG2   1 
ATOM   2666 N  N     . CYS C 3 268 ? 20.835 68.913 9.113   1.00 31.98 ? 268  CYS A N     1 
ATOM   2667 C  CA    . CYS C 3 268 ? 21.860 68.340 8.217   1.00 32.73 ? 268  CYS A CA    1 
ATOM   2668 C  C     . CYS C 3 268 ? 21.454 66.990 7.633   1.00 32.65 ? 268  CYS A C     1 
ATOM   2669 O  O     . CYS C 3 268 ? 22.002 66.573 6.588   1.00 33.09 ? 268  CYS A O     1 
ATOM   2670 C  CB    . CYS C 3 268 ? 23.130 68.143 8.995   1.00 33.08 ? 268  CYS A CB    1 
ATOM   2671 S  SG    . CYS C 3 268 ? 24.085 69.583 9.370   1.00 34.96 ? 268  CYS A SG    1 
ATOM   2672 N  N     . GLN C 3 269 ? 20.541 66.293 8.321   1.00 31.32 ? 269  GLN A N     1 
ATOM   2673 C  CA    . GLN C 3 269 ? 20.075 64.986 7.929   1.00 32.57 ? 269  GLN A CA    1 
ATOM   2674 C  C     . GLN C 3 269 ? 18.582 65.003 7.660   1.00 33.56 ? 269  GLN A C     1 
ATOM   2675 O  O     . GLN C 3 269 ? 17.784 64.518 8.468   1.00 34.43 ? 269  GLN A O     1 
ATOM   2676 C  CB    . GLN C 3 269 ? 20.449 63.916 9.010   1.00 31.63 ? 269  GLN A CB    1 
ATOM   2677 C  CG    . GLN C 3 269 ? 21.990 63.775 9.231   1.00 31.31 ? 269  GLN A CG    1 
ATOM   2678 C  CD    . GLN C 3 269 ? 22.280 62.951 10.496  1.00 32.01 ? 269  GLN A CD    1 
ATOM   2679 O  OE1   . GLN C 3 269 ? 22.586 63.513 11.555  1.00 30.30 ? 269  GLN A OE1   1 
ATOM   2680 N  NE2   . GLN C 3 269 ? 22.146 61.604 10.391  1.00 26.34 ? 269  GLN A NE2   1 
ATOM   2681 N  N     . GLN C 3 270 ? 18.200 65.550 6.501   1.00 35.45 ? 270  GLN A N     1 
ATOM   2682 C  CA    . GLN C 3 270 ? 16.791 65.716 6.143   1.00 37.55 ? 270  GLN A CA    1 
ATOM   2683 C  C     . GLN C 3 270 ? 16.061 64.393 5.954   1.00 39.57 ? 270  GLN A C     1 
ATOM   2684 O  O     . GLN C 3 270 ? 16.522 63.541 5.211   1.00 38.15 ? 270  GLN A O     1 
ATOM   2685 C  CB    . GLN C 3 270 ? 16.642 66.563 4.856   1.00 36.84 ? 270  GLN A CB    1 
ATOM   2686 C  CG    . GLN C 3 270 ? 17.025 67.991 5.029   1.00 37.69 ? 270  GLN A CG    1 
ATOM   2687 C  CD    . GLN C 3 270 ? 16.101 68.738 5.992   1.00 38.74 ? 270  GLN A CD    1 
ATOM   2688 O  OE1   . GLN C 3 270 ? 14.873 68.787 5.794   1.00 39.56 ? 270  GLN A OE1   1 
ATOM   2689 N  NE2   . GLN C 3 270 ? 16.691 69.371 7.007   1.00 34.54 ? 270  GLN A NE2   1 
ATOM   2690 N  N     . LYS C 3 271 ? 14.883 64.294 6.578   1.00 43.03 ? 271  LYS A N     1 
ATOM   2691 C  CA    . LYS C 3 271 ? 14.052 63.083 6.582   1.00 46.17 ? 271  LYS A CA    1 
ATOM   2692 C  C     . LYS C 3 271 ? 13.496 62.713 5.187   1.00 48.25 ? 271  LYS A C     1 
ATOM   2693 O  O     . LYS C 3 271 ? 13.387 61.526 4.764   1.00 49.22 ? 271  LYS A O     1 
ATOM   2694 C  CB    . LYS C 3 271 ? 12.910 63.267 7.590   1.00 45.11 ? 271  LYS A CB    1 
ATOM   2695 C  CG    . LYS C 3 271 ? 12.177 61.972 7.953   1.00 47.30 ? 271  LYS A CG    1 
ATOM   2696 C  CD    . LYS C 3 271 ? 11.180 62.144 9.104   1.00 47.43 ? 271  LYS A CD    1 
ATOM   2697 O  OXT   . LYS C 3 271 ? 13.132 63.629 4.433   1.00 49.98 ? 271  LYS A OXT   1 
HETATM 2698 ZN ZN    . ZN  D 4 .   ? 23.475 70.192 11.620  1.00 11.25 ? 5001 ZN  A ZN    1 
HETATM 2699 C  C1    . GOL E 5 .   ? 29.071 33.363 17.624  1.00 36.48 ? 1001 GOL A C1    1 
HETATM 2700 O  O1    . GOL E 5 .   ? 28.661 32.135 17.007  1.00 38.24 ? 1001 GOL A O1    1 
HETATM 2701 C  C2    . GOL E 5 .   ? 28.343 34.714 17.348  1.00 41.01 ? 1001 GOL A C2    1 
HETATM 2702 O  O2    . GOL E 5 .   ? 28.390 35.233 16.034  1.00 44.42 ? 1001 GOL A O2    1 
HETATM 2703 C  C3    . GOL E 5 .   ? 29.148 35.801 18.080  1.00 36.50 ? 1001 GOL A C3    1 
HETATM 2704 O  O3    . GOL E 5 .   ? 28.717 35.839 19.409  1.00 29.52 ? 1001 GOL A O3    1 
HETATM 2705 O  O     . HOH F 6 .   ? 20.283 51.143 21.450  1.00 31.50 ? 23   HOH B O     1 
HETATM 2706 O  O     . HOH F 6 .   ? 25.250 45.255 14.642  1.00 30.85 ? 26   HOH B O     1 
HETATM 2707 O  O     . HOH F 6 .   ? 22.482 55.084 22.365  1.00 32.14 ? 40   HOH B O     1 
HETATM 2708 O  O     . HOH F 6 .   ? 32.111 51.070 19.741  1.00 38.48 ? 44   HOH B O     1 
HETATM 2709 O  O     . HOH F 6 .   ? 21.262 48.470 23.460  1.00 29.40 ? 60   HOH B O     1 
HETATM 2710 O  O     . HOH F 6 .   ? 15.529 30.274 12.809  1.00 48.48 ? 91   HOH B O     1 
HETATM 2711 O  O     . HOH F 6 .   ? 18.503 43.130 14.770  1.00 41.18 ? 105  HOH B O     1 
HETATM 2712 O  O     . HOH F 6 .   ? 22.750 37.691 13.043  1.00 44.12 ? 107  HOH B O     1 
HETATM 2713 O  O     . HOH F 6 .   ? 28.910 39.966 13.127  1.00 32.92 ? 112  HOH B O     1 
HETATM 2714 O  O     . HOH F 6 .   ? 25.177 35.463 10.909  1.00 42.13 ? 120  HOH B O     1 
HETATM 2715 O  O     . HOH F 6 .   ? 10.986 32.733 11.256  1.00 43.82 ? 131  HOH B O     1 
HETATM 2716 O  O     . HOH F 6 .   ? 15.931 45.287 30.300  1.00 50.53 ? 143  HOH B O     1 
HETATM 2717 O  O     . HOH F 6 .   ? 8.550  32.379 10.036  1.00 46.53 ? 163  HOH B O     1 
HETATM 2718 O  O     . HOH F 6 .   ? 6.124  31.588 11.588  1.00 56.78 ? 172  HOH B O     1 
HETATM 2719 O  O     . HOH F 6 .   ? 17.636 38.916 12.423  1.00 52.18 ? 176  HOH B O     1 
HETATM 2720 O  O     . HOH F 6 .   ? 14.607 45.802 34.944  1.00 54.19 ? 179  HOH B O     1 
HETATM 2721 O  O     . HOH F 6 .   ? 14.680 36.576 11.655  1.00 50.63 ? 190  HOH B O     1 
HETATM 2722 O  O     . HOH F 6 .   ? 15.462 50.378 25.741  1.00 46.53 ? 191  HOH B O     1 
HETATM 2723 O  O     . HOH F 6 .   ? 13.894 45.974 37.859  1.00 57.03 ? 193  HOH B O     1 
HETATM 2724 O  O     . HOH F 6 .   ? 19.001 45.103 18.542  1.00 49.74 ? 198  HOH B O     1 
HETATM 2725 O  O     . HOH F 6 .   ? 7.806  36.810 18.844  1.00 58.27 ? 207  HOH B O     1 
HETATM 2726 O  O     . HOH F 6 .   ? 0.590  39.851 11.436  1.00 57.46 ? 208  HOH B O     1 
HETATM 2727 O  O     . HOH F 6 .   ? 4.643  39.110 15.362  1.00 59.02 ? 209  HOH B O     1 
HETATM 2728 O  O     . HOH F 6 .   ? 11.649 43.954 42.375  1.00 54.11 ? 211  HOH B O     1 
HETATM 2729 O  O     . HOH F 6 .   ? 24.131 40.531 12.580  1.00 43.23 ? 242  HOH B O     1 
HETATM 2730 O  O     . HOH F 6 .   ? 26.301 39.438 11.867  1.00 38.64 ? 243  HOH B O     1 
HETATM 2731 O  O     . HOH F 6 .   ? 23.790 42.215 14.614  1.00 39.95 ? 244  HOH B O     1 
HETATM 2732 O  O     . HOH F 6 .   ? 11.403 30.737 13.163  1.00 49.36 ? 253  HOH B O     1 
HETATM 2733 O  O     . HOH F 6 .   ? 25.025 31.684 15.177  1.00 48.69 ? 269  HOH B O     1 
HETATM 2734 O  O     . HOH F 6 .   ? 15.503 56.075 23.851  1.00 48.93 ? 270  HOH B O     1 
HETATM 2735 O  O     . HOH F 6 .   ? 10.984 45.343 37.855  1.00 52.82 ? 311  HOH B O     1 
HETATM 2736 O  O     . HOH F 6 .   ? 6.590  51.083 41.905  1.00 52.93 ? 323  HOH B O     1 
HETATM 2737 O  O     . HOH F 6 .   ? 27.062 53.783 25.283  1.00 46.06 ? 325  HOH B O     1 
HETATM 2738 O  O     . HOH F 6 .   ? 18.492 28.493 14.121  1.00 50.66 ? 331  HOH B O     1 
HETATM 2739 O  O     . HOH F 6 .   ? 20.450 37.160 11.937  1.00 61.28 ? 361  HOH B O     1 
HETATM 2740 O  O     . HOH F 6 .   ? 15.101 47.752 25.047  1.00 53.03 ? 375  HOH B O     1 
HETATM 2741 O  O     . HOH F 6 .   ? 15.159 49.161 41.593  1.00 62.34 ? 394  HOH B O     1 
HETATM 2742 O  O     . HOH G 6 .   ? 17.993 41.594 32.898  1.00 50.64 ? 118  HOH C O     1 
HETATM 2743 O  O     . HOH G 6 .   ? 24.033 32.244 32.488  1.00 51.25 ? 148  HOH C O     1 
HETATM 2744 O  O     . HOH G 6 .   ? 6.402  43.062 11.081  1.00 49.28 ? 152  HOH C O     1 
HETATM 2745 O  O     . HOH G 6 .   ? 18.869 34.943 22.758  1.00 55.16 ? 154  HOH C O     1 
HETATM 2746 O  O     . HOH G 6 .   ? 6.409  41.173 16.668  1.00 55.29 ? 155  HOH C O     1 
HETATM 2747 O  O     . HOH G 6 .   ? 17.549 49.356 39.825  1.00 48.80 ? 166  HOH C O     1 
HETATM 2748 O  O     . HOH G 6 .   ? 23.076 36.004 22.818  1.00 50.25 ? 171  HOH C O     1 
HETATM 2749 O  O     . HOH G 6 .   ? 18.959 43.603 36.298  1.00 55.09 ? 178  HOH C O     1 
HETATM 2750 O  O     . HOH G 6 .   ? 13.973 38.766 8.227   1.00 56.94 ? 183  HOH C O     1 
HETATM 2751 O  O     . HOH G 6 .   ? 23.177 31.441 28.795  1.00 61.88 ? 185  HOH C O     1 
HETATM 2752 O  O     . HOH G 6 .   ? 15.998 43.033 23.237  1.00 53.02 ? 196  HOH C O     1 
HETATM 2753 O  O     . HOH G 6 .   ? 9.069  30.809 7.913   1.00 57.50 ? 201  HOH C O     1 
HETATM 2754 O  O     . HOH G 6 .   ? 10.532 48.717 16.123  1.00 55.08 ? 204  HOH C O     1 
HETATM 2755 O  O     . HOH G 6 .   ? 25.664 46.028 32.888  1.00 53.85 ? 214  HOH C O     1 
HETATM 2756 O  O     . HOH G 6 .   ? 14.800 46.447 11.388  1.00 44.79 ? 252  HOH C O     1 
HETATM 2757 O  O     . HOH G 6 .   ? 15.449 46.162 8.487   1.00 45.20 ? 275  HOH C O     1 
HETATM 2758 O  O     . HOH G 6 .   ? 20.263 39.250 35.252  1.00 53.36 ? 287  HOH C O     1 
HETATM 2759 O  O     . HOH G 6 .   ? 21.788 42.878 38.902  1.00 55.19 ? 295  HOH C O     1 
HETATM 2760 O  O     . HOH G 6 .   ? 19.343 58.091 33.966  1.00 72.24 ? 305  HOH C O     1 
HETATM 2761 O  O     . HOH G 6 .   ? 26.172 38.114 38.109  1.00 53.10 ? 308  HOH C O     1 
HETATM 2762 O  O     . HOH G 6 .   ? 16.659 43.134 31.578  1.00 51.20 ? 310  HOH C O     1 
HETATM 2763 O  O     . HOH G 6 .   ? 27.643 45.107 40.740  1.00 58.07 ? 314  HOH C O     1 
HETATM 2764 O  O     . HOH G 6 .   ? 13.504 36.817 21.513  1.00 59.19 ? 335  HOH C O     1 
HETATM 2765 O  O     . HOH G 6 .   ? 14.535 45.534 19.382  1.00 51.08 ? 339  HOH C O     1 
HETATM 2766 O  O     . HOH G 6 .   ? 24.405 49.702 33.659  1.00 56.40 ? 341  HOH C O     1 
HETATM 2767 O  O     . HOH G 6 .   ? 7.201  41.992 7.597   1.00 58.54 ? 351  HOH C O     1 
HETATM 2768 O  O     . HOH G 6 .   ? 19.996 35.160 34.957  1.00 56.21 ? 355  HOH C O     1 
HETATM 2769 O  O     . HOH G 6 .   ? 16.945 44.029 34.482  1.00 47.97 ? 359  HOH C O     1 
HETATM 2770 O  O     . HOH G 6 .   ? 18.410 55.802 40.542  1.00 70.09 ? 360  HOH C O     1 
HETATM 2771 O  O     . HOH G 6 .   ? 13.551 48.722 10.169  1.00 54.72 ? 362  HOH C O     1 
HETATM 2772 O  O     . HOH G 6 .   ? 21.661 33.279 23.977  1.00 54.70 ? 370  HOH C O     1 
HETATM 2773 O  O     . HOH G 6 .   ? 16.781 37.013 29.188  1.00 60.80 ? 372  HOH C O     1 
HETATM 2774 O  O     . HOH G 6 .   ? 22.319 45.115 39.411  1.00 62.85 ? 376  HOH C O     1 
HETATM 2775 O  O     . HOH G 6 .   ? 17.023 40.533 4.943   1.00 59.65 ? 379  HOH C O     1 
HETATM 2776 O  O     . HOH G 6 .   ? 11.343 39.121 0.195   1.00 67.78 ? 384  HOH C O     1 
HETATM 2777 O  O     . HOH G 6 .   ? 15.489 43.155 14.932  1.00 59.05 ? 392  HOH C O     1 
HETATM 2778 O  O     . HOH H 6 .   ? 31.427 43.498 19.691  1.00 21.56 ? 5002 HOH A O     1 
HETATM 2779 O  O     . HOH H 6 .   ? 33.568 41.887 19.611  1.00 22.14 ? 5003 HOH A O     1 
HETATM 2780 O  O     . HOH H 6 .   ? 28.599 47.234 9.521   1.00 24.93 ? 5004 HOH A O     1 
HETATM 2781 O  O     . HOH H 6 .   ? 29.206 41.467 26.230  1.00 24.30 ? 5005 HOH A O     1 
HETATM 2782 O  O     . HOH H 6 .   ? 36.523 36.036 5.947   1.00 27.57 ? 5006 HOH A O     1 
HETATM 2783 O  O     . HOH H 6 .   ? 34.851 36.690 23.684  1.00 25.28 ? 5007 HOH A O     1 
HETATM 2784 O  O     . HOH H 6 .   ? 25.475 46.049 6.684   1.00 27.72 ? 5008 HOH A O     1 
HETATM 2785 O  O     . HOH H 6 .   ? 30.603 35.911 28.184  1.00 24.46 ? 5009 HOH A O     1 
HETATM 2786 O  O     . HOH H 6 .   ? 32.314 33.772 35.982  1.00 30.41 ? 5010 HOH A O     1 
HETATM 2787 O  O     . HOH H 6 .   ? 20.194 46.546 15.955  1.00 29.77 ? 5011 HOH A O     1 
HETATM 2788 O  O     . HOH H 6 .   ? 31.398 24.949 27.229  1.00 29.55 ? 5012 HOH A O     1 
HETATM 2789 O  O     . HOH H 6 .   ? 19.711 44.694 -1.004  1.00 31.10 ? 5013 HOH A O     1 
HETATM 2790 O  O     . HOH H 6 .   ? 40.165 36.083 37.445  1.00 33.96 ? 5014 HOH A O     1 
HETATM 2791 O  O     . HOH H 6 .   ? 32.652 33.021 19.259  1.00 26.24 ? 5015 HOH A O     1 
HETATM 2792 O  O     . HOH H 6 .   ? 47.546 42.279 37.268  1.00 36.52 ? 5016 HOH A O     1 
HETATM 2793 O  O     . HOH H 6 .   ? 30.776 46.032 -1.563  1.00 27.52 ? 5017 HOH A O     1 
HETATM 2794 O  O     . HOH H 6 .   ? 24.443 46.311 16.984  1.00 26.18 ? 5018 HOH A O     1 
HETATM 2795 O  O     . HOH H 6 .   ? 39.953 29.102 6.447   1.00 30.07 ? 5019 HOH A O     1 
HETATM 2796 O  O     . HOH H 6 .   ? 22.273 58.753 24.295  1.00 33.03 ? 5020 HOH A O     1 
HETATM 2797 O  O     . HOH H 6 .   ? 25.604 47.135 27.635  1.00 29.66 ? 5021 HOH A O     1 
HETATM 2798 O  O     . HOH H 6 .   ? 31.903 45.537 -8.945  1.00 31.71 ? 5022 HOH A O     1 
HETATM 2799 O  O     . HOH H 6 .   ? 34.863 51.225 -4.486  1.00 31.32 ? 5023 HOH A O     1 
HETATM 2800 O  O     . HOH H 6 .   ? 28.716 38.415 34.491  1.00 27.34 ? 5024 HOH A O     1 
HETATM 2801 O  O     . HOH H 6 .   ? 23.160 60.018 12.765  1.00 25.19 ? 5025 HOH A O     1 
HETATM 2802 O  O     . HOH H 6 .   ? 37.200 33.456 35.736  1.00 34.40 ? 5026 HOH A O     1 
HETATM 2803 O  O     . HOH H 6 .   ? 19.866 60.776 -1.485  1.00 31.76 ? 5027 HOH A O     1 
HETATM 2804 O  O     . HOH H 6 .   ? 42.923 31.580 9.606   1.00 33.32 ? 5028 HOH A O     1 
HETATM 2805 O  O     . HOH H 6 .   ? 26.215 29.720 26.389  1.00 33.19 ? 5029 HOH A O     1 
HETATM 2806 O  O     . HOH H 6 .   ? 37.416 43.583 33.260  1.00 30.54 ? 5030 HOH A O     1 
HETATM 2807 O  O     . HOH H 6 .   ? 36.107 23.821 22.145  1.00 29.66 ? 5031 HOH A O     1 
HETATM 2808 O  O     . HOH H 6 .   ? 31.195 42.096 12.539  1.00 29.29 ? 5032 HOH A O     1 
HETATM 2809 O  O     . HOH H 6 .   ? 39.698 45.923 7.934   1.00 33.29 ? 5033 HOH A O     1 
HETATM 2810 O  O     . HOH H 6 .   ? 29.311 30.275 11.263  1.00 28.66 ? 5034 HOH A O     1 
HETATM 2811 O  O     . HOH H 6 .   ? 49.275 38.375 14.329  1.00 31.98 ? 5035 HOH A O     1 
HETATM 2812 O  O     . HOH H 6 .   ? 34.985 33.992 4.646   1.00 26.98 ? 5036 HOH A O     1 
HETATM 2813 O  O     . HOH H 6 .   ? 54.350 30.886 28.621  1.00 37.44 ? 5037 HOH A O     1 
HETATM 2814 O  O     . HOH H 6 .   ? 36.758 51.430 -2.701  1.00 31.22 ? 5038 HOH A O     1 
HETATM 2815 O  O     . HOH H 6 .   ? 19.502 76.875 23.444  1.00 33.19 ? 5039 HOH A O     1 
HETATM 2816 O  O     . HOH H 6 .   ? 18.605 50.762 13.949  1.00 26.67 ? 5040 HOH A O     1 
HETATM 2817 O  O     . HOH H 6 .   ? 44.819 23.705 31.228  1.00 33.04 ? 5041 HOH A O     1 
HETATM 2818 O  O     . HOH H 6 .   ? 42.744 41.369 39.052  1.00 33.88 ? 5042 HOH A O     1 
HETATM 2819 O  O     . HOH H 6 .   ? 39.348 44.240 25.665  1.00 37.30 ? 5043 HOH A O     1 
HETATM 2820 O  O     . HOH H 6 .   ? 41.011 48.213 8.456   1.00 38.03 ? 5044 HOH A O     1 
HETATM 2821 O  O     . HOH H 6 .   ? 30.809 36.395 4.119   1.00 31.97 ? 5045 HOH A O     1 
HETATM 2822 O  O     . HOH H 6 .   ? 36.845 42.170 35.603  1.00 35.09 ? 5046 HOH A O     1 
HETATM 2823 O  O     . HOH H 6 .   ? 39.790 30.402 37.331  1.00 38.05 ? 5047 HOH A O     1 
HETATM 2824 O  O     . HOH H 6 .   ? 36.887 41.750 3.101   1.00 30.27 ? 5048 HOH A O     1 
HETATM 2825 O  O     . HOH H 6 .   ? 19.469 53.780 -4.029  1.00 34.44 ? 5049 HOH A O     1 
HETATM 2826 O  O     . HOH H 6 .   ? 33.286 36.400 4.622   1.00 33.16 ? 5050 HOH A O     1 
HETATM 2827 O  O     . HOH H 6 .   ? 39.090 31.663 35.088  1.00 36.33 ? 5051 HOH A O     1 
HETATM 2828 O  O     . HOH H 6 .   ? 45.838 44.853 30.398  1.00 31.12 ? 5052 HOH A O     1 
HETATM 2829 O  O     . HOH H 6 .   ? 21.700 46.017 24.874  1.00 32.98 ? 5053 HOH A O     1 
HETATM 2830 O  O     . HOH H 6 .   ? 43.428 43.551 11.194  1.00 33.93 ? 5054 HOH A O     1 
HETATM 2831 O  O     . HOH H 6 .   ? 28.878 30.018 15.105  1.00 32.14 ? 5055 HOH A O     1 
HETATM 2832 O  O     . HOH H 6 .   ? 40.234 37.964 8.700   1.00 40.04 ? 5056 HOH A O     1 
HETATM 2833 O  O     . HOH H 6 .   ? 49.574 44.370 31.734  1.00 36.04 ? 5057 HOH A O     1 
HETATM 2834 O  O     . HOH H 6 .   ? 30.915 57.046 -7.244  1.00 38.13 ? 5058 HOH A O     1 
HETATM 2835 O  O     . HOH H 6 .   ? 28.995 28.023 32.977  1.00 31.97 ? 5059 HOH A O     1 
HETATM 2836 O  O     . HOH H 6 .   ? 15.733 64.476 21.440  1.00 40.66 ? 5060 HOH A O     1 
HETATM 2837 O  O     . HOH H 6 .   ? 29.400 62.570 -3.284  1.00 33.68 ? 5061 HOH A O     1 
HETATM 2838 O  O     . HOH H 6 .   ? 32.146 43.540 -5.405  1.00 38.31 ? 5062 HOH A O     1 
HETATM 2839 O  O     . HOH H 6 .   ? 42.430 35.810 39.017  1.00 38.40 ? 5063 HOH A O     1 
HETATM 2840 O  O     . HOH H 6 .   ? 11.603 57.827 18.900  1.00 42.21 ? 5064 HOH A O     1 
HETATM 2841 O  O     . HOH H 6 .   ? 25.693 35.232 23.592  1.00 33.89 ? 5065 HOH A O     1 
HETATM 2842 O  O     . HOH H 6 .   ? 38.475 25.477 34.778  1.00 34.71 ? 5066 HOH A O     1 
HETATM 2843 O  O     . HOH H 6 .   ? 39.375 42.010 31.855  1.00 32.19 ? 5067 HOH A O     1 
HETATM 2844 O  O     . HOH H 6 .   ? 35.361 35.497 38.918  1.00 40.84 ? 5068 HOH A O     1 
HETATM 2845 O  O     . HOH H 6 .   ? 21.844 57.648 12.689  1.00 33.07 ? 5069 HOH A O     1 
HETATM 2846 O  O     . HOH H 6 .   ? 13.220 67.150 7.211   1.00 41.39 ? 5070 HOH A O     1 
HETATM 2847 O  O     . HOH H 6 .   ? 28.349 45.781 -0.199  1.00 29.05 ? 5071 HOH A O     1 
HETATM 2848 O  O     . HOH H 6 .   ? 17.126 66.596 21.747  1.00 43.67 ? 5072 HOH A O     1 
HETATM 2849 O  O     . HOH H 6 .   ? 20.114 65.633 4.244   1.00 34.72 ? 5073 HOH A O     1 
HETATM 2850 O  O     . HOH H 6 .   ? 32.407 39.476 2.304   1.00 46.39 ? 5074 HOH A O     1 
HETATM 2851 O  O     . HOH H 6 .   ? 46.454 34.679 9.398   1.00 37.26 ? 5075 HOH A O     1 
HETATM 2852 O  O     . HOH H 6 .   ? 51.514 37.270 45.464  1.00 40.93 ? 5076 HOH A O     1 
HETATM 2853 O  O     . HOH H 6 .   ? 46.450 48.804 19.867  1.00 36.56 ? 5077 HOH A O     1 
HETATM 2854 O  O     . HOH H 6 .   ? 30.375 65.469 4.663   1.00 34.52 ? 5078 HOH A O     1 
HETATM 2855 O  O     . HOH H 6 .   ? 33.419 61.903 4.320   1.00 35.43 ? 5079 HOH A O     1 
HETATM 2856 O  O     . HOH H 6 .   ? 46.195 52.909 12.093  1.00 47.77 ? 5080 HOH A O     1 
HETATM 2857 O  O     . HOH H 6 .   ? 44.360 42.640 37.030  1.00 39.96 ? 5081 HOH A O     1 
HETATM 2858 O  O     . HOH H 6 .   ? 24.138 63.713 -2.582  1.00 39.11 ? 5082 HOH A O     1 
HETATM 2859 O  O     . HOH H 6 .   ? 15.367 66.049 9.447   1.00 37.52 ? 5083 HOH A O     1 
HETATM 2860 O  O     . HOH H 6 .   ? 34.557 42.371 36.976  1.00 37.92 ? 5084 HOH A O     1 
HETATM 2861 O  O     . HOH H 6 .   ? 19.721 45.625 11.600  1.00 34.27 ? 5085 HOH A O     1 
HETATM 2862 O  O     . HOH H 6 .   ? 51.397 29.828 34.564  1.00 40.55 ? 5086 HOH A O     1 
HETATM 2863 O  O     . HOH H 6 .   ? 17.106 70.517 16.727  1.00 35.93 ? 5087 HOH A O     1 
HETATM 2864 O  O     . HOH H 6 .   ? 24.628 62.508 1.064   1.00 32.59 ? 5088 HOH A O     1 
HETATM 2865 O  O     . HOH H 6 .   ? 34.524 54.306 -4.616  1.00 36.76 ? 5089 HOH A O     1 
HETATM 2866 O  O     . HOH H 6 .   ? 44.102 51.135 16.976  1.00 39.47 ? 5090 HOH A O     1 
HETATM 2867 O  O     . HOH H 6 .   ? 36.613 60.919 8.374   1.00 65.65 ? 5091 HOH A O     1 
HETATM 2868 O  O     . HOH H 6 .   ? 30.084 28.166 5.080   1.00 35.42 ? 5092 HOH A O     1 
HETATM 2869 O  O     . HOH H 6 .   ? 26.413 72.363 22.487  1.00 43.58 ? 5093 HOH A O     1 
HETATM 2870 O  O     . HOH H 6 .   ? 33.511 61.076 -0.767  1.00 37.95 ? 5094 HOH A O     1 
HETATM 2871 O  O     . HOH H 6 .   ? 37.131 45.348 24.891  1.00 33.89 ? 5095 HOH A O     1 
HETATM 2872 O  O     . HOH H 6 .   ? 27.496 55.653 -5.735  1.00 36.70 ? 5096 HOH A O     1 
HETATM 2873 O  O     . HOH H 6 .   ? 29.255 60.579 23.545  1.00 39.62 ? 5097 HOH A O     1 
HETATM 2874 O  O     . HOH H 6 .   ? 17.755 73.591 17.660  1.00 41.65 ? 5098 HOH A O     1 
HETATM 2875 O  O     . HOH H 6 .   ? 51.337 29.636 12.737  1.00 56.49 ? 5099 HOH A O     1 
HETATM 2876 O  O     . HOH H 6 .   ? 48.305 46.415 29.803  1.00 52.05 ? 5100 HOH A O     1 
HETATM 2877 O  O     . HOH H 6 .   ? 30.810 62.015 12.525  1.00 33.67 ? 5101 HOH A O     1 
HETATM 2878 O  O     . HOH H 6 .   ? 43.168 34.017 37.060  1.00 39.72 ? 5102 HOH A O     1 
HETATM 2879 O  O     . HOH H 6 .   ? 13.028 57.375 2.873   1.00 37.89 ? 5103 HOH A O     1 
HETATM 2880 O  O     . HOH H 6 .   ? 14.328 48.643 7.751   1.00 38.18 ? 5104 HOH A O     1 
HETATM 2881 O  O     . HOH H 6 .   ? 29.416 67.124 2.271   1.00 54.14 ? 5105 HOH A O     1 
HETATM 2882 O  O     . HOH H 6 .   ? 13.219 62.353 12.631  1.00 43.31 ? 5106 HOH A O     1 
HETATM 2883 O  O     . HOH H 6 .   ? 35.697 67.585 17.749  1.00 59.49 ? 5107 HOH A O     1 
HETATM 2884 O  O     . HOH H 6 .   ? 43.759 40.513 10.772  1.00 38.04 ? 5108 HOH A O     1 
HETATM 2885 O  O     . HOH H 6 .   ? 52.257 25.201 19.308  1.00 39.13 ? 5109 HOH A O     1 
HETATM 2886 O  O     . HOH H 6 .   ? 20.929 49.599 -11.416 1.00 45.31 ? 5110 HOH A O     1 
HETATM 2887 O  O     . HOH H 6 .   ? 18.801 42.580 2.253   1.00 49.20 ? 5111 HOH A O     1 
HETATM 2888 O  O     . HOH H 6 .   ? 56.552 31.023 25.897  1.00 42.05 ? 5112 HOH A O     1 
HETATM 2889 O  O     . HOH H 6 .   ? 28.037 43.156 0.315   1.00 30.71 ? 5113 HOH A O     1 
HETATM 2890 O  O     . HOH H 6 .   ? 41.489 51.762 3.265   1.00 40.45 ? 5114 HOH A O     1 
HETATM 2891 O  O     . HOH H 6 .   ? 54.107 25.219 22.216  1.00 43.32 ? 5115 HOH A O     1 
HETATM 2892 O  O     . HOH H 6 .   ? 33.236 26.385 9.705   1.00 43.50 ? 5116 HOH A O     1 
HETATM 2893 O  O     . HOH H 6 .   ? 11.706 60.463 12.606  1.00 49.00 ? 5117 HOH A O     1 
HETATM 2894 O  O     . HOH H 6 .   ? 20.059 61.829 1.474   1.00 46.46 ? 5118 HOH A O     1 
HETATM 2895 O  O     . HOH H 6 .   ? 34.869 22.653 33.406  1.00 42.20 ? 5119 HOH A O     1 
HETATM 2896 O  O     . HOH H 6 .   ? 18.771 48.620 22.517  1.00 43.43 ? 5120 HOH A O     1 
HETATM 2897 O  O     . HOH H 6 .   ? 45.414 34.880 39.533  1.00 43.72 ? 5121 HOH A O     1 
HETATM 2898 O  O     . HOH H 6 .   ? 18.821 44.159 26.664  1.00 42.88 ? 5122 HOH A O     1 
HETATM 2899 O  O     . HOH H 6 .   ? 30.535 67.606 6.475   1.00 39.55 ? 5123 HOH A O     1 
HETATM 2900 O  O     . HOH H 6 .   ? 43.642 53.641 10.559  1.00 39.41 ? 5124 HOH A O     1 
HETATM 2901 O  O     . HOH H 6 .   ? 49.442 27.908 34.885  1.00 44.43 ? 5125 HOH A O     1 
HETATM 2902 O  O     . HOH H 6 .   ? 34.206 46.643 26.555  1.00 43.72 ? 5126 HOH A O     1 
HETATM 2903 O  O     . HOH H 6 .   ? 48.867 22.595 32.805  1.00 44.94 ? 5127 HOH A O     1 
HETATM 2904 O  O     . HOH H 6 .   ? 39.811 19.424 33.552  1.00 45.76 ? 5128 HOH A O     1 
HETATM 2905 O  O     . HOH H 6 .   ? 45.997 44.364 33.950  1.00 41.07 ? 5129 HOH A O     1 
HETATM 2906 O  O     . HOH H 6 .   ? 39.798 19.145 29.540  1.00 39.30 ? 5130 HOH A O     1 
HETATM 2907 O  O     . HOH H 6 .   ? 42.748 33.906 10.876  1.00 36.60 ? 5131 HOH A O     1 
HETATM 2908 O  O     . HOH H 6 .   ? 11.842 51.009 17.599  1.00 42.63 ? 5132 HOH A O     1 
HETATM 2909 O  O     . HOH H 6 .   ? 16.322 74.004 23.301  1.00 40.81 ? 5133 HOH A O     1 
HETATM 2910 O  O     . HOH H 6 .   ? 40.439 45.224 36.084  1.00 51.42 ? 5134 HOH A O     1 
HETATM 2911 O  O     . HOH H 6 .   ? 43.715 46.984 2.236   1.00 54.44 ? 5135 HOH A O     1 
HETATM 2912 O  O     . HOH H 6 .   ? 54.351 40.431 17.712  1.00 50.79 ? 5136 HOH A O     1 
HETATM 2913 O  O     . HOH H 6 .   ? 13.643 59.613 6.065   1.00 57.92 ? 5137 HOH A O     1 
HETATM 2914 O  O     . HOH H 6 .   ? 53.668 39.963 43.421  1.00 55.47 ? 5138 HOH A O     1 
HETATM 2915 O  O     . HOH H 6 .   ? 26.089 39.193 9.033   1.00 36.20 ? 5139 HOH A O     1 
HETATM 2916 O  O     . HOH H 6 .   ? 28.118 33.572 26.075  1.00 39.70 ? 5140 HOH A O     1 
HETATM 2917 O  O     . HOH H 6 .   ? 31.827 70.358 12.125  1.00 45.89 ? 5141 HOH A O     1 
HETATM 2918 O  O     . HOH H 6 .   ? 11.372 53.372 -1.113  1.00 40.17 ? 5142 HOH A O     1 
HETATM 2919 O  O     . HOH H 6 .   ? 54.232 33.908 15.308  1.00 48.70 ? 5143 HOH A O     1 
HETATM 2920 O  O     . HOH H 6 .   ? 55.442 37.338 23.628  1.00 49.46 ? 5144 HOH A O     1 
HETATM 2921 O  O     . HOH H 6 .   ? 15.876 69.246 21.794  1.00 49.66 ? 5145 HOH A O     1 
HETATM 2922 O  O     . HOH H 6 .   ? 23.620 42.848 1.939   1.00 49.18 ? 5146 HOH A O     1 
HETATM 2923 O  O     . HOH H 6 .   ? 47.968 31.942 38.557  1.00 46.78 ? 5147 HOH A O     1 
HETATM 2924 O  O     . HOH H 6 .   ? 36.391 42.346 0.063   1.00 52.24 ? 5148 HOH A O     1 
HETATM 2925 O  O     . HOH H 6 .   ? 22.236 68.196 26.175  1.00 46.16 ? 5149 HOH A O     1 
HETATM 2926 O  O     . HOH H 6 .   ? 23.962 61.683 -7.811  1.00 36.56 ? 5150 HOH A O     1 
HETATM 2927 O  O     . HOH H 6 .   ? 42.888 23.139 9.243   1.00 39.59 ? 5151 HOH A O     1 
HETATM 2928 O  O     . HOH H 6 .   ? 35.916 55.829 -3.150  1.00 45.92 ? 5152 HOH A O     1 
HETATM 2929 O  O     . HOH H 6 .   ? 24.027 65.171 25.796  1.00 47.24 ? 5153 HOH A O     1 
HETATM 2930 O  O     . HOH H 6 .   ? 33.585 44.642 35.273  1.00 52.65 ? 5154 HOH A O     1 
HETATM 2931 O  O     . HOH H 6 .   ? 22.368 52.103 -10.129 1.00 61.95 ? 5155 HOH A O     1 
HETATM 2932 O  O     . HOH H 6 .   ? 40.353 58.561 8.064   1.00 41.41 ? 5156 HOH A O     1 
HETATM 2933 O  O     . HOH H 6 .   ? 16.579 53.789 22.577  1.00 44.00 ? 5157 HOH A O     1 
HETATM 2934 O  O     . HOH H 6 .   ? 48.207 36.851 11.998  1.00 46.21 ? 5158 HOH A O     1 
HETATM 2935 O  O     . HOH H 6 .   ? 34.537 23.095 16.489  1.00 51.64 ? 5159 HOH A O     1 
HETATM 2936 O  O     . HOH H 6 .   ? 31.361 27.010 15.714  1.00 49.11 ? 5160 HOH A O     1 
HETATM 2937 O  O     . HOH H 6 .   ? 52.417 37.173 39.974  1.00 36.27 ? 5161 HOH A O     1 
HETATM 2938 O  O     . HOH H 6 .   ? 23.033 35.480 20.090  1.00 57.51 ? 5162 HOH A O     1 
HETATM 2939 O  O     . HOH H 6 .   ? 22.130 63.270 1.631   1.00 47.94 ? 5163 HOH A O     1 
HETATM 2940 O  O     . HOH H 6 .   ? 49.754 43.860 12.554  1.00 51.45 ? 5164 HOH A O     1 
HETATM 2941 O  O     . HOH H 6 .   ? 32.234 28.934 38.549  1.00 48.80 ? 5165 HOH A O     1 
HETATM 2942 O  O     . HOH H 6 .   ? 50.645 45.086 16.769  1.00 42.86 ? 5166 HOH A O     1 
HETATM 2943 O  O     . HOH H 6 .   ? 15.729 63.640 2.499   1.00 57.92 ? 5167 HOH A O     1 
HETATM 2944 O  O     . HOH H 6 .   ? 27.184 40.154 2.587   1.00 55.38 ? 5168 HOH A O     1 
HETATM 2945 O  O     . HOH H 6 .   ? 47.602 54.806 15.776  1.00 62.09 ? 5169 HOH A O     1 
HETATM 2946 O  O     . HOH H 6 .   ? 44.539 49.970 9.593   1.00 59.18 ? 5170 HOH A O     1 
HETATM 2947 O  O     . HOH H 6 .   ? 39.944 43.049 -2.341  1.00 64.43 ? 5171 HOH A O     1 
HETATM 2948 O  O     . HOH H 6 .   ? 27.524 37.140 12.866  1.00 53.30 ? 5172 HOH A O     1 
HETATM 2949 O  O     . HOH H 6 .   ? 35.184 42.798 41.391  1.00 44.26 ? 5173 HOH A O     1 
HETATM 2950 O  O     . HOH H 6 .   ? 46.271 39.879 11.110  1.00 44.73 ? 5174 HOH A O     1 
HETATM 2951 O  O     . HOH H 6 .   ? 21.376 76.847 11.011  1.00 45.98 ? 5175 HOH A O     1 
HETATM 2952 O  O     . HOH H 6 .   ? 24.373 64.073 -7.551  1.00 49.76 ? 5176 HOH A O     1 
HETATM 2953 O  O     . HOH H 6 .   ? 21.490 58.471 -8.718  1.00 49.84 ? 5177 HOH A O     1 
HETATM 2954 O  O     . HOH H 6 .   ? 28.299 48.769 25.533  1.00 35.74 ? 5178 HOH A O     1 
HETATM 2955 O  O     . HOH H 6 .   ? 42.534 47.230 10.453  1.00 32.53 ? 5179 HOH A O     1 
HETATM 2956 O  O     . HOH H 6 .   ? 40.546 23.930 34.232  1.00 55.84 ? 5180 HOH A O     1 
HETATM 2957 O  O     . HOH H 6 .   ? 45.647 26.800 35.937  1.00 43.98 ? 5181 HOH A O     1 
HETATM 2958 O  O     . HOH H 6 .   ? 39.271 32.262 39.478  1.00 36.76 ? 5182 HOH A O     1 
HETATM 2959 O  O     . HOH H 6 .   ? 40.719 34.142 35.865  1.00 48.57 ? 5183 HOH A O     1 
HETATM 2960 O  O     . HOH H 6 .   ? 26.203 32.855 24.298  1.00 42.95 ? 5184 HOH A O     1 
HETATM 2961 O  O     . HOH H 6 .   ? 36.499 21.687 20.458  1.00 39.10 ? 5185 HOH A O     1 
HETATM 2962 O  O     . HOH H 6 .   ? 12.407 63.675 14.933  1.00 44.66 ? 5186 HOH A O     1 
HETATM 2963 O  O     . HOH H 6 .   ? 49.158 22.099 17.143  1.00 48.18 ? 5187 HOH A O     1 
HETATM 2964 O  O     . HOH H 6 .   ? 51.820 37.207 14.199  1.00 45.92 ? 5188 HOH A O     1 
HETATM 2965 O  O     . HOH H 6 .   ? 42.165 35.695 9.238   1.00 40.48 ? 5189 HOH A O     1 
HETATM 2966 O  O     . HOH H 6 .   ? 40.934 34.116 7.487   1.00 44.89 ? 5190 HOH A O     1 
HETATM 2967 O  O     . HOH H 6 .   ? 41.707 31.379 7.113   1.00 31.84 ? 5191 HOH A O     1 
HETATM 2968 O  O     . HOH H 6 .   ? 38.635 35.522 7.949   1.00 36.82 ? 5192 HOH A O     1 
HETATM 2969 O  O     . HOH H 6 .   ? 32.474 43.765 31.221  1.00 30.24 ? 5193 HOH A O     1 
HETATM 2970 O  O     . HOH H 6 .   ? 31.592 46.364 31.382  1.00 39.98 ? 5194 HOH A O     1 
HETATM 2971 O  O     . HOH H 6 .   ? 55.179 39.473 34.576  1.00 46.29 ? 5195 HOH A O     1 
HETATM 2972 O  O     . HOH H 6 .   ? 34.743 44.001 39.209  1.00 48.60 ? 5196 HOH A O     1 
HETATM 2973 O  O     . HOH H 6 .   ? 39.450 27.452 4.407   1.00 41.62 ? 5197 HOH A O     1 
HETATM 2974 O  O     . HOH H 6 .   ? 30.716 26.904 9.316   1.00 47.35 ? 5198 HOH A O     1 
HETATM 2975 O  O     . HOH H 6 .   ? 40.701 44.947 3.227   1.00 48.29 ? 5199 HOH A O     1 
HETATM 2976 O  O     . HOH H 6 .   ? 32.116 43.555 -2.187  1.00 43.16 ? 5200 HOH A O     1 
HETATM 2977 O  O     . HOH H 6 .   ? 29.955 41.439 -0.672  1.00 46.01 ? 5201 HOH A O     1 
HETATM 2978 O  O     . HOH H 6 .   ? 18.307 47.942 14.342  1.00 36.31 ? 5202 HOH A O     1 
HETATM 2979 O  O     . HOH H 6 .   ? 17.346 46.152 12.901  1.00 40.56 ? 5203 HOH A O     1 
HETATM 2980 O  O     . HOH H 6 .   ? 21.045 44.843 14.212  1.00 42.60 ? 5204 HOH A O     1 
HETATM 2981 O  O     . HOH H 6 .   ? 25.874 64.162 -0.618  1.00 43.24 ? 5205 HOH A O     1 
HETATM 2982 O  O     . HOH H 6 .   ? 34.418 62.004 1.712   1.00 33.53 ? 5206 HOH A O     1 
HETATM 2983 O  O     . HOH H 6 .   ? 32.730 64.602 4.218   1.00 41.34 ? 5207 HOH A O     1 
HETATM 2984 O  O     . HOH H 6 .   ? 42.894 52.753 23.156  1.00 39.88 ? 5208 HOH A O     1 
HETATM 2985 O  O     . HOH H 6 .   ? 28.089 67.836 16.016  1.00 38.63 ? 5209 HOH A O     1 
HETATM 2986 O  O     . HOH H 6 .   ? 23.879 56.688 24.718  1.00 40.23 ? 5210 HOH A O     1 
HETATM 2987 O  O     . HOH H 6 .   ? 22.720 26.674 11.262  1.00 46.46 ? 5211 HOH A O     1 
HETATM 2988 O  O     . HOH H 6 .   ? 13.640 43.889 2.388   1.00 61.16 ? 5212 HOH A O     1 
HETATM 2989 O  O     . HOH H 6 .   ? 50.379 25.407 35.907  1.00 45.63 ? 5213 HOH A O     1 
HETATM 2990 O  O     . HOH H 6 .   ? 30.208 32.555 36.721  1.00 45.22 ? 5214 HOH A O     1 
HETATM 2991 O  O     . HOH H 6 .   ? 38.049 34.363 38.206  1.00 38.44 ? 5215 HOH A O     1 
HETATM 2992 O  O     . HOH H 6 .   ? 47.864 44.646 35.717  0.50 38.41 ? 5216 HOH A O     1 
HETATM 2993 O  O     . HOH H 6 .   ? 41.429 35.946 43.989  1.00 48.35 ? 5217 HOH A O     1 
HETATM 2994 O  O     . HOH H 6 .   ? 40.460 22.684 16.037  1.00 49.36 ? 5218 HOH A O     1 
HETATM 2995 O  O     . HOH H 6 .   ? 38.503 39.885 4.264   1.00 41.40 ? 5219 HOH A O     1 
HETATM 2996 O  O     . HOH H 6 .   ? 42.164 42.930 -0.218  0.50 40.75 ? 5220 HOH A O     1 
HETATM 2997 O  O     . HOH H 6 .   ? 42.559 49.695 1.193   1.00 47.97 ? 5221 HOH A O     1 
HETATM 2998 O  O     . HOH H 6 .   ? 33.047 63.407 11.883  1.00 38.79 ? 5222 HOH A O     1 
HETATM 2999 O  O     . HOH H 6 .   ? 28.990 60.172 -7.328  1.00 57.02 ? 5223 HOH A O     1 
HETATM 3000 O  O     . HOH H 6 .   ? 31.888 62.900 -2.063  1.00 38.66 ? 5224 HOH A O     1 
HETATM 3001 O  O     . HOH H 6 .   ? 35.842 61.706 5.924   1.00 42.69 ? 5225 HOH A O     1 
HETATM 3002 O  O     . HOH H 6 .   ? 21.502 61.192 25.114  1.00 50.60 ? 5226 HOH A O     1 
HETATM 3003 O  O     . HOH H 6 .   ? 36.760 23.402 12.539  1.00 42.12 ? 5227 HOH A O     1 
HETATM 3004 O  O     . HOH H 6 .   ? 49.480 26.898 9.576   1.00 54.43 ? 5228 HOH A O     1 
HETATM 3005 O  O     . HOH H 6 .   ? 18.096 47.523 -9.448  1.00 54.70 ? 5229 HOH A O     1 
HETATM 3006 O  O     . HOH H 6 .   ? 21.447 52.760 -8.178  1.00 41.32 ? 5230 HOH A O     1 
HETATM 3007 O  O     . HOH H 6 .   ? 46.508 21.915 15.257  1.00 55.52 ? 5231 HOH A O     1 
HETATM 3008 O  O     . HOH H 6 .   ? 34.310 24.129 7.669   1.00 49.96 ? 5232 HOH A O     1 
HETATM 3009 O  O     . HOH H 6 .   ? 33.550 46.914 29.422  1.00 62.69 ? 5233 HOH A O     1 
HETATM 3010 O  O     . HOH H 6 .   ? 41.497 44.684 5.965   1.00 44.96 ? 5234 HOH A O     1 
HETATM 3011 O  O     . HOH H 6 .   ? 52.064 26.632 12.287  1.00 63.10 ? 5235 HOH A O     1 
HETATM 3012 O  O     . HOH H 6 .   ? 20.066 42.510 -2.444  1.00 57.48 ? 5236 HOH A O     1 
HETATM 3013 O  O     . HOH H 6 .   ? 42.629 58.558 9.707   1.00 45.34 ? 5237 HOH A O     1 
HETATM 3014 O  O     . HOH H 6 .   ? 29.671 26.092 6.890   1.00 44.90 ? 5238 HOH A O     1 
HETATM 3015 O  O     . HOH H 6 .   ? 45.165 52.708 22.385  1.00 47.17 ? 5239 HOH A O     1 
HETATM 3016 O  O     . HOH H 6 .   ? 44.836 46.438 32.437  1.00 47.49 ? 5240 HOH A O     1 
HETATM 3017 O  O     . HOH H 6 .   ? 11.766 56.823 14.981  1.00 47.87 ? 5241 HOH A O     1 
HETATM 3018 O  O     . HOH H 6 .   ? 27.012 24.046 32.654  1.00 59.41 ? 5242 HOH A O     1 
HETATM 3019 O  O     . HOH H 6 .   ? 49.867 46.819 24.961  1.00 53.23 ? 5243 HOH A O     1 
HETATM 3020 O  O     . HOH H 6 .   ? 20.264 47.245 -8.118  1.00 45.89 ? 5244 HOH A O     1 
HETATM 3021 O  O     . HOH H 6 .   ? 28.152 64.774 -2.003  1.00 46.84 ? 5245 HOH A O     1 
HETATM 3022 O  O     . HOH H 6 .   ? 35.344 62.706 10.449  1.00 44.50 ? 5246 HOH A O     1 
HETATM 3023 O  O     . HOH H 6 .   ? 13.919 68.342 3.332   1.00 47.67 ? 5247 HOH A O     1 
HETATM 3024 O  O     . HOH H 6 .   ? 45.134 22.424 10.031  1.00 83.24 ? 5248 HOH A O     1 
HETATM 3025 O  O     . HOH H 6 .   ? 21.415 52.655 -5.567  1.00 46.85 ? 5249 HOH A O     1 
HETATM 3026 O  O     . HOH H 6 .   ? 34.656 44.393 32.746  1.00 47.25 ? 5250 HOH A O     1 
HETATM 3027 O  O     . HOH H 6 .   ? 10.224 53.146 5.600   1.00 49.89 ? 5251 HOH A O     1 
HETATM 3028 O  O     . HOH H 6 .   ? 36.024 33.929 2.110   1.00 45.20 ? 5252 HOH A O     1 
HETATM 3029 O  O     . HOH H 6 .   ? 42.756 22.062 14.236  1.00 55.59 ? 5253 HOH A O     1 
HETATM 3030 O  O     . HOH H 6 .   ? 31.483 27.389 2.928   1.00 46.34 ? 5254 HOH A O     1 
HETATM 3031 O  O     . HOH H 6 .   ? 17.891 45.078 8.811   1.00 51.55 ? 5255 HOH A O     1 
HETATM 3032 O  O     . HOH H 6 .   ? 41.098 45.372 26.472  1.00 46.20 ? 5256 HOH A O     1 
HETATM 3033 O  O     . HOH H 6 .   ? 32.067 48.313 26.045  1.00 53.35 ? 5257 HOH A O     1 
HETATM 3034 O  O     . HOH H 6 .   ? 40.040 40.221 6.237   1.00 42.38 ? 5258 HOH A O     1 
HETATM 3035 O  O     . HOH H 6 .   ? 41.779 54.170 4.910   1.00 59.69 ? 5259 HOH A O     1 
HETATM 3036 O  O     . HOH H 6 .   ? 39.459 20.858 9.291   1.00 53.53 ? 5260 HOH A O     1 
HETATM 3037 O  O     . HOH H 6 .   ? 24.074 28.126 28.507  1.00 54.87 ? 5261 HOH A O     1 
HETATM 3038 O  O     . HOH H 6 .   ? 29.574 62.347 -6.061  1.00 46.20 ? 5262 HOH A O     1 
HETATM 3039 O  O     . HOH H 6 .   ? 22.534 77.049 18.058  1.00 53.81 ? 5263 HOH A O     1 
HETATM 3040 O  O     . HOH H 6 .   ? 53.585 38.757 14.983  1.00 47.05 ? 5264 HOH A O     1 
HETATM 3041 O  O     . HOH H 6 .   ? 17.351 46.387 20.477  1.00 56.15 ? 5265 HOH A O     1 
HETATM 3042 O  O     . HOH H 6 .   ? 34.749 37.348 2.001   1.00 47.11 ? 5266 HOH A O     1 
HETATM 3043 O  O     . HOH H 6 .   ? 24.022 34.259 26.182  1.00 52.39 ? 5267 HOH A O     1 
HETATM 3044 O  O     . HOH H 6 .   ? 38.218 35.627 1.834   1.00 41.70 ? 5268 HOH A O     1 
HETATM 3045 O  O     . HOH H 6 .   ? 52.164 24.706 10.798  1.00 57.00 ? 5269 HOH A O     1 
HETATM 3046 O  O     . HOH H 6 .   ? 40.407 40.449 2.083   1.00 42.30 ? 5270 HOH A O     1 
HETATM 3047 O  O     . HOH H 6 .   ? 33.420 27.607 1.782   1.00 50.23 ? 5271 HOH A O     1 
HETATM 3048 O  O     . HOH H 6 .   ? 27.839 29.285 3.597   1.00 52.99 ? 5272 HOH A O     1 
HETATM 3049 O  O     . HOH H 6 .   ? 42.285 18.578 30.235  1.00 52.69 ? 5273 HOH A O     1 
HETATM 3050 O  O     . HOH H 6 .   ? 16.014 44.235 1.187   1.00 54.79 ? 5274 HOH A O     1 
HETATM 3051 O  O     . HOH H 6 .   ? 41.589 42.507 8.900   1.00 62.70 ? 5275 HOH A O     1 
HETATM 3052 O  O     . HOH H 6 .   ? 17.720 53.805 -6.452  1.00 48.42 ? 5276 HOH A O     1 
HETATM 3053 O  O     . HOH H 6 .   ? 53.998 28.613 35.067  1.00 52.47 ? 5277 HOH A O     1 
HETATM 3054 O  O     . HOH H 6 .   ? 22.766 25.476 28.422  1.00 47.90 ? 5278 HOH A O     1 
HETATM 3055 O  O     . HOH H 6 .   ? 34.632 43.095 -5.720  1.00 49.95 ? 5279 HOH A O     1 
HETATM 3056 O  O     . HOH H 6 .   ? 17.157 66.788 24.516  1.00 48.88 ? 5280 HOH A O     1 
HETATM 3057 O  O     . HOH H 6 .   ? 55.620 30.741 35.714  1.00 49.05 ? 5281 HOH A O     1 
HETATM 3058 O  O     . HOH H 6 .   ? 38.704 53.063 -4.221  1.00 50.15 ? 5282 HOH A O     1 
HETATM 3059 O  O     . HOH H 6 .   ? 14.211 65.492 16.706  1.00 57.24 ? 5283 HOH A O     1 
HETATM 3060 O  O     . HOH H 6 .   ? 49.578 36.322 46.551  1.00 59.14 ? 5284 HOH A O     1 
HETATM 3061 O  O     . HOH H 6 .   ? 25.998 32.426 18.804  1.00 62.69 ? 5285 HOH A O     1 
HETATM 3062 O  O     . HOH H 6 .   ? 17.254 57.895 25.884  1.00 47.32 ? 5286 HOH A O     1 
HETATM 3063 O  O     . HOH H 6 .   ? 33.442 66.009 11.118  1.00 48.69 ? 5287 HOH A O     1 
HETATM 3064 O  O     . HOH H 6 .   ? 44.630 19.937 29.703  1.00 47.04 ? 5288 HOH A O     1 
HETATM 3065 O  O     . HOH H 6 .   ? 52.099 23.499 14.535  1.00 57.91 ? 5289 HOH A O     1 
HETATM 3066 O  O     . HOH H 6 .   ? 23.103 24.566 30.825  1.00 47.29 ? 5290 HOH A O     1 
HETATM 3067 O  O     . HOH H 6 .   ? 49.765 47.827 22.734  1.00 50.19 ? 5291 HOH A O     1 
HETATM 3068 O  O     . HOH H 6 .   ? 13.332 65.638 2.812   1.00 50.57 ? 5292 HOH A O     1 
HETATM 3069 O  O     . HOH H 6 .   ? 35.367 40.129 1.752   1.00 53.79 ? 5293 HOH A O     1 
HETATM 3070 O  O     . HOH H 6 .   ? 39.448 39.447 0.000   0.50 50.48 ? 5294 HOH A O     1 
HETATM 3071 O  O     . HOH H 6 .   ? 33.356 35.588 37.931  1.00 57.69 ? 5295 HOH A O     1 
HETATM 3072 O  O     . HOH H 6 .   ? 42.107 46.926 32.180  1.00 48.50 ? 5296 HOH A O     1 
HETATM 3073 O  O     . HOH H 6 .   ? 13.445 45.783 0.445   1.00 61.75 ? 5297 HOH A O     1 
HETATM 3074 O  O     . HOH H 6 .   ? 19.602 75.514 18.571  1.00 54.22 ? 5298 HOH A O     1 
HETATM 3075 O  O     . HOH H 6 .   ? 36.583 45.132 -3.859  1.00 54.36 ? 5299 HOH A O     1 
HETATM 3076 O  O     . HOH H 6 .   ? 39.232 61.597 8.419   1.00 50.68 ? 5300 HOH A O     1 
HETATM 3077 O  O     . HOH H 6 .   ? 21.521 77.857 24.532  1.00 54.10 ? 5301 HOH A O     1 
HETATM 3078 O  O     . HOH H 6 .   ? 23.324 38.467 8.715   1.00 55.25 ? 5302 HOH A O     1 
HETATM 3079 O  O     . HOH H 6 .   ? 35.327 25.129 34.629  1.00 47.91 ? 5303 HOH A O     1 
HETATM 3080 O  O     . HOH H 6 .   ? 23.361 70.956 26.299  1.00 58.81 ? 5304 HOH A O     1 
HETATM 3081 O  O     . HOH H 6 .   ? 56.796 29.652 28.562  1.00 44.28 ? 5305 HOH A O     1 
HETATM 3082 O  O     . HOH H 6 .   ? 32.760 67.461 8.560   1.00 60.84 ? 5306 HOH A O     1 
HETATM 3083 O  O     . HOH H 6 .   ? 33.572 52.242 -8.115  1.00 60.66 ? 5307 HOH A O     1 
HETATM 3084 O  O     . HOH H 6 .   ? 29.844 36.589 37.272  1.00 56.56 ? 5308 HOH A O     1 
HETATM 3085 O  O     . HOH H 6 .   ? 25.692 27.932 5.164   1.00 58.29 ? 5309 HOH A O     1 
HETATM 3086 O  O     . HOH H 6 .   ? 37.551 21.872 14.024  1.00 46.01 ? 5310 HOH A O     1 
HETATM 3087 O  O     . HOH H 6 .   ? 43.318 44.026 1.773   1.00 46.21 ? 5311 HOH A O     1 
HETATM 3088 O  O     . HOH H 6 .   ? 41.032 63.058 19.837  1.00 55.59 ? 5312 HOH A O     1 
HETATM 3089 O  O     . HOH H 6 .   ? 28.495 64.997 -6.806  1.00 57.26 ? 5313 HOH A O     1 
HETATM 3090 O  O     . HOH H 6 .   ? 49.267 48.208 20.142  1.00 47.34 ? 5314 HOH A O     1 
HETATM 3091 O  O     . HOH H 6 .   ? 43.686 39.234 8.374   1.00 52.05 ? 5315 HOH A O     1 
HETATM 3092 O  O     . HOH H 6 .   ? 45.512 45.765 10.378  1.00 59.04 ? 5316 HOH A O     1 
HETATM 3093 O  O     . HOH H 6 .   ? 41.765 18.078 32.883  1.00 59.84 ? 5317 HOH A O     1 
HETATM 3094 O  O     . HOH H 6 .   ? 9.715  55.811 8.872   1.00 58.06 ? 5318 HOH A O     1 
HETATM 3095 O  O     . HOH H 6 .   ? 11.570 52.283 14.036  1.00 52.56 ? 5319 HOH A O     1 
HETATM 3096 O  O     . HOH H 6 .   ? 43.332 31.536 38.650  1.00 51.63 ? 5320 HOH A O     1 
HETATM 3097 O  O     . HOH H 6 .   ? 17.169 70.824 24.984  1.00 50.40 ? 5321 HOH A O     1 
HETATM 3098 O  O     . HOH H 6 .   ? 27.098 58.320 25.796  1.00 56.69 ? 5322 HOH A O     1 
HETATM 3099 O  O     . HOH H 6 .   ? 38.492 17.350 22.644  1.00 55.70 ? 5323 HOH A O     1 
HETATM 3100 O  O     . HOH H 6 .   ? 18.487 61.691 4.176   1.00 37.23 ? 5324 HOH A O     1 
HETATM 3101 O  O     . HOH H 6 .   ? 22.762 67.595 1.828   1.00 45.33 ? 5325 HOH A O     1 
# 
_atom_site_anisotrop.id                   2698 
_atom_site_anisotrop.type_symbol          ZN 
_atom_site_anisotrop.pdbx_label_atom_id   ZN 
_atom_site_anisotrop.pdbx_label_alt_id    . 
_atom_site_anisotrop.pdbx_label_comp_id   ZN 
_atom_site_anisotrop.pdbx_label_asym_id   D 
_atom_site_anisotrop.pdbx_label_seq_id    . 
_atom_site_anisotrop.pdbx_PDB_ins_code    ? 
_atom_site_anisotrop.U[1][1]              0.4321 
_atom_site_anisotrop.U[2][2]              0.0000 
_atom_site_anisotrop.U[3][3]              0.0000 
_atom_site_anisotrop.U[1][2]              0.0000 
_atom_site_anisotrop.U[1][3]              0.0000 
_atom_site_anisotrop.U[2][3]              0.0000 
_atom_site_anisotrop.pdbx_auth_seq_id     5001 
_atom_site_anisotrop.pdbx_auth_comp_id    ZN 
_atom_site_anisotrop.pdbx_auth_asym_id    A 
_atom_site_anisotrop.pdbx_auth_atom_id    ZN 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DC  1   1   1   DC  C   B . n 
A 1 2   DT  2   2   2   DT  T   B . n 
A 1 3   DC  3   3   3   DC  C   B . n 
A 1 4   DT  4   4   4   DT  T   B . n 
A 1 5   DT  5   5   5   DT  T   B . n 
A 1 6   DT  6   6   6   DT  T   B . n 
A 1 7   FOX 7   7   7   FOX FOX B . n 
A 1 8   DT  8   8   8   DT  T   B . n 
A 1 9   DT  9   9   9   DT  T   B . n 
A 1 10  DT  10  10  10  DT  T   B . n 
A 1 11  DC  11  11  11  DC  C   B . n 
A 1 12  DT  12  12  12  DT  T   B . n 
A 1 13  DC  13  13  13  DC  C   B . n 
A 1 14  DG  14  14  14  DG  G   B . n 
B 2 1   DG  1   15  15  DG  G   C . n 
B 2 2   DC  2   16  16  DC  C   C . n 
B 2 3   DG  3   17  17  DG  G   C . n 
B 2 4   DA  4   18  18  DA  A   C . n 
B 2 5   DG  5   19  19  DG  G   C . n 
B 2 6   DA  6   20  20  DA  A   C . n 
B 2 7   DA  7   21  21  DA  A   C . n 
B 2 8   DA  8   22  22  DA  A   C . n 
B 2 9   DC  9   23  23  DC  C   C . n 
B 2 10  DA  10  24  24  DA  A   C . n 
B 2 11  DA  11  25  25  DA  A   C . n 
B 2 12  DA  12  26  26  DA  A   C . n 
B 2 13  DG  13  27  27  DG  G   C . n 
B 2 14  DA  14  28  28  DA  A   C . n 
C 3 1   PRO 1   1   1   PRO PRO A . n 
C 3 2   GLU 2   2   2   GLU GLU A . n 
C 3 3   LEU 3   3   3   LEU LEU A . n 
C 3 4   PRO 4   4   4   PRO PRO A . n 
C 3 5   GLU 5   5   5   GLU GLU A . n 
C 3 6   VAL 6   6   6   VAL VAL A . n 
C 3 7   GLU 7   7   7   GLU GLU A . n 
C 3 8   THR 8   8   8   THR THR A . n 
C 3 9   VAL 9   9   9   VAL VAL A . n 
C 3 10  ARG 10  10  10  ARG ARG A . n 
C 3 11  ARG 11  11  11  ARG ARG A . n 
C 3 12  GLU 12  12  12  GLU GLU A . n 
C 3 13  LEU 13  13  13  LEU LEU A . n 
C 3 14  GLU 14  14  14  GLU GLU A . n 
C 3 15  LYS 15  15  15  LYS LYS A . n 
C 3 16  ARG 16  16  16  ARG ARG A . n 
C 3 17  ILE 17  17  17  ILE ILE A . n 
C 3 18  VAL 18  18  18  VAL VAL A . n 
C 3 19  GLY 19  19  19  GLY GLY A . n 
C 3 20  GLN 20  20  20  GLN GLN A . n 
C 3 21  LYS 21  21  21  LYS LYS A . n 
C 3 22  ILE 22  22  22  ILE ILE A . n 
C 3 23  ILE 23  23  23  ILE ILE A . n 
C 3 24  SER 24  24  24  SER SER A . n 
C 3 25  ILE 25  25  25  ILE ILE A . n 
C 3 26  GLU 26  26  26  GLU GLU A . n 
C 3 27  ALA 27  27  27  ALA ALA A . n 
C 3 28  THR 28  28  28  THR THR A . n 
C 3 29  TYR 29  29  29  TYR TYR A . n 
C 3 30  PRO 30  30  30  PRO PRO A . n 
C 3 31  ARG 31  31  31  ARG ARG A . n 
C 3 32  MET 32  32  32  MET MET A . n 
C 3 33  VAL 33  33  33  VAL VAL A . n 
C 3 34  LEU 34  34  34  LEU LEU A . n 
C 3 35  THR 35  35  35  THR THR A . n 
C 3 36  GLY 36  36  36  GLY GLY A . n 
C 3 37  PHE 37  37  37  PHE PHE A . n 
C 3 38  GLU 38  38  38  GLU GLU A . n 
C 3 39  GLN 39  39  39  GLN GLN A . n 
C 3 40  LEU 40  40  40  LEU LEU A . n 
C 3 41  LYS 41  41  41  LYS LYS A . n 
C 3 42  LYS 42  42  42  LYS LYS A . n 
C 3 43  GLU 43  43  43  GLU GLU A . n 
C 3 44  LEU 44  44  44  LEU LEU A . n 
C 3 45  THR 45  45  45  THR THR A . n 
C 3 46  GLY 46  46  46  GLY GLY A . n 
C 3 47  LYS 47  47  47  LYS LYS A . n 
C 3 48  THR 48  48  48  THR THR A . n 
C 3 49  ILE 49  49  49  ILE ILE A . n 
C 3 50  GLN 50  50  50  GLN GLN A . n 
C 3 51  GLY 51  51  51  GLY GLY A . n 
C 3 52  ILE 52  52  52  ILE ILE A . n 
C 3 53  SER 53  53  53  SER SER A . n 
C 3 54  ARG 54  54  54  ARG ARG A . n 
C 3 55  ARG 55  55  55  ARG ARG A . n 
C 3 56  GLY 56  56  56  GLY GLY A . n 
C 3 57  LYS 57  57  57  LYS LYS A . n 
C 3 58  TYR 58  58  58  TYR TYR A . n 
C 3 59  LEU 59  59  59  LEU LEU A . n 
C 3 60  ILE 60  60  60  ILE ILE A . n 
C 3 61  PHE 61  61  61  PHE PHE A . n 
C 3 62  GLU 62  62  62  GLU GLU A . n 
C 3 63  ILE 63  63  63  ILE ILE A . n 
C 3 64  GLY 64  64  64  GLY GLY A . n 
C 3 65  ASP 65  65  65  ASP ASP A . n 
C 3 66  ASP 66  66  66  ASP ASP A . n 
C 3 67  PHE 67  67  67  PHE PHE A . n 
C 3 68  ARG 68  68  68  ARG ARG A . n 
C 3 69  LEU 69  69  69  LEU LEU A . n 
C 3 70  ILE 70  70  70  ILE ILE A . n 
C 3 71  SER 71  71  71  SER SER A . n 
C 3 72  HIS 72  72  72  HIS HIS A . n 
C 3 73  LEU 73  73  73  LEU LEU A . n 
C 3 74  ARG 74  74  74  ARG ARG A . n 
C 3 75  MET 75  75  75  MET MET A . n 
C 3 76  GLU 76  76  76  GLU GLU A . n 
C 3 77  GLY 77  77  77  GLY GLY A . n 
C 3 78  LYS 78  78  78  LYS LYS A . n 
C 3 79  TYR 79  79  79  TYR TYR A . n 
C 3 80  ARG 80  80  80  ARG ARG A . n 
C 3 81  LEU 81  81  81  LEU LEU A . n 
C 3 82  ALA 82  82  82  ALA ALA A . n 
C 3 83  THR 83  83  83  THR THR A . n 
C 3 84  LEU 84  84  84  LEU LEU A . n 
C 3 85  ASP 85  85  85  ASP ASP A . n 
C 3 86  ALA 86  86  86  ALA ALA A . n 
C 3 87  PRO 87  87  87  PRO PRO A . n 
C 3 88  ARG 88  88  88  ARG ARG A . n 
C 3 89  GLU 89  89  89  GLU GLU A . n 
C 3 90  LYS 90  90  90  LYS LYS A . n 
C 3 91  HIS 91  91  91  HIS HIS A . n 
C 3 92  ASP 92  92  92  ASP ASP A . n 
C 3 93  HIS 93  93  93  HIS HIS A . n 
C 3 94  LEU 94  94  94  LEU LEU A . n 
C 3 95  THR 95  95  95  THR THR A . n 
C 3 96  MET 96  96  96  MET MET A . n 
C 3 97  LYS 97  97  97  LYS LYS A . n 
C 3 98  PHE 98  98  98  PHE PHE A . n 
C 3 99  ALA 99  99  99  ALA ALA A . n 
C 3 100 ASP 100 100 100 ASP ASP A . n 
C 3 101 GLY 101 101 101 GLY GLY A . n 
C 3 102 GLN 102 102 102 GLN GLN A . n 
C 3 103 LEU 103 103 103 LEU LEU A . n 
C 3 104 ILE 104 104 104 ILE ILE A . n 
C 3 105 TYR 105 105 105 TYR TYR A . n 
C 3 106 ALA 106 106 106 ALA ALA A . n 
C 3 107 ASP 107 107 107 ASP ASP A . n 
C 3 108 VAL 108 108 108 VAL VAL A . n 
C 3 109 ARG 109 109 109 ARG ARG A . n 
C 3 110 LYS 110 110 110 LYS LYS A . n 
C 3 111 PHE 111 111 111 PHE PHE A . n 
C 3 112 GLY 112 112 112 GLY GLY A . n 
C 3 113 THR 113 113 113 THR THR A . n 
C 3 114 TRP 114 114 114 TRP TRP A . n 
C 3 115 GLU 115 115 115 GLU GLU A . n 
C 3 116 LEU 116 116 116 LEU LEU A . n 
C 3 117 ILE 117 117 117 ILE ILE A . n 
C 3 118 SER 118 118 118 SER SER A . n 
C 3 119 THR 119 119 119 THR THR A . n 
C 3 120 ASP 120 120 120 ASP ASP A . n 
C 3 121 GLN 121 121 121 GLN GLN A . n 
C 3 122 VAL 122 122 122 VAL VAL A . n 
C 3 123 LEU 123 123 123 LEU LEU A . n 
C 3 124 PRO 124 124 124 PRO PRO A . n 
C 3 125 TYR 125 125 125 TYR TYR A . n 
C 3 126 PHE 126 126 126 PHE PHE A . n 
C 3 127 LEU 127 127 127 LEU LEU A . n 
C 3 128 LYS 128 128 128 LYS LYS A . n 
C 3 129 LYS 129 129 129 LYS LYS A . n 
C 3 130 LYS 130 130 130 LYS LYS A . n 
C 3 131 ILE 131 131 131 ILE ILE A . n 
C 3 132 GLY 132 132 132 GLY GLY A . n 
C 3 133 PRO 133 133 133 PRO PRO A . n 
C 3 134 GLU 134 134 134 GLU GLU A . n 
C 3 135 PRO 135 135 135 PRO PRO A . n 
C 3 136 THR 136 136 136 THR THR A . n 
C 3 137 TYR 137 137 137 TYR TYR A . n 
C 3 138 GLU 138 138 138 GLU GLU A . n 
C 3 139 ASP 139 139 139 ASP ASP A . n 
C 3 140 PHE 140 140 140 PHE PHE A . n 
C 3 141 ASP 141 141 141 ASP ASP A . n 
C 3 142 GLU 142 142 142 GLU GLU A . n 
C 3 143 LYS 143 143 143 LYS LYS A . n 
C 3 144 LEU 144 144 144 LEU LEU A . n 
C 3 145 PHE 145 145 145 PHE PHE A . n 
C 3 146 ARG 146 146 146 ARG ARG A . n 
C 3 147 GLU 147 147 147 GLU GLU A . n 
C 3 148 LYS 148 148 148 LYS LYS A . n 
C 3 149 LEU 149 149 149 LEU LEU A . n 
C 3 150 ARG 150 150 150 ARG ARG A . n 
C 3 151 LYS 151 151 151 LYS LYS A . n 
C 3 152 SER 152 152 152 SER SER A . n 
C 3 153 THR 153 153 153 THR THR A . n 
C 3 154 LYS 154 154 154 LYS LYS A . n 
C 3 155 LYS 155 155 155 LYS LYS A . n 
C 3 156 ILE 156 156 156 ILE ILE A . n 
C 3 157 LYS 157 157 157 LYS LYS A . n 
C 3 158 PRO 158 158 158 PRO PRO A . n 
C 3 159 TYR 159 159 159 TYR TYR A . n 
C 3 160 LEU 160 160 160 LEU LEU A . n 
C 3 161 LEU 161 161 161 LEU LEU A . n 
C 3 162 GLU 162 162 162 GLU GLU A . n 
C 3 163 GLN 163 163 163 GLN GLN A . n 
C 3 164 THR 164 164 164 THR THR A . n 
C 3 165 LEU 165 165 165 LEU LEU A . n 
C 3 166 VAL 166 166 166 VAL VAL A . n 
C 3 167 ALA 167 167 167 ALA ALA A . n 
C 3 168 GLY 168 168 168 GLY GLY A . n 
C 3 169 LEU 169 169 169 LEU LEU A . n 
C 3 170 GLY 170 170 170 GLY GLY A . n 
C 3 171 ASN 171 171 171 ASN ASN A . n 
C 3 172 ILE 172 172 172 ILE ILE A . n 
C 3 173 TYR 173 173 173 TYR TYR A . n 
C 3 174 VAL 174 174 174 VAL VAL A . n 
C 3 175 ASP 175 175 175 ASP ASP A . n 
C 3 176 GLU 176 176 176 GLU GLU A . n 
C 3 177 VAL 177 177 177 VAL VAL A . n 
C 3 178 LEU 178 178 178 LEU LEU A . n 
C 3 179 TRP 179 179 179 TRP TRP A . n 
C 3 180 LEU 180 180 180 LEU LEU A . n 
C 3 181 ALA 181 181 181 ALA ALA A . n 
C 3 182 LYS 182 182 182 LYS LYS A . n 
C 3 183 ILE 183 183 183 ILE ILE A . n 
C 3 184 HIS 184 184 184 HIS HIS A . n 
C 3 185 PRO 185 185 185 PRO PRO A . n 
C 3 186 GLU 186 186 186 GLU GLU A . n 
C 3 187 LYS 187 187 187 LYS LYS A . n 
C 3 188 GLU 188 188 188 GLU GLU A . n 
C 3 189 THR 189 189 189 THR THR A . n 
C 3 190 ASN 190 190 190 ASN ASN A . n 
C 3 191 GLN 191 191 191 GLN GLN A . n 
C 3 192 LEU 192 192 192 LEU LEU A . n 
C 3 193 ILE 193 193 193 ILE ILE A . n 
C 3 194 GLU 194 194 194 GLU GLU A . n 
C 3 195 SER 195 195 195 SER SER A . n 
C 3 196 SER 196 196 196 SER SER A . n 
C 3 197 ILE 197 197 197 ILE ILE A . n 
C 3 198 HIS 198 198 198 HIS HIS A . n 
C 3 199 LEU 199 199 199 LEU LEU A . n 
C 3 200 LEU 200 200 200 LEU LEU A . n 
C 3 201 HIS 201 201 201 HIS HIS A . n 
C 3 202 ASP 202 202 202 ASP ASP A . n 
C 3 203 SER 203 203 203 SER SER A . n 
C 3 204 ILE 204 204 204 ILE ILE A . n 
C 3 205 ILE 205 205 205 ILE ILE A . n 
C 3 206 GLU 206 206 206 GLU GLU A . n 
C 3 207 ILE 207 207 207 ILE ILE A . n 
C 3 208 LEU 208 208 208 LEU LEU A . n 
C 3 209 GLN 209 209 209 GLN GLN A . n 
C 3 210 LYS 210 210 210 LYS LYS A . n 
C 3 211 ALA 211 211 211 ALA ALA A . n 
C 3 212 ILE 212 212 212 ILE ILE A . n 
C 3 213 LYS 213 213 213 LYS LYS A . n 
C 3 214 LEU 214 214 214 LEU LEU A . n 
C 3 215 GLY 215 215 215 GLY GLY A . n 
C 3 216 GLY 216 216 216 GLY GLY A . n 
C 3 217 SER 217 217 217 SER SER A . n 
C 3 218 SER 218 218 218 SER SER A . n 
C 3 219 ILE 219 219 219 ILE ILE A . n 
C 3 220 ARG 220 220 220 ARG ARG A . n 
C 3 221 THR 221 221 221 THR THR A . n 
C 3 222 TYR 222 222 222 TYR TYR A . n 
C 3 223 SER 223 223 223 SER SER A . n 
C 3 224 ALA 224 224 224 ALA ALA A . n 
C 3 225 LEU 225 225 225 LEU LEU A . n 
C 3 226 GLY 226 226 226 GLY GLY A . n 
C 3 227 SER 227 227 227 SER SER A . n 
C 3 228 THR 228 228 228 THR THR A . n 
C 3 229 GLY 229 229 229 GLY GLY A . n 
C 3 230 LYS 230 230 230 LYS LYS A . n 
C 3 231 MET 231 231 231 MET MET A . n 
C 3 232 GLN 232 232 232 GLN GLN A . n 
C 3 233 ASN 233 233 233 ASN ASN A . n 
C 3 234 GLU 234 234 234 GLU GLU A . n 
C 3 235 LEU 235 235 235 LEU LEU A . n 
C 3 236 GLN 236 236 236 GLN GLN A . n 
C 3 237 VAL 237 237 237 VAL VAL A . n 
C 3 238 TYR 238 238 238 TYR TYR A . n 
C 3 239 GLY 239 239 239 GLY GLY A . n 
C 3 240 LYS 240 240 240 LYS LYS A . n 
C 3 241 THR 241 241 241 THR THR A . n 
C 3 242 GLY 242 242 242 GLY GLY A . n 
C 3 243 GLU 243 243 243 GLU GLU A . n 
C 3 244 LYS 244 244 244 LYS LYS A . n 
C 3 245 CYS 245 245 245 CYS CYS A . n 
C 3 246 SER 246 246 246 SER SER A . n 
C 3 247 ARG 247 247 247 ARG ARG A . n 
C 3 248 CYS 248 248 248 CYS CYS A . n 
C 3 249 GLY 249 249 249 GLY GLY A . n 
C 3 250 ALA 250 250 250 ALA ALA A . n 
C 3 251 GLU 251 251 251 GLU GLU A . n 
C 3 252 ILE 252 252 252 ILE ILE A . n 
C 3 253 GLN 253 253 253 GLN GLN A . n 
C 3 254 LYS 254 254 254 LYS LYS A . n 
C 3 255 ILE 255 255 255 ILE ILE A . n 
C 3 256 LYS 256 256 256 LYS LYS A . n 
C 3 257 VAL 257 257 257 VAL VAL A . n 
C 3 258 ALA 258 258 258 ALA ALA A . n 
C 3 259 GLY 259 259 259 GLY GLY A . n 
C 3 260 ARG 260 260 260 ARG ARG A . n 
C 3 261 GLY 261 261 261 GLY GLY A . n 
C 3 262 THR 262 262 262 THR THR A . n 
C 3 263 HIS 263 263 263 HIS HIS A . n 
C 3 264 PHE 264 264 264 PHE PHE A . n 
C 3 265 CYS 265 265 265 CYS CYS A . n 
C 3 266 PRO 266 266 266 PRO PRO A . n 
C 3 267 VAL 267 267 267 VAL VAL A . n 
C 3 268 CYS 268 268 268 CYS CYS A . n 
C 3 269 GLN 269 269 269 GLN GLN A . n 
C 3 270 GLN 270 270 270 GLN GLN A . n 
C 3 271 LYS 271 271 271 LYS LYS A . n 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    FOX 
_pdbx_struct_mod_residue.label_seq_id     7 
_pdbx_struct_mod_residue.auth_asym_id     B 
_pdbx_struct_mod_residue.auth_comp_id     FOX 
_pdbx_struct_mod_residue.auth_seq_id      7 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   DG 
_pdbx_struct_mod_residue.details          ? 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 5216 ? H HOH . 
2 1 A HOH 5294 ? H HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG ? C CYS 268 ? A CYS 268 ? 1_555 ZN ? D ZN . ? A ZN 5001 ? 1_555 SG ? C CYS 248 ? A CYS 248 ? 1_555 115.5 ? 
2 SG ? C CYS 268 ? A CYS 268 ? 1_555 ZN ? D ZN . ? A ZN 5001 ? 1_555 SG ? C CYS 265 ? A CYS 265 ? 1_555 112.7 ? 
3 SG ? C CYS 248 ? A CYS 248 ? 1_555 ZN ? D ZN . ? A ZN 5001 ? 1_555 SG ? C CYS 265 ? A CYS 265 ? 1_555 95.8  ? 
4 SG ? C CYS 268 ? A CYS 268 ? 1_555 ZN ? D ZN . ? A ZN 5001 ? 1_555 SG ? C CYS 245 ? A CYS 245 ? 1_555 107.0 ? 
5 SG ? C CYS 248 ? A CYS 248 ? 1_555 ZN ? D ZN . ? A ZN 5001 ? 1_555 SG ? C CYS 245 ? A CYS 245 ? 1_555 113.1 ? 
6 SG ? C CYS 265 ? A CYS 265 ? 1_555 ZN ? D ZN . ? A ZN 5001 ? 1_555 SG ? C CYS 245 ? A CYS 245 ? 1_555 112.8 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-09-06 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
Xnemo  'data collection' .         ? 1 
SCALA  'data scaling'    .         ? 2 
AMoRE  phasing           .         ? 3 
REFMAC refinement        5.2       ? 4 
XNEMO  'data reduction'  .         ? 5 
CCP4   'data scaling'    '(SCALA)' ? 6 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OP2 
_pdbx_validate_close_contact.auth_asym_id_1   C 
_pdbx_validate_close_contact.auth_comp_id_1   DA 
_pdbx_validate_close_contact.auth_seq_id_1    22 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   C 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    372 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.19 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 C5 B DT  8   ? ? C7 B DT  8   ? ? 1.535 1.496 0.039 0.006 N 
2 1 CB A CYS 265 ? ? SG A CYS 265 ? ? 1.926 1.818 0.108 0.017 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" B DT  2  ? ? "C1'" B DT  2  ? ? N1    B DT  2  ? ? 110.21 108.30 1.91  0.30 N 
2  1 "O4'" B DT  6  ? ? "C1'" B DT  6  ? ? N1    B DT  6  ? ? 110.18 108.30 1.88  0.30 N 
3  1 C4    B DT  6  ? ? C5    B DT  6  ? ? C7    B DT  6  ? ? 123.27 119.00 4.27  0.60 N 
4  1 "O4'" B DT  8  ? ? "C1'" B DT  8  ? ? N1    B DT  8  ? ? 103.64 108.00 -4.36 0.70 N 
5  1 C5    B DT  12 ? ? C4    B DT  12 ? ? O4    B DT  12 ? ? 120.38 124.90 -4.52 0.70 N 
6  1 "O4'" B DC  13 ? ? "C1'" B DC  13 ? ? "C2'" B DC  13 ? ? 100.74 105.90 -5.16 0.80 N 
7  1 "O4'" B DC  13 ? ? "C1'" B DC  13 ? ? N1    B DC  13 ? ? 103.33 108.00 -4.67 0.70 N 
8  1 "O4'" C DG  15 ? ? "C1'" C DG  15 ? ? N9    C DG  15 ? ? 112.23 108.30 3.93  0.30 N 
9  1 "O5'" C DG  17 ? ? "C5'" C DG  17 ? ? "C4'" C DG  17 ? ? 103.36 109.40 -6.04 0.80 N 
10 1 "O4'" C DA  18 ? ? "C1'" C DA  18 ? ? N9    C DA  18 ? ? 103.40 108.00 -4.60 0.70 N 
11 1 "O4'" C DA  20 ? ? "C1'" C DA  20 ? ? N9    C DA  20 ? ? 112.89 108.30 4.59  0.30 N 
12 1 "O5'" C DC  23 ? ? P     C DC  23 ? ? OP2   C DC  23 ? ? 99.60  105.70 -6.10 0.90 N 
13 1 "O4'" C DC  23 ? ? "C4'" C DC  23 ? ? "C3'" C DC  23 ? ? 102.06 104.50 -2.44 0.40 N 
14 1 "C1'" C DC  23 ? ? "O4'" C DC  23 ? ? "C4'" C DC  23 ? ? 103.72 110.10 -6.38 1.00 N 
15 1 "O4'" C DG  27 ? ? "C1'" C DG  27 ? ? N9    C DG  27 ? ? 112.50 108.30 4.20  0.30 N 
16 1 "O4'" C DA  28 ? ? "C1'" C DA  28 ? ? N9    C DA  28 ? ? 112.84 108.30 4.54  0.30 N 
17 1 CA    A LEU 40 ? ? CB    A LEU 40 ? ? CG    A LEU 40 ? ? 133.68 115.30 18.38 2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 74  ? ? 45.58   -124.15 
2 1 VAL A 166 ? ? -170.83 143.03  
3 1 ARG A 220 ? ? -133.14 -42.44  
4 1 VAL A 237 ? ? -134.30 -37.90  
5 1 GLN A 269 ? ? -118.98 76.27   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 15  ? CD  ? C LYS 15  CD  
2  1 Y 1 A LYS 15  ? CE  ? C LYS 15  CE  
3  1 Y 1 A LYS 15  ? NZ  ? C LYS 15  NZ  
4  1 Y 1 A ARG 31  ? CZ  ? C ARG 31  CZ  
5  1 Y 1 A ARG 31  ? NH1 ? C ARG 31  NH1 
6  1 Y 1 A ARG 31  ? NH2 ? C ARG 31  NH2 
7  1 Y 1 A LYS 42  ? CD  ? C LYS 42  CD  
8  1 Y 1 A LYS 42  ? CE  ? C LYS 42  CE  
9  1 Y 1 A LYS 42  ? NZ  ? C LYS 42  NZ  
10 1 Y 1 A ASP 65  ? CG  ? C ASP 65  CG  
11 1 Y 1 A ASP 65  ? OD1 ? C ASP 65  OD1 
12 1 Y 1 A ASP 65  ? OD2 ? C ASP 65  OD2 
13 1 Y 1 A ASP 66  ? CG  ? C ASP 66  CG  
14 1 Y 1 A ASP 66  ? OD1 ? C ASP 66  OD1 
15 1 Y 1 A ASP 66  ? OD2 ? C ASP 66  OD2 
16 1 Y 1 A LYS 78  ? CD  ? C LYS 78  CD  
17 1 Y 1 A LYS 78  ? CE  ? C LYS 78  CE  
18 1 Y 1 A LYS 78  ? NZ  ? C LYS 78  NZ  
19 1 Y 1 A ARG 88  ? CG  ? C ARG 88  CG  
20 1 Y 1 A ARG 88  ? CD  ? C ARG 88  CD  
21 1 Y 1 A ARG 88  ? NE  ? C ARG 88  NE  
22 1 Y 1 A ARG 88  ? CZ  ? C ARG 88  CZ  
23 1 Y 1 A ARG 88  ? NH1 ? C ARG 88  NH1 
24 1 Y 1 A ARG 88  ? NH2 ? C ARG 88  NH2 
25 1 Y 1 A ASP 100 ? CG  ? C ASP 100 CG  
26 1 Y 1 A ASP 100 ? OD1 ? C ASP 100 OD1 
27 1 Y 1 A ASP 100 ? OD2 ? C ASP 100 OD2 
28 1 Y 1 A GLN 121 ? CD  ? C GLN 121 CD  
29 1 Y 1 A GLN 121 ? OE1 ? C GLN 121 OE1 
30 1 Y 1 A GLN 121 ? NE2 ? C GLN 121 NE2 
31 1 Y 1 A LYS 130 ? CE  ? C LYS 130 CE  
32 1 Y 1 A LYS 130 ? NZ  ? C LYS 130 NZ  
33 1 Y 1 A GLU 138 ? CG  ? C GLU 138 CG  
34 1 Y 1 A GLU 138 ? CD  ? C GLU 138 CD  
35 1 Y 1 A GLU 138 ? OE1 ? C GLU 138 OE1 
36 1 Y 1 A GLU 138 ? OE2 ? C GLU 138 OE2 
37 1 Y 1 A ARG 150 ? CD  ? C ARG 150 CD  
38 1 Y 1 A ARG 150 ? NE  ? C ARG 150 NE  
39 1 Y 1 A ARG 150 ? CZ  ? C ARG 150 CZ  
40 1 Y 1 A ARG 150 ? NH1 ? C ARG 150 NH1 
41 1 Y 1 A ARG 150 ? NH2 ? C ARG 150 NH2 
42 1 Y 1 A LYS 187 ? NZ  ? C LYS 187 NZ  
43 1 Y 1 A GLN 191 ? CD  ? C GLN 191 CD  
44 1 Y 1 A GLN 191 ? OE1 ? C GLN 191 OE1 
45 1 Y 1 A GLN 191 ? NE2 ? C GLN 191 NE2 
46 1 Y 1 A LYS 213 ? CG  ? C LYS 213 CG  
47 1 Y 1 A LYS 213 ? CD  ? C LYS 213 CD  
48 1 Y 1 A LYS 213 ? CE  ? C LYS 213 CE  
49 1 Y 1 A LYS 213 ? NZ  ? C LYS 213 NZ  
50 1 Y 1 A ARG 220 ? CG  ? C ARG 220 CG  
51 1 Y 1 A ARG 220 ? CD  ? C ARG 220 CD  
52 1 Y 1 A ARG 220 ? NE  ? C ARG 220 NE  
53 1 Y 1 A ARG 220 ? CZ  ? C ARG 220 CZ  
54 1 Y 1 A ARG 220 ? NH1 ? C ARG 220 NH1 
55 1 Y 1 A ARG 220 ? NH2 ? C ARG 220 NH2 
56 1 Y 1 A LYS 230 ? CE  ? C LYS 230 CE  
57 1 Y 1 A LYS 230 ? NZ  ? C LYS 230 NZ  
58 1 Y 1 A LYS 271 ? CE  ? C LYS 271 CE  
59 1 Y 1 A LYS 271 ? NZ  ? C LYS 271 NZ  
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1XC8 'b-form double helix'  
1XC8 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DT 2  1_555 B DA 14 1_555 -0.181 -0.175 -0.022 -1.757 -6.255  -0.867 1  B_DT2:DA28_C  B 2  ? C 28 ? 20 1 
1 A DC 3  1_555 B DG 13 1_555 0.303  -0.069 -0.272 0.629  -7.484  -1.160 2  B_DC3:DG27_C  B 3  ? C 27 ? 19 1 
1 A DT 4  1_555 B DA 12 1_555 -0.078 -0.170 0.085  -5.823 -13.291 2.225  3  B_DT4:DA26_C  B 4  ? C 26 ? 20 1 
1 A DT 5  1_555 B DA 11 1_555 -0.095 -0.174 -0.146 1.539  -8.130  4.496  4  B_DT5:DA25_C  B 5  ? C 25 ? 20 1 
1 A DT 6  1_555 B DA 10 1_555 0.063  -0.099 -0.330 13.118 -2.447  3.004  5  B_DT6:DA24_C  B 6  ? C 24 ? 20 1 
1 A DT 8  1_555 B DA 8  1_555 -0.109 -0.045 -0.030 -9.771 -3.767  -0.093 6  B_DT8:DA22_C  B 8  ? C 22 ? 20 1 
1 A DT 9  1_555 B DA 7  1_555 -0.026 -0.073 -0.247 0.194  -8.624  0.339  7  B_DT9:DA21_C  B 9  ? C 21 ? 20 1 
1 A DT 10 1_555 B DA 6  1_555 -0.097 -0.090 -0.197 5.405  -4.860  0.308  8  B_DT10:DA20_C B 10 ? C 20 ? 20 1 
1 A DC 11 1_555 B DG 5  1_555 0.208  -0.151 0.107  -4.141 -16.115 -0.536 9  B_DC11:DG19_C B 11 ? C 19 ? 19 1 
1 A DT 12 1_555 B DA 4  1_555 -0.305 -0.145 0.049  -3.110 -8.846  -2.059 10 B_DT12:DA18_C B 12 ? C 18 ? 20 1 
1 A DC 13 1_555 B DG 3  1_555 0.188  -0.182 0.003  -4.542 -6.620  -1.400 11 B_DC13:DG17_C B 13 ? C 17 ? 19 1 
1 A DG 14 1_555 B DC 2  1_555 -0.147 -0.276 -0.021 5.833  -7.870  -1.654 12 B_DG14:DC16_C B 14 ? C 16 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DT 2  1_555 B DA 14 1_555 A DC 3  1_555 B DG 13 1_555 0.201  -0.368 3.306 2.835  2.747  36.512 -0.963 0.072  3.277 4.368  
-4.508 36.718 1  BB_DT2DC3:DG27DA28_CC   B 2  ? C 28 ? B 3  ? C 27 ? 
1 A DC 3  1_555 B DG 13 1_555 A DT 4  1_555 B DA 12 1_555 0.374  -0.477 3.518 -0.218 5.336  33.777 -1.708 -0.673 3.403 9.113  
0.372  34.185 2  BB_DC3DT4:DA26DG27_CC   B 3  ? C 27 ? B 4  ? C 26 ? 
1 A DT 4  1_555 B DA 12 1_555 A DT 5  1_555 B DA 11 1_555 0.163  -0.239 3.131 1.127  1.476  32.177 -0.682 -0.102 3.121 2.661  
-2.032 32.229 3  BB_DT4DT5:DA25DA26_CC   B 4  ? C 26 ? B 5  ? C 25 ? 
1 A DT 5  1_555 B DA 11 1_555 A DT 6  1_555 B DA 10 1_555 -0.062 0.071  3.169 2.323  9.698  28.187 -1.825 0.591  3.013 19.170 
-4.592 29.865 4  BB_DT5DT6:DA24DA25_CC   B 5  ? C 25 ? B 6  ? C 24 ? 
1 A DT 8  1_555 B DA 8  1_555 A DT 9  1_555 B DA 7  1_555 0.203  -0.028 3.189 0.466  3.791  29.624 -0.823 -0.299 3.163 7.376  
-0.907 29.864 5  BB_DT8DT9:DA21DA22_CC   B 8  ? C 22 ? B 9  ? C 21 ? 
1 A DT 9  1_555 B DA 7  1_555 A DT 10 1_555 B DA 6  1_555 0.550  -0.071 3.317 0.631  1.611  34.579 -0.372 -0.825 3.319 2.708  
-1.060 34.621 6  BB_DT9DT10:DA20DA21_CC  B 9  ? C 21 ? B 10 ? C 20 ? 
1 A DT 10 1_555 B DA 6  1_555 A DC 11 1_555 B DG 5  1_555 -0.528 -0.392 3.597 -2.553 -4.121 36.065 0.009  0.451  3.645 -6.619 
4.101  36.379 7  BB_DT10DC11:DG19DA20_CC B 10 ? C 20 ? B 11 ? C 19 ? 
1 A DC 11 1_555 B DG 5  1_555 A DT 12 1_555 B DA 4  1_555 -0.746 -0.404 3.338 1.741  6.834  29.205 -2.185 1.798  3.116 13.311 
-3.390 30.026 8  BB_DC11DT12:DA18DG19_CC B 11 ? C 19 ? B 12 ? C 18 ? 
1 A DT 12 1_555 B DA 4  1_555 A DC 13 1_555 B DG 3  1_555 0.359  -0.018 3.394 0.945  1.797  38.431 -0.259 -0.422 3.398 2.727  
-1.435 38.483 9  BB_DT12DC13:DG17DA18_CC B 12 ? C 18 ? B 13 ? C 17 ? 
1 A DC 13 1_555 B DG 3  1_555 A DG 14 1_555 B DC 2  1_555 0.459  0.732  3.214 0.386  9.757  30.390 -0.477 -0.764 3.291 18.036 
-0.713 31.885 10 BB_DC13DG14:DC16DG17_CC B 13 ? C 17 ? B 14 ? C 16 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION' ZN  
5 GLYCEROL   GOL 
6 water      HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 ZN  1   5001 5001 ZN  ZN  A . 
E 5 GOL 1   1001 1001 GOL GOL A . 
F 6 HOH 1   23   23   HOH HOH B . 
F 6 HOH 2   26   26   HOH HOH B . 
F 6 HOH 3   40   40   HOH HOH B . 
F 6 HOH 4   44   44   HOH HOH B . 
F 6 HOH 5   60   60   HOH HOH B . 
F 6 HOH 6   91   91   HOH HOH B . 
F 6 HOH 7   105  105  HOH HOH B . 
F 6 HOH 8   107  107  HOH HOH B . 
F 6 HOH 9   112  112  HOH HOH B . 
F 6 HOH 10  120  120  HOH HOH B . 
F 6 HOH 11  131  131  HOH HOH B . 
F 6 HOH 12  143  143  HOH HOH B . 
F 6 HOH 13  163  163  HOH HOH B . 
F 6 HOH 14  172  172  HOH HOH B . 
F 6 HOH 15  176  176  HOH HOH B . 
F 6 HOH 16  179  179  HOH HOH B . 
F 6 HOH 17  190  190  HOH HOH B . 
F 6 HOH 18  191  191  HOH HOH B . 
F 6 HOH 19  193  193  HOH HOH B . 
F 6 HOH 20  198  198  HOH HOH B . 
F 6 HOH 21  207  207  HOH HOH B . 
F 6 HOH 22  208  208  HOH HOH B . 
F 6 HOH 23  209  209  HOH HOH B . 
F 6 HOH 24  211  211  HOH HOH B . 
F 6 HOH 25  242  242  HOH HOH B . 
F 6 HOH 26  243  243  HOH HOH B . 
F 6 HOH 27  244  244  HOH HOH B . 
F 6 HOH 28  253  253  HOH HOH B . 
F 6 HOH 29  269  269  HOH HOH B . 
F 6 HOH 30  270  270  HOH HOH B . 
F 6 HOH 31  311  311  HOH HOH B . 
F 6 HOH 32  323  323  HOH HOH B . 
F 6 HOH 33  325  325  HOH HOH B . 
F 6 HOH 34  331  331  HOH HOH B . 
F 6 HOH 35  361  361  HOH HOH B . 
F 6 HOH 36  375  375  HOH HOH B . 
F 6 HOH 37  394  394  HOH HOH B . 
G 6 HOH 1   118  118  HOH HOH C . 
G 6 HOH 2   148  148  HOH HOH C . 
G 6 HOH 3   152  152  HOH HOH C . 
G 6 HOH 4   154  154  HOH HOH C . 
G 6 HOH 5   155  155  HOH HOH C . 
G 6 HOH 6   166  166  HOH HOH C . 
G 6 HOH 7   171  171  HOH HOH C . 
G 6 HOH 8   178  178  HOH HOH C . 
G 6 HOH 9   183  183  HOH HOH C . 
G 6 HOH 10  185  185  HOH HOH C . 
G 6 HOH 11  196  196  HOH HOH C . 
G 6 HOH 12  201  201  HOH HOH C . 
G 6 HOH 13  204  204  HOH HOH C . 
G 6 HOH 14  214  214  HOH HOH C . 
G 6 HOH 15  252  252  HOH HOH C . 
G 6 HOH 16  275  275  HOH HOH C . 
G 6 HOH 17  287  287  HOH HOH C . 
G 6 HOH 18  295  295  HOH HOH C . 
G 6 HOH 19  305  305  HOH HOH C . 
G 6 HOH 20  308  308  HOH HOH C . 
G 6 HOH 21  310  310  HOH HOH C . 
G 6 HOH 22  314  314  HOH HOH C . 
G 6 HOH 23  335  335  HOH HOH C . 
G 6 HOH 24  339  339  HOH HOH C . 
G 6 HOH 25  341  341  HOH HOH C . 
G 6 HOH 26  351  351  HOH HOH C . 
G 6 HOH 27  355  355  HOH HOH C . 
G 6 HOH 28  359  359  HOH HOH C . 
G 6 HOH 29  360  360  HOH HOH C . 
G 6 HOH 30  362  362  HOH HOH C . 
G 6 HOH 31  370  370  HOH HOH C . 
G 6 HOH 32  372  372  HOH HOH C . 
G 6 HOH 33  376  376  HOH HOH C . 
G 6 HOH 34  379  379  HOH HOH C . 
G 6 HOH 35  384  384  HOH HOH C . 
G 6 HOH 36  392  392  HOH HOH C . 
H 6 HOH 1   5002 1    HOH HOH A . 
H 6 HOH 2   5003 2    HOH HOH A . 
H 6 HOH 3   5004 3    HOH HOH A . 
H 6 HOH 4   5005 4    HOH HOH A . 
H 6 HOH 5   5006 5    HOH HOH A . 
H 6 HOH 6   5007 6    HOH HOH A . 
H 6 HOH 7   5008 7    HOH HOH A . 
H 6 HOH 8   5009 8    HOH HOH A . 
H 6 HOH 9   5010 9    HOH HOH A . 
H 6 HOH 10  5011 10   HOH HOH A . 
H 6 HOH 11  5012 11   HOH HOH A . 
H 6 HOH 12  5013 12   HOH HOH A . 
H 6 HOH 13  5014 13   HOH HOH A . 
H 6 HOH 14  5015 14   HOH HOH A . 
H 6 HOH 15  5016 15   HOH HOH A . 
H 6 HOH 16  5017 16   HOH HOH A . 
H 6 HOH 17  5018 17   HOH HOH A . 
H 6 HOH 18  5019 18   HOH HOH A . 
H 6 HOH 19  5020 19   HOH HOH A . 
H 6 HOH 20  5021 20   HOH HOH A . 
H 6 HOH 21  5022 21   HOH HOH A . 
H 6 HOH 22  5023 22   HOH HOH A . 
H 6 HOH 23  5024 24   HOH HOH A . 
H 6 HOH 24  5025 25   HOH HOH A . 
H 6 HOH 25  5026 27   HOH HOH A . 
H 6 HOH 26  5027 28   HOH HOH A . 
H 6 HOH 27  5028 29   HOH HOH A . 
H 6 HOH 28  5029 30   HOH HOH A . 
H 6 HOH 29  5030 31   HOH HOH A . 
H 6 HOH 30  5031 32   HOH HOH A . 
H 6 HOH 31  5032 33   HOH HOH A . 
H 6 HOH 32  5033 34   HOH HOH A . 
H 6 HOH 33  5034 35   HOH HOH A . 
H 6 HOH 34  5035 36   HOH HOH A . 
H 6 HOH 35  5036 37   HOH HOH A . 
H 6 HOH 36  5037 38   HOH HOH A . 
H 6 HOH 37  5038 39   HOH HOH A . 
H 6 HOH 38  5039 41   HOH HOH A . 
H 6 HOH 39  5040 42   HOH HOH A . 
H 6 HOH 40  5041 43   HOH HOH A . 
H 6 HOH 41  5042 45   HOH HOH A . 
H 6 HOH 42  5043 46   HOH HOH A . 
H 6 HOH 43  5044 47   HOH HOH A . 
H 6 HOH 44  5045 48   HOH HOH A . 
H 6 HOH 45  5046 49   HOH HOH A . 
H 6 HOH 46  5047 50   HOH HOH A . 
H 6 HOH 47  5048 51   HOH HOH A . 
H 6 HOH 48  5049 52   HOH HOH A . 
H 6 HOH 49  5050 53   HOH HOH A . 
H 6 HOH 50  5051 54   HOH HOH A . 
H 6 HOH 51  5052 55   HOH HOH A . 
H 6 HOH 52  5053 56   HOH HOH A . 
H 6 HOH 53  5054 57   HOH HOH A . 
H 6 HOH 54  5055 58   HOH HOH A . 
H 6 HOH 55  5056 59   HOH HOH A . 
H 6 HOH 56  5057 61   HOH HOH A . 
H 6 HOH 57  5058 62   HOH HOH A . 
H 6 HOH 58  5059 63   HOH HOH A . 
H 6 HOH 59  5060 64   HOH HOH A . 
H 6 HOH 60  5061 65   HOH HOH A . 
H 6 HOH 61  5062 66   HOH HOH A . 
H 6 HOH 62  5063 67   HOH HOH A . 
H 6 HOH 63  5064 68   HOH HOH A . 
H 6 HOH 64  5065 69   HOH HOH A . 
H 6 HOH 65  5066 70   HOH HOH A . 
H 6 HOH 66  5067 71   HOH HOH A . 
H 6 HOH 67  5068 72   HOH HOH A . 
H 6 HOH 68  5069 73   HOH HOH A . 
H 6 HOH 69  5070 74   HOH HOH A . 
H 6 HOH 70  5071 75   HOH HOH A . 
H 6 HOH 71  5072 76   HOH HOH A . 
H 6 HOH 72  5073 77   HOH HOH A . 
H 6 HOH 73  5074 78   HOH HOH A . 
H 6 HOH 74  5075 79   HOH HOH A . 
H 6 HOH 75  5076 80   HOH HOH A . 
H 6 HOH 76  5077 81   HOH HOH A . 
H 6 HOH 77  5078 82   HOH HOH A . 
H 6 HOH 78  5079 83   HOH HOH A . 
H 6 HOH 79  5080 84   HOH HOH A . 
H 6 HOH 80  5081 85   HOH HOH A . 
H 6 HOH 81  5082 86   HOH HOH A . 
H 6 HOH 82  5083 87   HOH HOH A . 
H 6 HOH 83  5084 88   HOH HOH A . 
H 6 HOH 84  5085 89   HOH HOH A . 
H 6 HOH 85  5086 90   HOH HOH A . 
H 6 HOH 86  5087 92   HOH HOH A . 
H 6 HOH 87  5088 93   HOH HOH A . 
H 6 HOH 88  5089 94   HOH HOH A . 
H 6 HOH 89  5090 95   HOH HOH A . 
H 6 HOH 90  5091 96   HOH HOH A . 
H 6 HOH 91  5092 97   HOH HOH A . 
H 6 HOH 92  5093 98   HOH HOH A . 
H 6 HOH 93  5094 99   HOH HOH A . 
H 6 HOH 94  5095 100  HOH HOH A . 
H 6 HOH 95  5096 101  HOH HOH A . 
H 6 HOH 96  5097 102  HOH HOH A . 
H 6 HOH 97  5098 103  HOH HOH A . 
H 6 HOH 98  5099 104  HOH HOH A . 
H 6 HOH 99  5100 106  HOH HOH A . 
H 6 HOH 100 5101 108  HOH HOH A . 
H 6 HOH 101 5102 109  HOH HOH A . 
H 6 HOH 102 5103 110  HOH HOH A . 
H 6 HOH 103 5104 111  HOH HOH A . 
H 6 HOH 104 5105 113  HOH HOH A . 
H 6 HOH 105 5106 114  HOH HOH A . 
H 6 HOH 106 5107 115  HOH HOH A . 
H 6 HOH 107 5108 116  HOH HOH A . 
H 6 HOH 108 5109 117  HOH HOH A . 
H 6 HOH 109 5110 119  HOH HOH A . 
H 6 HOH 110 5111 121  HOH HOH A . 
H 6 HOH 111 5112 122  HOH HOH A . 
H 6 HOH 112 5113 123  HOH HOH A . 
H 6 HOH 113 5114 124  HOH HOH A . 
H 6 HOH 114 5115 125  HOH HOH A . 
H 6 HOH 115 5116 126  HOH HOH A . 
H 6 HOH 116 5117 127  HOH HOH A . 
H 6 HOH 117 5118 128  HOH HOH A . 
H 6 HOH 118 5119 129  HOH HOH A . 
H 6 HOH 119 5120 130  HOH HOH A . 
H 6 HOH 120 5121 132  HOH HOH A . 
H 6 HOH 121 5122 133  HOH HOH A . 
H 6 HOH 122 5123 134  HOH HOH A . 
H 6 HOH 123 5124 135  HOH HOH A . 
H 6 HOH 124 5125 136  HOH HOH A . 
H 6 HOH 125 5126 137  HOH HOH A . 
H 6 HOH 126 5127 138  HOH HOH A . 
H 6 HOH 127 5128 139  HOH HOH A . 
H 6 HOH 128 5129 140  HOH HOH A . 
H 6 HOH 129 5130 141  HOH HOH A . 
H 6 HOH 130 5131 142  HOH HOH A . 
H 6 HOH 131 5132 144  HOH HOH A . 
H 6 HOH 132 5133 145  HOH HOH A . 
H 6 HOH 133 5134 146  HOH HOH A . 
H 6 HOH 134 5135 147  HOH HOH A . 
H 6 HOH 135 5136 149  HOH HOH A . 
H 6 HOH 136 5137 150  HOH HOH A . 
H 6 HOH 137 5138 151  HOH HOH A . 
H 6 HOH 138 5139 153  HOH HOH A . 
H 6 HOH 139 5140 156  HOH HOH A . 
H 6 HOH 140 5141 157  HOH HOH A . 
H 6 HOH 141 5142 158  HOH HOH A . 
H 6 HOH 142 5143 159  HOH HOH A . 
H 6 HOH 143 5144 160  HOH HOH A . 
H 6 HOH 144 5145 161  HOH HOH A . 
H 6 HOH 145 5146 162  HOH HOH A . 
H 6 HOH 146 5147 164  HOH HOH A . 
H 6 HOH 147 5148 165  HOH HOH A . 
H 6 HOH 148 5149 167  HOH HOH A . 
H 6 HOH 149 5150 168  HOH HOH A . 
H 6 HOH 150 5151 169  HOH HOH A . 
H 6 HOH 151 5152 170  HOH HOH A . 
H 6 HOH 152 5153 173  HOH HOH A . 
H 6 HOH 153 5154 174  HOH HOH A . 
H 6 HOH 154 5155 175  HOH HOH A . 
H 6 HOH 155 5156 177  HOH HOH A . 
H 6 HOH 156 5157 180  HOH HOH A . 
H 6 HOH 157 5158 181  HOH HOH A . 
H 6 HOH 158 5159 182  HOH HOH A . 
H 6 HOH 159 5160 184  HOH HOH A . 
H 6 HOH 160 5161 186  HOH HOH A . 
H 6 HOH 161 5162 187  HOH HOH A . 
H 6 HOH 162 5163 188  HOH HOH A . 
H 6 HOH 163 5164 189  HOH HOH A . 
H 6 HOH 164 5165 192  HOH HOH A . 
H 6 HOH 165 5166 194  HOH HOH A . 
H 6 HOH 166 5167 195  HOH HOH A . 
H 6 HOH 167 5168 197  HOH HOH A . 
H 6 HOH 168 5169 199  HOH HOH A . 
H 6 HOH 169 5170 200  HOH HOH A . 
H 6 HOH 170 5171 202  HOH HOH A . 
H 6 HOH 171 5172 203  HOH HOH A . 
H 6 HOH 172 5173 205  HOH HOH A . 
H 6 HOH 173 5174 206  HOH HOH A . 
H 6 HOH 174 5175 210  HOH HOH A . 
H 6 HOH 175 5176 212  HOH HOH A . 
H 6 HOH 176 5177 213  HOH HOH A . 
H 6 HOH 177 5178 215  HOH HOH A . 
H 6 HOH 178 5179 216  HOH HOH A . 
H 6 HOH 179 5180 217  HOH HOH A . 
H 6 HOH 180 5181 218  HOH HOH A . 
H 6 HOH 181 5182 219  HOH HOH A . 
H 6 HOH 182 5183 220  HOH HOH A . 
H 6 HOH 183 5184 221  HOH HOH A . 
H 6 HOH 184 5185 222  HOH HOH A . 
H 6 HOH 185 5186 223  HOH HOH A . 
H 6 HOH 186 5187 224  HOH HOH A . 
H 6 HOH 187 5188 225  HOH HOH A . 
H 6 HOH 188 5189 226  HOH HOH A . 
H 6 HOH 189 5190 227  HOH HOH A . 
H 6 HOH 190 5191 228  HOH HOH A . 
H 6 HOH 191 5192 229  HOH HOH A . 
H 6 HOH 192 5193 230  HOH HOH A . 
H 6 HOH 193 5194 231  HOH HOH A . 
H 6 HOH 194 5195 232  HOH HOH A . 
H 6 HOH 195 5196 233  HOH HOH A . 
H 6 HOH 196 5197 234  HOH HOH A . 
H 6 HOH 197 5198 235  HOH HOH A . 
H 6 HOH 198 5199 236  HOH HOH A . 
H 6 HOH 199 5200 237  HOH HOH A . 
H 6 HOH 200 5201 238  HOH HOH A . 
H 6 HOH 201 5202 239  HOH HOH A . 
H 6 HOH 202 5203 240  HOH HOH A . 
H 6 HOH 203 5204 241  HOH HOH A . 
H 6 HOH 204 5205 245  HOH HOH A . 
H 6 HOH 205 5206 246  HOH HOH A . 
H 6 HOH 206 5207 247  HOH HOH A . 
H 6 HOH 207 5208 248  HOH HOH A . 
H 6 HOH 208 5209 249  HOH HOH A . 
H 6 HOH 209 5210 250  HOH HOH A . 
H 6 HOH 210 5211 251  HOH HOH A . 
H 6 HOH 211 5212 254  HOH HOH A . 
H 6 HOH 212 5213 255  HOH HOH A . 
H 6 HOH 213 5214 256  HOH HOH A . 
H 6 HOH 214 5215 257  HOH HOH A . 
H 6 HOH 215 5216 258  HOH HOH A . 
H 6 HOH 216 5217 259  HOH HOH A . 
H 6 HOH 217 5218 260  HOH HOH A . 
H 6 HOH 218 5219 261  HOH HOH A . 
H 6 HOH 219 5220 262  HOH HOH A . 
H 6 HOH 220 5221 263  HOH HOH A . 
H 6 HOH 221 5222 264  HOH HOH A . 
H 6 HOH 222 5223 265  HOH HOH A . 
H 6 HOH 223 5224 266  HOH HOH A . 
H 6 HOH 224 5225 267  HOH HOH A . 
H 6 HOH 225 5226 268  HOH HOH A . 
H 6 HOH 226 5227 271  HOH HOH A . 
H 6 HOH 227 5228 272  HOH HOH A . 
H 6 HOH 228 5229 273  HOH HOH A . 
H 6 HOH 229 5230 274  HOH HOH A . 
H 6 HOH 230 5231 276  HOH HOH A . 
H 6 HOH 231 5232 277  HOH HOH A . 
H 6 HOH 232 5233 278  HOH HOH A . 
H 6 HOH 233 5234 279  HOH HOH A . 
H 6 HOH 234 5235 280  HOH HOH A . 
H 6 HOH 235 5236 281  HOH HOH A . 
H 6 HOH 236 5237 282  HOH HOH A . 
H 6 HOH 237 5238 283  HOH HOH A . 
H 6 HOH 238 5239 284  HOH HOH A . 
H 6 HOH 239 5240 285  HOH HOH A . 
H 6 HOH 240 5241 286  HOH HOH A . 
H 6 HOH 241 5242 288  HOH HOH A . 
H 6 HOH 242 5243 289  HOH HOH A . 
H 6 HOH 243 5244 290  HOH HOH A . 
H 6 HOH 244 5245 291  HOH HOH A . 
H 6 HOH 245 5246 292  HOH HOH A . 
H 6 HOH 246 5247 293  HOH HOH A . 
H 6 HOH 247 5248 294  HOH HOH A . 
H 6 HOH 248 5249 296  HOH HOH A . 
H 6 HOH 249 5250 297  HOH HOH A . 
H 6 HOH 250 5251 298  HOH HOH A . 
H 6 HOH 251 5252 299  HOH HOH A . 
H 6 HOH 252 5253 300  HOH HOH A . 
H 6 HOH 253 5254 301  HOH HOH A . 
H 6 HOH 254 5255 302  HOH HOH A . 
H 6 HOH 255 5256 303  HOH HOH A . 
H 6 HOH 256 5257 304  HOH HOH A . 
H 6 HOH 257 5258 306  HOH HOH A . 
H 6 HOH 258 5259 307  HOH HOH A . 
H 6 HOH 259 5260 309  HOH HOH A . 
H 6 HOH 260 5261 312  HOH HOH A . 
H 6 HOH 261 5262 313  HOH HOH A . 
H 6 HOH 262 5263 315  HOH HOH A . 
H 6 HOH 263 5264 316  HOH HOH A . 
H 6 HOH 264 5265 317  HOH HOH A . 
H 6 HOH 265 5266 318  HOH HOH A . 
H 6 HOH 266 5267 319  HOH HOH A . 
H 6 HOH 267 5268 320  HOH HOH A . 
H 6 HOH 268 5269 321  HOH HOH A . 
H 6 HOH 269 5270 322  HOH HOH A . 
H 6 HOH 270 5271 324  HOH HOH A . 
H 6 HOH 271 5272 326  HOH HOH A . 
H 6 HOH 272 5273 327  HOH HOH A . 
H 6 HOH 273 5274 328  HOH HOH A . 
H 6 HOH 274 5275 329  HOH HOH A . 
H 6 HOH 275 5276 330  HOH HOH A . 
H 6 HOH 276 5277 332  HOH HOH A . 
H 6 HOH 277 5278 333  HOH HOH A . 
H 6 HOH 278 5279 334  HOH HOH A . 
H 6 HOH 279 5280 336  HOH HOH A . 
H 6 HOH 280 5281 337  HOH HOH A . 
H 6 HOH 281 5282 338  HOH HOH A . 
H 6 HOH 282 5283 340  HOH HOH A . 
H 6 HOH 283 5284 342  HOH HOH A . 
H 6 HOH 284 5285 343  HOH HOH A . 
H 6 HOH 285 5286 344  HOH HOH A . 
H 6 HOH 286 5287 345  HOH HOH A . 
H 6 HOH 287 5288 346  HOH HOH A . 
H 6 HOH 288 5289 347  HOH HOH A . 
H 6 HOH 289 5290 348  HOH HOH A . 
H 6 HOH 290 5291 349  HOH HOH A . 
H 6 HOH 291 5292 350  HOH HOH A . 
H 6 HOH 292 5293 352  HOH HOH A . 
H 6 HOH 293 5294 353  HOH HOH A . 
H 6 HOH 294 5295 354  HOH HOH A . 
H 6 HOH 295 5296 356  HOH HOH A . 
H 6 HOH 296 5297 357  HOH HOH A . 
H 6 HOH 297 5298 358  HOH HOH A . 
H 6 HOH 298 5299 363  HOH HOH A . 
H 6 HOH 299 5300 364  HOH HOH A . 
H 6 HOH 300 5301 365  HOH HOH A . 
H 6 HOH 301 5302 366  HOH HOH A . 
H 6 HOH 302 5303 367  HOH HOH A . 
H 6 HOH 303 5304 368  HOH HOH A . 
H 6 HOH 304 5305 369  HOH HOH A . 
H 6 HOH 305 5306 371  HOH HOH A . 
H 6 HOH 306 5307 373  HOH HOH A . 
H 6 HOH 307 5308 374  HOH HOH A . 
H 6 HOH 308 5309 377  HOH HOH A . 
H 6 HOH 309 5310 378  HOH HOH A . 
H 6 HOH 310 5311 380  HOH HOH A . 
H 6 HOH 311 5312 381  HOH HOH A . 
H 6 HOH 312 5313 382  HOH HOH A . 
H 6 HOH 313 5314 383  HOH HOH A . 
H 6 HOH 314 5315 385  HOH HOH A . 
H 6 HOH 315 5316 386  HOH HOH A . 
H 6 HOH 316 5317 387  HOH HOH A . 
H 6 HOH 317 5318 388  HOH HOH A . 
H 6 HOH 318 5319 389  HOH HOH A . 
H 6 HOH 319 5320 390  HOH HOH A . 
H 6 HOH 320 5321 391  HOH HOH A . 
H 6 HOH 321 5322 393  HOH HOH A . 
H 6 HOH 322 5323 395  HOH HOH A . 
H 6 HOH 323 5324 396  HOH HOH A . 
H 6 HOH 324 5325 397  HOH HOH A . 
#