data_1XDM
# 
_entry.id   1XDM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1XDM         
RCSB  RCSB030241   
WWPDB D_1000030241 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1XDL 
_pdbx_database_related.details        'Same protein crystallized at 277K' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1XDM 
_pdbx_database_status.recvd_initial_deposition_date   2004-09-07 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Malay, A.D.' 1 
'Allen, K.N.' 2 
'Tolan, D.R.' 3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structure of the thermolabile mutant aldolase B, A149P: molecular basis of hereditary fructose intolerance.' J.Mol.Biol. 
347 135 144 2005 JMOBAK UK 0022-2836 0070 ? 15733923 10.1016/j.jmb.2005.01.008 
1       
;The temperature dependence of activity and structure for the most prevalent mutant aldolase B associated with hereditary fructose intolerance
;
Arch.Biochem.Biophys. 408 295 304 2002 ABBIA4 US 0003-9861 0158 ? ?        ?                         
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Malay, A.D.'    1 
primary 'Allen, K.N.'    2 
primary 'Tolan, D.R.'    3 
1       'Malay, A.D.'    4 
1       'Procious, S.L.' 5 
1       'Tolan, D.R.'    6 
# 
_cell.entry_id           1XDM 
_cell.length_a           153.421 
_cell.length_b           153.475 
_cell.length_c           185.553 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              32 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1XDM 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Fructose-bisphosphate aldolase B' 39558.938 8  4.1.2.13 A149P ? ? 
2 non-polymer syn 'SULFATE ION'                      96.063    8  ?        ?     ? ? 
3 water       nat water                              18.015    35 ?        ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Liver-type aldolase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSAHRFPALTQEQKKELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFREILFSVDSSINQSIGGVIL
FHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRPVLRIADQCP
SSLAIQENANALARYASICQQNGLVPIVEPEVIPDGDHDLEHCQYVTEKVLAAVYKALNDHHVYLEGTLLKPNMVTAGHA
CTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAA
NKEATQEAFMKRAMANCQAAKGQYVHTGSSGAASTQSLFTACYTY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSAHRFPALTQEQKKELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFREILFSVDSSINQSIGGVIL
FHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRPVLRIADQCP
SSLAIQENANALARYASICQQNGLVPIVEPEVIPDGDHDLEHCQYVTEKVLAAVYKALNDHHVYLEGTLLKPNMVTAGHA
CTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAA
NKEATQEAFMKRAMANCQAAKGQYVHTGSSGAASTQSLFTACYTY
;
_entity_poly.pdbx_strand_id                 A,B,C,D,W,X,Y,Z 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   ALA n 
1 4   HIS n 
1 5   ARG n 
1 6   PHE n 
1 7   PRO n 
1 8   ALA n 
1 9   LEU n 
1 10  THR n 
1 11  GLN n 
1 12  GLU n 
1 13  GLN n 
1 14  LYS n 
1 15  LYS n 
1 16  GLU n 
1 17  LEU n 
1 18  SER n 
1 19  GLU n 
1 20  ILE n 
1 21  ALA n 
1 22  GLN n 
1 23  SER n 
1 24  ILE n 
1 25  VAL n 
1 26  ALA n 
1 27  ASN n 
1 28  GLY n 
1 29  LYS n 
1 30  GLY n 
1 31  ILE n 
1 32  LEU n 
1 33  ALA n 
1 34  ALA n 
1 35  ASP n 
1 36  GLU n 
1 37  SER n 
1 38  VAL n 
1 39  GLY n 
1 40  THR n 
1 41  MET n 
1 42  GLY n 
1 43  ASN n 
1 44  ARG n 
1 45  LEU n 
1 46  GLN n 
1 47  ARG n 
1 48  ILE n 
1 49  LYS n 
1 50  VAL n 
1 51  GLU n 
1 52  ASN n 
1 53  THR n 
1 54  GLU n 
1 55  GLU n 
1 56  ASN n 
1 57  ARG n 
1 58  ARG n 
1 59  GLN n 
1 60  PHE n 
1 61  ARG n 
1 62  GLU n 
1 63  ILE n 
1 64  LEU n 
1 65  PHE n 
1 66  SER n 
1 67  VAL n 
1 68  ASP n 
1 69  SER n 
1 70  SER n 
1 71  ILE n 
1 72  ASN n 
1 73  GLN n 
1 74  SER n 
1 75  ILE n 
1 76  GLY n 
1 77  GLY n 
1 78  VAL n 
1 79  ILE n 
1 80  LEU n 
1 81  PHE n 
1 82  HIS n 
1 83  GLU n 
1 84  THR n 
1 85  LEU n 
1 86  TYR n 
1 87  GLN n 
1 88  LYS n 
1 89  ASP n 
1 90  SER n 
1 91  GLN n 
1 92  GLY n 
1 93  LYS n 
1 94  LEU n 
1 95  PHE n 
1 96  ARG n 
1 97  ASN n 
1 98  ILE n 
1 99  LEU n 
1 100 LYS n 
1 101 GLU n 
1 102 LYS n 
1 103 GLY n 
1 104 ILE n 
1 105 VAL n 
1 106 VAL n 
1 107 GLY n 
1 108 ILE n 
1 109 LYS n 
1 110 LEU n 
1 111 ASP n 
1 112 GLN n 
1 113 GLY n 
1 114 GLY n 
1 115 ALA n 
1 116 PRO n 
1 117 LEU n 
1 118 ALA n 
1 119 GLY n 
1 120 THR n 
1 121 ASN n 
1 122 LYS n 
1 123 GLU n 
1 124 THR n 
1 125 THR n 
1 126 ILE n 
1 127 GLN n 
1 128 GLY n 
1 129 LEU n 
1 130 ASP n 
1 131 GLY n 
1 132 LEU n 
1 133 SER n 
1 134 GLU n 
1 135 ARG n 
1 136 CYS n 
1 137 ALA n 
1 138 GLN n 
1 139 TYR n 
1 140 LYS n 
1 141 LYS n 
1 142 ASP n 
1 143 GLY n 
1 144 VAL n 
1 145 ASP n 
1 146 PHE n 
1 147 GLY n 
1 148 LYS n 
1 149 TRP n 
1 150 ARG n 
1 151 PRO n 
1 152 VAL n 
1 153 LEU n 
1 154 ARG n 
1 155 ILE n 
1 156 ALA n 
1 157 ASP n 
1 158 GLN n 
1 159 CYS n 
1 160 PRO n 
1 161 SER n 
1 162 SER n 
1 163 LEU n 
1 164 ALA n 
1 165 ILE n 
1 166 GLN n 
1 167 GLU n 
1 168 ASN n 
1 169 ALA n 
1 170 ASN n 
1 171 ALA n 
1 172 LEU n 
1 173 ALA n 
1 174 ARG n 
1 175 TYR n 
1 176 ALA n 
1 177 SER n 
1 178 ILE n 
1 179 CYS n 
1 180 GLN n 
1 181 GLN n 
1 182 ASN n 
1 183 GLY n 
1 184 LEU n 
1 185 VAL n 
1 186 PRO n 
1 187 ILE n 
1 188 VAL n 
1 189 GLU n 
1 190 PRO n 
1 191 GLU n 
1 192 VAL n 
1 193 ILE n 
1 194 PRO n 
1 195 ASP n 
1 196 GLY n 
1 197 ASP n 
1 198 HIS n 
1 199 ASP n 
1 200 LEU n 
1 201 GLU n 
1 202 HIS n 
1 203 CYS n 
1 204 GLN n 
1 205 TYR n 
1 206 VAL n 
1 207 THR n 
1 208 GLU n 
1 209 LYS n 
1 210 VAL n 
1 211 LEU n 
1 212 ALA n 
1 213 ALA n 
1 214 VAL n 
1 215 TYR n 
1 216 LYS n 
1 217 ALA n 
1 218 LEU n 
1 219 ASN n 
1 220 ASP n 
1 221 HIS n 
1 222 HIS n 
1 223 VAL n 
1 224 TYR n 
1 225 LEU n 
1 226 GLU n 
1 227 GLY n 
1 228 THR n 
1 229 LEU n 
1 230 LEU n 
1 231 LYS n 
1 232 PRO n 
1 233 ASN n 
1 234 MET n 
1 235 VAL n 
1 236 THR n 
1 237 ALA n 
1 238 GLY n 
1 239 HIS n 
1 240 ALA n 
1 241 CYS n 
1 242 THR n 
1 243 LYS n 
1 244 LYS n 
1 245 TYR n 
1 246 THR n 
1 247 PRO n 
1 248 GLU n 
1 249 GLN n 
1 250 VAL n 
1 251 ALA n 
1 252 MET n 
1 253 ALA n 
1 254 THR n 
1 255 VAL n 
1 256 THR n 
1 257 ALA n 
1 258 LEU n 
1 259 HIS n 
1 260 ARG n 
1 261 THR n 
1 262 VAL n 
1 263 PRO n 
1 264 ALA n 
1 265 ALA n 
1 266 VAL n 
1 267 PRO n 
1 268 GLY n 
1 269 ILE n 
1 270 CYS n 
1 271 PHE n 
1 272 LEU n 
1 273 SER n 
1 274 GLY n 
1 275 GLY n 
1 276 MET n 
1 277 SER n 
1 278 GLU n 
1 279 GLU n 
1 280 ASP n 
1 281 ALA n 
1 282 THR n 
1 283 LEU n 
1 284 ASN n 
1 285 LEU n 
1 286 ASN n 
1 287 ALA n 
1 288 ILE n 
1 289 ASN n 
1 290 LEU n 
1 291 CYS n 
1 292 PRO n 
1 293 LEU n 
1 294 PRO n 
1 295 LYS n 
1 296 PRO n 
1 297 TRP n 
1 298 LYS n 
1 299 LEU n 
1 300 SER n 
1 301 PHE n 
1 302 SER n 
1 303 TYR n 
1 304 GLY n 
1 305 ARG n 
1 306 ALA n 
1 307 LEU n 
1 308 GLN n 
1 309 ALA n 
1 310 SER n 
1 311 ALA n 
1 312 LEU n 
1 313 ALA n 
1 314 ALA n 
1 315 TRP n 
1 316 GLY n 
1 317 GLY n 
1 318 LYS n 
1 319 ALA n 
1 320 ALA n 
1 321 ASN n 
1 322 LYS n 
1 323 GLU n 
1 324 ALA n 
1 325 THR n 
1 326 GLN n 
1 327 GLU n 
1 328 ALA n 
1 329 PHE n 
1 330 MET n 
1 331 LYS n 
1 332 ARG n 
1 333 ALA n 
1 334 MET n 
1 335 ALA n 
1 336 ASN n 
1 337 CYS n 
1 338 GLN n 
1 339 ALA n 
1 340 ALA n 
1 341 LYS n 
1 342 GLY n 
1 343 GLN n 
1 344 TYR n 
1 345 VAL n 
1 346 HIS n 
1 347 THR n 
1 348 GLY n 
1 349 SER n 
1 350 SER n 
1 351 GLY n 
1 352 ALA n 
1 353 ALA n 
1 354 SER n 
1 355 THR n 
1 356 GLN n 
1 357 SER n 
1 358 LEU n 
1 359 PHE n 
1 360 THR n 
1 361 ALA n 
1 362 CYS n 
1 363 TYR n 
1 364 THR n 
1 365 TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'ALDOB, ALDB' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               DH5-alpha 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX-AP 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ALDOB_HUMAN 
_struct_ref.pdbx_db_accession          P05062 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AHRFPALTQEQKKELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFREILFSVDSSINQSIGGVILFH
ETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSS
LAIQENANALARYASICQQNGLVPIVEPEVIPDGDHDLEHCQYVTEKVLAAVYKALNDHHVYLEGTLLKPNMVTAGHACT
KKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAANK
EATQEAFMKRAMANCQAAKGQYVHTGSSGAASTQSLFTACYTY
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1XDM A 3 ? 365 ? P05062 1 ? 363 ? 1 363 
2 1 1XDM B 3 ? 365 ? P05062 1 ? 363 ? 1 363 
3 1 1XDM C 3 ? 365 ? P05062 1 ? 363 ? 1 363 
4 1 1XDM D 3 ? 365 ? P05062 1 ? 363 ? 1 363 
5 1 1XDM W 3 ? 365 ? P05062 1 ? 363 ? 1 363 
6 1 1XDM X 3 ? 365 ? P05062 1 ? 363 ? 1 363 
7 1 1XDM Y 3 ? 365 ? P05062 1 ? 363 ? 1 363 
8 1 1XDM Z 3 ? 365 ? P05062 1 ? 363 ? 1 363 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1XDM GLY A 1   ? UNP P05062 ?   ?   'CLONING ARTIFACT' -1  1  
1 1XDM SER A 2   ? UNP P05062 ?   ?   'CLONING ARTIFACT' 0   2  
1 1XDM PRO A 151 ? UNP P05062 ALA 149 ENGINEERED         149 3  
2 1XDM GLY B 1   ? UNP P05062 ?   ?   'CLONING ARTIFACT' -1  4  
2 1XDM SER B 2   ? UNP P05062 ?   ?   'CLONING ARTIFACT' 0   5  
2 1XDM PRO B 151 ? UNP P05062 ALA 149 ENGINEERED         149 6  
3 1XDM GLY C 1   ? UNP P05062 ?   ?   'CLONING ARTIFACT' -1  7  
3 1XDM SER C 2   ? UNP P05062 ?   ?   'CLONING ARTIFACT' 0   8  
3 1XDM PRO C 151 ? UNP P05062 ALA 149 ENGINEERED         149 9  
4 1XDM GLY D 1   ? UNP P05062 ?   ?   'CLONING ARTIFACT' -1  10 
4 1XDM SER D 2   ? UNP P05062 ?   ?   'CLONING ARTIFACT' 0   11 
4 1XDM PRO D 151 ? UNP P05062 ALA 149 ENGINEERED         149 12 
5 1XDM GLY W 1   ? UNP P05062 ?   ?   'CLONING ARTIFACT' -1  13 
5 1XDM SER W 2   ? UNP P05062 ?   ?   'CLONING ARTIFACT' 0   14 
5 1XDM PRO W 151 ? UNP P05062 ALA 149 ENGINEERED         149 15 
6 1XDM GLY X 1   ? UNP P05062 ?   ?   'CLONING ARTIFACT' -1  16 
6 1XDM SER X 2   ? UNP P05062 ?   ?   'CLONING ARTIFACT' 0   17 
6 1XDM PRO X 151 ? UNP P05062 ALA 149 ENGINEERED         149 18 
7 1XDM GLY Y 1   ? UNP P05062 ?   ?   'CLONING ARTIFACT' -1  19 
7 1XDM SER Y 2   ? UNP P05062 ?   ?   'CLONING ARTIFACT' 0   20 
7 1XDM PRO Y 151 ? UNP P05062 ALA 149 ENGINEERED         149 21 
8 1XDM GLY Z 1   ? UNP P05062 ?   ?   'CLONING ARTIFACT' -1  22 
8 1XDM SER Z 2   ? UNP P05062 ?   ?   'CLONING ARTIFACT' 0   23 
8 1XDM PRO Z 151 ? UNP P05062 ALA 149 ENGINEERED         149 24 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1XDM 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.4 
_exptl_crystal.density_percent_sol   63.7 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.4 
_exptl_crystal_grow.pdbx_details    'ammonium sulfate, 1,8-diaminooctane, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           93 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2003-01-13 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU300' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1XDM 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             100 
_reflns.d_resolution_high            3.0 
_reflns.number_obs                   83595 
_reflns.number_all                   87953 
_reflns.percent_possible_obs         95.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.067 
_reflns.pdbx_netI_over_sigmaI        12.1 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.00 
_reflns_shell.d_res_low              3.11 
_reflns_shell.percent_possible_all   88.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.364 
_reflns_shell.meanI_over_sigI_obs    2.1 
_reflns_shell.pdbx_redundancy        2.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      7680 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1XDM 
_refine.ls_number_reflns_obs                     79141 
_refine.ls_number_reflns_all                     83595 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               295432.84 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             79.40 
_refine.ls_d_res_high                            3.00 
_refine.ls_percent_reflns_obs                    89.8 
_refine.ls_R_factor_obs                          0.276 
_refine.ls_R_factor_all                          0.288 
_refine.ls_R_factor_R_work                       0.271 
_refine.ls_R_factor_R_free                       0.319 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  7920 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               60.3 
_refine.aniso_B[1][1]                            16.20 
_refine.aniso_B[2][2]                            12.39 
_refine.aniso_B[3][3]                            -28.59 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.294477 
_refine.solvent_model_param_bsol                 13.4177 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'used ncs restraints between monomers' 
_refine.pdbx_starting_model                      'PDB entry 1QO5' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             GROUP 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1XDM 
_refine_analyze.Luzzati_coordinate_error_obs    0.44 
_refine_analyze.Luzzati_sigma_a_obs             1.02 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.52 
_refine_analyze.Luzzati_sigma_a_free            1.15 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        18475 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         40 
_refine_hist.number_atoms_solvent             35 
_refine_hist.number_atoms_total               18550 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        79.40 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.4   ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      21.4  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.93  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       3.00 
_refine_ls_shell.d_res_low                        3.11 
_refine_ls_shell.number_reflns_R_work             5370 
_refine_ls_shell.R_factor_R_work                  0.437 
_refine_ls_shell.percent_reflns_obs               69.2 
_refine_ls_shell.R_factor_R_free                  0.448 
_refine_ls_shell.R_factor_R_free_error            0.018 
_refine_ls_shell.percent_reflns_R_free            10.8 
_refine_ls_shell.number_reflns_R_free             650 
_refine_ls_shell.number_reflns_obs                7735 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   ?           'X-RAY DIFFRACTION' 
3 ION.PARAM         ?           'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1XDM 
_struct.title                     'Structure of human aldolase B associated with hereditary fructose intolerance (A149P), at 291K' 
_struct.pdbx_descriptor           'Fructose-bisphosphate aldolase B (E.C.4.1.2.13)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1XDM 
_struct_keywords.pdbx_keywords   LYASE 
_struct_keywords.text            'ALPHA/BETA BARREL, LYASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 1 ? 
H N N 1 ? 
I N N 2 ? 
J N N 2 ? 
K N N 2 ? 
L N N 2 ? 
M N N 2 ? 
N N N 2 ? 
O N N 2 ? 
P N N 2 ? 
Q N N 3 ? 
R N N 3 ? 
S N N 3 ? 
T N N 3 ? 
U N N 3 ? 
V N N 3 ? 
W N N 3 ? 
X N N 3 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 
;The biological unit of AP-aldolase is a dimer, corresponding to monomer pairs AB, CD, WX, and YZ. The wild-type enzyme is tetrameric.
;
? 
2 ? ? 
3 ? ? 
4 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   THR A 10  ? ILE A 24  ? THR A 8   ILE A 22  1 ? 15 
HELX_P HELX_P2   2   SER A 37  ? ILE A 48  ? SER A 35  ILE A 46  1 ? 12 
HELX_P HELX_P3   3   THR A 53  ? VAL A 67  ? THR A 51  VAL A 65  1 ? 15 
HELX_P HELX_P4   4   ASP A 68  ? GLN A 73  ? ASP A 66  GLN A 71  5 ? 6  
HELX_P HELX_P5   5   HIS A 82  ? TYR A 86  ? HIS A 80  TYR A 84  5 ? 5  
HELX_P HELX_P6   6   PHE A 95  ? LYS A 102 ? PHE A 93  LYS A 100 1 ? 8  
HELX_P HELX_P7   7   GLY A 131 ? ASP A 142 ? GLY A 129 ASP A 140 1 ? 12 
HELX_P HELX_P8   8   SER A 161 ? GLN A 180 ? SER A 159 GLN A 178 1 ? 20 
HELX_P HELX_P9   9   GLN A 181 ? GLY A 183 ? GLN A 179 GLY A 181 5 ? 3  
HELX_P HELX_P10  10  ASP A 199 ? HIS A 221 ? ASP A 197 HIS A 219 1 ? 23 
HELX_P HELX_P11  11  THR A 246 ? ARG A 260 ? THR A 244 ARG A 258 1 ? 15 
HELX_P HELX_P12  12  GLU A 279 ? ASN A 289 ? GLU A 277 ASN A 287 1 ? 11 
HELX_P HELX_P13  13  GLY A 304 ? ALA A 314 ? GLY A 302 ALA A 312 1 ? 11 
HELX_P HELX_P14  14  ASN A 321 ? ALA A 340 ? ASN A 319 ALA A 338 1 ? 20 
HELX_P HELX_P15  15  THR B 10  ? VAL B 25  ? THR B 8   VAL B 23  1 ? 16 
HELX_P HELX_P16  16  SER B 37  ? ILE B 48  ? SER B 35  ILE B 46  1 ? 12 
HELX_P HELX_P17  17  THR B 53  ? VAL B 67  ? THR B 51  VAL B 65  1 ? 15 
HELX_P HELX_P18  18  ASP B 68  ? GLN B 73  ? ASP B 66  GLN B 71  5 ? 6  
HELX_P HELX_P19  19  HIS B 82  ? GLN B 87  ? HIS B 80  GLN B 85  5 ? 6  
HELX_P HELX_P20  20  LEU B 94  ? LYS B 102 ? LEU B 92  LYS B 100 1 ? 9  
HELX_P HELX_P21  21  GLY B 131 ? ASP B 142 ? GLY B 129 ASP B 140 1 ? 12 
HELX_P HELX_P22  22  SER B 161 ? ASN B 182 ? SER B 159 ASN B 180 1 ? 22 
HELX_P HELX_P23  23  ASP B 199 ? HIS B 221 ? ASP B 197 HIS B 219 1 ? 23 
HELX_P HELX_P24  24  TYR B 224 ? THR B 228 ? TYR B 222 THR B 226 5 ? 5  
HELX_P HELX_P25  25  THR B 246 ? VAL B 262 ? THR B 244 VAL B 260 1 ? 17 
HELX_P HELX_P26  26  SER B 277 ? CYS B 291 ? SER B 275 CYS B 289 1 ? 15 
HELX_P HELX_P27  27  GLY B 304 ? ALA B 314 ? GLY B 302 ALA B 312 1 ? 11 
HELX_P HELX_P28  28  LYS B 318 ? ALA B 320 ? LYS B 316 ALA B 318 5 ? 3  
HELX_P HELX_P29  29  ASN B 321 ? LYS B 341 ? ASN B 319 LYS B 339 1 ? 21 
HELX_P HELX_P30  30  THR C 10  ? VAL C 25  ? THR C 8   VAL C 23  1 ? 16 
HELX_P HELX_P31  31  SER C 37  ? ILE C 48  ? SER C 35  ILE C 46  1 ? 12 
HELX_P HELX_P32  32  GLU C 55  ? VAL C 67  ? GLU C 53  VAL C 65  1 ? 13 
HELX_P HELX_P33  33  ASP C 68  ? GLN C 73  ? ASP C 66  GLN C 71  5 ? 6  
HELX_P HELX_P34  34  GLU C 83  ? GLN C 87  ? GLU C 81  GLN C 85  5 ? 5  
HELX_P HELX_P35  35  LEU C 94  ? LYS C 102 ? LEU C 92  LYS C 100 1 ? 9  
HELX_P HELX_P36  36  LEU C 132 ? GLY C 143 ? LEU C 130 GLY C 141 1 ? 12 
HELX_P HELX_P37  37  SER C 161 ? GLY C 183 ? SER C 159 GLY C 181 1 ? 23 
HELX_P HELX_P38  38  ASP C 199 ? HIS C 221 ? ASP C 197 HIS C 219 1 ? 23 
HELX_P HELX_P39  39  TYR C 224 ? THR C 228 ? TYR C 222 THR C 226 5 ? 5  
HELX_P HELX_P40  40  THR C 246 ? VAL C 262 ? THR C 244 VAL C 260 1 ? 17 
HELX_P HELX_P41  41  GLU C 279 ? LEU C 290 ? GLU C 277 LEU C 288 1 ? 12 
HELX_P HELX_P42  42  GLY C 304 ? ALA C 314 ? GLY C 302 ALA C 312 1 ? 11 
HELX_P HELX_P43  43  ASN C 321 ? GLY C 342 ? ASN C 319 GLY C 340 1 ? 22 
HELX_P HELX_P44  44  THR D 10  ? SER D 23  ? THR D 8   SER D 21  1 ? 14 
HELX_P HELX_P45  45  SER D 37  ? ILE D 48  ? SER D 35  ILE D 46  1 ? 12 
HELX_P HELX_P46  46  THR D 53  ? SER D 66  ? THR D 51  SER D 64  1 ? 14 
HELX_P HELX_P47  47  SER D 70  ? SER D 74  ? SER D 68  SER D 72  1 ? 5  
HELX_P HELX_P48  48  GLU D 83  ? GLN D 87  ? GLU D 81  GLN D 85  5 ? 5  
HELX_P HELX_P49  49  LEU D 94  ? LYS D 102 ? LEU D 92  LYS D 100 1 ? 9  
HELX_P HELX_P50  50  GLY D 131 ? ASP D 142 ? GLY D 129 ASP D 140 1 ? 12 
HELX_P HELX_P51  51  LEU D 163 ? ASN D 182 ? LEU D 161 ASN D 180 1 ? 20 
HELX_P HELX_P52  52  ASP D 199 ? HIS D 221 ? ASP D 197 HIS D 219 1 ? 23 
HELX_P HELX_P53  53  TYR D 224 ? THR D 228 ? TYR D 222 THR D 226 5 ? 5  
HELX_P HELX_P54  54  THR D 246 ? VAL D 262 ? THR D 244 VAL D 260 1 ? 17 
HELX_P HELX_P55  55  SER D 277 ? CYS D 291 ? SER D 275 CYS D 289 1 ? 15 
HELX_P HELX_P56  56  GLY D 304 ? ALA D 314 ? GLY D 302 ALA D 312 1 ? 11 
HELX_P HELX_P57  57  LYS D 318 ? ALA D 320 ? LYS D 316 ALA D 318 5 ? 3  
HELX_P HELX_P58  58  ASN D 321 ? GLY D 342 ? ASN D 319 GLY D 340 1 ? 22 
HELX_P HELX_P59  59  THR E 10  ? SER E 23  ? THR W 8   SER W 21  1 ? 14 
HELX_P HELX_P60  60  SER E 37  ? ILE E 48  ? SER W 35  ILE W 46  1 ? 12 
HELX_P HELX_P61  61  THR E 53  ? SER E 66  ? THR W 51  SER W 64  1 ? 14 
HELX_P HELX_P62  62  SER E 70  ? SER E 74  ? SER W 68  SER W 72  1 ? 5  
HELX_P HELX_P63  63  GLU E 83  ? GLN E 87  ? GLU W 81  GLN W 85  5 ? 5  
HELX_P HELX_P64  64  LEU E 94  ? LYS E 102 ? LEU W 92  LYS W 100 1 ? 9  
HELX_P HELX_P65  65  GLY E 131 ? ASP E 142 ? GLY W 129 ASP W 140 1 ? 12 
HELX_P HELX_P66  66  LEU E 163 ? ASN E 182 ? LEU W 161 ASN W 180 1 ? 20 
HELX_P HELX_P67  67  ASP E 199 ? HIS E 221 ? ASP W 197 HIS W 219 1 ? 23 
HELX_P HELX_P68  68  TYR E 224 ? THR E 228 ? TYR W 222 THR W 226 5 ? 5  
HELX_P HELX_P69  69  THR E 246 ? VAL E 262 ? THR W 244 VAL W 260 1 ? 17 
HELX_P HELX_P70  70  SER E 277 ? CYS E 291 ? SER W 275 CYS W 289 1 ? 15 
HELX_P HELX_P71  71  GLY E 304 ? ALA E 314 ? GLY W 302 ALA W 312 1 ? 11 
HELX_P HELX_P72  72  LYS E 318 ? ALA E 320 ? LYS W 316 ALA W 318 5 ? 3  
HELX_P HELX_P73  73  ASN E 321 ? GLY E 342 ? ASN W 319 GLY W 340 1 ? 22 
HELX_P HELX_P74  74  THR F 10  ? VAL F 25  ? THR X 8   VAL X 23  1 ? 16 
HELX_P HELX_P75  75  SER F 37  ? ILE F 48  ? SER X 35  ILE X 46  1 ? 12 
HELX_P HELX_P76  76  GLU F 55  ? VAL F 67  ? GLU X 53  VAL X 65  1 ? 13 
HELX_P HELX_P77  77  ASP F 68  ? GLN F 73  ? ASP X 66  GLN X 71  5 ? 6  
HELX_P HELX_P78  78  GLU F 83  ? GLN F 87  ? GLU X 81  GLN X 85  5 ? 5  
HELX_P HELX_P79  79  LEU F 94  ? LYS F 102 ? LEU X 92  LYS X 100 1 ? 9  
HELX_P HELX_P80  80  LEU F 132 ? GLY F 143 ? LEU X 130 GLY X 141 1 ? 12 
HELX_P HELX_P81  81  LEU F 163 ? GLY F 183 ? LEU X 161 GLY X 181 1 ? 21 
HELX_P HELX_P82  82  ASP F 199 ? HIS F 221 ? ASP X 197 HIS X 219 1 ? 23 
HELX_P HELX_P83  83  TYR F 224 ? THR F 228 ? TYR X 222 THR X 226 5 ? 5  
HELX_P HELX_P84  84  THR F 246 ? VAL F 262 ? THR X 244 VAL X 260 1 ? 17 
HELX_P HELX_P85  85  SER F 277 ? LEU F 290 ? SER X 275 LEU X 288 1 ? 14 
HELX_P HELX_P86  86  GLY F 304 ? ALA F 314 ? GLY X 302 ALA X 312 1 ? 11 
HELX_P HELX_P87  87  ASN F 321 ? GLY F 342 ? ASN X 319 GLY X 340 1 ? 22 
HELX_P HELX_P88  88  THR G 10  ? VAL G 25  ? THR Y 8   VAL Y 23  1 ? 16 
HELX_P HELX_P89  89  SER G 37  ? ILE G 48  ? SER Y 35  ILE Y 46  1 ? 12 
HELX_P HELX_P90  90  THR G 53  ? VAL G 67  ? THR Y 51  VAL Y 65  1 ? 15 
HELX_P HELX_P91  91  ASP G 68  ? GLN G 73  ? ASP Y 66  GLN Y 71  5 ? 6  
HELX_P HELX_P92  92  HIS G 82  ? GLN G 87  ? HIS Y 80  GLN Y 85  5 ? 6  
HELX_P HELX_P93  93  LEU G 94  ? LYS G 102 ? LEU Y 92  LYS Y 100 1 ? 9  
HELX_P HELX_P94  94  GLY G 131 ? ASP G 142 ? GLY Y 129 ASP Y 140 1 ? 12 
HELX_P HELX_P95  95  SER G 161 ? ASN G 182 ? SER Y 159 ASN Y 180 1 ? 22 
HELX_P HELX_P96  96  ASP G 199 ? HIS G 221 ? ASP Y 197 HIS Y 219 1 ? 23 
HELX_P HELX_P97  97  TYR G 224 ? THR G 228 ? TYR Y 222 THR Y 226 5 ? 5  
HELX_P HELX_P98  98  THR G 246 ? VAL G 262 ? THR Y 244 VAL Y 260 1 ? 17 
HELX_P HELX_P99  99  SER G 277 ? CYS G 291 ? SER Y 275 CYS Y 289 1 ? 15 
HELX_P HELX_P100 100 GLY G 304 ? ALA G 314 ? GLY Y 302 ALA Y 312 1 ? 11 
HELX_P HELX_P101 101 LYS G 318 ? ALA G 320 ? LYS Y 316 ALA Y 318 5 ? 3  
HELX_P HELX_P102 102 ASN G 321 ? LYS G 341 ? ASN Y 319 LYS Y 339 1 ? 21 
HELX_P HELX_P103 103 THR H 10  ? ILE H 24  ? THR Z 8   ILE Z 22  1 ? 15 
HELX_P HELX_P104 104 SER H 37  ? ILE H 48  ? SER Z 35  ILE Z 46  1 ? 12 
HELX_P HELX_P105 105 THR H 53  ? VAL H 67  ? THR Z 51  VAL Z 65  1 ? 15 
HELX_P HELX_P106 106 ASP H 68  ? GLN H 73  ? ASP Z 66  GLN Z 71  5 ? 6  
HELX_P HELX_P107 107 HIS H 82  ? TYR H 86  ? HIS Z 80  TYR Z 84  5 ? 5  
HELX_P HELX_P108 108 PHE H 95  ? LYS H 102 ? PHE Z 93  LYS Z 100 1 ? 8  
HELX_P HELX_P109 109 GLY H 131 ? ASP H 142 ? GLY Z 129 ASP Z 140 1 ? 12 
HELX_P HELX_P110 110 SER H 161 ? GLN H 180 ? SER Z 159 GLN Z 178 1 ? 20 
HELX_P HELX_P111 111 GLN H 181 ? GLY H 183 ? GLN Z 179 GLY Z 181 5 ? 3  
HELX_P HELX_P112 112 ASP H 199 ? HIS H 221 ? ASP Z 197 HIS Z 219 1 ? 23 
HELX_P HELX_P113 113 THR H 246 ? ARG H 260 ? THR Z 244 ARG Z 258 1 ? 15 
HELX_P HELX_P114 114 GLU H 279 ? ASN H 289 ? GLU Z 277 ASN Z 287 1 ? 11 
HELX_P HELX_P115 115 GLY H 304 ? ALA H 314 ? GLY Z 302 ALA Z 312 1 ? 11 
HELX_P HELX_P116 116 ASN H 321 ? ALA H 340 ? ASN Z 319 ALA Z 338 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 2 ? 
C ? 9 ? 
D ? 6 ? 
E ? 6 ? 
F ? 2 ? 
G ? 6 ? 
H ? 2 ? 
I ? 5 ? 
J ? 9 ? 
K ? 5 ? 
L ? 2 ? 
M ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? parallel      
C 7 8 ? parallel      
C 8 9 ? parallel      
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
E 1 2 ? parallel      
E 2 3 ? parallel      
E 3 4 ? parallel      
E 4 5 ? parallel      
E 5 6 ? parallel      
F 1 2 ? parallel      
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? parallel      
H 1 2 ? parallel      
I 1 2 ? parallel      
I 2 3 ? parallel      
I 3 4 ? parallel      
I 4 5 ? parallel      
J 1 2 ? parallel      
J 2 3 ? parallel      
J 3 4 ? parallel      
J 4 5 ? parallel      
J 5 6 ? parallel      
J 6 7 ? parallel      
J 7 8 ? parallel      
J 8 9 ? parallel      
K 1 2 ? parallel      
K 2 3 ? parallel      
K 3 4 ? parallel      
K 4 5 ? parallel      
L 1 2 ? anti-parallel 
M 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 229 ? LEU A 230 ? LEU A 227 LEU A 228 
A 2 ILE A 187 ? VAL A 188 ? ILE A 185 VAL A 186 
A 3 PHE A 146 ? TRP A 149 ? PHE A 144 TRP A 147 
A 4 VAL A 106 ? LYS A 109 ? VAL A 104 LYS A 107 
A 5 ILE A 75  ? LEU A 80  ? ILE A 73  LEU A 78  
A 6 GLY A 30  ? ALA A 33  ? GLY A 28  ALA A 31  
A 7 SER A 302 ? TYR A 303 ? SER A 300 TYR A 301 
B 1 LYS A 88  ? ASP A 89  ? LYS A 86  ASP A 87  
B 2 LYS A 93  ? LEU A 94  ? LYS A 91  LEU A 92  
C 1 GLY B 30  ? ALA B 34  ? GLY B 28  ALA B 32  
C 2 ILE B 75  ? LEU B 80  ? ILE B 73  LEU B 78  
C 3 VAL B 105 ? LYS B 109 ? VAL B 103 LYS B 107 
C 4 VAL B 144 ? TRP B 149 ? VAL B 142 TRP B 147 
C 5 ILE B 187 ? VAL B 188 ? ILE B 185 VAL B 186 
C 6 LEU B 229 ? LEU B 230 ? LEU B 227 LEU B 228 
C 7 GLY B 268 ? PHE B 271 ? GLY B 266 PHE B 269 
C 8 LYS B 298 ? TYR B 303 ? LYS B 296 TYR B 301 
C 9 GLY B 30  ? ALA B 34  ? GLY B 28  ALA B 32  
D 1 VAL C 185 ? PRO C 186 ? VAL C 183 PRO C 184 
D 2 PHE C 146 ? LYS C 148 ? PHE C 144 LYS C 146 
D 3 VAL C 106 ? LYS C 109 ? VAL C 104 LYS C 107 
D 4 ILE C 75  ? LEU C 80  ? ILE C 73  LEU C 78  
D 5 GLY C 30  ? ALA C 34  ? GLY C 28  ALA C 32  
D 6 SER C 302 ? TYR C 303 ? SER C 300 TYR C 301 
E 1 GLY D 30  ? ALA D 33  ? GLY D 28  ALA D 31  
E 2 ILE D 75  ? LEU D 80  ? ILE D 73  LEU D 78  
E 3 VAL D 105 ? LYS D 109 ? VAL D 103 LYS D 107 
E 4 PHE D 146 ? TRP D 149 ? PHE D 144 TRP D 147 
E 5 VAL D 185 ? VAL D 188 ? VAL D 183 VAL D 186 
E 6 LEU D 229 ? LEU D 230 ? LEU D 227 LEU D 228 
F 1 GLY D 268 ? PHE D 271 ? GLY D 266 PHE D 269 
F 2 LYS D 298 ? PHE D 301 ? LYS D 296 PHE D 299 
G 1 GLY E 30  ? ALA E 33  ? GLY W 28  ALA W 31  
G 2 ILE E 75  ? LEU E 80  ? ILE W 73  LEU W 78  
G 3 VAL E 105 ? LYS E 109 ? VAL W 103 LYS W 107 
G 4 PHE E 146 ? LYS E 148 ? PHE W 144 LYS W 146 
G 5 VAL E 185 ? VAL E 188 ? VAL W 183 VAL W 186 
G 6 LEU E 229 ? LEU E 230 ? LEU W 227 LEU W 228 
H 1 GLY E 268 ? PHE E 271 ? GLY W 266 PHE W 269 
H 2 LYS E 298 ? PHE E 301 ? LYS W 296 PHE W 299 
I 1 PHE F 146 ? LYS F 148 ? PHE X 144 LYS X 146 
I 2 VAL F 106 ? LYS F 109 ? VAL X 104 LYS X 107 
I 3 ILE F 75  ? LEU F 80  ? ILE X 73  LEU X 78  
I 4 GLY F 30  ? ALA F 34  ? GLY X 28  ALA X 32  
I 5 SER F 302 ? TYR F 303 ? SER X 300 TYR X 301 
J 1 GLY G 30  ? ALA G 34  ? GLY Y 28  ALA Y 32  
J 2 ILE G 75  ? LEU G 80  ? ILE Y 73  LEU Y 78  
J 3 VAL G 105 ? LYS G 109 ? VAL Y 103 LYS Y 107 
J 4 VAL G 144 ? TRP G 149 ? VAL Y 142 TRP Y 147 
J 5 VAL G 185 ? VAL G 188 ? VAL Y 183 VAL Y 186 
J 6 LEU G 229 ? LEU G 230 ? LEU Y 227 LEU Y 228 
J 7 GLY G 268 ? PHE G 271 ? GLY Y 266 PHE Y 269 
J 8 LYS G 298 ? TYR G 303 ? LYS Y 296 TYR Y 301 
J 9 GLY G 30  ? ALA G 34  ? GLY Y 28  ALA Y 32  
K 1 PHE H 146 ? LYS H 148 ? PHE Z 144 LYS Z 146 
K 2 VAL H 105 ? LYS H 109 ? VAL Z 103 LYS Z 107 
K 3 ILE H 75  ? LEU H 80  ? ILE Z 73  LEU Z 78  
K 4 GLY H 30  ? ALA H 33  ? GLY Z 28  ALA Z 31  
K 5 SER H 302 ? TYR H 303 ? SER Z 300 TYR Z 301 
L 1 LYS H 88  ? ASP H 89  ? LYS Z 86  ASP Z 87  
L 2 LYS H 93  ? LEU H 94  ? LYS Z 91  LEU Z 92  
M 1 ILE H 187 ? VAL H 188 ? ILE Z 185 VAL Z 186 
M 2 LEU H 229 ? LEU H 230 ? LEU Z 227 LEU Z 228 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 229 ? O LEU A 227 N VAL A 188 ? N VAL A 186 
A 2 3 O ILE A 187 ? O ILE A 185 N GLY A 147 ? N GLY A 145 
A 3 4 O PHE A 146 ? O PHE A 144 N ILE A 108 ? N ILE A 106 
A 4 5 O LYS A 109 ? O LYS A 107 N LEU A 80  ? N LEU A 78  
A 5 6 O GLY A 76  ? O GLY A 74  N GLY A 30  ? N GLY A 28  
A 6 7 N ALA A 33  ? N ALA A 31  O TYR A 303 ? O TYR A 301 
B 1 2 N ASP A 89  ? N ASP A 87  O LYS A 93  ? O LYS A 91  
C 1 2 N LEU B 32  ? N LEU B 30  O ILE B 79  ? O ILE B 77  
C 2 3 N VAL B 78  ? N VAL B 76  O GLY B 107 ? O GLY B 105 
C 3 4 N VAL B 106 ? N VAL B 104 O ASP B 145 ? O ASP B 143 
C 4 5 N GLY B 147 ? N GLY B 145 O ILE B 187 ? O ILE B 185 
C 5 6 O VAL B 188 ? O VAL B 186 N LEU B 229 ? N LEU B 227 
C 6 7 N LEU B 230 ? N LEU B 228 O CYS B 270 ? O CYS B 268 
C 7 8 N ILE B 269 ? N ILE B 267 O LYS B 298 ? O LYS B 296 
C 8 9 O PHE B 301 ? O PHE B 299 N ILE B 31  ? N ILE B 29  
D 1 2 O VAL C 185 ? O VAL C 183 N GLY C 147 ? N GLY C 145 
D 2 3 O PHE C 146 ? O PHE C 144 N ILE C 108 ? N ILE C 106 
D 3 4 O GLY C 107 ? O GLY C 105 N LEU C 80  ? N LEU C 78  
D 4 5 O ILE C 79  ? O ILE C 77  N LEU C 32  ? N LEU C 30  
D 5 6 N ALA C 33  ? N ALA C 31  O TYR C 303 ? O TYR C 301 
E 1 2 N GLY D 30  ? N GLY D 28  O GLY D 76  ? O GLY D 74  
E 2 3 N VAL D 78  ? N VAL D 76  O GLY D 107 ? O GLY D 105 
E 3 4 N ILE D 108 ? N ILE D 106 O PHE D 146 ? O PHE D 144 
E 4 5 N GLY D 147 ? N GLY D 145 O ILE D 187 ? O ILE D 185 
E 5 6 N VAL D 188 ? N VAL D 186 O LEU D 229 ? O LEU D 227 
F 1 2 N ILE D 269 ? N ILE D 267 O LYS D 298 ? O LYS D 296 
G 1 2 N GLY E 30  ? N GLY W 28  O GLY E 76  ? O GLY W 74  
G 2 3 N VAL E 78  ? N VAL W 76  O GLY E 107 ? O GLY W 105 
G 3 4 N ILE E 108 ? N ILE W 106 O PHE E 146 ? O PHE W 144 
G 4 5 N GLY E 147 ? N GLY W 145 O ILE E 187 ? O ILE W 185 
G 5 6 N PRO E 186 ? N PRO W 184 O LEU E 229 ? O LEU W 227 
H 1 2 N ILE E 269 ? N ILE W 267 O LYS E 298 ? O LYS W 296 
I 1 2 O PHE F 146 ? O PHE X 144 N ILE F 108 ? N ILE X 106 
I 2 3 O GLY F 107 ? O GLY X 105 N LEU F 80  ? N LEU X 78  
I 3 4 O ILE F 79  ? O ILE X 77  N LEU F 32  ? N LEU X 30  
I 4 5 N ALA F 33  ? N ALA X 31  O TYR F 303 ? O TYR X 301 
J 1 2 N LEU G 32  ? N LEU Y 30  O ILE G 79  ? O ILE Y 77  
J 2 3 N VAL G 78  ? N VAL Y 76  O GLY G 107 ? O GLY Y 105 
J 3 4 N VAL G 106 ? N VAL Y 104 O ASP G 145 ? O ASP Y 143 
J 4 5 N GLY G 147 ? N GLY Y 145 O ILE G 187 ? O ILE Y 185 
J 5 6 O VAL G 188 ? O VAL Y 186 N LEU G 229 ? N LEU Y 227 
J 6 7 N LEU G 230 ? N LEU Y 228 O CYS G 270 ? O CYS Y 268 
J 7 8 N ILE G 269 ? N ILE Y 267 O LYS G 298 ? O LYS Y 296 
J 8 9 O PHE G 301 ? O PHE Y 299 N ILE G 31  ? N ILE Y 29  
K 1 2 O PHE H 146 ? O PHE Z 144 N ILE H 108 ? N ILE Z 106 
K 2 3 O VAL H 105 ? O VAL Z 103 N VAL H 78  ? N VAL Z 76  
K 3 4 O GLY H 76  ? O GLY Z 74  N GLY H 30  ? N GLY Z 28  
K 4 5 N ALA H 33  ? N ALA Z 31  O TYR H 303 ? O TYR Z 301 
L 1 2 N ASP H 89  ? N ASP Z 87  O LYS H 93  ? O LYS Z 91  
M 1 2 N VAL H 188 ? N VAL Z 186 O LEU H 229 ? O LEU Z 227 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 W 364' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 B 364' 
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 X 364' 
AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 Y 364' 
AC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 C 364' 
AC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 364' 
AC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 C 365' 
AC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 Z 364' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 GLN E 204 ? GLN W 202 . ? 1_555 ? 
2  AC1 5 THR E 256 ? THR W 254 . ? 1_555 ? 
3  AC1 5 ARG E 260 ? ARG W 258 . ? 1_555 ? 
4  AC1 5 GLN F 11  ? GLN X 9   . ? 1_555 ? 
5  AC1 5 LYS F 14  ? LYS X 12  . ? 1_555 ? 
6  AC2 4 LYS A 14  ? LYS A 12  . ? 1_555 ? 
7  AC2 4 GLN B 204 ? GLN B 202 . ? 1_555 ? 
8  AC2 4 THR B 256 ? THR B 254 . ? 1_555 ? 
9  AC2 4 ARG B 260 ? ARG B 258 . ? 1_555 ? 
10 AC3 3 LYS E 14  ? LYS W 12  . ? 1_555 ? 
11 AC3 3 GLN F 204 ? GLN X 202 . ? 1_555 ? 
12 AC3 3 ARG F 260 ? ARG X 258 . ? 1_555 ? 
13 AC4 3 GLN G 204 ? GLN Y 202 . ? 1_555 ? 
14 AC4 3 ARG G 260 ? ARG Y 258 . ? 1_555 ? 
15 AC4 3 LYS H 14  ? LYS Z 12  . ? 1_555 ? 
16 AC5 3 GLN C 204 ? GLN C 202 . ? 1_555 ? 
17 AC5 3 ARG C 260 ? ARG C 258 . ? 1_555 ? 
18 AC5 3 LYS D 14  ? LYS D 12  . ? 1_555 ? 
19 AC6 6 GLN A 204 ? GLN A 202 . ? 1_555 ? 
20 AC6 6 THR A 256 ? THR A 254 . ? 1_555 ? 
21 AC6 6 ARG A 260 ? ARG A 258 . ? 1_555 ? 
22 AC6 6 HOH Q .   ? HOH A 368 . ? 1_555 ? 
23 AC6 6 GLN B 11  ? GLN B 9   . ? 1_555 ? 
24 AC6 6 LYS B 14  ? LYS B 12  . ? 1_555 ? 
25 AC7 6 GLN C 11  ? GLN C 9   . ? 1_555 ? 
26 AC7 6 LYS C 14  ? LYS C 12  . ? 1_555 ? 
27 AC7 6 HOH S .   ? HOH C 368 . ? 1_555 ? 
28 AC7 6 GLN D 204 ? GLN D 202 . ? 1_555 ? 
29 AC7 6 THR D 256 ? THR D 254 . ? 1_555 ? 
30 AC7 6 ARG D 260 ? ARG D 258 . ? 1_555 ? 
31 AC8 5 GLN G 11  ? GLN Y 9   . ? 1_555 ? 
32 AC8 5 LYS G 14  ? LYS Y 12  . ? 1_555 ? 
33 AC8 5 GLN H 204 ? GLN Z 202 . ? 1_555 ? 
34 AC8 5 ARG H 260 ? ARG Z 258 . ? 1_555 ? 
35 AC8 5 HOH X .   ? HOH Z 367 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1XDM 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1XDM 
_atom_sites.fract_transf_matrix[1][1]   0.006518 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006516 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005389 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . PRO A 1 7   ? 62.348  23.057  106.315 1.00 92.42 ? 5   PRO A N   1 
ATOM   2     C CA  . PRO A 1 7   ? 61.089  22.567  106.947 1.00 92.42 ? 5   PRO A CA  1 
ATOM   3     C C   . PRO A 1 7   ? 59.862  23.344  106.440 1.00 92.42 ? 5   PRO A C   1 
ATOM   4     O O   . PRO A 1 7   ? 59.186  24.008  107.223 1.00 92.42 ? 5   PRO A O   1 
ATOM   5     C CB  . PRO A 1 7   ? 61.252  22.754  108.454 1.00 75.37 ? 5   PRO A CB  1 
ATOM   6     C CG  . PRO A 1 7   ? 62.796  22.820  108.604 1.00 75.37 ? 5   PRO A CG  1 
ATOM   7     C CD  . PRO A 1 7   ? 63.288  23.540  107.346 1.00 75.37 ? 5   PRO A CD  1 
ATOM   8     N N   . ALA A 1 8   ? 59.564  23.242  105.144 1.00 61.76 ? 6   ALA A N   1 
ATOM   9     C CA  . ALA A 1 8   ? 58.444  23.976  104.543 1.00 56.37 ? 6   ALA A CA  1 
ATOM   10    C C   . ALA A 1 8   ? 57.089  23.873  105.244 1.00 59.15 ? 6   ALA A C   1 
ATOM   11    O O   . ALA A 1 8   ? 56.678  22.802  105.692 1.00 64.73 ? 6   ALA A O   1 
ATOM   12    C CB  . ALA A 1 8   ? 58.293  23.595  103.072 1.00 10.22 ? 6   ALA A CB  1 
ATOM   13    N N   . LEU A 1 9   ? 56.405  25.017  105.315 1.00 81.25 ? 7   LEU A N   1 
ATOM   14    C CA  . LEU A 1 9   ? 55.092  25.144  105.947 1.00 81.33 ? 7   LEU A CA  1 
ATOM   15    C C   . LEU A 1 9   ? 54.075  24.168  105.399 1.00 81.33 ? 7   LEU A C   1 
ATOM   16    O O   . LEU A 1 9   ? 54.153  23.757  104.245 1.00 81.33 ? 7   LEU A O   1 
ATOM   17    C CB  . LEU A 1 9   ? 54.526  26.550  105.739 1.00 12.28 ? 7   LEU A CB  1 
ATOM   18    C CG  . LEU A 1 9   ? 55.289  27.730  106.325 1.00 15.73 ? 7   LEU A CG  1 
ATOM   19    C CD1 . LEU A 1 9   ? 54.833  29.024  105.684 1.00 24.44 ? 7   LEU A CD1 1 
ATOM   20    C CD2 . LEU A 1 9   ? 55.078  27.777  107.819 1.00 13.69 ? 7   LEU A CD2 1 
ATOM   21    N N   . THR A 1 10  ? 53.113  23.811  106.242 1.00 92.42 ? 8   THR A N   1 
ATOM   22    C CA  . THR A 1 10  ? 52.029  22.920  105.847 1.00 92.42 ? 8   THR A CA  1 
ATOM   23    C C   . THR A 1 10  ? 50.799  23.818  105.714 1.00 92.42 ? 8   THR A C   1 
ATOM   24    O O   . THR A 1 10  ? 50.733  24.889  106.329 1.00 92.42 ? 8   THR A O   1 
ATOM   25    C CB  . THR A 1 10  ? 51.766  21.815  106.904 1.00 57.35 ? 8   THR A CB  1 
ATOM   26    O OG1 . THR A 1 10  ? 51.706  22.399  108.215 1.00 57.84 ? 8   THR A OG1 1 
ATOM   27    C CG2 . THR A 1 10  ? 52.863  20.759  106.854 1.00 42.76 ? 8   THR A CG2 1 
ATOM   28    N N   . GLN A 1 11  ? 49.833  23.396  104.910 1.00 72.15 ? 9   GLN A N   1 
ATOM   29    C CA  . GLN A 1 11  ? 48.646  24.203  104.709 1.00 72.15 ? 9   GLN A CA  1 
ATOM   30    C C   . GLN A 1 11  ? 48.141  24.800  106.017 1.00 72.15 ? 9   GLN A C   1 
ATOM   31    O O   . GLN A 1 11  ? 47.718  25.955  106.055 1.00 72.15 ? 9   GLN A O   1 
ATOM   32    C CB  . GLN A 1 11  ? 47.542  23.371  104.053 1.00 92.42 ? 9   GLN A CB  1 
ATOM   33    C CG  . GLN A 1 11  ? 46.268  24.168  103.771 1.00 92.42 ? 9   GLN A CG  1 
ATOM   34    C CD  . GLN A 1 11  ? 46.503  25.362  102.840 1.00 92.42 ? 9   GLN A CD  1 
ATOM   35    O OE1 . GLN A 1 11  ? 45.674  26.279  102.760 1.00 92.42 ? 9   GLN A OE1 1 
ATOM   36    N NE2 . GLN A 1 11  ? 47.630  25.347  102.126 1.00 92.42 ? 9   GLN A NE2 1 
ATOM   37    N N   . GLU A 1 12  ? 48.211  24.014  107.088 1.00 59.02 ? 10  GLU A N   1 
ATOM   38    C CA  . GLU A 1 12  ? 47.735  24.431  108.407 1.00 59.02 ? 10  GLU A CA  1 
ATOM   39    C C   . GLU A 1 12  ? 48.458  25.643  108.980 1.00 59.02 ? 10  GLU A C   1 
ATOM   40    O O   . GLU A 1 12  ? 47.824  26.558  109.532 1.00 59.02 ? 10  GLU A O   1 
ATOM   41    C CB  . GLU A 1 12  ? 47.838  23.264  109.382 1.00 92.42 ? 10  GLU A CB  1 
ATOM   42    C CG  . GLU A 1 12  ? 47.125  23.498  110.694 1.00 92.42 ? 10  GLU A CG  1 
ATOM   43    C CD  . GLU A 1 12  ? 46.971  22.221  111.502 1.00 92.42 ? 10  GLU A CD  1 
ATOM   44    O OE1 . GLU A 1 12  ? 48.002  21.604  111.852 1.00 92.42 ? 10  GLU A OE1 1 
ATOM   45    O OE2 . GLU A 1 12  ? 45.814  21.832  111.782 1.00 92.42 ? 10  GLU A OE2 1 
ATOM   46    N N   . GLN A 1 13  ? 49.784  25.642  108.860 1.00 58.12 ? 11  GLN A N   1 
ATOM   47    C CA  . GLN A 1 13  ? 50.598  26.749  109.350 1.00 58.12 ? 11  GLN A CA  1 
ATOM   48    C C   . GLN A 1 13  ? 50.194  28.043  108.614 1.00 58.12 ? 11  GLN A C   1 
ATOM   49    O O   . GLN A 1 13  ? 50.120  29.131  109.204 1.00 58.12 ? 11  GLN A O   1 
ATOM   50    C CB  . GLN A 1 13  ? 52.079  26.424  109.124 1.00 68.94 ? 11  GLN A CB  1 
ATOM   51    C CG  . GLN A 1 13  ? 52.557  25.179  109.864 1.00 68.94 ? 11  GLN A CG  1 
ATOM   52    C CD  . GLN A 1 13  ? 54.043  24.895  109.660 1.00 68.94 ? 11  GLN A CD  1 
ATOM   53    O OE1 . GLN A 1 13  ? 54.457  24.419  108.605 1.00 68.94 ? 11  GLN A OE1 1 
ATOM   54    N NE2 . GLN A 1 13  ? 54.849  25.196  110.673 1.00 68.94 ? 11  GLN A NE2 1 
ATOM   55    N N   . LYS A 1 14  ? 49.917  27.904  107.321 1.00 57.49 ? 12  LYS A N   1 
ATOM   56    C CA  . LYS A 1 14  ? 49.503  29.027  106.497 1.00 57.49 ? 12  LYS A CA  1 
ATOM   57    C C   . LYS A 1 14  ? 48.181  29.551  107.047 1.00 57.49 ? 12  LYS A C   1 
ATOM   58    O O   . LYS A 1 14  ? 48.049  30.737  107.356 1.00 57.49 ? 12  LYS A O   1 
ATOM   59    C CB  . LYS A 1 14  ? 49.339  28.570  105.043 1.00 58.71 ? 12  LYS A CB  1 
ATOM   60    C CG  . LYS A 1 14  ? 50.630  28.027  104.432 1.00 58.71 ? 12  LYS A CG  1 
ATOM   61    C CD  . LYS A 1 14  ? 50.419  27.308  103.092 1.00 58.71 ? 12  LYS A CD  1 
ATOM   62    C CE  . LYS A 1 14  ? 51.742  26.746  102.551 1.00 58.71 ? 12  LYS A CE  1 
ATOM   63    N NZ  . LYS A 1 14  ? 51.587  25.894  101.343 1.00 58.71 ? 12  LYS A NZ  1 
ATOM   64    N N   . LYS A 1 15  ? 47.207  28.656  107.177 1.00 56.41 ? 13  LYS A N   1 
ATOM   65    C CA  . LYS A 1 15  ? 45.902  29.038  107.700 1.00 56.41 ? 13  LYS A CA  1 
ATOM   66    C C   . LYS A 1 15  ? 46.117  29.963  108.877 1.00 56.41 ? 13  LYS A C   1 
ATOM   67    O O   . LYS A 1 15  ? 45.632  31.099  108.878 1.00 56.41 ? 13  LYS A O   1 
ATOM   68    C CB  . LYS A 1 15  ? 45.115  27.808  108.161 1.00 68.12 ? 13  LYS A CB  1 
ATOM   69    C CG  . LYS A 1 15  ? 43.794  28.146  108.847 1.00 68.12 ? 13  LYS A CG  1 
ATOM   70    C CD  . LYS A 1 15  ? 43.043  26.888  109.315 1.00 68.12 ? 13  LYS A CD  1 
ATOM   71    C CE  . LYS A 1 15  ? 41.719  27.241  109.998 1.00 68.12 ? 13  LYS A CE  1 
ATOM   72    N NZ  . LYS A 1 15  ? 40.887  26.035  110.218 1.00 68.12 ? 13  LYS A NZ  1 
ATOM   73    N N   . GLU A 1 16  ? 46.868  29.474  109.865 1.00 62.07 ? 14  GLU A N   1 
ATOM   74    C CA  . GLU A 1 16  ? 47.139  30.264  111.057 1.00 62.07 ? 14  GLU A CA  1 
ATOM   75    C C   . GLU A 1 16  ? 47.754  31.619  110.704 1.00 62.07 ? 14  GLU A C   1 
ATOM   76    O O   . GLU A 1 16  ? 47.192  32.676  111.020 1.00 62.07 ? 14  GLU A O   1 
ATOM   77    C CB  . GLU A 1 16  ? 48.058  29.500  112.032 1.00 54.68 ? 14  GLU A CB  1 
ATOM   78    C CG  . GLU A 1 16  ? 48.326  30.280  113.338 1.00 54.68 ? 14  GLU A CG  1 
ATOM   79    C CD  . GLU A 1 16  ? 48.872  29.435  114.491 1.00 54.68 ? 14  GLU A CD  1 
ATOM   80    O OE1 . GLU A 1 16  ? 49.973  28.859  114.354 1.00 54.68 ? 14  GLU A OE1 1 
ATOM   81    O OE2 . GLU A 1 16  ? 48.201  29.356  115.547 1.00 54.68 ? 14  GLU A OE2 1 
ATOM   82    N N   . LEU A 1 17  ? 48.899  31.590  110.031 1.00 41.30 ? 15  LEU A N   1 
ATOM   83    C CA  . LEU A 1 17  ? 49.586  32.824  109.667 1.00 41.30 ? 15  LEU A CA  1 
ATOM   84    C C   . LEU A 1 17  ? 48.655  33.835  108.994 1.00 41.30 ? 15  LEU A C   1 
ATOM   85    O O   . LEU A 1 17  ? 48.556  35.007  109.412 1.00 41.30 ? 15  LEU A O   1 
ATOM   86    C CB  . LEU A 1 17  ? 50.757  32.473  108.756 1.00 33.62 ? 15  LEU A CB  1 
ATOM   87    C CG  . LEU A 1 17  ? 51.754  31.584  109.491 1.00 33.62 ? 15  LEU A CG  1 
ATOM   88    C CD1 . LEU A 1 17  ? 52.389  30.610  108.543 1.00 33.62 ? 15  LEU A CD1 1 
ATOM   89    C CD2 . LEU A 1 17  ? 52.787  32.461  110.173 1.00 33.62 ? 15  LEU A CD2 1 
ATOM   90    N N   . SER A 1 18  ? 47.971  33.347  107.958 1.00 55.42 ? 16  SER A N   1 
ATOM   91    C CA  . SER A 1 18  ? 47.032  34.125  107.157 1.00 55.42 ? 16  SER A CA  1 
ATOM   92    C C   . SER A 1 18  ? 45.962  34.799  108.003 1.00 55.42 ? 16  SER A C   1 
ATOM   93    O O   . SER A 1 18  ? 45.744  36.011  107.890 1.00 55.42 ? 16  SER A O   1 
ATOM   94    C CB  . SER A 1 18  ? 46.369  33.220  106.124 1.00 83.55 ? 16  SER A CB  1 
ATOM   95    O OG  . SER A 1 18  ? 45.469  33.964  105.325 1.00 83.55 ? 16  SER A OG  1 
ATOM   96    N N   . GLU A 1 19  ? 45.294  34.001  108.840 1.00 40.75 ? 17  GLU A N   1 
ATOM   97    C CA  . GLU A 1 19  ? 44.244  34.498  109.726 1.00 40.75 ? 17  GLU A CA  1 
ATOM   98    C C   . GLU A 1 19  ? 44.698  35.732  110.486 1.00 40.75 ? 17  GLU A C   1 
ATOM   99    O O   . GLU A 1 19  ? 43.951  36.711  110.601 1.00 40.75 ? 17  GLU A O   1 
ATOM   100   C CB  . GLU A 1 19  ? 43.871  33.443  110.760 1.00 77.67 ? 17  GLU A CB  1 
ATOM   101   C CG  . GLU A 1 19  ? 43.262  32.175  110.218 1.00 77.67 ? 17  GLU A CG  1 
ATOM   102   C CD  . GLU A 1 19  ? 42.809  31.248  111.339 1.00 77.67 ? 17  GLU A CD  1 
ATOM   103   O OE1 . GLU A 1 19  ? 42.256  31.764  112.339 1.00 77.67 ? 17  GLU A OE1 1 
ATOM   104   O OE2 . GLU A 1 19  ? 42.996  30.015  111.216 1.00 77.67 ? 17  GLU A OE2 1 
ATOM   105   N N   . ILE A 1 20  ? 45.933  35.658  110.994 1.00 34.31 ? 18  ILE A N   1 
ATOM   106   C CA  . ILE A 1 20  ? 46.571  36.702  111.813 1.00 34.31 ? 18  ILE A CA  1 
ATOM   107   C C   . ILE A 1 20  ? 46.949  38.015  111.128 1.00 34.31 ? 18  ILE A C   1 
ATOM   108   O O   . ILE A 1 20  ? 46.593  39.111  111.593 1.00 34.31 ? 18  ILE A O   1 
ATOM   109   C CB  . ILE A 1 20  ? 47.844  36.149  112.471 1.00 13.44 ? 18  ILE A CB  1 
ATOM   110   C CG1 . ILE A 1 20  ? 47.542  34.781  113.092 1.00 13.44 ? 18  ILE A CG1 1 
ATOM   111   C CG2 . ILE A 1 20  ? 48.373  37.156  113.486 1.00 13.44 ? 18  ILE A CG2 1 
ATOM   112   C CD1 . ILE A 1 20  ? 48.700  34.145  113.812 1.00 13.44 ? 18  ILE A CD1 1 
ATOM   113   N N   . ALA A 1 21  ? 47.705  37.881  110.043 1.00 46.35 ? 19  ALA A N   1 
ATOM   114   C CA  . ALA A 1 21  ? 48.162  39.026  109.276 1.00 46.35 ? 19  ALA A CA  1 
ATOM   115   C C   . ALA A 1 21  ? 46.953  39.776  108.770 1.00 46.35 ? 19  ALA A C   1 
ATOM   116   O O   . ALA A 1 21  ? 46.901  41.004  108.782 1.00 46.35 ? 19  ALA A O   1 
ATOM   117   C CB  . ALA A 1 21  ? 49.013  38.555  108.108 1.00 32.35 ? 19  ALA A CB  1 
ATOM   118   N N   . GLN A 1 22  ? 45.979  39.006  108.317 1.00 60.60 ? 20  GLN A N   1 
ATOM   119   C CA  . GLN A 1 22  ? 44.751  39.557  107.791 1.00 60.60 ? 20  GLN A CA  1 
ATOM   120   C C   . GLN A 1 22  ? 43.954  40.230  108.909 1.00 60.60 ? 20  GLN A C   1 
ATOM   121   O O   . GLN A 1 22  ? 43.307  41.255  108.696 1.00 60.60 ? 20  GLN A O   1 
ATOM   122   C CB  . GLN A 1 22  ? 43.928  38.429  107.158 1.00 31.70 ? 20  GLN A CB  1 
ATOM   123   C CG  . GLN A 1 22  ? 43.867  38.434  105.643 1.00 31.70 ? 20  GLN A CG  1 
ATOM   124   C CD  . GLN A 1 22  ? 43.081  37.249  105.098 1.00 31.70 ? 20  GLN A CD  1 
ATOM   125   O OE1 . GLN A 1 22  ? 42.824  37.169  103.898 1.00 31.70 ? 20  GLN A OE1 1 
ATOM   126   N NE2 . GLN A 1 22  ? 42.703  36.318  105.978 1.00 31.70 ? 20  GLN A NE2 1 
ATOM   127   N N   . SER A 1 23  ? 44.010  39.654  110.104 1.00 32.23 ? 21  SER A N   1 
ATOM   128   C CA  . SER A 1 23  ? 43.270  40.194  111.236 1.00 32.23 ? 21  SER A CA  1 
ATOM   129   C C   . SER A 1 23  ? 43.950  41.392  111.935 1.00 32.23 ? 21  SER A C   1 
ATOM   130   O O   . SER A 1 23  ? 43.382  42.018  112.832 1.00 32.23 ? 21  SER A O   1 
ATOM   131   C CB  . SER A 1 23  ? 43.012  39.072  112.231 1.00 25.37 ? 21  SER A CB  1 
ATOM   132   O OG  . SER A 1 23  ? 44.227  38.417  112.503 1.00 25.37 ? 21  SER A OG  1 
ATOM   133   N N   . ILE A 1 24  ? 45.161  41.720  111.522 1.00 49.09 ? 22  ILE A N   1 
ATOM   134   C CA  . ILE A 1 24  ? 45.847  42.851  112.119 1.00 49.09 ? 22  ILE A CA  1 
ATOM   135   C C   . ILE A 1 24  ? 45.478  44.095  111.333 1.00 49.09 ? 22  ILE A C   1 
ATOM   136   O O   . ILE A 1 24  ? 45.969  45.181  111.607 1.00 49.09 ? 22  ILE A O   1 
ATOM   137   C CB  . ILE A 1 24  ? 47.359  42.634  112.080 1.00 30.53 ? 22  ILE A CB  1 
ATOM   138   C CG1 . ILE A 1 24  ? 47.668  41.302  112.767 1.00 30.53 ? 22  ILE A CG1 1 
ATOM   139   C CG2 . ILE A 1 24  ? 48.096  43.812  112.725 1.00 30.53 ? 22  ILE A CG2 1 
ATOM   140   C CD1 . ILE A 1 24  ? 49.116  40.958  112.784 1.00 30.53 ? 22  ILE A CD1 1 
ATOM   141   N N   . VAL A 1 25  ? 44.600  43.921  110.352 1.00 80.94 ? 23  VAL A N   1 
ATOM   142   C CA  . VAL A 1 25  ? 44.143  45.016  109.502 1.00 80.94 ? 23  VAL A CA  1 
ATOM   143   C C   . VAL A 1 25  ? 42.712  44.751  109.035 1.00 80.94 ? 23  VAL A C   1 
ATOM   144   O O   . VAL A 1 25  ? 42.144  45.532  108.280 1.00 80.94 ? 23  VAL A O   1 
ATOM   145   C CB  . VAL A 1 25  ? 45.055  45.179  108.252 1.00 29.40 ? 23  VAL A CB  1 
ATOM   146   C CG1 . VAL A 1 25  ? 46.446  45.634  108.684 1.00 29.40 ? 23  VAL A CG1 1 
ATOM   147   C CG2 . VAL A 1 25  ? 45.144  43.864  107.485 1.00 29.40 ? 23  VAL A CG2 1 
ATOM   148   N N   . ALA A 1 26  ? 42.147  43.645  109.513 1.00 92.42 ? 24  ALA A N   1 
ATOM   149   C CA  . ALA A 1 26  ? 40.798  43.190  109.178 1.00 92.42 ? 24  ALA A CA  1 
ATOM   150   C C   . ALA A 1 26  ? 39.823  44.213  108.593 1.00 92.42 ? 24  ALA A C   1 
ATOM   151   O O   . ALA A 1 26  ? 39.127  43.914  107.613 1.00 92.42 ? 24  ALA A O   1 
ATOM   152   C CB  . ALA A 1 26  ? 40.170  42.518  110.398 1.00 68.43 ? 24  ALA A CB  1 
ATOM   153   N N   . ASN A 1 27  ? 39.758  45.405  109.179 1.00 41.15 ? 25  ASN A N   1 
ATOM   154   C CA  . ASN A 1 27  ? 38.834  46.425  108.679 1.00 41.15 ? 25  ASN A CA  1 
ATOM   155   C C   . ASN A 1 27  ? 39.413  47.818  108.638 1.00 41.15 ? 25  ASN A C   1 
ATOM   156   O O   . ASN A 1 27  ? 38.682  48.797  108.543 1.00 41.15 ? 25  ASN A O   1 
ATOM   157   C CB  . ASN A 1 27  ? 37.570  46.439  109.524 1.00 78.29 ? 25  ASN A CB  1 
ATOM   158   C CG  . ASN A 1 27  ? 36.777  45.170  109.383 1.00 78.29 ? 25  ASN A CG  1 
ATOM   159   O OD1 . ASN A 1 27  ? 36.112  44.747  110.316 1.00 78.29 ? 25  ASN A OD1 1 
ATOM   160   N ND2 . ASN A 1 27  ? 36.838  44.553  108.206 1.00 78.29 ? 25  ASN A ND2 1 
ATOM   161   N N   . GLY A 1 28  ? 40.732  47.900  108.702 1.00 69.14 ? 26  GLY A N   1 
ATOM   162   C CA  . GLY A 1 28  ? 41.392  49.187  108.671 1.00 69.14 ? 26  GLY A CA  1 
ATOM   163   C C   . GLY A 1 28  ? 42.114  49.362  109.976 1.00 69.14 ? 26  GLY A C   1 
ATOM   164   O O   . GLY A 1 28  ? 42.742  50.388  110.214 1.00 69.14 ? 26  GLY A O   1 
ATOM   165   N N   . LYS A 1 29  ? 42.005  48.344  110.825 1.00 82.67 ? 27  LYS A N   1 
ATOM   166   C CA  . LYS A 1 29  ? 42.649  48.357  112.128 1.00 82.67 ? 27  LYS A CA  1 
ATOM   167   C C   . LYS A 1 29  ? 44.168  48.389  111.948 1.00 82.67 ? 27  LYS A C   1 
ATOM   168   O O   . LYS A 1 29  ? 44.758  47.470  111.374 1.00 82.67 ? 27  LYS A O   1 
ATOM   169   C CB  . LYS A 1 29  ? 42.231  47.121  112.940 1.00 35.12 ? 27  LYS A CB  1 
ATOM   170   C CG  . LYS A 1 29  ? 40.782  47.124  113.437 1.00 35.12 ? 27  LYS A CG  1 
ATOM   171   C CD  . LYS A 1 29  ? 40.397  45.779  114.089 1.00 35.12 ? 27  LYS A CD  1 
ATOM   172   C CE  . LYS A 1 29  ? 40.452  44.626  113.059 1.00 35.12 ? 27  LYS A CE  1 
ATOM   173   N NZ  . LYS A 1 29  ? 40.123  43.256  113.588 1.00 35.12 ? 27  LYS A NZ  1 
ATOM   174   N N   . GLY A 1 30  ? 44.786  49.469  112.423 1.00 71.22 ? 28  GLY A N   1 
ATOM   175   C CA  . GLY A 1 30  ? 46.223  49.611  112.316 1.00 71.22 ? 28  GLY A CA  1 
ATOM   176   C C   . GLY A 1 30  ? 46.923  48.914  113.461 1.00 71.22 ? 28  GLY A C   1 
ATOM   177   O O   . GLY A 1 30  ? 46.323  48.111  114.178 1.00 71.22 ? 28  GLY A O   1 
ATOM   178   N N   . ILE A 1 31  ? 48.196  49.226  113.644 1.00 65.34 ? 29  ILE A N   1 
ATOM   179   C CA  . ILE A 1 31  ? 48.976  48.605  114.698 1.00 65.34 ? 29  ILE A CA  1 
ATOM   180   C C   . ILE A 1 31  ? 49.518  49.685  115.623 1.00 65.34 ? 29  ILE A C   1 
ATOM   181   O O   . ILE A 1 31  ? 49.891  50.770  115.173 1.00 65.34 ? 29  ILE A O   1 
ATOM   182   C CB  . ILE A 1 31  ? 50.150  47.785  114.091 1.00 58.39 ? 29  ILE A CB  1 
ATOM   183   C CG1 . ILE A 1 31  ? 49.639  46.983  112.894 1.00 58.39 ? 29  ILE A CG1 1 
ATOM   184   C CG2 . ILE A 1 31  ? 50.720  46.806  115.120 1.00 58.39 ? 29  ILE A CG2 1 
ATOM   185   C CD1 . ILE A 1 31  ? 50.676  46.107  112.259 1.00 58.39 ? 29  ILE A CD1 1 
ATOM   186   N N   . LEU A 1 32  ? 49.538  49.388  116.919 1.00 72.16 ? 30  LEU A N   1 
ATOM   187   C CA  . LEU A 1 32  ? 50.051  50.332  117.902 1.00 72.16 ? 30  LEU A CA  1 
ATOM   188   C C   . LEU A 1 32  ? 51.511  50.025  118.223 1.00 72.16 ? 30  LEU A C   1 
ATOM   189   O O   . LEU A 1 32  ? 51.903  48.865  118.431 1.00 72.16 ? 30  LEU A O   1 
ATOM   190   C CB  . LEU A 1 32  ? 49.225  50.281  119.194 1.00 62.81 ? 30  LEU A CB  1 
ATOM   191   C CG  . LEU A 1 32  ? 49.617  51.279  120.297 1.00 62.81 ? 30  LEU A CG  1 
ATOM   192   C CD1 . LEU A 1 32  ? 49.304  52.707  119.860 1.00 62.81 ? 30  LEU A CD1 1 
ATOM   193   C CD2 . LEU A 1 32  ? 48.867  50.944  121.567 1.00 62.81 ? 30  LEU A CD2 1 
ATOM   194   N N   . ALA A 1 33  ? 52.309  51.083  118.273 1.00 92.42 ? 31  ALA A N   1 
ATOM   195   C CA  . ALA A 1 33  ? 53.726  50.969  118.564 1.00 92.42 ? 31  ALA A CA  1 
ATOM   196   C C   . ALA A 1 33  ? 54.016  51.140  120.057 1.00 92.42 ? 31  ALA A C   1 
ATOM   197   O O   . ALA A 1 33  ? 54.761  52.038  120.453 1.00 92.42 ? 31  ALA A O   1 
ATOM   198   C CB  . ALA A 1 33  ? 54.482  52.008  117.766 1.00 10.76 ? 31  ALA A CB  1 
ATOM   199   N N   . ALA A 1 34  ? 53.422  50.286  120.885 1.00 87.60 ? 32  ALA A N   1 
ATOM   200   C CA  . ALA A 1 34  ? 53.646  50.355  122.326 1.00 87.60 ? 32  ALA A CA  1 
ATOM   201   C C   . ALA A 1 34  ? 54.668  49.284  122.676 1.00 87.60 ? 32  ALA A C   1 
ATOM   202   O O   . ALA A 1 34  ? 54.347  48.258  123.283 1.00 87.60 ? 32  ALA A O   1 
ATOM   203   C CB  . ALA A 1 34  ? 52.342  50.121  123.083 1.00 92.42 ? 32  ALA A CB  1 
ATOM   204   N N   . ASP A 1 35  ? 55.907  49.542  122.272 1.00 92.42 ? 33  ASP A N   1 
ATOM   205   C CA  . ASP A 1 35  ? 57.007  48.622  122.504 1.00 92.42 ? 33  ASP A CA  1 
ATOM   206   C C   . ASP A 1 35  ? 58.329  49.380  122.560 1.00 92.42 ? 33  ASP A C   1 
ATOM   207   O O   . ASP A 1 35  ? 59.398  48.768  122.488 1.00 92.42 ? 33  ASP A O   1 
ATOM   208   C CB  . ASP A 1 35  ? 57.055  47.591  121.377 1.00 92.42 ? 33  ASP A CB  1 
ATOM   209   C CG  . ASP A 1 35  ? 57.403  48.206  120.036 1.00 92.42 ? 33  ASP A CG  1 
ATOM   210   O OD1 . ASP A 1 35  ? 56.945  49.337  119.757 1.00 92.42 ? 33  ASP A OD1 1 
ATOM   211   O OD2 . ASP A 1 35  ? 58.128  47.552  119.254 1.00 92.42 ? 33  ASP A OD2 1 
ATOM   212   N N   . GLU A 1 36  ? 58.260  50.706  122.687 1.00 75.86 ? 34  GLU A N   1 
ATOM   213   C CA  . GLU A 1 36  ? 59.473  51.519  122.744 1.00 75.86 ? 34  GLU A CA  1 
ATOM   214   C C   . GLU A 1 36  ? 60.525  50.945  123.694 1.00 75.86 ? 34  GLU A C   1 
ATOM   215   O O   . GLU A 1 36  ? 60.201  50.273  124.676 1.00 75.86 ? 34  GLU A O   1 
ATOM   216   C CB  . GLU A 1 36  ? 59.143  52.958  123.152 1.00 79.07 ? 34  GLU A CB  1 
ATOM   217   C CG  . GLU A 1 36  ? 58.376  53.738  122.102 1.00 79.07 ? 34  GLU A CG  1 
ATOM   218   C CD  . GLU A 1 36  ? 56.948  54.007  122.510 1.00 79.07 ? 34  GLU A CD  1 
ATOM   219   O OE1 . GLU A 1 36  ? 56.262  53.040  122.925 1.00 79.07 ? 34  GLU A OE1 1 
ATOM   220   O OE2 . GLU A 1 36  ? 56.518  55.182  122.410 1.00 79.07 ? 34  GLU A OE2 1 
ATOM   221   N N   . SER A 1 37  ? 61.789  51.215  123.390 1.00 92.42 ? 35  SER A N   1 
ATOM   222   C CA  . SER A 1 37  ? 62.892  50.722  124.208 1.00 92.42 ? 35  SER A CA  1 
ATOM   223   C C   . SER A 1 37  ? 62.910  51.373  125.583 1.00 92.42 ? 35  SER A C   1 
ATOM   224   O O   . SER A 1 37  ? 62.188  52.345  125.834 1.00 92.42 ? 35  SER A O   1 
ATOM   225   C CB  . SER A 1 37  ? 64.234  50.976  123.511 1.00 92.42 ? 35  SER A CB  1 
ATOM   226   O OG  . SER A 1 37  ? 64.517  52.363  123.438 1.00 92.42 ? 35  SER A OG  1 
ATOM   227   N N   . VAL A 1 38  ? 63.739  50.828  126.469 1.00 86.56 ? 36  VAL A N   1 
ATOM   228   C CA  . VAL A 1 38  ? 63.857  51.360  127.818 1.00 86.56 ? 36  VAL A CA  1 
ATOM   229   C C   . VAL A 1 38  ? 64.324  52.809  127.695 1.00 86.56 ? 36  VAL A C   1 
ATOM   230   O O   . VAL A 1 38  ? 63.898  53.684  128.462 1.00 86.56 ? 36  VAL A O   1 
ATOM   231   C CB  . VAL A 1 38  ? 64.878  50.548  128.658 1.00 43.52 ? 36  VAL A CB  1 
ATOM   232   C CG1 . VAL A 1 38  ? 64.978  51.134  130.049 1.00 43.52 ? 36  VAL A CG1 1 
ATOM   233   C CG2 . VAL A 1 38  ? 64.461  49.073  128.729 1.00 43.52 ? 36  VAL A CG2 1 
ATOM   234   N N   . GLY A 1 39  ? 65.181  53.047  126.701 1.00 89.73 ? 37  GLY A N   1 
ATOM   235   C CA  . GLY A 1 39  ? 65.721  54.375  126.458 1.00 89.73 ? 37  GLY A CA  1 
ATOM   236   C C   . GLY A 1 39  ? 64.747  55.326  125.790 1.00 89.73 ? 37  GLY A C   1 
ATOM   237   O O   . GLY A 1 39  ? 64.536  56.443  126.264 1.00 89.73 ? 37  GLY A O   1 
ATOM   238   N N   . THR A 1 40  ? 64.150  54.884  124.687 1.00 92.42 ? 38  THR A N   1 
ATOM   239   C CA  . THR A 1 40  ? 63.192  55.710  123.954 1.00 92.42 ? 38  THR A CA  1 
ATOM   240   C C   . THR A 1 40  ? 62.064  56.168  124.875 1.00 92.42 ? 38  THR A C   1 
ATOM   241   O O   . THR A 1 40  ? 61.800  57.369  125.006 1.00 92.42 ? 38  THR A O   1 
ATOM   242   C CB  . THR A 1 40  ? 62.592  54.938  122.744 1.00 92.42 ? 38  THR A CB  1 
ATOM   243   O OG1 . THR A 1 40  ? 63.637  54.614  121.813 1.00 92.42 ? 38  THR A OG1 1 
ATOM   244   C CG2 . THR A 1 40  ? 61.537  55.786  122.029 1.00 92.42 ? 38  THR A CG2 1 
ATOM   245   N N   . MET A 1 41  ? 61.406  55.206  125.512 1.00 92.42 ? 39  MET A N   1 
ATOM   246   C CA  . MET A 1 41  ? 60.317  55.517  126.423 1.00 92.42 ? 39  MET A CA  1 
ATOM   247   C C   . MET A 1 41  ? 60.796  56.661  127.316 1.00 92.42 ? 39  MET A C   1 
ATOM   248   O O   . MET A 1 41  ? 60.027  57.569  127.659 1.00 92.42 ? 39  MET A O   1 
ATOM   249   C CB  . MET A 1 41  ? 59.977  54.282  127.268 1.00 92.42 ? 39  MET A CB  1 
ATOM   250   C CG  . MET A 1 41  ? 58.617  54.340  127.968 1.00 92.42 ? 39  MET A CG  1 
ATOM   251   S SD  . MET A 1 41  ? 57.211  54.356  126.825 1.00 92.42 ? 39  MET A SD  1 
ATOM   252   C CE  . MET A 1 41  ? 57.036  56.142  126.533 1.00 92.42 ? 39  MET A CE  1 
ATOM   253   N N   . GLY A 1 42  ? 62.084  56.612  127.658 1.00 86.32 ? 40  GLY A N   1 
ATOM   254   C CA  . GLY A 1 42  ? 62.694  57.625  128.504 1.00 86.32 ? 40  GLY A CA  1 
ATOM   255   C C   . GLY A 1 42  ? 62.514  59.062  128.056 1.00 86.32 ? 40  GLY A C   1 
ATOM   256   O O   . GLY A 1 42  ? 62.147  59.914  128.859 1.00 86.32 ? 40  GLY A O   1 
ATOM   257   N N   . ASN A 1 43  ? 62.781  59.338  126.782 1.00 92.42 ? 41  ASN A N   1 
ATOM   258   C CA  . ASN A 1 43  ? 62.634  60.689  126.253 1.00 92.42 ? 41  ASN A CA  1 
ATOM   259   C C   . ASN A 1 43  ? 61.162  60.990  126.100 1.00 92.42 ? 41  ASN A C   1 
ATOM   260   O O   . ASN A 1 43  ? 60.721  62.091  126.409 1.00 92.42 ? 41  ASN A O   1 
ATOM   261   C CB  . ASN A 1 43  ? 63.305  60.818  124.894 1.00 92.42 ? 41  ASN A CB  1 
ATOM   262   C CG  . ASN A 1 43  ? 64.057  59.573  124.511 1.00 92.42 ? 41  ASN A CG  1 
ATOM   263   O OD1 . ASN A 1 43  ? 65.044  59.209  125.149 1.00 92.42 ? 41  ASN A OD1 1 
ATOM   264   N ND2 . ASN A 1 43  ? 63.588  58.899  123.469 1.00 92.42 ? 41  ASN A ND2 1 
ATOM   265   N N   . ARG A 1 44  ? 60.404  60.010  125.614 1.00 92.42 ? 42  ARG A N   1 
ATOM   266   C CA  . ARG A 1 44  ? 58.962  60.190  125.433 1.00 92.42 ? 42  ARG A CA  1 
ATOM   267   C C   . ARG A 1 44  ? 58.376  60.752  126.723 1.00 92.42 ? 42  ARG A C   1 
ATOM   268   O O   . ARG A 1 44  ? 57.777  61.835  126.741 1.00 92.42 ? 42  ARG A O   1 
ATOM   269   C CB  . ARG A 1 44  ? 58.278  58.854  125.105 1.00 92.42 ? 42  ARG A CB  1 
ATOM   270   C CG  . ARG A 1 44  ? 58.659  58.262  123.751 1.00 92.42 ? 42  ARG A CG  1 
ATOM   271   C CD  . ARG A 1 44  ? 58.144  59.096  122.571 1.00 92.42 ? 42  ARG A CD  1 
ATOM   272   N NE  . ARG A 1 44  ? 58.753  58.677  121.308 1.00 92.42 ? 42  ARG A NE  1 
ATOM   273   C CZ  . ARG A 1 44  ? 60.024  58.900  120.971 1.00 92.42 ? 42  ARG A CZ  1 
ATOM   274   N NH1 . ARG A 1 44  ? 60.838  59.546  121.798 1.00 92.42 ? 42  ARG A NH1 1 
ATOM   275   N NH2 . ARG A 1 44  ? 60.490  58.470  119.805 1.00 92.42 ? 42  ARG A NH2 1 
ATOM   276   N N   . LEU A 1 45  ? 58.566  60.000  127.801 1.00 92.42 ? 43  LEU A N   1 
ATOM   277   C CA  . LEU A 1 45  ? 58.075  60.392  129.111 1.00 92.42 ? 43  LEU A CA  1 
ATOM   278   C C   . LEU A 1 45  ? 58.782  61.672  129.556 1.00 92.42 ? 43  LEU A C   1 
ATOM   279   O O   . LEU A 1 45  ? 58.180  62.539  130.186 1.00 92.42 ? 43  LEU A O   1 
ATOM   280   C CB  . LEU A 1 45  ? 58.335  59.254  130.107 1.00 92.42 ? 43  LEU A CB  1 
ATOM   281   C CG  . LEU A 1 45  ? 57.640  57.934  129.745 1.00 92.42 ? 43  LEU A CG  1 
ATOM   282   C CD1 . LEU A 1 45  ? 58.253  56.759  130.507 1.00 92.42 ? 43  LEU A CD1 1 
ATOM   283   C CD2 . LEU A 1 45  ? 56.147  58.074  130.043 1.00 92.42 ? 43  LEU A CD2 1 
ATOM   284   N N   . GLN A 1 46  ? 60.064  61.783  129.214 1.00 92.42 ? 44  GLN A N   1 
ATOM   285   C CA  . GLN A 1 46  ? 60.862  62.950  129.584 1.00 92.42 ? 44  GLN A CA  1 
ATOM   286   C C   . GLN A 1 46  ? 60.238  64.204  128.999 1.00 92.42 ? 44  GLN A C   1 
ATOM   287   O O   . GLN A 1 46  ? 60.005  65.189  129.702 1.00 92.42 ? 44  GLN A O   1 
ATOM   288   C CB  . GLN A 1 46  ? 62.291  62.793  129.065 1.00 92.42 ? 44  GLN A CB  1 
ATOM   289   C CG  . GLN A 1 46  ? 63.356  62.872  130.143 1.00 92.42 ? 44  GLN A CG  1 
ATOM   290   C CD  . GLN A 1 46  ? 64.659  62.219  129.711 1.00 92.42 ? 44  GLN A CD  1 
ATOM   291   O OE1 . GLN A 1 46  ? 65.220  62.563  128.665 1.00 92.42 ? 44  GLN A OE1 1 
ATOM   292   N NE2 . GLN A 1 46  ? 65.146  61.269  130.512 1.00 92.42 ? 44  GLN A NE2 1 
ATOM   293   N N   . ARG A 1 47  ? 59.966  64.150  127.703 1.00 70.88 ? 45  ARG A N   1 
ATOM   294   C CA  . ARG A 1 47  ? 59.366  65.261  126.992 1.00 70.88 ? 45  ARG A CA  1 
ATOM   295   C C   . ARG A 1 47  ? 58.218  65.877  127.804 1.00 70.88 ? 45  ARG A C   1 
ATOM   296   O O   . ARG A 1 47  ? 58.170  67.092  128.000 1.00 70.88 ? 45  ARG A O   1 
ATOM   297   C CB  . ARG A 1 47  ? 58.855  64.774  125.627 1.00 92.42 ? 45  ARG A CB  1 
ATOM   298   C CG  . ARG A 1 47  ? 59.925  64.174  124.698 1.00 92.42 ? 45  ARG A CG  1 
ATOM   299   C CD  . ARG A 1 47  ? 59.297  63.637  123.403 1.00 92.42 ? 45  ARG A CD  1 
ATOM   300   N NE  . ARG A 1 47  ? 60.284  63.125  122.446 1.00 92.42 ? 45  ARG A NE  1 
ATOM   301   C CZ  . ARG A 1 47  ? 59.979  62.647  121.238 1.00 92.42 ? 45  ARG A CZ  1 
ATOM   302   N NH1 . ARG A 1 47  ? 58.714  62.612  120.837 1.00 92.42 ? 45  ARG A NH1 1 
ATOM   303   N NH2 . ARG A 1 47  ? 60.935  62.206  120.426 1.00 92.42 ? 45  ARG A NH2 1 
ATOM   304   N N   . ILE A 1 48  ? 57.305  65.033  128.282 1.00 92.42 ? 46  ILE A N   1 
ATOM   305   C CA  . ILE A 1 48  ? 56.149  65.489  129.060 1.00 92.42 ? 46  ILE A CA  1 
ATOM   306   C C   . ILE A 1 48  ? 56.522  66.004  130.447 1.00 92.42 ? 46  ILE A C   1 
ATOM   307   O O   . ILE A 1 48  ? 55.659  66.100  131.328 1.00 92.42 ? 46  ILE A O   1 
ATOM   308   C CB  . ILE A 1 48  ? 55.085  64.354  129.247 1.00 92.42 ? 46  ILE A CB  1 
ATOM   309   C CG1 . ILE A 1 48  ? 55.768  63.068  129.731 1.00 92.42 ? 46  ILE A CG1 1 
ATOM   310   C CG2 . ILE A 1 48  ? 54.318  64.132  127.949 1.00 92.42 ? 46  ILE A CG2 1 
ATOM   311   C CD1 . ILE A 1 48  ? 54.842  61.916  130.048 1.00 92.42 ? 46  ILE A CD1 1 
ATOM   312   N N   . LYS A 1 49  ? 57.797  66.342  130.642 1.00 92.42 ? 47  LYS A N   1 
ATOM   313   C CA  . LYS A 1 49  ? 58.270  66.836  131.938 1.00 92.42 ? 47  LYS A CA  1 
ATOM   314   C C   . LYS A 1 49  ? 57.998  65.770  132.994 1.00 92.42 ? 47  LYS A C   1 
ATOM   315   O O   . LYS A 1 49  ? 57.225  65.996  133.929 1.00 92.42 ? 47  LYS A O   1 
ATOM   316   C CB  . LYS A 1 49  ? 57.545  68.136  132.328 1.00 76.42 ? 47  LYS A CB  1 
ATOM   317   C CG  . LYS A 1 49  ? 57.748  69.300  131.361 1.00 76.42 ? 47  LYS A CG  1 
ATOM   318   C CD  . LYS A 1 49  ? 56.875  70.504  131.723 1.00 76.42 ? 47  LYS A CD  1 
ATOM   319   C CE  . LYS A 1 49  ? 57.272  71.114  133.067 1.00 76.42 ? 47  LYS A CE  1 
ATOM   320   N NZ  . LYS A 1 49  ? 56.431  72.293  133.431 1.00 76.42 ? 47  LYS A NZ  1 
ATOM   321   N N   . VAL A 1 50  ? 58.616  64.603  132.822 1.00 84.76 ? 48  VAL A N   1 
ATOM   322   C CA  . VAL A 1 50  ? 58.458  63.482  133.752 1.00 84.76 ? 48  VAL A CA  1 
ATOM   323   C C   . VAL A 1 50  ? 59.738  62.652  133.734 1.00 84.76 ? 48  VAL A C   1 
ATOM   324   O O   . VAL A 1 50  ? 60.581  62.808  132.847 1.00 84.76 ? 48  VAL A O   1 
ATOM   325   C CB  . VAL A 1 50  ? 57.243  62.569  133.365 1.00 61.88 ? 48  VAL A CB  1 
ATOM   326   C CG1 . VAL A 1 50  ? 57.157  61.359  134.309 1.00 61.88 ? 48  VAL A CG1 1 
ATOM   327   C CG2 . VAL A 1 50  ? 55.939  63.372  133.421 1.00 61.88 ? 48  VAL A CG2 1 
ATOM   328   N N   . GLU A 1 51  ? 59.882  61.777  134.722 1.00 92.42 ? 49  GLU A N   1 
ATOM   329   C CA  . GLU A 1 51  ? 61.064  60.932  134.817 1.00 92.42 ? 49  GLU A CA  1 
ATOM   330   C C   . GLU A 1 51  ? 60.820  59.571  134.168 1.00 92.42 ? 49  GLU A C   1 
ATOM   331   O O   . GLU A 1 51  ? 59.685  59.080  134.128 1.00 92.42 ? 49  GLU A O   1 
ATOM   332   C CB  . GLU A 1 51  ? 61.458  60.736  136.288 1.00 92.42 ? 49  GLU A CB  1 
ATOM   333   C CG  . GLU A 1 51  ? 62.859  60.156  136.482 1.00 92.42 ? 49  GLU A CG  1 
ATOM   334   C CD  . GLU A 1 51  ? 63.082  59.600  137.881 1.00 92.42 ? 49  GLU A CD  1 
ATOM   335   O OE1 . GLU A 1 51  ? 64.226  59.175  138.179 1.00 92.42 ? 49  GLU A OE1 1 
ATOM   336   O OE2 . GLU A 1 51  ? 62.111  59.581  138.676 1.00 92.42 ? 49  GLU A OE2 1 
ATOM   337   N N   . ASN A 1 52  ? 61.898  58.972  133.664 1.00 92.42 ? 50  ASN A N   1 
ATOM   338   C CA  . ASN A 1 52  ? 61.836  57.662  133.021 1.00 92.42 ? 50  ASN A CA  1 
ATOM   339   C C   . ASN A 1 52  ? 62.074  56.524  134.019 1.00 92.42 ? 50  ASN A C   1 
ATOM   340   O O   . ASN A 1 52  ? 63.220  56.228  134.381 1.00 92.42 ? 50  ASN A O   1 
ATOM   341   C CB  . ASN A 1 52  ? 62.878  57.562  131.897 1.00 92.42 ? 50  ASN A CB  1 
ATOM   342   C CG  . ASN A 1 52  ? 62.910  56.175  131.243 1.00 92.42 ? 50  ASN A CG  1 
ATOM   343   O OD1 . ASN A 1 52  ? 63.805  55.866  130.447 1.00 92.42 ? 50  ASN A OD1 1 
ATOM   344   N ND2 . ASN A 1 52  ? 61.925  55.338  131.573 1.00 92.42 ? 50  ASN A ND2 1 
ATOM   345   N N   . THR A 1 53  ? 60.994  55.884  134.457 1.00 92.42 ? 51  THR A N   1 
ATOM   346   C CA  . THR A 1 53  ? 61.125  54.777  135.390 1.00 92.42 ? 51  THR A CA  1 
ATOM   347   C C   . THR A 1 53  ? 60.191  53.625  135.044 1.00 92.42 ? 51  THR A C   1 
ATOM   348   O O   . THR A 1 53  ? 59.034  53.824  134.668 1.00 92.42 ? 51  THR A O   1 
ATOM   349   C CB  . THR A 1 53  ? 60.867  55.222  136.842 1.00 82.71 ? 51  THR A CB  1 
ATOM   350   O OG1 . THR A 1 53  ? 61.774  56.279  137.176 1.00 82.71 ? 51  THR A OG1 1 
ATOM   351   C CG2 . THR A 1 53  ? 61.080  54.054  137.809 1.00 82.71 ? 51  THR A CG2 1 
ATOM   352   N N   . GLU A 1 54  ? 60.728  52.417  135.182 1.00 90.15 ? 52  GLU A N   1 
ATOM   353   C CA  . GLU A 1 54  ? 60.015  51.183  134.897 1.00 90.15 ? 52  GLU A CA  1 
ATOM   354   C C   . GLU A 1 54  ? 58.567  51.283  135.344 1.00 90.15 ? 52  GLU A C   1 
ATOM   355   O O   . GLU A 1 54  ? 57.663  51.168  134.529 1.00 90.15 ? 52  GLU A O   1 
ATOM   356   C CB  . GLU A 1 54  ? 60.719  50.020  135.606 1.00 82.74 ? 52  GLU A CB  1 
ATOM   357   C CG  . GLU A 1 54  ? 60.676  48.694  134.871 1.00 82.74 ? 52  GLU A CG  1 
ATOM   358   C CD  . GLU A 1 54  ? 59.310  48.072  134.900 1.00 82.74 ? 52  GLU A CD  1 
ATOM   359   O OE1 . GLU A 1 54  ? 58.805  47.816  136.013 1.00 82.74 ? 52  GLU A OE1 1 
ATOM   360   O OE2 . GLU A 1 54  ? 58.741  47.841  133.815 1.00 82.74 ? 52  GLU A OE2 1 
ATOM   361   N N   . GLU A 1 55  ? 58.350  51.518  136.634 1.00 91.42 ? 53  GLU A N   1 
ATOM   362   C CA  . GLU A 1 55  ? 56.997  51.624  137.162 1.00 91.42 ? 53  GLU A CA  1 
ATOM   363   C C   . GLU A 1 55  ? 56.125  52.572  136.341 1.00 91.42 ? 53  GLU A C   1 
ATOM   364   O O   . GLU A 1 55  ? 55.127  52.140  135.763 1.00 91.42 ? 53  GLU A O   1 
ATOM   365   C CB  . GLU A 1 55  ? 57.030  52.071  138.629 1.00 92.42 ? 53  GLU A CB  1 
ATOM   366   C CG  . GLU A 1 55  ? 55.654  52.247  139.297 1.00 92.42 ? 53  GLU A CG  1 
ATOM   367   C CD  . GLU A 1 55  ? 54.751  51.008  139.215 1.00 92.42 ? 53  GLU A CD  1 
ATOM   368   O OE1 . GLU A 1 55  ? 55.228  49.878  139.476 1.00 92.42 ? 53  GLU A OE1 1 
ATOM   369   O OE2 . GLU A 1 55  ? 53.549  51.171  138.906 1.00 92.42 ? 53  GLU A OE2 1 
ATOM   370   N N   . ASN A 1 56  ? 56.495  53.849  136.268 1.00 92.42 ? 54  ASN A N   1 
ATOM   371   C CA  . ASN A 1 56  ? 55.699  54.822  135.508 1.00 92.42 ? 54  ASN A CA  1 
ATOM   372   C C   . ASN A 1 56  ? 55.428  54.418  134.053 1.00 92.42 ? 54  ASN A C   1 
ATOM   373   O O   . ASN A 1 56  ? 54.741  55.136  133.314 1.00 92.42 ? 54  ASN A O   1 
ATOM   374   C CB  . ASN A 1 56  ? 56.348  56.214  135.550 1.00 92.42 ? 54  ASN A CB  1 
ATOM   375   C CG  . ASN A 1 56  ? 57.768  56.183  136.073 1.00 92.42 ? 54  ASN A CG  1 
ATOM   376   O OD1 . ASN A 1 56  ? 58.018  55.729  137.194 1.00 92.42 ? 54  ASN A OD1 1 
ATOM   377   N ND2 . ASN A 1 56  ? 58.710  56.673  135.268 1.00 92.42 ? 54  ASN A ND2 1 
ATOM   378   N N   . ARG A 1 57  ? 55.982  53.280  133.640 1.00 83.79 ? 55  ARG A N   1 
ATOM   379   C CA  . ARG A 1 57  ? 55.757  52.768  132.293 1.00 83.79 ? 55  ARG A CA  1 
ATOM   380   C C   . ARG A 1 57  ? 54.490  51.937  132.379 1.00 83.79 ? 55  ARG A C   1 
ATOM   381   O O   . ARG A 1 57  ? 53.460  52.294  131.814 1.00 83.79 ? 55  ARG A O   1 
ATOM   382   C CB  . ARG A 1 57  ? 56.917  51.879  131.832 1.00 92.42 ? 55  ARG A CB  1 
ATOM   383   C CG  . ARG A 1 57  ? 58.031  52.612  131.103 1.00 92.42 ? 55  ARG A CG  1 
ATOM   384   C CD  . ARG A 1 57  ? 59.011  51.626  130.468 1.00 92.42 ? 55  ARG A CD  1 
ATOM   385   N NE  . ARG A 1 57  ? 59.965  51.076  131.429 1.00 92.42 ? 55  ARG A NE  1 
ATOM   386   C CZ  . ARG A 1 57  ? 61.073  51.698  131.827 1.00 92.42 ? 55  ARG A CZ  1 
ATOM   387   N NH1 . ARG A 1 57  ? 61.377  52.896  131.346 1.00 92.42 ? 55  ARG A NH1 1 
ATOM   388   N NH2 . ARG A 1 57  ? 61.881  51.122  132.707 1.00 92.42 ? 55  ARG A NH2 1 
ATOM   389   N N   . ARG A 1 58  ? 54.577  50.834  133.114 1.00 79.08 ? 56  ARG A N   1 
ATOM   390   C CA  . ARG A 1 58  ? 53.452  49.934  133.304 1.00 79.08 ? 56  ARG A CA  1 
ATOM   391   C C   . ARG A 1 58  ? 52.195  50.760  133.528 1.00 79.08 ? 56  ARG A C   1 
ATOM   392   O O   . ARG A 1 58  ? 51.087  50.309  133.248 1.00 79.08 ? 56  ARG A O   1 
ATOM   393   C CB  . ARG A 1 58  ? 53.698  49.032  134.518 1.00 78.29 ? 56  ARG A CB  1 
ATOM   394   C CG  . ARG A 1 58  ? 53.037  47.670  134.416 1.00 78.29 ? 56  ARG A CG  1 
ATOM   395   C CD  . ARG A 1 58  ? 53.238  46.833  135.663 1.00 78.29 ? 56  ARG A CD  1 
ATOM   396   N NE  . ARG A 1 58  ? 52.529  47.372  136.824 1.00 78.29 ? 56  ARG A NE  1 
ATOM   397   C CZ  . ARG A 1 58  ? 51.226  47.650  136.856 1.00 78.29 ? 56  ARG A CZ  1 
ATOM   398   N NH1 . ARG A 1 58  ? 50.471  47.451  135.787 1.00 78.29 ? 56  ARG A NH1 1 
ATOM   399   N NH2 . ARG A 1 58  ? 50.667  48.107  137.969 1.00 78.29 ? 56  ARG A NH2 1 
ATOM   400   N N   . GLN A 1 59  ? 52.380  51.981  134.017 1.00 73.60 ? 57  GLN A N   1 
ATOM   401   C CA  . GLN A 1 59  ? 51.268  52.881  134.290 1.00 73.60 ? 57  GLN A CA  1 
ATOM   402   C C   . GLN A 1 59  ? 50.622  53.485  133.033 1.00 73.60 ? 57  GLN A C   1 
ATOM   403   O O   . GLN A 1 59  ? 49.397  53.457  132.893 1.00 73.60 ? 57  GLN A O   1 
ATOM   404   C CB  . GLN A 1 59  ? 51.736  53.979  135.256 1.00 92.42 ? 57  GLN A CB  1 
ATOM   405   C CG  . GLN A 1 59  ? 52.494  53.399  136.462 1.00 92.42 ? 57  GLN A CG  1 
ATOM   406   C CD  . GLN A 1 59  ? 52.607  54.348  137.653 1.00 92.42 ? 57  GLN A CD  1 
ATOM   407   O OE1 . GLN A 1 59  ? 51.609  54.669  138.308 1.00 92.42 ? 57  GLN A OE1 1 
ATOM   408   N NE2 . GLN A 1 59  ? 53.828  54.788  137.945 1.00 92.42 ? 57  GLN A NE2 1 
ATOM   409   N N   . PHE A 1 60  ? 51.431  54.017  132.117 1.00 78.83 ? 58  PHE A N   1 
ATOM   410   C CA  . PHE A 1 60  ? 50.904  54.605  130.877 1.00 78.83 ? 58  PHE A CA  1 
ATOM   411   C C   . PHE A 1 60  ? 50.459  53.511  129.906 1.00 78.83 ? 58  PHE A C   1 
ATOM   412   O O   . PHE A 1 60  ? 49.716  53.767  128.954 1.00 78.83 ? 58  PHE A O   1 
ATOM   413   C CB  . PHE A 1 60  ? 51.968  55.471  130.191 1.00 92.42 ? 58  PHE A CB  1 
ATOM   414   C CG  . PHE A 1 60  ? 51.446  56.281  129.022 1.00 92.42 ? 58  PHE A CG  1 
ATOM   415   C CD1 . PHE A 1 60  ? 50.594  57.362  129.228 1.00 92.42 ? 58  PHE A CD1 1 
ATOM   416   C CD2 . PHE A 1 60  ? 51.825  55.976  127.722 1.00 92.42 ? 58  PHE A CD2 1 
ATOM   417   C CE1 . PHE A 1 60  ? 50.133  58.124  128.160 1.00 92.42 ? 58  PHE A CE1 1 
ATOM   418   C CE2 . PHE A 1 60  ? 51.366  56.736  126.646 1.00 92.42 ? 58  PHE A CE2 1 
ATOM   419   C CZ  . PHE A 1 60  ? 50.520  57.811  126.869 1.00 92.42 ? 58  PHE A CZ  1 
ATOM   420   N N   . ARG A 1 61  ? 50.931  52.293  130.159 1.00 92.42 ? 59  ARG A N   1 
ATOM   421   C CA  . ARG A 1 61  ? 50.601  51.145  129.324 1.00 92.42 ? 59  ARG A CA  1 
ATOM   422   C C   . ARG A 1 61  ? 49.369  50.411  129.835 1.00 92.42 ? 59  ARG A C   1 
ATOM   423   O O   . ARG A 1 61  ? 48.583  49.887  129.041 1.00 92.42 ? 59  ARG A O   1 
ATOM   424   C CB  . ARG A 1 61  ? 51.813  50.206  129.229 1.00 82.49 ? 59  ARG A CB  1 
ATOM   425   C CG  . ARG A 1 61  ? 52.980  50.891  128.536 1.00 82.49 ? 59  ARG A CG  1 
ATOM   426   C CD  . ARG A 1 61  ? 54.202  50.020  128.299 1.00 82.49 ? 59  ARG A CD  1 
ATOM   427   N NE  . ARG A 1 61  ? 55.138  50.746  127.444 1.00 82.49 ? 59  ARG A NE  1 
ATOM   428   C CZ  . ARG A 1 61  ? 56.345  50.317  127.100 1.00 82.49 ? 59  ARG A CZ  1 
ATOM   429   N NH1 . ARG A 1 61  ? 56.782  49.149  127.541 1.00 82.49 ? 59  ARG A NH1 1 
ATOM   430   N NH2 . ARG A 1 61  ? 57.112  51.061  126.311 1.00 82.49 ? 59  ARG A NH2 1 
ATOM   431   N N   . GLU A 1 62  ? 49.193  50.375  131.154 1.00 81.54 ? 60  GLU A N   1 
ATOM   432   C CA  . GLU A 1 62  ? 48.019  49.725  131.726 1.00 81.54 ? 60  GLU A CA  1 
ATOM   433   C C   . GLU A 1 62  ? 46.815  50.552  131.288 1.00 81.54 ? 60  GLU A C   1 
ATOM   434   O O   . GLU A 1 62  ? 45.781  50.003  130.881 1.00 81.54 ? 60  GLU A O   1 
ATOM   435   C CB  . GLU A 1 62  ? 48.099  49.700  133.259 1.00 92.42 ? 60  GLU A CB  1 
ATOM   436   C CG  . GLU A 1 62  ? 46.891  49.035  133.932 1.00 92.42 ? 60  GLU A CG  1 
ATOM   437   C CD  . GLU A 1 62  ? 47.031  48.880  135.445 1.00 92.42 ? 60  GLU A CD  1 
ATOM   438   O OE1 . GLU A 1 62  ? 46.090  48.335  136.057 1.00 92.42 ? 60  GLU A OE1 1 
ATOM   439   O OE2 . GLU A 1 62  ? 48.062  49.290  136.023 1.00 92.42 ? 60  GLU A OE2 1 
ATOM   440   N N   . ILE A 1 63  ? 46.979  51.875  131.364 1.00 92.42 ? 61  ILE A N   1 
ATOM   441   C CA  . ILE A 1 63  ? 45.939  52.834  130.989 1.00 92.42 ? 61  ILE A CA  1 
ATOM   442   C C   . ILE A 1 63  ? 45.433  52.644  129.563 1.00 92.42 ? 61  ILE A C   1 
ATOM   443   O O   . ILE A 1 63  ? 44.222  52.568  129.331 1.00 92.42 ? 61  ILE A O   1 
ATOM   444   C CB  . ILE A 1 63  ? 46.439  54.303  131.121 1.00 77.08 ? 61  ILE A CB  1 
ATOM   445   C CG1 . ILE A 1 63  ? 46.646  54.653  132.596 1.00 77.08 ? 61  ILE A CG1 1 
ATOM   446   C CG2 . ILE A 1 63  ? 45.432  55.268  130.482 1.00 77.08 ? 61  ILE A CG2 1 
ATOM   447   C CD1 . ILE A 1 63  ? 46.992  56.108  132.850 1.00 77.08 ? 61  ILE A CD1 1 
ATOM   448   N N   . LEU A 1 64  ? 46.362  52.581  128.612 1.00 89.10 ? 62  LEU A N   1 
ATOM   449   C CA  . LEU A 1 64  ? 46.017  52.418  127.202 1.00 89.10 ? 62  LEU A CA  1 
ATOM   450   C C   . LEU A 1 64  ? 45.278  51.118  126.931 1.00 89.10 ? 62  LEU A C   1 
ATOM   451   O O   . LEU A 1 64  ? 44.154  51.138  126.430 1.00 89.10 ? 62  LEU A O   1 
ATOM   452   C CB  . LEU A 1 64  ? 47.280  52.480  126.341 1.00 59.44 ? 62  LEU A CB  1 
ATOM   453   C CG  . LEU A 1 64  ? 48.086  53.782  126.430 1.00 67.97 ? 62  LEU A CG  1 
ATOM   454   C CD1 . LEU A 1 64  ? 49.448  53.572  125.798 1.00 63.74 ? 62  LEU A CD1 1 
ATOM   455   C CD2 . LEU A 1 64  ? 47.337  54.924  125.753 1.00 58.92 ? 62  LEU A CD2 1 
ATOM   456   N N   . PHE A 1 65  ? 45.908  49.996  127.277 1.00 86.04 ? 63  PHE A N   1 
ATOM   457   C CA  . PHE A 1 65  ? 45.334  48.666  127.059 1.00 86.04 ? 63  PHE A CA  1 
ATOM   458   C C   . PHE A 1 65  ? 44.051  48.419  127.857 1.00 86.04 ? 63  PHE A C   1 
ATOM   459   O O   . PHE A 1 65  ? 43.417  47.366  127.708 1.00 86.04 ? 63  PHE A O   1 
ATOM   460   C CB  . PHE A 1 65  ? 46.339  47.568  127.427 1.00 68.59 ? 63  PHE A CB  1 
ATOM   461   C CG  . PHE A 1 65  ? 47.730  47.793  126.907 1.00 77.54 ? 63  PHE A CG  1 
ATOM   462   C CD1 . PHE A 1 65  ? 48.707  46.827  127.108 1.00 77.67 ? 63  PHE A CD1 1 
ATOM   463   C CD2 . PHE A 1 65  ? 48.078  48.964  126.242 1.00 75.51 ? 63  PHE A CD2 1 
ATOM   464   C CE1 . PHE A 1 65  ? 50.006  47.021  126.657 1.00 73.91 ? 63  PHE A CE1 1 
ATOM   465   C CE2 . PHE A 1 65  ? 49.374  49.169  125.787 1.00 65.20 ? 63  PHE A CE2 1 
ATOM   466   C CZ  . PHE A 1 65  ? 50.340  48.196  125.995 1.00 68.89 ? 63  PHE A CZ  1 
ATOM   467   N N   . SER A 1 66  ? 43.684  49.372  128.715 1.00 92.42 ? 64  SER A N   1 
ATOM   468   C CA  . SER A 1 66  ? 42.474  49.257  129.531 1.00 92.42 ? 64  SER A CA  1 
ATOM   469   C C   . SER A 1 66  ? 41.282  49.972  128.885 1.00 92.42 ? 64  SER A C   1 
ATOM   470   O O   . SER A 1 66  ? 40.131  49.645  129.176 1.00 92.42 ? 64  SER A O   1 
ATOM   471   C CB  . SER A 1 66  ? 42.715  49.850  130.920 1.00 80.14 ? 64  SER A CB  1 
ATOM   472   O OG  . SER A 1 66  ? 42.792  51.265  130.863 1.00 80.14 ? 64  SER A OG  1 
ATOM   473   N N   . VAL A 1 67  ? 41.568  50.938  128.011 1.00 50.06 ? 65  VAL A N   1 
ATOM   474   C CA  . VAL A 1 67  ? 40.536  51.720  127.333 1.00 42.68 ? 65  VAL A CA  1 
ATOM   475   C C   . VAL A 1 67  ? 39.389  50.844  126.818 1.00 47.34 ? 65  VAL A C   1 
ATOM   476   O O   . VAL A 1 67  ? 39.579  49.653  126.554 1.00 40.50 ? 65  VAL A O   1 
ATOM   477   C CB  . VAL A 1 67  ? 41.142  52.540  126.166 1.00 65.47 ? 65  VAL A CB  1 
ATOM   478   C CG1 . VAL A 1 67  ? 41.105  51.748  124.887 1.00 52.48 ? 65  VAL A CG1 1 
ATOM   479   C CG2 . VAL A 1 67  ? 40.398  53.839  126.007 1.00 57.83 ? 65  VAL A CG2 1 
ATOM   480   N N   . ASP A 1 68  ? 38.204  51.447  126.704 1.00 80.21 ? 66  ASP A N   1 
ATOM   481   C CA  . ASP A 1 68  ? 36.988  50.772  126.244 1.00 75.64 ? 66  ASP A CA  1 
ATOM   482   C C   . ASP A 1 68  ? 37.322  49.696  125.213 1.00 77.31 ? 66  ASP A C   1 
ATOM   483   O O   . ASP A 1 68  ? 38.311  49.820  124.493 1.00 79.45 ? 66  ASP A O   1 
ATOM   484   C CB  . ASP A 1 68  ? 36.038  51.808  125.631 1.00 55.10 ? 66  ASP A CB  1 
ATOM   485   C CG  . ASP A 1 68  ? 34.637  51.262  125.388 1.00 70.36 ? 66  ASP A CG  1 
ATOM   486   O OD1 . ASP A 1 68  ? 34.510  50.176  124.788 1.00 78.61 ? 66  ASP A OD1 1 
ATOM   487   O OD2 . ASP A 1 68  ? 33.656  51.929  125.785 1.00 78.61 ? 66  ASP A OD2 1 
ATOM   488   N N   . SER A 1 69  ? 36.509  48.643  125.136 1.00 92.42 ? 67  SER A N   1 
ATOM   489   C CA  . SER A 1 69  ? 36.757  47.564  124.174 1.00 92.42 ? 67  SER A CA  1 
ATOM   490   C C   . SER A 1 69  ? 36.500  48.001  122.727 1.00 92.42 ? 67  SER A C   1 
ATOM   491   O O   . SER A 1 69  ? 36.897  47.311  121.781 1.00 92.42 ? 67  SER A O   1 
ATOM   492   C CB  . SER A 1 69  ? 35.879  46.346  124.484 1.00 69.13 ? 67  SER A CB  1 
ATOM   493   O OG  . SER A 1 69  ? 34.527  46.582  124.128 1.00 87.29 ? 67  SER A OG  1 
ATOM   494   N N   . SER A 1 70  ? 35.843  49.148  122.561 1.00 71.35 ? 68  SER A N   1 
ATOM   495   C CA  . SER A 1 70  ? 35.525  49.671  121.236 1.00 76.49 ? 68  SER A CA  1 
ATOM   496   C C   . SER A 1 70  ? 36.791  49.868  120.436 1.00 76.49 ? 68  SER A C   1 
ATOM   497   O O   . SER A 1 70  ? 36.765  49.902  119.206 1.00 71.35 ? 68  SER A O   1 
ATOM   498   C CB  . SER A 1 70  ? 34.810  51.018  121.340 1.00 55.89 ? 68  SER A CB  1 
ATOM   499   O OG  . SER A 1 70  ? 35.723  52.061  121.645 1.00 67.73 ? 68  SER A OG  1 
ATOM   500   N N   . ILE A 1 71  ? 37.904  50.006  121.140 1.00 84.31 ? 69  ILE A N   1 
ATOM   501   C CA  . ILE A 1 71  ? 39.170  50.219  120.474 1.00 84.31 ? 69  ILE A CA  1 
ATOM   502   C C   . ILE A 1 71  ? 39.476  49.133  119.451 1.00 84.31 ? 69  ILE A C   1 
ATOM   503   O O   . ILE A 1 71  ? 40.088  49.431  118.428 1.00 84.31 ? 69  ILE A O   1 
ATOM   504   C CB  . ILE A 1 71  ? 40.331  50.290  121.468 1.00 55.86 ? 69  ILE A CB  1 
ATOM   505   C CG1 . ILE A 1 71  ? 41.508  51.009  120.820 1.00 43.31 ? 69  ILE A CG1 1 
ATOM   506   C CG2 . ILE A 1 71  ? 40.759  48.892  121.875 1.00 45.69 ? 69  ILE A CG2 1 
ATOM   507   C CD1 . ILE A 1 71  ? 42.773  50.918  121.624 1.00 56.37 ? 69  ILE A CD1 1 
ATOM   508   N N   . ASN A 1 72  ? 39.050  47.889  119.704 1.00 44.95 ? 70  ASN A N   1 
ATOM   509   C CA  . ASN A 1 72  ? 39.330  46.801  118.752 1.00 44.59 ? 70  ASN A CA  1 
ATOM   510   C C   . ASN A 1 72  ? 38.612  46.976  117.394 1.00 53.75 ? 70  ASN A C   1 
ATOM   511   O O   . ASN A 1 72  ? 38.413  46.018  116.621 1.00 56.50 ? 70  ASN A O   1 
ATOM   512   C CB  . ASN A 1 72  ? 39.027  45.424  119.371 1.00 79.37 ? 70  ASN A CB  1 
ATOM   513   C CG  . ASN A 1 72  ? 37.587  45.255  119.744 1.00 79.37 ? 70  ASN A CG  1 
ATOM   514   O OD1 . ASN A 1 72  ? 36.702  45.618  118.985 1.00 79.37 ? 70  ASN A OD1 1 
ATOM   515   N ND2 . ASN A 1 72  ? 37.338  44.681  120.909 1.00 79.37 ? 70  ASN A ND2 1 
ATOM   516   N N   . GLN A 1 73  ? 38.260  48.233  117.123 1.00 73.34 ? 71  GLN A N   1 
ATOM   517   C CA  . GLN A 1 73  ? 37.596  48.637  115.896 1.00 81.02 ? 71  GLN A CA  1 
ATOM   518   C C   . GLN A 1 73  ? 38.560  49.536  115.126 1.00 81.02 ? 71  GLN A C   1 
ATOM   519   O O   . GLN A 1 73  ? 38.308  49.902  113.981 1.00 81.02 ? 71  GLN A O   1 
ATOM   520   C CB  . GLN A 1 73  ? 36.306  49.402  116.223 1.00 84.70 ? 71  GLN A CB  1 
ATOM   521   C CG  . GLN A 1 73  ? 35.298  48.592  117.039 1.00 84.70 ? 71  GLN A CG  1 
ATOM   522   C CD  . GLN A 1 73  ? 34.816  47.341  116.317 1.00 84.70 ? 71  GLN A CD  1 
ATOM   523   O OE1 . GLN A 1 73  ? 33.871  47.386  115.529 1.00 84.70 ? 71  GLN A OE1 1 
ATOM   524   N NE2 . GLN A 1 73  ? 35.475  46.219  116.575 1.00 84.70 ? 71  GLN A NE2 1 
ATOM   525   N N   . SER A 1 74  ? 39.668  49.885  115.772 1.00 89.61 ? 72  SER A N   1 
ATOM   526   C CA  . SER A 1 74  ? 40.688  50.731  115.162 1.00 89.61 ? 72  SER A CA  1 
ATOM   527   C C   . SER A 1 74  ? 42.086  50.158  115.374 1.00 89.61 ? 72  SER A C   1 
ATOM   528   O O   . SER A 1 74  ? 43.029  50.536  114.691 1.00 89.61 ? 72  SER A O   1 
ATOM   529   C CB  . SER A 1 74  ? 40.618  52.148  115.735 1.00 25.69 ? 72  SER A CB  1 
ATOM   530   O OG  . SER A 1 74  ? 39.435  52.806  115.310 1.00 40.23 ? 72  SER A OG  1 
ATOM   531   N N   . ILE A 1 75  ? 42.215  49.243  116.324 1.00 46.34 ? 73  ILE A N   1 
ATOM   532   C CA  . ILE A 1 75  ? 43.495  48.607  116.621 1.00 46.34 ? 73  ILE A CA  1 
ATOM   533   C C   . ILE A 1 75  ? 43.384  47.093  116.398 1.00 46.34 ? 73  ILE A C   1 
ATOM   534   O O   . ILE A 1 75  ? 42.637  46.392  117.091 1.00 46.34 ? 73  ILE A O   1 
ATOM   535   C CB  . ILE A 1 75  ? 43.925  48.889  118.086 1.00 51.37 ? 73  ILE A CB  1 
ATOM   536   C CG1 . ILE A 1 75  ? 44.133  50.394  118.277 1.00 51.37 ? 73  ILE A CG1 1 
ATOM   537   C CG2 . ILE A 1 75  ? 45.190  48.117  118.437 1.00 51.37 ? 73  ILE A CG2 1 
ATOM   538   C CD1 . ILE A 1 75  ? 45.239  50.990  117.443 1.00 51.37 ? 73  ILE A CD1 1 
ATOM   539   N N   . GLY A 1 76  ? 44.132  46.594  115.421 1.00 49.72 ? 74  GLY A N   1 
ATOM   540   C CA  . GLY A 1 76  ? 44.088  45.176  115.125 1.00 49.72 ? 74  GLY A CA  1 
ATOM   541   C C   . GLY A 1 76  ? 45.201  44.393  115.784 1.00 49.72 ? 74  GLY A C   1 
ATOM   542   O O   . GLY A 1 76  ? 45.183  43.160  115.768 1.00 49.72 ? 74  GLY A O   1 
ATOM   543   N N   . GLY A 1 77  ? 46.167  45.106  116.361 1.00 57.97 ? 75  GLY A N   1 
ATOM   544   C CA  . GLY A 1 77  ? 47.285  44.454  117.025 1.00 57.97 ? 75  GLY A CA  1 
ATOM   545   C C   . GLY A 1 77  ? 48.270  45.453  117.605 1.00 57.97 ? 75  GLY A C   1 
ATOM   546   O O   . GLY A 1 77  ? 48.435  46.557  117.075 1.00 57.97 ? 75  GLY A O   1 
ATOM   547   N N   . VAL A 1 78  ? 48.925  45.072  118.697 1.00 49.58 ? 76  VAL A N   1 
ATOM   548   C CA  . VAL A 1 78  ? 49.892  45.951  119.339 1.00 49.58 ? 76  VAL A CA  1 
ATOM   549   C C   . VAL A 1 78  ? 51.212  45.239  119.603 1.00 49.58 ? 76  VAL A C   1 
ATOM   550   O O   . VAL A 1 78  ? 51.225  44.089  120.060 1.00 49.58 ? 76  VAL A O   1 
ATOM   551   C CB  . VAL A 1 78  ? 49.350  46.498  120.678 1.00 57.58 ? 76  VAL A CB  1 
ATOM   552   C CG1 . VAL A 1 78  ? 50.416  47.282  121.389 1.00 57.58 ? 76  VAL A CG1 1 
ATOM   553   C CG2 . VAL A 1 78  ? 48.167  47.401  120.426 1.00 57.58 ? 76  VAL A CG2 1 
ATOM   554   N N   . ILE A 1 79  ? 52.313  45.932  119.294 1.00 67.87 ? 77  ILE A N   1 
ATOM   555   C CA  . ILE A 1 79  ? 53.666  45.412  119.506 1.00 67.87 ? 77  ILE A CA  1 
ATOM   556   C C   . ILE A 1 79  ? 54.174  45.911  120.854 1.00 67.87 ? 77  ILE A C   1 
ATOM   557   O O   . ILE A 1 79  ? 53.948  47.068  121.228 1.00 67.87 ? 77  ILE A O   1 
ATOM   558   C CB  . ILE A 1 79  ? 54.667  45.895  118.433 1.00 62.87 ? 77  ILE A CB  1 
ATOM   559   C CG1 . ILE A 1 79  ? 54.193  45.492  117.042 1.00 62.87 ? 77  ILE A CG1 1 
ATOM   560   C CG2 . ILE A 1 79  ? 56.029  45.260  118.674 1.00 62.87 ? 77  ILE A CG2 1 
ATOM   561   C CD1 . ILE A 1 79  ? 55.091  45.997  115.909 1.00 62.87 ? 77  ILE A CD1 1 
ATOM   562   N N   . LEU A 1 80  ? 54.879  45.036  121.562 1.00 81.07 ? 78  LEU A N   1 
ATOM   563   C CA  . LEU A 1 80  ? 55.413  45.355  122.875 1.00 81.07 ? 78  LEU A CA  1 
ATOM   564   C C   . LEU A 1 80  ? 56.914  45.105  122.964 1.00 81.07 ? 78  LEU A C   1 
ATOM   565   O O   . LEU A 1 80  ? 57.462  44.275  122.238 1.00 81.07 ? 78  LEU A O   1 
ATOM   566   C CB  . LEU A 1 80  ? 54.710  44.505  123.927 1.00 49.85 ? 78  LEU A CB  1 
ATOM   567   C CG  . LEU A 1 80  ? 53.188  44.566  123.960 1.00 49.85 ? 78  LEU A CG  1 
ATOM   568   C CD1 . LEU A 1 80  ? 52.671  43.439  124.834 1.00 49.85 ? 78  LEU A CD1 1 
ATOM   569   C CD2 . LEU A 1 80  ? 52.733  45.922  124.466 1.00 49.85 ? 78  LEU A CD2 1 
ATOM   570   N N   . PHE A 1 81  ? 57.568  45.847  123.854 1.00 86.55 ? 79  PHE A N   1 
ATOM   571   C CA  . PHE A 1 81  ? 58.999  45.701  124.096 1.00 86.55 ? 79  PHE A CA  1 
ATOM   572   C C   . PHE A 1 81  ? 59.032  44.405  124.910 1.00 86.55 ? 79  PHE A C   1 
ATOM   573   O O   . PHE A 1 81  ? 57.973  43.927  125.316 1.00 86.55 ? 79  PHE A O   1 
ATOM   574   C CB  . PHE A 1 81  ? 59.497  46.898  124.921 1.00 92.42 ? 79  PHE A CB  1 
ATOM   575   C CG  . PHE A 1 81  ? 60.983  47.142  124.830 1.00 92.42 ? 79  PHE A CG  1 
ATOM   576   C CD1 . PHE A 1 81  ? 61.626  47.194  123.592 1.00 92.42 ? 79  PHE A CD1 1 
ATOM   577   C CD2 . PHE A 1 81  ? 61.738  47.354  125.985 1.00 92.42 ? 79  PHE A CD2 1 
ATOM   578   C CE1 . PHE A 1 81  ? 63.006  47.457  123.505 1.00 92.42 ? 79  PHE A CE1 1 
ATOM   579   C CE2 . PHE A 1 81  ? 63.116  47.618  125.913 1.00 92.42 ? 79  PHE A CE2 1 
ATOM   580   C CZ  . PHE A 1 81  ? 63.750  47.669  124.671 1.00 92.42 ? 79  PHE A CZ  1 
ATOM   581   N N   . HIS A 1 82  ? 60.202  43.819  125.151 1.00 83.67 ? 80  HIS A N   1 
ATOM   582   C CA  . HIS A 1 82  ? 60.229  42.570  125.920 1.00 83.67 ? 80  HIS A CA  1 
ATOM   583   C C   . HIS A 1 82  ? 59.458  42.733  127.231 1.00 83.67 ? 80  HIS A C   1 
ATOM   584   O O   . HIS A 1 82  ? 58.511  41.990  127.518 1.00 83.67 ? 80  HIS A O   1 
ATOM   585   C CB  . HIS A 1 82  ? 61.666  42.135  126.240 1.00 77.25 ? 80  HIS A CB  1 
ATOM   586   C CG  . HIS A 1 82  ? 61.767  40.724  126.745 1.00 77.25 ? 80  HIS A CG  1 
ATOM   587   N ND1 . HIS A 1 82  ? 62.953  40.164  127.169 1.00 77.25 ? 80  HIS A ND1 1 
ATOM   588   C CD2 . HIS A 1 82  ? 60.830  39.751  126.866 1.00 77.25 ? 80  HIS A CD2 1 
ATOM   589   C CE1 . HIS A 1 82  ? 62.744  38.909  127.528 1.00 77.25 ? 80  HIS A CE1 1 
ATOM   590   N NE2 . HIS A 1 82  ? 61.464  38.634  127.353 1.00 77.25 ? 80  HIS A NE2 1 
ATOM   591   N N   . GLU A 1 83  ? 59.885  43.719  128.014 1.00 92.42 ? 81  GLU A N   1 
ATOM   592   C CA  . GLU A 1 83  ? 59.296  44.056  129.309 1.00 92.42 ? 81  GLU A CA  1 
ATOM   593   C C   . GLU A 1 83  ? 57.782  43.864  129.396 1.00 92.42 ? 81  GLU A C   1 
ATOM   594   O O   . GLU A 1 83  ? 57.299  42.907  130.008 1.00 92.42 ? 81  GLU A O   1 
ATOM   595   C CB  . GLU A 1 83  ? 59.658  45.507  129.642 1.00 92.42 ? 81  GLU A CB  1 
ATOM   596   C CG  . GLU A 1 83  ? 58.934  46.104  130.826 1.00 92.42 ? 81  GLU A CG  1 
ATOM   597   C CD  . GLU A 1 83  ? 59.391  47.524  131.103 1.00 92.42 ? 81  GLU A CD  1 
ATOM   598   O OE1 . GLU A 1 83  ? 60.583  47.704  131.443 1.00 92.42 ? 81  GLU A OE1 1 
ATOM   599   O OE2 . GLU A 1 83  ? 58.564  48.457  130.974 1.00 92.42 ? 81  GLU A OE2 1 
ATOM   600   N N   . THR A 1 84  ? 57.050  44.784  128.770 1.00 40.54 ? 82  THR A N   1 
ATOM   601   C CA  . THR A 1 84  ? 55.589  44.788  128.766 1.00 40.54 ? 82  THR A CA  1 
ATOM   602   C C   . THR A 1 84  ? 54.929  43.442  128.519 1.00 40.54 ? 82  THR A C   1 
ATOM   603   O O   . THR A 1 84  ? 53.876  43.157  129.077 1.00 40.54 ? 82  THR A O   1 
ATOM   604   C CB  . THR A 1 84  ? 55.046  45.770  127.724 1.00 68.57 ? 82  THR A CB  1 
ATOM   605   O OG1 . THR A 1 84  ? 55.789  46.991  127.788 1.00 68.57 ? 82  THR A OG1 1 
ATOM   606   C CG2 . THR A 1 84  ? 53.585  46.074  128.003 1.00 68.57 ? 82  THR A CG2 1 
ATOM   607   N N   . LEU A 1 85  ? 55.538  42.609  127.689 1.00 49.12 ? 83  LEU A N   1 
ATOM   608   C CA  . LEU A 1 85  ? 54.947  41.313  127.402 1.00 49.12 ? 83  LEU A CA  1 
ATOM   609   C C   . LEU A 1 85  ? 54.699  40.490  128.672 1.00 49.12 ? 83  LEU A C   1 
ATOM   610   O O   . LEU A 1 85  ? 54.049  39.433  128.624 1.00 49.12 ? 83  LEU A O   1 
ATOM   611   C CB  . LEU A 1 85  ? 55.829  40.528  126.422 1.00 72.00 ? 83  LEU A CB  1 
ATOM   612   C CG  . LEU A 1 85  ? 55.363  39.105  126.074 1.00 72.00 ? 83  LEU A CG  1 
ATOM   613   C CD1 . LEU A 1 85  ? 53.956  39.125  125.490 1.00 72.00 ? 83  LEU A CD1 1 
ATOM   614   C CD2 . LEU A 1 85  ? 56.331  38.487  125.096 1.00 72.00 ? 83  LEU A CD2 1 
ATOM   615   N N   . TYR A 1 86  ? 55.201  40.970  129.809 1.00 92.42 ? 84  TYR A N   1 
ATOM   616   C CA  . TYR A 1 86  ? 55.006  40.245  131.067 1.00 92.42 ? 84  TYR A CA  1 
ATOM   617   C C   . TYR A 1 86  ? 54.361  41.027  132.211 1.00 92.42 ? 84  TYR A C   1 
ATOM   618   O O   . TYR A 1 86  ? 53.813  40.418  133.134 1.00 92.42 ? 84  TYR A O   1 
ATOM   619   C CB  . TYR A 1 86  ? 56.328  39.646  131.549 1.00 70.13 ? 84  TYR A CB  1 
ATOM   620   C CG  . TYR A 1 86  ? 56.849  38.533  130.664 1.00 70.13 ? 84  TYR A CG  1 
ATOM   621   C CD1 . TYR A 1 86  ? 57.603  38.819  129.523 1.00 70.13 ? 84  TYR A CD1 1 
ATOM   622   C CD2 . TYR A 1 86  ? 56.586  37.194  130.967 1.00 70.13 ? 84  TYR A CD2 1 
ATOM   623   C CE1 . TYR A 1 86  ? 58.083  37.802  128.708 1.00 70.13 ? 84  TYR A CE1 1 
ATOM   624   C CE2 . TYR A 1 86  ? 57.060  36.173  130.161 1.00 70.13 ? 84  TYR A CE2 1 
ATOM   625   C CZ  . TYR A 1 86  ? 57.810  36.483  129.032 1.00 70.13 ? 84  TYR A CZ  1 
ATOM   626   O OH  . TYR A 1 86  ? 58.297  35.477  128.226 1.00 70.13 ? 84  TYR A OH  1 
ATOM   627   N N   . GLN A 1 87  ? 54.417  42.357  132.147 1.00 92.42 ? 85  GLN A N   1 
ATOM   628   C CA  . GLN A 1 87  ? 53.828  43.205  133.183 1.00 92.42 ? 85  GLN A CA  1 
ATOM   629   C C   . GLN A 1 87  ? 52.383  42.829  133.549 1.00 92.42 ? 85  GLN A C   1 
ATOM   630   O O   . GLN A 1 87  ? 51.607  42.359  132.706 1.00 92.42 ? 85  GLN A O   1 
ATOM   631   C CB  . GLN A 1 87  ? 53.862  44.671  132.753 1.00 76.06 ? 85  GLN A CB  1 
ATOM   632   C CG  . GLN A 1 87  ? 55.246  45.246  132.614 1.00 76.06 ? 85  GLN A CG  1 
ATOM   633   C CD  . GLN A 1 87  ? 55.223  46.733  132.303 1.00 76.06 ? 85  GLN A CD  1 
ATOM   634   O OE1 . GLN A 1 87  ? 54.718  47.157  131.264 1.00 76.06 ? 85  GLN A OE1 1 
ATOM   635   N NE2 . GLN A 1 87  ? 55.769  47.533  133.206 1.00 76.06 ? 85  GLN A NE2 1 
ATOM   636   N N   . LYS A 1 88  ? 52.040  43.039  134.820 1.00 92.42 ? 86  LYS A N   1 
ATOM   637   C CA  . LYS A 1 88  ? 50.707  42.750  135.335 1.00 92.42 ? 86  LYS A CA  1 
ATOM   638   C C   . LYS A 1 88  ? 50.080  44.094  135.671 1.00 92.42 ? 86  LYS A C   1 
ATOM   639   O O   . LYS A 1 88  ? 50.755  44.958  136.227 1.00 92.42 ? 86  LYS A O   1 
ATOM   640   C CB  . LYS A 1 88  ? 50.795  41.880  136.601 1.00 62.55 ? 86  LYS A CB  1 
ATOM   641   C CG  . LYS A 1 88  ? 51.522  40.557  136.398 1.00 62.55 ? 86  LYS A CG  1 
ATOM   642   C CD  . LYS A 1 88  ? 51.099  39.484  137.403 1.00 62.55 ? 86  LYS A CD  1 
ATOM   643   C CE  . LYS A 1 88  ? 51.654  38.109  136.988 1.00 62.55 ? 86  LYS A CE  1 
ATOM   644   N NZ  . LYS A 1 88  ? 51.055  36.943  137.714 1.00 62.55 ? 86  LYS A NZ  1 
ATOM   645   N N   . ASP A 1 89  ? 48.805  44.279  135.326 1.00 48.91 ? 87  ASP A N   1 
ATOM   646   C CA  . ASP A 1 89  ? 48.123  45.540  135.611 1.00 52.67 ? 87  ASP A CA  1 
ATOM   647   C C   . ASP A 1 89  ? 47.686  45.499  137.050 1.00 51.51 ? 87  ASP A C   1 
ATOM   648   O O   . ASP A 1 89  ? 47.611  44.426  137.633 1.00 47.80 ? 87  ASP A O   1 
ATOM   649   C CB  . ASP A 1 89  ? 46.905  45.751  134.696 1.00 66.14 ? 87  ASP A CB  1 
ATOM   650   C CG  . ASP A 1 89  ? 45.635  45.118  135.236 1.00 76.35 ? 87  ASP A CG  1 
ATOM   651   O OD1 . ASP A 1 89  ? 44.553  45.384  134.666 1.00 76.35 ? 87  ASP A OD1 1 
ATOM   652   O OD2 . ASP A 1 89  ? 45.707  44.353  136.217 1.00 71.61 ? 87  ASP A OD2 1 
ATOM   653   N N   . SER A 1 90  ? 47.404  46.668  137.609 1.00 70.61 ? 88  SER A N   1 
ATOM   654   C CA  . SER A 1 90  ? 46.980  46.790  138.997 1.00 71.38 ? 88  SER A CA  1 
ATOM   655   C C   . SER A 1 90  ? 46.468  45.499  139.640 1.00 60.67 ? 88  SER A C   1 
ATOM   656   O O   . SER A 1 90  ? 47.053  45.026  140.616 1.00 77.17 ? 88  SER A O   1 
ATOM   657   C CB  . SER A 1 90  ? 45.926  47.888  139.116 1.00 87.78 ? 88  SER A CB  1 
ATOM   658   O OG  . SER A 1 90  ? 46.483  49.147  138.779 1.00 87.78 ? 88  SER A OG  1 
ATOM   659   N N   . GLN A 1 91  ? 45.390  44.928  139.105 1.00 83.27 ? 89  GLN A N   1 
ATOM   660   C CA  . GLN A 1 91  ? 44.839  43.689  139.663 1.00 83.27 ? 89  GLN A CA  1 
ATOM   661   C C   . GLN A 1 91  ? 45.648  42.449  139.249 1.00 83.27 ? 89  GLN A C   1 
ATOM   662   O O   . GLN A 1 91  ? 45.102  41.351  139.131 1.00 83.27 ? 89  GLN A O   1 
ATOM   663   C CB  . GLN A 1 91  ? 43.374  43.507  139.242 1.00 92.42 ? 89  GLN A CB  1 
ATOM   664   C CG  . GLN A 1 91  ? 42.392  44.524  139.823 1.00 92.42 ? 89  GLN A CG  1 
ATOM   665   C CD  . GLN A 1 91  ? 42.345  45.842  139.049 1.00 92.42 ? 89  GLN A CD  1 
ATOM   666   O OE1 . GLN A 1 91  ? 42.171  45.855  137.825 1.00 92.42 ? 89  GLN A OE1 1 
ATOM   667   N NE2 . GLN A 1 91  ? 42.483  46.959  139.765 1.00 92.42 ? 89  GLN A NE2 1 
ATOM   668   N N   . GLY A 1 92  ? 46.950  42.638  139.046 1.00 67.87 ? 90  GLY A N   1 
ATOM   669   C CA  . GLY A 1 92  ? 47.838  41.560  138.646 1.00 55.90 ? 90  GLY A CA  1 
ATOM   670   C C   . GLY A 1 92  ? 47.464  40.941  137.317 1.00 51.87 ? 90  GLY A C   1 
ATOM   671   O O   . GLY A 1 92  ? 47.826  39.799  137.025 1.00 68.81 ? 90  GLY A O   1 
ATOM   672   N N   . LYS A 1 93  ? 46.747  41.701  136.500 1.00 71.80 ? 91  LYS A N   1 
ATOM   673   C CA  . LYS A 1 93  ? 46.288  41.208  135.205 1.00 77.07 ? 91  LYS A CA  1 
ATOM   674   C C   . LYS A 1 93  ? 47.367  41.386  134.144 1.00 80.51 ? 91  LYS A C   1 
ATOM   675   O O   . LYS A 1 93  ? 47.880  42.481  133.964 1.00 66.85 ? 91  LYS A O   1 
ATOM   676   C CB  . LYS A 1 93  ? 45.005  41.960  134.812 1.00 50.39 ? 91  LYS A CB  1 
ATOM   677   C CG  . LYS A 1 93  ? 44.373  41.557  133.493 1.00 65.21 ? 91  LYS A CG  1 
ATOM   678   C CD  . LYS A 1 93  ? 43.314  40.490  133.660 1.00 72.74 ? 91  LYS A CD  1 
ATOM   679   C CE  . LYS A 1 93  ? 42.649  40.224  132.323 1.00 71.92 ? 91  LYS A CE  1 
ATOM   680   N NZ  . LYS A 1 93  ? 41.500  39.300  132.448 1.00 81.20 ? 91  LYS A NZ  1 
ATOM   681   N N   . LEU A 1 94  ? 47.714  40.313  133.441 1.00 73.85 ? 92  LEU A N   1 
ATOM   682   C CA  . LEU A 1 94  ? 48.747  40.387  132.405 1.00 73.85 ? 92  LEU A CA  1 
ATOM   683   C C   . LEU A 1 94  ? 48.390  41.350  131.278 1.00 73.85 ? 92  LEU A C   1 
ATOM   684   O O   . LEU A 1 94  ? 47.323  41.221  130.678 1.00 73.85 ? 92  LEU A O   1 
ATOM   685   C CB  . LEU A 1 94  ? 48.993  39.000  131.806 1.00 70.39 ? 92  LEU A CB  1 
ATOM   686   C CG  . LEU A 1 94  ? 49.740  37.970  132.656 1.00 70.39 ? 92  LEU A CG  1 
ATOM   687   C CD1 . LEU A 1 94  ? 49.664  36.607  131.981 1.00 70.39 ? 92  LEU A CD1 1 
ATOM   688   C CD2 . LEU A 1 94  ? 51.195  38.411  132.851 1.00 70.39 ? 92  LEU A CD2 1 
ATOM   689   N N   . PHE A 1 95  ? 49.278  42.308  130.994 1.00 73.82 ? 93  PHE A N   1 
ATOM   690   C CA  . PHE A 1 95  ? 49.064  43.279  129.911 1.00 73.82 ? 93  PHE A CA  1 
ATOM   691   C C   . PHE A 1 95  ? 48.729  42.504  128.643 1.00 73.82 ? 93  PHE A C   1 
ATOM   692   O O   . PHE A 1 95  ? 47.942  42.940  127.795 1.00 73.82 ? 93  PHE A O   1 
ATOM   693   C CB  . PHE A 1 95  ? 50.335  44.086  129.669 1.00 73.84 ? 93  PHE A CB  1 
ATOM   694   C CG  . PHE A 1 95  ? 50.455  45.294  130.530 1.00 73.84 ? 93  PHE A CG  1 
ATOM   695   C CD1 . PHE A 1 95  ? 50.357  45.194  131.910 1.00 73.84 ? 93  PHE A CD1 1 
ATOM   696   C CD2 . PHE A 1 95  ? 50.655  46.547  129.959 1.00 73.84 ? 93  PHE A CD2 1 
ATOM   697   C CE1 . PHE A 1 95  ? 50.452  46.329  132.714 1.00 73.84 ? 93  PHE A CE1 1 
ATOM   698   C CE2 . PHE A 1 95  ? 50.752  47.687  130.753 1.00 73.84 ? 93  PHE A CE2 1 
ATOM   699   C CZ  . PHE A 1 95  ? 50.650  47.580  132.130 1.00 73.84 ? 93  PHE A CZ  1 
ATOM   700   N N   . ARG A 1 96  ? 49.372  41.347  128.540 1.00 92.42 ? 94  ARG A N   1 
ATOM   701   C CA  . ARG A 1 96  ? 49.209  40.413  127.440 1.00 92.42 ? 94  ARG A CA  1 
ATOM   702   C C   . ARG A 1 96  ? 47.734  40.091  127.239 1.00 92.42 ? 94  ARG A C   1 
ATOM   703   O O   . ARG A 1 96  ? 47.170  40.332  126.168 1.00 92.42 ? 94  ARG A O   1 
ATOM   704   C CB  . ARG A 1 96  ? 49.981  39.135  127.776 1.00 67.14 ? 94  ARG A CB  1 
ATOM   705   C CG  . ARG A 1 96  ? 49.582  37.898  127.000 1.00 67.14 ? 94  ARG A CG  1 
ATOM   706   C CD  . ARG A 1 96  ? 50.150  36.663  127.675 1.00 67.14 ? 94  ARG A CD  1 
ATOM   707   N NE  . ARG A 1 96  ? 51.450  36.954  128.273 1.00 67.14 ? 94  ARG A NE  1 
ATOM   708   C CZ  . ARG A 1 96  ? 52.247  36.044  128.824 1.00 67.14 ? 94  ARG A CZ  1 
ATOM   709   N NH1 . ARG A 1 96  ? 51.883  34.766  128.851 1.00 67.14 ? 94  ARG A NH1 1 
ATOM   710   N NH2 . ARG A 1 96  ? 53.404  36.420  129.357 1.00 67.14 ? 94  ARG A NH2 1 
ATOM   711   N N   . ASN A 1 97  ? 47.121  39.561  128.293 1.00 44.73 ? 95  ASN A N   1 
ATOM   712   C CA  . ASN A 1 97  ? 45.724  39.162  128.265 1.00 46.50 ? 95  ASN A CA  1 
ATOM   713   C C   . ASN A 1 97  ? 44.724  40.308  128.254 1.00 47.89 ? 95  ASN A C   1 
ATOM   714   O O   . ASN A 1 97  ? 43.598  40.133  127.794 1.00 40.45 ? 95  ASN A O   1 
ATOM   715   C CB  . ASN A 1 97  ? 45.442  38.212  129.425 1.00 54.23 ? 95  ASN A CB  1 
ATOM   716   C CG  . ASN A 1 97  ? 46.247  36.926  129.326 1.00 68.41 ? 95  ASN A CG  1 
ATOM   717   O OD1 . ASN A 1 97  ? 46.204  36.234  128.307 1.00 65.30 ? 95  ASN A OD1 1 
ATOM   718   N ND2 . ASN A 1 97  ? 46.987  36.602  130.384 1.00 68.71 ? 95  ASN A ND2 1 
ATOM   719   N N   . ILE A 1 98  ? 45.121  41.476  128.747 1.00 72.79 ? 96  ILE A N   1 
ATOM   720   C CA  . ILE A 1 98  ? 44.223  42.630  128.735 1.00 75.69 ? 96  ILE A CA  1 
ATOM   721   C C   . ILE A 1 98  ? 43.937  42.987  127.278 1.00 81.87 ? 96  ILE A C   1 
ATOM   722   O O   . ILE A 1 98  ? 42.880  43.533  126.953 1.00 76.87 ? 96  ILE A O   1 
ATOM   723   C CB  . ILE A 1 98  ? 44.859  43.883  129.363 1.00 81.65 ? 96  ILE A CB  1 
ATOM   724   C CG1 . ILE A 1 98  ? 45.275  43.612  130.806 1.00 87.00 ? 96  ILE A CG1 1 
ATOM   725   C CG2 . ILE A 1 98  ? 43.875  45.040  129.304 1.00 75.79 ? 96  ILE A CG2 1 
ATOM   726   C CD1 . ILE A 1 98  ? 46.071  44.758  131.425 1.00 88.79 ? 96  ILE A CD1 1 
ATOM   727   N N   . LEU A 1 99  ? 44.903  42.691  126.412 1.00 83.90 ? 97  LEU A N   1 
ATOM   728   C CA  . LEU A 1 99  ? 44.787  42.979  124.988 1.00 83.90 ? 97  LEU A CA  1 
ATOM   729   C C   . LEU A 1 99  ? 44.171  41.827  124.214 1.00 83.90 ? 97  LEU A C   1 
ATOM   730   O O   . LEU A 1 99  ? 43.384  42.042  123.299 1.00 83.90 ? 97  LEU A O   1 
ATOM   731   C CB  . LEU A 1 99  ? 46.160  43.306  124.409 1.00 37.42 ? 97  LEU A CB  1 
ATOM   732   C CG  . LEU A 1 99  ? 46.792  44.596  124.924 1.00 46.57 ? 97  LEU A CG  1 
ATOM   733   C CD1 . LEU A 1 99  ? 48.095  44.837  124.192 1.00 45.48 ? 97  LEU A CD1 1 
ATOM   734   C CD2 . LEU A 1 99  ? 45.842  45.766  124.709 1.00 40.73 ? 97  LEU A CD2 1 
ATOM   735   N N   . LYS A 1 100 ? 44.532  40.605  124.582 1.00 41.02 ? 98  LYS A N   1 
ATOM   736   C CA  . LYS A 1 100 ? 44.012  39.417  123.917 1.00 50.27 ? 98  LYS A CA  1 
ATOM   737   C C   . LYS A 1 100 ? 42.504  39.312  124.091 1.00 53.84 ? 98  LYS A C   1 
ATOM   738   O O   . LYS A 1 100 ? 41.765  39.149  123.126 1.00 53.89 ? 98  LYS A O   1 
ATOM   739   C CB  . LYS A 1 100 ? 44.683  38.171  124.489 1.00 41.94 ? 98  LYS A CB  1 
ATOM   740   C CG  . LYS A 1 100 ? 44.399  36.887  123.748 1.00 65.04 ? 98  LYS A CG  1 
ATOM   741   C CD  . LYS A 1 100 ? 45.286  35.796  124.298 1.00 69.09 ? 98  LYS A CD  1 
ATOM   742   C CE  . LYS A 1 100 ? 46.750  36.225  124.254 1.00 63.37 ? 98  LYS A CE  1 
ATOM   743   N NZ  . LYS A 1 100 ? 47.598  35.376  125.136 1.00 77.84 ? 98  LYS A NZ  1 
ATOM   744   N N   . GLU A 1 101 ? 42.049  39.405  125.332 1.00 75.20 ? 99  GLU A N   1 
ATOM   745   C CA  . GLU A 1 101 ? 40.625  39.321  125.626 1.00 78.91 ? 99  GLU A CA  1 
ATOM   746   C C   . GLU A 1 101 ? 39.884  40.255  124.687 1.00 79.10 ? 99  GLU A C   1 
ATOM   747   O O   . GLU A 1 101 ? 39.011  39.833  123.937 1.00 79.10 ? 99  GLU A O   1 
ATOM   748   C CB  . GLU A 1 101 ? 40.377  39.727  127.081 1.00 92.42 ? 99  GLU A CB  1 
ATOM   749   C CG  . GLU A 1 101 ? 39.019  39.326  127.645 1.00 92.42 ? 99  GLU A CG  1 
ATOM   750   C CD  . GLU A 1 101 ? 39.070  39.030  129.158 1.00 92.42 ? 99  GLU A CD  1 
ATOM   751   O OE1 . GLU A 1 101 ? 38.005  38.723  129.750 1.00 92.42 ? 99  GLU A OE1 1 
ATOM   752   O OE2 . GLU A 1 101 ? 40.172  39.095  129.758 1.00 92.42 ? 99  GLU A OE2 1 
ATOM   753   N N   . LYS A 1 102 ? 40.267  41.526  124.720 1.00 48.24 ? 100 LYS A N   1 
ATOM   754   C CA  . LYS A 1 102 ? 39.652  42.547  123.887 1.00 54.28 ? 100 LYS A CA  1 
ATOM   755   C C   . LYS A 1 102 ? 39.827  42.321  122.391 1.00 56.79 ? 100 LYS A C   1 
ATOM   756   O O   . LYS A 1 102 ? 39.471  43.182  121.589 1.00 54.02 ? 100 LYS A O   1 
ATOM   757   C CB  . LYS A 1 102 ? 40.196  43.929  124.258 1.00 33.06 ? 100 LYS A CB  1 
ATOM   758   C CG  . LYS A 1 102 ? 40.007  44.283  125.729 1.00 42.73 ? 100 LYS A CG  1 
ATOM   759   C CD  . LYS A 1 102 ? 40.358  45.731  125.994 1.00 47.95 ? 100 LYS A CD  1 
ATOM   760   C CE  . LYS A 1 102 ? 40.282  46.042  127.469 1.00 53.18 ? 100 LYS A CE  1 
ATOM   761   N NZ  . LYS A 1 102 ? 40.565  47.480  127.702 1.00 52.11 ? 100 LYS A NZ  1 
ATOM   762   N N   . GLY A 1 103 ? 40.388  41.177  122.011 1.00 72.61 ? 101 GLY A N   1 
ATOM   763   C CA  . GLY A 1 103 ? 40.559  40.883  120.596 1.00 75.09 ? 101 GLY A CA  1 
ATOM   764   C C   . GLY A 1 103 ? 41.820  41.339  119.874 1.00 79.27 ? 101 GLY A C   1 
ATOM   765   O O   . GLY A 1 103 ? 42.108  40.844  118.782 1.00 85.26 ? 101 GLY A O   1 
ATOM   766   N N   . ILE A 1 104 ? 42.562  42.284  120.446 1.00 31.59 ? 102 ILE A N   1 
ATOM   767   C CA  . ILE A 1 104 ? 43.792  42.756  119.820 1.00 34.69 ? 102 ILE A CA  1 
ATOM   768   C C   . ILE A 1 104 ? 44.833  41.632  119.834 1.00 39.40 ? 102 ILE A C   1 
ATOM   769   O O   . ILE A 1 104 ? 44.749  40.707  120.636 1.00 41.37 ? 102 ILE A O   1 
ATOM   770   C CB  . ILE A 1 104 ? 44.336  44.016  120.541 1.00 33.22 ? 102 ILE A CB  1 
ATOM   771   C CG1 . ILE A 1 104 ? 43.394  45.200  120.278 1.00 33.91 ? 102 ILE A CG1 1 
ATOM   772   C CG2 . ILE A 1 104 ? 45.729  44.350  120.052 1.00 34.39 ? 102 ILE A CG2 1 
ATOM   773   C CD1 . ILE A 1 104 ? 43.879  46.544  120.828 1.00 35.01 ? 102 ILE A CD1 1 
ATOM   774   N N   . VAL A 1 105 ? 45.802  41.693  118.929 1.00 58.32 ? 103 VAL A N   1 
ATOM   775   C CA  . VAL A 1 105 ? 46.815  40.654  118.871 1.00 47.57 ? 103 VAL A CA  1 
ATOM   776   C C   . VAL A 1 105 ? 48.116  41.103  119.499 1.00 58.19 ? 103 VAL A C   1 
ATOM   777   O O   . VAL A 1 105 ? 48.522  42.266  119.394 1.00 60.50 ? 103 VAL A O   1 
ATOM   778   C CB  . VAL A 1 105 ? 47.091  40.217  117.432 1.00 54.94 ? 103 VAL A CB  1 
ATOM   779   C CG1 . VAL A 1 105 ? 47.911  38.940  117.442 1.00 44.39 ? 103 VAL A CG1 1 
ATOM   780   C CG2 . VAL A 1 105 ? 45.781  40.008  116.692 1.00 38.07 ? 103 VAL A CG2 1 
ATOM   781   N N   . VAL A 1 106 ? 48.770  40.156  120.150 1.00 72.30 ? 104 VAL A N   1 
ATOM   782   C CA  . VAL A 1 106 ? 50.023  40.423  120.823 1.00 72.30 ? 104 VAL A CA  1 
ATOM   783   C C   . VAL A 1 106 ? 51.199  40.446  119.843 1.00 72.30 ? 104 VAL A C   1 
ATOM   784   O O   . VAL A 1 106 ? 51.377  39.520  119.051 1.00 72.30 ? 104 VAL A O   1 
ATOM   785   C CB  . VAL A 1 106 ? 50.272  39.348  121.901 1.00 78.43 ? 104 VAL A CB  1 
ATOM   786   C CG1 . VAL A 1 106 ? 51.396  39.773  122.819 1.00 78.43 ? 104 VAL A CG1 1 
ATOM   787   C CG2 . VAL A 1 106 ? 48.992  39.096  122.688 1.00 78.43 ? 104 VAL A CG2 1 
ATOM   788   N N   . GLY A 1 107 ? 51.985  41.518  119.894 1.00 59.97 ? 105 GLY A N   1 
ATOM   789   C CA  . GLY A 1 107 ? 53.157  41.640  119.040 1.00 59.97 ? 105 GLY A CA  1 
ATOM   790   C C   . GLY A 1 107 ? 54.410  41.724  119.900 1.00 59.97 ? 105 GLY A C   1 
ATOM   791   O O   . GLY A 1 107 ? 54.333  42.172  121.042 1.00 59.97 ? 105 GLY A O   1 
ATOM   792   N N   . ILE A 1 108 ? 55.560  41.286  119.391 1.00 73.43 ? 106 ILE A N   1 
ATOM   793   C CA  . ILE A 1 108 ? 56.785  41.358  120.196 1.00 73.43 ? 106 ILE A CA  1 
ATOM   794   C C   . ILE A 1 108 ? 58.047  41.743  119.433 1.00 73.43 ? 106 ILE A C   1 
ATOM   795   O O   . ILE A 1 108 ? 58.434  41.085  118.466 1.00 73.43 ? 106 ILE A O   1 
ATOM   796   C CB  . ILE A 1 108 ? 57.078  40.026  120.938 1.00 56.97 ? 106 ILE A CB  1 
ATOM   797   C CG1 . ILE A 1 108 ? 58.084  40.277  122.069 1.00 55.86 ? 106 ILE A CG1 1 
ATOM   798   C CG2 . ILE A 1 108 ? 57.670  38.995  119.979 1.00 49.53 ? 106 ILE A CG2 1 
ATOM   799   C CD1 . ILE A 1 108 ? 57.553  41.147  123.204 1.00 62.55 ? 106 ILE A CD1 1 
ATOM   800   N N   . LYS A 1 109 ? 58.699  42.804  119.895 1.00 77.99 ? 107 LYS A N   1 
ATOM   801   C CA  . LYS A 1 109 ? 59.924  43.278  119.265 1.00 77.99 ? 107 LYS A CA  1 
ATOM   802   C C   . LYS A 1 109 ? 61.027  42.235  119.428 1.00 77.99 ? 107 LYS A C   1 
ATOM   803   O O   . LYS A 1 109 ? 61.565  42.066  120.519 1.00 77.99 ? 107 LYS A O   1 
ATOM   804   C CB  . LYS A 1 109 ? 60.364  44.602  119.903 1.00 42.17 ? 107 LYS A CB  1 
ATOM   805   C CG  . LYS A 1 109 ? 61.146  45.531  118.969 1.00 44.62 ? 107 LYS A CG  1 
ATOM   806   C CD  . LYS A 1 109 ? 61.407  46.876  119.626 1.00 42.62 ? 107 LYS A CD  1 
ATOM   807   C CE  . LYS A 1 109 ? 61.920  47.893  118.615 1.00 48.79 ? 107 LYS A CE  1 
ATOM   808   N NZ  . LYS A 1 109 ? 62.056  49.242  119.245 1.00 74.15 ? 107 LYS A NZ  1 
ATOM   809   N N   . LEU A 1 110 ? 61.349  41.530  118.348 1.00 92.42 ? 108 LEU A N   1 
ATOM   810   C CA  . LEU A 1 110 ? 62.403  40.515  118.378 1.00 92.42 ? 108 LEU A CA  1 
ATOM   811   C C   . LEU A 1 110 ? 63.767  41.195  118.209 1.00 92.42 ? 108 LEU A C   1 
ATOM   812   O O   . LEU A 1 110 ? 64.820  40.542  118.126 1.00 92.42 ? 108 LEU A O   1 
ATOM   813   C CB  . LEU A 1 110 ? 62.190  39.500  117.251 1.00 18.55 ? 108 LEU A CB  1 
ATOM   814   C CG  . LEU A 1 110 ? 61.001  38.569  117.395 1.00 34.47 ? 108 LEU A CG  1 
ATOM   815   C CD1 . LEU A 1 110 ? 61.067  37.510  116.330 1.00 16.30 ? 108 LEU A CD1 1 
ATOM   816   C CD2 . LEU A 1 110 ? 61.037  37.922  118.752 1.00 24.48 ? 108 LEU A CD2 1 
ATOM   817   N N   . ASP A 1 111 ? 63.715  42.523  118.171 1.00 92.42 ? 109 ASP A N   1 
ATOM   818   C CA  . ASP A 1 111 ? 64.878  43.380  117.990 1.00 92.42 ? 109 ASP A CA  1 
ATOM   819   C C   . ASP A 1 111 ? 65.531  43.745  119.333 1.00 92.42 ? 109 ASP A C   1 
ATOM   820   O O   . ASP A 1 111 ? 65.250  43.145  120.380 1.00 92.42 ? 109 ASP A O   1 
ATOM   821   C CB  . ASP A 1 111 ? 64.419  44.641  117.243 1.00 92.42 ? 109 ASP A CB  1 
ATOM   822   C CG  . ASP A 1 111 ? 65.562  45.427  116.644 1.00 92.42 ? 109 ASP A CG  1 
ATOM   823   O OD1 . ASP A 1 111 ? 66.251  46.164  117.387 1.00 92.42 ? 109 ASP A OD1 1 
ATOM   824   O OD2 . ASP A 1 111 ? 65.763  45.302  115.417 1.00 92.42 ? 109 ASP A OD2 1 
ATOM   825   N N   . GLY A 1 128 ? 71.086  39.950  114.825 1.00 90.71 ? 126 GLY A N   1 
ATOM   826   C CA  . GLY A 1 128 ? 71.470  38.562  115.017 1.00 90.71 ? 126 GLY A CA  1 
ATOM   827   C C   . GLY A 1 128 ? 70.299  37.587  115.037 1.00 90.71 ? 126 GLY A C   1 
ATOM   828   O O   . GLY A 1 128 ? 69.428  37.654  115.923 1.00 90.71 ? 126 GLY A O   1 
ATOM   829   N N   . LEU A 1 129 ? 70.289  36.675  114.060 1.00 92.42 ? 127 LEU A N   1 
ATOM   830   C CA  . LEU A 1 129 ? 69.245  35.649  113.915 1.00 92.42 ? 127 LEU A CA  1 
ATOM   831   C C   . LEU A 1 129 ? 69.565  34.414  114.752 1.00 92.42 ? 127 LEU A C   1 
ATOM   832   O O   . LEU A 1 129 ? 68.980  33.343  114.568 1.00 92.42 ? 127 LEU A O   1 
ATOM   833   C CB  . LEU A 1 129 ? 69.113  35.220  112.453 1.00 74.48 ? 127 LEU A CB  1 
ATOM   834   C CG  . LEU A 1 129 ? 69.066  36.320  111.400 1.00 74.48 ? 127 LEU A CG  1 
ATOM   835   C CD1 . LEU A 1 129 ? 68.869  35.665  110.047 1.00 74.48 ? 127 LEU A CD1 1 
ATOM   836   C CD2 . LEU A 1 129 ? 67.951  37.304  111.700 1.00 74.48 ? 127 LEU A CD2 1 
ATOM   837   N N   . ASP A 1 130 ? 70.511  34.566  115.663 1.00 92.42 ? 128 ASP A N   1 
ATOM   838   C CA  . ASP A 1 130 ? 70.888  33.466  116.517 1.00 92.42 ? 128 ASP A CA  1 
ATOM   839   C C   . ASP A 1 130 ? 69.973  33.476  117.736 1.00 92.42 ? 128 ASP A C   1 
ATOM   840   O O   . ASP A 1 130 ? 69.874  34.483  118.445 1.00 92.42 ? 128 ASP A O   1 
ATOM   841   C CB  . ASP A 1 130 ? 72.345  33.611  116.940 1.00 85.94 ? 128 ASP A CB  1 
ATOM   842   C CG  . ASP A 1 130 ? 72.929  32.309  117.419 1.00 85.94 ? 128 ASP A CG  1 
ATOM   843   O OD1 . ASP A 1 130 ? 72.937  31.347  116.616 1.00 85.94 ? 128 ASP A OD1 1 
ATOM   844   O OD2 . ASP A 1 130 ? 73.371  32.246  118.590 1.00 85.94 ? 128 ASP A OD2 1 
ATOM   845   N N   . GLY A 1 131 ? 69.296  32.355  117.968 1.00 88.84 ? 129 GLY A N   1 
ATOM   846   C CA  . GLY A 1 131 ? 68.394  32.269  119.096 1.00 88.84 ? 129 GLY A CA  1 
ATOM   847   C C   . GLY A 1 131 ? 66.982  32.710  118.747 1.00 88.84 ? 129 GLY A C   1 
ATOM   848   O O   . GLY A 1 131 ? 66.108  32.732  119.618 1.00 88.84 ? 129 GLY A O   1 
ATOM   849   N N   . LEU A 1 132 ? 66.745  33.050  117.480 1.00 51.56 ? 130 LEU A N   1 
ATOM   850   C CA  . LEU A 1 132 ? 65.423  33.504  117.054 1.00 50.70 ? 130 LEU A CA  1 
ATOM   851   C C   . LEU A 1 132 ? 64.457  32.344  116.905 1.00 42.58 ? 130 LEU A C   1 
ATOM   852   O O   . LEU A 1 132 ? 63.332  32.434  117.363 1.00 50.81 ? 130 LEU A O   1 
ATOM   853   C CB  . LEU A 1 132 ? 65.519  34.310  115.748 1.00 35.57 ? 130 LEU A CB  1 
ATOM   854   C CG  . LEU A 1 132 ? 64.745  35.649  115.677 1.00 44.63 ? 130 LEU A CG  1 
ATOM   855   C CD1 . LEU A 1 132 ? 64.912  36.450  116.963 1.00 25.30 ? 130 LEU A CD1 1 
ATOM   856   C CD2 . LEU A 1 132 ? 65.237  36.469  114.484 1.00 31.06 ? 130 LEU A CD2 1 
ATOM   857   N N   . SER A 1 133 ? 64.887  31.248  116.287 1.00 70.82 ? 131 SER A N   1 
ATOM   858   C CA  . SER A 1 133 ? 64.009  30.085  116.130 1.00 70.82 ? 131 SER A CA  1 
ATOM   859   C C   . SER A 1 133 ? 63.656  29.472  117.477 1.00 70.82 ? 131 SER A C   1 
ATOM   860   O O   . SER A 1 133 ? 62.823  28.569  117.554 1.00 70.82 ? 131 SER A O   1 
ATOM   861   C CB  . SER A 1 133 ? 64.669  29.000  115.276 1.00 77.88 ? 131 SER A CB  1 
ATOM   862   O OG  . SER A 1 133 ? 63.928  27.785  115.340 1.00 77.88 ? 131 SER A OG  1 
ATOM   863   N N   . GLU A 1 134 ? 64.303  29.953  118.535 1.00 49.74 ? 132 GLU A N   1 
ATOM   864   C CA  . GLU A 1 134 ? 64.065  29.439  119.881 1.00 49.74 ? 132 GLU A CA  1 
ATOM   865   C C   . GLU A 1 134 ? 63.259  30.482  120.650 1.00 49.74 ? 132 GLU A C   1 
ATOM   866   O O   . GLU A 1 134 ? 62.208  30.174  121.219 1.00 49.74 ? 132 GLU A O   1 
ATOM   867   C CB  . GLU A 1 134 ? 65.409  29.157  120.581 1.00 69.25 ? 132 GLU A CB  1 
ATOM   868   C CG  . GLU A 1 134 ? 66.360  28.138  119.863 1.00 69.25 ? 132 GLU A CG  1 
ATOM   869   C CD  . GLU A 1 134 ? 67.123  28.699  118.633 1.00 69.25 ? 132 GLU A CD  1 
ATOM   870   O OE1 . GLU A 1 134 ? 67.767  29.762  118.743 1.00 69.25 ? 132 GLU A OE1 1 
ATOM   871   O OE2 . GLU A 1 134 ? 67.103  28.065  117.551 1.00 69.25 ? 132 GLU A OE2 1 
ATOM   872   N N   . ARG A 1 135 ? 63.760  31.718  120.636 1.00 68.88 ? 133 ARG A N   1 
ATOM   873   C CA  . ARG A 1 135 ? 63.120  32.858  121.292 1.00 68.88 ? 133 ARG A CA  1 
ATOM   874   C C   . ARG A 1 135 ? 61.689  33.046  120.787 1.00 68.88 ? 133 ARG A C   1 
ATOM   875   O O   . ARG A 1 135 ? 60.796  33.421  121.549 1.00 68.88 ? 133 ARG A O   1 
ATOM   876   C CB  . ARG A 1 135 ? 63.917  34.139  121.025 1.00 92.42 ? 133 ARG A CB  1 
ATOM   877   C CG  . ARG A 1 135 ? 64.870  34.547  122.145 1.00 92.42 ? 133 ARG A CG  1 
ATOM   878   C CD  . ARG A 1 135 ? 66.190  35.098  121.606 1.00 92.42 ? 133 ARG A CD  1 
ATOM   879   N NE  . ARG A 1 135 ? 66.020  36.176  120.633 1.00 92.42 ? 133 ARG A NE  1 
ATOM   880   C CZ  . ARG A 1 135 ? 67.005  36.655  119.868 1.00 92.42 ? 133 ARG A CZ  1 
ATOM   881   N NH1 . ARG A 1 135 ? 68.233  36.151  119.963 1.00 92.42 ? 133 ARG A NH1 1 
ATOM   882   N NH2 . ARG A 1 135 ? 66.768  37.637  119.001 1.00 92.42 ? 133 ARG A NH2 1 
ATOM   883   N N   . CYS A 1 136 ? 61.486  32.794  119.496 1.00 92.42 ? 134 CYS A N   1 
ATOM   884   C CA  . CYS A 1 136 ? 60.169  32.918  118.877 1.00 92.42 ? 134 CYS A CA  1 
ATOM   885   C C   . CYS A 1 136 ? 59.271  31.799  119.377 1.00 92.42 ? 134 CYS A C   1 
ATOM   886   O O   . CYS A 1 136 ? 58.159  32.041  119.852 1.00 92.42 ? 134 CYS A O   1 
ATOM   887   C CB  . CYS A 1 136 ? 60.269  32.827  117.347 1.00 77.72 ? 134 CYS A CB  1 
ATOM   888   S SG  . CYS A 1 136 ? 61.130  34.199  116.521 1.00 77.72 ? 134 CYS A SG  1 
ATOM   889   N N   . ALA A 1 137 ? 59.763  30.570  119.265 1.00 65.26 ? 135 ALA A N   1 
ATOM   890   C CA  . ALA A 1 137 ? 59.002  29.414  119.709 1.00 65.26 ? 135 ALA A CA  1 
ATOM   891   C C   . ALA A 1 137 ? 58.371  29.734  121.058 1.00 65.26 ? 135 ALA A C   1 
ATOM   892   O O   . ALA A 1 137 ? 57.159  29.536  121.262 1.00 65.26 ? 135 ALA A O   1 
ATOM   893   C CB  . ALA A 1 137 ? 59.910  28.219  119.830 1.00 88.49 ? 135 ALA A CB  1 
ATOM   894   N N   . GLN A 1 138 ? 59.207  30.222  121.976 1.00 92.42 ? 136 GLN A N   1 
ATOM   895   C CA  . GLN A 1 138 ? 58.725  30.603  123.299 1.00 92.42 ? 136 GLN A CA  1 
ATOM   896   C C   . GLN A 1 138 ? 57.700  31.725  123.125 1.00 92.42 ? 136 GLN A C   1 
ATOM   897   O O   . GLN A 1 138 ? 56.518  31.530  123.421 1.00 92.42 ? 136 GLN A O   1 
ATOM   898   C CB  . GLN A 1 138 ? 59.859  31.100  124.194 1.00 68.34 ? 136 GLN A CB  1 
ATOM   899   C CG  . GLN A 1 138 ? 59.437  31.320  125.656 1.00 68.34 ? 136 GLN A CG  1 
ATOM   900   C CD  . GLN A 1 138 ? 59.040  30.021  126.345 1.00 68.34 ? 136 GLN A CD  1 
ATOM   901   O OE1 . GLN A 1 138 ? 59.197  28.930  125.793 1.00 68.34 ? 136 GLN A OE1 1 
ATOM   902   N NE2 . GLN A 1 138 ? 58.530  30.136  127.557 1.00 68.34 ? 136 GLN A NE2 1 
ATOM   903   N N   . TYR A 1 139 ? 58.139  32.882  122.624 1.00 38.29 ? 137 TYR A N   1 
ATOM   904   C CA  . TYR A 1 139 ? 57.238  34.004  122.417 1.00 38.29 ? 137 TYR A CA  1 
ATOM   905   C C   . TYR A 1 139 ? 55.806  33.624  122.014 1.00 38.29 ? 137 TYR A C   1 
ATOM   906   O O   . TYR A 1 139 ? 54.848  34.173  122.555 1.00 38.29 ? 137 TYR A O   1 
ATOM   907   C CB  . TYR A 1 139 ? 57.841  34.964  121.395 1.00 61.57 ? 137 TYR A CB  1 
ATOM   908   C CG  . TYR A 1 139 ? 58.736  35.981  122.043 1.00 61.57 ? 137 TYR A CG  1 
ATOM   909   C CD1 . TYR A 1 139 ? 58.265  36.762  123.087 1.00 61.57 ? 137 TYR A CD1 1 
ATOM   910   C CD2 . TYR A 1 139 ? 60.057  36.157  121.630 1.00 61.57 ? 137 TYR A CD2 1 
ATOM   911   C CE1 . TYR A 1 139 ? 59.082  37.694  123.712 1.00 61.57 ? 137 TYR A CE1 1 
ATOM   912   C CE2 . TYR A 1 139 ? 60.887  37.093  122.246 1.00 61.57 ? 137 TYR A CE2 1 
ATOM   913   C CZ  . TYR A 1 139 ? 60.388  37.857  123.287 1.00 61.57 ? 137 TYR A CZ  1 
ATOM   914   O OH  . TYR A 1 139 ? 61.184  38.792  123.899 1.00 61.57 ? 137 TYR A OH  1 
ATOM   915   N N   . LYS A 1 140 ? 55.653  32.698  121.071 1.00 70.67 ? 138 LYS A N   1 
ATOM   916   C CA  . LYS A 1 140 ? 54.322  32.281  120.641 1.00 70.67 ? 138 LYS A CA  1 
ATOM   917   C C   . LYS A 1 140 ? 53.572  31.756  121.848 1.00 70.67 ? 138 LYS A C   1 
ATOM   918   O O   . LYS A 1 140 ? 52.451  32.179  122.123 1.00 70.67 ? 138 LYS A O   1 
ATOM   919   C CB  . LYS A 1 140 ? 54.408  31.178  119.589 1.00 73.01 ? 138 LYS A CB  1 
ATOM   920   C CG  . LYS A 1 140 ? 53.050  30.780  119.012 1.00 73.01 ? 138 LYS A CG  1 
ATOM   921   C CD  . LYS A 1 140 ? 52.401  31.926  118.223 1.00 73.01 ? 138 LYS A CD  1 
ATOM   922   C CE  . LYS A 1 140 ? 51.079  31.481  117.589 1.00 73.01 ? 138 LYS A CE  1 
ATOM   923   N NZ  . LYS A 1 140 ? 50.410  32.557  116.812 1.00 73.01 ? 138 LYS A NZ  1 
ATOM   924   N N   . LYS A 1 141 ? 54.194  30.824  122.561 1.00 57.49 ? 139 LYS A N   1 
ATOM   925   C CA  . LYS A 1 141 ? 53.593  30.241  123.763 1.00 57.49 ? 139 LYS A CA  1 
ATOM   926   C C   . LYS A 1 141 ? 53.175  31.336  124.761 1.00 57.49 ? 139 LYS A C   1 
ATOM   927   O O   . LYS A 1 141 ? 52.105  31.270  125.365 1.00 57.49 ? 139 LYS A O   1 
ATOM   928   C CB  . LYS A 1 141 ? 54.589  29.268  124.398 1.00 86.85 ? 139 LYS A CB  1 
ATOM   929   C CG  . LYS A 1 141 ? 55.021  28.175  123.429 1.00 86.85 ? 139 LYS A CG  1 
ATOM   930   C CD  . LYS A 1 141 ? 56.219  27.386  123.940 1.00 86.85 ? 139 LYS A CD  1 
ATOM   931   C CE  . LYS A 1 141 ? 56.519  26.184  123.039 1.00 86.85 ? 139 LYS A CE  1 
ATOM   932   N NZ  . LYS A 1 141 ? 56.805  26.556  121.621 1.00 86.85 ? 139 LYS A NZ  1 
ATOM   933   N N   . ASP A 1 142 ? 54.023  32.350  124.902 1.00 70.91 ? 140 ASP A N   1 
ATOM   934   C CA  . ASP A 1 142 ? 53.758  33.467  125.799 1.00 70.91 ? 140 ASP A CA  1 
ATOM   935   C C   . ASP A 1 142 ? 52.738  34.428  125.213 1.00 70.91 ? 140 ASP A C   1 
ATOM   936   O O   . ASP A 1 142 ? 52.725  35.604  125.569 1.00 70.91 ? 140 ASP A O   1 
ATOM   937   C CB  . ASP A 1 142 ? 55.045  34.236  126.088 1.00 84.80 ? 140 ASP A CB  1 
ATOM   938   C CG  . ASP A 1 142 ? 55.989  33.475  126.999 1.00 84.80 ? 140 ASP A CG  1 
ATOM   939   O OD1 . ASP A 1 142 ? 56.285  32.290  126.726 1.00 84.80 ? 140 ASP A OD1 1 
ATOM   940   O OD2 . ASP A 1 142 ? 56.445  34.067  127.994 1.00 84.80 ? 140 ASP A OD2 1 
ATOM   941   N N   . GLY A 1 143 ? 51.909  33.934  124.294 1.00 69.47 ? 141 GLY A N   1 
ATOM   942   C CA  . GLY A 1 143 ? 50.871  34.758  123.688 1.00 69.47 ? 141 GLY A CA  1 
ATOM   943   C C   . GLY A 1 143 ? 51.180  35.779  122.595 1.00 69.47 ? 141 GLY A C   1 
ATOM   944   O O   . GLY A 1 143 ? 50.407  36.716  122.414 1.00 69.47 ? 141 GLY A O   1 
ATOM   945   N N   . VAL A 1 144 ? 52.280  35.617  121.864 1.00 46.71 ? 142 VAL A N   1 
ATOM   946   C CA  . VAL A 1 144 ? 52.616  36.547  120.785 1.00 46.71 ? 142 VAL A CA  1 
ATOM   947   C C   . VAL A 1 144 ? 52.250  35.888  119.447 1.00 46.71 ? 142 VAL A C   1 
ATOM   948   O O   . VAL A 1 144 ? 52.477  34.685  119.261 1.00 46.71 ? 142 VAL A O   1 
ATOM   949   C CB  . VAL A 1 144 ? 54.129  36.875  120.771 1.00 34.64 ? 142 VAL A CB  1 
ATOM   950   C CG1 . VAL A 1 144 ? 54.379  38.143  119.970 1.00 34.64 ? 142 VAL A CG1 1 
ATOM   951   C CG2 . VAL A 1 144 ? 54.654  37.014  122.189 1.00 34.64 ? 142 VAL A CG2 1 
ATOM   952   N N   . ASP A 1 145 ? 51.685  36.663  118.519 1.00 56.31 ? 143 ASP A N   1 
ATOM   953   C CA  . ASP A 1 145 ? 51.295  36.127  117.210 1.00 56.31 ? 143 ASP A CA  1 
ATOM   954   C C   . ASP A 1 145 ? 52.036  36.761  116.030 1.00 56.31 ? 143 ASP A C   1 
ATOM   955   O O   . ASP A 1 145 ? 51.760  36.445  114.875 1.00 56.31 ? 143 ASP A O   1 
ATOM   956   C CB  . ASP A 1 145 ? 49.782  36.276  116.994 1.00 43.02 ? 143 ASP A CB  1 
ATOM   957   C CG  . ASP A 1 145 ? 48.955  35.455  117.988 1.00 43.02 ? 143 ASP A CG  1 
ATOM   958   O OD1 . ASP A 1 145 ? 49.014  34.198  117.951 1.00 43.02 ? 143 ASP A OD1 1 
ATOM   959   O OD2 . ASP A 1 145 ? 48.240  36.079  118.810 1.00 43.02 ? 143 ASP A OD2 1 
ATOM   960   N N   . PHE A 1 146 ? 52.977  37.652  116.317 1.00 68.73 ? 144 PHE A N   1 
ATOM   961   C CA  . PHE A 1 146 ? 53.743  38.285  115.259 1.00 68.73 ? 144 PHE A CA  1 
ATOM   962   C C   . PHE A 1 146 ? 54.974  39.012  115.787 1.00 68.73 ? 144 PHE A C   1 
ATOM   963   O O   . PHE A 1 146 ? 54.974  39.503  116.915 1.00 68.73 ? 144 PHE A O   1 
ATOM   964   C CB  . PHE A 1 146 ? 52.829  39.222  114.470 1.00 31.09 ? 144 PHE A CB  1 
ATOM   965   C CG  . PHE A 1 146 ? 52.643  40.597  115.071 1.00 31.09 ? 144 PHE A CG  1 
ATOM   966   C CD1 . PHE A 1 146 ? 53.394  41.684  114.602 1.00 31.09 ? 144 PHE A CD1 1 
ATOM   967   C CD2 . PHE A 1 146 ? 51.628  40.844  115.984 1.00 31.09 ? 144 PHE A CD2 1 
ATOM   968   C CE1 . PHE A 1 146 ? 53.121  42.997  115.023 1.00 31.09 ? 144 PHE A CE1 1 
ATOM   969   C CE2 . PHE A 1 146 ? 51.353  42.168  116.408 1.00 31.09 ? 144 PHE A CE2 1 
ATOM   970   C CZ  . PHE A 1 146 ? 52.099  43.240  115.921 1.00 31.09 ? 144 PHE A CZ  1 
ATOM   971   N N   . GLY A 1 147 ? 56.030  39.068  114.981 1.00 79.87 ? 145 GLY A N   1 
ATOM   972   C CA  . GLY A 1 147 ? 57.241  39.731  115.428 1.00 79.87 ? 145 GLY A CA  1 
ATOM   973   C C   . GLY A 1 147 ? 57.777  40.843  114.543 1.00 79.87 ? 145 GLY A C   1 
ATOM   974   O O   . GLY A 1 147 ? 57.638  40.797  113.319 1.00 79.87 ? 145 GLY A O   1 
ATOM   975   N N   . LYS A 1 148 ? 58.380  41.848  115.181 1.00 77.19 ? 146 LYS A N   1 
ATOM   976   C CA  . LYS A 1 148 ? 58.989  42.990  114.496 1.00 77.19 ? 146 LYS A CA  1 
ATOM   977   C C   . LYS A 1 148 ? 60.497  42.883  114.667 1.00 77.19 ? 146 LYS A C   1 
ATOM   978   O O   . LYS A 1 148 ? 60.986  42.414  115.695 1.00 77.19 ? 146 LYS A O   1 
ATOM   979   C CB  . LYS A 1 148 ? 58.519  44.319  115.086 1.00 43.80 ? 146 LYS A CB  1 
ATOM   980   C CG  . LYS A 1 148 ? 59.199  45.535  114.472 1.00 47.26 ? 146 LYS A CG  1 
ATOM   981   C CD  . LYS A 1 148 ? 58.737  46.831  115.130 1.00 46.03 ? 146 LYS A CD  1 
ATOM   982   C CE  . LYS A 1 148 ? 59.478  48.042  114.574 1.00 57.98 ? 146 LYS A CE  1 
ATOM   983   N NZ  . LYS A 1 148 ? 59.093  49.307  115.250 1.00 53.26 ? 146 LYS A NZ  1 
ATOM   984   N N   . TRP A 1 149 ? 61.223  43.338  113.654 1.00 92.42 ? 147 TRP A N   1 
ATOM   985   C CA  . TRP A 1 149 ? 62.681  43.281  113.630 1.00 92.42 ? 147 TRP A CA  1 
ATOM   986   C C   . TRP A 1 149 ? 63.160  44.133  112.461 1.00 92.42 ? 147 TRP A C   1 
ATOM   987   O O   . TRP A 1 149 ? 62.580  44.095  111.366 1.00 92.42 ? 147 TRP A O   1 
ATOM   988   C CB  . TRP A 1 149 ? 63.125  41.818  113.451 1.00 92.42 ? 147 TRP A CB  1 
ATOM   989   C CG  . TRP A 1 149 ? 64.505  41.601  112.874 1.00 92.42 ? 147 TRP A CG  1 
ATOM   990   C CD1 . TRP A 1 149 ? 64.953  41.972  111.634 1.00 92.42 ? 147 TRP A CD1 1 
ATOM   991   C CD2 . TRP A 1 149 ? 65.589  40.902  113.493 1.00 92.42 ? 147 TRP A CD2 1 
ATOM   992   N NE1 . TRP A 1 149 ? 66.248  41.547  111.442 1.00 92.42 ? 147 TRP A NE1 1 
ATOM   993   C CE2 . TRP A 1 149 ? 66.663  40.886  112.566 1.00 92.42 ? 147 TRP A CE2 1 
ATOM   994   C CE3 . TRP A 1 149 ? 65.758  40.284  114.741 1.00 92.42 ? 147 TRP A CE3 1 
ATOM   995   C CZ2 . TRP A 1 149 ? 67.888  40.277  112.847 1.00 92.42 ? 147 TRP A CZ2 1 
ATOM   996   C CZ3 . TRP A 1 149 ? 66.977  39.676  115.024 1.00 92.42 ? 147 TRP A CZ3 1 
ATOM   997   C CH2 . TRP A 1 149 ? 68.028  39.678  114.076 1.00 92.42 ? 147 TRP A CH2 1 
ATOM   998   N N   . ARG A 1 150 ? 64.219  44.900  112.690 1.00 92.42 ? 148 ARG A N   1 
ATOM   999   C CA  . ARG A 1 150 ? 64.769  45.754  111.644 1.00 92.42 ? 148 ARG A CA  1 
ATOM   1000  C C   . ARG A 1 150 ? 66.299  45.656  111.643 1.00 92.42 ? 148 ARG A C   1 
ATOM   1001  O O   . ARG A 1 150 ? 66.959  46.121  112.571 1.00 92.42 ? 148 ARG A O   1 
ATOM   1002  C CB  . ARG A 1 150 ? 64.311  47.203  111.872 1.00 92.42 ? 148 ARG A CB  1 
ATOM   1003  C CG  . ARG A 1 150 ? 64.514  47.646  113.308 1.00 92.42 ? 148 ARG A CG  1 
ATOM   1004  C CD  . ARG A 1 150 ? 63.890  48.990  113.655 1.00 92.42 ? 148 ARG A CD  1 
ATOM   1005  N NE  . ARG A 1 150 ? 64.210  49.319  115.045 1.00 92.42 ? 148 ARG A NE  1 
ATOM   1006  C CZ  . ARG A 1 150 ? 63.685  50.325  115.736 1.00 92.42 ? 148 ARG A CZ  1 
ATOM   1007  N NH1 . ARG A 1 150 ? 62.790  51.129  115.176 1.00 92.42 ? 148 ARG A NH1 1 
ATOM   1008  N NH2 . ARG A 1 150 ? 64.067  50.525  116.994 1.00 92.42 ? 148 ARG A NH2 1 
ATOM   1009  N N   . PRO A 1 151 ? 66.878  45.009  110.614 1.00 92.42 ? 149 PRO A N   1 
ATOM   1010  C CA  . PRO A 1 151 ? 68.332  44.872  110.529 1.00 92.42 ? 149 PRO A CA  1 
ATOM   1011  C C   . PRO A 1 151 ? 68.919  45.825  109.471 1.00 92.42 ? 149 PRO A C   1 
ATOM   1012  O O   . PRO A 1 151 ? 68.189  46.547  108.779 1.00 92.42 ? 149 PRO A O   1 
ATOM   1013  C CB  . PRO A 1 151 ? 68.499  43.408  110.153 1.00 92.42 ? 149 PRO A CB  1 
ATOM   1014  C CG  . PRO A 1 151 ? 67.424  43.249  109.130 1.00 92.42 ? 149 PRO A CG  1 
ATOM   1015  C CD  . PRO A 1 151 ? 66.230  44.044  109.706 1.00 92.42 ? 149 PRO A CD  1 
ATOM   1016  N N   . SER A 1 161 ? 74.444  50.880  99.308  1.00 65.42 ? 159 SER A N   1 
ATOM   1017  C CA  . SER A 1 161 ? 75.246  50.093  98.378  1.00 60.56 ? 159 SER A CA  1 
ATOM   1018  C C   . SER A 1 161 ? 74.496  48.832  97.993  1.00 65.62 ? 159 SER A C   1 
ATOM   1019  O O   . SER A 1 161 ? 73.757  48.276  98.801  1.00 73.03 ? 159 SER A O   1 
ATOM   1020  C CB  . SER A 1 161 ? 76.589  49.706  99.013  1.00 87.66 ? 159 SER A CB  1 
ATOM   1021  O OG  . SER A 1 161 ? 77.431  49.022  98.092  1.00 87.66 ? 159 SER A OG  1 
ATOM   1022  N N   . SER A 1 162 ? 74.697  48.390  96.753  1.00 54.58 ? 160 SER A N   1 
ATOM   1023  C CA  . SER A 1 162 ? 74.062  47.183  96.219  1.00 53.46 ? 160 SER A CA  1 
ATOM   1024  C C   . SER A 1 162 ? 74.273  46.022  97.191  1.00 51.58 ? 160 SER A C   1 
ATOM   1025  O O   . SER A 1 162 ? 73.358  45.240  97.479  1.00 61.66 ? 160 SER A O   1 
ATOM   1026  C CB  . SER A 1 162 ? 74.685  46.840  94.865  1.00 50.11 ? 160 SER A CB  1 
ATOM   1027  O OG  . SER A 1 162 ? 74.904  48.015  94.100  1.00 69.20 ? 160 SER A OG  1 
ATOM   1028  N N   . LEU A 1 163 ? 75.501  45.930  97.686  1.00 55.07 ? 161 LEU A N   1 
ATOM   1029  C CA  . LEU A 1 163 ? 75.907  44.909  98.636  1.00 55.07 ? 161 LEU A CA  1 
ATOM   1030  C C   . LEU A 1 163 ? 75.035  45.015  99.878  1.00 55.07 ? 161 LEU A C   1 
ATOM   1031  O O   . LEU A 1 163 ? 74.425  44.044  100.316 1.00 55.07 ? 161 LEU A O   1 
ATOM   1032  C CB  . LEU A 1 163 ? 77.364  45.138  99.018  1.00 70.62 ? 161 LEU A CB  1 
ATOM   1033  C CG  . LEU A 1 163 ? 78.036  44.082  99.889  1.00 70.62 ? 161 LEU A CG  1 
ATOM   1034  C CD1 . LEU A 1 163 ? 78.120  42.766  99.121  1.00 70.62 ? 161 LEU A CD1 1 
ATOM   1035  C CD2 . LEU A 1 163 ? 79.425  44.571  100.288 1.00 70.62 ? 161 LEU A CD2 1 
ATOM   1036  N N   . ALA A 1 164 ? 74.992  46.214  100.441 1.00 54.19 ? 162 ALA A N   1 
ATOM   1037  C CA  . ALA A 1 164 ? 74.203  46.485  101.631 1.00 54.19 ? 162 ALA A CA  1 
ATOM   1038  C C   . ALA A 1 164 ? 72.762  46.058  101.401 1.00 54.19 ? 162 ALA A C   1 
ATOM   1039  O O   . ALA A 1 164 ? 72.262  45.130  102.031 1.00 54.19 ? 162 ALA A O   1 
ATOM   1040  C CB  . ALA A 1 164 ? 74.260  47.984  101.959 1.00 24.26 ? 162 ALA A CB  1 
ATOM   1041  N N   . ILE A 1 165 ? 72.110  46.759  100.483 1.00 41.35 ? 163 ILE A N   1 
ATOM   1042  C CA  . ILE A 1 165 ? 70.727  46.519  100.132 1.00 41.35 ? 163 ILE A CA  1 
ATOM   1043  C C   . ILE A 1 165 ? 70.382  45.050  100.061 1.00 41.35 ? 163 ILE A C   1 
ATOM   1044  O O   . ILE A 1 165 ? 69.322  44.635  100.528 1.00 41.35 ? 163 ILE A O   1 
ATOM   1045  C CB  . ILE A 1 165 ? 70.403  47.199  98.791  1.00 30.75 ? 163 ILE A CB  1 
ATOM   1046  C CG1 . ILE A 1 165 ? 69.612  48.487  99.051  1.00 30.75 ? 163 ILE A CG1 1 
ATOM   1047  C CG2 . ILE A 1 165 ? 69.679  46.227  97.856  1.00 30.75 ? 163 ILE A CG2 1 
ATOM   1048  C CD1 . ILE A 1 165 ? 69.917  49.596  98.056  1.00 30.75 ? 163 ILE A CD1 1 
ATOM   1049  N N   . GLN A 1 166 ? 71.269  44.256  99.480  1.00 26.61 ? 164 GLN A N   1 
ATOM   1050  C CA  . GLN A 1 166 ? 70.997  42.829  99.369  1.00 26.61 ? 164 GLN A CA  1 
ATOM   1051  C C   . GLN A 1 166 ? 71.179  42.114  100.695 1.00 26.61 ? 164 GLN A C   1 
ATOM   1052  O O   . GLN A 1 166 ? 70.574  41.074  100.935 1.00 26.61 ? 164 GLN A O   1 
ATOM   1053  C CB  . GLN A 1 166 ? 71.911  42.184  98.330  1.00 92.42 ? 164 GLN A CB  1 
ATOM   1054  C CG  . GLN A 1 166 ? 71.580  40.723  98.072  1.00 92.42 ? 164 GLN A CG  1 
ATOM   1055  C CD  . GLN A 1 166 ? 72.472  40.096  97.019  1.00 92.42 ? 164 GLN A CD  1 
ATOM   1056  O OE1 . GLN A 1 166 ? 73.672  39.914  97.235  1.00 92.42 ? 164 GLN A OE1 1 
ATOM   1057  N NE2 . GLN A 1 166 ? 71.890  39.764  95.866  1.00 92.42 ? 164 GLN A NE2 1 
ATOM   1058  N N   . GLU A 1 167 ? 72.019  42.685  101.550 1.00 50.98 ? 165 GLU A N   1 
ATOM   1059  C CA  . GLU A 1 167 ? 72.315  42.102  102.846 1.00 50.98 ? 165 GLU A CA  1 
ATOM   1060  C C   . GLU A 1 167 ? 71.138  42.048  103.793 1.00 50.98 ? 165 GLU A C   1 
ATOM   1061  O O   . GLU A 1 167 ? 70.647  40.959  104.085 1.00 50.98 ? 165 GLU A O   1 
ATOM   1062  C CB  . GLU A 1 167 ? 73.482  42.838  103.506 1.00 83.49 ? 165 GLU A CB  1 
ATOM   1063  C CG  . GLU A 1 167 ? 74.852  42.483  102.927 1.00 83.49 ? 165 GLU A CG  1 
ATOM   1064  C CD  . GLU A 1 167 ? 75.175  40.989  103.010 1.00 83.49 ? 165 GLU A CD  1 
ATOM   1065  O OE1 . GLU A 1 167 ? 76.356  40.659  103.259 1.00 83.49 ? 165 GLU A OE1 1 
ATOM   1066  O OE2 . GLU A 1 167 ? 74.262  40.147  102.815 1.00 83.49 ? 165 GLU A OE2 1 
ATOM   1067  N N   . ASN A 1 168 ? 70.686  43.206  104.278 1.00 48.59 ? 166 ASN A N   1 
ATOM   1068  C CA  . ASN A 1 168 ? 69.548  43.247  105.206 1.00 48.59 ? 166 ASN A CA  1 
ATOM   1069  C C   . ASN A 1 168 ? 68.332  42.529  104.617 1.00 48.59 ? 166 ASN A C   1 
ATOM   1070  O O   . ASN A 1 168 ? 67.420  42.122  105.337 1.00 48.59 ? 166 ASN A O   1 
ATOM   1071  C CB  . ASN A 1 168 ? 69.187  44.706  105.584 1.00 74.55 ? 166 ASN A CB  1 
ATOM   1072  C CG  . ASN A 1 168 ? 68.511  45.488  104.446 1.00 74.55 ? 166 ASN A CG  1 
ATOM   1073  O OD1 . ASN A 1 168 ? 68.167  46.666  104.610 1.00 74.55 ? 166 ASN A OD1 1 
ATOM   1074  N ND2 . ASN A 1 168 ? 68.317  44.841  103.300 1.00 74.55 ? 166 ASN A ND2 1 
ATOM   1075  N N   . ALA A 1 169 ? 68.351  42.372  103.298 1.00 36.67 ? 167 ALA A N   1 
ATOM   1076  C CA  . ALA A 1 169 ? 67.294  41.715  102.560 1.00 36.67 ? 167 ALA A CA  1 
ATOM   1077  C C   . ALA A 1 169 ? 67.313  40.202  102.784 1.00 36.67 ? 167 ALA A C   1 
ATOM   1078  O O   . ALA A 1 169 ? 66.301  39.620  103.178 1.00 36.67 ? 167 ALA A O   1 
ATOM   1079  C CB  . ALA A 1 169 ? 67.446  42.024  101.095 1.00 6.49  ? 167 ALA A CB  1 
ATOM   1080  N N   . ASN A 1 170 ? 68.448  39.557  102.517 1.00 62.97 ? 168 ASN A N   1 
ATOM   1081  C CA  . ASN A 1 170 ? 68.549  38.115  102.732 1.00 62.97 ? 168 ASN A CA  1 
ATOM   1082  C C   . ASN A 1 170 ? 68.372  37.887  104.234 1.00 62.97 ? 168 ASN A C   1 
ATOM   1083  O O   . ASN A 1 170 ? 67.874  36.845  104.673 1.00 62.97 ? 168 ASN A O   1 
ATOM   1084  C CB  . ASN A 1 170 ? 69.917  37.598  102.299 1.00 72.64 ? 168 ASN A CB  1 
ATOM   1085  C CG  . ASN A 1 170 ? 70.341  38.147  100.972 1.00 72.64 ? 168 ASN A CG  1 
ATOM   1086  O OD1 . ASN A 1 170 ? 69.604  38.054  99.994  1.00 72.64 ? 168 ASN A OD1 1 
ATOM   1087  N ND2 . ASN A 1 170 ? 71.541  38.725  100.923 1.00 72.64 ? 168 ASN A ND2 1 
ATOM   1088  N N   . ALA A 1 171 ? 68.801  38.873  105.015 1.00 49.59 ? 169 ALA A N   1 
ATOM   1089  C CA  . ALA A 1 171 ? 68.673  38.814  106.458 1.00 49.59 ? 169 ALA A CA  1 
ATOM   1090  C C   . ALA A 1 171 ? 67.183  38.685  106.734 1.00 49.59 ? 169 ALA A C   1 
ATOM   1091  O O   . ALA A 1 171 ? 66.719  37.634  107.193 1.00 49.59 ? 169 ALA A O   1 
ATOM   1092  C CB  . ALA A 1 171 ? 69.208  40.087  107.072 1.00 64.97 ? 169 ALA A CB  1 
ATOM   1093  N N   . LEU A 1 172 ? 66.446  39.764  106.444 1.00 48.78 ? 170 LEU A N   1 
ATOM   1094  C CA  . LEU A 1 172 ? 64.992  39.808  106.614 1.00 48.78 ? 170 LEU A CA  1 
ATOM   1095  C C   . LEU A 1 172 ? 64.449  38.459  106.211 1.00 48.78 ? 170 LEU A C   1 
ATOM   1096  O O   . LEU A 1 172 ? 63.899  37.728  107.024 1.00 48.78 ? 170 LEU A O   1 
ATOM   1097  C CB  . LEU A 1 172 ? 64.375  40.875  105.710 1.00 21.15 ? 170 LEU A CB  1 
ATOM   1098  C CG  . LEU A 1 172 ? 64.493  42.332  106.151 1.00 21.15 ? 170 LEU A CG  1 
ATOM   1099  C CD1 . LEU A 1 172 ? 64.098  43.275  105.027 1.00 21.15 ? 170 LEU A CD1 1 
ATOM   1100  C CD2 . LEU A 1 172 ? 63.593  42.548  107.337 1.00 21.15 ? 170 LEU A CD2 1 
ATOM   1101  N N   . ALA A 1 173 ? 64.627  38.137  104.939 1.00 28.31 ? 171 ALA A N   1 
ATOM   1102  C CA  . ALA A 1 173 ? 64.176  36.875  104.392 1.00 28.31 ? 171 ALA A CA  1 
ATOM   1103  C C   . ALA A 1 173 ? 64.287  35.709  105.380 1.00 28.31 ? 171 ALA A C   1 
ATOM   1104  O O   . ALA A 1 173 ? 63.325  34.959  105.559 1.00 28.31 ? 171 ALA A O   1 
ATOM   1105  C CB  . ALA A 1 173 ? 64.952  36.570  103.124 1.00 44.42 ? 171 ALA A CB  1 
ATOM   1106  N N   . ARG A 1 174 ? 65.447  35.554  106.021 1.00 44.83 ? 172 ARG A N   1 
ATOM   1107  C CA  . ARG A 1 174 ? 65.663  34.466  106.990 1.00 44.83 ? 172 ARG A CA  1 
ATOM   1108  C C   . ARG A 1 174 ? 64.853  34.665  108.279 1.00 44.83 ? 172 ARG A C   1 
ATOM   1109  O O   . ARG A 1 174 ? 64.172  33.753  108.750 1.00 44.83 ? 172 ARG A O   1 
ATOM   1110  C CB  . ARG A 1 174 ? 67.147  34.364  107.348 1.00 67.64 ? 172 ARG A CB  1 
ATOM   1111  C CG  . ARG A 1 174 ? 68.076  34.297  106.166 1.00 67.64 ? 172 ARG A CG  1 
ATOM   1112  C CD  . ARG A 1 174 ? 69.507  34.458  106.631 1.00 67.64 ? 172 ARG A CD  1 
ATOM   1113  N NE  . ARG A 1 174 ? 70.347  35.100  105.622 1.00 67.64 ? 172 ARG A NE  1 
ATOM   1114  C CZ  . ARG A 1 174 ? 71.549  35.621  105.863 1.00 67.64 ? 172 ARG A CZ  1 
ATOM   1115  N NH1 . ARG A 1 174 ? 72.064  35.575  107.089 1.00 67.64 ? 172 ARG A NH1 1 
ATOM   1116  N NH2 . ARG A 1 174 ? 72.232  36.199  104.880 1.00 67.64 ? 172 ARG A NH2 1 
ATOM   1117  N N   . TYR A 1 175 ? 64.942  35.863  108.849 1.00 64.17 ? 173 TYR A N   1 
ATOM   1118  C CA  . TYR A 1 175 ? 64.219  36.184  110.072 1.00 64.17 ? 173 TYR A CA  1 
ATOM   1119  C C   . TYR A 1 175 ? 62.725  35.996  109.860 1.00 64.17 ? 173 TYR A C   1 
ATOM   1120  O O   . TYR A 1 175 ? 62.025  35.511  110.745 1.00 64.17 ? 173 TYR A O   1 
ATOM   1121  C CB  . TYR A 1 175 ? 64.528  37.626  110.495 1.00 65.12 ? 173 TYR A CB  1 
ATOM   1122  C CG  . TYR A 1 175 ? 63.320  38.472  110.830 1.00 65.12 ? 173 TYR A CG  1 
ATOM   1123  C CD1 . TYR A 1 175 ? 62.445  38.108  111.846 1.00 65.12 ? 173 TYR A CD1 1 
ATOM   1124  C CD2 . TYR A 1 175 ? 63.048  39.635  110.118 1.00 65.12 ? 173 TYR A CD2 1 
ATOM   1125  C CE1 . TYR A 1 175 ? 61.329  38.876  112.141 1.00 65.12 ? 173 TYR A CE1 1 
ATOM   1126  C CE2 . TYR A 1 175 ? 61.938  40.411  110.406 1.00 65.12 ? 173 TYR A CE2 1 
ATOM   1127  C CZ  . TYR A 1 175 ? 61.083  40.022  111.416 1.00 65.12 ? 173 TYR A CZ  1 
ATOM   1128  O OH  . TYR A 1 175 ? 59.963  40.765  111.684 1.00 65.12 ? 173 TYR A OH  1 
ATOM   1129  N N   . ALA A 1 176 ? 62.245  36.384  108.681 1.00 68.00 ? 174 ALA A N   1 
ATOM   1130  C CA  . ALA A 1 176 ? 60.831  36.262  108.329 1.00 68.00 ? 174 ALA A CA  1 
ATOM   1131  C C   . ALA A 1 176 ? 60.450  34.794  108.158 1.00 68.00 ? 174 ALA A C   1 
ATOM   1132  O O   . ALA A 1 176 ? 59.352  34.367  108.526 1.00 68.00 ? 174 ALA A O   1 
ATOM   1133  C CB  . ALA A 1 176 ? 60.549  37.032  107.034 1.00 15.92 ? 174 ALA A CB  1 
ATOM   1134  N N   . SER A 1 177 ? 61.370  34.029  107.590 1.00 29.14 ? 175 SER A N   1 
ATOM   1135  C CA  . SER A 1 177 ? 61.139  32.618  107.367 1.00 29.14 ? 175 SER A CA  1 
ATOM   1136  C C   . SER A 1 177 ? 61.125  31.914  108.699 1.00 29.14 ? 175 SER A C   1 
ATOM   1137  O O   . SER A 1 177 ? 60.472  30.878  108.857 1.00 29.14 ? 175 SER A O   1 
ATOM   1138  C CB  . SER A 1 177 ? 62.241  32.013  106.490 1.00 38.14 ? 175 SER A CB  1 
ATOM   1139  O OG  . SER A 1 177 ? 62.052  30.612  106.328 1.00 38.14 ? 175 SER A OG  1 
ATOM   1140  N N   . ILE A 1 178 ? 61.859  32.471  109.657 1.00 70.74 ? 176 ILE A N   1 
ATOM   1141  C CA  . ILE A 1 178 ? 61.938  31.879  110.984 1.00 70.74 ? 176 ILE A CA  1 
ATOM   1142  C C   . ILE A 1 178 ? 60.641  32.081  111.753 1.00 70.74 ? 176 ILE A C   1 
ATOM   1143  O O   . ILE A 1 178 ? 60.093  31.131  112.305 1.00 70.74 ? 176 ILE A O   1 
ATOM   1144  C CB  . ILE A 1 178 ? 63.117  32.467  111.787 1.00 71.35 ? 176 ILE A CB  1 
ATOM   1145  C CG1 . ILE A 1 178 ? 64.429  32.154  111.068 1.00 71.35 ? 176 ILE A CG1 1 
ATOM   1146  C CG2 . ILE A 1 178 ? 63.143  31.881  113.195 1.00 71.35 ? 176 ILE A CG2 1 
ATOM   1147  C CD1 . ILE A 1 178 ? 65.648  32.740  111.739 1.00 71.35 ? 176 ILE A CD1 1 
ATOM   1148  N N   . CYS A 1 179 ? 60.143  33.310  111.783 1.00 58.87 ? 177 CYS A N   1 
ATOM   1149  C CA  . CYS A 1 179 ? 58.905  33.583  112.492 1.00 58.87 ? 177 CYS A CA  1 
ATOM   1150  C C   . CYS A 1 179 ? 57.801  32.630  112.026 1.00 58.87 ? 177 CYS A C   1 
ATOM   1151  O O   . CYS A 1 179 ? 57.110  32.020  112.845 1.00 58.87 ? 177 CYS A O   1 
ATOM   1152  C CB  . CYS A 1 179 ? 58.445  35.020  112.245 1.00 40.41 ? 177 CYS A CB  1 
ATOM   1153  S SG  . CYS A 1 179 ? 59.636  36.309  112.607 1.00 40.41 ? 177 CYS A SG  1 
ATOM   1154  N N   . GLN A 1 180 ? 57.634  32.502  110.712 1.00 67.39 ? 178 GLN A N   1 
ATOM   1155  C CA  . GLN A 1 180 ? 56.591  31.642  110.161 1.00 67.39 ? 178 GLN A CA  1 
ATOM   1156  C C   . GLN A 1 180 ? 56.737  30.175  110.565 1.00 67.39 ? 178 GLN A C   1 
ATOM   1157  O O   . GLN A 1 180 ? 55.805  29.384  110.405 1.00 67.39 ? 178 GLN A O   1 
ATOM   1158  C CB  . GLN A 1 180 ? 56.563  31.757  108.640 1.00 64.01 ? 178 GLN A CB  1 
ATOM   1159  C CG  . GLN A 1 180 ? 56.616  33.180  108.132 1.00 64.01 ? 178 GLN A CG  1 
ATOM   1160  C CD  . GLN A 1 180 ? 56.122  33.283  106.713 1.00 64.01 ? 178 GLN A CD  1 
ATOM   1161  O OE1 . GLN A 1 180 ? 56.315  32.372  105.913 1.00 64.01 ? 178 GLN A OE1 1 
ATOM   1162  N NE2 . GLN A 1 180 ? 55.488  34.398  106.386 1.00 64.01 ? 178 GLN A NE2 1 
ATOM   1163  N N   . GLN A 1 181 ? 57.910  29.815  111.079 1.00 66.04 ? 179 GLN A N   1 
ATOM   1164  C CA  . GLN A 1 181 ? 58.172  28.450  111.542 1.00 66.04 ? 179 GLN A CA  1 
ATOM   1165  C C   . GLN A 1 181 ? 57.641  28.286  112.976 1.00 66.04 ? 179 GLN A C   1 
ATOM   1166  O O   . GLN A 1 181 ? 57.249  27.192  113.402 1.00 66.04 ? 179 GLN A O   1 
ATOM   1167  C CB  . GLN A 1 181 ? 59.676  28.163  111.505 1.00 74.14 ? 179 GLN A CB  1 
ATOM   1168  C CG  . GLN A 1 181 ? 60.181  27.658  110.170 1.00 74.14 ? 179 GLN A CG  1 
ATOM   1169  C CD  . GLN A 1 181 ? 59.693  26.249  109.855 1.00 74.14 ? 179 GLN A CD  1 
ATOM   1170  O OE1 . GLN A 1 181 ? 60.097  25.654  108.856 1.00 74.14 ? 179 GLN A OE1 1 
ATOM   1171  N NE2 . GLN A 1 181 ? 58.820  25.710  110.707 1.00 74.14 ? 179 GLN A NE2 1 
ATOM   1172  N N   . ASN A 1 182 ? 57.636  29.397  113.707 1.00 75.53 ? 180 ASN A N   1 
ATOM   1173  C CA  . ASN A 1 182 ? 57.153  29.435  115.079 1.00 75.53 ? 180 ASN A CA  1 
ATOM   1174  C C   . ASN A 1 182 ? 55.825  30.198  115.095 1.00 75.53 ? 180 ASN A C   1 
ATOM   1175  O O   . ASN A 1 182 ? 55.653  31.158  115.851 1.00 75.53 ? 180 ASN A O   1 
ATOM   1176  C CB  . ASN A 1 182 ? 58.171  30.144  115.979 1.00 76.04 ? 180 ASN A CB  1 
ATOM   1177  C CG  . ASN A 1 182 ? 59.593  29.651  115.760 1.00 76.04 ? 180 ASN A CG  1 
ATOM   1178  O OD1 . ASN A 1 182 ? 59.865  28.448  115.803 1.00 76.04 ? 180 ASN A OD1 1 
ATOM   1179  N ND2 . ASN A 1 182 ? 60.508  30.585  115.529 1.00 76.04 ? 180 ASN A ND2 1 
ATOM   1180  N N   . GLY A 1 183 ? 54.901  29.769  114.240 1.00 70.42 ? 181 GLY A N   1 
ATOM   1181  C CA  . GLY A 1 183 ? 53.599  30.399  114.154 1.00 70.42 ? 181 GLY A CA  1 
ATOM   1182  C C   . GLY A 1 183 ? 53.547  31.897  114.395 1.00 70.42 ? 181 GLY A C   1 
ATOM   1183  O O   . GLY A 1 183 ? 52.608  32.373  115.028 1.00 70.42 ? 181 GLY A O   1 
ATOM   1184  N N   . LEU A 1 184 ? 54.543  32.641  113.916 1.00 54.49 ? 182 LEU A N   1 
ATOM   1185  C CA  . LEU A 1 184 ? 54.551  34.102  114.073 1.00 54.49 ? 182 LEU A CA  1 
ATOM   1186  C C   . LEU A 1 184 ? 54.392  34.781  112.709 1.00 54.49 ? 182 LEU A C   1 
ATOM   1187  O O   . LEU A 1 184 ? 54.730  34.202  111.670 1.00 54.49 ? 182 LEU A O   1 
ATOM   1188  C CB  . LEU A 1 184 ? 55.842  34.590  114.735 1.00 60.41 ? 182 LEU A CB  1 
ATOM   1189  C CG  . LEU A 1 184 ? 56.051  34.270  116.214 1.00 60.41 ? 182 LEU A CG  1 
ATOM   1190  C CD1 . LEU A 1 184 ? 57.210  35.092  116.745 1.00 60.41 ? 182 LEU A CD1 1 
ATOM   1191  C CD2 . LEU A 1 184 ? 54.797  34.592  116.989 1.00 60.41 ? 182 LEU A CD2 1 
ATOM   1192  N N   . VAL A 1 185 ? 53.882  36.009  112.706 1.00 35.86 ? 183 VAL A N   1 
ATOM   1193  C CA  . VAL A 1 185 ? 53.661  36.721  111.449 1.00 35.86 ? 183 VAL A CA  1 
ATOM   1194  C C   . VAL A 1 185 ? 54.609  37.914  111.283 1.00 35.86 ? 183 VAL A C   1 
ATOM   1195  O O   . VAL A 1 185 ? 54.335  39.025  111.742 1.00 35.86 ? 183 VAL A O   1 
ATOM   1196  C CB  . VAL A 1 185 ? 52.146  37.143  111.334 1.00 43.16 ? 183 VAL A CB  1 
ATOM   1197  C CG1 . VAL A 1 185 ? 51.988  38.404  110.503 1.00 43.16 ? 183 VAL A CG1 1 
ATOM   1198  C CG2 . VAL A 1 185 ? 51.337  35.998  110.701 1.00 43.16 ? 183 VAL A CG2 1 
ATOM   1199  N N   . PRO A 1 186 ? 55.744  37.686  110.601 1.00 48.15 ? 184 PRO A N   1 
ATOM   1200  C CA  . PRO A 1 186 ? 56.786  38.685  110.333 1.00 48.15 ? 184 PRO A CA  1 
ATOM   1201  C C   . PRO A 1 186 ? 56.334  40.017  109.749 1.00 48.15 ? 184 PRO A C   1 
ATOM   1202  O O   . PRO A 1 186 ? 55.627  40.062  108.743 1.00 48.15 ? 184 PRO A O   1 
ATOM   1203  C CB  . PRO A 1 186 ? 57.745  37.944  109.391 1.00 17.97 ? 184 PRO A CB  1 
ATOM   1204  C CG  . PRO A 1 186 ? 56.870  36.924  108.722 1.00 17.97 ? 184 PRO A CG  1 
ATOM   1205  C CD  . PRO A 1 186 ? 56.038  36.434  109.883 1.00 17.97 ? 184 PRO A CD  1 
ATOM   1206  N N   . ILE A 1 187 ? 56.737  41.103  110.394 1.00 61.91 ? 185 ILE A N   1 
ATOM   1207  C CA  . ILE A 1 187 ? 56.413  42.431  109.894 1.00 61.91 ? 185 ILE A CA  1 
ATOM   1208  C C   . ILE A 1 187 ? 57.711  42.927  109.285 1.00 61.91 ? 185 ILE A C   1 
ATOM   1209  O O   . ILE A 1 187 ? 58.487  43.643  109.915 1.00 61.91 ? 185 ILE A O   1 
ATOM   1210  C CB  . ILE A 1 187 ? 55.972  43.390  111.015 1.00 58.15 ? 185 ILE A CB  1 
ATOM   1211  C CG1 . ILE A 1 187 ? 54.545  43.050  111.447 1.00 58.15 ? 185 ILE A CG1 1 
ATOM   1212  C CG2 . ILE A 1 187 ? 56.081  44.845  110.546 1.00 58.15 ? 185 ILE A CG2 1 
ATOM   1213  C CD1 . ILE A 1 187 ? 53.903  44.115  112.310 1.00 58.15 ? 185 ILE A CD1 1 
ATOM   1214  N N   . VAL A 1 188 ? 57.960  42.510  108.055 1.00 40.05 ? 186 VAL A N   1 
ATOM   1215  C CA  . VAL A 1 188 ? 59.176  42.891  107.367 1.00 40.05 ? 186 VAL A CA  1 
ATOM   1216  C C   . VAL A 1 188 ? 59.392  44.398  107.312 1.00 40.05 ? 186 VAL A C   1 
ATOM   1217  O O   . VAL A 1 188 ? 58.620  45.121  106.688 1.00 40.05 ? 186 VAL A O   1 
ATOM   1218  C CB  . VAL A 1 188 ? 59.165  42.318  105.953 1.00 27.10 ? 186 VAL A CB  1 
ATOM   1219  C CG1 . VAL A 1 188 ? 60.433  42.707  105.226 1.00 27.10 ? 186 VAL A CG1 1 
ATOM   1220  C CG2 . VAL A 1 188 ? 59.023  40.802  106.023 1.00 27.10 ? 186 VAL A CG2 1 
ATOM   1221  N N   . GLU A 1 189 ? 60.440  44.876  107.977 1.00 70.07 ? 187 GLU A N   1 
ATOM   1222  C CA  . GLU A 1 189 ? 60.724  46.301  107.952 1.00 70.07 ? 187 GLU A CA  1 
ATOM   1223  C C   . GLU A 1 189 ? 61.991  46.616  107.151 1.00 70.07 ? 187 GLU A C   1 
ATOM   1224  O O   . GLU A 1 189 ? 63.107  46.264  107.547 1.00 70.07 ? 187 GLU A O   1 
ATOM   1225  C CB  . GLU A 1 189 ? 60.841  46.879  109.378 1.00 25.13 ? 187 GLU A CB  1 
ATOM   1226  C CG  . GLU A 1 189 ? 60.425  48.368  109.426 1.00 29.19 ? 187 GLU A CG  1 
ATOM   1227  C CD  . GLU A 1 189 ? 60.417  48.997  110.825 1.00 45.80 ? 187 GLU A CD  1 
ATOM   1228  O OE1 . GLU A 1 189 ? 60.220  48.273  111.826 1.00 37.25 ? 187 GLU A OE1 1 
ATOM   1229  O OE2 . GLU A 1 189 ? 60.583  50.235  110.919 1.00 43.72 ? 187 GLU A OE2 1 
ATOM   1230  N N   . PRO A 1 190 ? 61.822  47.243  105.977 1.00 92.42 ? 188 PRO A N   1 
ATOM   1231  C CA  . PRO A 1 190 ? 62.952  47.615  105.117 1.00 92.42 ? 188 PRO A CA  1 
ATOM   1232  C C   . PRO A 1 190 ? 63.529  48.926  105.653 1.00 92.42 ? 188 PRO A C   1 
ATOM   1233  O O   . PRO A 1 190 ? 62.898  49.982  105.533 1.00 92.42 ? 188 PRO A O   1 
ATOM   1234  C CB  . PRO A 1 190 ? 62.299  47.801  103.745 1.00 89.51 ? 188 PRO A CB  1 
ATOM   1235  C CG  . PRO A 1 190 ? 61.081  46.927  103.814 1.00 89.51 ? 188 PRO A CG  1 
ATOM   1236  C CD  . PRO A 1 190 ? 60.573  47.237  105.199 1.00 89.51 ? 188 PRO A CD  1 
ATOM   1237  N N   . GLU A 1 191 ? 64.714  48.857  106.249 1.00 84.80 ? 189 GLU A N   1 
ATOM   1238  C CA  . GLU A 1 191 ? 65.340  50.044  106.816 1.00 84.80 ? 189 GLU A CA  1 
ATOM   1239  C C   . GLU A 1 191 ? 65.180  51.294  105.952 1.00 84.80 ? 189 GLU A C   1 
ATOM   1240  O O   . GLU A 1 191 ? 65.318  51.239  104.733 1.00 84.80 ? 189 GLU A O   1 
ATOM   1241  C CB  . GLU A 1 191 ? 66.836  49.803  107.047 1.00 92.42 ? 189 GLU A CB  1 
ATOM   1242  C CG  . GLU A 1 191 ? 67.528  50.958  107.786 1.00 92.42 ? 189 GLU A CG  1 
ATOM   1243  C CD  . GLU A 1 191 ? 69.038  50.967  107.621 1.00 92.42 ? 189 GLU A CD  1 
ATOM   1244  O OE1 . GLU A 1 191 ? 69.676  49.922  107.874 1.00 92.42 ? 189 GLU A OE1 1 
ATOM   1245  O OE2 . GLU A 1 191 ? 69.588  52.024  107.242 1.00 92.42 ? 189 GLU A OE2 1 
ATOM   1246  N N   . VAL A 1 192 ? 64.886  52.423  106.588 1.00 92.42 ? 190 VAL A N   1 
ATOM   1247  C CA  . VAL A 1 192 ? 64.760  53.684  105.867 1.00 92.42 ? 190 VAL A CA  1 
ATOM   1248  C C   . VAL A 1 192 ? 66.156  54.339  105.892 1.00 92.42 ? 190 VAL A C   1 
ATOM   1249  O O   . VAL A 1 192 ? 66.817  54.360  106.939 1.00 92.42 ? 190 VAL A O   1 
ATOM   1250  C CB  . VAL A 1 192 ? 63.743  54.627  106.551 1.00 65.11 ? 190 VAL A CB  1 
ATOM   1251  C CG1 . VAL A 1 192 ? 63.463  55.833  105.654 1.00 65.11 ? 190 VAL A CG1 1 
ATOM   1252  C CG2 . VAL A 1 192 ? 62.464  53.870  106.871 1.00 65.11 ? 190 VAL A CG2 1 
ATOM   1253  N N   . ILE A 1 193 ? 66.603  54.858  104.745 1.00 92.42 ? 191 ILE A N   1 
ATOM   1254  C CA  . ILE A 1 193 ? 67.922  55.498  104.639 1.00 92.42 ? 191 ILE A CA  1 
ATOM   1255  C C   . ILE A 1 193 ? 67.871  56.840  103.896 1.00 92.42 ? 191 ILE A C   1 
ATOM   1256  O O   . ILE A 1 193 ? 68.042  57.909  104.491 1.00 92.42 ? 191 ILE A O   1 
ATOM   1257  C CB  . ILE A 1 193 ? 68.933  54.558  103.919 1.00 72.66 ? 191 ILE A CB  1 
ATOM   1258  C CG1 . ILE A 1 193 ? 68.448  54.245  102.498 1.00 65.37 ? 191 ILE A CG1 1 
ATOM   1259  C CG2 . ILE A 1 193 ? 69.079  53.256  104.703 1.00 55.18 ? 191 ILE A CG2 1 
ATOM   1260  C CD1 . ILE A 1 193 ? 69.367  53.321  101.709 1.00 75.49 ? 191 ILE A CD1 1 
ATOM   1261  N N   . ASP A 1 197 ? 68.792  64.700  102.541 1.00 92.42 ? 195 ASP A N   1 
ATOM   1262  C CA  . ASP A 1 197 ? 68.424  66.054  102.138 1.00 92.42 ? 195 ASP A CA  1 
ATOM   1263  C C   . ASP A 1 197 ? 67.904  66.099  100.698 1.00 92.42 ? 195 ASP A C   1 
ATOM   1264  O O   . ASP A 1 197 ? 67.489  67.160  100.221 1.00 92.42 ? 195 ASP A O   1 
ATOM   1265  C CB  . ASP A 1 197 ? 69.631  66.999  102.270 1.00 92.42 ? 195 ASP A CB  1 
ATOM   1266  C CG  . ASP A 1 197 ? 70.610  66.908  101.076 1.00 92.42 ? 195 ASP A CG  1 
ATOM   1267  O OD1 . ASP A 1 197 ? 70.225  67.264  99.935  1.00 92.42 ? 195 ASP A OD1 1 
ATOM   1268  O OD2 . ASP A 1 197 ? 71.774  66.490  101.282 1.00 92.42 ? 195 ASP A OD2 1 
ATOM   1269  N N   . HIS A 1 198 ? 67.929  64.954  100.009 1.00 92.42 ? 196 HIS A N   1 
ATOM   1270  C CA  . HIS A 1 198 ? 67.477  64.881  98.614  1.00 92.42 ? 196 HIS A CA  1 
ATOM   1271  C C   . HIS A 1 198 ? 65.975  65.059  98.390  1.00 92.42 ? 196 HIS A C   1 
ATOM   1272  O O   . HIS A 1 198 ? 65.202  65.279  99.329  1.00 92.42 ? 196 HIS A O   1 
ATOM   1273  C CB  . HIS A 1 198 ? 67.918  63.562  97.969  1.00 92.42 ? 196 HIS A CB  1 
ATOM   1274  C CG  . HIS A 1 198 ? 69.364  63.527  97.574  1.00 92.42 ? 196 HIS A CG  1 
ATOM   1275  N ND1 . HIS A 1 198 ? 70.386  63.366  98.488  1.00 92.42 ? 196 HIS A ND1 1 
ATOM   1276  C CD2 . HIS A 1 198 ? 69.957  63.615  96.357  1.00 92.42 ? 196 HIS A CD2 1 
ATOM   1277  C CE1 . HIS A 1 198 ? 71.545  63.352  97.851  1.00 92.42 ? 196 HIS A CE1 1 
ATOM   1278  N NE2 . HIS A 1 198 ? 71.313  63.501  96.558  1.00 92.42 ? 196 HIS A NE2 1 
ATOM   1279  N N   . ASP A 1 199 ? 65.576  64.945  97.127  1.00 86.40 ? 197 ASP A N   1 
ATOM   1280  C CA  . ASP A 1 199 ? 64.184  65.109  96.726  1.00 86.40 ? 197 ASP A CA  1 
ATOM   1281  C C   . ASP A 1 199 ? 63.297  63.871  96.877  1.00 86.40 ? 197 ASP A C   1 
ATOM   1282  O O   . ASP A 1 199 ? 63.776  62.756  97.092  1.00 86.40 ? 197 ASP A O   1 
ATOM   1283  C CB  . ASP A 1 199 ? 64.136  65.614  95.279  1.00 92.42 ? 197 ASP A CB  1 
ATOM   1284  C CG  . ASP A 1 199 ? 65.136  64.900  94.374  1.00 92.42 ? 197 ASP A CG  1 
ATOM   1285  O OD1 . ASP A 1 199 ? 66.350  64.871  94.716  1.00 92.42 ? 197 ASP A OD1 1 
ATOM   1286  O OD2 . ASP A 1 199 ? 64.704  64.374  93.319  1.00 92.42 ? 197 ASP A OD2 1 
ATOM   1287  N N   . LEU A 1 200 ? 61.991  64.093  96.772  1.00 88.37 ? 198 LEU A N   1 
ATOM   1288  C CA  . LEU A 1 200 ? 61.004  63.030  96.883  1.00 88.37 ? 198 LEU A CA  1 
ATOM   1289  C C   . LEU A 1 200 ? 61.344  61.992  95.818  1.00 88.37 ? 198 LEU A C   1 
ATOM   1290  O O   . LEU A 1 200 ? 61.523  60.808  96.120  1.00 88.37 ? 198 LEU A O   1 
ATOM   1291  C CB  . LEU A 1 200 ? 59.602  63.601  96.630  1.00 61.59 ? 198 LEU A CB  1 
ATOM   1292  C CG  . LEU A 1 200 ? 58.378  63.090  97.398  1.00 71.13 ? 198 LEU A CG  1 
ATOM   1293  C CD1 . LEU A 1 200 ? 58.553  63.375  98.881  1.00 56.48 ? 198 LEU A CD1 1 
ATOM   1294  C CD2 . LEU A 1 200 ? 57.123  63.791  96.884  1.00 57.87 ? 198 LEU A CD2 1 
ATOM   1295  N N   . GLU A 1 201 ? 61.439  62.455  94.570  1.00 89.80 ? 199 GLU A N   1 
ATOM   1296  C CA  . GLU A 1 201 ? 61.754  61.587  93.435  1.00 89.80 ? 199 GLU A CA  1 
ATOM   1297  C C   . GLU A 1 201 ? 62.967  60.709  93.745  1.00 89.80 ? 199 GLU A C   1 
ATOM   1298  O O   . GLU A 1 201 ? 63.066  59.576  93.274  1.00 89.80 ? 199 GLU A O   1 
ATOM   1299  C CB  . GLU A 1 201 ? 62.023  62.430  92.184  1.00 92.42 ? 199 GLU A CB  1 
ATOM   1300  C CG  . GLU A 1 201 ? 62.521  61.619  90.988  1.00 92.42 ? 199 GLU A CG  1 
ATOM   1301  C CD  . GLU A 1 201 ? 62.835  62.481  89.773  1.00 92.42 ? 199 GLU A CD  1 
ATOM   1302  O OE1 . GLU A 1 201 ? 63.417  61.956  88.796  1.00 92.42 ? 199 GLU A OE1 1 
ATOM   1303  O OE2 . GLU A 1 201 ? 62.494  63.683  89.795  1.00 92.42 ? 199 GLU A OE2 1 
ATOM   1304  N N   . HIS A 1 202 ? 63.886  61.248  94.540  1.00 92.42 ? 200 HIS A N   1 
ATOM   1305  C CA  . HIS A 1 202 ? 65.085  60.524  94.940  1.00 92.42 ? 200 HIS A CA  1 
ATOM   1306  C C   . HIS A 1 202 ? 64.649  59.429  95.908  1.00 92.42 ? 200 HIS A C   1 
ATOM   1307  O O   . HIS A 1 202 ? 64.803  58.233  95.630  1.00 92.42 ? 200 HIS A O   1 
ATOM   1308  C CB  . HIS A 1 202 ? 66.060  61.476  95.644  1.00 92.42 ? 200 HIS A CB  1 
ATOM   1309  C CG  . HIS A 1 202 ? 67.344  60.833  96.073  1.00 92.42 ? 200 HIS A CG  1 
ATOM   1310  N ND1 . HIS A 1 202 ? 68.383  60.584  95.201  1.00 92.42 ? 200 HIS A ND1 1 
ATOM   1311  C CD2 . HIS A 1 202 ? 67.761  60.395  97.286  1.00 92.42 ? 200 HIS A CD2 1 
ATOM   1312  C CE1 . HIS A 1 202 ? 69.384  60.023  95.857  1.00 92.42 ? 200 HIS A CE1 1 
ATOM   1313  N NE2 . HIS A 1 202 ? 69.032  59.898  97.124  1.00 92.42 ? 200 HIS A NE2 1 
ATOM   1314  N N   . CYS A 1 203 ? 64.098  59.859  97.041  1.00 92.42 ? 201 CYS A N   1 
ATOM   1315  C CA  . CYS A 1 203 ? 63.619  58.953  98.079  1.00 92.42 ? 201 CYS A CA  1 
ATOM   1316  C C   . CYS A 1 203 ? 62.739  57.869  97.453  1.00 92.42 ? 201 CYS A C   1 
ATOM   1317  O O   . CYS A 1 203 ? 62.785  56.707  97.865  1.00 92.42 ? 201 CYS A O   1 
ATOM   1318  C CB  . CYS A 1 203 ? 62.833  59.749  99.133  1.00 92.42 ? 201 CYS A CB  1 
ATOM   1319  S SG  . CYS A 1 203 ? 62.191  58.815  100.572 1.00 92.42 ? 201 CYS A SG  1 
ATOM   1320  N N   . GLN A 1 204 ? 61.952  58.246  96.447  1.00 61.80 ? 202 GLN A N   1 
ATOM   1321  C CA  . GLN A 1 204 ? 61.076  57.286  95.782  1.00 61.80 ? 202 GLN A CA  1 
ATOM   1322  C C   . GLN A 1 204 ? 61.859  56.180  95.078  1.00 61.80 ? 202 GLN A C   1 
ATOM   1323  O O   . GLN A 1 204 ? 61.515  55.001  95.181  1.00 61.80 ? 202 GLN A O   1 
ATOM   1324  C CB  . GLN A 1 204 ? 60.175  57.985  94.765  1.00 77.50 ? 202 GLN A CB  1 
ATOM   1325  C CG  . GLN A 1 204 ? 59.114  57.050  94.202  1.00 77.50 ? 202 GLN A CG  1 
ATOM   1326  C CD  . GLN A 1 204 ? 58.168  57.723  93.230  1.00 77.50 ? 202 GLN A CD  1 
ATOM   1327  O OE1 . GLN A 1 204 ? 57.616  58.792  93.510  1.00 77.50 ? 202 GLN A OE1 1 
ATOM   1328  N NE2 . GLN A 1 204 ? 57.962  57.090  92.081  1.00 77.50 ? 202 GLN A NE2 1 
ATOM   1329  N N   . TYR A 1 205 ? 62.912  56.568  94.363  1.00 47.28 ? 203 TYR A N   1 
ATOM   1330  C CA  . TYR A 1 205 ? 63.751  55.619  93.639  1.00 47.28 ? 203 TYR A CA  1 
ATOM   1331  C C   . TYR A 1 205 ? 64.461  54.638  94.577  1.00 47.28 ? 203 TYR A C   1 
ATOM   1332  O O   . TYR A 1 205 ? 64.609  53.447  94.270  1.00 47.28 ? 203 TYR A O   1 
ATOM   1333  C CB  . TYR A 1 205 ? 64.777  56.380  92.791  1.00 85.36 ? 203 TYR A CB  1 
ATOM   1334  C CG  . TYR A 1 205 ? 65.838  55.501  92.177  1.00 85.36 ? 203 TYR A CG  1 
ATOM   1335  C CD1 . TYR A 1 205 ? 65.553  54.183  91.806  1.00 85.36 ? 203 TYR A CD1 1 
ATOM   1336  C CD2 . TYR A 1 205 ? 67.130  55.977  91.976  1.00 85.36 ? 203 TYR A CD2 1 
ATOM   1337  C CE1 . TYR A 1 205 ? 66.523  53.361  91.261  1.00 85.36 ? 203 TYR A CE1 1 
ATOM   1338  C CE2 . TYR A 1 205 ? 68.114  55.161  91.426  1.00 85.36 ? 203 TYR A CE2 1 
ATOM   1339  C CZ  . TYR A 1 205 ? 67.802  53.852  91.074  1.00 85.36 ? 203 TYR A CZ  1 
ATOM   1340  O OH  . TYR A 1 205 ? 68.767  53.026  90.543  1.00 85.36 ? 203 TYR A OH  1 
ATOM   1341  N N   . VAL A 1 206 ? 64.892  55.142  95.726  1.00 59.99 ? 204 VAL A N   1 
ATOM   1342  C CA  . VAL A 1 206 ? 65.579  54.301  96.694  1.00 59.99 ? 204 VAL A CA  1 
ATOM   1343  C C   . VAL A 1 206 ? 64.612  53.277  97.279  1.00 59.99 ? 204 VAL A C   1 
ATOM   1344  O O   . VAL A 1 206 ? 64.889  52.076  97.256  1.00 59.99 ? 204 VAL A O   1 
ATOM   1345  C CB  . VAL A 1 206 ? 66.198  55.139  97.835  1.00 79.03 ? 204 VAL A CB  1 
ATOM   1346  C CG1 . VAL A 1 206 ? 67.659  54.737  98.031  1.00 79.03 ? 204 VAL A CG1 1 
ATOM   1347  C CG2 . VAL A 1 206 ? 66.094  56.624  97.517  1.00 79.03 ? 204 VAL A CG2 1 
ATOM   1348  N N   . THR A 1 207 ? 63.474  53.755  97.784  1.00 55.88 ? 205 THR A N   1 
ATOM   1349  C CA  . THR A 1 207 ? 62.459  52.878  98.367  1.00 55.88 ? 205 THR A CA  1 
ATOM   1350  C C   . THR A 1 207 ? 62.126  51.761  97.392  1.00 55.88 ? 205 THR A C   1 
ATOM   1351  O O   . THR A 1 207 ? 62.047  50.588  97.774  1.00 55.88 ? 205 THR A O   1 
ATOM   1352  C CB  . THR A 1 207 ? 61.163  53.631  98.660  1.00 64.01 ? 205 THR A CB  1 
ATOM   1353  O OG1 . THR A 1 207 ? 61.449  54.801  99.432  1.00 64.01 ? 205 THR A OG1 1 
ATOM   1354  C CG2 . THR A 1 207 ? 60.216  52.741  99.440  1.00 64.01 ? 205 THR A CG2 1 
ATOM   1355  N N   . GLU A 1 208 ? 61.926  52.145  96.132  1.00 62.74 ? 206 GLU A N   1 
ATOM   1356  C CA  . GLU A 1 208 ? 61.617  51.198  95.066  1.00 62.74 ? 206 GLU A CA  1 
ATOM   1357  C C   . GLU A 1 208 ? 62.740  50.178  94.927  1.00 62.74 ? 206 GLU A C   1 
ATOM   1358  O O   . GLU A 1 208 ? 62.501  48.963  94.984  1.00 62.74 ? 206 GLU A O   1 
ATOM   1359  C CB  . GLU A 1 208 ? 61.439  51.936  93.737  1.00 75.61 ? 206 GLU A CB  1 
ATOM   1360  C CG  . GLU A 1 208 ? 60.104  52.638  93.590  1.00 75.61 ? 206 GLU A CG  1 
ATOM   1361  C CD  . GLU A 1 208 ? 60.020  53.508  92.343  1.00 75.61 ? 206 GLU A CD  1 
ATOM   1362  O OE1 . GLU A 1 208 ? 60.518  53.078  91.280  1.00 75.61 ? 206 GLU A OE1 1 
ATOM   1363  O OE2 . GLU A 1 208 ? 59.442  54.616  92.426  1.00 75.61 ? 206 GLU A OE2 1 
ATOM   1364  N N   . LYS A 1 209 ? 63.963  50.684  94.752  1.00 66.11 ? 207 LYS A N   1 
ATOM   1365  C CA  . LYS A 1 209 ? 65.142  49.840  94.595  1.00 66.11 ? 207 LYS A CA  1 
ATOM   1366  C C   . LYS A 1 209 ? 65.313  48.882  95.760  1.00 66.11 ? 207 LYS A C   1 
ATOM   1367  O O   . LYS A 1 209 ? 65.738  47.736  95.580  1.00 66.11 ? 207 LYS A O   1 
ATOM   1368  C CB  . LYS A 1 209 ? 66.391  50.700  94.463  1.00 68.08 ? 207 LYS A CB  1 
ATOM   1369  C CG  . LYS A 1 209 ? 67.105  50.518  93.139  1.00 68.08 ? 207 LYS A CG  1 
ATOM   1370  C CD  . LYS A 1 209 ? 68.493  51.151  93.160  1.00 68.08 ? 207 LYS A CD  1 
ATOM   1371  C CE  . LYS A 1 209 ? 69.394  50.528  94.230  1.00 68.08 ? 207 LYS A CE  1 
ATOM   1372  N NZ  . LYS A 1 209 ? 70.763  51.124  94.220  1.00 68.08 ? 207 LYS A NZ  1 
ATOM   1373  N N   . VAL A 1 210 ? 64.971  49.359  96.954  1.00 60.40 ? 208 VAL A N   1 
ATOM   1374  C CA  . VAL A 1 210 ? 65.075  48.567  98.176  1.00 60.40 ? 208 VAL A CA  1 
ATOM   1375  C C   . VAL A 1 210 ? 64.015  47.476  98.276  1.00 60.40 ? 208 VAL A C   1 
ATOM   1376  O O   . VAL A 1 210 ? 64.339  46.292  98.410  1.00 60.40 ? 208 VAL A O   1 
ATOM   1377  C CB  . VAL A 1 210 ? 64.913  49.445  99.406  1.00 22.66 ? 208 VAL A CB  1 
ATOM   1378  C CG1 . VAL A 1 210 ? 65.064  48.599  100.654 1.00 22.66 ? 208 VAL A CG1 1 
ATOM   1379  C CG2 . VAL A 1 210 ? 65.916  50.575  99.372  1.00 22.66 ? 208 VAL A CG2 1 
ATOM   1380  N N   . LEU A 1 211 ? 62.750  47.902  98.232  1.00 50.81 ? 209 LEU A N   1 
ATOM   1381  C CA  . LEU A 1 211 ? 61.600  47.003  98.317  1.00 50.81 ? 209 LEU A CA  1 
ATOM   1382  C C   . LEU A 1 211 ? 61.698  45.857  97.315  1.00 50.81 ? 209 LEU A C   1 
ATOM   1383  O O   . LEU A 1 211 ? 61.333  44.711  97.615  1.00 50.81 ? 209 LEU A O   1 
ATOM   1384  C CB  . LEU A 1 211 ? 60.312  47.803  98.094  1.00 35.47 ? 209 LEU A CB  1 
ATOM   1385  C CG  . LEU A 1 211 ? 59.931  48.709  99.274  1.00 35.47 ? 209 LEU A CG  1 
ATOM   1386  C CD1 . LEU A 1 211 ? 58.828  49.695  98.910  1.00 35.47 ? 209 LEU A CD1 1 
ATOM   1387  C CD2 . LEU A 1 211 ? 59.490  47.823  100.422 1.00 35.47 ? 209 LEU A CD2 1 
ATOM   1388  N N   . ALA A 1 212 ? 62.202  46.177  96.127  1.00 51.99 ? 210 ALA A N   1 
ATOM   1389  C CA  . ALA A 1 212 ? 62.378  45.194  95.069  1.00 51.99 ? 210 ALA A CA  1 
ATOM   1390  C C   . ALA A 1 212 ? 63.332  44.082  95.515  1.00 51.99 ? 210 ALA A C   1 
ATOM   1391  O O   . ALA A 1 212 ? 63.102  42.898  95.224  1.00 51.99 ? 210 ALA A O   1 
ATOM   1392  C CB  . ALA A 1 212 ? 62.918  45.874  93.831  1.00 41.30 ? 210 ALA A CB  1 
ATOM   1393  N N   . ALA A 1 213 ? 64.401  44.478  96.215  1.00 59.10 ? 211 ALA A N   1 
ATOM   1394  C CA  . ALA A 1 213 ? 65.417  43.548  96.725  1.00 59.10 ? 211 ALA A CA  1 
ATOM   1395  C C   . ALA A 1 213 ? 64.861  42.765  97.899  1.00 59.10 ? 211 ALA A C   1 
ATOM   1396  O O   . ALA A 1 213 ? 65.146  41.583  98.074  1.00 59.10 ? 211 ALA A O   1 
ATOM   1397  C CB  . ALA A 1 213 ? 66.654  44.312  97.163  1.00 33.27 ? 211 ALA A CB  1 
ATOM   1398  N N   . VAL A 1 214 ? 64.066  43.454  98.705  1.00 45.99 ? 212 VAL A N   1 
ATOM   1399  C CA  . VAL A 1 214 ? 63.439  42.860  99.872  1.00 45.99 ? 212 VAL A CA  1 
ATOM   1400  C C   . VAL A 1 214 ? 62.566  41.698  99.464  1.00 45.99 ? 212 VAL A C   1 
ATOM   1401  O O   . VAL A 1 214 ? 62.732  40.585  99.956  1.00 45.99 ? 212 VAL A O   1 
ATOM   1402  C CB  . VAL A 1 214 ? 62.533  43.860  100.592 1.00 34.65 ? 212 VAL A CB  1 
ATOM   1403  C CG1 . VAL A 1 214 ? 61.961  43.216  101.842 1.00 34.65 ? 212 VAL A CG1 1 
ATOM   1404  C CG2 . VAL A 1 214 ? 63.305  45.145  100.906 1.00 34.65 ? 212 VAL A CG2 1 
ATOM   1405  N N   . TYR A 1 215 ? 61.629  41.961  98.561  1.00 37.58 ? 213 TYR A N   1 
ATOM   1406  C CA  . TYR A 1 215 ? 60.737  40.904  98.136  1.00 37.58 ? 213 TYR A CA  1 
ATOM   1407  C C   . TYR A 1 215 ? 61.426  39.854  97.304  1.00 37.58 ? 213 TYR A C   1 
ATOM   1408  O O   . TYR A 1 215 ? 61.150  38.663  97.468  1.00 37.58 ? 213 TYR A O   1 
ATOM   1409  C CB  . TYR A 1 215 ? 59.505  41.495  97.455  1.00 35.43 ? 213 TYR A CB  1 
ATOM   1410  C CG  . TYR A 1 215 ? 58.544  41.987  98.509  1.00 35.43 ? 213 TYR A CG  1 
ATOM   1411  C CD1 . TYR A 1 215 ? 57.823  41.078  99.297  1.00 35.43 ? 213 TYR A CD1 1 
ATOM   1412  C CD2 . TYR A 1 215 ? 58.469  43.343  98.840  1.00 35.43 ? 213 TYR A CD2 1 
ATOM   1413  C CE1 . TYR A 1 215 ? 57.065  41.504  100.400 1.00 35.43 ? 213 TYR A CE1 1 
ATOM   1414  C CE2 . TYR A 1 215 ? 57.707  43.784  99.944  1.00 35.43 ? 213 TYR A CE2 1 
ATOM   1415  C CZ  . TYR A 1 215 ? 57.013  42.859  100.720 1.00 35.43 ? 213 TYR A CZ  1 
ATOM   1416  O OH  . TYR A 1 215 ? 56.290  43.284  101.823 1.00 35.43 ? 213 TYR A OH  1 
ATOM   1417  N N   . LYS A 1 216 ? 62.348  40.275  96.442  1.00 62.60 ? 214 LYS A N   1 
ATOM   1418  C CA  . LYS A 1 216 ? 63.082  39.309  95.630  1.00 62.60 ? 214 LYS A CA  1 
ATOM   1419  C C   . LYS A 1 216 ? 63.720  38.295  96.578  1.00 62.60 ? 214 LYS A C   1 
ATOM   1420  O O   . LYS A 1 216 ? 63.536  37.080  96.429  1.00 62.60 ? 214 LYS A O   1 
ATOM   1421  C CB  . LYS A 1 216 ? 64.174  40.003  94.802  1.00 55.46 ? 214 LYS A CB  1 
ATOM   1422  C CG  . LYS A 1 216 ? 65.221  39.046  94.197  1.00 55.46 ? 214 LYS A CG  1 
ATOM   1423  C CD  . LYS A 1 216 ? 64.606  38.003  93.274  1.00 55.46 ? 214 LYS A CD  1 
ATOM   1424  C CE  . LYS A 1 216 ? 65.602  36.921  92.936  1.00 55.46 ? 214 LYS A CE  1 
ATOM   1425  N NZ  . LYS A 1 216 ? 66.898  37.527  92.515  1.00 55.46 ? 214 LYS A NZ  1 
ATOM   1426  N N   . ALA A 1 217 ? 64.453  38.818  97.561  1.00 80.18 ? 215 ALA A N   1 
ATOM   1427  C CA  . ALA A 1 217 ? 65.139  38.000  98.556  1.00 80.18 ? 215 ALA A CA  1 
ATOM   1428  C C   . ALA A 1 217 ? 64.139  37.109  99.244  1.00 80.18 ? 215 ALA A C   1 
ATOM   1429  O O   . ALA A 1 217 ? 64.360  35.904  99.394  1.00 80.18 ? 215 ALA A O   1 
ATOM   1430  C CB  . ALA A 1 217 ? 65.824  38.884  99.582  1.00 78.17 ? 215 ALA A CB  1 
ATOM   1431  N N   . LEU A 1 218 ? 63.034  37.714  99.662  1.00 36.95 ? 216 LEU A N   1 
ATOM   1432  C CA  . LEU A 1 218 ? 61.991  36.969  100.344 1.00 36.95 ? 216 LEU A CA  1 
ATOM   1433  C C   . LEU A 1 218 ? 61.497  35.811  99.491  1.00 36.95 ? 216 LEU A C   1 
ATOM   1434  O O   . LEU A 1 218 ? 61.233  34.727  100.019 1.00 36.95 ? 216 LEU A O   1 
ATOM   1435  C CB  . LEU A 1 218 ? 60.850  37.904  100.742 1.00 25.06 ? 216 LEU A CB  1 
ATOM   1436  C CG  . LEU A 1 218 ? 61.000  38.482  102.158 1.00 25.06 ? 216 LEU A CG  1 
ATOM   1437  C CD1 . LEU A 1 218 ? 60.658  39.971  102.188 1.00 25.06 ? 216 LEU A CD1 1 
ATOM   1438  C CD2 . LEU A 1 218 ? 60.111  37.700  103.106 1.00 25.06 ? 216 LEU A CD2 1 
ATOM   1439  N N   . ASN A 1 219 ? 61.381  36.014  98.179  1.00 37.15 ? 217 ASN A N   1 
ATOM   1440  C CA  . ASN A 1 219 ? 60.945  34.902  97.346  1.00 37.15 ? 217 ASN A CA  1 
ATOM   1441  C C   . ASN A 1 219 ? 62.027  33.830  97.441  1.00 37.15 ? 217 ASN A C   1 
ATOM   1442  O O   . ASN A 1 219 ? 61.738  32.649  97.689  1.00 37.15 ? 217 ASN A O   1 
ATOM   1443  C CB  . ASN A 1 219 ? 60.772  35.291  95.872  1.00 57.57 ? 217 ASN A CB  1 
ATOM   1444  C CG  . ASN A 1 219 ? 60.286  34.109  95.008  1.00 57.57 ? 217 ASN A CG  1 
ATOM   1445  O OD1 . ASN A 1 219 ? 60.860  33.012  95.031  1.00 57.57 ? 217 ASN A OD1 1 
ATOM   1446  N ND2 . ASN A 1 219 ? 59.227  34.337  94.250  1.00 57.57 ? 217 ASN A ND2 1 
ATOM   1447  N N   . ASP A 1 220 ? 63.275  34.246  97.247  1.00 50.07 ? 218 ASP A N   1 
ATOM   1448  C CA  . ASP A 1 220 ? 64.387  33.318  97.306  1.00 50.07 ? 218 ASP A CA  1 
ATOM   1449  C C   . ASP A 1 220 ? 64.288  32.398  98.505  1.00 50.07 ? 218 ASP A C   1 
ATOM   1450  O O   . ASP A 1 220 ? 64.672  31.235  98.421  1.00 50.07 ? 218 ASP A O   1 
ATOM   1451  C CB  . ASP A 1 220 ? 65.702  34.082  97.331  1.00 63.47 ? 218 ASP A CB  1 
ATOM   1452  C CG  . ASP A 1 220 ? 66.128  34.525  95.953  1.00 63.47 ? 218 ASP A CG  1 
ATOM   1453  O OD1 . ASP A 1 220 ? 65.294  35.124  95.229  1.00 63.47 ? 218 ASP A OD1 1 
ATOM   1454  O OD2 . ASP A 1 220 ? 67.298  34.267  95.594  1.00 63.47 ? 218 ASP A OD2 1 
ATOM   1455  N N   . HIS A 1 221 ? 63.750  32.912  99.608  1.00 61.16 ? 219 HIS A N   1 
ATOM   1456  C CA  . HIS A 1 221 ? 63.606  32.129  100.832 1.00 61.16 ? 219 HIS A CA  1 
ATOM   1457  C C   . HIS A 1 221 ? 62.220  31.525  101.074 1.00 61.16 ? 219 HIS A C   1 
ATOM   1458  O O   . HIS A 1 221 ? 61.853  31.245  102.217 1.00 61.16 ? 219 HIS A O   1 
ATOM   1459  C CB  . HIS A 1 221 ? 64.037  32.970  102.033 1.00 83.08 ? 219 HIS A CB  1 
ATOM   1460  C CG  . HIS A 1 221 ? 65.516  33.191  102.102 1.00 83.08 ? 219 HIS A CG  1 
ATOM   1461  N ND1 . HIS A 1 221 ? 66.392  32.224  102.545 1.00 83.08 ? 219 HIS A ND1 1 
ATOM   1462  C CD2 . HIS A 1 221 ? 66.278  34.251  101.744 1.00 83.08 ? 219 HIS A CD2 1 
ATOM   1463  C CE1 . HIS A 1 221 ? 67.628  32.680  102.460 1.00 83.08 ? 219 HIS A CE1 1 
ATOM   1464  N NE2 . HIS A 1 221 ? 67.587  33.908  101.976 1.00 83.08 ? 219 HIS A NE2 1 
ATOM   1465  N N   . HIS A 1 222 ? 61.455  31.343  99.998  1.00 45.01 ? 220 HIS A N   1 
ATOM   1466  C CA  . HIS A 1 222 ? 60.136  30.718  100.063 1.00 45.01 ? 220 HIS A CA  1 
ATOM   1467  C C   . HIS A 1 222 ? 59.257  31.243  101.203 1.00 45.01 ? 220 HIS A C   1 
ATOM   1468  O O   . HIS A 1 222 ? 58.580  30.470  101.882 1.00 45.01 ? 220 HIS A O   1 
ATOM   1469  C CB  . HIS A 1 222 ? 60.350  29.205  100.197 1.00 84.54 ? 220 HIS A CB  1 
ATOM   1470  C CG  . HIS A 1 222 ? 59.154  28.371  99.852  1.00 84.54 ? 220 HIS A CG  1 
ATOM   1471  N ND1 . HIS A 1 222 ? 58.385  28.592  98.729  1.00 84.54 ? 220 HIS A ND1 1 
ATOM   1472  C CD2 . HIS A 1 222 ? 58.638  27.270  100.449 1.00 84.54 ? 220 HIS A CD2 1 
ATOM   1473  C CE1 . HIS A 1 222 ? 57.448  27.665  98.649  1.00 84.54 ? 220 HIS A CE1 1 
ATOM   1474  N NE2 . HIS A 1 222 ? 57.579  26.849  99.680  1.00 84.54 ? 220 HIS A NE2 1 
ATOM   1475  N N   . VAL A 1 223 ? 59.254  32.558  101.404 1.00 92.42 ? 221 VAL A N   1 
ATOM   1476  C CA  . VAL A 1 223 ? 58.459  33.165  102.476 1.00 92.42 ? 221 VAL A CA  1 
ATOM   1477  C C   . VAL A 1 223 ? 56.989  33.356  102.098 1.00 92.42 ? 221 VAL A C   1 
ATOM   1478  O O   . VAL A 1 223 ? 56.679  34.051  101.125 1.00 92.42 ? 221 VAL A O   1 
ATOM   1479  C CB  . VAL A 1 223 ? 59.009  34.553  102.878 1.00 34.95 ? 221 VAL A CB  1 
ATOM   1480  C CG1 . VAL A 1 223 ? 58.389  34.992  104.195 1.00 34.95 ? 221 VAL A CG1 1 
ATOM   1481  C CG2 . VAL A 1 223 ? 60.523  34.515  102.976 1.00 34.95 ? 221 VAL A CG2 1 
ATOM   1482  N N   . TYR A 1 224 ? 56.092  32.748  102.874 1.00 53.86 ? 222 TYR A N   1 
ATOM   1483  C CA  . TYR A 1 224 ? 54.652  32.859  102.641 1.00 53.86 ? 222 TYR A CA  1 
ATOM   1484  C C   . TYR A 1 224 ? 54.301  34.332  102.731 1.00 53.86 ? 222 TYR A C   1 
ATOM   1485  O O   . TYR A 1 224 ? 54.158  34.866  103.825 1.00 53.86 ? 222 TYR A O   1 
ATOM   1486  C CB  . TYR A 1 224 ? 53.898  32.104  103.727 1.00 71.51 ? 222 TYR A CB  1 
ATOM   1487  C CG  . TYR A 1 224 ? 52.459  31.798  103.400 1.00 71.51 ? 222 TYR A CG  1 
ATOM   1488  C CD1 . TYR A 1 224 ? 52.142  30.830  102.455 1.00 71.51 ? 222 TYR A CD1 1 
ATOM   1489  C CD2 . TYR A 1 224 ? 51.411  32.443  104.062 1.00 71.51 ? 222 TYR A CD2 1 
ATOM   1490  C CE1 . TYR A 1 224 ? 50.825  30.501  102.176 1.00 71.51 ? 222 TYR A CE1 1 
ATOM   1491  C CE2 . TYR A 1 224 ? 50.086  32.122  103.791 1.00 71.51 ? 222 TYR A CE2 1 
ATOM   1492  C CZ  . TYR A 1 224 ? 49.802  31.145  102.842 1.00 71.51 ? 222 TYR A CZ  1 
ATOM   1493  O OH  . TYR A 1 224 ? 48.506  30.793  102.543 1.00 71.51 ? 222 TYR A OH  1 
ATOM   1494  N N   . LEU A 1 225 ? 54.160  34.996  101.593 1.00 45.59 ? 223 LEU A N   1 
ATOM   1495  C CA  . LEU A 1 225 ? 53.861  36.419  101.629 1.00 45.59 ? 223 LEU A CA  1 
ATOM   1496  C C   . LEU A 1 225 ? 52.509  36.702  102.259 1.00 45.59 ? 223 LEU A C   1 
ATOM   1497  O O   . LEU A 1 225 ? 52.361  37.703  102.964 1.00 45.59 ? 223 LEU A O   1 
ATOM   1498  C CB  . LEU A 1 225 ? 53.905  37.029  100.228 1.00 25.69 ? 223 LEU A CB  1 
ATOM   1499  C CG  . LEU A 1 225 ? 55.123  36.812  99.333  1.00 25.69 ? 223 LEU A CG  1 
ATOM   1500  C CD1 . LEU A 1 225 ? 54.921  37.669  98.102  1.00 25.69 ? 223 LEU A CD1 1 
ATOM   1501  C CD2 . LEU A 1 225 ? 56.448  37.188  100.034 1.00 25.69 ? 223 LEU A CD2 1 
ATOM   1502  N N   . GLU A 1 226 ? 51.530  35.827  102.005 1.00 51.44 ? 224 GLU A N   1 
ATOM   1503  C CA  . GLU A 1 226 ? 50.178  35.993  102.552 1.00 51.44 ? 224 GLU A CA  1 
ATOM   1504  C C   . GLU A 1 226 ? 50.225  36.147  104.059 1.00 51.44 ? 224 GLU A C   1 
ATOM   1505  O O   . GLU A 1 226 ? 49.542  36.999  104.622 1.00 51.44 ? 224 GLU A O   1 
ATOM   1506  C CB  . GLU A 1 226 ? 49.283  34.802  102.203 1.00 88.04 ? 224 GLU A CB  1 
ATOM   1507  C CG  . GLU A 1 226 ? 48.664  34.856  100.819 1.00 88.04 ? 224 GLU A CG  1 
ATOM   1508  C CD  . GLU A 1 226 ? 49.679  34.660  99.706  1.00 88.04 ? 224 GLU A CD  1 
ATOM   1509  O OE1 . GLU A 1 226 ? 50.599  35.494  99.576  1.00 88.04 ? 224 GLU A OE1 1 
ATOM   1510  O OE2 . GLU A 1 226 ? 49.549  33.665  98.957  1.00 88.04 ? 224 GLU A OE2 1 
ATOM   1511  N N   . GLY A 1 227 ? 51.029  35.307  104.702 1.00 55.28 ? 225 GLY A N   1 
ATOM   1512  C CA  . GLY A 1 227 ? 51.176  35.372  106.143 1.00 47.30 ? 225 GLY A CA  1 
ATOM   1513  C C   . GLY A 1 227 ? 52.380  36.223  106.495 1.00 56.97 ? 225 GLY A C   1 
ATOM   1514  O O   . GLY A 1 227 ? 53.305  35.760  107.149 1.00 60.55 ? 225 GLY A O   1 
ATOM   1515  N N   . THR A 1 228 ? 52.359  37.473  106.051 1.00 37.86 ? 226 THR A N   1 
ATOM   1516  C CA  . THR A 1 228 ? 53.441  38.419  106.287 1.00 39.18 ? 226 THR A CA  1 
ATOM   1517  C C   . THR A 1 228 ? 52.808  39.780  106.429 1.00 42.58 ? 226 THR A C   1 
ATOM   1518  O O   . THR A 1 228 ? 51.595  39.886  106.492 1.00 38.87 ? 226 THR A O   1 
ATOM   1519  C CB  . THR A 1 228 ? 54.405  38.438  105.080 1.00 36.50 ? 226 THR A CB  1 
ATOM   1520  O OG1 . THR A 1 228 ? 55.702  38.029  105.511 1.00 51.32 ? 226 THR A OG1 1 
ATOM   1521  C CG2 . THR A 1 228 ? 54.495  39.826  104.439 1.00 24.77 ? 226 THR A CG2 1 
ATOM   1522  N N   . LEU A 1 229 ? 53.629  40.816  106.485 1.00 28.41 ? 227 LEU A N   1 
ATOM   1523  C CA  . LEU A 1 229 ? 53.139  42.179  106.563 1.00 27.87 ? 227 LEU A CA  1 
ATOM   1524  C C   . LEU A 1 229 ? 54.324  43.087  106.317 1.00 33.33 ? 227 LEU A C   1 
ATOM   1525  O O   . LEU A 1 229 ? 55.427  42.810  106.772 1.00 28.96 ? 227 LEU A O   1 
ATOM   1526  C CB  . LEU A 1 229 ? 52.533  42.465  107.939 1.00 29.25 ? 227 LEU A CB  1 
ATOM   1527  C CG  . LEU A 1 229 ? 51.137  41.928  108.288 1.00 35.79 ? 227 LEU A CG  1 
ATOM   1528  C CD1 . LEU A 1 229 ? 50.889  42.036  109.793 1.00 22.13 ? 227 LEU A CD1 1 
ATOM   1529  C CD2 . LEU A 1 229 ? 50.078  42.700  107.516 1.00 24.34 ? 227 LEU A CD2 1 
ATOM   1530  N N   . LEU A 1 230 ? 54.099  44.165  105.582 1.00 22.11 ? 228 LEU A N   1 
ATOM   1531  C CA  . LEU A 1 230 ? 55.156  45.120  105.287 1.00 22.96 ? 228 LEU A CA  1 
ATOM   1532  C C   . LEU A 1 230 ? 54.992  46.340  106.163 1.00 31.55 ? 228 LEU A C   1 
ATOM   1533  O O   . LEU A 1 230 ? 53.873  46.775  106.429 1.00 31.06 ? 228 LEU A O   1 
ATOM   1534  C CB  . LEU A 1 230 ? 55.108  45.551  103.818 1.00 18.68 ? 228 LEU A CB  1 
ATOM   1535  C CG  . LEU A 1 230 ? 56.096  46.633  103.377 1.00 28.37 ? 228 LEU A CG  1 
ATOM   1536  C CD1 . LEU A 1 230 ? 57.479  46.133  103.676 1.00 15.48 ? 228 LEU A CD1 1 
ATOM   1537  C CD2 . LEU A 1 230 ? 55.976  46.937  101.886 1.00 15.39 ? 228 LEU A CD2 1 
ATOM   1538  N N   . LYS A 1 231 ? 56.122  46.862  106.625 1.00 46.52 ? 229 LYS A N   1 
ATOM   1539  C CA  . LYS A 1 231 ? 56.157  48.066  107.445 1.00 43.75 ? 229 LYS A CA  1 
ATOM   1540  C C   . LYS A 1 231 ? 57.134  49.012  106.738 1.00 46.01 ? 229 LYS A C   1 
ATOM   1541  O O   . LYS A 1 231 ? 58.326  49.043  107.045 1.00 50.09 ? 229 LYS A O   1 
ATOM   1542  C CB  . LYS A 1 231 ? 56.630  47.748  108.873 1.00 38.31 ? 229 LYS A CB  1 
ATOM   1543  C CG  . LYS A 1 231 ? 56.639  48.970  109.788 1.00 26.02 ? 229 LYS A CG  1 
ATOM   1544  C CD  . LYS A 1 231 ? 56.415  48.612  111.252 1.00 37.19 ? 229 LYS A CD  1 
ATOM   1545  C CE  . LYS A 1 231 ? 56.195  49.882  112.109 1.00 36.75 ? 229 LYS A CE  1 
ATOM   1546  N NZ  . LYS A 1 231 ? 55.911  49.602  113.564 1.00 45.25 ? 229 LYS A NZ  1 
ATOM   1547  N N   . PRO A 1 232 ? 56.636  49.769  105.746 1.00 29.90 ? 230 PRO A N   1 
ATOM   1548  C CA  . PRO A 1 232 ? 57.438  50.713  104.971 1.00 30.97 ? 230 PRO A CA  1 
ATOM   1549  C C   . PRO A 1 232 ? 57.318  52.140  105.461 1.00 37.02 ? 230 PRO A C   1 
ATOM   1550  O O   . PRO A 1 232 ? 56.564  52.441  106.380 1.00 39.59 ? 230 PRO A O   1 
ATOM   1551  C CB  . PRO A 1 232 ? 56.869  50.551  103.575 1.00 68.12 ? 230 PRO A CB  1 
ATOM   1552  C CG  . PRO A 1 232 ? 55.409  50.487  103.870 1.00 79.71 ? 230 PRO A CG  1 
ATOM   1553  C CD  . PRO A 1 232 ? 55.330  49.560  105.091 1.00 75.50 ? 230 PRO A CD  1 
ATOM   1554  N N   . ASN A 1 233 ? 58.073  53.017  104.821 1.00 63.32 ? 231 ASN A N   1 
ATOM   1555  C CA  . ASN A 1 233 ? 58.087  54.430  105.156 1.00 63.38 ? 231 ASN A CA  1 
ATOM   1556  C C   . ASN A 1 233 ? 57.295  55.149  104.086 1.00 70.77 ? 231 ASN A C   1 
ATOM   1557  O O   . ASN A 1 233 ? 57.109  54.624  103.002 1.00 65.29 ? 231 ASN A O   1 
ATOM   1558  C CB  . ASN A 1 233 ? 59.523  54.942  105.134 1.00 92.42 ? 231 ASN A CB  1 
ATOM   1559  C CG  . ASN A 1 233 ? 60.177  54.779  103.762 1.00 92.42 ? 231 ASN A CG  1 
ATOM   1560  O OD1 . ASN A 1 233 ? 59.846  55.494  102.807 1.00 92.42 ? 231 ASN A OD1 1 
ATOM   1561  N ND2 . ASN A 1 233 ? 61.100  53.825  103.656 1.00 92.42 ? 231 ASN A ND2 1 
ATOM   1562  N N   . MET A 1 234 ? 56.822  56.348  104.378 1.00 80.85 ? 232 MET A N   1 
ATOM   1563  C CA  . MET A 1 234 ? 56.095  57.086  103.364 1.00 80.85 ? 232 MET A CA  1 
ATOM   1564  C C   . MET A 1 234 ? 57.140  57.879  102.604 1.00 80.85 ? 232 MET A C   1 
ATOM   1565  O O   . MET A 1 234 ? 57.881  58.652  103.202 1.00 80.85 ? 232 MET A O   1 
ATOM   1566  C CB  . MET A 1 234 ? 55.095  58.049  104.001 1.00 62.56 ? 232 MET A CB  1 
ATOM   1567  C CG  . MET A 1 234 ? 54.201  57.414  105.042 1.00 62.83 ? 232 MET A CG  1 
ATOM   1568  S SD  . MET A 1 234 ? 52.829  58.479  105.482 1.00 66.02 ? 232 MET A SD  1 
ATOM   1569  C CE  . MET A 1 234 ? 51.649  57.270  106.009 1.00 65.72 ? 232 MET A CE  1 
ATOM   1570  N N   . VAL A 1 235 ? 57.230  57.672  101.299 1.00 50.47 ? 233 VAL A N   1 
ATOM   1571  C CA  . VAL A 1 235 ? 58.188  58.425  100.501 1.00 50.10 ? 233 VAL A CA  1 
ATOM   1572  C C   . VAL A 1 235 ? 57.955  59.925  100.766 1.00 44.25 ? 233 VAL A C   1 
ATOM   1573  O O   . VAL A 1 235 ? 57.132  60.565  100.098 1.00 53.09 ? 233 VAL A O   1 
ATOM   1574  C CB  . VAL A 1 235 ? 57.999  58.107  98.988  1.00 51.81 ? 233 VAL A CB  1 
ATOM   1575  C CG1 . VAL A 1 235 ? 58.792  59.095  98.114  1.00 36.71 ? 233 VAL A CG1 1 
ATOM   1576  C CG2 . VAL A 1 235 ? 58.429  56.670  98.712  1.00 43.40 ? 233 VAL A CG2 1 
ATOM   1577  N N   . THR A 1 236 ? 58.665  60.474  101.759 1.00 92.42 ? 234 THR A N   1 
ATOM   1578  C CA  . THR A 1 236 ? 58.550  61.898  102.128 1.00 92.42 ? 234 THR A CA  1 
ATOM   1579  C C   . THR A 1 236 ? 59.873  62.642  101.914 1.00 92.42 ? 234 THR A C   1 
ATOM   1580  O O   . THR A 1 236 ? 60.937  62.025  101.823 1.00 92.42 ? 234 THR A O   1 
ATOM   1581  C CB  . THR A 1 236 ? 58.142  62.090  103.619 1.00 92.42 ? 234 THR A CB  1 
ATOM   1582  O OG1 . THR A 1 236 ? 59.205  61.641  104.470 1.00 92.42 ? 234 THR A OG1 1 
ATOM   1583  C CG2 . THR A 1 236 ? 56.879  61.304  103.946 1.00 92.42 ? 234 THR A CG2 1 
ATOM   1584  N N   . ALA A 1 237 ? 59.793  63.969  101.847 1.00 92.42 ? 235 ALA A N   1 
ATOM   1585  C CA  . ALA A 1 237 ? 60.968  64.816  101.638 1.00 92.42 ? 235 ALA A CA  1 
ATOM   1586  C C   . ALA A 1 237 ? 62.275  64.242  102.210 1.00 92.42 ? 235 ALA A C   1 
ATOM   1587  O O   . ALA A 1 237 ? 62.301  63.662  103.301 1.00 92.42 ? 235 ALA A O   1 
ATOM   1588  C CB  . ALA A 1 237 ? 60.708  66.211  102.222 1.00 92.42 ? 235 ALA A CB  1 
ATOM   1589  N N   . TYR A 1 245 ? 55.186  69.428  98.822  1.00 85.44 ? 243 TYR A N   1 
ATOM   1590  C CA  . TYR A 1 245 ? 55.128  67.983  99.012  1.00 85.44 ? 243 TYR A CA  1 
ATOM   1591  C C   . TYR A 1 245 ? 53.900  67.557  99.818  1.00 85.44 ? 243 TYR A C   1 
ATOM   1592  O O   . TYR A 1 245 ? 54.003  66.713  100.711 1.00 85.44 ? 243 TYR A O   1 
ATOM   1593  C CB  . TYR A 1 245 ? 56.405  67.485  99.716  1.00 81.87 ? 243 TYR A CB  1 
ATOM   1594  C CG  . TYR A 1 245 ? 57.602  67.231  98.803  1.00 81.87 ? 243 TYR A CG  1 
ATOM   1595  C CD1 . TYR A 1 245 ? 58.846  66.870  99.334  1.00 81.87 ? 243 TYR A CD1 1 
ATOM   1596  C CD2 . TYR A 1 245 ? 57.490  67.341  97.411  1.00 81.87 ? 243 TYR A CD2 1 
ATOM   1597  C CE1 . TYR A 1 245 ? 59.944  66.628  98.502  1.00 81.87 ? 243 TYR A CE1 1 
ATOM   1598  C CE2 . TYR A 1 245 ? 58.583  67.101  96.576  1.00 81.87 ? 243 TYR A CE2 1 
ATOM   1599  C CZ  . TYR A 1 245 ? 59.802  66.748  97.127  1.00 81.87 ? 243 TYR A CZ  1 
ATOM   1600  O OH  . TYR A 1 245 ? 60.876  66.527  96.298  1.00 81.87 ? 243 TYR A OH  1 
ATOM   1601  N N   . THR A 1 246 ? 52.743  68.134  99.496  1.00 85.81 ? 244 THR A N   1 
ATOM   1602  C CA  . THR A 1 246 ? 51.501  67.806  100.199 1.00 85.81 ? 244 THR A CA  1 
ATOM   1603  C C   . THR A 1 246 ? 51.236  66.305  100.194 1.00 85.81 ? 244 THR A C   1 
ATOM   1604  O O   . THR A 1 246 ? 51.650  65.599  99.276  1.00 85.81 ? 244 THR A O   1 
ATOM   1605  C CB  . THR A 1 246 ? 50.286  68.521  99.574  1.00 83.61 ? 244 THR A CB  1 
ATOM   1606  O OG1 . THR A 1 246 ? 50.216  68.217  98.175  1.00 83.61 ? 244 THR A OG1 1 
ATOM   1607  C CG2 . THR A 1 246 ? 50.392  70.033  99.778  1.00 83.61 ? 244 THR A CG2 1 
ATOM   1608  N N   . PRO A 1 247 ? 50.536  65.802  101.228 1.00 87.22 ? 245 PRO A N   1 
ATOM   1609  C CA  . PRO A 1 247 ? 50.181  64.390  101.408 1.00 87.22 ? 245 PRO A CA  1 
ATOM   1610  C C   . PRO A 1 247 ? 49.800  63.668  100.122 1.00 87.22 ? 245 PRO A C   1 
ATOM   1611  O O   . PRO A 1 247 ? 50.151  62.507  99.924  1.00 87.22 ? 245 PRO A O   1 
ATOM   1612  C CB  . PRO A 1 247 ? 49.034  64.458  102.406 1.00 92.42 ? 245 PRO A CB  1 
ATOM   1613  C CG  . PRO A 1 247 ? 49.477  65.564  103.297 1.00 92.42 ? 245 PRO A CG  1 
ATOM   1614  C CD  . PRO A 1 247 ? 49.930  66.618  102.295 1.00 92.42 ? 245 PRO A CD  1 
ATOM   1615  N N   . GLU A 1 248 ? 49.071  64.352  99.253  1.00 80.98 ? 246 GLU A N   1 
ATOM   1616  C CA  . GLU A 1 248 ? 48.680  63.756  97.987  1.00 80.98 ? 246 GLU A CA  1 
ATOM   1617  C C   . GLU A 1 248 ? 49.967  63.437  97.241  1.00 80.98 ? 246 GLU A C   1 
ATOM   1618  O O   . GLU A 1 248 ? 50.195  62.304  96.819  1.00 80.98 ? 246 GLU A O   1 
ATOM   1619  C CB  . GLU A 1 248 ? 47.840  64.740  97.177  1.00 92.42 ? 246 GLU A CB  1 
ATOM   1620  C CG  . GLU A 1 248 ? 46.566  65.172  97.877  1.00 92.42 ? 246 GLU A CG  1 
ATOM   1621  C CD  . GLU A 1 248 ? 46.830  65.867  99.203  1.00 92.42 ? 246 GLU A CD  1 
ATOM   1622  O OE1 . GLU A 1 248 ? 47.557  66.886  99.207  1.00 92.42 ? 246 GLU A OE1 1 
ATOM   1623  O OE2 . GLU A 1 248 ? 46.312  65.395  100.240 1.00 92.42 ? 246 GLU A OE2 1 
ATOM   1624  N N   . GLN A 1 249 ? 50.813  64.451  97.103  1.00 75.59 ? 247 GLN A N   1 
ATOM   1625  C CA  . GLN A 1 249 ? 52.086  64.306  96.417  1.00 75.59 ? 247 GLN A CA  1 
ATOM   1626  C C   . GLN A 1 249 ? 52.977  63.307  97.117  1.00 75.59 ? 247 GLN A C   1 
ATOM   1627  O O   . GLN A 1 249 ? 53.858  62.711  96.499  1.00 75.59 ? 247 GLN A O   1 
ATOM   1628  C CB  . GLN A 1 249 ? 52.792  65.645  96.356  1.00 60.12 ? 247 GLN A CB  1 
ATOM   1629  C CG  . GLN A 1 249 ? 51.985  66.678  95.648  1.00 60.12 ? 247 GLN A CG  1 
ATOM   1630  C CD  . GLN A 1 249 ? 52.713  67.973  95.556  1.00 60.12 ? 247 GLN A CD  1 
ATOM   1631  O OE1 . GLN A 1 249 ? 52.978  68.620  96.570  1.00 60.12 ? 247 GLN A OE1 1 
ATOM   1632  N NE2 . GLN A 1 249 ? 53.061  68.366  94.338  1.00 60.12 ? 247 GLN A NE2 1 
ATOM   1633  N N   . VAL A 1 250 ? 52.757  63.140  98.415  1.00 87.80 ? 248 VAL A N   1 
ATOM   1634  C CA  . VAL A 1 250 ? 53.543  62.193  99.190  1.00 87.80 ? 248 VAL A CA  1 
ATOM   1635  C C   . VAL A 1 250 ? 52.947  60.812  98.964  1.00 87.80 ? 248 VAL A C   1 
ATOM   1636  O O   . VAL A 1 250 ? 53.667  59.820  98.880  1.00 87.80 ? 248 VAL A O   1 
ATOM   1637  C CB  . VAL A 1 250 ? 53.507  62.526  100.698 1.00 82.97 ? 248 VAL A CB  1 
ATOM   1638  C CG1 . VAL A 1 250 ? 54.348  61.523  101.468 1.00 82.97 ? 248 VAL A CG1 1 
ATOM   1639  C CG2 . VAL A 1 250 ? 54.022  63.939  100.932 1.00 82.97 ? 248 VAL A CG2 1 
ATOM   1640  N N   . ALA A 1 251 ? 51.623  60.766  98.843  1.00 62.08 ? 249 ALA A N   1 
ATOM   1641  C CA  . ALA A 1 251 ? 50.914  59.516  98.627  1.00 62.08 ? 249 ALA A CA  1 
ATOM   1642  C C   . ALA A 1 251 ? 51.008  59.084  97.161  1.00 62.08 ? 249 ALA A C   1 
ATOM   1643  O O   . ALA A 1 251 ? 51.005  57.888  96.855  1.00 62.08 ? 249 ALA A O   1 
ATOM   1644  C CB  . ALA A 1 251 ? 49.461  59.668  99.050  1.00 56.52 ? 249 ALA A CB  1 
ATOM   1645  N N   . MET A 1 252 ? 51.098  60.057  96.259  1.00 77.99 ? 250 MET A N   1 
ATOM   1646  C CA  . MET A 1 252 ? 51.208  59.757  94.837  1.00 77.99 ? 250 MET A CA  1 
ATOM   1647  C C   . MET A 1 252 ? 52.595  59.188  94.550  1.00 77.99 ? 250 MET A C   1 
ATOM   1648  O O   . MET A 1 252 ? 52.773  58.395  93.628  1.00 77.99 ? 250 MET A O   1 
ATOM   1649  C CB  . MET A 1 252 ? 50.967  61.021  93.999  1.00 78.64 ? 250 MET A CB  1 
ATOM   1650  C CG  . MET A 1 252 ? 51.099  60.826  92.486  1.00 78.64 ? 250 MET A CG  1 
ATOM   1651  S SD  . MET A 1 252 ? 50.117  59.442  91.801  1.00 78.64 ? 250 MET A SD  1 
ATOM   1652  C CE  . MET A 1 252 ? 51.180  58.892  90.406  1.00 78.64 ? 250 MET A CE  1 
ATOM   1653  N N   . ALA A 1 253 ? 53.576  59.588  95.353  1.00 66.69 ? 251 ALA A N   1 
ATOM   1654  C CA  . ALA A 1 253 ? 54.937  59.103  95.181  1.00 66.69 ? 251 ALA A CA  1 
ATOM   1655  C C   . ALA A 1 253 ? 55.173  57.887  96.066  1.00 66.69 ? 251 ALA A C   1 
ATOM   1656  O O   . ALA A 1 253 ? 56.128  57.137  95.860  1.00 66.69 ? 251 ALA A O   1 
ATOM   1657  C CB  . ALA A 1 253 ? 55.928  60.194  95.520  1.00 82.69 ? 251 ALA A CB  1 
ATOM   1658  N N   . THR A 1 254 ? 54.303  57.698  97.055  1.00 34.63 ? 252 THR A N   1 
ATOM   1659  C CA  . THR A 1 254 ? 54.423  56.552  97.954  1.00 34.63 ? 252 THR A CA  1 
ATOM   1660  C C   . THR A 1 254 ? 53.785  55.283  97.357  1.00 34.63 ? 252 THR A C   1 
ATOM   1661  O O   . THR A 1 254 ? 54.441  54.239  97.218  1.00 34.63 ? 252 THR A O   1 
ATOM   1662  C CB  . THR A 1 254 ? 53.750  56.824  99.305  1.00 22.40 ? 252 THR A CB  1 
ATOM   1663  O OG1 . THR A 1 254 ? 54.368  57.954  99.932  1.00 22.40 ? 252 THR A OG1 1 
ATOM   1664  C CG2 . THR A 1 254 ? 53.875  55.596  100.206 1.00 22.40 ? 252 THR A CG2 1 
ATOM   1665  N N   . VAL A 1 255 ? 52.504  55.380  97.009  1.00 74.70 ? 253 VAL A N   1 
ATOM   1666  C CA  . VAL A 1 255 ? 51.793  54.248  96.431  1.00 74.70 ? 253 VAL A CA  1 
ATOM   1667  C C   . VAL A 1 255 ? 52.497  53.795  95.165  1.00 74.70 ? 253 VAL A C   1 
ATOM   1668  O O   . VAL A 1 255 ? 52.815  52.618  95.013  1.00 74.70 ? 253 VAL A O   1 
ATOM   1669  C CB  . VAL A 1 255 ? 50.346  54.612  96.084  1.00 44.16 ? 253 VAL A CB  1 
ATOM   1670  C CG1 . VAL A 1 255 ? 49.590  53.369  95.621  1.00 44.16 ? 253 VAL A CG1 1 
ATOM   1671  C CG2 . VAL A 1 255 ? 49.680  55.232  97.290  1.00 44.16 ? 253 VAL A CG2 1 
ATOM   1672  N N   . THR A 1 256 ? 52.740  54.737  94.259  1.00 53.78 ? 254 THR A N   1 
ATOM   1673  C CA  . THR A 1 256 ? 53.414  54.431  93.004  1.00 53.78 ? 254 THR A CA  1 
ATOM   1674  C C   . THR A 1 256 ? 54.580  53.487  93.242  1.00 53.78 ? 254 THR A C   1 
ATOM   1675  O O   . THR A 1 256 ? 54.592  52.337  92.775  1.00 53.78 ? 254 THR A O   1 
ATOM   1676  C CB  . THR A 1 256 ? 53.939  55.718  92.335  1.00 22.69 ? 254 THR A CB  1 
ATOM   1677  O OG1 . THR A 1 256 ? 52.958  56.208  91.414  1.00 22.69 ? 254 THR A OG1 1 
ATOM   1678  C CG2 . THR A 1 256 ? 55.235  55.459  91.586  1.00 22.69 ? 254 THR A CG2 1 
ATOM   1679  N N   . ALA A 1 257 ? 55.558  53.990  93.983  1.00 54.55 ? 255 ALA A N   1 
ATOM   1680  C CA  . ALA A 1 257 ? 56.743  53.221  94.297  1.00 54.55 ? 255 ALA A CA  1 
ATOM   1681  C C   . ALA A 1 257 ? 56.367  51.903  94.976  1.00 54.55 ? 255 ALA A C   1 
ATOM   1682  O O   . ALA A 1 257 ? 57.081  50.899  94.857  1.00 54.55 ? 255 ALA A O   1 
ATOM   1683  C CB  . ALA A 1 257 ? 57.636  54.040  95.188  1.00 51.95 ? 255 ALA A CB  1 
ATOM   1684  N N   . LEU A 1 258 ? 55.234  51.916  95.676  1.00 55.83 ? 256 LEU A N   1 
ATOM   1685  C CA  . LEU A 1 258 ? 54.741  50.743  96.395  1.00 55.83 ? 256 LEU A CA  1 
ATOM   1686  C C   . LEU A 1 258 ? 54.120  49.675  95.499  1.00 55.83 ? 256 LEU A C   1 
ATOM   1687  O O   . LEU A 1 258 ? 54.387  48.480  95.666  1.00 55.83 ? 256 LEU A O   1 
ATOM   1688  C CB  . LEU A 1 258 ? 53.721  51.176  97.457  1.00 27.52 ? 256 LEU A CB  1 
ATOM   1689  C CG  . LEU A 1 258 ? 54.295  51.720  98.772  1.00 27.52 ? 256 LEU A CG  1 
ATOM   1690  C CD1 . LEU A 1 258 ? 53.272  52.566  99.492  1.00 27.52 ? 256 LEU A CD1 1 
ATOM   1691  C CD2 . LEU A 1 258 ? 54.756  50.560  99.644  1.00 27.52 ? 256 LEU A CD2 1 
ATOM   1692  N N   . HIS A 1 259 ? 53.302  50.106  94.544  1.00 70.03 ? 257 HIS A N   1 
ATOM   1693  C CA  . HIS A 1 259 ? 52.627  49.166  93.663  1.00 70.03 ? 257 HIS A CA  1 
ATOM   1694  C C   . HIS A 1 259 ? 53.545  48.605  92.587  1.00 70.03 ? 257 HIS A C   1 
ATOM   1695  O O   . HIS A 1 259 ? 53.265  47.549  92.003  1.00 70.03 ? 257 HIS A O   1 
ATOM   1696  C CB  . HIS A 1 259 ? 51.376  49.827  93.056  1.00 89.41 ? 257 HIS A CB  1 
ATOM   1697  C CG  . HIS A 1 259 ? 51.583  50.417  91.696  1.00 89.41 ? 257 HIS A CG  1 
ATOM   1698  N ND1 . HIS A 1 259 ? 52.578  51.329  91.418  1.00 89.41 ? 257 HIS A ND1 1 
ATOM   1699  C CD2 . HIS A 1 259 ? 50.894  50.248  90.541  1.00 89.41 ? 257 HIS A CD2 1 
ATOM   1700  C CE1 . HIS A 1 259 ? 52.493  51.695  90.151  1.00 89.41 ? 257 HIS A CE1 1 
ATOM   1701  N NE2 . HIS A 1 259 ? 51.480  51.054  89.597  1.00 89.41 ? 257 HIS A NE2 1 
ATOM   1702  N N   . ARG A 1 260 ? 54.646  49.305  92.336  1.00 47.82 ? 258 ARG A N   1 
ATOM   1703  C CA  . ARG A 1 260 ? 55.606  48.850  91.344  1.00 47.82 ? 258 ARG A CA  1 
ATOM   1704  C C   . ARG A 1 260 ? 56.490  47.777  91.959  1.00 47.82 ? 258 ARG A C   1 
ATOM   1705  O O   . ARG A 1 260 ? 57.205  47.074  91.246  1.00 47.82 ? 258 ARG A O   1 
ATOM   1706  C CB  . ARG A 1 260 ? 56.510  49.993  90.898  1.00 66.04 ? 258 ARG A CB  1 
ATOM   1707  C CG  . ARG A 1 260 ? 55.819  51.184  90.284  1.00 66.04 ? 258 ARG A CG  1 
ATOM   1708  C CD  . ARG A 1 260 ? 56.815  51.937  89.407  1.00 66.04 ? 258 ARG A CD  1 
ATOM   1709  N NE  . ARG A 1 260 ? 56.392  53.300  89.094  1.00 66.04 ? 258 ARG A NE  1 
ATOM   1710  C CZ  . ARG A 1 260 ? 57.159  54.187  88.471  1.00 66.04 ? 258 ARG A CZ  1 
ATOM   1711  N NH1 . ARG A 1 260 ? 58.386  53.849  88.094  1.00 66.04 ? 258 ARG A NH1 1 
ATOM   1712  N NH2 . ARG A 1 260 ? 56.710  55.413  88.242  1.00 66.04 ? 258 ARG A NH2 1 
ATOM   1713  N N   . THR A 1 261 ? 56.420  47.652  93.286  1.00 32.20 ? 259 THR A N   1 
ATOM   1714  C CA  . THR A 1 261 ? 57.256  46.714  94.050  1.00 32.20 ? 259 THR A CA  1 
ATOM   1715  C C   . THR A 1 261 ? 56.574  45.688  94.972  1.00 32.20 ? 259 THR A C   1 
ATOM   1716  O O   . THR A 1 261 ? 56.920  44.505  94.980  1.00 32.20 ? 259 THR A O   1 
ATOM   1717  C CB  . THR A 1 261 ? 58.182  47.517  94.904  1.00 27.79 ? 259 THR A CB  1 
ATOM   1718  O OG1 . THR A 1 261 ? 57.427  48.571  95.510  1.00 27.79 ? 259 THR A OG1 1 
ATOM   1719  C CG2 . THR A 1 261 ? 59.284  48.120  94.061  1.00 27.79 ? 259 THR A CG2 1 
ATOM   1720  N N   . VAL A 1 262 ? 55.616  46.157  95.759  1.00 54.73 ? 260 VAL A N   1 
ATOM   1721  C CA  . VAL A 1 262 ? 54.914  45.295  96.694  1.00 54.73 ? 260 VAL A CA  1 
ATOM   1722  C C   . VAL A 1 262 ? 53.816  44.413  96.087  1.00 54.73 ? 260 VAL A C   1 
ATOM   1723  O O   . VAL A 1 262 ? 52.787  44.911  95.619  1.00 54.73 ? 260 VAL A O   1 
ATOM   1724  C CB  . VAL A 1 262 ? 54.291  46.128  97.825  1.00 70.09 ? 260 VAL A CB  1 
ATOM   1725  C CG1 . VAL A 1 262 ? 53.704  45.199  98.878  1.00 70.09 ? 260 VAL A CG1 1 
ATOM   1726  C CG2 . VAL A 1 262 ? 55.339  47.055  98.432  1.00 70.09 ? 260 VAL A CG2 1 
ATOM   1727  N N   . PRO A 1 263 ? 54.032  43.083  96.088  1.00 32.54 ? 261 PRO A N   1 
ATOM   1728  C CA  . PRO A 1 263 ? 53.129  42.044  95.574  1.00 32.54 ? 261 PRO A CA  1 
ATOM   1729  C C   . PRO A 1 263 ? 51.728  42.064  96.163  1.00 32.54 ? 261 PRO A C   1 
ATOM   1730  O O   . PRO A 1 263 ? 51.558  42.252  97.363  1.00 32.54 ? 261 PRO A O   1 
ATOM   1731  C CB  . PRO A 1 263 ? 53.865  40.759  95.920  1.00 16.40 ? 261 PRO A CB  1 
ATOM   1732  C CG  . PRO A 1 263 ? 55.257  41.137  95.659  1.00 16.40 ? 261 PRO A CG  1 
ATOM   1733  C CD  . PRO A 1 263 ? 55.374  42.515  96.299  1.00 16.40 ? 261 PRO A CD  1 
ATOM   1734  N N   . ALA A 1 264 ? 50.733  41.852  95.309  1.00 52.50 ? 262 ALA A N   1 
ATOM   1735  C CA  . ALA A 1 264 ? 49.335  41.832  95.732  1.00 52.50 ? 262 ALA A CA  1 
ATOM   1736  C C   . ALA A 1 264 ? 49.116  40.889  96.909  1.00 52.50 ? 262 ALA A C   1 
ATOM   1737  O O   . ALA A 1 264 ? 48.333  41.198  97.810  1.00 52.50 ? 262 ALA A O   1 
ATOM   1738  C CB  . ALA A 1 264 ? 48.434  41.403  94.568  1.00 38.07 ? 262 ALA A CB  1 
ATOM   1739  N N   . ALA A 1 265 ? 49.815  39.750  96.888  1.00 36.00 ? 263 ALA A N   1 
ATOM   1740  C CA  . ALA A 1 265 ? 49.709  38.713  97.914  1.00 36.00 ? 263 ALA A CA  1 
ATOM   1741  C C   . ALA A 1 265 ? 50.046  39.140  99.329  1.00 36.00 ? 263 ALA A C   1 
ATOM   1742  O O   . ALA A 1 265 ? 49.851  38.367  100.269 1.00 36.00 ? 263 ALA A O   1 
ATOM   1743  C CB  . ALA A 1 265 ? 50.550  37.522  97.536  1.00 1.71  ? 263 ALA A CB  1 
ATOM   1744  N N   . VAL A 1 266 ? 50.570  40.351  99.493  1.00 65.75 ? 264 VAL A N   1 
ATOM   1745  C CA  . VAL A 1 266 ? 50.868  40.842  100.830 1.00 65.75 ? 264 VAL A CA  1 
ATOM   1746  C C   . VAL A 1 266 ? 49.558  41.452  101.312 1.00 65.75 ? 264 VAL A C   1 
ATOM   1747  O O   . VAL A 1 266 ? 49.071  42.438  100.748 1.00 65.75 ? 264 VAL A O   1 
ATOM   1748  C CB  . VAL A 1 266 ? 52.007  41.883  100.817 1.00 49.71 ? 264 VAL A CB  1 
ATOM   1749  C CG1 . VAL A 1 266 ? 51.892  42.802  102.013 1.00 49.71 ? 264 VAL A CG1 1 
ATOM   1750  C CG2 . VAL A 1 266 ? 53.352  41.163  100.869 1.00 49.71 ? 264 VAL A CG2 1 
ATOM   1751  N N   . PRO A 1 267 ? 48.959  40.846  102.353 1.00 40.95 ? 265 PRO A N   1 
ATOM   1752  C CA  . PRO A 1 267 ? 47.697  41.236  102.981 1.00 40.95 ? 265 PRO A CA  1 
ATOM   1753  C C   . PRO A 1 267 ? 47.579  42.692  103.406 1.00 40.95 ? 265 PRO A C   1 
ATOM   1754  O O   . PRO A 1 267 ? 46.478  43.257  103.423 1.00 40.95 ? 265 PRO A O   1 
ATOM   1755  C CB  . PRO A 1 267 ? 47.596  40.271  104.152 1.00 35.03 ? 265 PRO A CB  1 
ATOM   1756  C CG  . PRO A 1 267 ? 49.011  40.065  104.520 1.00 35.03 ? 265 PRO A CG  1 
ATOM   1757  C CD  . PRO A 1 267 ? 49.624  39.820  103.170 1.00 35.03 ? 265 PRO A CD  1 
ATOM   1758  N N   . GLY A 1 268 ? 48.699  43.311  103.750 1.00 36.79 ? 266 GLY A N   1 
ATOM   1759  C CA  . GLY A 1 268 ? 48.619  44.700  104.146 1.00 35.82 ? 266 GLY A CA  1 
ATOM   1760  C C   . GLY A 1 268 ? 49.950  45.345  104.409 1.00 39.93 ? 266 GLY A C   1 
ATOM   1761  O O   . GLY A 1 268 ? 50.932  44.673  104.680 1.00 38.01 ? 266 GLY A O   1 
ATOM   1762  N N   . ILE A 1 269 ? 49.976  46.665  104.334 1.00 40.45 ? 267 ILE A N   1 
ATOM   1763  C CA  . ILE A 1 269 ? 51.202  47.392  104.569 1.00 29.44 ? 267 ILE A CA  1 
ATOM   1764  C C   . ILE A 1 269 ? 50.960  48.579  105.513 1.00 40.86 ? 267 ILE A C   1 
ATOM   1765  O O   . ILE A 1 269 ? 50.556  49.669  105.087 1.00 41.92 ? 267 ILE A O   1 
ATOM   1766  C CB  . ILE A 1 269 ? 51.845  47.857  103.208 1.00 33.94 ? 267 ILE A CB  1 
ATOM   1767  C CG1 . ILE A 1 269 ? 51.346  49.241  102.789 1.00 26.82 ? 267 ILE A CG1 1 
ATOM   1768  C CG2 . ILE A 1 269 ? 51.516  46.837  102.100 1.00 26.98 ? 267 ILE A CG2 1 
ATOM   1769  C CD1 . ILE A 1 269 ? 52.136  49.844  101.638 1.00 60.02 ? 267 ILE A CD1 1 
ATOM   1770  N N   . CYS A 1 270 ? 51.199  48.343  106.805 1.00 35.97 ? 268 CYS A N   1 
ATOM   1771  C CA  . CYS A 1 270 ? 51.021  49.349  107.857 1.00 38.21 ? 268 CYS A CA  1 
ATOM   1772  C C   . CYS A 1 270 ? 52.253  50.242  107.878 1.00 44.55 ? 268 CYS A C   1 
ATOM   1773  O O   . CYS A 1 270 ? 53.357  49.756  108.082 1.00 39.51 ? 268 CYS A O   1 
ATOM   1774  C CB  . CYS A 1 270 ? 50.875  48.650  109.204 1.00 54.07 ? 268 CYS A CB  1 
ATOM   1775  S SG  . CYS A 1 270 ? 50.021  47.051  109.099 1.00 63.06 ? 268 CYS A SG  1 
ATOM   1776  N N   . PHE A 1 271 ? 52.064  51.543  107.670 1.00 49.20 ? 269 PHE A N   1 
ATOM   1777  C CA  . PHE A 1 271 ? 53.183  52.486  107.647 1.00 50.54 ? 269 PHE A CA  1 
ATOM   1778  C C   . PHE A 1 271 ? 53.696  52.876  109.025 1.00 50.63 ? 269 PHE A C   1 
ATOM   1779  O O   . PHE A 1 271 ? 52.983  52.742  110.023 1.00 57.96 ? 269 PHE A O   1 
ATOM   1780  C CB  . PHE A 1 271 ? 52.794  53.759  106.901 1.00 42.69 ? 269 PHE A CB  1 
ATOM   1781  C CG  . PHE A 1 271 ? 52.491  53.542  105.452 1.00 43.99 ? 269 PHE A CG  1 
ATOM   1782  C CD1 . PHE A 1 271 ? 51.266  53.013  105.052 1.00 37.05 ? 269 PHE A CD1 1 
ATOM   1783  C CD2 . PHE A 1 271 ? 53.428  53.872  104.478 1.00 46.08 ? 269 PHE A CD2 1 
ATOM   1784  C CE1 . PHE A 1 271 ? 50.975  52.821  103.694 1.00 49.93 ? 269 PHE A CE1 1 
ATOM   1785  C CE2 . PHE A 1 271 ? 53.144  53.682  103.126 1.00 41.44 ? 269 PHE A CE2 1 
ATOM   1786  C CZ  . PHE A 1 271 ? 51.914  53.156  102.735 1.00 52.72 ? 269 PHE A CZ  1 
ATOM   1787  N N   . LEU A 1 272 ? 54.942  53.349  109.079 1.00 60.25 ? 270 LEU A N   1 
ATOM   1788  C CA  . LEU A 1 272 ? 55.532  53.792  110.335 1.00 58.41 ? 270 LEU A CA  1 
ATOM   1789  C C   . LEU A 1 272 ? 55.538  55.316  110.262 1.00 62.66 ? 270 LEU A C   1 
ATOM   1790  O O   . LEU A 1 272 ? 56.046  55.900  109.306 1.00 58.30 ? 270 LEU A O   1 
ATOM   1791  C CB  . LEU A 1 272 ? 56.950  53.233  110.501 1.00 54.59 ? 270 LEU A CB  1 
ATOM   1792  C CG  . LEU A 1 272 ? 58.097  53.697  109.586 1.00 71.89 ? 270 LEU A CG  1 
ATOM   1793  C CD1 . LEU A 1 272 ? 58.529  55.115  109.961 1.00 51.31 ? 270 LEU A CD1 1 
ATOM   1794  C CD2 . LEU A 1 272 ? 59.300  52.749  109.733 1.00 59.29 ? 270 LEU A CD2 1 
ATOM   1795  N N   . SER A 1 273 ? 54.937  55.954  111.259 1.00 77.72 ? 271 SER A N   1 
ATOM   1796  C CA  . SER A 1 273 ? 54.846  57.411  111.305 1.00 79.48 ? 271 SER A CA  1 
ATOM   1797  C C   . SER A 1 273 ? 56.209  58.090  111.265 1.00 81.67 ? 271 SER A C   1 
ATOM   1798  O O   . SER A 1 273 ? 56.445  58.983  110.455 1.00 82.14 ? 271 SER A O   1 
ATOM   1799  C CB  . SER A 1 273 ? 54.080  57.854  112.561 1.00 92.42 ? 271 SER A CB  1 
ATOM   1800  O OG  . SER A 1 273 ? 54.644  57.307  113.747 1.00 92.42 ? 271 SER A OG  1 
ATOM   1801  N N   . GLY A 1 274 ? 57.091  57.663  112.162 1.00 92.42 ? 272 GLY A N   1 
ATOM   1802  C CA  . GLY A 1 274 ? 58.440  58.202  112.235 1.00 92.42 ? 272 GLY A CA  1 
ATOM   1803  C C   . GLY A 1 274 ? 58.717  59.677  111.951 1.00 92.42 ? 272 GLY A C   1 
ATOM   1804  O O   . GLY A 1 274 ? 59.087  60.050  110.834 1.00 92.42 ? 272 GLY A O   1 
ATOM   1805  N N   . GLY A 1 275 ? 58.564  60.523  112.963 1.00 79.26 ? 273 GLY A N   1 
ATOM   1806  C CA  . GLY A 1 275 ? 58.849  61.931  112.768 1.00 79.26 ? 273 GLY A CA  1 
ATOM   1807  C C   . GLY A 1 275 ? 57.722  62.700  112.123 1.00 79.26 ? 273 GLY A C   1 
ATOM   1808  O O   . GLY A 1 275 ? 57.921  63.802  111.615 1.00 79.26 ? 273 GLY A O   1 
ATOM   1809  N N   . MET A 1 276 ? 56.532  62.116  112.134 1.00 90.61 ? 274 MET A N   1 
ATOM   1810  C CA  . MET A 1 276 ? 55.379  62.782  111.557 1.00 90.61 ? 274 MET A CA  1 
ATOM   1811  C C   . MET A 1 276 ? 54.374  63.041  112.675 1.00 90.61 ? 274 MET A C   1 
ATOM   1812  O O   . MET A 1 276 ? 54.059  62.140  113.461 1.00 90.61 ? 274 MET A O   1 
ATOM   1813  C CB  . MET A 1 276 ? 54.753  61.910  110.468 1.00 92.42 ? 274 MET A CB  1 
ATOM   1814  C CG  . MET A 1 276 ? 55.749  61.426  109.425 1.00 92.42 ? 274 MET A CG  1 
ATOM   1815  S SD  . MET A 1 276 ? 54.980  60.575  108.023 1.00 92.42 ? 274 MET A SD  1 
ATOM   1816  C CE  . MET A 1 276 ? 54.077  59.247  108.876 1.00 92.42 ? 274 MET A CE  1 
ATOM   1817  N N   . SER A 1 277 ? 53.889  64.277  112.753 1.00 92.42 ? 275 SER A N   1 
ATOM   1818  C CA  . SER A 1 277 ? 52.921  64.661  113.777 1.00 92.42 ? 275 SER A CA  1 
ATOM   1819  C C   . SER A 1 277 ? 51.669  63.804  113.640 1.00 92.42 ? 275 SER A C   1 
ATOM   1820  O O   . SER A 1 277 ? 51.354  63.340  112.545 1.00 92.42 ? 275 SER A O   1 
ATOM   1821  C CB  . SER A 1 277 ? 52.556  66.142  113.624 1.00 63.55 ? 275 SER A CB  1 
ATOM   1822  O OG  . SER A 1 277 ? 52.038  66.409  112.330 1.00 81.53 ? 275 SER A OG  1 
ATOM   1823  N N   . GLU A 1 278 ? 50.958  63.589  114.745 1.00 66.09 ? 276 GLU A N   1 
ATOM   1824  C CA  . GLU A 1 278 ? 49.735  62.785  114.713 1.00 69.96 ? 276 GLU A CA  1 
ATOM   1825  C C   . GLU A 1 278 ? 48.771  63.338  113.673 1.00 69.96 ? 276 GLU A C   1 
ATOM   1826  O O   . GLU A 1 278 ? 47.865  62.638  113.233 1.00 69.96 ? 276 GLU A O   1 
ATOM   1827  C CB  . GLU A 1 278 ? 49.017  62.797  116.065 1.00 92.42 ? 276 GLU A CB  1 
ATOM   1828  C CG  . GLU A 1 278 ? 49.825  62.334  117.271 1.00 92.42 ? 276 GLU A CG  1 
ATOM   1829  C CD  . GLU A 1 278 ? 48.985  62.324  118.549 1.00 92.42 ? 276 GLU A CD  1 
ATOM   1830  O OE1 . GLU A 1 278 ? 48.443  63.394  118.921 1.00 92.42 ? 276 GLU A OE1 1 
ATOM   1831  O OE2 . GLU A 1 278 ? 48.862  61.250  119.181 1.00 92.42 ? 276 GLU A OE2 1 
ATOM   1832  N N   . GLU A 1 279 ? 48.967  64.598  113.293 1.00 92.42 ? 277 GLU A N   1 
ATOM   1833  C CA  . GLU A 1 279 ? 48.096  65.233  112.314 1.00 92.42 ? 277 GLU A CA  1 
ATOM   1834  C C   . GLU A 1 279 ? 48.587  65.067  110.869 1.00 92.42 ? 277 GLU A C   1 
ATOM   1835  O O   . GLU A 1 279 ? 47.810  65.213  109.921 1.00 92.42 ? 277 GLU A O   1 
ATOM   1836  C CB  . GLU A 1 279 ? 47.909  66.715  112.662 1.00 87.50 ? 277 GLU A CB  1 
ATOM   1837  C CG  . GLU A 1 279 ? 46.617  67.326  112.097 1.00 87.50 ? 277 GLU A CG  1 
ATOM   1838  C CD  . GLU A 1 279 ? 45.405  66.376  112.167 1.00 87.50 ? 277 GLU A CD  1 
ATOM   1839  O OE1 . GLU A 1 279 ? 45.157  65.758  113.231 1.00 87.50 ? 277 GLU A OE1 1 
ATOM   1840  O OE2 . GLU A 1 279 ? 44.691  66.259  111.145 1.00 87.50 ? 277 GLU A OE2 1 
ATOM   1841  N N   . ASP A 1 280 ? 49.868  64.758  110.692 1.00 92.42 ? 278 ASP A N   1 
ATOM   1842  C CA  . ASP A 1 280 ? 50.395  64.547  109.351 1.00 92.42 ? 278 ASP A CA  1 
ATOM   1843  C C   . ASP A 1 280 ? 50.498  63.062  109.057 1.00 92.42 ? 278 ASP A C   1 
ATOM   1844  O O   . ASP A 1 280 ? 50.568  62.655  107.900 1.00 92.42 ? 278 ASP A O   1 
ATOM   1845  C CB  . ASP A 1 280 ? 51.754  65.219  109.187 1.00 84.41 ? 278 ASP A CB  1 
ATOM   1846  C CG  . ASP A 1 280 ? 51.627  66.690  108.855 1.00 84.41 ? 278 ASP A CG  1 
ATOM   1847  O OD1 . ASP A 1 280 ? 50.960  67.015  107.847 1.00 84.41 ? 278 ASP A OD1 1 
ATOM   1848  O OD2 . ASP A 1 280 ? 52.189  67.518  109.600 1.00 84.41 ? 278 ASP A OD2 1 
ATOM   1849  N N   . ALA A 1 281 ? 50.507  62.252  110.107 1.00 60.36 ? 279 ALA A N   1 
ATOM   1850  C CA  . ALA A 1 281 ? 50.572  60.816  109.927 1.00 60.36 ? 279 ALA A CA  1 
ATOM   1851  C C   . ALA A 1 281 ? 49.168  60.364  109.568 1.00 60.36 ? 279 ALA A C   1 
ATOM   1852  O O   . ALA A 1 281 ? 48.955  59.201  109.242 1.00 60.36 ? 279 ALA A O   1 
ATOM   1853  C CB  . ALA A 1 281 ? 51.040  60.134  111.200 1.00 43.27 ? 279 ALA A CB  1 
ATOM   1854  N N   . THR A 1 282 ? 48.209  61.290  109.637 1.00 86.54 ? 280 THR A N   1 
ATOM   1855  C CA  . THR A 1 282 ? 46.822  60.977  109.291 1.00 86.54 ? 280 THR A CA  1 
ATOM   1856  C C   . THR A 1 282 ? 46.527  61.504  107.894 1.00 86.54 ? 280 THR A C   1 
ATOM   1857  O O   . THR A 1 282 ? 46.003  60.782  107.046 1.00 86.54 ? 280 THR A O   1 
ATOM   1858  C CB  . THR A 1 282 ? 45.803  61.623  110.250 1.00 51.12 ? 280 THR A CB  1 
ATOM   1859  O OG1 . THR A 1 282 ? 46.277  61.535  111.594 1.00 51.12 ? 280 THR A OG1 1 
ATOM   1860  C CG2 . THR A 1 282 ? 44.475  60.893  110.166 1.00 51.12 ? 280 THR A CG2 1 
ATOM   1861  N N   . LEU A 1 283 ? 46.861  62.769  107.660 1.00 92.42 ? 281 LEU A N   1 
ATOM   1862  C CA  . LEU A 1 283 ? 46.641  63.384  106.354 1.00 92.42 ? 281 LEU A CA  1 
ATOM   1863  C C   . LEU A 1 283 ? 47.210  62.471  105.260 1.00 92.42 ? 281 LEU A C   1 
ATOM   1864  O O   . LEU A 1 283 ? 46.489  62.043  104.349 1.00 92.42 ? 281 LEU A O   1 
ATOM   1865  C CB  . LEU A 1 283 ? 47.330  64.755  106.297 1.00 78.56 ? 281 LEU A CB  1 
ATOM   1866  C CG  . LEU A 1 283 ? 46.979  65.760  107.398 1.00 78.56 ? 281 LEU A CG  1 
ATOM   1867  C CD1 . LEU A 1 283 ? 47.764  67.044  107.172 1.00 78.56 ? 281 LEU A CD1 1 
ATOM   1868  C CD2 . LEU A 1 283 ? 45.479  66.021  107.413 1.00 78.56 ? 281 LEU A CD2 1 
ATOM   1869  N N   . ASN A 1 284 ? 48.506  62.177  105.376 1.00 92.42 ? 282 ASN A N   1 
ATOM   1870  C CA  . ASN A 1 284 ? 49.221  61.319  104.434 1.00 92.42 ? 282 ASN A CA  1 
ATOM   1871  C C   . ASN A 1 284 ? 48.575  59.937  104.274 1.00 92.42 ? 282 ASN A C   1 
ATOM   1872  O O   . ASN A 1 284 ? 48.207  59.542  103.166 1.00 92.42 ? 282 ASN A O   1 
ATOM   1873  C CB  . ASN A 1 284 ? 50.682  61.151  104.880 1.00 51.09 ? 282 ASN A CB  1 
ATOM   1874  C CG  . ASN A 1 284 ? 51.502  62.420  104.712 1.00 51.09 ? 282 ASN A CG  1 
ATOM   1875  O OD1 . ASN A 1 284 ? 50.962  63.483  104.396 1.00 51.09 ? 282 ASN A OD1 1 
ATOM   1876  N ND2 . ASN A 1 284 ? 52.817  62.314  104.930 1.00 51.09 ? 282 ASN A ND2 1 
ATOM   1877  N N   . LEU A 1 285 ? 48.440  59.196  105.371 1.00 56.82 ? 283 LEU A N   1 
ATOM   1878  C CA  . LEU A 1 285 ? 47.839  57.872  105.292 1.00 56.82 ? 283 LEU A CA  1 
ATOM   1879  C C   . LEU A 1 285 ? 46.450  57.924  104.704 1.00 56.82 ? 283 LEU A C   1 
ATOM   1880  O O   . LEU A 1 285 ? 45.912  56.899  104.308 1.00 56.82 ? 283 LEU A O   1 
ATOM   1881  C CB  . LEU A 1 285 ? 47.769  57.212  106.665 1.00 51.80 ? 283 LEU A CB  1 
ATOM   1882  C CG  . LEU A 1 285 ? 47.050  55.855  106.760 1.00 51.80 ? 283 LEU A CG  1 
ATOM   1883  C CD1 . LEU A 1 285 ? 47.546  54.874  105.699 1.00 51.80 ? 283 LEU A CD1 1 
ATOM   1884  C CD2 . LEU A 1 285 ? 47.284  55.288  108.154 1.00 51.80 ? 283 LEU A CD2 1 
ATOM   1885  N N   . ASN A 1 286 ? 45.849  59.107  104.655 1.00 68.02 ? 284 ASN A N   1 
ATOM   1886  C CA  . ASN A 1 286 ? 44.519  59.205  104.067 1.00 68.02 ? 284 ASN A CA  1 
ATOM   1887  C C   . ASN A 1 286 ? 44.696  59.294  102.556 1.00 68.02 ? 284 ASN A C   1 
ATOM   1888  O O   . ASN A 1 286 ? 44.110  58.508  101.803 1.00 68.02 ? 284 ASN A O   1 
ATOM   1889  C CB  . ASN A 1 286 ? 43.770  60.434  104.579 1.00 83.28 ? 284 ASN A CB  1 
ATOM   1890  C CG  . ASN A 1 286 ? 42.272  60.315  104.377 1.00 83.28 ? 284 ASN A CG  1 
ATOM   1891  O OD1 . ASN A 1 286 ? 41.647  59.369  104.858 1.00 83.28 ? 284 ASN A OD1 1 
ATOM   1892  N ND2 . ASN A 1 286 ? 41.689  61.269  103.662 1.00 83.28 ? 284 ASN A ND2 1 
ATOM   1893  N N   . ALA A 1 287 ? 45.519  60.247  102.122 1.00 66.32 ? 285 ALA A N   1 
ATOM   1894  C CA  . ALA A 1 287 ? 45.797  60.423  100.702 1.00 66.32 ? 285 ALA A CA  1 
ATOM   1895  C C   . ALA A 1 287 ? 46.284  59.098  100.113 1.00 66.32 ? 285 ALA A C   1 
ATOM   1896  O O   . ALA A 1 287 ? 45.880  58.727  99.017  1.00 66.32 ? 285 ALA A O   1 
ATOM   1897  C CB  . ALA A 1 287 ? 46.851  61.511  100.496 1.00 26.17 ? 285 ALA A CB  1 
ATOM   1898  N N   . ILE A 1 288 ? 47.148  58.390  100.842 1.00 88.86 ? 286 ILE A N   1 
ATOM   1899  C CA  . ILE A 1 288 ? 47.661  57.101  100.377 1.00 88.86 ? 286 ILE A CA  1 
ATOM   1900  C C   . ILE A 1 288 ? 46.517  56.163  100.045 1.00 88.86 ? 286 ILE A C   1 
ATOM   1901  O O   . ILE A 1 288 ? 46.576  55.428  99.059  1.00 88.86 ? 286 ILE A O   1 
ATOM   1902  C CB  . ILE A 1 288 ? 48.547  56.399  101.435 1.00 61.54 ? 286 ILE A CB  1 
ATOM   1903  C CG1 . ILE A 1 288 ? 49.931  57.037  101.451 1.00 61.54 ? 286 ILE A CG1 1 
ATOM   1904  C CG2 . ILE A 1 288 ? 48.649  54.888  101.139 1.00 61.54 ? 286 ILE A CG2 1 
ATOM   1905  C CD1 . ILE A 1 288 ? 50.876  56.376  102.429 1.00 61.54 ? 286 ILE A CD1 1 
ATOM   1906  N N   . ASN A 1 289 ? 45.478  56.182  100.875 1.00 88.07 ? 287 ASN A N   1 
ATOM   1907  C CA  . ASN A 1 289 ? 44.332  55.317  100.649 1.00 88.07 ? 287 ASN A CA  1 
ATOM   1908  C C   . ASN A 1 289 ? 43.365  55.971  99.680  1.00 88.07 ? 287 ASN A C   1 
ATOM   1909  O O   . ASN A 1 289 ? 42.224  55.543  99.531  1.00 88.07 ? 287 ASN A O   1 
ATOM   1910  C CB  . ASN A 1 289 ? 43.656  54.984  101.979 1.00 41.98 ? 287 ASN A CB  1 
ATOM   1911  C CG  . ASN A 1 289 ? 43.715  53.492  102.295 1.00 41.98 ? 287 ASN A CG  1 
ATOM   1912  O OD1 . ASN A 1 289 ? 43.742  53.076  103.461 1.00 41.98 ? 287 ASN A OD1 1 
ATOM   1913  N ND2 . ASN A 1 289 ? 43.729  52.675  101.245 1.00 41.98 ? 287 ASN A ND2 1 
ATOM   1914  N N   . LEU A 1 290 ? 43.855  57.009  99.012  1.00 73.68 ? 288 LEU A N   1 
ATOM   1915  C CA  . LEU A 1 290 ? 43.084  57.751  98.028  1.00 73.68 ? 288 LEU A CA  1 
ATOM   1916  C C   . LEU A 1 290 ? 43.827  57.838  96.696  1.00 73.68 ? 288 LEU A C   1 
ATOM   1917  O O   . LEU A 1 290 ? 43.205  57.941  95.637  1.00 73.68 ? 288 LEU A O   1 
ATOM   1918  C CB  . LEU A 1 290 ? 42.797  59.156  98.540  1.00 89.76 ? 288 LEU A CB  1 
ATOM   1919  C CG  . LEU A 1 290 ? 41.687  59.234  99.580  1.00 89.76 ? 288 LEU A CG  1 
ATOM   1920  C CD1 . LEU A 1 290 ? 41.655  60.629  100.178 1.00 89.76 ? 288 LEU A CD1 1 
ATOM   1921  C CD2 . LEU A 1 290 ? 40.358  58.885  98.927  1.00 89.76 ? 288 LEU A CD2 1 
ATOM   1922  N N   . CYS A 1 291 ? 45.154  57.798  96.745  1.00 75.29 ? 289 CYS A N   1 
ATOM   1923  C CA  . CYS A 1 291 ? 45.954  57.874  95.529  1.00 75.29 ? 289 CYS A CA  1 
ATOM   1924  C C   . CYS A 1 291 ? 45.327  56.997  94.443  1.00 75.29 ? 289 CYS A C   1 
ATOM   1925  O O   . CYS A 1 291 ? 45.060  55.814  94.657  1.00 75.29 ? 289 CYS A O   1 
ATOM   1926  C CB  . CYS A 1 291 ? 47.392  57.427  95.807  1.00 61.34 ? 289 CYS A CB  1 
ATOM   1927  S SG  . CYS A 1 291 ? 48.508  57.541  94.382  1.00 61.34 ? 289 CYS A SG  1 
ATOM   1928  N N   . PRO A 1 292 ? 45.078  57.577  93.263  1.00 42.83 ? 290 PRO A N   1 
ATOM   1929  C CA  . PRO A 1 292 ? 44.477  56.890  92.119  1.00 42.83 ? 290 PRO A CA  1 
ATOM   1930  C C   . PRO A 1 292 ? 45.357  55.849  91.450  1.00 42.83 ? 290 PRO A C   1 
ATOM   1931  O O   . PRO A 1 292 ? 45.749  56.022  90.304  1.00 42.83 ? 290 PRO A O   1 
ATOM   1932  C CB  . PRO A 1 292 ? 44.153  58.039  91.173  1.00 44.77 ? 290 PRO A CB  1 
ATOM   1933  C CG  . PRO A 1 292 ? 45.290  58.975  91.414  1.00 44.77 ? 290 PRO A CG  1 
ATOM   1934  C CD  . PRO A 1 292 ? 45.365  58.983  92.926  1.00 44.77 ? 290 PRO A CD  1 
ATOM   1935  N N   . LEU A 1 293 ? 45.666  54.767  92.149  1.00 45.17 ? 291 LEU A N   1 
ATOM   1936  C CA  . LEU A 1 293 ? 46.498  53.715  91.569  1.00 45.17 ? 291 LEU A CA  1 
ATOM   1937  C C   . LEU A 1 293 ? 46.121  52.355  92.154  1.00 45.17 ? 291 LEU A C   1 
ATOM   1938  O O   . LEU A 1 293 ? 45.425  52.266  93.172  1.00 45.17 ? 291 LEU A O   1 
ATOM   1939  C CB  . LEU A 1 293 ? 47.994  53.977  91.839  1.00 46.58 ? 291 LEU A CB  1 
ATOM   1940  C CG  . LEU A 1 293 ? 48.850  55.006  91.086  1.00 46.58 ? 291 LEU A CG  1 
ATOM   1941  C CD1 . LEU A 1 293 ? 48.498  56.431  91.473  1.00 46.58 ? 291 LEU A CD1 1 
ATOM   1942  C CD2 . LEU A 1 293 ? 50.295  54.751  91.433  1.00 46.58 ? 291 LEU A CD2 1 
ATOM   1943  N N   . PRO A 1 294 ? 46.569  51.274  91.506  1.00 60.62 ? 292 PRO A N   1 
ATOM   1944  C CA  . PRO A 1 294 ? 46.303  49.899  91.943  1.00 60.62 ? 292 PRO A CA  1 
ATOM   1945  C C   . PRO A 1 294 ? 46.786  49.761  93.382  1.00 60.62 ? 292 PRO A C   1 
ATOM   1946  O O   . PRO A 1 294 ? 47.895  50.197  93.700  1.00 60.62 ? 292 PRO A O   1 
ATOM   1947  C CB  . PRO A 1 294 ? 47.131  49.069  90.975  1.00 44.75 ? 292 PRO A CB  1 
ATOM   1948  C CG  . PRO A 1 294 ? 47.069  49.886  89.731  1.00 44.75 ? 292 PRO A CG  1 
ATOM   1949  C CD  . PRO A 1 294 ? 47.279  51.288  90.219  1.00 44.75 ? 292 PRO A CD  1 
ATOM   1950  N N   . LYS A 1 295 ? 45.982  49.143  94.244  1.00 16.16 ? 293 LYS A N   1 
ATOM   1951  C CA  . LYS A 1 295 ? 46.365  49.047  95.629  1.00 12.62 ? 293 LYS A CA  1 
ATOM   1952  C C   . LYS A 1 295 ? 45.964  47.776  96.351  1.00 13.79 ? 293 LYS A C   1 
ATOM   1953  O O   . LYS A 1 295 ? 45.642  47.805  97.537  1.00 18.24 ? 293 LYS A O   1 
ATOM   1954  C CB  . LYS A 1 295 ? 45.799  50.277  96.345  1.00 19.99 ? 293 LYS A CB  1 
ATOM   1955  C CG  . LYS A 1 295 ? 46.326  51.568  95.738  1.00 41.89 ? 293 LYS A CG  1 
ATOM   1956  C CD  . LYS A 1 295 ? 45.689  52.794  96.303  1.00 27.90 ? 293 LYS A CD  1 
ATOM   1957  C CE  . LYS A 1 295 ? 44.275  52.958  95.806  1.00 34.44 ? 293 LYS A CE  1 
ATOM   1958  N NZ  . LYS A 1 295 ? 43.629  54.116  96.497  1.00 47.95 ? 293 LYS A NZ  1 
ATOM   1959  N N   . PRO A 1 296 ? 46.043  46.630  95.680  1.00 16.04 ? 294 PRO A N   1 
ATOM   1960  C CA  . PRO A 1 296 ? 45.671  45.331  96.273  1.00 7.69  ? 294 PRO A CA  1 
ATOM   1961  C C   . PRO A 1 296 ? 46.002  44.979  97.758  1.00 18.83 ? 294 PRO A C   1 
ATOM   1962  O O   . PRO A 1 296 ? 45.694  43.871  98.219  1.00 18.18 ? 294 PRO A O   1 
ATOM   1963  C CB  . PRO A 1 296 ? 46.285  44.328  95.299  1.00 29.36 ? 294 PRO A CB  1 
ATOM   1964  C CG  . PRO A 1 296 ? 47.472  45.080  94.750  1.00 32.47 ? 294 PRO A CG  1 
ATOM   1965  C CD  . PRO A 1 296 ? 46.899  46.447  94.500  1.00 22.92 ? 294 PRO A CD  1 
ATOM   1966  N N   . TRP A 1 297 ? 46.624  45.870  98.521  1.00 33.98 ? 295 TRP A N   1 
ATOM   1967  C CA  . TRP A 1 297 ? 46.908  45.513  99.913  1.00 28.60 ? 295 TRP A CA  1 
ATOM   1968  C C   . TRP A 1 297 ? 46.315  46.530  100.888 1.00 35.62 ? 295 TRP A C   1 
ATOM   1969  O O   . TRP A 1 297 ? 46.181  47.716  100.566 1.00 38.07 ? 295 TRP A O   1 
ATOM   1970  C CB  . TRP A 1 297 ? 48.442  45.363  100.191 1.00 15.59 ? 295 TRP A CB  1 
ATOM   1971  C CG  . TRP A 1 297 ? 49.330  45.641  99.034  1.00 28.66 ? 295 TRP A CG  1 
ATOM   1972  C CD1 . TRP A 1 297 ? 49.898  44.724  98.202  1.00 28.44 ? 295 TRP A CD1 1 
ATOM   1973  C CD2 . TRP A 1 297 ? 49.566  46.920  98.450  1.00 26.90 ? 295 TRP A CD2 1 
ATOM   1974  N NE1 . TRP A 1 297 ? 50.453  45.353  97.118  1.00 19.43 ? 295 TRP A NE1 1 
ATOM   1975  C CE2 . TRP A 1 297 ? 50.259  46.706  97.244  1.00 31.09 ? 295 TRP A CE2 1 
ATOM   1976  C CE3 . TRP A 1 297 ? 49.243  48.229  98.823  1.00 29.87 ? 295 TRP A CE3 1 
ATOM   1977  C CZ2 . TRP A 1 297 ? 50.632  47.764  96.395  1.00 17.71 ? 295 TRP A CZ2 1 
ATOM   1978  C CZ3 . TRP A 1 297 ? 49.614  49.279  97.981  1.00 27.72 ? 295 TRP A CZ3 1 
ATOM   1979  C CH2 . TRP A 1 297 ? 50.297  49.038  96.783  1.00 22.82 ? 295 TRP A CH2 1 
ATOM   1980  N N   . LYS A 1 298 ? 45.960  46.050  102.078 1.00 37.03 ? 296 LYS A N   1 
ATOM   1981  C CA  . LYS A 1 298 ? 45.409  46.911  103.097 1.00 38.50 ? 296 LYS A CA  1 
ATOM   1982  C C   . LYS A 1 298 ? 46.445  47.981  103.340 1.00 36.66 ? 296 LYS A C   1 
ATOM   1983  O O   . LYS A 1 298 ? 47.592  47.660  103.632 1.00 38.70 ? 296 LYS A O   1 
ATOM   1984  C CB  . LYS A 1 298 ? 45.172  46.115  104.376 1.00 47.27 ? 296 LYS A CB  1 
ATOM   1985  C CG  . LYS A 1 298 ? 43.932  45.239  104.329 1.00 40.39 ? 296 LYS A CG  1 
ATOM   1986  C CD  . LYS A 1 298 ? 42.642  46.082  104.382 1.00 51.82 ? 296 LYS A CD  1 
ATOM   1987  C CE  . LYS A 1 298 ? 41.378  45.203  104.351 1.00 56.82 ? 296 LYS A CE  1 
ATOM   1988  N NZ  . LYS A 1 298 ? 40.079  45.951  104.462 1.00 69.20 ? 296 LYS A NZ  1 
ATOM   1989  N N   . LEU A 1 299 ? 46.066  49.247  103.195 1.00 29.21 ? 297 LEU A N   1 
ATOM   1990  C CA  . LEU A 1 299 ? 47.013  50.329  103.433 1.00 19.47 ? 297 LEU A CA  1 
ATOM   1991  C C   . LEU A 1 299 ? 46.838  50.906  104.829 1.00 35.43 ? 297 LEU A C   1 
ATOM   1992  O O   . LEU A 1 299 ? 46.430  52.058  105.004 1.00 39.89 ? 297 LEU A O   1 
ATOM   1993  C CB  . LEU A 1 299 ? 46.853  51.410  102.376 1.00 45.34 ? 297 LEU A CB  1 
ATOM   1994  C CG  . LEU A 1 299 ? 47.386  50.893  101.042 1.00 58.05 ? 297 LEU A CG  1 
ATOM   1995  C CD1 . LEU A 1 299 ? 47.156  51.913  99.951  1.00 47.37 ? 297 LEU A CD1 1 
ATOM   1996  C CD2 . LEU A 1 299 ? 48.854  50.604  101.177 1.00 46.02 ? 297 LEU A CD2 1 
ATOM   1997  N N   . SER A 1 300 ? 47.191  50.084  105.815 1.00 37.38 ? 298 SER A N   1 
ATOM   1998  C CA  . SER A 1 300 ? 47.068  50.406  107.231 1.00 33.41 ? 298 SER A CA  1 
ATOM   1999  C C   . SER A 1 300 ? 48.184  51.283  107.822 1.00 45.82 ? 298 SER A C   1 
ATOM   2000  O O   . SER A 1 300 ? 48.902  51.988  107.103 1.00 46.22 ? 298 SER A O   1 
ATOM   2001  C CB  . SER A 1 300 ? 46.973  49.091  108.015 1.00 47.39 ? 298 SER A CB  1 
ATOM   2002  O OG  . SER A 1 300 ? 46.455  49.287  109.317 1.00 49.29 ? 298 SER A OG  1 
ATOM   2003  N N   . PHE A 1 301 ? 48.297  51.236  109.150 1.00 92.42 ? 299 PHE A N   1 
ATOM   2004  C CA  . PHE A 1 301 ? 49.299  51.996  109.906 1.00 92.42 ? 299 PHE A CA  1 
ATOM   2005  C C   . PHE A 1 301 ? 49.868  51.166  111.056 1.00 92.42 ? 299 PHE A C   1 
ATOM   2006  O O   . PHE A 1 301 ? 49.248  50.212  111.527 1.00 92.42 ? 299 PHE A O   1 
ATOM   2007  C CB  . PHE A 1 301 ? 48.695  53.285  110.508 1.00 77.11 ? 299 PHE A CB  1 
ATOM   2008  C CG  . PHE A 1 301 ? 47.605  53.033  111.534 1.00 82.01 ? 299 PHE A CG  1 
ATOM   2009  C CD1 . PHE A 1 301 ? 46.262  53.000  111.155 1.00 76.97 ? 299 PHE A CD1 1 
ATOM   2010  C CD2 . PHE A 1 301 ? 47.924  52.786  112.868 1.00 71.99 ? 299 PHE A CD2 1 
ATOM   2011  C CE1 . PHE A 1 301 ? 45.261  52.725  112.079 1.00 78.67 ? 299 PHE A CE1 1 
ATOM   2012  C CE2 . PHE A 1 301 ? 46.926  52.509  113.794 1.00 79.46 ? 299 PHE A CE2 1 
ATOM   2013  C CZ  . PHE A 1 301 ? 45.593  52.479  113.395 1.00 76.30 ? 299 PHE A CZ  1 
ATOM   2014  N N   . SER A 1 302 ? 51.057  51.546  111.499 1.00 90.24 ? 300 SER A N   1 
ATOM   2015  C CA  . SER A 1 302 ? 51.721  50.901  112.622 1.00 90.24 ? 300 SER A CA  1 
ATOM   2016  C C   . SER A 1 302 ? 52.425  52.085  113.273 1.00 90.24 ? 300 SER A C   1 
ATOM   2017  O O   . SER A 1 302 ? 53.653  52.231  113.204 1.00 90.24 ? 300 SER A O   1 
ATOM   2018  C CB  . SER A 1 302 ? 52.728  49.848  112.145 1.00 66.96 ? 300 SER A CB  1 
ATOM   2019  O OG  . SER A 1 302 ? 53.135  48.999  113.211 1.00 68.02 ? 300 SER A OG  1 
ATOM   2020  N N   . TYR A 1 303 ? 51.603  52.943  113.876 1.00 92.42 ? 301 TYR A N   1 
ATOM   2021  C CA  . TYR A 1 303 ? 52.053  54.165  114.536 1.00 92.42 ? 301 TYR A CA  1 
ATOM   2022  C C   . TYR A 1 303 ? 52.322  54.024  116.026 1.00 92.42 ? 301 TYR A C   1 
ATOM   2023  O O   . TYR A 1 303 ? 51.815  53.112  116.695 1.00 92.42 ? 301 TYR A O   1 
ATOM   2024  C CB  . TYR A 1 303 ? 51.012  55.264  114.359 1.00 76.79 ? 301 TYR A CB  1 
ATOM   2025  C CG  . TYR A 1 303 ? 50.761  55.703  112.936 1.00 82.89 ? 301 TYR A CG  1 
ATOM   2026  C CD1 . TYR A 1 303 ? 49.795  56.669  112.661 1.00 83.43 ? 301 TYR A CD1 1 
ATOM   2027  C CD2 . TYR A 1 303 ? 51.494  55.187  111.873 1.00 80.45 ? 301 TYR A CD2 1 
ATOM   2028  C CE1 . TYR A 1 303 ? 49.565  57.114  111.375 1.00 79.38 ? 301 TYR A CE1 1 
ATOM   2029  C CE2 . TYR A 1 303 ? 51.268  55.630  110.578 1.00 78.55 ? 301 TYR A CE2 1 
ATOM   2030  C CZ  . TYR A 1 303 ? 50.300  56.595  110.343 1.00 77.98 ? 301 TYR A CZ  1 
ATOM   2031  O OH  . TYR A 1 303 ? 50.062  57.053  109.078 1.00 79.30 ? 301 TYR A OH  1 
ATOM   2032  N N   . GLY A 1 304 ? 53.110  54.964  116.539 1.00 75.92 ? 302 GLY A N   1 
ATOM   2033  C CA  . GLY A 1 304 ? 53.447  54.970  117.945 1.00 72.51 ? 302 GLY A CA  1 
ATOM   2034  C C   . GLY A 1 304 ? 53.462  56.392  118.446 1.00 79.69 ? 302 GLY A C   1 
ATOM   2035  O O   . GLY A 1 304 ? 52.837  56.712  119.452 1.00 79.69 ? 302 GLY A O   1 
ATOM   2036  N N   . ARG A 1 305 ? 54.169  57.256  117.729 1.00 78.84 ? 303 ARG A N   1 
ATOM   2037  C CA  . ARG A 1 305 ? 54.262  58.651  118.125 1.00 82.55 ? 303 ARG A CA  1 
ATOM   2038  C C   . ARG A 1 305 ? 52.978  59.387  117.751 1.00 82.55 ? 303 ARG A C   1 
ATOM   2039  O O   . ARG A 1 305 ? 52.596  60.358  118.406 1.00 82.55 ? 303 ARG A O   1 
ATOM   2040  C CB  . ARG A 1 305 ? 55.475  59.331  117.460 1.00 73.61 ? 303 ARG A CB  1 
ATOM   2041  C CG  . ARG A 1 305 ? 56.550  58.386  116.877 1.00 84.59 ? 303 ARG A CG  1 
ATOM   2042  C CD  . ARG A 1 305 ? 57.084  57.377  117.887 1.00 84.59 ? 303 ARG A CD  1 
ATOM   2043  N NE  . ARG A 1 305 ? 57.865  56.309  117.261 1.00 84.59 ? 303 ARG A NE  1 
ATOM   2044  C CZ  . ARG A 1 305 ? 57.507  55.650  116.159 1.00 84.59 ? 303 ARG A CZ  1 
ATOM   2045  N NH1 . ARG A 1 305 ? 56.378  55.944  115.529 1.00 84.59 ? 303 ARG A NH1 1 
ATOM   2046  N NH2 . ARG A 1 305 ? 58.266  54.665  115.701 1.00 84.59 ? 303 ARG A NH2 1 
ATOM   2047  N N   . ALA A 1 306 ? 52.304  58.913  116.708 1.00 92.42 ? 304 ALA A N   1 
ATOM   2048  C CA  . ALA A 1 306 ? 51.062  59.544  116.264 1.00 92.42 ? 304 ALA A CA  1 
ATOM   2049  C C   . ALA A 1 306 ? 49.835  58.951  116.961 1.00 92.42 ? 304 ALA A C   1 
ATOM   2050  O O   . ALA A 1 306 ? 48.701  59.392  116.741 1.00 92.42 ? 304 ALA A O   1 
ATOM   2051  C CB  . ALA A 1 306 ? 50.919  59.419  114.742 1.00 60.23 ? 304 ALA A CB  1 
ATOM   2052  N N   . LEU A 1 307 ? 50.067  57.948  117.799 1.00 87.58 ? 305 LEU A N   1 
ATOM   2053  C CA  . LEU A 1 307 ? 48.980  57.311  118.523 1.00 87.58 ? 305 LEU A CA  1 
ATOM   2054  C C   . LEU A 1 307 ? 49.108  57.564  120.023 1.00 87.58 ? 305 LEU A C   1 
ATOM   2055  O O   . LEU A 1 307 ? 48.138  57.422  120.772 1.00 87.58 ? 305 LEU A O   1 
ATOM   2056  C CB  . LEU A 1 307 ? 48.979  55.802  118.256 1.00 59.64 ? 305 LEU A CB  1 
ATOM   2057  C CG  . LEU A 1 307 ? 48.513  55.302  116.889 1.00 71.81 ? 305 LEU A CG  1 
ATOM   2058  C CD1 . LEU A 1 307 ? 48.835  53.824  116.762 1.00 67.58 ? 305 LEU A CD1 1 
ATOM   2059  C CD2 . LEU A 1 307 ? 47.016  55.547  116.727 1.00 59.87 ? 305 LEU A CD2 1 
ATOM   2060  N N   . GLN A 1 308 ? 50.303  57.948  120.462 1.00 89.03 ? 306 GLN A N   1 
ATOM   2061  C CA  . GLN A 1 308 ? 50.531  58.191  121.880 1.00 89.03 ? 306 GLN A CA  1 
ATOM   2062  C C   . GLN A 1 308 ? 50.698  59.661  122.241 1.00 89.03 ? 306 GLN A C   1 
ATOM   2063  O O   . GLN A 1 308 ? 50.059  60.139  123.172 1.00 89.03 ? 306 GLN A O   1 
ATOM   2064  C CB  . GLN A 1 308 ? 51.751  57.392  122.352 1.00 68.93 ? 306 GLN A CB  1 
ATOM   2065  C CG  . GLN A 1 308 ? 51.578  55.889  122.206 1.00 68.93 ? 306 GLN A CG  1 
ATOM   2066  C CD  . GLN A 1 308 ? 52.824  55.115  122.568 1.00 68.93 ? 306 GLN A CD  1 
ATOM   2067  O OE1 . GLN A 1 308 ? 53.880  55.700  122.820 1.00 68.93 ? 306 GLN A OE1 1 
ATOM   2068  N NE2 . GLN A 1 308 ? 52.713  53.786  122.588 1.00 68.93 ? 306 GLN A NE2 1 
ATOM   2069  N N   . ALA A 1 309 ? 51.547  60.370  121.501 1.00 92.42 ? 307 ALA A N   1 
ATOM   2070  C CA  . ALA A 1 309 ? 51.812  61.788  121.760 1.00 92.42 ? 307 ALA A CA  1 
ATOM   2071  C C   . ALA A 1 309 ? 50.753  62.490  122.616 1.00 92.42 ? 307 ALA A C   1 
ATOM   2072  O O   . ALA A 1 309 ? 50.989  62.786  123.790 1.00 92.42 ? 307 ALA A O   1 
ATOM   2073  C CB  . ALA A 1 309 ? 51.987  62.531  120.440 1.00 92.42 ? 307 ALA A CB  1 
ATOM   2074  N N   . SER A 1 310 ? 49.590  62.755  122.029 1.00 78.60 ? 308 SER A N   1 
ATOM   2075  C CA  . SER A 1 310 ? 48.516  63.432  122.751 1.00 78.60 ? 308 SER A CA  1 
ATOM   2076  C C   . SER A 1 310 ? 48.132  62.697  124.044 1.00 78.60 ? 308 SER A C   1 
ATOM   2077  O O   . SER A 1 310 ? 48.068  63.308  125.119 1.00 78.60 ? 308 SER A O   1 
ATOM   2078  C CB  . SER A 1 310 ? 47.294  63.582  121.839 1.00 92.42 ? 308 SER A CB  1 
ATOM   2079  O OG  . SER A 1 310 ? 46.909  62.329  121.297 1.00 92.42 ? 308 SER A OG  1 
ATOM   2080  N N   . ALA A 1 311 ? 47.874  61.391  123.938 1.00 92.42 ? 309 ALA A N   1 
ATOM   2081  C CA  . ALA A 1 311 ? 47.508  60.563  125.096 1.00 92.42 ? 309 ALA A CA  1 
ATOM   2082  C C   . ALA A 1 311 ? 48.658  60.501  126.109 1.00 92.42 ? 309 ALA A C   1 
ATOM   2083  O O   . ALA A 1 311 ? 48.462  60.128  127.270 1.00 92.42 ? 309 ALA A O   1 
ATOM   2084  C CB  . ALA A 1 311 ? 47.140  59.156  124.636 1.00 81.20 ? 309 ALA A CB  1 
ATOM   2085  N N   . LEU A 1 312 ? 49.850  60.876  125.649 1.00 92.42 ? 310 LEU A N   1 
ATOM   2086  C CA  . LEU A 1 312 ? 51.052  60.892  126.470 1.00 92.42 ? 310 LEU A CA  1 
ATOM   2087  C C   . LEU A 1 312 ? 51.099  62.158  127.326 1.00 92.42 ? 310 LEU A C   1 
ATOM   2088  O O   . LEU A 1 312 ? 51.555  62.125  128.469 1.00 92.42 ? 310 LEU A O   1 
ATOM   2089  C CB  . LEU A 1 312 ? 52.292  60.827  125.579 1.00 86.47 ? 310 LEU A CB  1 
ATOM   2090  C CG  . LEU A 1 312 ? 53.620  60.616  126.299 1.00 86.47 ? 310 LEU A CG  1 
ATOM   2091  C CD1 . LEU A 1 312 ? 53.600  59.266  127.016 1.00 86.47 ? 310 LEU A CD1 1 
ATOM   2092  C CD2 . LEU A 1 312 ? 54.759  60.678  125.294 1.00 86.47 ? 310 LEU A CD2 1 
ATOM   2093  N N   . ALA A 1 313 ? 50.638  63.277  126.773 1.00 86.70 ? 311 ALA A N   1 
ATOM   2094  C CA  . ALA A 1 313 ? 50.624  64.527  127.529 1.00 86.70 ? 311 ALA A CA  1 
ATOM   2095  C C   . ALA A 1 313 ? 49.489  64.468  128.554 1.00 86.70 ? 311 ALA A C   1 
ATOM   2096  O O   . ALA A 1 313 ? 49.659  64.843  129.717 1.00 86.70 ? 311 ALA A O   1 
ATOM   2097  C CB  . ALA A 1 313 ? 50.425  65.719  126.585 1.00 92.42 ? 311 ALA A CB  1 
ATOM   2098  N N   . ALA A 1 314 ? 48.340  63.972  128.108 1.00 84.00 ? 312 ALA A N   1 
ATOM   2099  C CA  . ALA A 1 314 ? 47.151  63.849  128.947 1.00 84.00 ? 312 ALA A CA  1 
ATOM   2100  C C   . ALA A 1 314 ? 47.363  63.000  130.205 1.00 84.00 ? 312 ALA A C   1 
ATOM   2101  O O   . ALA A 1 314 ? 46.406  62.627  130.887 1.00 84.00 ? 312 ALA A O   1 
ATOM   2102  C CB  . ALA A 1 314 ? 46.016  63.273  128.120 1.00 83.23 ? 312 ALA A CB  1 
ATOM   2103  N N   . TRP A 1 315 ? 48.621  62.713  130.516 1.00 92.42 ? 313 TRP A N   1 
ATOM   2104  C CA  . TRP A 1 315 ? 48.966  61.896  131.673 1.00 92.42 ? 313 TRP A CA  1 
ATOM   2105  C C   . TRP A 1 315 ? 49.957  62.654  132.542 1.00 92.42 ? 313 TRP A C   1 
ATOM   2106  O O   . TRP A 1 315 ? 49.616  63.106  133.633 1.00 92.42 ? 313 TRP A O   1 
ATOM   2107  C CB  . TRP A 1 315 ? 49.587  60.586  131.187 1.00 87.78 ? 313 TRP A CB  1 
ATOM   2108  C CG  . TRP A 1 315 ? 49.938  59.585  132.240 1.00 87.78 ? 313 TRP A CG  1 
ATOM   2109  C CD1 . TRP A 1 315 ? 49.073  58.878  133.024 1.00 87.78 ? 313 TRP A CD1 1 
ATOM   2110  C CD2 . TRP A 1 315 ? 51.251  59.097  132.546 1.00 87.78 ? 313 TRP A CD2 1 
ATOM   2111  N NE1 . TRP A 1 315 ? 49.765  57.968  133.794 1.00 87.78 ? 313 TRP A NE1 1 
ATOM   2112  C CE2 . TRP A 1 315 ? 51.103  58.082  133.521 1.00 87.78 ? 313 TRP A CE2 1 
ATOM   2113  C CE3 . TRP A 1 315 ? 52.538  59.416  132.089 1.00 87.78 ? 313 TRP A CE3 1 
ATOM   2114  C CZ2 . TRP A 1 315 ? 52.197  57.380  134.047 1.00 87.78 ? 313 TRP A CZ2 1 
ATOM   2115  C CZ3 . TRP A 1 315 ? 53.626  58.718  132.611 1.00 87.78 ? 313 TRP A CZ3 1 
ATOM   2116  C CH2 . TRP A 1 315 ? 53.446  57.711  133.581 1.00 87.78 ? 313 TRP A CH2 1 
ATOM   2117  N N   . GLY A 1 316 ? 51.184  62.790  132.043 1.00 92.42 ? 314 GLY A N   1 
ATOM   2118  C CA  . GLY A 1 316 ? 52.229  63.491  132.771 1.00 92.42 ? 314 GLY A CA  1 
ATOM   2119  C C   . GLY A 1 316 ? 52.475  62.962  134.174 1.00 92.42 ? 314 GLY A C   1 
ATOM   2120  O O   . GLY A 1 316 ? 52.672  63.749  135.104 1.00 92.42 ? 314 GLY A O   1 
ATOM   2121  N N   . GLY A 1 317 ? 52.471  61.635  134.330 1.00 92.42 ? 315 GLY A N   1 
ATOM   2122  C CA  . GLY A 1 317 ? 52.691  61.021  135.635 1.00 92.42 ? 315 GLY A CA  1 
ATOM   2123  C C   . GLY A 1 317 ? 51.390  60.800  136.393 1.00 92.42 ? 315 GLY A C   1 
ATOM   2124  O O   . GLY A 1 317 ? 51.132  59.709  136.921 1.00 92.42 ? 315 GLY A O   1 
ATOM   2125  N N   . LYS A 1 318 ? 50.574  61.855  136.443 1.00 92.42 ? 316 LYS A N   1 
ATOM   2126  C CA  . LYS A 1 318 ? 49.271  61.841  137.107 1.00 92.42 ? 316 LYS A CA  1 
ATOM   2127  C C   . LYS A 1 318 ? 48.455  60.677  136.545 1.00 92.42 ? 316 LYS A C   1 
ATOM   2128  O O   . LYS A 1 318 ? 48.128  60.663  135.361 1.00 92.42 ? 316 LYS A O   1 
ATOM   2129  C CB  . LYS A 1 318 ? 48.540  63.164  136.840 1.00 63.69 ? 316 LYS A CB  1 
ATOM   2130  C CG  . LYS A 1 318 ? 49.379  64.418  137.095 1.00 72.01 ? 316 LYS A CG  1 
ATOM   2131  C CD  . LYS A 1 318 ? 48.586  65.685  136.795 1.00 72.01 ? 316 LYS A CD  1 
ATOM   2132  C CE  . LYS A 1 318 ? 49.389  66.936  137.099 1.00 72.01 ? 316 LYS A CE  1 
ATOM   2133  N NZ  . LYS A 1 318 ? 50.653  66.972  136.317 1.00 72.01 ? 316 LYS A NZ  1 
ATOM   2134  N N   . ALA A 1 319 ? 48.124  59.708  137.390 1.00 73.88 ? 317 ALA A N   1 
ATOM   2135  C CA  . ALA A 1 319 ? 47.373  58.547  136.939 1.00 73.88 ? 317 ALA A CA  1 
ATOM   2136  C C   . ALA A 1 319 ? 45.873  58.577  137.287 1.00 73.88 ? 317 ALA A C   1 
ATOM   2137  O O   . ALA A 1 319 ? 45.264  57.536  137.567 1.00 73.88 ? 317 ALA A O   1 
ATOM   2138  C CB  . ALA A 1 319 ? 48.028  57.288  137.493 1.00 55.98 ? 317 ALA A CB  1 
ATOM   2139  N N   . ALA A 1 320 ? 45.276  59.765  137.252 1.00 92.42 ? 318 ALA A N   1 
ATOM   2140  C CA  . ALA A 1 320 ? 43.854  59.908  137.562 1.00 92.42 ? 318 ALA A CA  1 
ATOM   2141  C C   . ALA A 1 320 ? 43.110  60.484  136.374 1.00 92.42 ? 318 ALA A C   1 
ATOM   2142  O O   . ALA A 1 320 ? 41.884  60.390  136.287 1.00 92.42 ? 318 ALA A O   1 
ATOM   2143  C CB  . ALA A 1 320 ? 43.669  60.817  138.764 1.00 68.78 ? 318 ALA A CB  1 
ATOM   2144  N N   . ASN A 1 321 ? 43.870  61.075  135.461 1.00 92.42 ? 319 ASN A N   1 
ATOM   2145  C CA  . ASN A 1 321 ? 43.320  61.706  134.265 1.00 92.42 ? 319 ASN A CA  1 
ATOM   2146  C C   . ASN A 1 321 ? 43.223  60.725  133.090 1.00 92.42 ? 319 ASN A C   1 
ATOM   2147  O O   . ASN A 1 321 ? 43.342  61.117  131.926 1.00 92.42 ? 319 ASN A O   1 
ATOM   2148  C CB  . ASN A 1 321 ? 44.198  62.910  133.912 1.00 90.38 ? 319 ASN A CB  1 
ATOM   2149  C CG  . ASN A 1 321 ? 45.131  63.299  135.061 1.00 90.38 ? 319 ASN A CG  1 
ATOM   2150  O OD1 . ASN A 1 321 ? 44.712  63.384  136.220 1.00 90.38 ? 319 ASN A OD1 1 
ATOM   2151  N ND2 . ASN A 1 321 ? 46.401  63.530  134.741 1.00 90.38 ? 319 ASN A ND2 1 
ATOM   2152  N N   . LYS A 1 322 ? 42.997  59.452  133.421 1.00 92.42 ? 320 LYS A N   1 
ATOM   2153  C CA  . LYS A 1 322 ? 42.869  58.375  132.438 1.00 92.42 ? 320 LYS A CA  1 
ATOM   2154  C C   . LYS A 1 322 ? 41.931  58.802  131.321 1.00 92.42 ? 320 LYS A C   1 
ATOM   2155  O O   . LYS A 1 322 ? 42.014  58.316  130.190 1.00 92.42 ? 320 LYS A O   1 
ATOM   2156  C CB  . LYS A 1 322 ? 42.324  57.119  133.115 1.00 82.94 ? 320 LYS A CB  1 
ATOM   2157  C CG  . LYS A 1 322 ? 43.128  56.721  134.312 1.00 82.94 ? 320 LYS A CG  1 
ATOM   2158  C CD  . LYS A 1 322 ? 42.398  55.708  135.149 1.00 82.94 ? 320 LYS A CD  1 
ATOM   2159  C CE  . LYS A 1 322 ? 43.109  55.524  136.492 1.00 82.94 ? 320 LYS A CE  1 
ATOM   2160  N NZ  . LYS A 1 322 ? 42.387  54.587  137.413 1.00 82.94 ? 320 LYS A NZ  1 
ATOM   2161  N N   . GLU A 1 323 ? 41.024  59.710  131.648 1.00 92.42 ? 321 GLU A N   1 
ATOM   2162  C CA  . GLU A 1 323 ? 40.101  60.199  130.648 1.00 92.42 ? 321 GLU A CA  1 
ATOM   2163  C C   . GLU A 1 323 ? 40.887  60.923  129.566 1.00 92.42 ? 321 GLU A C   1 
ATOM   2164  O O   . GLU A 1 323 ? 40.895  60.496  128.411 1.00 92.42 ? 321 GLU A O   1 
ATOM   2165  C CB  . GLU A 1 323 ? 39.086  61.140  131.280 1.00 92.42 ? 321 GLU A CB  1 
ATOM   2166  C CG  . GLU A 1 323 ? 38.061  60.424  132.116 1.00 92.42 ? 321 GLU A CG  1 
ATOM   2167  C CD  . GLU A 1 323 ? 36.700  61.062  131.982 1.00 92.42 ? 321 GLU A CD  1 
ATOM   2168  O OE1 . GLU A 1 323 ? 36.274  61.288  130.824 1.00 92.42 ? 321 GLU A OE1 1 
ATOM   2169  O OE2 . GLU A 1 323 ? 36.061  61.333  133.025 1.00 92.42 ? 321 GLU A OE2 1 
ATOM   2170  N N   . ALA A 1 324 ? 41.556  62.008  129.950 1.00 92.42 ? 322 ALA A N   1 
ATOM   2171  C CA  . ALA A 1 324 ? 42.355  62.791  129.015 1.00 92.42 ? 322 ALA A CA  1 
ATOM   2172  C C   . ALA A 1 324 ? 43.289  61.874  128.218 1.00 92.42 ? 322 ALA A C   1 
ATOM   2173  O O   . ALA A 1 324 ? 43.431  62.028  127.001 1.00 92.42 ? 322 ALA A O   1 
ATOM   2174  C CB  . ALA A 1 324 ? 43.161  63.841  129.777 1.00 81.94 ? 322 ALA A CB  1 
ATOM   2175  N N   . THR A 1 325 ? 43.916  60.923  128.917 1.00 92.42 ? 323 THR A N   1 
ATOM   2176  C CA  . THR A 1 325 ? 44.841  59.956  128.312 1.00 92.42 ? 323 THR A CA  1 
ATOM   2177  C C   . THR A 1 325 ? 44.116  59.072  127.301 1.00 92.42 ? 323 THR A C   1 
ATOM   2178  O O   . THR A 1 325 ? 44.404  59.109  126.099 1.00 92.42 ? 323 THR A O   1 
ATOM   2179  C CB  . THR A 1 325 ? 45.467  59.019  129.382 1.00 92.42 ? 323 THR A CB  1 
ATOM   2180  O OG1 . THR A 1 325 ? 46.199  59.794  130.340 1.00 92.42 ? 323 THR A OG1 1 
ATOM   2181  C CG2 . THR A 1 325 ? 46.402  58.009  128.732 1.00 92.42 ? 323 THR A CG2 1 
ATOM   2182  N N   . GLN A 1 326 ? 43.174  58.283  127.814 1.00 83.65 ? 324 GLN A N   1 
ATOM   2183  C CA  . GLN A 1 326 ? 42.386  57.355  127.012 1.00 83.65 ? 324 GLN A CA  1 
ATOM   2184  C C   . GLN A 1 326 ? 41.530  58.086  125.999 1.00 83.65 ? 324 GLN A C   1 
ATOM   2185  O O   . GLN A 1 326 ? 40.941  57.482  125.107 1.00 83.65 ? 324 GLN A O   1 
ATOM   2186  C CB  . GLN A 1 326 ? 41.528  56.498  127.936 1.00 78.25 ? 324 GLN A CB  1 
ATOM   2187  C CG  . GLN A 1 326 ? 42.358  55.905  129.059 1.00 78.25 ? 324 GLN A CG  1 
ATOM   2188  C CD  . GLN A 1 326 ? 41.747  54.675  129.659 1.00 78.25 ? 324 GLN A CD  1 
ATOM   2189  O OE1 . GLN A 1 326 ? 42.309  54.081  130.577 1.00 78.25 ? 324 GLN A OE1 1 
ATOM   2190  N NE2 . GLN A 1 326 ? 40.595  54.273  129.144 1.00 78.25 ? 324 GLN A NE2 1 
ATOM   2191  N N   . GLU A 1 327 ? 41.487  59.402  126.150 1.00 52.60 ? 325 GLU A N   1 
ATOM   2192  C CA  . GLU A 1 327 ? 40.743  60.278  125.267 1.00 52.60 ? 325 GLU A CA  1 
ATOM   2193  C C   . GLU A 1 327 ? 41.616  60.578  124.057 1.00 52.60 ? 325 GLU A C   1 
ATOM   2194  O O   . GLU A 1 327 ? 41.199  60.396  122.912 1.00 52.60 ? 325 GLU A O   1 
ATOM   2195  C CB  . GLU A 1 327 ? 40.413  61.587  125.994 1.00 92.42 ? 325 GLU A CB  1 
ATOM   2196  C CG  . GLU A 1 327 ? 39.684  62.600  125.148 1.00 92.42 ? 325 GLU A CG  1 
ATOM   2197  C CD  . GLU A 1 327 ? 38.401  62.035  124.573 1.00 92.42 ? 325 GLU A CD  1 
ATOM   2198  O OE1 . GLU A 1 327 ? 37.743  62.731  123.764 1.00 92.42 ? 325 GLU A OE1 1 
ATOM   2199  O OE2 . GLU A 1 327 ? 38.052  60.887  124.935 1.00 92.42 ? 325 GLU A OE2 1 
ATOM   2200  N N   . ALA A 1 328 ? 42.837  61.031  124.341 1.00 92.42 ? 326 ALA A N   1 
ATOM   2201  C CA  . ALA A 1 328 ? 43.826  61.397  123.325 1.00 92.42 ? 326 ALA A CA  1 
ATOM   2202  C C   . ALA A 1 328 ? 44.373  60.203  122.572 1.00 92.42 ? 326 ALA A C   1 
ATOM   2203  O O   . ALA A 1 328 ? 44.948  60.346  121.497 1.00 92.42 ? 326 ALA A O   1 
ATOM   2204  C CB  . ALA A 1 328 ? 44.966  62.161  123.968 1.00 92.42 ? 326 ALA A CB  1 
ATOM   2205  N N   . PHE A 1 329 ? 44.218  59.025  123.152 1.00 79.23 ? 327 PHE A N   1 
ATOM   2206  C CA  . PHE A 1 329 ? 44.672  57.818  122.494 1.00 79.23 ? 327 PHE A CA  1 
ATOM   2207  C C   . PHE A 1 329 ? 43.513  57.316  121.655 1.00 79.23 ? 327 PHE A C   1 
ATOM   2208  O O   . PHE A 1 329 ? 43.641  57.109  120.448 1.00 79.23 ? 327 PHE A O   1 
ATOM   2209  C CB  . PHE A 1 329 ? 45.061  56.761  123.522 1.00 67.23 ? 327 PHE A CB  1 
ATOM   2210  C CG  . PHE A 1 329 ? 45.170  55.373  122.956 1.00 67.23 ? 327 PHE A CG  1 
ATOM   2211  C CD1 . PHE A 1 329 ? 45.881  55.137  121.782 1.00 67.23 ? 327 PHE A CD1 1 
ATOM   2212  C CD2 . PHE A 1 329 ? 44.581  54.298  123.613 1.00 67.23 ? 327 PHE A CD2 1 
ATOM   2213  C CE1 . PHE A 1 329 ? 46.005  53.853  121.273 1.00 67.23 ? 327 PHE A CE1 1 
ATOM   2214  C CE2 . PHE A 1 329 ? 44.698  53.013  123.116 1.00 67.23 ? 327 PHE A CE2 1 
ATOM   2215  C CZ  . PHE A 1 329 ? 45.413  52.789  121.941 1.00 67.23 ? 327 PHE A CZ  1 
ATOM   2216  N N   . MET A 1 330 ? 42.368  57.144  122.299 1.00 70.09 ? 328 MET A N   1 
ATOM   2217  C CA  . MET A 1 330 ? 41.202  56.655  121.595 1.00 70.09 ? 328 MET A CA  1 
ATOM   2218  C C   . MET A 1 330 ? 40.786  57.565  120.442 1.00 70.09 ? 328 MET A C   1 
ATOM   2219  O O   . MET A 1 330 ? 40.138  57.110  119.502 1.00 70.09 ? 328 MET A O   1 
ATOM   2220  C CB  . MET A 1 330 ? 40.034  56.483  122.560 1.00 92.42 ? 328 MET A CB  1 
ATOM   2221  C CG  . MET A 1 330 ? 38.971  55.569  122.005 1.00 92.42 ? 328 MET A CG  1 
ATOM   2222  S SD  . MET A 1 330 ? 39.673  53.943  121.633 1.00 92.42 ? 328 MET A SD  1 
ATOM   2223  C CE  . MET A 1 330 ? 38.456  52.911  122.422 1.00 92.42 ? 328 MET A CE  1 
ATOM   2224  N N   . LYS A 1 331 ? 41.161  58.843  120.507 1.00 92.42 ? 329 LYS A N   1 
ATOM   2225  C CA  . LYS A 1 331 ? 40.804  59.792  119.448 1.00 92.42 ? 329 LYS A CA  1 
ATOM   2226  C C   . LYS A 1 331 ? 41.608  59.557  118.174 1.00 92.42 ? 329 LYS A C   1 
ATOM   2227  O O   . LYS A 1 331 ? 41.094  59.735  117.061 1.00 92.42 ? 329 LYS A O   1 
ATOM   2228  C CB  . LYS A 1 331 ? 41.023  61.242  119.904 1.00 52.34 ? 329 LYS A CB  1 
ATOM   2229  C CG  . LYS A 1 331 ? 40.592  62.272  118.860 1.00 52.34 ? 329 LYS A CG  1 
ATOM   2230  C CD  . LYS A 1 331 ? 40.987  63.699  119.229 1.00 52.34 ? 329 LYS A CD  1 
ATOM   2231  C CE  . LYS A 1 331 ? 40.578  64.681  118.124 1.00 52.34 ? 329 LYS A CE  1 
ATOM   2232  N NZ  . LYS A 1 331 ? 41.183  66.057  118.225 1.00 52.34 ? 329 LYS A NZ  1 
ATOM   2233  N N   . ARG A 1 332 ? 42.867  59.158  118.344 1.00 92.42 ? 330 ARG A N   1 
ATOM   2234  C CA  . ARG A 1 332 ? 43.758  58.916  117.216 1.00 92.42 ? 330 ARG A CA  1 
ATOM   2235  C C   . ARG A 1 332 ? 43.590  57.537  116.591 1.00 92.42 ? 330 ARG A C   1 
ATOM   2236  O O   . ARG A 1 332 ? 43.685  57.399  115.370 1.00 92.42 ? 330 ARG A O   1 
ATOM   2237  C CB  . ARG A 1 332 ? 45.212  59.125  117.650 1.00 81.41 ? 330 ARG A CB  1 
ATOM   2238  C CG  . ARG A 1 332 ? 45.435  60.466  118.320 1.00 81.41 ? 330 ARG A CG  1 
ATOM   2239  C CD  . ARG A 1 332 ? 44.826  61.556  117.477 1.00 81.41 ? 330 ARG A CD  1 
ATOM   2240  N NE  . ARG A 1 332 ? 45.493  61.642  116.183 1.00 81.41 ? 330 ARG A NE  1 
ATOM   2241  C CZ  . ARG A 1 332 ? 44.971  62.222  115.108 1.00 81.41 ? 330 ARG A CZ  1 
ATOM   2242  N NH1 . ARG A 1 332 ? 43.762  62.765  115.159 1.00 81.41 ? 330 ARG A NH1 1 
ATOM   2243  N NH2 . ARG A 1 332 ? 45.667  62.279  113.984 1.00 81.41 ? 330 ARG A NH2 1 
ATOM   2244  N N   . ALA A 1 333 ? 43.339  56.521  117.415 1.00 90.73 ? 331 ALA A N   1 
ATOM   2245  C CA  . ALA A 1 333 ? 43.160  55.164  116.899 1.00 90.73 ? 331 ALA A CA  1 
ATOM   2246  C C   . ALA A 1 333 ? 42.019  55.129  115.882 1.00 90.73 ? 331 ALA A C   1 
ATOM   2247  O O   . ALA A 1 333 ? 42.133  54.483  114.837 1.00 90.73 ? 331 ALA A O   1 
ATOM   2248  C CB  . ALA A 1 333 ? 42.875  54.195  118.041 1.00 82.83 ? 331 ALA A CB  1 
ATOM   2249  N N   . MET A 1 334 ? 40.926  55.829  116.188 1.00 76.76 ? 332 MET A N   1 
ATOM   2250  C CA  . MET A 1 334 ? 39.765  55.886  115.302 1.00 76.76 ? 332 MET A CA  1 
ATOM   2251  C C   . MET A 1 334 ? 40.104  56.717  114.078 1.00 76.76 ? 332 MET A C   1 
ATOM   2252  O O   . MET A 1 334 ? 39.896  56.286  112.949 1.00 76.76 ? 332 MET A O   1 
ATOM   2253  C CB  . MET A 1 334 ? 38.565  56.510  116.023 1.00 92.42 ? 332 MET A CB  1 
ATOM   2254  C CG  . MET A 1 334 ? 38.031  55.687  117.201 1.00 92.42 ? 332 MET A CG  1 
ATOM   2255  S SD  . MET A 1 334 ? 36.576  56.418  118.024 1.00 92.42 ? 332 MET A SD  1 
ATOM   2256  C CE  . MET A 1 334 ? 37.300  57.035  119.573 1.00 92.42 ? 332 MET A CE  1 
ATOM   2257  N N   . ALA A 1 335 ? 40.634  57.911  114.313 1.00 72.47 ? 333 ALA A N   1 
ATOM   2258  C CA  . ALA A 1 335 ? 41.008  58.817  113.233 1.00 72.47 ? 333 ALA A CA  1 
ATOM   2259  C C   . ALA A 1 335 ? 41.904  58.131  112.202 1.00 72.47 ? 333 ALA A C   1 
ATOM   2260  O O   . ALA A 1 335 ? 41.585  58.101  111.010 1.00 72.47 ? 333 ALA A O   1 
ATOM   2261  C CB  . ALA A 1 335 ? 41.716  60.043  113.810 1.00 92.42 ? 333 ALA A CB  1 
ATOM   2262  N N   . ASN A 1 336 ? 43.024  57.584  112.668 1.00 92.42 ? 334 ASN A N   1 
ATOM   2263  C CA  . ASN A 1 336 ? 43.967  56.901  111.791 1.00 92.42 ? 334 ASN A CA  1 
ATOM   2264  C C   . ASN A 1 336 ? 43.441  55.558  111.326 1.00 92.42 ? 334 ASN A C   1 
ATOM   2265  O O   . ASN A 1 336 ? 44.063  54.882  110.503 1.00 92.42 ? 334 ASN A O   1 
ATOM   2266  C CB  . ASN A 1 336 ? 45.313  56.739  112.486 1.00 75.23 ? 334 ASN A CB  1 
ATOM   2267  C CG  . ASN A 1 336 ? 46.038  58.049  112.614 1.00 75.23 ? 334 ASN A CG  1 
ATOM   2268  O OD1 . ASN A 1 336 ? 46.209  58.763  111.626 1.00 75.23 ? 334 ASN A OD1 1 
ATOM   2269  N ND2 . ASN A 1 336 ? 46.465  58.383  113.827 1.00 75.23 ? 334 ASN A ND2 1 
ATOM   2270  N N   . CYS A 1 337 ? 42.296  55.167  111.869 1.00 92.42 ? 335 CYS A N   1 
ATOM   2271  C CA  . CYS A 1 337 ? 41.656  53.929  111.455 1.00 92.42 ? 335 CYS A CA  1 
ATOM   2272  C C   . CYS A 1 337 ? 40.860  54.318  110.217 1.00 92.42 ? 335 CYS A C   1 
ATOM   2273  O O   . CYS A 1 337 ? 40.538  53.479  109.377 1.00 92.42 ? 335 CYS A O   1 
ATOM   2274  C CB  . CYS A 1 337 ? 40.698  53.426  112.529 1.00 90.31 ? 335 CYS A CB  1 
ATOM   2275  S SG  . CYS A 1 337 ? 39.275  52.567  111.842 1.00 90.31 ? 335 CYS A SG  1 
ATOM   2276  N N   . GLN A 1 338 ? 40.558  55.612  110.132 1.00 79.86 ? 336 GLN A N   1 
ATOM   2277  C CA  . GLN A 1 338 ? 39.800  56.190  109.032 1.00 79.86 ? 336 GLN A CA  1 
ATOM   2278  C C   . GLN A 1 338 ? 40.736  56.672  107.941 1.00 79.86 ? 336 GLN A C   1 
ATOM   2279  O O   . GLN A 1 338 ? 40.309  56.975  106.826 1.00 79.86 ? 336 GLN A O   1 
ATOM   2280  C CB  . GLN A 1 338 ? 38.950  57.345  109.544 1.00 92.42 ? 336 GLN A CB  1 
ATOM   2281  C CG  . GLN A 1 338 ? 38.048  56.931  110.693 1.00 92.42 ? 336 GLN A CG  1 
ATOM   2282  C CD  . GLN A 1 338 ? 37.215  58.071  111.226 1.00 92.42 ? 336 GLN A CD  1 
ATOM   2283  O OE1 . GLN A 1 338 ? 36.363  58.611  110.516 1.00 92.42 ? 336 GLN A OE1 1 
ATOM   2284  N NE2 . GLN A 1 338 ? 37.457  58.450  112.482 1.00 92.42 ? 336 GLN A NE2 1 
ATOM   2285  N N   . ALA A 1 339 ? 42.017  56.766  108.276 1.00 90.37 ? 337 ALA A N   1 
ATOM   2286  C CA  . ALA A 1 339 ? 43.018  57.166  107.299 1.00 90.37 ? 337 ALA A CA  1 
ATOM   2287  C C   . ALA A 1 339 ? 43.224  55.909  106.476 1.00 90.37 ? 337 ALA A C   1 
ATOM   2288  O O   . ALA A 1 339 ? 43.497  55.976  105.277 1.00 90.37 ? 337 ALA A O   1 
ATOM   2289  C CB  . ALA A 1 339 ? 44.316  57.559  107.990 1.00 74.90 ? 337 ALA A CB  1 
ATOM   2290  N N   . ALA A 1 340 ? 43.071  54.765  107.151 1.00 80.64 ? 338 ALA A N   1 
ATOM   2291  C CA  . ALA A 1 340 ? 43.215  53.442  106.543 1.00 80.64 ? 338 ALA A CA  1 
ATOM   2292  C C   . ALA A 1 340 ? 41.981  53.114  105.723 1.00 80.64 ? 338 ALA A C   1 
ATOM   2293  O O   . ALA A 1 340 ? 41.855  52.003  105.208 1.00 80.64 ? 338 ALA A O   1 
ATOM   2294  C CB  . ALA A 1 340 ? 43.418  52.376  107.618 1.00 37.00 ? 338 ALA A CB  1 
ATOM   2295  N N   . LYS A 1 341 ? 41.077  54.089  105.614 1.00 57.52 ? 339 LYS A N   1 
ATOM   2296  C CA  . LYS A 1 341 ? 39.848  53.940  104.844 1.00 57.52 ? 339 LYS A CA  1 
ATOM   2297  C C   . LYS A 1 341 ? 39.623  55.100  103.885 1.00 57.52 ? 339 LYS A C   1 
ATOM   2298  O O   . LYS A 1 341 ? 38.815  54.992  102.972 1.00 57.52 ? 339 LYS A O   1 
ATOM   2299  C CB  . LYS A 1 341 ? 38.639  53.820  105.770 1.00 70.11 ? 339 LYS A CB  1 
ATOM   2300  C CG  . LYS A 1 341 ? 38.540  52.491  106.487 1.00 70.11 ? 339 LYS A CG  1 
ATOM   2301  C CD  . LYS A 1 341 ? 37.139  52.275  107.028 1.00 70.11 ? 339 LYS A CD  1 
ATOM   2302  C CE  . LYS A 1 341 ? 36.939  50.856  107.523 1.00 70.11 ? 339 LYS A CE  1 
ATOM   2303  N NZ  . LYS A 1 341 ? 35.493  50.545  107.657 1.00 70.11 ? 339 LYS A NZ  1 
ATOM   2304  N N   . GLY A 1 342 ? 40.332  56.206  104.100 1.00 60.38 ? 340 GLY A N   1 
ATOM   2305  C CA  . GLY A 1 342 ? 40.180  57.373  103.242 1.00 60.38 ? 340 GLY A CA  1 
ATOM   2306  C C   . GLY A 1 342 ? 38.938  58.202  103.551 1.00 60.38 ? 340 GLY A C   1 
ATOM   2307  O O   . GLY A 1 342 ? 38.739  59.292  103.004 1.00 60.38 ? 340 GLY A O   1 
ATOM   2308  N N   . GLN A 1 343 ? 38.095  57.677  104.433 1.00 85.35 ? 341 GLN A N   1 
ATOM   2309  C CA  . GLN A 1 343 ? 36.867  58.351  104.827 1.00 85.35 ? 341 GLN A CA  1 
ATOM   2310  C C   . GLN A 1 343 ? 37.192  59.464  105.818 1.00 85.35 ? 341 GLN A C   1 
ATOM   2311  O O   . GLN A 1 343 ? 36.289  60.081  106.382 1.00 85.35 ? 341 GLN A O   1 
ATOM   2312  C CB  . GLN A 1 343 ? 35.911  57.350  105.477 1.00 79.90 ? 341 GLN A CB  1 
ATOM   2313  C CG  . GLN A 1 343 ? 35.808  56.017  104.739 1.00 79.90 ? 341 GLN A CG  1 
ATOM   2314  C CD  . GLN A 1 343 ? 35.164  54.925  105.584 1.00 79.90 ? 341 GLN A CD  1 
ATOM   2315  O OE1 . GLN A 1 343 ? 35.607  54.643  106.699 1.00 79.90 ? 341 GLN A OE1 1 
ATOM   2316  N NE2 . GLN A 1 343 ? 34.119  54.303  105.053 1.00 79.90 ? 341 GLN A NE2 1 
ATOM   2317  N N   . TYR A 1 344 ? 38.485  59.710  106.030 1.00 69.12 ? 342 TYR A N   1 
ATOM   2318  C CA  . TYR A 1 344 ? 38.943  60.751  106.954 1.00 69.12 ? 342 TYR A CA  1 
ATOM   2319  C C   . TYR A 1 344 ? 38.654  62.150  106.396 1.00 69.12 ? 342 TYR A C   1 
ATOM   2320  O O   . TYR A 1 344 ? 39.618  62.871  106.059 1.00 69.12 ? 342 TYR A O   1 
ATOM   2321  C CB  . TYR A 1 344 ? 40.449  60.605  107.218 1.00 92.42 ? 342 TYR A CB  1 
ATOM   2322  C CG  . TYR A 1 344 ? 40.973  61.447  108.375 1.00 92.42 ? 342 TYR A CG  1 
ATOM   2323  C CD1 . TYR A 1 344 ? 40.780  61.042  109.703 1.00 92.42 ? 342 TYR A CD1 1 
ATOM   2324  C CD2 . TYR A 1 344 ? 41.652  62.653  108.145 1.00 92.42 ? 342 TYR A CD2 1 
ATOM   2325  C CE1 . TYR A 1 344 ? 41.252  61.816  110.776 1.00 92.42 ? 342 TYR A CE1 1 
ATOM   2326  C CE2 . TYR A 1 344 ? 42.126  63.436  109.210 1.00 92.42 ? 342 TYR A CE2 1 
ATOM   2327  C CZ  . TYR A 1 344 ? 41.922  63.009  110.523 1.00 92.42 ? 342 TYR A CZ  1 
ATOM   2328  O OH  . TYR A 1 344 ? 42.388  63.762  111.582 1.00 92.42 ? 342 TYR A OH  1 
ATOM   2329  N N   . ALA B 1 8   ? 66.218  56.928  80.521  1.00 70.25 ? 6   ALA B N   1 
ATOM   2330  C CA  . ALA B 1 8   ? 65.943  58.353  80.876  1.00 66.31 ? 6   ALA B CA  1 
ATOM   2331  C C   . ALA B 1 8   ? 64.563  58.782  80.392  1.00 70.25 ? 6   ALA B C   1 
ATOM   2332  O O   . ALA B 1 8   ? 64.302  59.977  80.224  1.00 70.25 ? 6   ALA B O   1 
ATOM   2333  C CB  . ALA B 1 8   ? 67.004  59.256  80.267  1.00 22.28 ? 6   ALA B CB  1 
ATOM   2334  N N   . LEU B 1 9   ? 63.690  57.800  80.165  1.00 72.95 ? 7   LEU B N   1 
ATOM   2335  C CA  . LEU B 1 9   ? 62.325  58.039  79.695  1.00 74.12 ? 7   LEU B CA  1 
ATOM   2336  C C   . LEU B 1 9   ? 61.773  59.342  80.254  1.00 75.99 ? 7   LEU B C   1 
ATOM   2337  O O   . LEU B 1 9   ? 61.904  59.607  81.445  1.00 77.67 ? 7   LEU B O   1 
ATOM   2338  C CB  . LEU B 1 9   ? 61.415  56.892  80.139  1.00 43.55 ? 7   LEU B CB  1 
ATOM   2339  C CG  . LEU B 1 9   ? 61.722  55.476  79.656  1.00 48.06 ? 7   LEU B CG  1 
ATOM   2340  C CD1 . LEU B 1 9   ? 61.165  54.459  80.642  1.00 54.16 ? 7   LEU B CD1 1 
ATOM   2341  C CD2 . LEU B 1 9   ? 61.131  55.276  78.275  1.00 47.59 ? 7   LEU B CD2 1 
ATOM   2342  N N   . THR B 1 10  ? 61.164  60.160  79.406  1.00 71.59 ? 8   THR B N   1 
ATOM   2343  C CA  . THR B 1 10  ? 60.583  61.406  79.886  1.00 71.59 ? 8   THR B CA  1 
ATOM   2344  C C   . THR B 1 10  ? 59.134  61.159  80.299  1.00 71.59 ? 8   THR B C   1 
ATOM   2345  O O   . THR B 1 10  ? 58.492  60.229  79.810  1.00 71.59 ? 8   THR B O   1 
ATOM   2346  C CB  . THR B 1 10  ? 60.622  62.507  78.810  1.00 70.24 ? 8   THR B CB  1 
ATOM   2347  O OG1 . THR B 1 10  ? 60.016  62.034  77.600  1.00 70.24 ? 8   THR B OG1 1 
ATOM   2348  C CG2 . THR B 1 10  ? 62.054  62.911  78.539  1.00 70.24 ? 8   THR B CG2 1 
ATOM   2349  N N   . GLN B 1 11  ? 58.616  61.980  81.206  1.00 71.50 ? 9   GLN B N   1 
ATOM   2350  C CA  . GLN B 1 11  ? 57.237  61.819  81.652  1.00 71.50 ? 9   GLN B CA  1 
ATOM   2351  C C   . GLN B 1 11  ? 56.360  61.864  80.405  1.00 71.50 ? 9   GLN B C   1 
ATOM   2352  O O   . GLN B 1 11  ? 55.168  61.571  80.454  1.00 71.50 ? 9   GLN B O   1 
ATOM   2353  C CB  . GLN B 1 11  ? 56.853  62.951  82.610  1.00 78.53 ? 9   GLN B CB  1 
ATOM   2354  C CG  . GLN B 1 11  ? 55.823  62.582  83.693  1.00 78.53 ? 9   GLN B CG  1 
ATOM   2355  C CD  . GLN B 1 11  ? 56.420  61.829  84.891  1.00 78.53 ? 9   GLN B CD  1 
ATOM   2356  O OE1 . GLN B 1 11  ? 55.769  61.689  85.930  1.00 78.53 ? 9   GLN B OE1 1 
ATOM   2357  N NE2 . GLN B 1 11  ? 57.650  61.341  84.745  1.00 78.53 ? 9   GLN B NE2 1 
ATOM   2358  N N   . GLU B 1 12  ? 56.978  62.228  79.285  1.00 64.60 ? 10  GLU B N   1 
ATOM   2359  C CA  . GLU B 1 12  ? 56.311  62.326  77.991  1.00 64.60 ? 10  GLU B CA  1 
ATOM   2360  C C   . GLU B 1 12  ? 56.147  60.968  77.303  1.00 64.60 ? 10  GLU B C   1 
ATOM   2361  O O   . GLU B 1 12  ? 55.078  60.665  76.772  1.00 64.60 ? 10  GLU B O   1 
ATOM   2362  C CB  . GLU B 1 12  ? 57.104  63.276  77.088  1.00 88.81 ? 10  GLU B CB  1 
ATOM   2363  C CG  . GLU B 1 12  ? 56.778  63.193  75.606  1.00 88.81 ? 10  GLU B CG  1 
ATOM   2364  C CD  . GLU B 1 12  ? 57.712  64.050  74.762  1.00 88.81 ? 10  GLU B CD  1 
ATOM   2365  O OE1 . GLU B 1 12  ? 58.941  64.008  74.995  1.00 88.81 ? 10  GLU B OE1 1 
ATOM   2366  O OE2 . GLU B 1 12  ? 57.220  64.760  73.859  1.00 88.81 ? 10  GLU B OE2 1 
ATOM   2367  N N   . GLN B 1 13  ? 57.209  60.161  77.307  1.00 59.88 ? 11  GLN B N   1 
ATOM   2368  C CA  . GLN B 1 13  ? 57.195  58.833  76.686  1.00 59.88 ? 11  GLN B CA  1 
ATOM   2369  C C   . GLN B 1 13  ? 56.484  57.825  77.565  1.00 59.88 ? 11  GLN B C   1 
ATOM   2370  O O   . GLN B 1 13  ? 55.900  56.862  77.067  1.00 59.88 ? 11  GLN B O   1 
ATOM   2371  C CB  . GLN B 1 13  ? 58.610  58.341  76.452  1.00 52.73 ? 11  GLN B CB  1 
ATOM   2372  C CG  . GLN B 1 13  ? 59.440  59.244  75.613  1.00 52.73 ? 11  GLN B CG  1 
ATOM   2373  C CD  . GLN B 1 13  ? 60.890  58.979  75.834  1.00 52.73 ? 11  GLN B CD  1 
ATOM   2374  O OE1 . GLN B 1 13  ? 61.454  59.378  76.855  1.00 52.73 ? 11  GLN B OE1 1 
ATOM   2375  N NE2 . GLN B 1 13  ? 61.510  58.277  74.898  1.00 52.73 ? 11  GLN B NE2 1 
ATOM   2376  N N   . LYS B 1 14  ? 56.572  58.022  78.877  1.00 67.69 ? 12  LYS B N   1 
ATOM   2377  C CA  . LYS B 1 14  ? 55.889  57.135  79.800  1.00 67.69 ? 12  LYS B CA  1 
ATOM   2378  C C   . LYS B 1 14  ? 54.416  57.292  79.430  1.00 67.69 ? 12  LYS B C   1 
ATOM   2379  O O   . LYS B 1 14  ? 53.674  56.312  79.324  1.00 67.69 ? 12  LYS B O   1 
ATOM   2380  C CB  . LYS B 1 14  ? 56.127  57.573  81.248  1.00 56.26 ? 12  LYS B CB  1 
ATOM   2381  C CG  . LYS B 1 14  ? 57.514  57.262  81.787  1.00 56.26 ? 12  LYS B CG  1 
ATOM   2382  C CD  . LYS B 1 14  ? 57.689  57.826  83.197  1.00 56.26 ? 12  LYS B CD  1 
ATOM   2383  C CE  . LYS B 1 14  ? 59.124  57.649  83.728  1.00 56.26 ? 12  LYS B CE  1 
ATOM   2384  N NZ  . LYS B 1 14  ? 59.371  58.319  85.059  1.00 56.26 ? 12  LYS B NZ  1 
ATOM   2385  N N   . LYS B 1 15  ? 54.012  58.543  79.217  1.00 58.50 ? 13  LYS B N   1 
ATOM   2386  C CA  . LYS B 1 15  ? 52.645  58.875  78.827  1.00 58.50 ? 13  LYS B CA  1 
ATOM   2387  C C   . LYS B 1 15  ? 52.256  57.892  77.742  1.00 58.50 ? 13  LYS B C   1 
ATOM   2388  O O   . LYS B 1 15  ? 51.304  57.130  77.894  1.00 58.50 ? 13  LYS B O   1 
ATOM   2389  C CB  . LYS B 1 15  ? 52.597  60.299  78.274  1.00 92.42 ? 13  LYS B CB  1 
ATOM   2390  C CG  . LYS B 1 15  ? 51.214  60.826  77.950  1.00 92.42 ? 13  LYS B CG  1 
ATOM   2391  C CD  . LYS B 1 15  ? 51.314  62.287  77.509  1.00 92.42 ? 13  LYS B CD  1 
ATOM   2392  C CE  . LYS B 1 15  ? 49.946  62.960  77.390  1.00 92.42 ? 13  LYS B CE  1 
ATOM   2393  N NZ  . LYS B 1 15  ? 50.055  64.392  76.952  1.00 92.42 ? 13  LYS B NZ  1 
ATOM   2394  N N   . GLU B 1 16  ? 53.031  57.906  76.661  1.00 55.64 ? 14  GLU B N   1 
ATOM   2395  C CA  . GLU B 1 16  ? 52.819  57.026  75.515  1.00 55.64 ? 14  GLU B CA  1 
ATOM   2396  C C   . GLU B 1 16  ? 52.930  55.544  75.874  1.00 55.64 ? 14  GLU B C   1 
ATOM   2397  O O   . GLU B 1 16  ? 51.945  54.804  75.828  1.00 55.64 ? 14  GLU B O   1 
ATOM   2398  C CB  . GLU B 1 16  ? 53.826  57.351  74.404  1.00 72.32 ? 14  GLU B CB  1 
ATOM   2399  C CG  . GLU B 1 16  ? 53.715  56.444  73.185  1.00 72.32 ? 14  GLU B CG  1 
ATOM   2400  C CD  . GLU B 1 16  ? 54.846  56.653  72.189  1.00 72.32 ? 14  GLU B CD  1 
ATOM   2401  O OE1 . GLU B 1 16  ? 56.026  56.614  72.608  1.00 72.32 ? 14  GLU B OE1 1 
ATOM   2402  O OE2 . GLU B 1 16  ? 54.562  56.845  70.986  1.00 72.32 ? 14  GLU B OE2 1 
ATOM   2403  N N   . LEU B 1 17  ? 54.134  55.109  76.219  1.00 57.17 ? 15  LEU B N   1 
ATOM   2404  C CA  . LEU B 1 17  ? 54.341  53.716  76.570  1.00 57.17 ? 15  LEU B CA  1 
ATOM   2405  C C   . LEU B 1 17  ? 53.098  53.129  77.214  1.00 57.17 ? 15  LEU B C   1 
ATOM   2406  O O   . LEU B 1 17  ? 52.655  52.044  76.842  1.00 57.17 ? 15  LEU B O   1 
ATOM   2407  C CB  . LEU B 1 17  ? 55.535  53.581  77.514  1.00 25.89 ? 15  LEU B CB  1 
ATOM   2408  C CG  . LEU B 1 17  ? 56.881  53.762  76.822  1.00 25.89 ? 15  LEU B CG  1 
ATOM   2409  C CD1 . LEU B 1 17  ? 58.000  53.645  77.830  1.00 25.89 ? 15  LEU B CD1 1 
ATOM   2410  C CD2 . LEU B 1 17  ? 57.024  52.702  75.736  1.00 25.89 ? 15  LEU B CD2 1 
ATOM   2411  N N   . SER B 1 18  ? 52.525  53.869  78.161  1.00 33.33 ? 16  SER B N   1 
ATOM   2412  C CA  . SER B 1 18  ? 51.336  53.415  78.865  1.00 33.33 ? 16  SER B CA  1 
ATOM   2413  C C   . SER B 1 18  ? 50.097  53.385  77.965  1.00 33.33 ? 16  SER B C   1 
ATOM   2414  O O   . SER B 1 18  ? 49.508  52.314  77.753  1.00 33.33 ? 16  SER B O   1 
ATOM   2415  C CB  . SER B 1 18  ? 51.075  54.302  80.079  1.00 61.28 ? 16  SER B CB  1 
ATOM   2416  O OG  . SER B 1 18  ? 50.265  53.630  81.030  1.00 61.28 ? 16  SER B OG  1 
ATOM   2417  N N   . GLU B 1 19  ? 49.705  54.549  77.437  1.00 28.54 ? 17  GLU B N   1 
ATOM   2418  C CA  . GLU B 1 19  ? 48.533  54.637  76.561  1.00 28.54 ? 17  GLU B CA  1 
ATOM   2419  C C   . GLU B 1 19  ? 48.474  53.408  75.687  1.00 28.54 ? 17  GLU B C   1 
ATOM   2420  O O   . GLU B 1 19  ? 47.423  52.787  75.537  1.00 28.54 ? 17  GLU B O   1 
ATOM   2421  C CB  . GLU B 1 19  ? 48.604  55.867  75.667  1.00 78.12 ? 17  GLU B CB  1 
ATOM   2422  C CG  . GLU B 1 19  ? 48.715  57.172  76.416  1.00 78.12 ? 17  GLU B CG  1 
ATOM   2423  C CD  . GLU B 1 19  ? 48.704  58.359  75.480  1.00 78.12 ? 17  GLU B CD  1 
ATOM   2424  O OE1 . GLU B 1 19  ? 49.421  58.307  74.455  1.00 78.12 ? 17  GLU B OE1 1 
ATOM   2425  O OE2 . GLU B 1 19  ? 47.985  59.339  75.768  1.00 78.12 ? 17  GLU B OE2 1 
ATOM   2426  N N   . ILE B 1 20  ? 49.626  53.056  75.128  1.00 39.51 ? 18  ILE B N   1 
ATOM   2427  C CA  . ILE B 1 20  ? 49.752  51.890  74.258  1.00 39.51 ? 18  ILE B CA  1 
ATOM   2428  C C   . ILE B 1 20  ? 49.643  50.605  75.064  1.00 39.51 ? 18  ILE B C   1 
ATOM   2429  O O   . ILE B 1 20  ? 48.932  49.681  74.681  1.00 39.51 ? 18  ILE B O   1 
ATOM   2430  C CB  . ILE B 1 20  ? 51.124  51.873  73.519  1.00 33.50 ? 18  ILE B CB  1 
ATOM   2431  C CG1 . ILE B 1 20  ? 51.295  53.154  72.684  1.00 33.50 ? 18  ILE B CG1 1 
ATOM   2432  C CG2 . ILE B 1 20  ? 51.227  50.627  72.647  1.00 33.50 ? 18  ILE B CG2 1 
ATOM   2433  C CD1 . ILE B 1 20  ? 52.668  53.307  72.038  1.00 33.50 ? 18  ILE B CD1 1 
ATOM   2434  N N   . ALA B 1 21  ? 50.365  50.559  76.178  1.00 50.40 ? 19  ALA B N   1 
ATOM   2435  C CA  . ALA B 1 21  ? 50.380  49.393  77.044  1.00 50.40 ? 19  ALA B CA  1 
ATOM   2436  C C   . ALA B 1 21  ? 48.975  48.965  77.403  1.00 50.40 ? 19  ALA B C   1 
ATOM   2437  O O   . ALA B 1 21  ? 48.653  47.777  77.372  1.00 50.40 ? 19  ALA B O   1 
ATOM   2438  C CB  . ALA B 1 21  ? 51.164  49.703  78.303  1.00 71.44 ? 19  ALA B CB  1 
ATOM   2439  N N   . GLN B 1 22  ? 48.147  49.949  77.735  1.00 57.75 ? 20  GLN B N   1 
ATOM   2440  C CA  . GLN B 1 22  ? 46.760  49.725  78.130  1.00 57.75 ? 20  GLN B CA  1 
ATOM   2441  C C   . GLN B 1 22  ? 45.792  49.571  76.952  1.00 57.75 ? 20  GLN B C   1 
ATOM   2442  O O   . GLN B 1 22  ? 44.944  48.668  76.940  1.00 57.75 ? 20  GLN B O   1 
ATOM   2443  C CB  . GLN B 1 22  ? 46.296  50.882  79.009  1.00 22.92 ? 20  GLN B CB  1 
ATOM   2444  C CG  . GLN B 1 22  ? 46.740  50.815  80.468  1.00 22.92 ? 20  GLN B CG  1 
ATOM   2445  C CD  . GLN B 1 22  ? 46.465  52.119  81.199  1.00 22.92 ? 20  GLN B CD  1 
ATOM   2446  O OE1 . GLN B 1 22  ? 46.311  52.153  82.426  1.00 22.92 ? 20  GLN B OE1 1 
ATOM   2447  N NE2 . GLN B 1 22  ? 46.412  53.214  80.437  1.00 22.92 ? 20  GLN B NE2 1 
ATOM   2448  N N   . SER B 1 23  ? 45.905  50.459  75.969  1.00 27.83 ? 21  SER B N   1 
ATOM   2449  C CA  . SER B 1 23  ? 45.035  50.390  74.808  1.00 27.83 ? 21  SER B CA  1 
ATOM   2450  C C   . SER B 1 23  ? 45.018  48.981  74.222  1.00 27.83 ? 21  SER B C   1 
ATOM   2451  O O   . SER B 1 23  ? 44.104  48.610  73.501  1.00 27.83 ? 21  SER B O   1 
ATOM   2452  C CB  . SER B 1 23  ? 45.496  51.383  73.739  1.00 55.52 ? 21  SER B CB  1 
ATOM   2453  O OG  . SER B 1 23  ? 46.779  51.043  73.251  1.00 55.52 ? 21  SER B OG  1 
ATOM   2454  N N   . ILE B 1 24  ? 46.031  48.189  74.531  1.00 23.59 ? 22  ILE B N   1 
ATOM   2455  C CA  . ILE B 1 24  ? 46.091  46.840  73.994  1.00 23.59 ? 22  ILE B CA  1 
ATOM   2456  C C   . ILE B 1 24  ? 45.115  45.921  74.717  1.00 23.59 ? 22  ILE B C   1 
ATOM   2457  O O   . ILE B 1 24  ? 44.418  45.119  74.092  1.00 23.59 ? 22  ILE B O   1 
ATOM   2458  C CB  . ILE B 1 24  ? 47.529  46.256  74.100  1.00 25.98 ? 22  ILE B CB  1 
ATOM   2459  C CG1 . ILE B 1 24  ? 48.513  47.171  73.367  1.00 25.98 ? 22  ILE B CG1 1 
ATOM   2460  C CG2 . ILE B 1 24  ? 47.569  44.854  73.503  1.00 25.98 ? 22  ILE B CG2 1 
ATOM   2461  C CD1 . ILE B 1 24  ? 49.933  46.655  73.311  1.00 25.98 ? 22  ILE B CD1 1 
ATOM   2462  N N   . VAL B 1 25  ? 45.064  46.067  76.034  1.00 36.86 ? 23  VAL B N   1 
ATOM   2463  C CA  . VAL B 1 25  ? 44.212  45.250  76.888  1.00 36.86 ? 23  VAL B CA  1 
ATOM   2464  C C   . VAL B 1 25  ? 43.090  46.068  77.516  1.00 36.86 ? 23  VAL B C   1 
ATOM   2465  O O   . VAL B 1 25  ? 42.827  45.953  78.708  1.00 36.86 ? 23  VAL B O   1 
ATOM   2466  C CB  . VAL B 1 25  ? 45.061  44.590  78.026  1.00 26.84 ? 23  VAL B CB  1 
ATOM   2467  C CG1 . VAL B 1 25  ? 45.840  43.387  77.466  1.00 26.84 ? 23  VAL B CG1 1 
ATOM   2468  C CG2 . VAL B 1 25  ? 46.040  45.631  78.639  1.00 26.84 ? 23  VAL B CG2 1 
ATOM   2469  N N   . ALA B 1 26  ? 42.422  46.882  76.711  1.00 72.29 ? 24  ALA B N   1 
ATOM   2470  C CA  . ALA B 1 26  ? 41.361  47.734  77.225  1.00 72.29 ? 24  ALA B CA  1 
ATOM   2471  C C   . ALA B 1 26  ? 40.201  47.029  77.899  1.00 72.29 ? 24  ALA B C   1 
ATOM   2472  O O   . ALA B 1 26  ? 40.192  46.836  79.110  1.00 72.29 ? 24  ALA B O   1 
ATOM   2473  C CB  . ALA B 1 26  ? 40.839  48.617  76.132  1.00 31.05 ? 24  ALA B CB  1 
ATOM   2474  N N   . ASN B 1 27  ? 39.203  46.653  77.122  1.00 48.09 ? 25  ASN B N   1 
ATOM   2475  C CA  . ASN B 1 27  ? 38.048  46.017  77.718  1.00 48.09 ? 25  ASN B CA  1 
ATOM   2476  C C   . ASN B 1 27  ? 37.959  44.563  77.325  1.00 48.09 ? 25  ASN B C   1 
ATOM   2477  O O   . ASN B 1 27  ? 37.356  44.218  76.318  1.00 48.09 ? 25  ASN B O   1 
ATOM   2478  C CB  . ASN B 1 27  ? 36.787  46.754  77.290  1.00 35.40 ? 25  ASN B CB  1 
ATOM   2479  C CG  . ASN B 1 27  ? 37.015  48.250  77.119  1.00 35.40 ? 25  ASN B CG  1 
ATOM   2480  O OD1 . ASN B 1 27  ? 37.596  48.693  76.133  1.00 35.40 ? 25  ASN B OD1 1 
ATOM   2481  N ND2 . ASN B 1 27  ? 36.553  49.032  78.083  1.00 35.40 ? 25  ASN B ND2 1 
ATOM   2482  N N   . GLY B 1 28  ? 38.558  43.706  78.134  1.00 43.26 ? 26  GLY B N   1 
ATOM   2483  C CA  . GLY B 1 28  ? 38.532  42.292  77.832  1.00 43.26 ? 26  GLY B CA  1 
ATOM   2484  C C   . GLY B 1 28  ? 39.186  42.006  76.498  1.00 43.26 ? 26  GLY B C   1 
ATOM   2485  O O   . GLY B 1 28  ? 39.042  40.909  75.956  1.00 43.26 ? 26  GLY B O   1 
ATOM   2486  N N   . LYS B 1 29  ? 39.911  42.986  75.966  1.00 36.99 ? 27  LYS B N   1 
ATOM   2487  C CA  . LYS B 1 29  ? 40.578  42.800  74.684  1.00 36.99 ? 27  LYS B CA  1 
ATOM   2488  C C   . LYS B 1 29  ? 41.942  42.135  74.856  1.00 36.99 ? 27  LYS B C   1 
ATOM   2489  O O   . LYS B 1 29  ? 42.631  42.362  75.851  1.00 36.99 ? 27  LYS B O   1 
ATOM   2490  C CB  . LYS B 1 29  ? 40.729  44.144  73.955  1.00 22.34 ? 27  LYS B CB  1 
ATOM   2491  C CG  . LYS B 1 29  ? 39.605  44.451  72.969  1.00 22.34 ? 27  LYS B CG  1 
ATOM   2492  C CD  . LYS B 1 29  ? 39.864  45.711  72.147  1.00 22.34 ? 27  LYS B CD  1 
ATOM   2493  C CE  . LYS B 1 29  ? 40.016  46.957  73.017  1.00 22.34 ? 27  LYS B CE  1 
ATOM   2494  N NZ  . LYS B 1 29  ? 40.180  48.181  72.184  1.00 22.34 ? 27  LYS B NZ  1 
ATOM   2495  N N   . GLY B 1 30  ? 42.319  41.310  73.884  1.00 44.43 ? 28  GLY B N   1 
ATOM   2496  C CA  . GLY B 1 30  ? 43.592  40.619  73.939  1.00 44.43 ? 28  GLY B CA  1 
ATOM   2497  C C   . GLY B 1 30  ? 44.426  40.822  72.688  1.00 44.43 ? 28  GLY B C   1 
ATOM   2498  O O   . GLY B 1 30  ? 44.112  41.664  71.847  1.00 44.43 ? 28  GLY B O   1 
ATOM   2499  N N   . ILE B 1 31  ? 45.483  40.029  72.550  1.00 54.91 ? 29  ILE B N   1 
ATOM   2500  C CA  . ILE B 1 31  ? 46.391  40.143  71.414  1.00 54.91 ? 29  ILE B CA  1 
ATOM   2501  C C   . ILE B 1 31  ? 46.389  38.890  70.532  1.00 54.91 ? 29  ILE B C   1 
ATOM   2502  O O   . ILE B 1 31  ? 46.316  37.770  71.033  1.00 54.91 ? 29  ILE B O   1 
ATOM   2503  C CB  . ILE B 1 31  ? 47.835  40.419  71.932  1.00 16.71 ? 29  ILE B CB  1 
ATOM   2504  C CG1 . ILE B 1 31  ? 47.883  41.765  72.654  1.00 16.71 ? 29  ILE B CG1 1 
ATOM   2505  C CG2 . ILE B 1 31  ? 48.815  40.405  70.802  1.00 16.71 ? 29  ILE B CG2 1 
ATOM   2506  C CD1 . ILE B 1 31  ? 49.235  42.097  73.241  1.00 16.71 ? 29  ILE B CD1 1 
ATOM   2507  N N   . LEU B 1 32  ? 46.448  39.086  69.218  1.00 43.06 ? 30  LEU B N   1 
ATOM   2508  C CA  . LEU B 1 32  ? 46.492  37.967  68.283  1.00 43.06 ? 30  LEU B CA  1 
ATOM   2509  C C   . LEU B 1 32  ? 47.948  37.789  67.865  1.00 43.06 ? 30  LEU B C   1 
ATOM   2510  O O   . LEU B 1 32  ? 48.638  38.770  67.583  1.00 43.06 ? 30  LEU B O   1 
ATOM   2511  C CB  . LEU B 1 32  ? 45.641  38.254  67.042  1.00 25.50 ? 30  LEU B CB  1 
ATOM   2512  C CG  . LEU B 1 32  ? 45.880  37.430  65.757  1.00 25.50 ? 30  LEU B CG  1 
ATOM   2513  C CD1 . LEU B 1 32  ? 45.464  35.958  65.921  1.00 25.50 ? 30  LEU B CD1 1 
ATOM   2514  C CD2 . LEU B 1 32  ? 45.088  38.062  64.635  1.00 25.50 ? 30  LEU B CD2 1 
ATOM   2515  N N   . ALA B 1 33  ? 48.418  36.544  67.819  1.00 45.38 ? 31  ALA B N   1 
ATOM   2516  C CA  . ALA B 1 33  ? 49.802  36.271  67.444  1.00 45.38 ? 31  ALA B CA  1 
ATOM   2517  C C   . ALA B 1 33  ? 49.905  35.718  66.039  1.00 45.38 ? 31  ALA B C   1 
ATOM   2518  O O   . ALA B 1 33  ? 50.038  34.509  65.854  1.00 45.38 ? 31  ALA B O   1 
ATOM   2519  C CB  . ALA B 1 33  ? 50.407  35.296  68.407  1.00 1.56  ? 31  ALA B CB  1 
ATOM   2520  N N   . ALA B 1 34  ? 49.846  36.605  65.053  1.00 48.50 ? 32  ALA B N   1 
ATOM   2521  C CA  . ALA B 1 34  ? 49.933  36.207  63.652  1.00 48.50 ? 32  ALA B CA  1 
ATOM   2522  C C   . ALA B 1 34  ? 51.388  36.319  63.254  1.00 48.50 ? 32  ALA B C   1 
ATOM   2523  O O   . ALA B 1 34  ? 51.729  36.462  62.077  1.00 48.50 ? 32  ALA B O   1 
ATOM   2524  C CB  . ALA B 1 34  ? 49.072  37.131  62.789  1.00 89.29 ? 32  ALA B CB  1 
ATOM   2525  N N   . ASP B 1 35  ? 52.244  36.245  64.259  1.00 39.38 ? 33  ASP B N   1 
ATOM   2526  C CA  . ASP B 1 35  ? 53.664  36.376  64.033  1.00 39.38 ? 33  ASP B CA  1 
ATOM   2527  C C   . ASP B 1 35  ? 54.417  35.065  63.784  1.00 39.38 ? 33  ASP B C   1 
ATOM   2528  O O   . ASP B 1 35  ? 55.639  35.033  63.916  1.00 39.38 ? 33  ASP B O   1 
ATOM   2529  C CB  . ASP B 1 35  ? 54.287  37.129  65.214  1.00 52.23 ? 33  ASP B CB  1 
ATOM   2530  C CG  . ASP B 1 35  ? 54.163  36.373  66.536  1.00 52.23 ? 33  ASP B CG  1 
ATOM   2531  O OD1 . ASP B 1 35  ? 54.374  36.983  67.603  1.00 52.23 ? 33  ASP B OD1 1 
ATOM   2532  O OD2 . ASP B 1 35  ? 53.869  35.163  66.524  1.00 52.23 ? 33  ASP B OD2 1 
ATOM   2533  N N   . GLU B 1 36  ? 53.725  33.989  63.414  1.00 45.75 ? 34  GLU B N   1 
ATOM   2534  C CA  . GLU B 1 36  ? 54.436  32.735  63.182  1.00 45.75 ? 34  GLU B CA  1 
ATOM   2535  C C   . GLU B 1 36  ? 55.550  32.923  62.167  1.00 45.75 ? 34  GLU B C   1 
ATOM   2536  O O   . GLU B 1 36  ? 55.358  33.555  61.127  1.00 45.75 ? 34  GLU B O   1 
ATOM   2537  C CB  . GLU B 1 36  ? 53.500  31.648  62.675  1.00 49.66 ? 34  GLU B CB  1 
ATOM   2538  C CG  . GLU B 1 36  ? 52.380  31.332  63.615  1.00 49.66 ? 34  GLU B CG  1 
ATOM   2539  C CD  . GLU B 1 36  ? 51.133  32.086  63.263  1.00 49.66 ? 34  GLU B CD  1 
ATOM   2540  O OE1 . GLU B 1 36  ? 51.232  33.297  62.954  1.00 49.66 ? 34  GLU B OE1 1 
ATOM   2541  O OE2 . GLU B 1 36  ? 50.057  31.459  63.299  1.00 49.66 ? 34  GLU B OE2 1 
ATOM   2542  N N   . SER B 1 37  ? 56.724  32.381  62.465  1.00 77.88 ? 35  SER B N   1 
ATOM   2543  C CA  . SER B 1 37  ? 57.837  32.504  61.536  1.00 77.88 ? 35  SER B CA  1 
ATOM   2544  C C   . SER B 1 37  ? 57.597  31.491  60.435  1.00 77.88 ? 35  SER B C   1 
ATOM   2545  O O   . SER B 1 37  ? 57.061  30.409  60.688  1.00 77.88 ? 35  SER B O   1 
ATOM   2546  C CB  . SER B 1 37  ? 59.166  32.187  62.219  1.00 83.59 ? 35  SER B CB  1 
ATOM   2547  O OG  . SER B 1 37  ? 59.355  30.786  62.316  1.00 83.59 ? 35  SER B OG  1 
ATOM   2548  N N   . VAL B 1 38  ? 57.994  31.856  59.221  1.00 56.56 ? 36  VAL B N   1 
ATOM   2549  C CA  . VAL B 1 38  ? 57.857  30.999  58.045  1.00 56.56 ? 36  VAL B CA  1 
ATOM   2550  C C   . VAL B 1 38  ? 57.722  29.511  58.375  1.00 56.56 ? 36  VAL B C   1 
ATOM   2551  O O   . VAL B 1 38  ? 56.629  28.948  58.334  1.00 56.56 ? 36  VAL B O   1 
ATOM   2552  C CB  . VAL B 1 38  ? 59.066  31.181  57.110  1.00 38.21 ? 36  VAL B CB  1 
ATOM   2553  C CG1 . VAL B 1 38  ? 58.915  30.304  55.882  1.00 38.21 ? 36  VAL B CG1 1 
ATOM   2554  C CG2 . VAL B 1 38  ? 59.201  32.655  56.723  1.00 38.21 ? 36  VAL B CG2 1 
ATOM   2555  N N   . GLY B 1 39  ? 58.843  28.882  58.702  1.00 56.44 ? 37  GLY B N   1 
ATOM   2556  C CA  . GLY B 1 39  ? 58.841  27.466  59.033  1.00 56.44 ? 37  GLY B CA  1 
ATOM   2557  C C   . GLY B 1 39  ? 57.651  27.014  59.850  1.00 56.44 ? 37  GLY B C   1 
ATOM   2558  O O   . GLY B 1 39  ? 57.079  25.960  59.564  1.00 56.44 ? 37  GLY B O   1 
ATOM   2559  N N   . THR B 1 40  ? 57.295  27.809  60.863  1.00 39.07 ? 38  THR B N   1 
ATOM   2560  C CA  . THR B 1 40  ? 56.159  27.532  61.748  1.00 39.07 ? 38  THR B CA  1 
ATOM   2561  C C   . THR B 1 40  ? 54.841  27.544  60.975  1.00 39.07 ? 38  THR B C   1 
ATOM   2562  O O   . THR B 1 40  ? 54.068  26.567  60.960  1.00 39.07 ? 38  THR B O   1 
ATOM   2563  C CB  . THR B 1 40  ? 56.009  28.611  62.799  1.00 46.75 ? 38  THR B CB  1 
ATOM   2564  O OG1 . THR B 1 40  ? 57.260  28.824  63.448  1.00 46.75 ? 38  THR B OG1 1 
ATOM   2565  C CG2 . THR B 1 40  ? 54.956  28.207  63.803  1.00 46.75 ? 38  THR B CG2 1 
ATOM   2566  N N   . MET B 1 41  ? 54.599  28.694  60.351  1.00 52.38 ? 39  MET B N   1 
ATOM   2567  C CA  . MET B 1 41  ? 53.403  28.937  59.572  1.00 52.38 ? 39  MET B CA  1 
ATOM   2568  C C   . MET B 1 41  ? 53.161  27.802  58.604  1.00 52.38 ? 39  MET B C   1 
ATOM   2569  O O   . MET B 1 41  ? 52.021  27.460  58.319  1.00 52.38 ? 39  MET B O   1 
ATOM   2570  C CB  . MET B 1 41  ? 53.547  30.251  58.816  1.00 50.51 ? 39  MET B CB  1 
ATOM   2571  C CG  . MET B 1 41  ? 52.255  30.746  58.218  1.00 50.51 ? 39  MET B CG  1 
ATOM   2572  S SD  . MET B 1 41  ? 50.961  30.981  59.456  1.00 50.51 ? 39  MET B SD  1 
ATOM   2573  C CE  . MET B 1 41  ? 49.888  29.664  59.085  1.00 50.51 ? 39  MET B CE  1 
ATOM   2574  N N   . GLY B 1 42  ? 54.240  27.216  58.102  1.00 59.78 ? 40  GLY B N   1 
ATOM   2575  C CA  . GLY B 1 42  ? 54.106  26.113  57.172  1.00 59.78 ? 40  GLY B CA  1 
ATOM   2576  C C   . GLY B 1 42  ? 53.593  24.867  57.870  1.00 59.78 ? 40  GLY B C   1 
ATOM   2577  O O   . GLY B 1 42  ? 52.798  24.097  57.318  1.00 59.78 ? 40  GLY B O   1 
ATOM   2578  N N   . ASN B 1 43  ? 54.060  24.665  59.094  1.00 65.75 ? 41  ASN B N   1 
ATOM   2579  C CA  . ASN B 1 43  ? 53.641  23.515  59.872  1.00 65.75 ? 41  ASN B CA  1 
ATOM   2580  C C   . ASN B 1 43  ? 52.142  23.630  60.072  1.00 65.75 ? 41  ASN B C   1 
ATOM   2581  O O   . ASN B 1 43  ? 51.425  22.635  60.052  1.00 65.75 ? 41  ASN B O   1 
ATOM   2582  C CB  . ASN B 1 43  ? 54.368  23.504  61.216  1.00 66.44 ? 41  ASN B CB  1 
ATOM   2583  C CG  . ASN B 1 43  ? 55.867  23.300  61.064  1.00 66.44 ? 41  ASN B CG  1 
ATOM   2584  O OD1 . ASN B 1 43  ? 56.320  22.232  60.653  1.00 66.44 ? 41  ASN B OD1 1 
ATOM   2585  N ND2 . ASN B 1 43  ? 56.641  24.325  61.388  1.00 66.44 ? 41  ASN B ND2 1 
ATOM   2586  N N   . ARG B 1 44  ? 51.679  24.864  60.250  1.00 69.17 ? 42  ARG B N   1 
ATOM   2587  C CA  . ARG B 1 44  ? 50.258  25.144  60.438  1.00 69.17 ? 42  ARG B CA  1 
ATOM   2588  C C   . ARG B 1 44  ? 49.501  24.752  59.175  1.00 69.17 ? 42  ARG B C   1 
ATOM   2589  O O   . ARG B 1 44  ? 48.624  23.888  59.200  1.00 69.17 ? 42  ARG B O   1 
ATOM   2590  C CB  . ARG B 1 44  ? 50.056  26.634  60.706  1.00 61.39 ? 42  ARG B CB  1 
ATOM   2591  C CG  . ARG B 1 44  ? 50.761  27.143  61.940  1.00 61.39 ? 42  ARG B CG  1 
ATOM   2592  C CD  . ARG B 1 44  ? 49.932  26.948  63.195  1.00 61.39 ? 42  ARG B CD  1 
ATOM   2593  N NE  . ARG B 1 44  ? 50.718  27.255  64.383  1.00 61.39 ? 42  ARG B NE  1 
ATOM   2594  C CZ  . ARG B 1 44  ? 51.708  26.488  64.829  1.00 61.39 ? 42  ARG B CZ  1 
ATOM   2595  N NH1 . ARG B 1 44  ? 52.025  25.365  64.187  1.00 61.39 ? 42  ARG B NH1 1 
ATOM   2596  N NH2 . ARG B 1 44  ? 52.386  26.850  65.908  1.00 61.39 ? 42  ARG B NH2 1 
ATOM   2597  N N   . LEU B 1 45  ? 49.854  25.405  58.072  1.00 59.94 ? 43  LEU B N   1 
ATOM   2598  C CA  . LEU B 1 45  ? 49.230  25.138  56.788  1.00 59.94 ? 43  LEU B CA  1 
ATOM   2599  C C   . LEU B 1 45  ? 49.347  23.660  56.472  1.00 59.94 ? 43  LEU B C   1 
ATOM   2600  O O   . LEU B 1 45  ? 48.431  23.052  55.921  1.00 59.94 ? 43  LEU B O   1 
ATOM   2601  C CB  . LEU B 1 45  ? 49.906  25.958  55.689  1.00 45.68 ? 43  LEU B CB  1 
ATOM   2602  C CG  . LEU B 1 45  ? 49.776  27.465  55.890  1.00 45.68 ? 43  LEU B CG  1 
ATOM   2603  C CD1 . LEU B 1 45  ? 50.542  28.188  54.804  1.00 45.68 ? 43  LEU B CD1 1 
ATOM   2604  C CD2 . LEU B 1 45  ? 48.301  27.861  55.879  1.00 45.68 ? 43  LEU B CD2 1 
ATOM   2605  N N   . GLN B 1 46  ? 50.476  23.074  56.836  1.00 49.24 ? 44  GLN B N   1 
ATOM   2606  C CA  . GLN B 1 46  ? 50.687  21.666  56.576  1.00 49.24 ? 44  GLN B CA  1 
ATOM   2607  C C   . GLN B 1 46  ? 49.586  20.810  57.203  1.00 49.24 ? 44  GLN B C   1 
ATOM   2608  O O   . GLN B 1 46  ? 49.223  19.771  56.658  1.00 49.24 ? 44  GLN B O   1 
ATOM   2609  C CB  . GLN B 1 46  ? 52.053  21.256  57.107  1.00 65.92 ? 44  GLN B CB  1 
ATOM   2610  C CG  . GLN B 1 46  ? 52.479  19.862  56.723  1.00 65.92 ? 44  GLN B CG  1 
ATOM   2611  C CD  . GLN B 1 46  ? 53.930  19.623  57.044  1.00 65.92 ? 44  GLN B CD  1 
ATOM   2612  O OE1 . GLN B 1 46  ? 54.353  19.766  58.188  1.00 65.92 ? 44  GLN B OE1 1 
ATOM   2613  N NE2 . GLN B 1 46  ? 54.707  19.268  56.034  1.00 65.92 ? 44  GLN B NE2 1 
ATOM   2614  N N   . ARG B 1 47  ? 49.047  21.250  58.338  1.00 62.48 ? 45  ARG B N   1 
ATOM   2615  C CA  . ARG B 1 47  ? 47.991  20.494  59.010  1.00 62.48 ? 45  ARG B CA  1 
ATOM   2616  C C   . ARG B 1 47  ? 46.672  20.605  58.245  1.00 62.48 ? 45  ARG B C   1 
ATOM   2617  O O   . ARG B 1 47  ? 45.779  19.776  58.400  1.00 62.48 ? 45  ARG B O   1 
ATOM   2618  C CB  . ARG B 1 47  ? 47.819  20.973  60.464  1.00 72.36 ? 45  ARG B CB  1 
ATOM   2619  C CG  . ARG B 1 47  ? 47.910  19.842  61.506  1.00 72.36 ? 45  ARG B CG  1 
ATOM   2620  C CD  . ARG B 1 47  ? 48.332  20.329  62.911  1.00 72.36 ? 45  ARG B CD  1 
ATOM   2621  N NE  . ARG B 1 47  ? 49.517  21.201  62.884  1.00 72.36 ? 45  ARG B NE  1 
ATOM   2622  C CZ  . ARG B 1 47  ? 50.344  21.404  63.911  1.00 72.36 ? 45  ARG B CZ  1 
ATOM   2623  N NH1 . ARG B 1 47  ? 50.128  20.787  65.065  1.00 72.36 ? 45  ARG B NH1 1 
ATOM   2624  N NH2 . ARG B 1 47  ? 51.379  22.235  63.788  1.00 72.36 ? 45  ARG B NH2 1 
ATOM   2625  N N   . ILE B 1 48  ? 46.550  21.630  57.413  1.00 46.31 ? 46  ILE B N   1 
ATOM   2626  C CA  . ILE B 1 48  ? 45.343  21.805  56.622  1.00 46.31 ? 46  ILE B CA  1 
ATOM   2627  C C   . ILE B 1 48  ? 45.699  21.384  55.211  1.00 46.31 ? 46  ILE B C   1 
ATOM   2628  O O   . ILE B 1 48  ? 45.002  21.715  54.251  1.00 46.31 ? 46  ILE B O   1 
ATOM   2629  C CB  . ILE B 1 48  ? 44.855  23.274  56.624  1.00 35.67 ? 46  ILE B CB  1 
ATOM   2630  C CG1 . ILE B 1 48  ? 45.903  24.189  55.997  1.00 35.67 ? 46  ILE B CG1 1 
ATOM   2631  C CG2 . ILE B 1 48  ? 44.574  23.717  58.040  1.00 35.67 ? 46  ILE B CG2 1 
ATOM   2632  C CD1 . ILE B 1 48  ? 45.559  25.662  56.055  1.00 35.67 ? 46  ILE B CD1 1 
ATOM   2633  N N   . LYS B 1 49  ? 46.806  20.652  55.111  1.00 45.30 ? 47  LYS B N   1 
ATOM   2634  C CA  . LYS B 1 49  ? 47.302  20.137  53.842  1.00 45.30 ? 47  LYS B CA  1 
ATOM   2635  C C   . LYS B 1 49  ? 47.511  21.242  52.817  1.00 45.30 ? 47  LYS B C   1 
ATOM   2636  O O   . LYS B 1 49  ? 47.290  21.046  51.629  1.00 45.30 ? 47  LYS B O   1 
ATOM   2637  C CB  . LYS B 1 49  ? 46.321  19.102  53.289  1.00 58.66 ? 47  LYS B CB  1 
ATOM   2638  C CG  . LYS B 1 49  ? 45.975  18.005  54.275  1.00 58.66 ? 47  LYS B CG  1 
ATOM   2639  C CD  . LYS B 1 49  ? 44.478  17.939  54.567  1.00 58.66 ? 47  LYS B CD  1 
ATOM   2640  C CE  . LYS B 1 49  ? 43.679  17.516  53.343  1.00 58.66 ? 47  LYS B CE  1 
ATOM   2641  N NZ  . LYS B 1 49  ? 42.297  17.078  53.710  1.00 58.66 ? 47  LYS B NZ  1 
ATOM   2642  N N   . VAL B 1 50  ? 47.942  22.410  53.268  1.00 70.92 ? 48  VAL B N   1 
ATOM   2643  C CA  . VAL B 1 50  ? 48.157  23.512  52.346  1.00 70.92 ? 48  VAL B CA  1 
ATOM   2644  C C   . VAL B 1 50  ? 49.627  23.868  52.143  1.00 70.92 ? 48  VAL B C   1 
ATOM   2645  O O   . VAL B 1 50  ? 50.345  24.193  53.096  1.00 70.92 ? 48  VAL B O   1 
ATOM   2646  C CB  . VAL B 1 50  ? 47.392  24.770  52.803  1.00 45.05 ? 48  VAL B CB  1 
ATOM   2647  C CG1 . VAL B 1 50  ? 47.814  25.979  51.970  1.00 45.05 ? 48  VAL B CG1 1 
ATOM   2648  C CG2 . VAL B 1 50  ? 45.891  24.526  52.677  1.00 45.05 ? 48  VAL B CG2 1 
ATOM   2649  N N   . GLU B 1 51  ? 50.052  23.799  50.881  1.00 48.27 ? 49  GLU B N   1 
ATOM   2650  C CA  . GLU B 1 51  ? 51.414  24.118  50.475  1.00 48.27 ? 49  GLU B CA  1 
ATOM   2651  C C   . GLU B 1 51  ? 51.853  25.399  51.163  1.00 48.27 ? 49  GLU B C   1 
ATOM   2652  O O   . GLU B 1 51  ? 51.037  26.287  51.401  1.00 48.27 ? 49  GLU B O   1 
ATOM   2653  C CB  . GLU B 1 51  ? 51.460  24.320  48.961  1.00 92.42 ? 49  GLU B CB  1 
ATOM   2654  C CG  . GLU B 1 51  ? 52.861  24.398  48.387  1.00 92.42 ? 49  GLU B CG  1 
ATOM   2655  C CD  . GLU B 1 51  ? 53.627  23.099  48.570  1.00 92.42 ? 49  GLU B CD  1 
ATOM   2656  O OE1 . GLU B 1 51  ? 54.038  22.796  49.718  1.00 92.42 ? 49  GLU B OE1 1 
ATOM   2657  O OE2 . GLU B 1 51  ? 53.801  22.374  47.563  1.00 92.42 ? 49  GLU B OE2 1 
ATOM   2658  N N   . ASN B 1 52  ? 53.135  25.499  51.486  1.00 46.70 ? 50  ASN B N   1 
ATOM   2659  C CA  . ASN B 1 52  ? 53.641  26.691  52.148  1.00 46.70 ? 50  ASN B CA  1 
ATOM   2660  C C   . ASN B 1 52  ? 54.171  27.647  51.091  1.00 46.70 ? 50  ASN B C   1 
ATOM   2661  O O   . ASN B 1 52  ? 55.145  27.353  50.418  1.00 46.70 ? 50  ASN B O   1 
ATOM   2662  C CB  . ASN B 1 52  ? 54.748  26.313  53.130  1.00 56.56 ? 50  ASN B CB  1 
ATOM   2663  C CG  . ASN B 1 52  ? 55.156  27.466  54.023  1.00 56.56 ? 50  ASN B CG  1 
ATOM   2664  O OD1 . ASN B 1 52  ? 55.996  27.301  54.903  1.00 56.56 ? 50  ASN B OD1 1 
ATOM   2665  N ND2 . ASN B 1 52  ? 54.566  28.639  53.804  1.00 56.56 ? 50  ASN B ND2 1 
ATOM   2666  N N   . THR B 1 53  ? 53.515  28.792  50.950  1.00 40.07 ? 51  THR B N   1 
ATOM   2667  C CA  . THR B 1 53  ? 53.890  29.797  49.957  1.00 40.07 ? 51  THR B CA  1 
ATOM   2668  C C   . THR B 1 53  ? 53.853  31.194  50.558  1.00 40.07 ? 51  THR B C   1 
ATOM   2669  O O   . THR B 1 53  ? 53.016  31.485  51.406  1.00 40.07 ? 51  THR B O   1 
ATOM   2670  C CB  . THR B 1 53  ? 52.915  29.774  48.759  1.00 48.50 ? 51  THR B CB  1 
ATOM   2671  O OG1 . THR B 1 53  ? 53.017  28.519  48.072  1.00 48.50 ? 51  THR B OG1 1 
ATOM   2672  C CG2 . THR B 1 53  ? 53.219  30.919  47.804  1.00 48.50 ? 51  THR B CG2 1 
ATOM   2673  N N   . GLU B 1 54  ? 54.753  32.062  50.114  1.00 44.76 ? 52  GLU B N   1 
ATOM   2674  C CA  . GLU B 1 54  ? 54.777  33.420  50.633  1.00 44.76 ? 52  GLU B CA  1 
ATOM   2675  C C   . GLU B 1 54  ? 53.372  33.979  50.506  1.00 44.76 ? 52  GLU B C   1 
ATOM   2676  O O   . GLU B 1 54  ? 52.920  34.745  51.361  1.00 44.76 ? 52  GLU B O   1 
ATOM   2677  C CB  . GLU B 1 54  ? 55.731  34.291  49.830  1.00 73.14 ? 52  GLU B CB  1 
ATOM   2678  C CG  . GLU B 1 54  ? 56.154  35.536  50.564  1.00 73.14 ? 52  GLU B CG  1 
ATOM   2679  C CD  . GLU B 1 54  ? 56.145  36.758  49.682  1.00 73.14 ? 52  GLU B CD  1 
ATOM   2680  O OE1 . GLU B 1 54  ? 56.597  36.664  48.523  1.00 73.14 ? 52  GLU B OE1 1 
ATOM   2681  O OE2 . GLU B 1 54  ? 55.694  37.819  50.156  1.00 73.14 ? 52  GLU B OE2 1 
ATOM   2682  N N   . GLU B 1 55  ? 52.688  33.567  49.438  1.00 63.23 ? 53  GLU B N   1 
ATOM   2683  C CA  . GLU B 1 55  ? 51.326  33.998  49.144  1.00 63.23 ? 53  GLU B CA  1 
ATOM   2684  C C   . GLU B 1 55  ? 50.280  33.339  50.046  1.00 63.23 ? 53  GLU B C   1 
ATOM   2685  O O   . GLU B 1 55  ? 49.498  34.039  50.694  1.00 63.23 ? 53  GLU B O   1 
ATOM   2686  C CB  . GLU B 1 55  ? 51.005  33.709  47.681  1.00 35.88 ? 53  GLU B CB  1 
ATOM   2687  C CG  . GLU B 1 55  ? 49.576  34.044  47.250  1.00 35.88 ? 53  GLU B CG  1 
ATOM   2688  C CD  . GLU B 1 55  ? 49.303  35.531  47.152  1.00 35.88 ? 53  GLU B CD  1 
ATOM   2689  O OE1 . GLU B 1 55  ? 50.260  36.328  47.239  1.00 35.88 ? 53  GLU B OE1 1 
ATOM   2690  O OE2 . GLU B 1 55  ? 48.124  35.898  46.975  1.00 35.88 ? 53  GLU B OE2 1 
ATOM   2691  N N   . ASN B 1 56  ? 50.253  32.007  50.094  1.00 37.91 ? 54  ASN B N   1 
ATOM   2692  C CA  . ASN B 1 56  ? 49.283  31.323  50.947  1.00 37.91 ? 54  ASN B CA  1 
ATOM   2693  C C   . ASN B 1 56  ? 49.263  32.009  52.301  1.00 37.91 ? 54  ASN B C   1 
ATOM   2694  O O   . ASN B 1 56  ? 48.200  32.273  52.860  1.00 37.91 ? 54  ASN B O   1 
ATOM   2695  C CB  . ASN B 1 56  ? 49.647  29.858  51.111  1.00 54.29 ? 54  ASN B CB  1 
ATOM   2696  C CG  . ASN B 1 56  ? 49.829  29.179  49.793  1.00 54.29 ? 54  ASN B CG  1 
ATOM   2697  O OD1 . ASN B 1 56  ? 49.208  29.558  48.805  1.00 54.29 ? 54  ASN B OD1 1 
ATOM   2698  N ND2 . ASN B 1 56  ? 50.675  28.162  49.758  1.00 54.29 ? 54  ASN B ND2 1 
ATOM   2699  N N   . ARG B 1 57  ? 50.447  32.301  52.826  1.00 36.03 ? 55  ARG B N   1 
ATOM   2700  C CA  . ARG B 1 57  ? 50.549  32.997  54.092  1.00 36.03 ? 55  ARG B CA  1 
ATOM   2701  C C   . ARG B 1 57  ? 49.852  34.348  53.928  1.00 36.03 ? 55  ARG B C   1 
ATOM   2702  O O   . ARG B 1 57  ? 48.871  34.634  54.617  1.00 36.03 ? 55  ARG B O   1 
ATOM   2703  C CB  . ARG B 1 57  ? 52.017  33.195  54.467  1.00 44.03 ? 55  ARG B CB  1 
ATOM   2704  C CG  . ARG B 1 57  ? 52.787  31.889  54.656  1.00 44.03 ? 55  ARG B CG  1 
ATOM   2705  C CD  . ARG B 1 57  ? 54.030  32.108  55.519  1.00 44.03 ? 55  ARG B CD  1 
ATOM   2706  N NE  . ARG B 1 57  ? 55.035  32.924  54.846  1.00 44.03 ? 55  ARG B NE  1 
ATOM   2707  C CZ  . ARG B 1 57  ? 55.923  32.444  53.983  1.00 44.03 ? 55  ARG B CZ  1 
ATOM   2708  N NH1 . ARG B 1 57  ? 55.932  31.148  53.698  1.00 44.03 ? 55  ARG B NH1 1 
ATOM   2709  N NH2 . ARG B 1 57  ? 56.784  33.260  53.391  1.00 44.03 ? 55  ARG B NH2 1 
ATOM   2710  N N   . ARG B 1 58  ? 50.333  35.162  52.990  1.00 31.85 ? 56  ARG B N   1 
ATOM   2711  C CA  . ARG B 1 58  ? 49.751  36.488  52.754  1.00 31.85 ? 56  ARG B CA  1 
ATOM   2712  C C   . ARG B 1 58  ? 48.237  36.477  52.677  1.00 31.85 ? 56  ARG B C   1 
ATOM   2713  O O   . ARG B 1 58  ? 47.578  37.379  53.182  1.00 31.85 ? 56  ARG B O   1 
ATOM   2714  C CB  . ARG B 1 58  ? 50.280  37.104  51.457  1.00 42.62 ? 56  ARG B CB  1 
ATOM   2715  C CG  . ARG B 1 58  ? 50.017  38.600  51.324  1.00 42.62 ? 56  ARG B CG  1 
ATOM   2716  C CD  . ARG B 1 58  ? 50.174  39.068  49.879  1.00 42.62 ? 56  ARG B CD  1 
ATOM   2717  N NE  . ARG B 1 58  ? 49.117  38.512  49.045  1.00 42.62 ? 56  ARG B NE  1 
ATOM   2718  C CZ  . ARG B 1 58  ? 47.834  38.812  49.196  1.00 42.62 ? 56  ARG B CZ  1 
ATOM   2719  N NH1 . ARG B 1 58  ? 47.469  39.667  50.137  1.00 42.62 ? 56  ARG B NH1 1 
ATOM   2720  N NH2 . ARG B 1 58  ? 46.912  38.239  48.435  1.00 42.62 ? 56  ARG B NH2 1 
ATOM   2721  N N   . GLN B 1 59  ? 47.682  35.459  52.038  1.00 49.62 ? 57  GLN B N   1 
ATOM   2722  C CA  . GLN B 1 59  ? 46.237  35.391  51.899  1.00 49.62 ? 57  GLN B CA  1 
ATOM   2723  C C   . GLN B 1 59  ? 45.583  35.110  53.233  1.00 49.62 ? 57  GLN B C   1 
ATOM   2724  O O   . GLN B 1 59  ? 44.864  35.950  53.762  1.00 49.62 ? 57  GLN B O   1 
ATOM   2725  C CB  . GLN B 1 59  ? 45.839  34.313  50.890  1.00 86.44 ? 57  GLN B CB  1 
ATOM   2726  C CG  . GLN B 1 59  ? 44.510  34.567  50.197  1.00 86.44 ? 57  GLN B CG  1 
ATOM   2727  C CD  . GLN B 1 59  ? 44.276  33.597  49.056  1.00 86.44 ? 57  GLN B CD  1 
ATOM   2728  O OE1 . GLN B 1 59  ? 43.783  32.482  49.255  1.00 86.44 ? 57  GLN B OE1 1 
ATOM   2729  N NE2 . GLN B 1 59  ? 44.653  34.009  47.847  1.00 86.44 ? 57  GLN B NE2 1 
ATOM   2730  N N   . PHE B 1 60  ? 45.832  33.930  53.787  1.00 42.57 ? 58  PHE B N   1 
ATOM   2731  C CA  . PHE B 1 60  ? 45.220  33.590  55.058  1.00 42.57 ? 58  PHE B CA  1 
ATOM   2732  C C   . PHE B 1 60  ? 45.229  34.799  55.978  1.00 42.57 ? 58  PHE B C   1 
ATOM   2733  O O   . PHE B 1 60  ? 44.177  35.289  56.382  1.00 42.57 ? 58  PHE B O   1 
ATOM   2734  C CB  . PHE B 1 60  ? 45.940  32.418  55.729  1.00 30.41 ? 58  PHE B CB  1 
ATOM   2735  C CG  . PHE B 1 60  ? 45.300  31.991  57.012  1.00 30.41 ? 58  PHE B CG  1 
ATOM   2736  C CD1 . PHE B 1 60  ? 43.959  31.631  57.041  1.00 30.41 ? 58  PHE B CD1 1 
ATOM   2737  C CD2 . PHE B 1 60  ? 46.018  31.977  58.196  1.00 30.41 ? 58  PHE B CD2 1 
ATOM   2738  C CE1 . PHE B 1 60  ? 43.337  31.264  58.234  1.00 30.41 ? 58  PHE B CE1 1 
ATOM   2739  C CE2 . PHE B 1 60  ? 45.405  31.610  59.403  1.00 30.41 ? 58  PHE B CE2 1 
ATOM   2740  C CZ  . PHE B 1 60  ? 44.061  31.255  59.419  1.00 30.41 ? 58  PHE B CZ  1 
ATOM   2741  N N   . ARG B 1 61  ? 46.417  35.301  56.278  1.00 51.68 ? 59  ARG B N   1 
ATOM   2742  C CA  . ARG B 1 61  ? 46.521  36.447  57.165  1.00 51.68 ? 59  ARG B CA  1 
ATOM   2743  C C   . ARG B 1 61  ? 45.769  37.661  56.638  1.00 51.68 ? 59  ARG B C   1 
ATOM   2744  O O   . ARG B 1 61  ? 45.374  38.541  57.408  1.00 51.68 ? 59  ARG B O   1 
ATOM   2745  C CB  . ARG B 1 61  ? 47.992  36.774  57.440  1.00 45.00 ? 59  ARG B CB  1 
ATOM   2746  C CG  . ARG B 1 61  ? 48.712  35.605  58.103  1.00 45.00 ? 59  ARG B CG  1 
ATOM   2747  C CD  . ARG B 1 61  ? 50.087  35.975  58.588  1.00 45.00 ? 59  ARG B CD  1 
ATOM   2748  N NE  . ARG B 1 61  ? 50.912  34.786  58.749  1.00 45.00 ? 59  ARG B NE  1 
ATOM   2749  C CZ  . ARG B 1 61  ? 52.235  34.814  58.795  1.00 45.00 ? 59  ARG B CZ  1 
ATOM   2750  N NH1 . ARG B 1 61  ? 52.873  35.972  58.702  1.00 45.00 ? 59  ARG B NH1 1 
ATOM   2751  N NH2 . ARG B 1 61  ? 52.920  33.685  58.891  1.00 45.00 ? 59  ARG B NH2 1 
ATOM   2752  N N   . GLU B 1 62  ? 45.559  37.708  55.329  1.00 44.23 ? 60  GLU B N   1 
ATOM   2753  C CA  . GLU B 1 62  ? 44.809  38.811  54.750  1.00 44.23 ? 60  GLU B CA  1 
ATOM   2754  C C   . GLU B 1 62  ? 43.367  38.638  55.210  1.00 44.23 ? 60  GLU B C   1 
ATOM   2755  O O   . GLU B 1 62  ? 42.707  39.598  55.612  1.00 44.23 ? 60  GLU B O   1 
ATOM   2756  C CB  . GLU B 1 62  ? 44.862  38.763  53.228  1.00 45.70 ? 60  GLU B CB  1 
ATOM   2757  C CG  . GLU B 1 62  ? 44.105  39.902  52.564  1.00 45.70 ? 60  GLU B CG  1 
ATOM   2758  C CD  . GLU B 1 62  ? 43.902  39.702  51.064  1.00 45.70 ? 60  GLU B CD  1 
ATOM   2759  O OE1 . GLU B 1 62  ? 43.425  40.645  50.407  1.00 45.70 ? 60  GLU B OE1 1 
ATOM   2760  O OE2 . GLU B 1 62  ? 44.206  38.606  50.542  1.00 45.70 ? 60  GLU B OE2 1 
ATOM   2761  N N   . ILE B 1 63  ? 42.895  37.395  55.150  1.00 50.48 ? 61  ILE B N   1 
ATOM   2762  C CA  . ILE B 1 63  ? 41.539  37.063  55.558  1.00 50.48 ? 61  ILE B CA  1 
ATOM   2763  C C   . ILE B 1 63  ? 41.308  37.477  56.993  1.00 50.48 ? 61  ILE B C   1 
ATOM   2764  O O   . ILE B 1 63  ? 40.311  38.130  57.296  1.00 50.48 ? 61  ILE B O   1 
ATOM   2765  C CB  . ILE B 1 63  ? 41.274  35.568  55.479  1.00 14.01 ? 61  ILE B CB  1 
ATOM   2766  C CG1 . ILE B 1 63  ? 41.361  35.105  54.035  1.00 14.01 ? 61  ILE B CG1 1 
ATOM   2767  C CG2 . ILE B 1 63  ? 39.910  35.272  56.068  1.00 14.01 ? 61  ILE B CG2 1 
ATOM   2768  C CD1 . ILE B 1 63  ? 41.269  33.624  53.862  1.00 14.01 ? 61  ILE B CD1 1 
ATOM   2769  N N   . LEU B 1 64  ? 42.219  37.068  57.876  1.00 30.92 ? 62  LEU B N   1 
ATOM   2770  C CA  . LEU B 1 64  ? 42.111  37.416  59.283  1.00 29.79 ? 62  LEU B CA  1 
ATOM   2771  C C   . LEU B 1 64  ? 41.988  38.917  59.391  1.00 35.44 ? 62  LEU B C   1 
ATOM   2772  O O   . LEU B 1 64  ? 40.913  39.419  59.670  1.00 31.48 ? 62  LEU B O   1 
ATOM   2773  C CB  . LEU B 1 64  ? 43.332  36.938  60.068  1.00 30.75 ? 62  LEU B CB  1 
ATOM   2774  C CG  . LEU B 1 64  ? 43.572  35.426  60.044  1.00 39.59 ? 62  LEU B CG  1 
ATOM   2775  C CD1 . LEU B 1 64  ? 44.848  35.102  60.779  1.00 30.76 ? 62  LEU B CD1 1 
ATOM   2776  C CD2 . LEU B 1 64  ? 42.416  34.711  60.684  1.00 32.28 ? 62  LEU B CD2 1 
ATOM   2777  N N   . PHE B 1 65  ? 43.074  39.635  59.132  1.00 32.04 ? 63  PHE B N   1 
ATOM   2778  C CA  . PHE B 1 65  ? 43.062  41.094  59.227  1.00 26.56 ? 63  PHE B CA  1 
ATOM   2779  C C   . PHE B 1 65  ? 41.943  41.790  58.455  1.00 32.58 ? 63  PHE B C   1 
ATOM   2780  O O   . PHE B 1 65  ? 41.638  42.959  58.716  1.00 34.91 ? 63  PHE B O   1 
ATOM   2781  C CB  . PHE B 1 65  ? 44.395  41.673  58.754  1.00 35.38 ? 63  PHE B CB  1 
ATOM   2782  C CG  . PHE B 1 65  ? 45.590  41.074  59.424  1.00 46.95 ? 63  PHE B CG  1 
ATOM   2783  C CD1 . PHE B 1 65  ? 46.820  41.089  58.790  1.00 43.88 ? 63  PHE B CD1 1 
ATOM   2784  C CD2 . PHE B 1 65  ? 45.487  40.480  60.671  1.00 47.16 ? 63  PHE B CD2 1 
ATOM   2785  C CE1 . PHE B 1 65  ? 47.924  40.517  59.383  1.00 38.96 ? 63  PHE B CE1 1 
ATOM   2786  C CE2 . PHE B 1 65  ? 46.592  39.906  61.277  1.00 36.83 ? 63  PHE B CE2 1 
ATOM   2787  C CZ  . PHE B 1 65  ? 47.809  39.922  60.633  1.00 40.45 ? 63  PHE B CZ  1 
ATOM   2788  N N   . SER B 1 66  ? 41.334  41.095  57.502  1.00 13.57 ? 64  SER B N   1 
ATOM   2789  C CA  . SER B 1 66  ? 40.263  41.715  56.717  1.00 21.30 ? 64  SER B CA  1 
ATOM   2790  C C   . SER B 1 66  ? 38.900  41.518  57.350  1.00 26.29 ? 64  SER B C   1 
ATOM   2791  O O   . SER B 1 66  ? 37.907  42.060  56.880  1.00 26.86 ? 64  SER B O   1 
ATOM   2792  C CB  . SER B 1 66  ? 40.229  41.144  55.292  1.00 16.20 ? 64  SER B CB  1 
ATOM   2793  O OG  . SER B 1 66  ? 39.161  40.226  55.142  1.00 28.44 ? 64  SER B OG  1 
ATOM   2794  N N   . VAL B 1 67  ? 38.854  40.731  58.414  1.00 39.06 ? 65  VAL B N   1 
ATOM   2795  C CA  . VAL B 1 67  ? 37.591  40.450  59.066  1.00 31.62 ? 65  VAL B CA  1 
ATOM   2796  C C   . VAL B 1 67  ? 36.935  41.771  59.442  1.00 36.82 ? 65  VAL B C   1 
ATOM   2797  O O   . VAL B 1 67  ? 37.609  42.805  59.492  1.00 29.98 ? 65  VAL B O   1 
ATOM   2798  C CB  . VAL B 1 67  ? 37.798  39.556  60.302  1.00 35.06 ? 65  VAL B CB  1 
ATOM   2799  C CG1 . VAL B 1 67  ? 38.376  40.355  61.456  1.00 26.39 ? 65  VAL B CG1 1 
ATOM   2800  C CG2 . VAL B 1 67  ? 36.499  38.917  60.675  1.00 28.15 ? 65  VAL B CG2 1 
ATOM   2801  N N   . ASP B 1 68  ? 35.620  41.735  59.664  1.00 35.48 ? 66  ASP B N   1 
ATOM   2802  C CA  . ASP B 1 68  ? 34.849  42.921  60.023  1.00 27.60 ? 66  ASP B CA  1 
ATOM   2803  C C   . ASP B 1 68  ? 35.553  43.760  61.082  1.00 29.10 ? 66  ASP B C   1 
ATOM   2804  O O   . ASP B 1 68  ? 36.246  43.225  61.947  1.00 21.48 ? 66  ASP B O   1 
ATOM   2805  C CB  . ASP B 1 68  ? 33.462  42.523  60.538  1.00 15.53 ? 66  ASP B CB  1 
ATOM   2806  C CG  . ASP B 1 68  ? 32.455  42.320  59.423  1.00 33.04 ? 66  ASP B CG  1 
ATOM   2807  O OD1 . ASP B 1 68  ? 31.263  42.120  59.753  1.00 46.08 ? 66  ASP B OD1 1 
ATOM   2808  O OD2 . ASP B 1 68  ? 32.850  42.361  58.234  1.00 53.71 ? 66  ASP B OD2 1 
ATOM   2809  N N   . SER B 1 69  ? 35.361  45.075  61.015  1.00 55.26 ? 67  SER B N   1 
ATOM   2810  C CA  . SER B 1 69  ? 35.989  45.981  61.962  1.00 58.11 ? 67  SER B CA  1 
ATOM   2811  C C   . SER B 1 69  ? 35.503  45.781  63.400  1.00 57.74 ? 67  SER B C   1 
ATOM   2812  O O   . SER B 1 69  ? 36.126  46.293  64.334  1.00 52.44 ? 67  SER B O   1 
ATOM   2813  C CB  . SER B 1 69  ? 35.747  47.426  61.543  1.00 8.99  ? 67  SER B CB  1 
ATOM   2814  O OG  . SER B 1 69  ? 34.429  47.819  61.862  1.00 47.18 ? 67  SER B OG  1 
ATOM   2815  N N   . SER B 1 70  ? 34.403  45.051  63.587  1.00 37.29 ? 68  SER B N   1 
ATOM   2816  C CA  . SER B 1 70  ? 33.895  44.815  64.941  1.00 43.42 ? 68  SER B CA  1 
ATOM   2817  C C   . SER B 1 70  ? 34.859  43.880  65.650  1.00 45.94 ? 68  SER B C   1 
ATOM   2818  O O   . SER B 1 70  ? 34.690  43.569  66.831  1.00 39.89 ? 68  SER B O   1 
ATOM   2819  C CB  . SER B 1 70  ? 32.502  44.187  64.924  1.00 52.69 ? 68  SER B CB  1 
ATOM   2820  O OG  . SER B 1 70  ? 32.563  42.824  64.562  1.00 64.16 ? 68  SER B OG  1 
ATOM   2821  N N   . ILE B 1 71  ? 35.866  43.429  64.906  1.00 17.92 ? 69  ILE B N   1 
ATOM   2822  C CA  . ILE B 1 71  ? 36.898  42.558  65.442  1.00 23.58 ? 69  ILE B CA  1 
ATOM   2823  C C   . ILE B 1 71  ? 37.736  43.385  66.379  1.00 22.49 ? 69  ILE B C   1 
ATOM   2824  O O   . ILE B 1 71  ? 38.545  42.838  67.120  1.00 14.36 ? 69  ILE B O   1 
ATOM   2825  C CB  . ILE B 1 71  ? 37.851  42.088  64.384  1.00 17.64 ? 69  ILE B CB  1 
ATOM   2826  C CG1 . ILE B 1 71  ? 38.736  40.976  64.942  1.00 10.12 ? 69  ILE B CG1 1 
ATOM   2827  C CG2 . ILE B 1 71  ? 38.712  43.246  63.945  1.00 7.24  ? 69  ILE B CG2 1 
ATOM   2828  C CD1 . ILE B 1 71  ? 37.978  39.693  65.281  1.00 17.14 ? 69  ILE B CD1 1 
ATOM   2829  N N   . ASN B 1 72  ? 37.567  44.707  66.310  1.00 16.95 ? 70  ASN B N   1 
ATOM   2830  C CA  . ASN B 1 72  ? 38.315  45.619  67.164  1.00 16.84 ? 70  ASN B CA  1 
ATOM   2831  C C   . ASN B 1 72  ? 37.677  45.815  68.535  1.00 28.63 ? 70  ASN B C   1 
ATOM   2832  O O   . ASN B 1 72  ? 37.978  46.773  69.250  1.00 33.71 ? 70  ASN B O   1 
ATOM   2833  C CB  . ASN B 1 72  ? 38.537  46.979  66.468  1.00 38.64 ? 70  ASN B CB  1 
ATOM   2834  C CG  . ASN B 1 72  ? 37.302  47.863  66.448  1.00 50.83 ? 70  ASN B CG  1 
ATOM   2835  O OD1 . ASN B 1 72  ? 36.516  47.876  67.387  1.00 57.83 ? 70  ASN B OD1 1 
ATOM   2836  N ND2 . ASN B 1 72  ? 37.154  48.643  65.380  1.00 50.99 ? 70  ASN B ND2 1 
ATOM   2837  N N   . GLN B 1 73  ? 36.803  44.889  68.904  1.00 35.65 ? 71  GLN B N   1 
ATOM   2838  C CA  . GLN B 1 73  ? 36.130  44.955  70.185  1.00 40.62 ? 71  GLN B CA  1 
ATOM   2839  C C   . GLN B 1 73  ? 36.626  43.792  71.015  1.00 41.63 ? 71  GLN B C   1 
ATOM   2840  O O   . GLN B 1 73  ? 36.400  43.720  72.221  1.00 39.33 ? 71  GLN B O   1 
ATOM   2841  C CB  . GLN B 1 73  ? 34.616  44.862  69.990  1.00 7.58  ? 71  GLN B CB  1 
ATOM   2842  C CG  . GLN B 1 73  ? 33.925  46.185  69.707  1.00 24.80 ? 71  GLN B CG  1 
ATOM   2843  C CD  . GLN B 1 73  ? 32.443  46.006  69.514  1.00 46.81 ? 71  GLN B CD  1 
ATOM   2844  O OE1 . GLN B 1 73  ? 31.931  44.890  69.565  1.00 41.59 ? 71  GLN B OE1 1 
ATOM   2845  N NE2 . GLN B 1 73  ? 31.742  47.101  69.291  1.00 24.03 ? 71  GLN B NE2 1 
ATOM   2846  N N   . SER B 1 74  ? 37.300  42.867  70.351  1.00 25.92 ? 72  SER B N   1 
ATOM   2847  C CA  . SER B 1 74  ? 37.843  41.708  71.030  1.00 38.39 ? 72  SER B CA  1 
ATOM   2848  C C   . SER B 1 74  ? 39.368  41.729  70.914  1.00 41.05 ? 72  SER B C   1 
ATOM   2849  O O   . SER B 1 74  ? 40.086  41.472  71.885  1.00 37.77 ? 72  SER B O   1 
ATOM   2850  C CB  . SER B 1 74  ? 37.265  40.444  70.409  1.00 35.05 ? 72  SER B CB  1 
ATOM   2851  O OG  . SER B 1 74  ? 35.862  40.402  70.602  1.00 45.09 ? 72  SER B OG  1 
ATOM   2852  N N   . ILE B 1 75  ? 39.856  42.050  69.720  1.00 32.77 ? 73  ILE B N   1 
ATOM   2853  C CA  . ILE B 1 75  ? 41.284  42.121  69.474  1.00 32.77 ? 73  ILE B CA  1 
ATOM   2854  C C   . ILE B 1 75  ? 41.754  43.584  69.558  1.00 32.77 ? 73  ILE B C   1 
ATOM   2855  O O   . ILE B 1 75  ? 41.388  44.425  68.729  1.00 32.77 ? 73  ILE B O   1 
ATOM   2856  C CB  . ILE B 1 75  ? 41.619  41.560  68.095  1.00 25.58 ? 73  ILE B CB  1 
ATOM   2857  C CG1 . ILE B 1 75  ? 40.979  40.181  67.918  1.00 25.58 ? 73  ILE B CG1 1 
ATOM   2858  C CG2 . ILE B 1 75  ? 43.126  41.485  67.936  1.00 25.58 ? 73  ILE B CG2 1 
ATOM   2859  C CD1 . ILE B 1 75  ? 41.446  39.141  68.927  1.00 25.58 ? 73  ILE B CD1 1 
ATOM   2860  N N   . GLY B 1 76  ? 42.571  43.883  70.564  1.00 59.21 ? 74  GLY B N   1 
ATOM   2861  C CA  . GLY B 1 76  ? 43.054  45.238  70.748  1.00 59.21 ? 74  GLY B CA  1 
ATOM   2862  C C   . GLY B 1 76  ? 44.440  45.452  70.198  1.00 59.21 ? 74  GLY B C   1 
ATOM   2863  O O   . GLY B 1 76  ? 44.927  46.579  70.175  1.00 59.21 ? 74  GLY B O   1 
ATOM   2864  N N   . GLY B 1 77  ? 45.072  44.368  69.757  1.00 47.60 ? 75  GLY B N   1 
ATOM   2865  C CA  . GLY B 1 77  ? 46.413  44.447  69.194  1.00 47.60 ? 75  GLY B CA  1 
ATOM   2866  C C   . GLY B 1 77  ? 46.838  43.138  68.546  1.00 47.60 ? 75  GLY B C   1 
ATOM   2867  O O   . GLY B 1 77  ? 46.623  42.063  69.123  1.00 47.60 ? 75  GLY B O   1 
ATOM   2868  N N   . VAL B 1 78  ? 47.440  43.219  67.356  1.00 20.41 ? 76  VAL B N   1 
ATOM   2869  C CA  . VAL B 1 78  ? 47.888  42.026  66.627  1.00 20.41 ? 76  VAL B CA  1 
ATOM   2870  C C   . VAL B 1 78  ? 49.424  42.025  66.422  1.00 20.41 ? 76  VAL B C   1 
ATOM   2871  O O   . VAL B 1 78  ? 49.999  43.040  66.024  1.00 20.41 ? 76  VAL B O   1 
ATOM   2872  C CB  . VAL B 1 78  ? 47.175  41.944  65.235  1.00 26.36 ? 76  VAL B CB  1 
ATOM   2873  C CG1 . VAL B 1 78  ? 47.541  40.656  64.514  1.00 26.36 ? 76  VAL B CG1 1 
ATOM   2874  C CG2 . VAL B 1 78  ? 45.670  42.028  65.412  1.00 26.36 ? 76  VAL B CG2 1 
ATOM   2875  N N   . ILE B 1 79  ? 50.099  40.909  66.714  1.00 40.26 ? 77  ILE B N   1 
ATOM   2876  C CA  . ILE B 1 79  ? 51.551  40.861  66.502  1.00 40.26 ? 77  ILE B CA  1 
ATOM   2877  C C   . ILE B 1 79  ? 51.760  40.381  65.073  1.00 40.26 ? 77  ILE B C   1 
ATOM   2878  O O   . ILE B 1 79  ? 50.905  39.704  64.501  1.00 40.26 ? 77  ILE B O   1 
ATOM   2879  C CB  . ILE B 1 79  ? 52.315  39.875  67.438  1.00 31.20 ? 77  ILE B CB  1 
ATOM   2880  C CG1 . ILE B 1 79  ? 51.773  39.918  68.875  1.00 31.20 ? 77  ILE B CG1 1 
ATOM   2881  C CG2 . ILE B 1 79  ? 53.799  40.257  67.444  1.00 31.20 ? 77  ILE B CG2 1 
ATOM   2882  C CD1 . ILE B 1 79  ? 52.526  39.014  69.867  1.00 31.20 ? 77  ILE B CD1 1 
ATOM   2883  N N   . LEU B 1 80  ? 52.900  40.721  64.496  1.00 28.21 ? 78  LEU B N   1 
ATOM   2884  C CA  . LEU B 1 80  ? 53.164  40.343  63.120  1.00 28.21 ? 78  LEU B CA  1 
ATOM   2885  C C   . LEU B 1 80  ? 54.590  39.869  62.916  1.00 28.21 ? 78  LEU B C   1 
ATOM   2886  O O   . LEU B 1 80  ? 55.512  40.328  63.603  1.00 28.21 ? 78  LEU B O   1 
ATOM   2887  C CB  . LEU B 1 80  ? 52.900  41.543  62.194  1.00 41.60 ? 78  LEU B CB  1 
ATOM   2888  C CG  . LEU B 1 80  ? 51.470  42.089  62.133  1.00 41.60 ? 78  LEU B CG  1 
ATOM   2889  C CD1 . LEU B 1 80  ? 51.370  43.340  61.260  1.00 41.60 ? 78  LEU B CD1 1 
ATOM   2890  C CD2 . LEU B 1 80  ? 50.580  40.971  61.615  1.00 41.60 ? 78  LEU B CD2 1 
ATOM   2891  N N   . PHE B 1 81  ? 54.778  38.951  61.970  1.00 60.28 ? 79  PHE B N   1 
ATOM   2892  C CA  . PHE B 1 81  ? 56.120  38.471  61.680  1.00 60.28 ? 79  PHE B CA  1 
ATOM   2893  C C   . PHE B 1 81  ? 56.748  39.383  60.622  1.00 60.28 ? 79  PHE B C   1 
ATOM   2894  O O   . PHE B 1 81  ? 56.065  39.868  59.723  1.00 60.28 ? 79  PHE B O   1 
ATOM   2895  C CB  . PHE B 1 81  ? 56.091  37.037  61.179  1.00 61.45 ? 79  PHE B CB  1 
ATOM   2896  C CG  . PHE B 1 81  ? 57.430  36.551  60.744  1.00 61.45 ? 79  PHE B CG  1 
ATOM   2897  C CD1 . PHE B 1 81  ? 58.530  36.755  61.570  1.00 61.45 ? 79  PHE B CD1 1 
ATOM   2898  C CD2 . PHE B 1 81  ? 57.626  35.957  59.498  1.00 61.45 ? 79  PHE B CD2 1 
ATOM   2899  C CE1 . PHE B 1 81  ? 59.821  36.390  61.176  1.00 61.45 ? 79  PHE B CE1 1 
ATOM   2900  C CE2 . PHE B 1 81  ? 58.926  35.579  59.083  1.00 61.45 ? 79  PHE B CE2 1 
ATOM   2901  C CZ  . PHE B 1 81  ? 60.025  35.802  59.930  1.00 61.45 ? 79  PHE B CZ  1 
ATOM   2902  N N   . HIS B 1 82  ? 58.049  39.617  60.738  1.00 46.27 ? 80  HIS B N   1 
ATOM   2903  C CA  . HIS B 1 82  ? 58.780  40.495  59.824  1.00 46.27 ? 80  HIS B CA  1 
ATOM   2904  C C   . HIS B 1 82  ? 58.136  40.653  58.422  1.00 46.27 ? 80  HIS B C   1 
ATOM   2905  O O   . HIS B 1 82  ? 57.532  41.692  58.110  1.00 46.27 ? 80  HIS B O   1 
ATOM   2906  C CB  . HIS B 1 82  ? 60.210  39.972  59.701  1.00 92.42 ? 80  HIS B CB  1 
ATOM   2907  C CG  . HIS B 1 82  ? 61.191  41.021  59.302  1.00 92.42 ? 80  HIS B CG  1 
ATOM   2908  N ND1 . HIS B 1 82  ? 62.553  40.850  59.418  1.00 92.42 ? 80  HIS B ND1 1 
ATOM   2909  C CD2 . HIS B 1 82  ? 61.002  42.284  58.853  1.00 92.42 ? 80  HIS B CD2 1 
ATOM   2910  C CE1 . HIS B 1 82  ? 63.161  41.969  59.064  1.00 92.42 ? 80  HIS B CE1 1 
ATOM   2911  N NE2 . HIS B 1 82  ? 62.242  42.855  58.718  1.00 92.42 ? 80  HIS B NE2 1 
ATOM   2912  N N   . GLU B 1 83  ? 58.306  39.629  57.589  1.00 62.34 ? 81  GLU B N   1 
ATOM   2913  C CA  . GLU B 1 83  ? 57.736  39.586  56.250  1.00 62.34 ? 81  GLU B CA  1 
ATOM   2914  C C   . GLU B 1 83  ? 56.376  40.271  56.183  1.00 62.34 ? 81  GLU B C   1 
ATOM   2915  O O   . GLU B 1 83  ? 56.183  41.232  55.449  1.00 62.34 ? 81  GLU B O   1 
ATOM   2916  C CB  . GLU B 1 83  ? 57.586  38.116  55.836  1.00 50.57 ? 81  GLU B CB  1 
ATOM   2917  C CG  . GLU B 1 83  ? 56.359  37.821  54.965  1.00 50.57 ? 81  GLU B CG  1 
ATOM   2918  C CD  . GLU B 1 83  ? 55.939  36.349  54.943  1.00 50.57 ? 81  GLU B CD  1 
ATOM   2919  O OE1 . GLU B 1 83  ? 56.753  35.505  54.504  1.00 50.57 ? 81  GLU B OE1 1 
ATOM   2920  O OE2 . GLU B 1 83  ? 54.790  36.048  55.363  1.00 50.57 ? 81  GLU B OE2 1 
ATOM   2921  N N   . THR B 1 84  ? 55.441  39.725  56.944  1.00 33.13 ? 82  THR B N   1 
ATOM   2922  C CA  . THR B 1 84  ? 54.082  40.190  56.996  1.00 33.13 ? 82  THR B CA  1 
ATOM   2923  C C   . THR B 1 84  ? 53.915  41.659  57.286  1.00 33.13 ? 82  THR B C   1 
ATOM   2924  O O   . THR B 1 84  ? 52.960  42.249  56.815  1.00 33.13 ? 82  THR B O   1 
ATOM   2925  C CB  . THR B 1 84  ? 53.304  39.379  58.018  1.00 41.41 ? 82  THR B CB  1 
ATOM   2926  O OG1 . THR B 1 84  ? 53.006  38.095  57.460  1.00 41.41 ? 82  THR B OG1 1 
ATOM   2927  C CG2 . THR B 1 84  ? 52.027  40.079  58.422  1.00 41.41 ? 82  THR B CG2 1 
ATOM   2928  N N   . LEU B 1 85  ? 54.818  42.271  58.045  1.00 8.29  ? 83  LEU B N   1 
ATOM   2929  C CA  . LEU B 1 85  ? 54.659  43.703  58.345  1.00 8.29  ? 83  LEU B CA  1 
ATOM   2930  C C   . LEU B 1 85  ? 54.661  44.560  57.088  1.00 8.29  ? 83  LEU B C   1 
ATOM   2931  O O   . LEU B 1 85  ? 54.302  45.736  57.115  1.00 8.29  ? 83  LEU B O   1 
ATOM   2932  C CB  . LEU B 1 85  ? 55.760  44.214  59.297  1.00 34.40 ? 83  LEU B CB  1 
ATOM   2933  C CG  . LEU B 1 85  ? 55.838  45.748  59.487  1.00 34.40 ? 83  LEU B CG  1 
ATOM   2934  C CD1 . LEU B 1 85  ? 54.490  46.320  59.891  1.00 34.40 ? 83  LEU B CD1 1 
ATOM   2935  C CD2 . LEU B 1 85  ? 56.874  46.092  60.535  1.00 34.40 ? 83  LEU B CD2 1 
ATOM   2936  N N   . TYR B 1 86  ? 55.045  43.963  55.975  1.00 39.62 ? 84  TYR B N   1 
ATOM   2937  C CA  . TYR B 1 86  ? 55.116  44.726  54.752  1.00 39.62 ? 84  TYR B CA  1 
ATOM   2938  C C   . TYR B 1 86  ? 54.279  44.201  53.599  1.00 39.62 ? 84  TYR B C   1 
ATOM   2939  O O   . TYR B 1 86  ? 54.350  44.733  52.492  1.00 39.62 ? 84  TYR B O   1 
ATOM   2940  C CB  . TYR B 1 86  ? 56.574  44.841  54.322  1.00 33.02 ? 84  TYR B CB  1 
ATOM   2941  C CG  . TYR B 1 86  ? 57.477  45.351  55.424  1.00 33.02 ? 84  TYR B CG  1 
ATOM   2942  C CD1 . TYR B 1 86  ? 58.124  44.466  56.295  1.00 33.02 ? 84  TYR B CD1 1 
ATOM   2943  C CD2 . TYR B 1 86  ? 57.672  46.724  55.607  1.00 33.02 ? 84  TYR B CD2 1 
ATOM   2944  C CE1 . TYR B 1 86  ? 58.944  44.935  57.313  1.00 33.02 ? 84  TYR B CE1 1 
ATOM   2945  C CE2 . TYR B 1 86  ? 58.483  47.202  56.622  1.00 33.02 ? 84  TYR B CE2 1 
ATOM   2946  C CZ  . TYR B 1 86  ? 59.118  46.308  57.467  1.00 33.02 ? 84  TYR B CZ  1 
ATOM   2947  O OH  . TYR B 1 86  ? 59.947  46.798  58.444  1.00 33.02 ? 84  TYR B OH  1 
ATOM   2948  N N   . GLN B 1 87  ? 53.497  43.157  53.839  1.00 64.75 ? 85  GLN B N   1 
ATOM   2949  C CA  . GLN B 1 87  ? 52.656  42.624  52.783  1.00 64.75 ? 85  GLN B CA  1 
ATOM   2950  C C   . GLN B 1 87  ? 51.397  43.469  52.680  1.00 64.75 ? 85  GLN B C   1 
ATOM   2951  O O   . GLN B 1 87  ? 51.010  44.150  53.635  1.00 64.75 ? 85  GLN B O   1 
ATOM   2952  C CB  . GLN B 1 87  ? 52.297  41.169  53.062  1.00 32.79 ? 85  GLN B CB  1 
ATOM   2953  C CG  . GLN B 1 87  ? 53.439  40.220  52.813  1.00 32.79 ? 85  GLN B CG  1 
ATOM   2954  C CD  . GLN B 1 87  ? 53.097  38.795  53.168  1.00 32.79 ? 85  GLN B CD  1 
ATOM   2955  O OE1 . GLN B 1 87  ? 52.877  38.467  54.336  1.00 32.79 ? 85  GLN B OE1 1 
ATOM   2956  N NE2 . GLN B 1 87  ? 53.054  37.935  52.166  1.00 32.79 ? 85  GLN B NE2 1 
ATOM   2957  N N   . LYS B 1 88  ? 50.774  43.427  51.505  1.00 51.66 ? 86  LYS B N   1 
ATOM   2958  C CA  . LYS B 1 88  ? 49.560  44.182  51.237  1.00 51.66 ? 86  LYS B CA  1 
ATOM   2959  C C   . LYS B 1 88  ? 48.432  43.233  50.869  1.00 51.66 ? 86  LYS B C   1 
ATOM   2960  O O   . LYS B 1 88  ? 48.668  42.197  50.238  1.00 51.66 ? 86  LYS B O   1 
ATOM   2961  C CB  . LYS B 1 88  ? 49.779  45.143  50.069  1.00 80.49 ? 86  LYS B CB  1 
ATOM   2962  C CG  . LYS B 1 88  ? 50.914  46.137  50.232  1.00 80.49 ? 86  LYS B CG  1 
ATOM   2963  C CD  . LYS B 1 88  ? 51.105  46.923  48.936  1.00 80.49 ? 86  LYS B CD  1 
ATOM   2964  C CE  . LYS B 1 88  ? 52.328  47.819  48.986  1.00 80.49 ? 86  LYS B CE  1 
ATOM   2965  N NZ  . LYS B 1 88  ? 52.477  48.604  47.731  1.00 80.49 ? 86  LYS B NZ  1 
ATOM   2966  N N   . ASP B 1 89  ? 47.210  43.597  51.254  1.00 36.49 ? 87  ASP B N   1 
ATOM   2967  C CA  . ASP B 1 89  ? 46.040  42.784  50.942  1.00 36.49 ? 87  ASP B CA  1 
ATOM   2968  C C   . ASP B 1 89  ? 45.788  42.781  49.433  1.00 36.49 ? 87  ASP B C   1 
ATOM   2969  O O   . ASP B 1 89  ? 46.418  43.526  48.682  1.00 36.49 ? 87  ASP B O   1 
ATOM   2970  C CB  . ASP B 1 89  ? 44.799  43.309  51.670  1.00 56.75 ? 87  ASP B CB  1 
ATOM   2971  C CG  . ASP B 1 89  ? 44.336  44.645  51.143  1.00 56.75 ? 87  ASP B CG  1 
ATOM   2972  O OD1 . ASP B 1 89  ? 43.249  45.102  51.559  1.00 56.75 ? 87  ASP B OD1 1 
ATOM   2973  O OD2 . ASP B 1 89  ? 45.057  45.240  50.315  1.00 56.75 ? 87  ASP B OD2 1 
ATOM   2974  N N   . SER B 1 90  ? 44.861  41.943  48.993  1.00 34.20 ? 88  SER B N   1 
ATOM   2975  C CA  . SER B 1 90  ? 44.558  41.836  47.575  1.00 34.20 ? 88  SER B CA  1 
ATOM   2976  C C   . SER B 1 90  ? 44.520  43.155  46.802  1.00 34.20 ? 88  SER B C   1 
ATOM   2977  O O   . SER B 1 90  ? 44.860  43.170  45.620  1.00 34.20 ? 88  SER B O   1 
ATOM   2978  C CB  . SER B 1 90  ? 43.245  41.062  47.359  1.00 43.71 ? 88  SER B CB  1 
ATOM   2979  O OG  . SER B 1 90  ? 43.424  39.671  47.582  1.00 43.71 ? 88  SER B OG  1 
ATOM   2980  N N   . GLN B 1 91  ? 44.124  44.259  47.439  1.00 18.90 ? 89  GLN B N   1 
ATOM   2981  C CA  . GLN B 1 91  ? 44.074  45.541  46.723  1.00 18.90 ? 89  GLN B CA  1 
ATOM   2982  C C   . GLN B 1 91  ? 45.269  46.447  46.989  1.00 18.90 ? 89  GLN B C   1 
ATOM   2983  O O   . GLN B 1 91  ? 45.131  47.653  47.096  1.00 18.90 ? 89  GLN B O   1 
ATOM   2984  C CB  . GLN B 1 91  ? 42.776  46.300  47.027  1.00 47.10 ? 89  GLN B CB  1 
ATOM   2985  C CG  . GLN B 1 91  ? 41.542  45.605  46.522  1.00 47.10 ? 89  GLN B CG  1 
ATOM   2986  C CD  . GLN B 1 91  ? 41.350  44.246  47.182  1.00 47.10 ? 89  GLN B CD  1 
ATOM   2987  O OE1 . GLN B 1 91  ? 41.146  44.157  48.389  1.00 47.10 ? 89  GLN B OE1 1 
ATOM   2988  N NE2 . GLN B 1 91  ? 41.426  43.182  46.394  1.00 47.10 ? 89  GLN B NE2 1 
ATOM   2989  N N   . GLY B 1 92  ? 46.450  45.854  47.085  1.00 59.98 ? 90  GLY B N   1 
ATOM   2990  C CA  . GLY B 1 92  ? 47.649  46.640  47.302  1.00 59.98 ? 90  GLY B CA  1 
ATOM   2991  C C   . GLY B 1 92  ? 47.672  47.477  48.562  1.00 59.98 ? 90  GLY B C   1 
ATOM   2992  O O   . GLY B 1 92  ? 48.571  48.299  48.734  1.00 59.98 ? 90  GLY B O   1 
ATOM   2993  N N   . LYS B 1 93  ? 46.693  47.280  49.440  1.00 60.31 ? 91  LYS B N   1 
ATOM   2994  C CA  . LYS B 1 93  ? 46.631  48.023  50.697  1.00 60.31 ? 91  LYS B CA  1 
ATOM   2995  C C   . LYS B 1 93  ? 47.509  47.315  51.730  1.00 60.31 ? 91  LYS B C   1 
ATOM   2996  O O   . LYS B 1 93  ? 47.744  46.115  51.627  1.00 60.31 ? 91  LYS B O   1 
ATOM   2997  C CB  . LYS B 1 93  ? 45.192  48.078  51.194  1.00 49.44 ? 91  LYS B CB  1 
ATOM   2998  C CG  . LYS B 1 93  ? 45.001  48.864  52.466  1.00 49.44 ? 91  LYS B CG  1 
ATOM   2999  C CD  . LYS B 1 93  ? 45.159  50.355  52.232  1.00 49.44 ? 91  LYS B CD  1 
ATOM   3000  C CE  . LYS B 1 93  ? 44.488  51.138  53.364  1.00 49.44 ? 91  LYS B CE  1 
ATOM   3001  N NZ  . LYS B 1 93  ? 44.354  52.587  53.044  1.00 49.44 ? 91  LYS B NZ  1 
ATOM   3002  N N   . LEU B 1 94  ? 47.973  48.043  52.739  1.00 29.33 ? 92  LEU B N   1 
ATOM   3003  C CA  . LEU B 1 94  ? 48.847  47.447  53.747  1.00 29.33 ? 92  LEU B CA  1 
ATOM   3004  C C   . LEU B 1 94  ? 48.225  46.887  55.022  1.00 29.33 ? 92  LEU B C   1 
ATOM   3005  O O   . LEU B 1 94  ? 47.617  47.626  55.795  1.00 29.33 ? 92  LEU B O   1 
ATOM   3006  C CB  . LEU B 1 94  ? 49.925  48.454  54.141  1.00 35.56 ? 92  LEU B CB  1 
ATOM   3007  C CG  . LEU B 1 94  ? 51.198  48.376  53.314  1.00 35.56 ? 92  LEU B CG  1 
ATOM   3008  C CD1 . LEU B 1 94  ? 52.095  49.537  53.670  1.00 35.56 ? 92  LEU B CD1 1 
ATOM   3009  C CD2 . LEU B 1 94  ? 51.880  47.039  53.574  1.00 35.56 ? 92  LEU B CD2 1 
ATOM   3010  N N   . PHE B 1 95  ? 48.401  45.586  55.256  1.00 11.60 ? 93  PHE B N   1 
ATOM   3011  C CA  . PHE B 1 95  ? 47.865  44.984  56.465  1.00 11.60 ? 93  PHE B CA  1 
ATOM   3012  C C   . PHE B 1 95  ? 48.193  45.954  57.583  1.00 11.60 ? 93  PHE B C   1 
ATOM   3013  O O   . PHE B 1 95  ? 47.340  46.326  58.380  1.00 11.60 ? 93  PHE B O   1 
ATOM   3014  C CB  . PHE B 1 95  ? 48.550  43.663  56.789  1.00 32.80 ? 93  PHE B CB  1 
ATOM   3015  C CG  . PHE B 1 95  ? 48.407  42.620  55.735  1.00 32.80 ? 93  PHE B CG  1 
ATOM   3016  C CD1 . PHE B 1 95  ? 47.187  42.391  55.123  1.00 32.80 ? 93  PHE B CD1 1 
ATOM   3017  C CD2 . PHE B 1 95  ? 49.482  41.814  55.397  1.00 32.80 ? 93  PHE B CD2 1 
ATOM   3018  C CE1 . PHE B 1 95  ? 47.035  41.368  54.186  1.00 32.80 ? 93  PHE B CE1 1 
ATOM   3019  C CE2 . PHE B 1 95  ? 49.340  40.790  54.464  1.00 32.80 ? 93  PHE B CE2 1 
ATOM   3020  C CZ  . PHE B 1 95  ? 48.112  40.567  53.858  1.00 32.80 ? 93  PHE B CZ  1 
ATOM   3021  N N   . ARG B 1 96  ? 49.455  46.363  57.619  1.00 47.09 ? 94  ARG B N   1 
ATOM   3022  C CA  . ARG B 1 96  ? 49.925  47.279  58.636  1.00 47.09 ? 94  ARG B CA  1 
ATOM   3023  C C   . ARG B 1 96  ? 48.884  48.356  58.901  1.00 47.09 ? 94  ARG B C   1 
ATOM   3024  O O   . ARG B 1 96  ? 48.369  48.470  60.012  1.00 47.09 ? 94  ARG B O   1 
ATOM   3025  C CB  . ARG B 1 96  ? 51.230  47.919  58.191  1.00 58.79 ? 94  ARG B CB  1 
ATOM   3026  C CG  . ARG B 1 96  ? 51.838  48.849  59.217  1.00 58.79 ? 94  ARG B CG  1 
ATOM   3027  C CD  . ARG B 1 96  ? 52.786  49.827  58.549  1.00 58.79 ? 94  ARG B CD  1 
ATOM   3028  N NE  . ARG B 1 96  ? 53.699  49.152  57.633  1.00 58.79 ? 94  ARG B NE  1 
ATOM   3029  C CZ  . ARG B 1 96  ? 54.424  49.784  56.718  1.00 58.79 ? 94  ARG B CZ  1 
ATOM   3030  N NH1 . ARG B 1 96  ? 54.340  51.105  56.619  1.00 58.79 ? 94  ARG B NH1 1 
ATOM   3031  N NH2 . ARG B 1 96  ? 55.190  49.094  55.875  1.00 58.79 ? 94  ARG B NH2 1 
ATOM   3032  N N   . ASN B 1 97  ? 48.554  49.132  57.878  1.00 43.84 ? 95  ASN B N   1 
ATOM   3033  C CA  . ASN B 1 97  ? 47.575  50.192  58.046  1.00 43.84 ? 95  ASN B CA  1 
ATOM   3034  C C   . ASN B 1 97  ? 46.139  49.696  58.071  1.00 43.84 ? 95  ASN B C   1 
ATOM   3035  O O   . ASN B 1 97  ? 45.259  50.340  58.646  1.00 43.84 ? 95  ASN B O   1 
ATOM   3036  C CB  . ASN B 1 97  ? 47.743  51.250  56.965  1.00 50.07 ? 95  ASN B CB  1 
ATOM   3037  C CG  . ASN B 1 97  ? 49.065  51.964  57.070  1.00 50.07 ? 95  ASN B CG  1 
ATOM   3038  O OD1 . ASN B 1 97  ? 49.492  52.359  58.165  1.00 50.07 ? 95  ASN B OD1 1 
ATOM   3039  N ND2 . ASN B 1 97  ? 49.729  52.139  55.931  1.00 50.07 ? 95  ASN B ND2 1 
ATOM   3040  N N   . ILE B 1 98  ? 45.887  48.554  57.453  1.00 57.50 ? 96  ILE B N   1 
ATOM   3041  C CA  . ILE B 1 98  ? 44.542  48.005  57.470  1.00 57.50 ? 96  ILE B CA  1 
ATOM   3042  C C   . ILE B 1 98  ? 44.131  47.799  58.927  1.00 57.50 ? 96  ILE B C   1 
ATOM   3043  O O   . ILE B 1 98  ? 42.974  48.003  59.299  1.00 57.50 ? 96  ILE B O   1 
ATOM   3044  C CB  . ILE B 1 98  ? 44.501  46.674  56.725  1.00 24.04 ? 96  ILE B CB  1 
ATOM   3045  C CG1 . ILE B 1 98  ? 44.273  46.950  55.240  1.00 24.04 ? 96  ILE B CG1 1 
ATOM   3046  C CG2 . ILE B 1 98  ? 43.456  45.754  57.345  1.00 24.04 ? 96  ILE B CG2 1 
ATOM   3047  C CD1 . ILE B 1 98  ? 44.055  45.715  54.406  1.00 24.04 ? 96  ILE B CD1 1 
ATOM   3048  N N   . LEU B 1 99  ? 45.110  47.403  59.735  1.00 22.62 ? 97  LEU B N   1 
ATOM   3049  C CA  . LEU B 1 99  ? 44.937  47.155  61.153  1.00 22.62 ? 97  LEU B CA  1 
ATOM   3050  C C   . LEU B 1 99  ? 44.977  48.458  61.946  1.00 22.62 ? 97  LEU B C   1 
ATOM   3051  O O   . LEU B 1 99  ? 44.255  48.609  62.921  1.00 22.62 ? 97  LEU B O   1 
ATOM   3052  C CB  . LEU B 1 99  ? 46.034  46.207  61.631  1.00 14.96 ? 97  LEU B CB  1 
ATOM   3053  C CG  . LEU B 1 99  ? 45.969  44.786  61.073  1.00 14.96 ? 97  LEU B CG  1 
ATOM   3054  C CD1 . LEU B 1 99  ? 47.203  44.016  61.457  1.00 14.96 ? 97  LEU B CD1 1 
ATOM   3055  C CD2 . LEU B 1 99  ? 44.737  44.100  61.612  1.00 14.96 ? 97  LEU B CD2 1 
ATOM   3056  N N   . LYS B 1 100 ? 45.833  49.393  61.543  1.00 24.61 ? 98  LYS B N   1 
ATOM   3057  C CA  . LYS B 1 100 ? 45.921  50.680  62.234  1.00 24.61 ? 98  LYS B CA  1 
ATOM   3058  C C   . LYS B 1 100 ? 44.585  51.403  62.154  1.00 24.61 ? 98  LYS B C   1 
ATOM   3059  O O   . LYS B 1 100 ? 44.086  51.907  63.152  1.00 24.61 ? 98  LYS B O   1 
ATOM   3060  C CB  . LYS B 1 100 ? 47.006  51.553  61.601  1.00 67.42 ? 98  LYS B CB  1 
ATOM   3061  C CG  . LYS B 1 100 ? 46.852  53.047  61.864  1.00 67.42 ? 98  LYS B CG  1 
ATOM   3062  C CD  . LYS B 1 100 ? 47.960  53.860  61.188  1.00 67.42 ? 98  LYS B CD  1 
ATOM   3063  C CE  . LYS B 1 100 ? 49.346  53.543  61.774  1.00 67.42 ? 98  LYS B CE  1 
ATOM   3064  N NZ  . LYS B 1 100 ? 50.435  54.427  61.243  1.00 67.42 ? 98  LYS B NZ  1 
ATOM   3065  N N   . GLU B 1 101 ? 44.018  51.449  60.952  1.00 34.62 ? 99  GLU B N   1 
ATOM   3066  C CA  . GLU B 1 101 ? 42.741  52.107  60.716  1.00 34.62 ? 99  GLU B CA  1 
ATOM   3067  C C   . GLU B 1 101 ? 41.617  51.335  61.365  1.00 34.62 ? 99  GLU B C   1 
ATOM   3068  O O   . GLU B 1 101 ? 40.634  51.915  61.800  1.00 34.62 ? 99  GLU B O   1 
ATOM   3069  C CB  . GLU B 1 101 ? 42.456  52.209  59.219  1.00 68.01 ? 99  GLU B CB  1 
ATOM   3070  C CG  . GLU B 1 101 ? 43.225  53.289  58.491  1.00 68.01 ? 99  GLU B CG  1 
ATOM   3071  C CD  . GLU B 1 101 ? 43.078  53.192  56.978  1.00 68.01 ? 99  GLU B CD  1 
ATOM   3072  O OE1 . GLU B 1 101 ? 41.928  53.072  56.494  1.00 68.01 ? 99  GLU B OE1 1 
ATOM   3073  O OE2 . GLU B 1 101 ? 44.115  53.241  56.275  1.00 68.01 ? 99  GLU B OE2 1 
ATOM   3074  N N   . LYS B 1 102 ? 41.759  50.018  61.428  1.00 42.56 ? 100 LYS B N   1 
ATOM   3075  C CA  . LYS B 1 102 ? 40.712  49.190  62.003  1.00 42.56 ? 100 LYS B CA  1 
ATOM   3076  C C   . LYS B 1 102 ? 40.788  49.178  63.511  1.00 42.56 ? 100 LYS B C   1 
ATOM   3077  O O   . LYS B 1 102 ? 40.423  48.184  64.137  1.00 42.56 ? 100 LYS B O   1 
ATOM   3078  C CB  . LYS B 1 102 ? 40.815  47.753  61.479  1.00 42.41 ? 100 LYS B CB  1 
ATOM   3079  C CG  . LYS B 1 102 ? 39.537  46.943  61.636  1.00 42.41 ? 100 LYS B CG  1 
ATOM   3080  C CD  . LYS B 1 102 ? 39.654  45.564  61.005  1.00 42.41 ? 100 LYS B CD  1 
ATOM   3081  C CE  . LYS B 1 102 ? 39.996  45.615  59.504  1.00 42.41 ? 100 LYS B CE  1 
ATOM   3082  N NZ  . LYS B 1 102 ? 38.914  46.156  58.622  1.00 42.41 ? 100 LYS B NZ  1 
ATOM   3083  N N   . GLY B 1 103 ? 41.264  50.270  64.101  1.00 49.61 ? 101 GLY B N   1 
ATOM   3084  C CA  . GLY B 1 103 ? 41.370  50.317  65.550  1.00 49.61 ? 101 GLY B CA  1 
ATOM   3085  C C   . GLY B 1 103 ? 42.561  49.568  66.150  1.00 49.61 ? 101 GLY B C   1 
ATOM   3086  O O   . GLY B 1 103 ? 43.352  50.152  66.897  1.00 49.61 ? 101 GLY B O   1 
ATOM   3087  N N   . ILE B 1 104 ? 42.689  48.279  65.836  1.00 41.37 ? 102 ILE B N   1 
ATOM   3088  C CA  . ILE B 1 104 ? 43.784  47.443  66.337  1.00 41.37 ? 102 ILE B CA  1 
ATOM   3089  C C   . ILE B 1 104 ? 45.162  48.107  66.281  1.00 41.37 ? 102 ILE B C   1 
ATOM   3090  O O   . ILE B 1 104 ? 45.430  48.905  65.383  1.00 41.37 ? 102 ILE B O   1 
ATOM   3091  C CB  . ILE B 1 104 ? 43.871  46.133  65.539  1.00 28.05 ? 102 ILE B CB  1 
ATOM   3092  C CG1 . ILE B 1 104 ? 42.534  45.391  65.625  1.00 28.05 ? 102 ILE B CG1 1 
ATOM   3093  C CG2 . ILE B 1 104 ? 45.021  45.280  66.057  1.00 28.05 ? 102 ILE B CG2 1 
ATOM   3094  C CD1 . ILE B 1 104 ? 41.906  45.082  64.265  1.00 28.05 ? 102 ILE B CD1 1 
ATOM   3095  N N   . VAL B 1 105 ? 46.024  47.776  67.247  1.00 46.37 ? 103 VAL B N   1 
ATOM   3096  C CA  . VAL B 1 105 ? 47.392  48.301  67.305  1.00 46.37 ? 103 VAL B CA  1 
ATOM   3097  C C   . VAL B 1 105 ? 48.312  47.231  66.734  1.00 46.37 ? 103 VAL B C   1 
ATOM   3098  O O   . VAL B 1 105 ? 48.134  46.040  67.018  1.00 46.37 ? 103 VAL B O   1 
ATOM   3099  C CB  . VAL B 1 105 ? 47.852  48.581  68.739  1.00 66.54 ? 103 VAL B CB  1 
ATOM   3100  C CG1 . VAL B 1 105 ? 49.190  49.308  68.713  1.00 66.54 ? 103 VAL B CG1 1 
ATOM   3101  C CG2 . VAL B 1 105 ? 46.801  49.382  69.474  1.00 66.54 ? 103 VAL B CG2 1 
ATOM   3102  N N   . VAL B 1 106 ? 49.299  47.651  65.945  1.00 43.98 ? 104 VAL B N   1 
ATOM   3103  C CA  . VAL B 1 106 ? 50.213  46.701  65.322  1.00 43.98 ? 104 VAL B CA  1 
ATOM   3104  C C   . VAL B 1 106 ? 51.442  46.427  66.167  1.00 43.98 ? 104 VAL B C   1 
ATOM   3105  O O   . VAL B 1 106 ? 52.047  47.344  66.720  1.00 43.98 ? 104 VAL B O   1 
ATOM   3106  C CB  . VAL B 1 106 ? 50.673  47.191  63.925  1.00 41.45 ? 104 VAL B CB  1 
ATOM   3107  C CG1 . VAL B 1 106 ? 51.328  46.056  63.155  1.00 41.45 ? 104 VAL B CG1 1 
ATOM   3108  C CG2 . VAL B 1 106 ? 49.492  47.724  63.152  1.00 41.45 ? 104 VAL B CG2 1 
ATOM   3109  N N   . GLY B 1 107 ? 51.804  45.153  66.260  1.00 52.10 ? 105 GLY B N   1 
ATOM   3110  C CA  . GLY B 1 107 ? 52.970  44.769  67.027  1.00 52.10 ? 105 GLY B CA  1 
ATOM   3111  C C   . GLY B 1 107 ? 53.879  43.883  66.201  1.00 52.10 ? 105 GLY B C   1 
ATOM   3112  O O   . GLY B 1 107 ? 53.392  42.996  65.509  1.00 52.10 ? 105 GLY B O   1 
ATOM   3113  N N   . ILE B 1 108 ? 55.189  44.123  66.273  1.00 44.92 ? 106 ILE B N   1 
ATOM   3114  C CA  . ILE B 1 108 ? 56.187  43.347  65.527  1.00 37.32 ? 106 ILE B CA  1 
ATOM   3115  C C   . ILE B 1 108 ? 56.934  42.358  66.415  1.00 44.17 ? 106 ILE B C   1 
ATOM   3116  O O   . ILE B 1 108 ? 57.029  42.555  67.624  1.00 46.90 ? 106 ILE B O   1 
ATOM   3117  C CB  . ILE B 1 108 ? 57.257  44.256  64.928  1.00 70.44 ? 106 ILE B CB  1 
ATOM   3118  C CG1 . ILE B 1 108 ? 58.242  43.443  64.084  1.00 65.77 ? 106 ILE B CG1 1 
ATOM   3119  C CG2 . ILE B 1 108 ? 58.029  44.921  66.044  1.00 59.84 ? 106 ILE B CG2 1 
ATOM   3120  C CD1 . ILE B 1 108 ? 57.684  42.969  62.752  1.00 71.01 ? 106 ILE B CD1 1 
ATOM   3121  N N   . LYS B 1 109 ? 57.459  41.296  65.811  1.00 50.00 ? 107 LYS B N   1 
ATOM   3122  C CA  . LYS B 1 109 ? 58.249  40.311  66.548  1.00 52.18 ? 107 LYS B CA  1 
ATOM   3123  C C   . LYS B 1 109 ? 59.701  40.665  66.277  1.00 53.05 ? 107 LYS B C   1 
ATOM   3124  O O   . LYS B 1 109 ? 60.159  40.541  65.144  1.00 51.45 ? 107 LYS B O   1 
ATOM   3125  C CB  . LYS B 1 109 ? 57.996  38.893  66.040  1.00 21.40 ? 107 LYS B CB  1 
ATOM   3126  C CG  . LYS B 1 109 ? 59.105  37.928  66.401  1.00 23.10 ? 107 LYS B CG  1 
ATOM   3127  C CD  . LYS B 1 109 ? 58.879  36.551  65.808  1.00 23.26 ? 107 LYS B CD  1 
ATOM   3128  C CE  . LYS B 1 109 ? 57.760  35.787  66.511  1.00 31.52 ? 107 LYS B CE  1 
ATOM   3129  N NZ  . LYS B 1 109 ? 57.822  34.311  66.253  1.00 58.54 ? 107 LYS B NZ  1 
ATOM   3130  N N   . LEU B 1 110 ? 60.433  41.085  67.304  1.00 80.09 ? 108 LEU B N   1 
ATOM   3131  C CA  . LEU B 1 110 ? 61.824  41.480  67.117  1.00 80.09 ? 108 LEU B CA  1 
ATOM   3132  C C   . LEU B 1 110 ? 62.836  40.364  66.887  1.00 80.09 ? 108 LEU B C   1 
ATOM   3133  O O   . LEU B 1 110 ? 63.800  40.559  66.146  1.00 80.09 ? 108 LEU B O   1 
ATOM   3134  C CB  . LEU B 1 110 ? 62.284  42.332  68.289  1.00 16.59 ? 108 LEU B CB  1 
ATOM   3135  C CG  . LEU B 1 110 ? 61.427  43.553  68.594  1.00 28.68 ? 108 LEU B CG  1 
ATOM   3136  C CD1 . LEU B 1 110 ? 62.149  44.437  69.574  1.00 18.28 ? 108 LEU B CD1 1 
ATOM   3137  C CD2 . LEU B 1 110 ? 61.161  44.316  67.336  1.00 22.70 ? 108 LEU B CD2 1 
ATOM   3138  N N   . ASP B 1 111 ? 62.640  39.208  67.519  1.00 48.84 ? 109 ASP B N   1 
ATOM   3139  C CA  . ASP B 1 111 ? 63.569  38.096  67.339  1.00 49.02 ? 109 ASP B CA  1 
ATOM   3140  C C   . ASP B 1 111 ? 63.104  37.149  66.238  1.00 45.35 ? 109 ASP B C   1 
ATOM   3141  O O   . ASP B 1 111 ? 63.261  37.431  65.049  1.00 53.61 ? 109 ASP B O   1 
ATOM   3142  C CB  . ASP B 1 111 ? 63.735  37.319  68.646  1.00 92.42 ? 109 ASP B CB  1 
ATOM   3143  C CG  . ASP B 1 111 ? 62.478  36.581  69.053  1.00 92.42 ? 109 ASP B CG  1 
ATOM   3144  O OD1 . ASP B 1 111 ? 62.015  35.703  68.289  1.00 92.42 ? 109 ASP B OD1 1 
ATOM   3145  O OD2 . ASP B 1 111 ? 61.958  36.878  70.149  1.00 92.42 ? 109 ASP B OD2 1 
ATOM   3146  N N   . ASP B 1 130 ? 71.863  44.046  70.433  1.00 75.94 ? 128 ASP B N   1 
ATOM   3147  C CA  . ASP B 1 130 ? 72.900  44.312  69.439  1.00 75.94 ? 128 ASP B CA  1 
ATOM   3148  C C   . ASP B 1 130 ? 72.260  44.614  68.099  1.00 75.94 ? 128 ASP B C   1 
ATOM   3149  O O   . ASP B 1 130 ? 72.060  43.712  67.283  1.00 75.94 ? 128 ASP B O   1 
ATOM   3150  C CB  . ASP B 1 130 ? 73.833  43.104  69.289  1.00 92.42 ? 128 ASP B CB  1 
ATOM   3151  C CG  . ASP B 1 130 ? 74.927  43.330  68.246  1.00 92.42 ? 128 ASP B CG  1 
ATOM   3152  O OD1 . ASP B 1 130 ? 75.684  44.321  68.374  1.00 92.42 ? 128 ASP B OD1 1 
ATOM   3153  O OD2 . ASP B 1 130 ? 75.030  42.513  67.303  1.00 92.42 ? 128 ASP B OD2 1 
ATOM   3154  N N   . GLY B 1 131 ? 71.957  45.888  67.868  1.00 92.42 ? 129 GLY B N   1 
ATOM   3155  C CA  . GLY B 1 131 ? 71.316  46.275  66.624  1.00 92.42 ? 129 GLY B CA  1 
ATOM   3156  C C   . GLY B 1 131 ? 69.834  46.458  66.885  1.00 92.42 ? 129 GLY B C   1 
ATOM   3157  O O   . GLY B 1 131 ? 69.108  47.054  66.093  1.00 92.42 ? 129 GLY B O   1 
ATOM   3158  N N   . LEU B 1 132 ? 69.396  45.937  68.023  1.00 51.26 ? 130 LEU B N   1 
ATOM   3159  C CA  . LEU B 1 132 ? 68.013  46.014  68.437  1.00 52.27 ? 130 LEU B CA  1 
ATOM   3160  C C   . LEU B 1 132 ? 67.546  47.467  68.471  1.00 45.91 ? 130 LEU B C   1 
ATOM   3161  O O   . LEU B 1 132 ? 66.768  47.887  67.626  1.00 48.36 ? 130 LEU B O   1 
ATOM   3162  C CB  . LEU B 1 132 ? 67.872  45.356  69.813  1.00 67.23 ? 130 LEU B CB  1 
ATOM   3163  C CG  . LEU B 1 132 ? 66.502  45.119  70.448  1.00 69.51 ? 130 LEU B CG  1 
ATOM   3164  C CD1 . LEU B 1 132 ? 65.584  44.429  69.471  1.00 55.45 ? 130 LEU B CD1 1 
ATOM   3165  C CD2 . LEU B 1 132 ? 66.678  44.270  71.693  1.00 61.04 ? 130 LEU B CD2 1 
ATOM   3166  N N   . SER B 1 133 ? 68.036  48.250  69.420  1.00 40.68 ? 131 SER B N   1 
ATOM   3167  C CA  . SER B 1 133 ? 67.597  49.633  69.518  1.00 40.68 ? 131 SER B CA  1 
ATOM   3168  C C   . SER B 1 133 ? 67.547  50.351  68.178  1.00 40.68 ? 131 SER B C   1 
ATOM   3169  O O   . SER B 1 133 ? 66.823  51.338  68.030  1.00 40.68 ? 131 SER B O   1 
ATOM   3170  C CB  . SER B 1 133 ? 68.475  50.420  70.496  1.00 65.20 ? 131 SER B CB  1 
ATOM   3171  O OG  . SER B 1 133 ? 69.824  50.445  70.074  1.00 65.20 ? 131 SER B OG  1 
ATOM   3172  N N   . GLU B 1 134 ? 68.304  49.870  67.196  1.00 65.50 ? 132 GLU B N   1 
ATOM   3173  C CA  . GLU B 1 134 ? 68.286  50.525  65.892  1.00 65.50 ? 132 GLU B CA  1 
ATOM   3174  C C   . GLU B 1 134 ? 67.048  50.069  65.131  1.00 65.50 ? 132 GLU B C   1 
ATOM   3175  O O   . GLU B 1 134 ? 66.327  50.888  64.569  1.00 65.50 ? 132 GLU B O   1 
ATOM   3176  C CB  . GLU B 1 134 ? 69.567  50.210  65.093  1.00 92.42 ? 132 GLU B CB  1 
ATOM   3177  C CG  . GLU B 1 134 ? 70.874  50.746  65.726  1.00 92.42 ? 132 GLU B CG  1 
ATOM   3178  C CD  . GLU B 1 134 ? 71.433  49.862  66.862  1.00 92.42 ? 132 GLU B CD  1 
ATOM   3179  O OE1 . GLU B 1 134 ? 71.978  48.778  66.565  1.00 92.42 ? 132 GLU B OE1 1 
ATOM   3180  O OE2 . GLU B 1 134 ? 71.335  50.248  68.051  1.00 92.42 ? 132 GLU B OE2 1 
ATOM   3181  N N   . ARG B 1 135 ? 66.795  48.762  65.146  1.00 77.66 ? 133 ARG B N   1 
ATOM   3182  C CA  . ARG B 1 135 ? 65.643  48.171  64.464  1.00 77.66 ? 133 ARG B CA  1 
ATOM   3183  C C   . ARG B 1 135 ? 64.343  48.755  64.990  1.00 77.66 ? 133 ARG B C   1 
ATOM   3184  O O   . ARG B 1 135 ? 63.465  49.145  64.222  1.00 77.66 ? 133 ARG B O   1 
ATOM   3185  C CB  . ARG B 1 135 ? 65.606  46.667  64.694  1.00 76.74 ? 133 ARG B CB  1 
ATOM   3186  C CG  . ARG B 1 135 ? 66.952  46.014  64.651  1.00 76.74 ? 133 ARG B CG  1 
ATOM   3187  C CD  . ARG B 1 135 ? 66.851  44.566  65.051  1.00 76.74 ? 133 ARG B CD  1 
ATOM   3188  N NE  . ARG B 1 135 ? 65.997  43.819  64.135  1.00 76.74 ? 133 ARG B NE  1 
ATOM   3189  C CZ  . ARG B 1 135 ? 65.803  42.505  64.202  1.00 76.74 ? 133 ARG B CZ  1 
ATOM   3190  N NH1 . ARG B 1 135 ? 66.405  41.792  65.146  1.00 76.74 ? 133 ARG B NH1 1 
ATOM   3191  N NH2 . ARG B 1 135 ? 65.014  41.903  63.319  1.00 76.74 ? 133 ARG B NH2 1 
ATOM   3192  N N   . CYS B 1 136 ? 64.223  48.789  66.312  1.00 83.52 ? 134 CYS B N   1 
ATOM   3193  C CA  . CYS B 1 136 ? 63.033  49.315  66.956  1.00 83.52 ? 134 CYS B CA  1 
ATOM   3194  C C   . CYS B 1 136 ? 62.616  50.654  66.370  1.00 83.52 ? 134 CYS B C   1 
ATOM   3195  O O   . CYS B 1 136 ? 61.564  50.761  65.747  1.00 83.52 ? 134 CYS B O   1 
ATOM   3196  C CB  . CYS B 1 136 ? 63.263  49.450  68.463  1.00 51.12 ? 134 CYS B CB  1 
ATOM   3197  S SG  . CYS B 1 136 ? 63.313  47.875  69.333  1.00 51.12 ? 134 CYS B SG  1 
ATOM   3198  N N   . ALA B 1 137 ? 63.436  51.676  66.562  1.00 55.13 ? 135 ALA B N   1 
ATOM   3199  C CA  . ALA B 1 137 ? 63.108  52.990  66.034  1.00 55.13 ? 135 ALA B CA  1 
ATOM   3200  C C   . ALA B 1 137 ? 62.521  52.872  64.623  1.00 55.13 ? 135 ALA B C   1 
ATOM   3201  O O   . ALA B 1 137 ? 61.600  53.611  64.252  1.00 55.13 ? 135 ALA B O   1 
ATOM   3202  C CB  . ALA B 1 137 ? 64.353  53.862  66.014  1.00 92.42 ? 135 ALA B CB  1 
ATOM   3203  N N   . GLN B 1 138 ? 63.050  51.931  63.844  1.00 64.82 ? 136 GLN B N   1 
ATOM   3204  C CA  . GLN B 1 138 ? 62.574  51.727  62.484  1.00 64.82 ? 136 GLN B CA  1 
ATOM   3205  C C   . GLN B 1 138 ? 61.161  51.151  62.486  1.00 64.82 ? 136 GLN B C   1 
ATOM   3206  O O   . GLN B 1 138 ? 60.261  51.706  61.862  1.00 64.82 ? 136 GLN B O   1 
ATOM   3207  C CB  . GLN B 1 138 ? 63.523  50.801  61.720  1.00 92.42 ? 136 GLN B CB  1 
ATOM   3208  C CG  . GLN B 1 138 ? 63.292  50.821  60.219  1.00 92.42 ? 136 GLN B CG  1 
ATOM   3209  C CD  . GLN B 1 138 ? 63.416  52.222  59.616  1.00 92.42 ? 136 GLN B CD  1 
ATOM   3210  O OE1 . GLN B 1 138 ? 62.985  52.461  58.489  1.00 92.42 ? 136 GLN B OE1 1 
ATOM   3211  N NE2 . GLN B 1 138 ? 64.012  53.148  60.362  1.00 92.42 ? 136 GLN B NE2 1 
ATOM   3212  N N   . TYR B 1 139 ? 60.972  50.038  63.187  1.00 45.68 ? 137 TYR B N   1 
ATOM   3213  C CA  . TYR B 1 139 ? 59.662  49.403  63.288  1.00 45.68 ? 137 TYR B CA  1 
ATOM   3214  C C   . TYR B 1 139 ? 58.655  50.383  63.903  1.00 45.68 ? 137 TYR B C   1 
ATOM   3215  O O   . TYR B 1 139 ? 57.445  50.215  63.776  1.00 45.68 ? 137 TYR B O   1 
ATOM   3216  C CB  . TYR B 1 139 ? 59.745  48.160  64.172  1.00 35.86 ? 137 TYR B CB  1 
ATOM   3217  C CG  . TYR B 1 139 ? 60.419  46.947  63.568  1.00 35.86 ? 137 TYR B CG  1 
ATOM   3218  C CD1 . TYR B 1 139 ? 59.814  46.222  62.538  1.00 35.86 ? 137 TYR B CD1 1 
ATOM   3219  C CD2 . TYR B 1 139 ? 61.602  46.448  64.111  1.00 35.86 ? 137 TYR B CD2 1 
ATOM   3220  C CE1 . TYR B 1 139 ? 60.365  45.014  62.076  1.00 35.86 ? 137 TYR B CE1 1 
ATOM   3221  C CE2 . TYR B 1 139 ? 62.160  45.246  63.657  1.00 35.86 ? 137 TYR B CE2 1 
ATOM   3222  C CZ  . TYR B 1 139 ? 61.534  44.531  62.646  1.00 35.86 ? 137 TYR B CZ  1 
ATOM   3223  O OH  . TYR B 1 139 ? 62.053  43.319  62.243  1.00 35.86 ? 137 TYR B OH  1 
ATOM   3224  N N   . LYS B 1 140 ? 59.166  51.399  64.589  1.00 49.64 ? 138 LYS B N   1 
ATOM   3225  C CA  . LYS B 1 140 ? 58.320  52.408  65.218  1.00 49.64 ? 138 LYS B CA  1 
ATOM   3226  C C   . LYS B 1 140 ? 57.873  53.357  64.128  1.00 49.64 ? 138 LYS B C   1 
ATOM   3227  O O   . LYS B 1 140 ? 56.730  53.801  64.104  1.00 49.64 ? 138 LYS B O   1 
ATOM   3228  C CB  . LYS B 1 140 ? 59.105  53.177  66.278  1.00 63.40 ? 138 LYS B CB  1 
ATOM   3229  C CG  . LYS B 1 140 ? 58.379  54.378  66.844  1.00 63.40 ? 138 LYS B CG  1 
ATOM   3230  C CD  . LYS B 1 140 ? 57.242  53.986  67.764  1.00 63.40 ? 138 LYS B CD  1 
ATOM   3231  C CE  . LYS B 1 140 ? 56.662  55.234  68.433  1.00 63.40 ? 138 LYS B CE  1 
ATOM   3232  N NZ  . LYS B 1 140 ? 55.593  54.947  69.435  1.00 63.40 ? 138 LYS B NZ  1 
ATOM   3233  N N   . LYS B 1 141 ? 58.797  53.665  63.228  1.00 36.55 ? 139 LYS B N   1 
ATOM   3234  C CA  . LYS B 1 141 ? 58.518  54.540  62.097  1.00 36.55 ? 139 LYS B CA  1 
ATOM   3235  C C   . LYS B 1 141 ? 57.472  53.889  61.199  1.00 36.55 ? 139 LYS B C   1 
ATOM   3236  O O   . LYS B 1 141 ? 56.685  54.570  60.553  1.00 36.55 ? 139 LYS B O   1 
ATOM   3237  C CB  . LYS B 1 141 ? 59.785  54.766  61.263  1.00 92.42 ? 139 LYS B CB  1 
ATOM   3238  C CG  . LYS B 1 141 ? 60.716  55.871  61.735  1.00 92.42 ? 139 LYS B CG  1 
ATOM   3239  C CD  . LYS B 1 141 ? 61.912  55.967  60.787  1.00 92.42 ? 139 LYS B CD  1 
ATOM   3240  C CE  . LYS B 1 141 ? 62.687  57.273  60.950  1.00 92.42 ? 139 LYS B CE  1 
ATOM   3241  N NZ  . LYS B 1 141 ? 63.312  57.427  62.295  1.00 92.42 ? 139 LYS B NZ  1 
ATOM   3242  N N   . ASP B 1 142 ? 57.469  52.563  61.166  1.00 61.40 ? 140 ASP B N   1 
ATOM   3243  C CA  . ASP B 1 142 ? 56.545  51.833  60.316  1.00 61.40 ? 140 ASP B CA  1 
ATOM   3244  C C   . ASP B 1 142 ? 55.137  51.643  60.851  1.00 61.40 ? 140 ASP B C   1 
ATOM   3245  O O   . ASP B 1 142 ? 54.248  51.254  60.103  1.00 61.40 ? 140 ASP B O   1 
ATOM   3246  C CB  . ASP B 1 142 ? 57.156  50.489  59.944  1.00 44.90 ? 140 ASP B CB  1 
ATOM   3247  C CG  . ASP B 1 142 ? 58.416  50.649  59.120  1.00 44.90 ? 140 ASP B CG  1 
ATOM   3248  O OD1 . ASP B 1 142 ? 59.010  51.750  59.174  1.00 44.90 ? 140 ASP B OD1 1 
ATOM   3249  O OD2 . ASP B 1 142 ? 58.819  49.684  58.433  1.00 44.90 ? 140 ASP B OD2 1 
ATOM   3250  N N   . GLY B 1 143 ? 54.917  51.926  62.128  1.00 92.42 ? 141 GLY B N   1 
ATOM   3251  C CA  . GLY B 1 143 ? 53.580  51.771  62.669  1.00 92.42 ? 141 GLY B CA  1 
ATOM   3252  C C   . GLY B 1 143 ? 53.454  50.726  63.763  1.00 92.42 ? 141 GLY B C   1 
ATOM   3253  O O   . GLY B 1 143 ? 52.343  50.445  64.225  1.00 92.42 ? 141 GLY B O   1 
ATOM   3254  N N   . VAL B 1 144 ? 54.578  50.143  64.176  1.00 41.84 ? 142 VAL B N   1 
ATOM   3255  C CA  . VAL B 1 144 ? 54.565  49.143  65.235  1.00 41.84 ? 142 VAL B CA  1 
ATOM   3256  C C   . VAL B 1 144 ? 54.735  49.894  66.539  1.00 41.84 ? 142 VAL B C   1 
ATOM   3257  O O   . VAL B 1 144 ? 55.614  50.750  66.638  1.00 41.84 ? 142 VAL B O   1 
ATOM   3258  C CB  . VAL B 1 144 ? 55.732  48.167  65.108  1.00 16.41 ? 142 VAL B CB  1 
ATOM   3259  C CG1 . VAL B 1 144 ? 55.508  46.986  66.033  1.00 16.41 ? 142 VAL B CG1 1 
ATOM   3260  C CG2 . VAL B 1 144 ? 55.877  47.709  63.675  1.00 16.41 ? 142 VAL B CG2 1 
ATOM   3261  N N   . ASP B 1 145 ? 53.904  49.586  67.533  1.00 54.27 ? 143 ASP B N   1 
ATOM   3262  C CA  . ASP B 1 145 ? 53.994  50.269  68.816  1.00 54.27 ? 143 ASP B CA  1 
ATOM   3263  C C   . ASP B 1 145 ? 54.260  49.349  69.998  1.00 54.27 ? 143 ASP B C   1 
ATOM   3264  O O   . ASP B 1 145 ? 54.045  49.734  71.153  1.00 54.27 ? 143 ASP B O   1 
ATOM   3265  C CB  . ASP B 1 145 ? 52.736  51.107  69.067  1.00 55.34 ? 143 ASP B CB  1 
ATOM   3266  C CG  . ASP B 1 145 ? 52.721  52.393  68.252  1.00 55.34 ? 143 ASP B CG  1 
ATOM   3267  O OD1 . ASP B 1 145 ? 53.720  53.138  68.296  1.00 55.34 ? 143 ASP B OD1 1 
ATOM   3268  O OD2 . ASP B 1 145 ? 51.715  52.670  67.570  1.00 55.34 ? 143 ASP B OD2 1 
ATOM   3269  N N   . PHE B 1 146 ? 54.731  48.139  69.705  1.00 57.12 ? 144 PHE B N   1 
ATOM   3270  C CA  . PHE B 1 146 ? 55.069  47.164  70.740  1.00 57.12 ? 144 PHE B CA  1 
ATOM   3271  C C   . PHE B 1 146 ? 55.652  45.927  70.081  1.00 57.12 ? 144 PHE B C   1 
ATOM   3272  O O   . PHE B 1 146 ? 55.216  45.545  68.995  1.00 57.12 ? 144 PHE B O   1 
ATOM   3273  C CB  . PHE B 1 146 ? 53.841  46.830  71.612  1.00 32.59 ? 144 PHE B CB  1 
ATOM   3274  C CG  . PHE B 1 146 ? 52.960  45.727  71.083  1.00 32.59 ? 144 PHE B CG  1 
ATOM   3275  C CD1 . PHE B 1 146 ? 53.301  44.388  71.263  1.00 32.59 ? 144 PHE B CD1 1 
ATOM   3276  C CD2 . PHE B 1 146 ? 51.751  46.024  70.472  1.00 32.59 ? 144 PHE B CD2 1 
ATOM   3277  C CE1 . PHE B 1 146 ? 52.444  43.366  70.847  1.00 32.59 ? 144 PHE B CE1 1 
ATOM   3278  C CE2 . PHE B 1 146 ? 50.895  45.006  70.054  1.00 32.59 ? 144 PHE B CE2 1 
ATOM   3279  C CZ  . PHE B 1 146 ? 51.243  43.677  70.244  1.00 32.59 ? 144 PHE B CZ  1 
ATOM   3280  N N   . GLY B 1 147 ? 56.649  45.318  70.728  1.00 17.41 ? 145 GLY B N   1 
ATOM   3281  C CA  . GLY B 1 147 ? 57.300  44.145  70.159  1.00 8.91  ? 145 GLY B CA  1 
ATOM   3282  C C   . GLY B 1 147 ? 57.436  42.966  71.092  1.00 15.50 ? 145 GLY B C   1 
ATOM   3283  O O   . GLY B 1 147 ? 57.011  43.029  72.238  1.00 16.93 ? 145 GLY B O   1 
ATOM   3284  N N   . LYS B 1 148 ? 58.037  41.890  70.597  1.00 87.61 ? 146 LYS B N   1 
ATOM   3285  C CA  . LYS B 1 148 ? 58.215  40.679  71.387  1.00 87.61 ? 146 LYS B CA  1 
ATOM   3286  C C   . LYS B 1 148 ? 59.585  40.026  71.185  1.00 87.61 ? 146 LYS B C   1 
ATOM   3287  O O   . LYS B 1 148 ? 60.215  40.182  70.136  1.00 87.61 ? 146 LYS B O   1 
ATOM   3288  C CB  . LYS B 1 148 ? 57.107  39.684  71.034  1.00 45.04 ? 146 LYS B CB  1 
ATOM   3289  C CG  . LYS B 1 148 ? 57.315  38.262  71.522  1.00 43.13 ? 146 LYS B CG  1 
ATOM   3290  C CD  . LYS B 1 148 ? 56.213  37.376  70.944  1.00 46.05 ? 146 LYS B CD  1 
ATOM   3291  C CE  . LYS B 1 148 ? 56.535  35.878  70.977  1.00 60.12 ? 146 LYS B CE  1 
ATOM   3292  N NZ  . LYS B 1 148 ? 55.417  35.087  70.363  1.00 54.77 ? 146 LYS B NZ  1 
ATOM   3293  N N   . TRP B 1 149 ? 60.039  39.313  72.212  1.00 58.81 ? 147 TRP B N   1 
ATOM   3294  C CA  . TRP B 1 149 ? 61.306  38.592  72.197  1.00 58.81 ? 147 TRP B CA  1 
ATOM   3295  C C   . TRP B 1 149 ? 61.381  37.703  73.420  1.00 58.81 ? 147 TRP B C   1 
ATOM   3296  O O   . TRP B 1 149 ? 61.469  38.193  74.553  1.00 58.48 ? 147 TRP B O   1 
ATOM   3297  C CB  . TRP B 1 149 ? 62.524  39.534  72.196  1.00 84.93 ? 147 TRP B CB  1 
ATOM   3298  C CG  . TRP B 1 149 ? 63.835  38.857  72.649  1.00 84.93 ? 147 TRP B CG  1 
ATOM   3299  C CD1 . TRP B 1 149 ? 64.017  37.537  72.992  1.00 84.93 ? 147 TRP B CD1 1 
ATOM   3300  C CD2 . TRP B 1 149 ? 65.099  39.491  72.869  1.00 84.93 ? 147 TRP B CD2 1 
ATOM   3301  N NE1 . TRP B 1 149 ? 65.298  37.319  73.418  1.00 84.93 ? 147 TRP B NE1 1 
ATOM   3302  C CE2 . TRP B 1 149 ? 65.989  38.499  73.353  1.00 84.93 ? 147 TRP B CE2 1 
ATOM   3303  C CE3 . TRP B 1 149 ? 65.571  40.800  72.707  1.00 84.93 ? 147 TRP B CE3 1 
ATOM   3304  C CZ2 . TRP B 1 149 ? 67.322  38.779  73.676  1.00 84.93 ? 147 TRP B CZ2 1 
ATOM   3305  C CZ3 . TRP B 1 149 ? 66.902  41.080  73.029  1.00 84.93 ? 147 TRP B CZ3 1 
ATOM   3306  C CH2 . TRP B 1 149 ? 67.760  40.071  73.508  1.00 84.93 ? 147 TRP B CH2 1 
ATOM   3307  N N   . ARG B 1 150 ? 61.367  36.393  73.171  1.00 92.42 ? 148 ARG B N   1 
ATOM   3308  C CA  . ARG B 1 150 ? 61.464  35.382  74.220  1.00 92.42 ? 148 ARG B CA  1 
ATOM   3309  C C   . ARG B 1 150 ? 62.877  34.775  74.195  1.00 92.42 ? 148 ARG B C   1 
ATOM   3310  O O   . ARG B 1 150 ? 63.504  34.678  73.134  1.00 92.42 ? 148 ARG B O   1 
ATOM   3311  C CB  . ARG B 1 150 ? 60.399  34.296  74.008  1.00 92.42 ? 148 ARG B CB  1 
ATOM   3312  C CG  . ARG B 1 150 ? 60.367  33.722  72.606  1.00 92.42 ? 148 ARG B CG  1 
ATOM   3313  C CD  . ARG B 1 150 ? 59.137  32.840  72.384  1.00 92.42 ? 148 ARG B CD  1 
ATOM   3314  N NE  . ARG B 1 150 ? 59.083  32.305  71.017  1.00 92.42 ? 148 ARG B NE  1 
ATOM   3315  C CZ  . ARG B 1 150 ? 58.076  31.583  70.515  1.00 92.42 ? 148 ARG B CZ  1 
ATOM   3316  N NH1 . ARG B 1 150 ? 57.013  31.294  71.260  1.00 92.42 ? 148 ARG B NH1 1 
ATOM   3317  N NH2 . ARG B 1 150 ? 58.131  31.151  69.258  1.00 92.42 ? 148 ARG B NH2 1 
ATOM   3318  N N   . PRO B 1 151 ? 63.402  34.383  75.372  1.00 92.42 ? 149 PRO B N   1 
ATOM   3319  C CA  . PRO B 1 151 ? 64.741  33.787  75.505  1.00 92.42 ? 149 PRO B CA  1 
ATOM   3320  C C   . PRO B 1 151 ? 65.004  32.630  74.536  1.00 92.42 ? 149 PRO B C   1 
ATOM   3321  O O   . PRO B 1 151 ? 65.582  31.606  74.908  1.00 92.42 ? 149 PRO B O   1 
ATOM   3322  C CB  . PRO B 1 151 ? 64.767  33.337  76.964  1.00 92.42 ? 149 PRO B CB  1 
ATOM   3323  C CG  . PRO B 1 151 ? 63.913  34.386  77.649  1.00 92.42 ? 149 PRO B CG  1 
ATOM   3324  C CD  . PRO B 1 151 ? 62.752  34.521  76.693  1.00 92.42 ? 149 PRO B CD  1 
ATOM   3325  N N   . SER B 1 161 ? 67.870  26.567  85.539  1.00 87.04 ? 159 SER B N   1 
ATOM   3326  C CA  . SER B 1 161 ? 68.990  26.795  86.449  1.00 87.04 ? 159 SER B CA  1 
ATOM   3327  C C   . SER B 1 161 ? 68.930  28.178  87.081  1.00 87.04 ? 159 SER B C   1 
ATOM   3328  O O   . SER B 1 161 ? 68.429  29.133  86.481  1.00 87.04 ? 159 SER B O   1 
ATOM   3329  C CB  . SER B 1 161 ? 70.329  26.639  85.716  1.00 89.45 ? 159 SER B CB  1 
ATOM   3330  O OG  . SER B 1 161 ? 71.418  27.013  86.550  1.00 89.45 ? 159 SER B OG  1 
ATOM   3331  N N   . SER B 1 162 ? 69.455  28.273  88.297  1.00 46.31 ? 160 SER B N   1 
ATOM   3332  C CA  . SER B 1 162 ? 69.465  29.525  89.036  1.00 56.75 ? 160 SER B CA  1 
ATOM   3333  C C   . SER B 1 162 ? 70.184  30.571  88.205  1.00 55.82 ? 160 SER B C   1 
ATOM   3334  O O   . SER B 1 162 ? 69.709  31.696  88.039  1.00 61.46 ? 160 SER B O   1 
ATOM   3335  C CB  . SER B 1 162 ? 70.179  29.337  90.376  1.00 75.75 ? 160 SER B CB  1 
ATOM   3336  O OG  . SER B 1 162 ? 69.601  28.280  91.128  1.00 75.75 ? 160 SER B OG  1 
ATOM   3337  N N   . LEU B 1 163 ? 71.335  30.182  87.675  1.00 91.85 ? 161 LEU B N   1 
ATOM   3338  C CA  . LEU B 1 163 ? 72.131  31.079  86.854  1.00 91.85 ? 161 LEU B CA  1 
ATOM   3339  C C   . LEU B 1 163 ? 71.368  31.388  85.570  1.00 91.85 ? 161 LEU B C   1 
ATOM   3340  O O   . LEU B 1 163 ? 71.156  32.557  85.222  1.00 91.85 ? 161 LEU B O   1 
ATOM   3341  C CB  . LEU B 1 163 ? 73.476  30.423  86.533  1.00 92.42 ? 161 LEU B CB  1 
ATOM   3342  C CG  . LEU B 1 163 ? 74.506  31.207  85.711  1.00 92.42 ? 161 LEU B CG  1 
ATOM   3343  C CD1 . LEU B 1 163 ? 74.834  32.529  86.401  1.00 92.42 ? 161 LEU B CD1 1 
ATOM   3344  C CD2 . LEU B 1 163 ? 75.761  30.352  85.541  1.00 92.42 ? 161 LEU B CD2 1 
ATOM   3345  N N   . ALA B 1 164 ? 70.954  30.330  84.877  1.00 55.34 ? 162 ALA B N   1 
ATOM   3346  C CA  . ALA B 1 164 ? 70.204  30.466  83.635  1.00 55.34 ? 162 ALA B CA  1 
ATOM   3347  C C   . ALA B 1 164 ? 69.139  31.541  83.793  1.00 55.34 ? 162 ALA B C   1 
ATOM   3348  O O   . ALA B 1 164 ? 69.236  32.621  83.206  1.00 55.34 ? 162 ALA B O   1 
ATOM   3349  C CB  . ALA B 1 164 ? 69.552  29.140  83.270  1.00 19.58 ? 162 ALA B CB  1 
ATOM   3350  N N   . ILE B 1 165 ? 68.130  31.231  84.605  1.00 61.51 ? 163 ILE B N   1 
ATOM   3351  C CA  . ILE B 1 165 ? 67.021  32.138  84.875  1.00 61.51 ? 163 ILE B CA  1 
ATOM   3352  C C   . ILE B 1 165 ? 67.473  33.587  85.066  1.00 61.51 ? 163 ILE B C   1 
ATOM   3353  O O   . ILE B 1 165 ? 66.759  34.518  84.675  1.00 61.51 ? 163 ILE B O   1 
ATOM   3354  C CB  . ILE B 1 165 ? 66.245  31.672  86.121  1.00 22.33 ? 163 ILE B CB  1 
ATOM   3355  C CG1 . ILE B 1 165 ? 65.762  30.233  85.900  1.00 22.33 ? 163 ILE B CG1 1 
ATOM   3356  C CG2 . ILE B 1 165 ? 65.089  32.632  86.412  1.00 22.33 ? 163 ILE B CG2 1 
ATOM   3357  C CD1 . ILE B 1 165 ? 65.139  29.592  87.105  1.00 22.33 ? 163 ILE B CD1 1 
ATOM   3358  N N   . GLN B 1 166 ? 68.660  33.774  85.654  1.00 40.32 ? 164 GLN B N   1 
ATOM   3359  C CA  . GLN B 1 166 ? 69.195  35.116  85.883  1.00 40.32 ? 164 GLN B CA  1 
ATOM   3360  C C   . GLN B 1 166 ? 69.557  35.799  84.571  1.00 40.32 ? 164 GLN B C   1 
ATOM   3361  O O   . GLN B 1 166 ? 69.215  36.956  84.348  1.00 40.32 ? 164 GLN B O   1 
ATOM   3362  C CB  . GLN B 1 166 ? 70.422  35.071  86.797  1.00 92.42 ? 164 GLN B CB  1 
ATOM   3363  C CG  . GLN B 1 166 ? 70.944  36.465  87.147  1.00 92.42 ? 164 GLN B CG  1 
ATOM   3364  C CD  . GLN B 1 166 ? 72.057  36.461  88.190  1.00 92.42 ? 164 GLN B CD  1 
ATOM   3365  O OE1 . GLN B 1 166 ? 72.652  37.503  88.482  1.00 92.42 ? 164 GLN B OE1 1 
ATOM   3366  N NE2 . GLN B 1 166 ? 72.337  35.292  88.761  1.00 92.42 ? 164 GLN B NE2 1 
ATOM   3367  N N   . GLU B 1 167 ? 70.244  35.081  83.695  1.00 45.94 ? 165 GLU B N   1 
ATOM   3368  C CA  . GLU B 1 167 ? 70.622  35.668  82.412  1.00 45.94 ? 165 GLU B CA  1 
ATOM   3369  C C   . GLU B 1 167 ? 69.350  35.984  81.629  1.00 45.94 ? 165 GLU B C   1 
ATOM   3370  O O   . GLU B 1 167 ? 69.224  37.055  81.021  1.00 45.94 ? 165 GLU B O   1 
ATOM   3371  C CB  . GLU B 1 167 ? 71.520  34.700  81.618  1.00 68.91 ? 165 GLU B CB  1 
ATOM   3372  C CG  . GLU B 1 167 ? 72.898  34.418  82.259  1.00 68.91 ? 165 GLU B CG  1 
ATOM   3373  C CD  . GLU B 1 167 ? 73.890  35.560  82.084  1.00 68.91 ? 165 GLU B CD  1 
ATOM   3374  O OE1 . GLU B 1 167 ? 74.415  35.715  80.965  1.00 68.91 ? 165 GLU B OE1 1 
ATOM   3375  O OE2 . GLU B 1 167 ? 74.141  36.304  83.057  1.00 68.91 ? 165 GLU B OE2 1 
ATOM   3376  N N   . ASN B 1 168 ? 68.410  35.039  81.664  1.00 66.12 ? 166 ASN B N   1 
ATOM   3377  C CA  . ASN B 1 168 ? 67.130  35.179  80.975  1.00 66.12 ? 166 ASN B CA  1 
ATOM   3378  C C   . ASN B 1 168 ? 66.477  36.433  81.466  1.00 66.12 ? 166 ASN B C   1 
ATOM   3379  O O   . ASN B 1 168 ? 66.130  37.327  80.695  1.00 66.12 ? 166 ASN B O   1 
ATOM   3380  C CB  . ASN B 1 168 ? 66.188  34.020  81.302  1.00 92.42 ? 166 ASN B CB  1 
ATOM   3381  C CG  . ASN B 1 168 ? 66.637  32.716  80.702  1.00 92.42 ? 166 ASN B CG  1 
ATOM   3382  O OD1 . ASN B 1 168 ? 67.649  32.141  81.107  1.00 92.42 ? 166 ASN B OD1 1 
ATOM   3383  N ND2 . ASN B 1 168 ? 65.886  32.237  79.721  1.00 92.42 ? 166 ASN B ND2 1 
ATOM   3384  N N   . ALA B 1 169 ? 66.302  36.472  82.777  1.00 31.84 ? 167 ALA B N   1 
ATOM   3385  C CA  . ALA B 1 169 ? 65.674  37.600  83.418  1.00 31.84 ? 167 ALA B CA  1 
ATOM   3386  C C   . ALA B 1 169 ? 66.269  38.911  82.929  1.00 31.84 ? 167 ALA B C   1 
ATOM   3387  O O   . ALA B 1 169 ? 65.542  39.802  82.498  1.00 31.84 ? 167 ALA B O   1 
ATOM   3388  C CB  . ALA B 1 169 ? 65.821  37.484  84.925  1.00 25.73 ? 167 ALA B CB  1 
ATOM   3389  N N   . ASN B 1 170 ? 67.594  39.007  82.961  1.00 62.97 ? 168 ASN B N   1 
ATOM   3390  C CA  . ASN B 1 170 ? 68.293  40.225  82.565  1.00 62.97 ? 168 ASN B CA  1 
ATOM   3391  C C   . ASN B 1 170 ? 68.290  40.589  81.082  1.00 62.97 ? 168 ASN B C   1 
ATOM   3392  O O   . ASN B 1 170 ? 68.319  41.773  80.729  1.00 62.97 ? 168 ASN B O   1 
ATOM   3393  C CB  . ASN B 1 170 ? 69.708  40.162  83.112  1.00 34.30 ? 168 ASN B CB  1 
ATOM   3394  C CG  . ASN B 1 170 ? 69.723  40.078  84.619  1.00 34.30 ? 168 ASN B CG  1 
ATOM   3395  O OD1 . ASN B 1 170 ? 69.278  41.001  85.304  1.00 34.30 ? 168 ASN B OD1 1 
ATOM   3396  N ND2 . ASN B 1 170 ? 70.217  38.967  85.149  1.00 34.30 ? 168 ASN B ND2 1 
ATOM   3397  N N   . ALA B 1 171 ? 68.268  39.586  80.214  1.00 45.50 ? 169 ALA B N   1 
ATOM   3398  C CA  . ALA B 1 171 ? 68.212  39.852  78.781  1.00 45.50 ? 169 ALA B CA  1 
ATOM   3399  C C   . ALA B 1 171 ? 66.833  40.473  78.560  1.00 45.50 ? 169 ALA B C   1 
ATOM   3400  O O   . ALA B 1 171 ? 66.688  41.576  78.020  1.00 45.50 ? 169 ALA B O   1 
ATOM   3401  C CB  . ALA B 1 171 ? 68.328  38.539  77.998  1.00 4.49  ? 169 ALA B CB  1 
ATOM   3402  N N   . LEU B 1 172 ? 65.824  39.737  79.016  1.00 73.50 ? 170 LEU B N   1 
ATOM   3403  C CA  . LEU B 1 172 ? 64.438  40.154  78.916  1.00 73.50 ? 170 LEU B CA  1 
ATOM   3404  C C   . LEU B 1 172 ? 64.234  41.558  79.461  1.00 73.50 ? 170 LEU B C   1 
ATOM   3405  O O   . LEU B 1 172 ? 63.210  42.190  79.199  1.00 73.50 ? 170 LEU B O   1 
ATOM   3406  C CB  . LEU B 1 172 ? 63.549  39.157  79.667  1.00 59.23 ? 170 LEU B CB  1 
ATOM   3407  C CG  . LEU B 1 172 ? 63.020  38.025  78.779  1.00 59.23 ? 170 LEU B CG  1 
ATOM   3408  C CD1 . LEU B 1 172 ? 62.728  36.757  79.569  1.00 59.23 ? 170 LEU B CD1 1 
ATOM   3409  C CD2 . LEU B 1 172 ? 61.773  38.537  78.080  1.00 59.23 ? 170 LEU B CD2 1 
ATOM   3410  N N   . ALA B 1 173 ? 65.220  42.053  80.203  1.00 18.44 ? 171 ALA B N   1 
ATOM   3411  C CA  . ALA B 1 173 ? 65.116  43.377  80.790  1.00 18.44 ? 171 ALA B CA  1 
ATOM   3412  C C   . ALA B 1 173 ? 65.882  44.417  80.018  1.00 18.44 ? 171 ALA B C   1 
ATOM   3413  O O   . ALA B 1 173 ? 65.521  45.598  80.040  1.00 18.44 ? 171 ALA B O   1 
ATOM   3414  C CB  . ALA B 1 173 ? 65.585  43.352  82.212  1.00 1.56  ? 171 ALA B CB  1 
ATOM   3415  N N   . ARG B 1 174 ? 66.952  43.998  79.355  1.00 48.27 ? 172 ARG B N   1 
ATOM   3416  C CA  . ARG B 1 174 ? 67.735  44.934  78.560  1.00 48.27 ? 172 ARG B CA  1 
ATOM   3417  C C   . ARG B 1 174 ? 66.827  45.295  77.388  1.00 48.27 ? 172 ARG B C   1 
ATOM   3418  O O   . ARG B 1 174 ? 66.494  46.461  77.175  1.00 48.27 ? 172 ARG B O   1 
ATOM   3419  C CB  . ARG B 1 174 ? 69.025  44.267  78.063  1.00 66.94 ? 172 ARG B CB  1 
ATOM   3420  C CG  . ARG B 1 174 ? 69.922  43.716  79.173  1.00 66.94 ? 172 ARG B CG  1 
ATOM   3421  C CD  . ARG B 1 174 ? 70.997  42.780  78.625  1.00 66.94 ? 172 ARG B CD  1 
ATOM   3422  N NE  . ARG B 1 174 ? 71.617  41.989  79.688  1.00 66.94 ? 172 ARG B NE  1 
ATOM   3423  C CZ  . ARG B 1 174 ? 72.033  40.730  79.543  1.00 66.94 ? 172 ARG B CZ  1 
ATOM   3424  N NH1 . ARG B 1 174 ? 71.895  40.119  78.375  1.00 66.94 ? 172 ARG B NH1 1 
ATOM   3425  N NH2 . ARG B 1 174 ? 72.571  40.070  80.568  1.00 66.94 ? 172 ARG B NH2 1 
ATOM   3426  N N   . TYR B 1 175 ? 66.408  44.267  76.654  1.00 55.06 ? 173 TYR B N   1 
ATOM   3427  C CA  . TYR B 1 175 ? 65.521  44.421  75.500  1.00 55.06 ? 173 TYR B CA  1 
ATOM   3428  C C   . TYR B 1 175 ? 64.310  45.250  75.902  1.00 55.06 ? 173 TYR B C   1 
ATOM   3429  O O   . TYR B 1 175 ? 63.826  46.095  75.149  1.00 55.06 ? 173 TYR B O   1 
ATOM   3430  C CB  . TYR B 1 175 ? 65.090  43.027  75.003  1.00 62.77 ? 173 TYR B CB  1 
ATOM   3431  C CG  . TYR B 1 175 ? 63.601  42.818  74.786  1.00 62.77 ? 173 TYR B CG  1 
ATOM   3432  C CD1 . TYR B 1 175 ? 62.906  43.512  73.792  1.00 62.77 ? 173 TYR B CD1 1 
ATOM   3433  C CD2 . TYR B 1 175 ? 62.892  41.918  75.574  1.00 62.77 ? 173 TYR B CD2 1 
ATOM   3434  C CE1 . TYR B 1 175 ? 61.546  43.315  73.594  1.00 62.77 ? 173 TYR B CE1 1 
ATOM   3435  C CE2 . TYR B 1 175 ? 61.535  41.714  75.387  1.00 62.77 ? 173 TYR B CE2 1 
ATOM   3436  C CZ  . TYR B 1 175 ? 60.867  42.417  74.400  1.00 62.77 ? 173 TYR B CZ  1 
ATOM   3437  O OH  . TYR B 1 175 ? 59.511  42.238  74.249  1.00 62.77 ? 173 TYR B OH  1 
ATOM   3438  N N   . ALA B 1 176 ? 63.835  44.999  77.109  1.00 39.72 ? 174 ALA B N   1 
ATOM   3439  C CA  . ALA B 1 176 ? 62.692  45.709  77.616  1.00 39.72 ? 174 ALA B CA  1 
ATOM   3440  C C   . ALA B 1 176 ? 62.924  47.214  77.550  1.00 39.72 ? 174 ALA B C   1 
ATOM   3441  O O   . ALA B 1 176 ? 62.137  47.938  76.942  1.00 39.72 ? 174 ALA B O   1 
ATOM   3442  C CB  . ALA B 1 176 ? 62.415  45.271  79.034  1.00 26.42 ? 174 ALA B CB  1 
ATOM   3443  N N   . SER B 1 177 ? 64.009  47.685  78.163  1.00 54.92 ? 175 SER B N   1 
ATOM   3444  C CA  . SER B 1 177 ? 64.321  49.115  78.173  1.00 54.92 ? 175 SER B CA  1 
ATOM   3445  C C   . SER B 1 177 ? 64.766  49.645  76.810  1.00 54.92 ? 175 SER B C   1 
ATOM   3446  O O   . SER B 1 177 ? 64.731  50.849  76.552  1.00 54.92 ? 175 SER B O   1 
ATOM   3447  C CB  . SER B 1 177 ? 65.386  49.403  79.231  1.00 49.29 ? 175 SER B CB  1 
ATOM   3448  O OG  . SER B 1 177 ? 66.129  48.230  79.511  1.00 49.29 ? 175 SER B OG  1 
ATOM   3449  N N   . ILE B 1 178 ? 65.186  48.743  75.934  1.00 46.15 ? 176 ILE B N   1 
ATOM   3450  C CA  . ILE B 1 178 ? 65.598  49.144  74.604  1.00 46.15 ? 176 ILE B CA  1 
ATOM   3451  C C   . ILE B 1 178 ? 64.366  49.560  73.794  1.00 46.15 ? 176 ILE B C   1 
ATOM   3452  O O   . ILE B 1 178 ? 64.437  50.493  72.987  1.00 46.15 ? 176 ILE B O   1 
ATOM   3453  C CB  . ILE B 1 178 ? 66.304  47.994  73.897  1.00 41.38 ? 176 ILE B CB  1 
ATOM   3454  C CG1 . ILE B 1 178 ? 67.598  47.673  74.640  1.00 41.38 ? 176 ILE B CG1 1 
ATOM   3455  C CG2 . ILE B 1 178 ? 66.583  48.356  72.461  1.00 41.38 ? 176 ILE B CG2 1 
ATOM   3456  C CD1 . ILE B 1 178 ? 68.370  46.482  74.081  1.00 41.38 ? 176 ILE B CD1 1 
ATOM   3457  N N   . CYS B 1 179 ? 63.241  48.867  74.022  1.00 33.67 ? 177 CYS B N   1 
ATOM   3458  C CA  . CYS B 1 179 ? 61.983  49.145  73.322  1.00 33.67 ? 177 CYS B CA  1 
ATOM   3459  C C   . CYS B 1 179 ? 61.452  50.469  73.762  1.00 33.67 ? 177 CYS B C   1 
ATOM   3460  O O   . CYS B 1 179 ? 61.191  51.339  72.944  1.00 33.67 ? 177 CYS B O   1 
ATOM   3461  C CB  . CYS B 1 179 ? 60.935  48.098  73.641  1.00 36.54 ? 177 CYS B CB  1 
ATOM   3462  S SG  . CYS B 1 179 ? 61.436  46.427  73.271  1.00 36.54 ? 177 CYS B SG  1 
ATOM   3463  N N   . GLN B 1 180 ? 61.287  50.615  75.069  1.00 47.19 ? 178 GLN B N   1 
ATOM   3464  C CA  . GLN B 1 180 ? 60.771  51.855  75.625  1.00 47.19 ? 178 GLN B CA  1 
ATOM   3465  C C   . GLN B 1 180 ? 61.671  53.023  75.251  1.00 47.19 ? 178 GLN B C   1 
ATOM   3466  O O   . GLN B 1 180 ? 61.241  54.181  75.216  1.00 47.19 ? 178 GLN B O   1 
ATOM   3467  C CB  . GLN B 1 180 ? 60.623  51.724  77.139  1.00 57.56 ? 178 GLN B CB  1 
ATOM   3468  C CG  . GLN B 1 180 ? 59.461  50.835  77.511  1.00 57.56 ? 178 GLN B CG  1 
ATOM   3469  C CD  . GLN B 1 180 ? 59.455  50.460  78.963  1.00 57.56 ? 178 GLN B CD  1 
ATOM   3470  O OE1 . GLN B 1 180 ? 59.500  51.326  79.842  1.00 57.56 ? 178 GLN B OE1 1 
ATOM   3471  N NE2 . GLN B 1 180 ? 59.397  49.158  79.235  1.00 57.56 ? 178 GLN B NE2 1 
ATOM   3472  N N   . GLN B 1 181 ? 62.926  52.710  74.958  1.00 64.05 ? 179 GLN B N   1 
ATOM   3473  C CA  . GLN B 1 181 ? 63.865  53.739  74.559  1.00 64.05 ? 179 GLN B CA  1 
ATOM   3474  C C   . GLN B 1 181 ? 63.397  54.190  73.183  1.00 64.05 ? 179 GLN B C   1 
ATOM   3475  O O   . GLN B 1 181 ? 63.401  55.374  72.865  1.00 64.05 ? 179 GLN B O   1 
ATOM   3476  C CB  . GLN B 1 181 ? 65.281  53.159  74.495  1.00 81.74 ? 179 GLN B CB  1 
ATOM   3477  C CG  . GLN B 1 181 ? 66.275  53.904  75.362  1.00 81.74 ? 179 GLN B CG  1 
ATOM   3478  C CD  . GLN B 1 181 ? 65.698  54.249  76.721  1.00 81.74 ? 179 GLN B CD  1 
ATOM   3479  O OE1 . GLN B 1 181 ? 65.288  53.371  77.480  1.00 81.74 ? 179 GLN B OE1 1 
ATOM   3480  N NE2 . GLN B 1 181 ? 65.656  55.539  77.032  1.00 81.74 ? 179 GLN B NE2 1 
ATOM   3481  N N   . ASN B 1 182 ? 62.961  53.224  72.386  1.00 49.69 ? 180 ASN B N   1 
ATOM   3482  C CA  . ASN B 1 182 ? 62.486  53.497  71.045  1.00 49.69 ? 180 ASN B CA  1 
ATOM   3483  C C   . ASN B 1 182 ? 60.964  53.498  70.970  1.00 49.69 ? 180 ASN B C   1 
ATOM   3484  O O   . ASN B 1 182 ? 60.391  53.021  69.995  1.00 49.69 ? 180 ASN B O   1 
ATOM   3485  C CB  . ASN B 1 182 ? 63.057  52.461  70.076  1.00 87.89 ? 180 ASN B CB  1 
ATOM   3486  C CG  . ASN B 1 182 ? 64.577  52.496  70.009  1.00 87.89 ? 180 ASN B CG  1 
ATOM   3487  O OD1 . ASN B 1 182 ? 65.169  53.422  69.449  1.00 87.89 ? 180 ASN B OD1 1 
ATOM   3488  N ND2 . ASN B 1 182 ? 65.215  51.486  70.588  1.00 87.89 ? 180 ASN B ND2 1 
ATOM   3489  N N   . GLY B 1 183 ? 60.316  54.023  72.007  1.00 54.67 ? 181 GLY B N   1 
ATOM   3490  C CA  . GLY B 1 183 ? 58.858  54.111  72.042  1.00 54.67 ? 181 GLY B CA  1 
ATOM   3491  C C   . GLY B 1 183 ? 57.981  52.908  71.693  1.00 54.67 ? 181 GLY B C   1 
ATOM   3492  O O   . GLY B 1 183 ? 56.965  53.067  71.014  1.00 54.67 ? 181 GLY B O   1 
ATOM   3493  N N   . LEU B 1 184 ? 58.355  51.715  72.159  1.00 29.68 ? 182 LEU B N   1 
ATOM   3494  C CA  . LEU B 1 184 ? 57.589  50.492  71.911  1.00 29.68 ? 182 LEU B CA  1 
ATOM   3495  C C   . LEU B 1 184 ? 57.172  49.878  73.243  1.00 29.68 ? 182 LEU B C   1 
ATOM   3496  O O   . LEU B 1 184 ? 57.739  50.183  74.273  1.00 29.68 ? 182 LEU B O   1 
ATOM   3497  C CB  . LEU B 1 184 ? 58.433  49.476  71.136  1.00 22.50 ? 182 LEU B CB  1 
ATOM   3498  C CG  . LEU B 1 184 ? 58.944  49.812  69.725  1.00 22.50 ? 182 LEU B CG  1 
ATOM   3499  C CD1 . LEU B 1 184 ? 59.325  48.512  68.998  1.00 22.50 ? 182 LEU B CD1 1 
ATOM   3500  C CD2 . LEU B 1 184 ? 57.877  50.547  68.939  1.00 22.50 ? 182 LEU B CD2 1 
ATOM   3501  N N   . VAL B 1 185 ? 56.167  49.025  73.246  1.00 72.39 ? 183 VAL B N   1 
ATOM   3502  C CA  . VAL B 1 185 ? 55.786  48.425  74.508  1.00 72.39 ? 183 VAL B CA  1 
ATOM   3503  C C   . VAL B 1 185 ? 56.250  46.978  74.532  1.00 72.39 ? 183 VAL B C   1 
ATOM   3504  O O   . VAL B 1 185 ? 55.669  46.109  73.887  1.00 72.39 ? 183 VAL B O   1 
ATOM   3505  C CB  . VAL B 1 185 ? 54.277  48.510  74.750  1.00 35.76 ? 183 VAL B CB  1 
ATOM   3506  C CG1 . VAL B 1 185 ? 53.927  47.788  76.028  1.00 35.76 ? 183 VAL B CG1 1 
ATOM   3507  C CG2 . VAL B 1 185 ? 53.858  49.965  74.857  1.00 35.76 ? 183 VAL B CG2 1 
ATOM   3508  N N   . PRO B 1 186 ? 57.326  46.712  75.280  1.00 43.30 ? 184 PRO B N   1 
ATOM   3509  C CA  . PRO B 1 186 ? 57.991  45.419  75.481  1.00 43.30 ? 184 PRO B CA  1 
ATOM   3510  C C   . PRO B 1 186 ? 57.158  44.319  76.099  1.00 43.30 ? 184 PRO B C   1 
ATOM   3511  O O   . PRO B 1 186 ? 56.821  44.394  77.268  1.00 43.30 ? 184 PRO B O   1 
ATOM   3512  C CB  . PRO B 1 186 ? 59.170  45.778  76.371  1.00 24.98 ? 184 PRO B CB  1 
ATOM   3513  C CG  . PRO B 1 186 ? 58.657  46.969  77.146  1.00 24.98 ? 184 PRO B CG  1 
ATOM   3514  C CD  . PRO B 1 186 ? 57.983  47.765  76.071  1.00 24.98 ? 184 PRO B CD  1 
ATOM   3515  N N   . ILE B 1 187 ? 56.837  43.286  75.330  1.00 30.66 ? 185 ILE B N   1 
ATOM   3516  C CA  . ILE B 1 187 ? 56.048  42.194  75.880  1.00 30.66 ? 185 ILE B CA  1 
ATOM   3517  C C   . ILE B 1 187 ? 56.963  41.153  76.519  1.00 30.66 ? 185 ILE B C   1 
ATOM   3518  O O   . ILE B 1 187 ? 57.383  40.188  75.883  1.00 30.66 ? 185 ILE B O   1 
ATOM   3519  C CB  . ILE B 1 187 ? 55.132  41.548  74.792  1.00 37.71 ? 185 ILE B CB  1 
ATOM   3520  C CG1 . ILE B 1 187 ? 53.908  42.440  74.570  1.00 37.71 ? 185 ILE B CG1 1 
ATOM   3521  C CG2 . ILE B 1 187 ? 54.687  40.132  75.197  1.00 37.71 ? 185 ILE B CG2 1 
ATOM   3522  C CD1 . ILE B 1 187 ? 52.856  41.832  73.676  1.00 37.71 ? 185 ILE B CD1 1 
ATOM   3523  N N   . VAL B 1 188 ? 57.277  41.354  77.790  1.00 34.02 ? 186 VAL B N   1 
ATOM   3524  C CA  . VAL B 1 188 ? 58.139  40.422  78.508  1.00 34.02 ? 186 VAL B CA  1 
ATOM   3525  C C   . VAL B 1 188 ? 57.629  38.983  78.527  1.00 34.02 ? 186 VAL B C   1 
ATOM   3526  O O   . VAL B 1 188 ? 56.610  38.697  79.153  1.00 34.02 ? 186 VAL B O   1 
ATOM   3527  C CB  . VAL B 1 188 ? 58.304  40.847  79.961  1.00 42.75 ? 186 VAL B CB  1 
ATOM   3528  C CG1 . VAL B 1 188 ? 59.223  39.858  80.689  1.00 42.75 ? 186 VAL B CG1 1 
ATOM   3529  C CG2 . VAL B 1 188 ? 58.834  42.269  80.018  1.00 42.75 ? 186 VAL B CG2 1 
ATOM   3530  N N   . GLU B 1 189 ? 58.323  38.063  77.867  1.00 28.36 ? 187 GLU B N   1 
ATOM   3531  C CA  . GLU B 1 189 ? 57.878  36.669  77.881  1.00 26.18 ? 187 GLU B CA  1 
ATOM   3532  C C   . GLU B 1 189 ? 58.865  35.801  78.661  1.00 33.26 ? 187 GLU B C   1 
ATOM   3533  O O   . GLU B 1 189 ? 60.024  35.669  78.289  1.00 35.89 ? 187 GLU B O   1 
ATOM   3534  C CB  . GLU B 1 189 ? 57.730  36.131  76.450  1.00 41.80 ? 187 GLU B CB  1 
ATOM   3535  C CG  . GLU B 1 189 ? 56.593  35.113  76.245  1.00 65.01 ? 187 GLU B CG  1 
ATOM   3536  C CD  . GLU B 1 189 ? 56.576  34.533  74.830  1.00 77.79 ? 187 GLU B CD  1 
ATOM   3537  O OE1 . GLU B 1 189 ? 56.636  35.317  73.862  1.00 61.95 ? 187 GLU B OE1 1 
ATOM   3538  O OE2 . GLU B 1 189 ? 56.501  33.299  74.680  1.00 80.89 ? 187 GLU B OE2 1 
ATOM   3539  N N   . PRO B 1 190 ? 58.420  35.231  79.789  1.00 41.95 ? 188 PRO B N   1 
ATOM   3540  C CA  . PRO B 1 190 ? 59.294  34.371  80.595  1.00 33.03 ? 188 PRO B CA  1 
ATOM   3541  C C   . PRO B 1 190 ? 59.403  33.010  79.920  1.00 36.02 ? 188 PRO B C   1 
ATOM   3542  O O   . PRO B 1 190 ? 59.120  32.876  78.743  1.00 39.91 ? 188 PRO B O   1 
ATOM   3543  C CB  . PRO B 1 190 ? 58.558  34.320  81.939  1.00 88.11 ? 188 PRO B CB  1 
ATOM   3544  C CG  . PRO B 1 190 ? 57.915  35.682  81.974  1.00 88.11 ? 188 PRO B CG  1 
ATOM   3545  C CD  . PRO B 1 190 ? 57.302  35.717  80.615  1.00 88.11 ? 188 PRO B CD  1 
ATOM   3546  N N   . GLU B 1 191 ? 59.800  32.003  80.673  1.00 91.47 ? 189 GLU B N   1 
ATOM   3547  C CA  . GLU B 1 191 ? 59.961  30.679  80.097  1.00 91.47 ? 189 GLU B CA  1 
ATOM   3548  C C   . GLU B 1 191 ? 59.448  29.609  81.063  1.00 91.47 ? 189 GLU B C   1 
ATOM   3549  O O   . GLU B 1 191 ? 58.966  29.956  82.134  1.00 91.47 ? 189 GLU B O   1 
ATOM   3550  C CB  . GLU B 1 191 ? 61.444  30.463  79.820  1.00 92.42 ? 189 GLU B CB  1 
ATOM   3551  C CG  . GLU B 1 191 ? 62.330  31.072  80.899  1.00 92.42 ? 189 GLU B CG  1 
ATOM   3552  C CD  . GLU B 1 191 ? 63.745  30.562  80.857  1.00 92.42 ? 189 GLU B CD  1 
ATOM   3553  O OE1 . GLU B 1 191 ? 64.202  30.171  79.760  1.00 79.31 ? 189 GLU B OE1 1 
ATOM   3554  O OE2 . GLU B 1 191 ? 64.399  30.575  81.923  1.00 92.42 ? 189 GLU B OE2 1 
ATOM   3555  N N   . VAL B 1 192 ? 59.561  28.328  80.689  1.00 92.42 ? 190 VAL B N   1 
ATOM   3556  C CA  . VAL B 1 192 ? 59.168  27.151  81.517  1.00 92.42 ? 190 VAL B CA  1 
ATOM   3557  C C   . VAL B 1 192 ? 59.267  25.841  80.691  1.00 92.42 ? 190 VAL B C   1 
ATOM   3558  O O   . VAL B 1 192 ? 59.247  25.891  79.470  1.00 92.42 ? 190 VAL B O   1 
ATOM   3559  C CB  . VAL B 1 192 ? 57.714  27.175  82.048  1.00 62.19 ? 190 VAL B CB  1 
ATOM   3560  C CG1 . VAL B 1 192 ? 57.480  25.940  82.894  1.00 52.52 ? 190 VAL B CG1 1 
ATOM   3561  C CG2 . VAL B 1 192 ? 57.459  28.376  82.892  1.00 50.53 ? 190 VAL B CG2 1 
ATOM   3562  N N   . ILE B 1 193 ? 59.334  24.682  81.358  1.00 79.89 ? 191 ILE B N   1 
ATOM   3563  C CA  . ILE B 1 193 ? 59.429  23.362  80.706  1.00 79.89 ? 191 ILE B CA  1 
ATOM   3564  C C   . ILE B 1 193 ? 58.280  22.420  81.082  1.00 79.89 ? 191 ILE B C   1 
ATOM   3565  O O   . ILE B 1 193 ? 57.863  22.375  82.230  1.00 79.89 ? 191 ILE B O   1 
ATOM   3566  C CB  . ILE B 1 193 ? 60.796  22.666  81.064  1.00 92.42 ? 191 ILE B CB  1 
ATOM   3567  C CG1 . ILE B 1 193 ? 61.941  23.617  80.727  1.00 92.42 ? 191 ILE B CG1 1 
ATOM   3568  C CG2 . ILE B 1 193 ? 60.971  21.322  80.314  1.00 92.42 ? 191 ILE B CG2 1 
ATOM   3569  C CD1 . ILE B 1 193 ? 63.355  23.117  80.965  1.00 92.42 ? 191 ILE B CD1 1 
ATOM   3570  N N   . PRO B 1 194 ? 57.736  21.696  80.084  1.00 92.42 ? 192 PRO B N   1 
ATOM   3571  C CA  . PRO B 1 194 ? 56.632  20.733  80.206  1.00 92.42 ? 192 PRO B CA  1 
ATOM   3572  C C   . PRO B 1 194 ? 56.784  19.704  81.300  1.00 92.42 ? 192 PRO B C   1 
ATOM   3573  O O   . PRO B 1 194 ? 55.784  19.065  81.603  1.00 92.42 ? 192 PRO B O   1 
ATOM   3574  C CB  . PRO B 1 194 ? 56.585  20.060  78.836  1.00 84.10 ? 192 PRO B CB  1 
ATOM   3575  C CG  . PRO B 1 194 ? 57.166  21.162  77.912  1.00 84.10 ? 192 PRO B CG  1 
ATOM   3576  C CD  . PRO B 1 194 ? 58.329  21.646  78.735  1.00 84.10 ? 192 PRO B CD  1 
ATOM   3577  N N   . ASP B 1 195 ? 57.999  19.500  81.833  1.00 90.80 ? 193 ASP B N   1 
ATOM   3578  C CA  . ASP B 1 195 ? 58.246  18.528  82.925  1.00 90.80 ? 193 ASP B CA  1 
ATOM   3579  C C   . ASP B 1 195 ? 57.233  18.699  84.077  1.00 90.80 ? 193 ASP B C   1 
ATOM   3580  O O   . ASP B 1 195 ? 56.906  17.768  84.826  1.00 90.80 ? 193 ASP B O   1 
ATOM   3581  C CB  . ASP B 1 195 ? 59.652  18.733  83.510  1.00 92.42 ? 193 ASP B CB  1 
ATOM   3582  C CG  . ASP B 1 195 ? 60.707  18.913  82.452  1.00 92.42 ? 193 ASP B CG  1 
ATOM   3583  O OD1 . ASP B 1 195 ? 61.680  19.675  82.720  1.00 92.42 ? 193 ASP B OD1 1 
ATOM   3584  O OD2 . ASP B 1 195 ? 60.549  18.303  81.363  1.00 92.42 ? 193 ASP B OD2 1 
ATOM   3585  N N   . ASP B 1 199 ? 53.854  18.061  89.349  1.00 68.71 ? 197 ASP B N   1 
ATOM   3586  C CA  . ASP B 1 199 ? 52.424  18.282  89.197  1.00 75.74 ? 197 ASP B CA  1 
ATOM   3587  C C   . ASP B 1 199 ? 52.192  19.778  89.134  1.00 76.08 ? 197 ASP B C   1 
ATOM   3588  O O   . ASP B 1 199 ? 53.101  20.550  88.816  1.00 76.08 ? 197 ASP B O   1 
ATOM   3589  C CB  . ASP B 1 199 ? 51.663  17.713  90.394  1.00 92.42 ? 197 ASP B CB  1 
ATOM   3590  C CG  . ASP B 1 199 ? 51.865  18.543  91.657  1.00 92.42 ? 197 ASP B CG  1 
ATOM   3591  O OD1 . ASP B 1 199 ? 53.037  18.817  92.004  1.00 92.42 ? 197 ASP B OD1 1 
ATOM   3592  O OD2 . ASP B 1 199 ? 50.859  18.921  92.303  1.00 92.42 ? 197 ASP B OD2 1 
ATOM   3593  N N   . LEU B 1 200 ? 50.968  20.177  89.461  1.00 50.17 ? 198 LEU B N   1 
ATOM   3594  C CA  . LEU B 1 200 ? 50.571  21.580  89.455  1.00 54.42 ? 198 LEU B CA  1 
ATOM   3595  C C   . LEU B 1 200 ? 51.471  22.436  90.353  1.00 55.81 ? 198 LEU B C   1 
ATOM   3596  O O   . LEU B 1 200 ? 52.112  23.374  89.878  1.00 52.93 ? 198 LEU B O   1 
ATOM   3597  C CB  . LEU B 1 200 ? 49.111  21.691  89.899  1.00 62.27 ? 198 LEU B CB  1 
ATOM   3598  C CG  . LEU B 1 200 ? 48.443  23.033  89.640  1.00 68.19 ? 198 LEU B CG  1 
ATOM   3599  C CD1 . LEU B 1 200 ? 48.842  23.509  88.259  1.00 49.88 ? 198 LEU B CD1 1 
ATOM   3600  C CD2 . LEU B 1 200 ? 46.932  22.908  89.761  1.00 56.26 ? 198 LEU B CD2 1 
ATOM   3601  N N   . GLU B 1 201 ? 51.514  22.095  91.645  1.00 53.91 ? 199 GLU B N   1 
ATOM   3602  C CA  . GLU B 1 201 ? 52.324  22.806  92.639  1.00 51.62 ? 199 GLU B CA  1 
ATOM   3603  C C   . GLU B 1 201 ? 53.783  22.848  92.194  1.00 51.68 ? 199 GLU B C   1 
ATOM   3604  O O   . GLU B 1 201 ? 54.585  23.630  92.698  1.00 50.87 ? 199 GLU B O   1 
ATOM   3605  C CB  . GLU B 1 201 ? 52.211  22.101  93.996  1.00 92.42 ? 199 GLU B CB  1 
ATOM   3606  C CG  . GLU B 1 201 ? 53.002  22.757  95.133  1.00 92.42 ? 199 GLU B CG  1 
ATOM   3607  C CD  . GLU B 1 201 ? 53.060  21.896  96.404  1.00 92.42 ? 199 GLU B CD  1 
ATOM   3608  O OE1 . GLU B 1 201 ? 53.720  22.314  97.386  1.00 92.42 ? 199 GLU B OE1 1 
ATOM   3609  O OE2 . GLU B 1 201 ? 52.446  20.804  96.420  1.00 92.42 ? 199 GLU B OE2 1 
ATOM   3610  N N   . HIS B 1 202 ? 54.123  21.987  91.246  1.00 58.86 ? 200 HIS B N   1 
ATOM   3611  C CA  . HIS B 1 202 ? 55.475  21.919  90.713  1.00 60.46 ? 200 HIS B CA  1 
ATOM   3612  C C   . HIS B 1 202 ? 55.662  23.079  89.732  1.00 62.37 ? 200 HIS B C   1 
ATOM   3613  O O   . HIS B 1 202 ? 56.513  23.952  89.949  1.00 61.93 ? 200 HIS B O   1 
ATOM   3614  C CB  . HIS B 1 202 ? 55.669  20.561  90.016  1.00 92.42 ? 200 HIS B CB  1 
ATOM   3615  C CG  . HIS B 1 202 ? 56.936  20.451  89.221  1.00 92.42 ? 200 HIS B CG  1 
ATOM   3616  N ND1 . HIS B 1 202 ? 58.187  20.583  89.787  1.00 92.42 ? 200 HIS B ND1 1 
ATOM   3617  C CD2 . HIS B 1 202 ? 57.142  20.213  87.901  1.00 92.42 ? 200 HIS B CD2 1 
ATOM   3618  C CE1 . HIS B 1 202 ? 59.109  20.432  88.851  1.00 92.42 ? 200 HIS B CE1 1 
ATOM   3619  N NE2 . HIS B 1 202 ? 58.502  20.207  87.698  1.00 92.42 ? 200 HIS B NE2 1 
ATOM   3620  N N   . CYS B 1 203 ? 54.845  23.079  88.671  1.00 38.04 ? 201 CYS B N   1 
ATOM   3621  C CA  . CYS B 1 203 ? 54.869  24.112  87.622  1.00 38.09 ? 201 CYS B CA  1 
ATOM   3622  C C   . CYS B 1 203 ? 54.644  25.495  88.235  1.00 37.40 ? 201 CYS B C   1 
ATOM   3623  O O   . CYS B 1 203 ? 55.107  26.514  87.709  1.00 41.07 ? 201 CYS B O   1 
ATOM   3624  C CB  . CYS B 1 203 ? 53.778  23.818  86.575  1.00 71.79 ? 201 CYS B CB  1 
ATOM   3625  S SG  . CYS B 1 203 ? 53.724  24.915  85.113  1.00 72.15 ? 201 CYS B SG  1 
ATOM   3626  N N   . GLN B 1 204 ? 53.936  25.509  89.361  1.00 55.78 ? 202 GLN B N   1 
ATOM   3627  C CA  . GLN B 1 204 ? 53.629  26.739  90.070  1.00 55.78 ? 202 GLN B CA  1 
ATOM   3628  C C   . GLN B 1 204 ? 54.897  27.292  90.685  1.00 55.78 ? 202 GLN B C   1 
ATOM   3629  O O   . GLN B 1 204 ? 55.352  28.373  90.318  1.00 55.78 ? 202 GLN B O   1 
ATOM   3630  C CB  . GLN B 1 204 ? 52.614  26.476  91.180  1.00 55.18 ? 202 GLN B CB  1 
ATOM   3631  C CG  . GLN B 1 204 ? 51.834  27.706  91.606  1.00 55.18 ? 202 GLN B CG  1 
ATOM   3632  C CD  . GLN B 1 204 ? 51.414  27.660  93.063  1.00 55.18 ? 202 GLN B CD  1 
ATOM   3633  O OE1 . GLN B 1 204 ? 51.005  26.614  93.580  1.00 55.18 ? 202 GLN B OE1 1 
ATOM   3634  N NE2 . GLN B 1 204 ? 51.504  28.806  93.734  1.00 55.18 ? 202 GLN B NE2 1 
ATOM   3635  N N   . TYR B 1 205 ? 55.462  26.536  91.622  1.00 61.80 ? 203 TYR B N   1 
ATOM   3636  C CA  . TYR B 1 205 ? 56.680  26.938  92.312  1.00 61.80 ? 203 TYR B CA  1 
ATOM   3637  C C   . TYR B 1 205 ? 57.721  27.459  91.334  1.00 61.80 ? 203 TYR B C   1 
ATOM   3638  O O   . TYR B 1 205 ? 58.385  28.461  91.599  1.00 61.80 ? 203 TYR B O   1 
ATOM   3639  C CB  . TYR B 1 205 ? 57.237  25.764  93.125  1.00 81.07 ? 203 TYR B CB  1 
ATOM   3640  C CG  . TYR B 1 205 ? 58.639  25.975  93.655  1.00 81.07 ? 203 TYR B CG  1 
ATOM   3641  C CD1 . TYR B 1 205 ? 59.091  27.245  94.015  1.00 81.07 ? 203 TYR B CD1 1 
ATOM   3642  C CD2 . TYR B 1 205 ? 59.523  24.903  93.780  1.00 81.07 ? 203 TYR B CD2 1 
ATOM   3643  C CE1 . TYR B 1 205 ? 60.390  27.445  94.474  1.00 81.07 ? 203 TYR B CE1 1 
ATOM   3644  C CE2 . TYR B 1 205 ? 60.820  25.090  94.242  1.00 81.07 ? 203 TYR B CE2 1 
ATOM   3645  C CZ  . TYR B 1 205 ? 61.248  26.364  94.582  1.00 81.07 ? 203 TYR B CZ  1 
ATOM   3646  O OH  . TYR B 1 205 ? 62.541  26.559  95.008  1.00 81.07 ? 203 TYR B OH  1 
ATOM   3647  N N   . VAL B 1 206 ? 57.853  26.792  90.194  1.00 40.09 ? 204 VAL B N   1 
ATOM   3648  C CA  . VAL B 1 206 ? 58.816  27.226  89.192  1.00 40.09 ? 204 VAL B CA  1 
ATOM   3649  C C   . VAL B 1 206 ? 58.425  28.592  88.619  1.00 40.09 ? 204 VAL B C   1 
ATOM   3650  O O   . VAL B 1 206 ? 59.237  29.526  88.580  1.00 40.09 ? 204 VAL B O   1 
ATOM   3651  C CB  . VAL B 1 206 ? 58.891  26.228  88.041  1.00 31.28 ? 204 VAL B CB  1 
ATOM   3652  C CG1 . VAL B 1 206 ? 60.007  26.628  87.100  1.00 31.28 ? 204 VAL B CG1 1 
ATOM   3653  C CG2 . VAL B 1 206 ? 59.092  24.821  88.586  1.00 31.28 ? 204 VAL B CG2 1 
ATOM   3654  N N   . THR B 1 207 ? 57.173  28.689  88.176  1.00 35.04 ? 205 THR B N   1 
ATOM   3655  C CA  . THR B 1 207 ? 56.640  29.920  87.605  1.00 35.04 ? 205 THR B CA  1 
ATOM   3656  C C   . THR B 1 207 ? 56.933  31.137  88.474  1.00 35.04 ? 205 THR B C   1 
ATOM   3657  O O   . THR B 1 207 ? 57.302  32.193  87.952  1.00 35.04 ? 205 THR B O   1 
ATOM   3658  C CB  . THR B 1 207 ? 55.106  29.832  87.400  1.00 30.37 ? 205 THR B CB  1 
ATOM   3659  O OG1 . THR B 1 207 ? 54.801  28.818  86.428  1.00 30.37 ? 205 THR B OG1 1 
ATOM   3660  C CG2 . THR B 1 207 ? 54.555  31.179  86.936  1.00 30.37 ? 205 THR B CG2 1 
ATOM   3661  N N   . GLU B 1 208 ? 56.763  30.983  89.792  1.00 62.54 ? 206 GLU B N   1 
ATOM   3662  C CA  . GLU B 1 208 ? 56.986  32.073  90.746  1.00 62.54 ? 206 GLU B CA  1 
ATOM   3663  C C   . GLU B 1 208 ? 58.455  32.488  90.829  1.00 62.54 ? 206 GLU B C   1 
ATOM   3664  O O   . GLU B 1 208 ? 58.766  33.672  90.999  1.00 62.54 ? 206 GLU B O   1 
ATOM   3665  C CB  . GLU B 1 208 ? 56.494  31.683  92.142  1.00 71.11 ? 206 GLU B CB  1 
ATOM   3666  C CG  . GLU B 1 208 ? 55.076  31.141  92.193  1.00 71.11 ? 206 GLU B CG  1 
ATOM   3667  C CD  . GLU B 1 208 ? 54.594  30.900  93.619  1.00 71.11 ? 206 GLU B CD  1 
ATOM   3668  O OE1 . GLU B 1 208 ? 55.397  30.413  94.445  1.00 71.11 ? 206 GLU B OE1 1 
ATOM   3669  O OE2 . GLU B 1 208 ? 53.410  31.188  93.911  1.00 71.11 ? 206 GLU B OE2 1 
ATOM   3670  N N   . LYS B 1 209 ? 59.358  31.515  90.724  1.00 66.53 ? 207 LYS B N   1 
ATOM   3671  C CA  . LYS B 1 209 ? 60.791  31.805  90.763  1.00 66.53 ? 207 LYS B CA  1 
ATOM   3672  C C   . LYS B 1 209 ? 61.115  32.626  89.521  1.00 66.53 ? 207 LYS B C   1 
ATOM   3673  O O   . LYS B 1 209 ? 61.505  33.800  89.593  1.00 66.53 ? 207 LYS B O   1 
ATOM   3674  C CB  . LYS B 1 209 ? 61.597  30.504  90.725  1.00 78.71 ? 207 LYS B CB  1 
ATOM   3675  C CG  . LYS B 1 209 ? 61.598  29.705  92.021  1.00 78.71 ? 207 LYS B CG  1 
ATOM   3676  C CD  . LYS B 1 209 ? 62.471  28.445  91.899  1.00 78.71 ? 207 LYS B CD  1 
ATOM   3677  C CE  . LYS B 1 209 ? 63.932  28.762  91.523  1.00 78.71 ? 207 LYS B CE  1 
ATOM   3678  N NZ  . LYS B 1 209 ? 64.818  27.557  91.421  1.00 78.71 ? 207 LYS B NZ  1 
ATOM   3679  N N   . VAL B 1 210 ? 60.924  31.970  88.380  1.00 27.30 ? 208 VAL B N   1 
ATOM   3680  C CA  . VAL B 1 210 ? 61.162  32.539  87.058  1.00 27.30 ? 208 VAL B CA  1 
ATOM   3681  C C   . VAL B 1 210 ? 60.528  33.940  86.912  1.00 27.30 ? 208 VAL B C   1 
ATOM   3682  O O   . VAL B 1 210 ? 61.025  34.790  86.173  1.00 27.30 ? 208 VAL B O   1 
ATOM   3683  C CB  . VAL B 1 210 ? 60.605  31.555  85.969  1.00 6.31  ? 208 VAL B CB  1 
ATOM   3684  C CG1 . VAL B 1 210 ? 61.117  31.933  84.582  1.00 6.31  ? 208 VAL B CG1 1 
ATOM   3685  C CG2 . VAL B 1 210 ? 60.983  30.110  86.325  1.00 6.31  ? 208 VAL B CG2 1 
ATOM   3686  N N   . LEU B 1 211 ? 59.441  34.180  87.636  1.00 62.52 ? 209 LEU B N   1 
ATOM   3687  C CA  . LEU B 1 211 ? 58.766  35.465  87.551  1.00 62.52 ? 209 LEU B CA  1 
ATOM   3688  C C   . LEU B 1 211 ? 59.321  36.515  88.504  1.00 62.52 ? 209 LEU B C   1 
ATOM   3689  O O   . LEU B 1 211 ? 59.118  37.715  88.288  1.00 62.52 ? 209 LEU B O   1 
ATOM   3690  C CB  . LEU B 1 211 ? 57.254  35.293  87.764  1.00 13.90 ? 209 LEU B CB  1 
ATOM   3691  C CG  . LEU B 1 211 ? 56.412  34.993  86.508  1.00 13.90 ? 209 LEU B CG  1 
ATOM   3692  C CD1 . LEU B 1 211 ? 54.959  34.650  86.875  1.00 13.90 ? 209 LEU B CD1 1 
ATOM   3693  C CD2 . LEU B 1 211 ? 56.440  36.210  85.581  1.00 13.90 ? 209 LEU B CD2 1 
ATOM   3694  N N   . ALA B 1 212 ? 60.016  36.079  89.555  1.00 73.93 ? 210 ALA B N   1 
ATOM   3695  C CA  . ALA B 1 212 ? 60.604  37.028  90.507  1.00 73.93 ? 210 ALA B CA  1 
ATOM   3696  C C   . ALA B 1 212 ? 61.917  37.510  89.918  1.00 73.93 ? 210 ALA B C   1 
ATOM   3697  O O   . ALA B 1 212 ? 62.300  38.676  90.057  1.00 73.93 ? 210 ALA B O   1 
ATOM   3698  C CB  . ALA B 1 212 ? 60.857  36.366  91.855  1.00 21.70 ? 210 ALA B CB  1 
ATOM   3699  N N   . ALA B 1 213 ? 62.603  36.584  89.258  1.00 55.64 ? 211 ALA B N   1 
ATOM   3700  C CA  . ALA B 1 213 ? 63.871  36.882  88.616  1.00 55.64 ? 211 ALA B CA  1 
ATOM   3701  C C   . ALA B 1 213 ? 63.634  38.033  87.649  1.00 55.64 ? 211 ALA B C   1 
ATOM   3702  O O   . ALA B 1 213 ? 64.365  39.027  87.645  1.00 55.64 ? 211 ALA B O   1 
ATOM   3703  C CB  . ALA B 1 213 ? 64.372  35.640  87.853  1.00 23.95 ? 211 ALA B CB  1 
ATOM   3704  N N   . VAL B 1 214 ? 62.571  37.889  86.860  1.00 47.62 ? 212 VAL B N   1 
ATOM   3705  C CA  . VAL B 1 214 ? 62.215  38.859  85.844  1.00 47.62 ? 212 VAL B CA  1 
ATOM   3706  C C   . VAL B 1 214 ? 61.776  40.230  86.306  1.00 47.62 ? 212 VAL B C   1 
ATOM   3707  O O   . VAL B 1 214 ? 62.266  41.241  85.793  1.00 47.62 ? 212 VAL B O   1 
ATOM   3708  C CB  . VAL B 1 214 ? 61.123  38.318  84.925  1.00 14.01 ? 212 VAL B CB  1 
ATOM   3709  C CG1 . VAL B 1 214 ? 60.843  39.321  83.813  1.00 14.01 ? 212 VAL B CG1 1 
ATOM   3710  C CG2 . VAL B 1 214 ? 61.559  36.992  84.336  1.00 14.01 ? 212 VAL B CG2 1 
ATOM   3711  N N   . TYR B 1 215 ? 60.847  40.295  87.250  1.00 48.31 ? 213 TYR B N   1 
ATOM   3712  C CA  . TYR B 1 215 ? 60.406  41.611  87.674  1.00 48.31 ? 213 TYR B CA  1 
ATOM   3713  C C   . TYR B 1 215 ? 61.434  42.282  88.556  1.00 48.31 ? 213 TYR B C   1 
ATOM   3714  O O   . TYR B 1 215 ? 61.406  43.502  88.748  1.00 48.31 ? 213 TYR B O   1 
ATOM   3715  C CB  . TYR B 1 215 ? 59.006  41.532  88.298  1.00 35.96 ? 213 TYR B CB  1 
ATOM   3716  C CG  . TYR B 1 215 ? 57.950  41.456  87.201  1.00 35.96 ? 213 TYR B CG  1 
ATOM   3717  C CD1 . TYR B 1 215 ? 57.629  42.588  86.429  1.00 35.96 ? 213 TYR B CD1 1 
ATOM   3718  C CD2 . TYR B 1 215 ? 57.376  40.229  86.834  1.00 35.96 ? 213 TYR B CD2 1 
ATOM   3719  C CE1 . TYR B 1 215 ? 56.779  42.493  85.322  1.00 35.96 ? 213 TYR B CE1 1 
ATOM   3720  C CE2 . TYR B 1 215 ? 56.524  40.128  85.726  1.00 35.96 ? 213 TYR B CE2 1 
ATOM   3721  C CZ  . TYR B 1 215 ? 56.234  41.258  84.979  1.00 35.96 ? 213 TYR B CZ  1 
ATOM   3722  O OH  . TYR B 1 215 ? 55.405  41.145  83.884  1.00 35.96 ? 213 TYR B OH  1 
ATOM   3723  N N   . LYS B 1 216 ? 62.366  41.476  89.061  1.00 56.39 ? 214 LYS B N   1 
ATOM   3724  C CA  . LYS B 1 216 ? 63.464  41.987  89.876  1.00 56.39 ? 214 LYS B CA  1 
ATOM   3725  C C   . LYS B 1 216 ? 64.433  42.557  88.854  1.00 56.39 ? 214 LYS B C   1 
ATOM   3726  O O   . LYS B 1 216 ? 64.927  43.682  89.005  1.00 56.39 ? 214 LYS B O   1 
ATOM   3727  C CB  . LYS B 1 216 ? 64.152  40.861  90.657  1.00 70.32 ? 214 LYS B CB  1 
ATOM   3728  C CG  . LYS B 1 216 ? 65.503  41.261  91.268  1.00 70.32 ? 214 LYS B CG  1 
ATOM   3729  C CD  . LYS B 1 216 ? 65.374  42.435  92.242  1.00 70.32 ? 214 LYS B CD  1 
ATOM   3730  C CE  . LYS B 1 216 ? 66.729  43.041  92.601  1.00 70.32 ? 214 LYS B CE  1 
ATOM   3731  N NZ  . LYS B 1 216 ? 67.649  42.040  93.177  1.00 70.32 ? 214 LYS B NZ  1 
ATOM   3732  N N   . ALA B 1 217 ? 64.680  41.754  87.811  1.00 33.57 ? 215 ALA B N   1 
ATOM   3733  C CA  . ALA B 1 217 ? 65.563  42.111  86.705  1.00 33.57 ? 215 ALA B CA  1 
ATOM   3734  C C   . ALA B 1 217 ? 65.136  43.471  86.156  1.00 33.57 ? 215 ALA B C   1 
ATOM   3735  O O   . ALA B 1 217 ? 65.907  44.434  86.134  1.00 33.57 ? 215 ALA B O   1 
ATOM   3736  C CB  . ALA B 1 217 ? 65.469  41.048  85.608  1.00 1.56  ? 215 ALA B CB  1 
ATOM   3737  N N   . LEU B 1 218 ? 63.884  43.532  85.728  1.00 54.26 ? 216 LEU B N   1 
ATOM   3738  C CA  . LEU B 1 218 ? 63.322  44.744  85.172  1.00 54.26 ? 216 LEU B CA  1 
ATOM   3739  C C   . LEU B 1 218 ? 63.474  45.924  86.127  1.00 54.26 ? 216 LEU B C   1 
ATOM   3740  O O   . LEU B 1 218 ? 63.435  47.085  85.710  1.00 54.26 ? 216 LEU B O   1 
ATOM   3741  C CB  . LEU B 1 218 ? 61.852  44.501  84.821  1.00 25.01 ? 216 LEU B CB  1 
ATOM   3742  C CG  . LEU B 1 218 ? 61.643  43.596  83.608  1.00 25.01 ? 216 LEU B CG  1 
ATOM   3743  C CD1 . LEU B 1 218 ? 60.431  42.728  83.815  1.00 25.01 ? 216 LEU B CD1 1 
ATOM   3744  C CD2 . LEU B 1 218 ? 61.524  44.451  82.361  1.00 25.01 ? 216 LEU B CD2 1 
ATOM   3745  N N   . ASN B 1 219 ? 63.654  45.638  87.411  1.00 82.97 ? 217 ASN B N   1 
ATOM   3746  C CA  . ASN B 1 219 ? 63.817  46.724  88.360  1.00 82.97 ? 217 ASN B CA  1 
ATOM   3747  C C   . ASN B 1 219 ? 65.270  47.179  88.409  1.00 82.97 ? 217 ASN B C   1 
ATOM   3748  O O   . ASN B 1 219 ? 65.542  48.378  88.442  1.00 82.97 ? 217 ASN B O   1 
ATOM   3749  C CB  . ASN B 1 219 ? 63.362  46.318  89.757  1.00 58.42 ? 217 ASN B CB  1 
ATOM   3750  C CG  . ASN B 1 219 ? 63.363  47.487  90.715  1.00 58.42 ? 217 ASN B CG  1 
ATOM   3751  O OD1 . ASN B 1 219 ? 64.394  48.122  90.934  1.00 58.42 ? 217 ASN B OD1 1 
ATOM   3752  N ND2 . ASN B 1 219 ? 62.205  47.788  91.281  1.00 58.42 ? 217 ASN B ND2 1 
ATOM   3753  N N   . ASP B 1 220 ? 66.202  46.231  88.418  1.00 54.19 ? 218 ASP B N   1 
ATOM   3754  C CA  . ASP B 1 220 ? 67.613  46.595  88.444  1.00 54.19 ? 218 ASP B CA  1 
ATOM   3755  C C   . ASP B 1 220 ? 67.897  47.483  87.231  1.00 54.19 ? 218 ASP B C   1 
ATOM   3756  O O   . ASP B 1 220 ? 68.737  48.386  87.285  1.00 54.19 ? 218 ASP B O   1 
ATOM   3757  C CB  . ASP B 1 220 ? 68.514  45.354  88.372  1.00 69.59 ? 218 ASP B CB  1 
ATOM   3758  C CG  . ASP B 1 220 ? 68.223  44.346  89.468  1.00 69.59 ? 218 ASP B CG  1 
ATOM   3759  O OD1 . ASP B 1 220 ? 67.870  44.767  90.590  1.00 69.59 ? 218 ASP B OD1 1 
ATOM   3760  O OD2 . ASP B 1 220 ? 68.367  43.129  89.208  1.00 69.59 ? 218 ASP B OD2 1 
ATOM   3761  N N   . HIS B 1 221 ? 67.186  47.219  86.135  1.00 46.05 ? 219 HIS B N   1 
ATOM   3762  C CA  . HIS B 1 221 ? 67.363  47.980  84.904  1.00 46.05 ? 219 HIS B CA  1 
ATOM   3763  C C   . HIS B 1 221 ? 66.415  49.178  84.831  1.00 46.05 ? 219 HIS B C   1 
ATOM   3764  O O   . HIS B 1 221 ? 66.338  49.847  83.804  1.00 46.05 ? 219 HIS B O   1 
ATOM   3765  C CB  . HIS B 1 221 ? 67.136  47.088  83.681  1.00 47.20 ? 219 HIS B CB  1 
ATOM   3766  C CG  . HIS B 1 221 ? 68.045  45.898  83.606  1.00 47.20 ? 219 HIS B CG  1 
ATOM   3767  N ND1 . HIS B 1 221 ? 69.021  45.771  82.643  1.00 47.20 ? 219 HIS B ND1 1 
ATOM   3768  C CD2 . HIS B 1 221 ? 68.075  44.749  84.326  1.00 47.20 ? 219 HIS B CD2 1 
ATOM   3769  C CE1 . HIS B 1 221 ? 69.609  44.593  82.767  1.00 47.20 ? 219 HIS B CE1 1 
ATOM   3770  N NE2 . HIS B 1 221 ? 69.053  43.954  83.781  1.00 47.20 ? 219 HIS B NE2 1 
ATOM   3771  N N   . HIS B 1 222 ? 65.667  49.438  85.897  1.00 56.55 ? 220 HIS B N   1 
ATOM   3772  C CA  . HIS B 1 222 ? 64.776  50.588  85.900  1.00 56.55 ? 220 HIS B CA  1 
ATOM   3773  C C   . HIS B 1 222 ? 63.858  50.609  84.678  1.00 56.55 ? 220 HIS B C   1 
ATOM   3774  O O   . HIS B 1 222 ? 63.885  51.569  83.907  1.00 56.55 ? 220 HIS B O   1 
ATOM   3775  C CB  . HIS B 1 222 ? 65.627  51.856  85.911  1.00 50.02 ? 220 HIS B CB  1 
ATOM   3776  C CG  . HIS B 1 222 ? 64.879  53.096  86.281  1.00 50.02 ? 220 HIS B CG  1 
ATOM   3777  N ND1 . HIS B 1 222 ? 64.241  53.247  87.493  1.00 50.02 ? 220 HIS B ND1 1 
ATOM   3778  C CD2 . HIS B 1 222 ? 64.730  54.274  85.630  1.00 50.02 ? 220 HIS B CD2 1 
ATOM   3779  C CE1 . HIS B 1 222 ? 63.735  54.466  87.577  1.00 50.02 ? 220 HIS B CE1 1 
ATOM   3780  N NE2 . HIS B 1 222 ? 64.019  55.110  86.459  1.00 50.02 ? 220 HIS B NE2 1 
ATOM   3781  N N   . VAL B 1 223 ? 63.063  49.556  84.491  1.00 71.00 ? 221 VAL B N   1 
ATOM   3782  C CA  . VAL B 1 223 ? 62.129  49.477  83.359  1.00 71.00 ? 221 VAL B CA  1 
ATOM   3783  C C   . VAL B 1 223 ? 60.792  50.059  83.786  1.00 71.00 ? 221 VAL B C   1 
ATOM   3784  O O   . VAL B 1 223 ? 60.217  49.608  84.769  1.00 71.00 ? 221 VAL B O   1 
ATOM   3785  C CB  . VAL B 1 223 ? 61.864  48.014  82.928  1.00 34.01 ? 221 VAL B CB  1 
ATOM   3786  C CG1 . VAL B 1 223 ? 60.840  47.976  81.811  1.00 34.01 ? 221 VAL B CG1 1 
ATOM   3787  C CG2 . VAL B 1 223 ? 63.151  47.354  82.486  1.00 34.01 ? 221 VAL B CG2 1 
ATOM   3788  N N   . TYR B 1 224 ? 60.290  51.053  83.064  1.00 74.77 ? 222 TYR B N   1 
ATOM   3789  C CA  . TYR B 1 224 ? 59.000  51.638  83.423  1.00 74.77 ? 222 TYR B CA  1 
ATOM   3790  C C   . TYR B 1 224 ? 57.926  50.543  83.306  1.00 74.77 ? 222 TYR B C   1 
ATOM   3791  O O   . TYR B 1 224 ? 57.280  50.405  82.263  1.00 74.77 ? 222 TYR B O   1 
ATOM   3792  C CB  . TYR B 1 224 ? 58.689  52.817  82.492  1.00 53.87 ? 222 TYR B CB  1 
ATOM   3793  C CG  . TYR B 1 224 ? 57.380  53.536  82.767  1.00 53.87 ? 222 TYR B CG  1 
ATOM   3794  C CD1 . TYR B 1 224 ? 57.102  54.072  84.017  1.00 53.87 ? 222 TYR B CD1 1 
ATOM   3795  C CD2 . TYR B 1 224 ? 56.432  53.698  81.762  1.00 53.87 ? 222 TYR B CD2 1 
ATOM   3796  C CE1 . TYR B 1 224 ? 55.911  54.753  84.259  1.00 53.87 ? 222 TYR B CE1 1 
ATOM   3797  C CE2 . TYR B 1 224 ? 55.243  54.375  81.992  1.00 53.87 ? 222 TYR B CE2 1 
ATOM   3798  C CZ  . TYR B 1 224 ? 54.989  54.901  83.239  1.00 53.87 ? 222 TYR B CZ  1 
ATOM   3799  O OH  . TYR B 1 224 ? 53.817  55.586  83.460  1.00 53.87 ? 222 TYR B OH  1 
ATOM   3800  N N   . LEU B 1 225 ? 57.752  49.769  84.382  1.00 58.19 ? 223 LEU B N   1 
ATOM   3801  C CA  . LEU B 1 225 ? 56.792  48.657  84.435  1.00 58.19 ? 223 LEU B CA  1 
ATOM   3802  C C   . LEU B 1 225 ? 55.410  48.988  83.892  1.00 58.19 ? 223 LEU B C   1 
ATOM   3803  O O   . LEU B 1 225 ? 54.727  48.118  83.342  1.00 58.19 ? 223 LEU B O   1 
ATOM   3804  C CB  . LEU B 1 225 ? 56.679  48.142  85.874  1.00 60.80 ? 223 LEU B CB  1 
ATOM   3805  C CG  . LEU B 1 225 ? 57.979  47.498  86.391  1.00 60.80 ? 223 LEU B CG  1 
ATOM   3806  C CD1 . LEU B 1 225 ? 58.021  47.527  87.915  1.00 60.80 ? 223 LEU B CD1 1 
ATOM   3807  C CD2 . LEU B 1 225 ? 58.098  46.069  85.870  1.00 60.80 ? 223 LEU B CD2 1 
ATOM   3808  N N   . GLU B 1 226 ? 55.015  50.251  84.039  1.00 62.03 ? 224 GLU B N   1 
ATOM   3809  C CA  . GLU B 1 226 ? 53.717  50.728  83.573  1.00 62.03 ? 224 GLU B CA  1 
ATOM   3810  C C   . GLU B 1 226 ? 53.606  50.788  82.054  1.00 62.03 ? 224 GLU B C   1 
ATOM   3811  O O   . GLU B 1 226 ? 52.528  51.044  81.519  1.00 62.03 ? 224 GLU B O   1 
ATOM   3812  C CB  . GLU B 1 226 ? 53.411  52.108  84.156  1.00 74.96 ? 224 GLU B CB  1 
ATOM   3813  C CG  . GLU B 1 226 ? 53.088  52.110  85.645  1.00 74.96 ? 224 GLU B CG  1 
ATOM   3814  C CD  . GLU B 1 226 ? 54.307  52.329  86.521  1.00 74.96 ? 224 GLU B CD  1 
ATOM   3815  O OE1 . GLU B 1 226 ? 55.224  51.478  86.506  1.00 74.96 ? 224 GLU B OE1 1 
ATOM   3816  O OE2 . GLU B 1 226 ? 54.346  53.360  87.226  1.00 74.96 ? 224 GLU B OE2 1 
ATOM   3817  N N   . GLY B 1 227 ? 54.718  50.562  81.361  1.00 37.50 ? 225 GLY B N   1 
ATOM   3818  C CA  . GLY B 1 227 ? 54.709  50.578  79.904  1.00 33.67 ? 225 GLY B CA  1 
ATOM   3819  C C   . GLY B 1 227 ? 55.171  49.214  79.443  1.00 43.37 ? 225 GLY B C   1 
ATOM   3820  O O   . GLY B 1 227 ? 56.000  49.076  78.544  1.00 43.66 ? 225 GLY B O   1 
ATOM   3821  N N   . THR B 1 228 ? 54.592  48.199  80.072  1.00 46.66 ? 226 THR B N   1 
ATOM   3822  C CA  . THR B 1 228 ? 54.931  46.808  79.832  1.00 51.94 ? 226 THR B CA  1 
ATOM   3823  C C   . THR B 1 228 ? 53.687  45.939  79.696  1.00 53.27 ? 226 THR B C   1 
ATOM   3824  O O   . THR B 1 228 ? 52.563  46.410  79.815  1.00 49.71 ? 226 THR B O   1 
ATOM   3825  C CB  . THR B 1 228 ? 55.765  46.314  81.032  1.00 17.50 ? 226 THR B CB  1 
ATOM   3826  O OG1 . THR B 1 228 ? 56.995  47.038  81.057  1.00 54.24 ? 226 THR B OG1 1 
ATOM   3827  C CG2 . THR B 1 228 ? 56.032  44.816  80.982  1.00 28.96 ? 226 THR B CG2 1 
ATOM   3828  N N   . LEU B 1 229 ? 53.917  44.659  79.444  1.00 32.21 ? 227 LEU B N   1 
ATOM   3829  C CA  . LEU B 1 229 ? 52.883  43.644  79.332  1.00 32.00 ? 227 LEU B CA  1 
ATOM   3830  C C   . LEU B 1 229 ? 53.589  42.315  79.543  1.00 41.95 ? 227 LEU B C   1 
ATOM   3831  O O   . LEU B 1 229 ? 54.733  42.142  79.135  1.00 34.96 ? 227 LEU B O   1 
ATOM   3832  C CB  . LEU B 1 229 ? 52.224  43.660  77.961  1.00 22.82 ? 227 LEU B CB  1 
ATOM   3833  C CG  . LEU B 1 229 ? 51.092  44.658  77.706  1.00 36.12 ? 227 LEU B CG  1 
ATOM   3834  C CD1 . LEU B 1 229 ? 50.414  44.256  76.408  1.00 16.64 ? 227 LEU B CD1 1 
ATOM   3835  C CD2 . LEU B 1 229 ? 50.061  44.639  78.832  1.00 22.37 ? 227 LEU B CD2 1 
ATOM   3836  N N   . LEU B 1 230 ? 52.911  41.369  80.172  1.00 21.95 ? 228 LEU B N   1 
ATOM   3837  C CA  . LEU B 1 230 ? 53.518  40.075  80.456  1.00 37.55 ? 228 LEU B CA  1 
ATOM   3838  C C   . LEU B 1 230 ? 52.812  38.958  79.722  1.00 48.41 ? 228 LEU B C   1 
ATOM   3839  O O   . LEU B 1 230 ? 51.594  38.904  79.727  1.00 46.61 ? 228 LEU B O   1 
ATOM   3840  C CB  . LEU B 1 230 ? 53.448  39.807  81.959  1.00 36.70 ? 228 LEU B CB  1 
ATOM   3841  C CG  . LEU B 1 230 ? 54.031  38.496  82.468  1.00 46.54 ? 228 LEU B CG  1 
ATOM   3842  C CD1 . LEU B 1 230 ? 55.540  38.586  82.452  1.00 34.07 ? 228 LEU B CD1 1 
ATOM   3843  C CD2 . LEU B 1 230 ? 53.561  38.236  83.876  1.00 30.34 ? 228 LEU B CD2 1 
ATOM   3844  N N   . LYS B 1 231 ? 53.563  38.070  79.086  1.00 21.01 ? 229 LYS B N   1 
ATOM   3845  C CA  . LYS B 1 231 ? 52.947  36.941  78.384  1.00 14.05 ? 229 LYS B CA  1 
ATOM   3846  C C   . LYS B 1 231 ? 53.326  35.656  79.104  1.00 24.00 ? 229 LYS B C   1 
ATOM   3847  O O   . LYS B 1 231 ? 54.129  34.881  78.601  1.00 28.62 ? 229 LYS B O   1 
ATOM   3848  C CB  . LYS B 1 231 ? 53.435  36.865  76.934  1.00 39.04 ? 229 LYS B CB  1 
ATOM   3849  C CG  . LYS B 1 231 ? 52.684  35.868  76.034  1.00 31.43 ? 229 LYS B CG  1 
ATOM   3850  C CD  . LYS B 1 231 ? 53.227  35.977  74.613  1.00 29.69 ? 229 LYS B CD  1 
ATOM   3851  C CE  . LYS B 1 231 ? 52.191  35.681  73.517  1.00 28.58 ? 229 LYS B CE  1 
ATOM   3852  N NZ  . LYS B 1 231 ? 52.725  35.939  72.115  1.00 41.92 ? 229 LYS B NZ  1 
ATOM   3853  N N   . PRO B 1 232 ? 52.759  35.416  80.298  1.00 19.65 ? 230 PRO B N   1 
ATOM   3854  C CA  . PRO B 1 232 ? 53.078  34.209  81.053  1.00 17.48 ? 230 PRO B CA  1 
ATOM   3855  C C   . PRO B 1 232 ? 52.459  32.961  80.489  1.00 17.30 ? 230 PRO B C   1 
ATOM   3856  O O   . PRO B 1 232 ? 51.613  33.024  79.619  1.00 24.87 ? 230 PRO B O   1 
ATOM   3857  C CB  . PRO B 1 232 ? 52.549  34.528  82.443  1.00 42.00 ? 230 PRO B CB  1 
ATOM   3858  C CG  . PRO B 1 232 ? 51.356  35.298  82.146  1.00 48.51 ? 230 PRO B CG  1 
ATOM   3859  C CD  . PRO B 1 232 ? 51.855  36.266  81.086  1.00 42.59 ? 230 PRO B CD  1 
ATOM   3860  N N   . ASN B 1 233 ? 52.928  31.818  80.954  1.00 36.94 ? 231 ASN B N   1 
ATOM   3861  C CA  . ASN B 1 233 ? 52.358  30.562  80.524  1.00 43.06 ? 231 ASN B CA  1 
ATOM   3862  C C   . ASN B 1 233 ? 51.292  30.400  81.594  1.00 44.78 ? 231 ASN B C   1 
ATOM   3863  O O   . ASN B 1 233 ? 51.119  31.289  82.434  1.00 39.57 ? 231 ASN B O   1 
ATOM   3864  C CB  . ASN B 1 233 ? 53.392  29.442  80.626  1.00 55.63 ? 231 ASN B CB  1 
ATOM   3865  C CG  . ASN B 1 233 ? 54.030  29.364  82.003  1.00 63.50 ? 231 ASN B CG  1 
ATOM   3866  O OD1 . ASN B 1 233 ? 53.677  28.516  82.831  1.00 64.45 ? 231 ASN B OD1 1 
ATOM   3867  N ND2 . ASN B 1 233 ? 54.972  30.264  82.258  1.00 54.00 ? 231 ASN B ND2 1 
ATOM   3868  N N   . MET B 1 234 ? 50.563  29.296  81.563  1.00 39.10 ? 232 MET B N   1 
ATOM   3869  C CA  . MET B 1 234 ? 49.556  29.068  82.579  1.00 34.46 ? 232 MET B CA  1 
ATOM   3870  C C   . MET B 1 234 ? 50.077  27.931  83.432  1.00 33.65 ? 232 MET B C   1 
ATOM   3871  O O   . MET B 1 234 ? 50.551  26.919  82.916  1.00 41.12 ? 232 MET B O   1 
ATOM   3872  C CB  . MET B 1 234 ? 48.208  28.693  81.954  1.00 35.75 ? 232 MET B CB  1 
ATOM   3873  C CG  . MET B 1 234 ? 47.316  29.876  81.597  1.00 39.49 ? 232 MET B CG  1 
ATOM   3874  S SD  . MET B 1 234 ? 45.801  29.323  80.780  1.00 42.64 ? 232 MET B SD  1 
ATOM   3875  C CE  . MET B 1 234 ? 45.301  30.813  79.948  1.00 41.22 ? 232 MET B CE  1 
ATOM   3876  N N   . VAL B 1 235 ? 50.016  28.109  84.744  1.00 41.81 ? 233 VAL B N   1 
ATOM   3877  C CA  . VAL B 1 235 ? 50.488  27.084  85.654  1.00 39.58 ? 233 VAL B CA  1 
ATOM   3878  C C   . VAL B 1 235 ? 49.534  25.917  85.570  1.00 36.64 ? 233 VAL B C   1 
ATOM   3879  O O   . VAL B 1 235 ? 48.415  26.003  86.074  1.00 48.14 ? 233 VAL B O   1 
ATOM   3880  C CB  . VAL B 1 235 ? 50.518  27.595  87.096  1.00 66.04 ? 233 VAL B CB  1 
ATOM   3881  C CG1 . VAL B 1 235 ? 50.896  26.460  88.037  1.00 54.26 ? 233 VAL B CG1 1 
ATOM   3882  C CG2 . VAL B 1 235 ? 51.502  28.753  87.211  1.00 58.04 ? 233 VAL B CG2 1 
ATOM   3883  N N   . THR B 1 236 ? 49.973  24.836  84.927  1.00 28.01 ? 234 THR B N   1 
ATOM   3884  C CA  . THR B 1 236 ? 49.132  23.653  84.785  1.00 28.10 ? 234 THR B CA  1 
ATOM   3885  C C   . THR B 1 236 ? 49.866  22.369  85.162  1.00 35.83 ? 234 THR B C   1 
ATOM   3886  O O   . THR B 1 236 ? 50.627  21.822  84.366  1.00 42.41 ? 234 THR B O   1 
ATOM   3887  C CB  . THR B 1 236 ? 48.620  23.522  83.348  1.00 41.26 ? 234 THR B CB  1 
ATOM   3888  O OG1 . THR B 1 236 ? 49.698  23.108  82.505  1.00 39.03 ? 234 THR B OG1 1 
ATOM   3889  C CG2 . THR B 1 236 ? 48.087  24.862  82.846  1.00 30.98 ? 234 THR B CG2 1 
ATOM   3890  N N   . LYS B 1 243 ? 47.824  13.419  86.825  1.00 92.42 ? 241 LYS B N   1 
ATOM   3891  C CA  . LYS B 1 243 ? 46.941  14.344  87.535  1.00 92.42 ? 241 LYS B CA  1 
ATOM   3892  C C   . LYS B 1 243 ? 46.082  15.161  86.562  1.00 92.42 ? 241 LYS B C   1 
ATOM   3893  O O   . LYS B 1 243 ? 46.593  15.743  85.604  1.00 92.42 ? 241 LYS B O   1 
ATOM   3894  C CB  . LYS B 1 243 ? 47.774  15.291  88.414  1.00 92.42 ? 241 LYS B CB  1 
ATOM   3895  C CG  . LYS B 1 243 ? 47.543  15.171  89.935  1.00 92.42 ? 241 LYS B CG  1 
ATOM   3896  C CD  . LYS B 1 243 ? 46.122  15.589  90.352  1.00 92.42 ? 241 LYS B CD  1 
ATOM   3897  C CE  . LYS B 1 243 ? 45.973  15.776  91.872  1.00 92.42 ? 241 LYS B CE  1 
ATOM   3898  N NZ  . LYS B 1 243 ? 46.672  16.992  92.383  1.00 92.42 ? 241 LYS B NZ  1 
ATOM   3899  N N   . LYS B 1 244 ? 44.776  15.197  86.814  1.00 89.09 ? 242 LYS B N   1 
ATOM   3900  C CA  . LYS B 1 244 ? 43.839  15.948  85.978  1.00 89.09 ? 242 LYS B CA  1 
ATOM   3901  C C   . LYS B 1 244 ? 43.554  17.306  86.626  1.00 89.09 ? 242 LYS B C   1 
ATOM   3902  O O   . LYS B 1 244 ? 43.449  17.398  87.852  1.00 89.09 ? 242 LYS B O   1 
ATOM   3903  C CB  . LYS B 1 244 ? 42.528  15.174  85.841  1.00 90.21 ? 242 LYS B CB  1 
ATOM   3904  C CG  . LYS B 1 244 ? 42.671  13.760  85.296  1.00 90.21 ? 242 LYS B CG  1 
ATOM   3905  C CD  . LYS B 1 244 ? 41.303  13.087  85.181  1.00 90.21 ? 242 LYS B CD  1 
ATOM   3906  C CE  . LYS B 1 244 ? 41.350  11.886  84.247  1.00 90.21 ? 242 LYS B CE  1 
ATOM   3907  N NZ  . LYS B 1 244 ? 40.000  11.279  84.083  1.00 90.21 ? 242 LYS B NZ  1 
ATOM   3908  N N   . TYR B 1 245 ? 43.422  18.361  85.825  1.00 71.21 ? 243 TYR B N   1 
ATOM   3909  C CA  . TYR B 1 245 ? 43.151  19.671  86.405  1.00 67.23 ? 243 TYR B CA  1 
ATOM   3910  C C   . TYR B 1 245 ? 42.007  20.475  85.799  1.00 66.79 ? 243 TYR B C   1 
ATOM   3911  O O   . TYR B 1 245 ? 41.893  20.616  84.585  1.00 71.21 ? 243 TYR B O   1 
ATOM   3912  C CB  . TYR B 1 245 ? 44.423  20.517  86.413  1.00 92.34 ? 243 TYR B CB  1 
ATOM   3913  C CG  . TYR B 1 245 ? 45.482  19.989  87.359  1.00 92.34 ? 243 TYR B CG  1 
ATOM   3914  C CD1 . TYR B 1 245 ? 46.553  19.230  86.886  1.00 92.34 ? 243 TYR B CD1 1 
ATOM   3915  C CD2 . TYR B 1 245 ? 45.415  20.249  88.731  1.00 92.34 ? 243 TYR B CD2 1 
ATOM   3916  C CE1 . TYR B 1 245 ? 47.534  18.749  87.753  1.00 92.34 ? 243 TYR B CE1 1 
ATOM   3917  C CE2 . TYR B 1 245 ? 46.392  19.768  89.607  1.00 92.34 ? 243 TYR B CE2 1 
ATOM   3918  C CZ  . TYR B 1 245 ? 47.448  19.023  89.107  1.00 92.34 ? 243 TYR B CZ  1 
ATOM   3919  O OH  . TYR B 1 245 ? 48.431  18.564  89.950  1.00 92.34 ? 243 TYR B OH  1 
ATOM   3920  N N   . THR B 1 246 ? 41.159  21.000  86.676  1.00 71.34 ? 244 THR B N   1 
ATOM   3921  C CA  . THR B 1 246 ? 40.022  21.801  86.267  1.00 57.61 ? 244 THR B CA  1 
ATOM   3922  C C   . THR B 1 246 ? 40.390  23.268  86.181  1.00 67.70 ? 244 THR B C   1 
ATOM   3923  O O   . THR B 1 246 ? 41.176  23.767  86.986  1.00 73.74 ? 244 THR B O   1 
ATOM   3924  C CB  . THR B 1 246 ? 38.871  21.718  87.268  1.00 92.42 ? 244 THR B CB  1 
ATOM   3925  O OG1 . THR B 1 246 ? 37.825  22.603  86.853  1.00 92.42 ? 244 THR B OG1 1 
ATOM   3926  C CG2 . THR B 1 246 ? 39.324  22.154  88.641  1.00 92.42 ? 244 THR B CG2 1 
ATOM   3927  N N   . PRO B 1 247 ? 39.809  23.984  85.210  1.00 35.52 ? 245 PRO B N   1 
ATOM   3928  C CA  . PRO B 1 247 ? 40.063  25.408  85.017  1.00 31.58 ? 245 PRO B CA  1 
ATOM   3929  C C   . PRO B 1 247 ? 40.074  26.124  86.354  1.00 33.92 ? 245 PRO B C   1 
ATOM   3930  O O   . PRO B 1 247 ? 40.697  27.166  86.503  1.00 39.94 ? 245 PRO B O   1 
ATOM   3931  C CB  . PRO B 1 247 ? 38.897  25.838  84.154  1.00 48.90 ? 245 PRO B CB  1 
ATOM   3932  C CG  . PRO B 1 247 ? 38.733  24.651  83.264  1.00 42.16 ? 245 PRO B CG  1 
ATOM   3933  C CD  . PRO B 1 247 ? 38.853  23.481  84.211  1.00 50.94 ? 245 PRO B CD  1 
ATOM   3934  N N   . GLU B 1 248 ? 39.369  25.554  87.327  1.00 54.88 ? 246 GLU B N   1 
ATOM   3935  C CA  . GLU B 1 248 ? 39.300  26.120  88.669  1.00 54.88 ? 246 GLU B CA  1 
ATOM   3936  C C   . GLU B 1 248 ? 40.700  26.173  89.244  1.00 54.88 ? 246 GLU B C   1 
ATOM   3937  O O   . GLU B 1 248 ? 41.208  27.244  89.579  1.00 54.88 ? 246 GLU B O   1 
ATOM   3938  C CB  . GLU B 1 248 ? 38.412  25.246  89.558  1.00 89.22 ? 246 GLU B CB  1 
ATOM   3939  C CG  . GLU B 1 248 ? 36.943  25.621  89.518  1.00 89.22 ? 246 GLU B CG  1 
ATOM   3940  C CD  . GLU B 1 248 ? 36.436  25.887  88.114  1.00 89.22 ? 246 GLU B CD  1 
ATOM   3941  O OE1 . GLU B 1 248 ? 36.306  24.925  87.326  1.00 89.22 ? 246 GLU B OE1 1 
ATOM   3942  O OE2 . GLU B 1 248 ? 36.174  27.066  87.799  1.00 89.22 ? 246 GLU B OE2 1 
ATOM   3943  N N   . GLN B 1 249 ? 41.313  24.997  89.327  1.00 56.00 ? 247 GLN B N   1 
ATOM   3944  C CA  . GLN B 1 249 ? 42.663  24.802  89.858  1.00 56.00 ? 247 GLN B CA  1 
ATOM   3945  C C   . GLN B 1 249 ? 43.732  25.453  88.989  1.00 56.00 ? 247 GLN B C   1 
ATOM   3946  O O   . GLN B 1 249 ? 44.512  26.293  89.446  1.00 56.00 ? 247 GLN B O   1 
ATOM   3947  C CB  . GLN B 1 249 ? 42.926  23.305  89.949  1.00 58.92 ? 247 GLN B CB  1 
ATOM   3948  C CG  . GLN B 1 249 ? 41.707  22.566  90.441  1.00 58.92 ? 247 GLN B CG  1 
ATOM   3949  C CD  . GLN B 1 249 ? 41.763  21.093  90.164  1.00 58.92 ? 247 GLN B CD  1 
ATOM   3950  O OE1 . GLN B 1 249 ? 42.143  20.671  89.070  1.00 58.92 ? 247 GLN B OE1 1 
ATOM   3951  N NE2 . GLN B 1 249 ? 41.362  20.290  91.148  1.00 58.92 ? 247 GLN B NE2 1 
ATOM   3952  N N   . VAL B 1 250 ? 43.764  25.027  87.734  1.00 40.27 ? 248 VAL B N   1 
ATOM   3953  C CA  . VAL B 1 250 ? 44.701  25.546  86.765  1.00 40.27 ? 248 VAL B CA  1 
ATOM   3954  C C   . VAL B 1 250 ? 44.713  27.069  86.807  1.00 40.27 ? 248 VAL B C   1 
ATOM   3955  O O   . VAL B 1 250 ? 45.725  27.698  86.517  1.00 40.27 ? 248 VAL B O   1 
ATOM   3956  C CB  . VAL B 1 250 ? 44.320  25.061  85.355  1.00 21.03 ? 248 VAL B CB  1 
ATOM   3957  C CG1 . VAL B 1 250 ? 44.716  26.107  84.321  1.00 21.03 ? 248 VAL B CG1 1 
ATOM   3958  C CG2 . VAL B 1 250 ? 45.004  23.686  85.062  1.00 21.03 ? 248 VAL B CG2 1 
ATOM   3959  N N   . ALA B 1 251 ? 43.585  27.657  87.177  1.00 28.23 ? 249 ALA B N   1 
ATOM   3960  C CA  . ALA B 1 251 ? 43.479  29.107  87.262  1.00 28.23 ? 249 ALA B CA  1 
ATOM   3961  C C   . ALA B 1 251 ? 43.988  29.619  88.609  1.00 28.23 ? 249 ALA B C   1 
ATOM   3962  O O   . ALA B 1 251 ? 44.664  30.646  88.679  1.00 28.23 ? 249 ALA B O   1 
ATOM   3963  C CB  . ALA B 1 251 ? 42.032  29.535  87.061  1.00 89.03 ? 249 ALA B CB  1 
ATOM   3964  N N   . MET B 1 252 ? 43.646  28.908  89.677  1.00 60.60 ? 250 MET B N   1 
ATOM   3965  C CA  . MET B 1 252 ? 44.077  29.290  91.014  1.00 60.60 ? 250 MET B CA  1 
ATOM   3966  C C   . MET B 1 252 ? 45.598  29.221  91.107  1.00 60.60 ? 250 MET B C   1 
ATOM   3967  O O   . MET B 1 252 ? 46.270  30.234  91.316  1.00 60.60 ? 250 MET B O   1 
ATOM   3968  C CB  . MET B 1 252 ? 43.462  28.352  92.043  1.00 36.15 ? 250 MET B CB  1 
ATOM   3969  C CG  . MET B 1 252 ? 43.923  28.613  93.451  1.00 36.15 ? 250 MET B CG  1 
ATOM   3970  S SD  . MET B 1 252 ? 43.300  30.157  94.143  1.00 36.15 ? 250 MET B SD  1 
ATOM   3971  C CE  . MET B 1 252 ? 42.642  29.546  95.708  1.00 36.15 ? 250 MET B CE  1 
ATOM   3972  N N   . ALA B 1 253 ? 46.133  28.013  90.955  1.00 71.02 ? 251 ALA B N   1 
ATOM   3973  C CA  . ALA B 1 253 ? 47.573  27.795  90.998  1.00 71.02 ? 251 ALA B CA  1 
ATOM   3974  C C   . ALA B 1 253 ? 48.256  28.951  90.283  1.00 71.02 ? 251 ALA B C   1 
ATOM   3975  O O   . ALA B 1 253 ? 49.275  29.473  90.729  1.00 71.02 ? 251 ALA B O   1 
ATOM   3976  C CB  . ALA B 1 253 ? 47.915  26.482  90.299  1.00 2.55  ? 251 ALA B CB  1 
ATOM   3977  N N   . THR B 1 254 ? 47.662  29.347  89.168  1.00 31.41 ? 252 THR B N   1 
ATOM   3978  C CA  . THR B 1 254 ? 48.180  30.423  88.349  1.00 31.41 ? 252 THR B CA  1 
ATOM   3979  C C   . THR B 1 254 ? 48.077  31.810  88.960  1.00 31.41 ? 252 THR B C   1 
ATOM   3980  O O   . THR B 1 254 ? 49.102  32.461  89.183  1.00 31.41 ? 252 THR B O   1 
ATOM   3981  C CB  . THR B 1 254 ? 47.475  30.461  86.981  1.00 18.24 ? 252 THR B CB  1 
ATOM   3982  O OG1 . THR B 1 254 ? 47.866  29.309  86.218  1.00 18.24 ? 252 THR B OG1 1 
ATOM   3983  C CG2 . THR B 1 254 ? 47.816  31.775  86.226  1.00 18.24 ? 252 THR B CG2 1 
ATOM   3984  N N   . VAL B 1 255 ? 46.856  32.277  89.212  1.00 52.00 ? 253 VAL B N   1 
ATOM   3985  C CA  . VAL B 1 255 ? 46.672  33.614  89.771  1.00 52.00 ? 253 VAL B CA  1 
ATOM   3986  C C   . VAL B 1 255 ? 47.432  33.763  91.078  1.00 52.00 ? 253 VAL B C   1 
ATOM   3987  O O   . VAL B 1 255 ? 47.978  34.832  91.384  1.00 52.00 ? 253 VAL B O   1 
ATOM   3988  C CB  . VAL B 1 255 ? 45.192  33.924  89.995  1.00 13.27 ? 253 VAL B CB  1 
ATOM   3989  C CG1 . VAL B 1 255 ? 45.024  35.366  90.486  1.00 13.27 ? 253 VAL B CG1 1 
ATOM   3990  C CG2 . VAL B 1 255 ? 44.434  33.709  88.694  1.00 13.27 ? 253 VAL B CG2 1 
ATOM   3991  N N   . THR B 1 256 ? 47.464  32.686  91.851  1.00 47.49 ? 254 THR B N   1 
ATOM   3992  C CA  . THR B 1 256 ? 48.199  32.700  93.101  1.00 47.49 ? 254 THR B CA  1 
ATOM   3993  C C   . THR B 1 256 ? 49.586  33.210  92.734  1.00 47.49 ? 254 THR B C   1 
ATOM   3994  O O   . THR B 1 256 ? 49.943  34.366  92.999  1.00 47.49 ? 254 THR B O   1 
ATOM   3995  C CB  . THR B 1 256 ? 48.304  31.282  93.667  1.00 33.49 ? 254 THR B CB  1 
ATOM   3996  O OG1 . THR B 1 256 ? 47.105  30.961  94.380  1.00 33.49 ? 254 THR B OG1 1 
ATOM   3997  C CG2 . THR B 1 256 ? 49.493  31.164  94.581  1.00 33.49 ? 254 THR B CG2 1 
ATOM   3998  N N   . ALA B 1 257 ? 50.340  32.331  92.084  1.00 30.56 ? 255 ALA B N   1 
ATOM   3999  C CA  . ALA B 1 257 ? 51.682  32.618  91.629  1.00 30.56 ? 255 ALA B CA  1 
ATOM   4000  C C   . ALA B 1 257 ? 51.803  33.994  90.986  1.00 30.56 ? 255 ALA B C   1 
ATOM   4001  O O   . ALA B 1 257 ? 52.788  34.697  91.196  1.00 30.56 ? 255 ALA B O   1 
ATOM   4002  C CB  . ALA B 1 257 ? 52.110  31.561  90.661  1.00 1.56  ? 255 ALA B CB  1 
ATOM   4003  N N   . LEU B 1 258 ? 50.817  34.386  90.195  1.00 41.23 ? 256 LEU B N   1 
ATOM   4004  C CA  . LEU B 1 258 ? 50.886  35.696  89.571  1.00 41.23 ? 256 LEU B CA  1 
ATOM   4005  C C   . LEU B 1 258 ? 50.832  36.831  90.590  1.00 41.23 ? 256 LEU B C   1 
ATOM   4006  O O   . LEU B 1 258 ? 51.569  37.812  90.470  1.00 41.23 ? 256 LEU B O   1 
ATOM   4007  C CB  . LEU B 1 258 ? 49.759  35.883  88.553  1.00 41.97 ? 256 LEU B CB  1 
ATOM   4008  C CG  . LEU B 1 258 ? 50.000  35.331  87.152  1.00 41.97 ? 256 LEU B CG  1 
ATOM   4009  C CD1 . LEU B 1 258 ? 48.911  35.796  86.243  1.00 41.97 ? 256 LEU B CD1 1 
ATOM   4010  C CD2 . LEU B 1 258 ? 51.326  35.835  86.625  1.00 41.97 ? 256 LEU B CD2 1 
ATOM   4011  N N   . HIS B 1 259 ? 49.978  36.712  91.602  1.00 46.89 ? 257 HIS B N   1 
ATOM   4012  C CA  . HIS B 1 259 ? 49.888  37.802  92.563  1.00 46.89 ? 257 HIS B CA  1 
ATOM   4013  C C   . HIS B 1 259 ? 50.925  37.699  93.656  1.00 46.89 ? 257 HIS B C   1 
ATOM   4014  O O   . HIS B 1 259 ? 50.896  38.451  94.625  1.00 46.89 ? 257 HIS B O   1 
ATOM   4015  C CB  . HIS B 1 259 ? 48.472  37.909  93.151  1.00 40.91 ? 257 HIS B CB  1 
ATOM   4016  C CG  . HIS B 1 259 ? 48.253  37.100  94.389  1.00 40.91 ? 257 HIS B CG  1 
ATOM   4017  N ND1 . HIS B 1 259 ? 48.539  35.752  94.465  1.00 40.91 ? 257 HIS B ND1 1 
ATOM   4018  C CD2 . HIS B 1 259 ? 47.745  37.450  95.595  1.00 40.91 ? 257 HIS B CD2 1 
ATOM   4019  C CE1 . HIS B 1 259 ? 48.216  35.309  95.667  1.00 40.91 ? 257 HIS B CE1 1 
ATOM   4020  N NE2 . HIS B 1 259 ? 47.732  36.318  96.372  1.00 40.91 ? 257 HIS B NE2 1 
ATOM   4021  N N   . ARG B 1 260 ? 51.847  36.761  93.494  1.00 54.14 ? 258 ARG B N   1 
ATOM   4022  C CA  . ARG B 1 260 ? 52.934  36.595  94.452  1.00 54.14 ? 258 ARG B CA  1 
ATOM   4023  C C   . ARG B 1 260 ? 54.120  37.388  93.910  1.00 54.14 ? 258 ARG B C   1 
ATOM   4024  O O   . ARG B 1 260 ? 54.838  38.046  94.669  1.00 54.14 ? 258 ARG B O   1 
ATOM   4025  C CB  . ARG B 1 260 ? 53.376  35.132  94.544  1.00 32.26 ? 258 ARG B CB  1 
ATOM   4026  C CG  . ARG B 1 260 ? 52.282  34.123  94.784  1.00 32.26 ? 258 ARG B CG  1 
ATOM   4027  C CD  . ARG B 1 260 ? 52.103  33.812  96.271  1.00 32.26 ? 258 ARG B CD  1 
ATOM   4028  N NE  . ARG B 1 260 ? 51.910  32.378  96.476  1.00 32.26 ? 258 ARG B NE  1 
ATOM   4029  C CZ  . ARG B 1 260 ? 51.704  31.805  97.653  1.00 32.26 ? 258 ARG B CZ  1 
ATOM   4030  N NH1 . ARG B 1 260 ? 51.658  32.535  98.754  1.00 32.26 ? 258 ARG B NH1 1 
ATOM   4031  N NH2 . ARG B 1 260 ? 51.560  30.495  97.724  1.00 32.26 ? 258 ARG B NH2 1 
ATOM   4032  N N   . THR B 1 261 ? 54.277  37.325  92.580  1.00 27.00 ? 259 THR B N   1 
ATOM   4033  C CA  . THR B 1 261 ? 55.389  37.924  91.832  1.00 27.00 ? 259 THR B CA  1 
ATOM   4034  C C   . THR B 1 261 ? 55.193  39.147  90.898  1.00 27.00 ? 259 THR B C   1 
ATOM   4035  O O   . THR B 1 261 ? 55.987  40.092  90.917  1.00 27.00 ? 259 THR B O   1 
ATOM   4036  C CB  . THR B 1 261 ? 56.025  36.827  91.001  1.00 32.73 ? 259 THR B CB  1 
ATOM   4037  O OG1 . THR B 1 261 ? 55.015  36.255  90.161  1.00 32.73 ? 259 THR B OG1 1 
ATOM   4038  C CG2 . THR B 1 261 ? 56.567  35.734  91.893  1.00 32.73 ? 259 THR B CG2 1 
ATOM   4039  N N   . VAL B 1 262 ? 54.166  39.128  90.066  1.00 31.86 ? 260 VAL B N   1 
ATOM   4040  C CA  . VAL B 1 262 ? 53.966  40.233  89.140  1.00 31.86 ? 260 VAL B CA  1 
ATOM   4041  C C   . VAL B 1 262 ? 53.291  41.458  89.736  1.00 31.86 ? 260 VAL B C   1 
ATOM   4042  O O   . VAL B 1 262 ? 52.109  41.406  90.073  1.00 31.86 ? 260 VAL B O   1 
ATOM   4043  C CB  . VAL B 1 262 ? 53.138  39.788  87.932  1.00 50.05 ? 260 VAL B CB  1 
ATOM   4044  C CG1 . VAL B 1 262 ? 53.095  40.911  86.886  1.00 50.05 ? 260 VAL B CG1 1 
ATOM   4045  C CG2 . VAL B 1 262 ? 53.719  38.493  87.355  1.00 50.05 ? 260 VAL B CG2 1 
ATOM   4046  N N   . PRO B 1 263 ? 54.031  42.581  89.854  1.00 34.10 ? 261 PRO B N   1 
ATOM   4047  C CA  . PRO B 1 263 ? 53.596  43.872  90.392  1.00 34.10 ? 261 PRO B CA  1 
ATOM   4048  C C   . PRO B 1 263 ? 52.261  44.402  89.904  1.00 34.10 ? 261 PRO B C   1 
ATOM   4049  O O   . PRO B 1 263 ? 51.823  44.122  88.789  1.00 34.10 ? 261 PRO B O   1 
ATOM   4050  C CB  . PRO B 1 263 ? 54.732  44.794  89.998  1.00 16.37 ? 261 PRO B CB  1 
ATOM   4051  C CG  . PRO B 1 263 ? 55.877  43.953  90.214  1.00 16.37 ? 261 PRO B CG  1 
ATOM   4052  C CD  . PRO B 1 263 ? 55.477  42.627  89.590  1.00 16.37 ? 261 PRO B CD  1 
ATOM   4053  N N   . ALA B 1 264 ? 51.636  45.206  90.750  1.00 48.48 ? 262 ALA B N   1 
ATOM   4054  C CA  . ALA B 1 264 ? 50.361  45.811  90.419  1.00 48.48 ? 262 ALA B CA  1 
ATOM   4055  C C   . ALA B 1 264 ? 50.542  46.980  89.443  1.00 48.48 ? 262 ALA B C   1 
ATOM   4056  O O   . ALA B 1 264 ? 49.573  47.640  89.078  1.00 48.48 ? 262 ALA B O   1 
ATOM   4057  C CB  . ALA B 1 264 ? 49.695  46.305  91.680  1.00 66.46 ? 262 ALA B CB  1 
ATOM   4058  N N   . ALA B 1 265 ? 51.776  47.246  89.029  1.00 22.05 ? 263 ALA B N   1 
ATOM   4059  C CA  . ALA B 1 265 ? 52.034  48.343  88.112  1.00 19.06 ? 263 ALA B CA  1 
ATOM   4060  C C   . ALA B 1 265 ? 51.931  47.887  86.665  1.00 18.30 ? 263 ALA B C   1 
ATOM   4061  O O   . ALA B 1 265 ? 51.618  48.680  85.773  1.00 23.45 ? 263 ALA B O   1 
ATOM   4062  C CB  . ALA B 1 265 ? 53.389  48.919  88.380  1.00 64.92 ? 263 ALA B CB  1 
ATOM   4063  N N   . VAL B 1 266 ? 52.212  46.609  86.432  1.00 49.69 ? 264 VAL B N   1 
ATOM   4064  C CA  . VAL B 1 266 ? 52.112  46.036  85.095  1.00 45.84 ? 264 VAL B CA  1 
ATOM   4065  C C   . VAL B 1 266 ? 50.631  46.164  84.749  1.00 55.26 ? 264 VAL B C   1 
ATOM   4066  O O   . VAL B 1 266 ? 49.777  45.626  85.451  1.00 56.81 ? 264 VAL B O   1 
ATOM   4067  C CB  . VAL B 1 266 ? 52.520  44.545  85.102  1.00 49.07 ? 264 VAL B CB  1 
ATOM   4068  C CG1 . VAL B 1 266 ? 52.284  43.935  83.757  1.00 35.89 ? 264 VAL B CG1 1 
ATOM   4069  C CG2 . VAL B 1 266 ? 53.973  44.411  85.433  1.00 43.08 ? 264 VAL B CG2 1 
ATOM   4070  N N   . PRO B 1 267 ? 50.299  46.889  83.672  1.00 68.66 ? 265 PRO B N   1 
ATOM   4071  C CA  . PRO B 1 267 ? 48.880  47.031  83.331  1.00 58.11 ? 265 PRO B CA  1 
ATOM   4072  C C   . PRO B 1 267 ? 48.158  45.798  82.794  1.00 60.93 ? 265 PRO B C   1 
ATOM   4073  O O   . PRO B 1 267 ? 46.927  45.770  82.768  1.00 73.81 ? 265 PRO B O   1 
ATOM   4074  C CB  . PRO B 1 267 ? 48.875  48.203  82.349  1.00 55.75 ? 265 PRO B CB  1 
ATOM   4075  C CG  . PRO B 1 267 ? 50.209  48.082  81.682  1.00 61.01 ? 265 PRO B CG  1 
ATOM   4076  C CD  . PRO B 1 267 ? 51.140  47.755  82.830  1.00 63.21 ? 265 PRO B CD  1 
ATOM   4077  N N   . GLY B 1 268 ? 48.893  44.772  82.388  1.00 9.51  ? 266 GLY B N   1 
ATOM   4078  C CA  . GLY B 1 268 ? 48.203  43.605  81.885  1.00 9.43  ? 266 GLY B CA  1 
ATOM   4079  C C   . GLY B 1 268 ? 48.996  42.340  81.638  1.00 13.10 ? 266 GLY B C   1 
ATOM   4080  O O   . GLY B 1 268 ? 50.099  42.372  81.119  1.00 12.21 ? 266 GLY B O   1 
ATOM   4081  N N   . ILE B 1 269 ? 48.415  41.207  81.994  1.00 14.52 ? 267 ILE B N   1 
ATOM   4082  C CA  . ILE B 1 269 ? 49.058  39.921  81.803  1.00 8.74  ? 267 ILE B CA  1 
ATOM   4083  C C   . ILE B 1 269 ? 48.305  39.186  80.688  1.00 19.86 ? 267 ILE B C   1 
ATOM   4084  O O   . ILE B 1 269 ? 47.193  38.716  80.900  1.00 21.26 ? 267 ILE B O   1 
ATOM   4085  C CB  . ILE B 1 269 ? 48.971  39.079  83.098  1.00 27.73 ? 267 ILE B CB  1 
ATOM   4086  C CG1 . ILE B 1 269 ? 49.474  39.891  84.293  1.00 20.68 ? 267 ILE B CG1 1 
ATOM   4087  C CG2 . ILE B 1 269 ? 49.794  37.826  82.974  1.00 19.25 ? 267 ILE B CG2 1 
ATOM   4088  C CD1 . ILE B 1 269 ? 49.306  39.183  85.647  1.00 49.23 ? 267 ILE B CD1 1 
ATOM   4089  N N   . CYS B 1 270 ? 48.896  39.086  79.504  1.00 20.09 ? 268 CYS B N   1 
ATOM   4090  C CA  . CYS B 1 270 ? 48.242  38.388  78.401  1.00 16.46 ? 268 CYS B CA  1 
ATOM   4091  C C   . CYS B 1 270 ? 48.755  36.964  78.202  1.00 23.13 ? 268 CYS B C   1 
ATOM   4092  O O   . CYS B 1 270 ? 49.637  36.738  77.386  1.00 20.15 ? 268 CYS B O   1 
ATOM   4093  C CB  . CYS B 1 270 ? 48.425  39.173  77.109  1.00 36.82 ? 268 CYS B CB  1 
ATOM   4094  S SG  . CYS B 1 270 ? 47.848  40.885  77.246  1.00 39.07 ? 268 CYS B SG  1 
ATOM   4095  N N   . PHE B 1 271 ? 48.180  36.013  78.939  1.00 23.40 ? 269 PHE B N   1 
ATOM   4096  C CA  . PHE B 1 271 ? 48.543  34.584  78.872  1.00 26.12 ? 269 PHE B CA  1 
ATOM   4097  C C   . PHE B 1 271 ? 48.684  33.948  77.500  1.00 25.89 ? 269 PHE B C   1 
ATOM   4098  O O   . PHE B 1 271 ? 47.853  34.160  76.627  1.00 29.11 ? 269 PHE B O   1 
ATOM   4099  C CB  . PHE B 1 271 ? 47.523  33.735  79.632  1.00 47.37 ? 269 PHE B CB  1 
ATOM   4100  C CG  . PHE B 1 271 ? 47.477  34.017  81.093  1.00 57.13 ? 269 PHE B CG  1 
ATOM   4101  C CD1 . PHE B 1 271 ? 47.006  35.245  81.564  1.00 49.15 ? 269 PHE B CD1 1 
ATOM   4102  C CD2 . PHE B 1 271 ? 47.907  33.062  82.006  1.00 57.56 ? 269 PHE B CD2 1 
ATOM   4103  C CE1 . PHE B 1 271 ? 46.963  35.522  82.934  1.00 59.22 ? 269 PHE B CE1 1 
ATOM   4104  C CE2 . PHE B 1 271 ? 47.871  33.322  83.372  1.00 56.10 ? 269 PHE B CE2 1 
ATOM   4105  C CZ  . PHE B 1 271 ? 47.395  34.558  83.839  1.00 61.63 ? 269 PHE B CZ  1 
ATOM   4106  N N   . LEU B 1 272 ? 49.710  33.131  77.312  1.00 17.33 ? 270 LEU B N   1 
ATOM   4107  C CA  . LEU B 1 272 ? 49.890  32.467  76.032  1.00 14.58 ? 270 LEU B CA  1 
ATOM   4108  C C   . LEU B 1 272 ? 49.217  31.109  76.195  1.00 23.03 ? 270 LEU B C   1 
ATOM   4109  O O   . LEU B 1 272 ? 49.329  30.487  77.251  1.00 19.63 ? 270 LEU B O   1 
ATOM   4110  C CB  . LEU B 1 272 ? 51.379  32.323  75.711  1.00 29.92 ? 270 LEU B CB  1 
ATOM   4111  C CG  . LEU B 1 272 ? 52.231  31.371  76.555  1.00 48.34 ? 270 LEU B CG  1 
ATOM   4112  C CD1 . LEU B 1 272 ? 51.996  29.896  76.137  1.00 32.39 ? 270 LEU B CD1 1 
ATOM   4113  C CD2 . LEU B 1 272 ? 53.696  31.752  76.370  1.00 36.50 ? 270 LEU B CD2 1 
ATOM   4114  N N   . SER B 1 273 ? 48.513  30.665  75.154  1.00 60.70 ? 271 SER B N   1 
ATOM   4115  C CA  . SER B 1 273 ? 47.770  29.397  75.176  1.00 59.42 ? 271 SER B CA  1 
ATOM   4116  C C   . SER B 1 273 ? 48.549  28.173  74.713  1.00 61.79 ? 271 SER B C   1 
ATOM   4117  O O   . SER B 1 273 ? 47.992  27.076  74.650  1.00 63.64 ? 271 SER B O   1 
ATOM   4118  C CB  . SER B 1 273 ? 46.508  29.507  74.304  1.00 90.20 ? 271 SER B CB  1 
ATOM   4119  O OG  . SER B 1 273 ? 46.838  29.526  72.916  1.00 92.42 ? 271 SER B OG  1 
ATOM   4120  N N   . GLY B 1 274 ? 49.821  28.365  74.386  1.00 54.43 ? 272 GLY B N   1 
ATOM   4121  C CA  . GLY B 1 274 ? 50.639  27.266  73.911  1.00 60.81 ? 272 GLY B CA  1 
ATOM   4122  C C   . GLY B 1 274 ? 50.183  25.864  74.285  1.00 62.95 ? 272 GLY B C   1 
ATOM   4123  O O   . GLY B 1 274 ? 50.250  25.470  75.449  1.00 77.33 ? 272 GLY B O   1 
ATOM   4124  N N   . GLY B 1 275 ? 49.701  25.113  73.299  1.00 70.87 ? 273 GLY B N   1 
ATOM   4125  C CA  . GLY B 1 275 ? 49.279  23.744  73.546  1.00 79.45 ? 273 GLY B CA  1 
ATOM   4126  C C   . GLY B 1 275 ? 47.807  23.524  73.803  1.00 77.46 ? 273 GLY B C   1 
ATOM   4127  O O   . GLY B 1 275 ? 47.251  22.502  73.409  1.00 83.68 ? 273 GLY B O   1 
ATOM   4128  N N   . MET B 1 276 ? 47.171  24.480  74.465  1.00 79.39 ? 274 MET B N   1 
ATOM   4129  C CA  . MET B 1 276 ? 45.755  24.367  74.776  1.00 75.93 ? 274 MET B CA  1 
ATOM   4130  C C   . MET B 1 276 ? 44.855  24.510  73.543  1.00 79.51 ? 274 MET B C   1 
ATOM   4131  O O   . MET B 1 276 ? 45.207  25.170  72.559  1.00 79.41 ? 274 MET B O   1 
ATOM   4132  C CB  . MET B 1 276 ? 45.364  25.422  75.822  1.00 48.09 ? 274 MET B CB  1 
ATOM   4133  C CG  . MET B 1 276 ? 46.239  25.415  77.062  1.00 46.00 ? 274 MET B CG  1 
ATOM   4134  S SD  . MET B 1 276 ? 45.662  26.495  78.389  1.00 52.64 ? 274 MET B SD  1 
ATOM   4135  C CE  . MET B 1 276 ? 45.778  28.069  77.576  1.00 70.38 ? 274 MET B CE  1 
ATOM   4136  N N   . SER B 1 277 ? 43.695  23.864  73.606  1.00 58.53 ? 275 SER B N   1 
ATOM   4137  C CA  . SER B 1 277 ? 42.714  23.939  72.536  1.00 58.53 ? 275 SER B CA  1 
ATOM   4138  C C   . SER B 1 277 ? 42.099  25.333  72.649  1.00 58.53 ? 275 SER B C   1 
ATOM   4139  O O   . SER B 1 277 ? 42.215  25.976  73.692  1.00 58.53 ? 275 SER B O   1 
ATOM   4140  C CB  . SER B 1 277 ? 41.630  22.876  72.737  1.00 52.14 ? 275 SER B CB  1 
ATOM   4141  O OG  . SER B 1 277 ? 40.808  23.174  73.855  1.00 52.14 ? 275 SER B OG  1 
ATOM   4142  N N   . GLU B 1 278 ? 41.450  25.804  71.589  1.00 61.44 ? 276 GLU B N   1 
ATOM   4143  C CA  . GLU B 1 278 ? 40.839  27.131  71.621  1.00 61.44 ? 276 GLU B CA  1 
ATOM   4144  C C   . GLU B 1 278 ? 39.879  27.226  72.796  1.00 61.44 ? 276 GLU B C   1 
ATOM   4145  O O   . GLU B 1 278 ? 39.747  28.285  73.415  1.00 61.44 ? 276 GLU B O   1 
ATOM   4146  C CB  . GLU B 1 278 ? 40.061  27.407  70.328  1.00 44.12 ? 276 GLU B CB  1 
ATOM   4147  C CG  . GLU B 1 278 ? 40.868  27.244  69.053  1.00 44.12 ? 276 GLU B CG  1 
ATOM   4148  C CD  . GLU B 1 278 ? 40.014  27.327  67.800  1.00 44.12 ? 276 GLU B CD  1 
ATOM   4149  O OE1 . GLU B 1 278 ? 39.042  26.547  67.690  1.00 44.12 ? 276 GLU B OE1 1 
ATOM   4150  O OE2 . GLU B 1 278 ? 40.319  28.166  66.922  1.00 44.12 ? 276 GLU B OE2 1 
ATOM   4151  N N   . GLU B 1 279 ? 39.222  26.105  73.091  1.00 24.20 ? 277 GLU B N   1 
ATOM   4152  C CA  . GLU B 1 279 ? 38.231  26.015  74.159  1.00 24.20 ? 277 GLU B CA  1 
ATOM   4153  C C   . GLU B 1 279 ? 38.857  26.171  75.529  1.00 24.20 ? 277 GLU B C   1 
ATOM   4154  O O   . GLU B 1 279 ? 38.399  26.964  76.349  1.00 24.20 ? 277 GLU B O   1 
ATOM   4155  C CB  . GLU B 1 279 ? 37.518  24.664  74.078  1.00 63.07 ? 277 GLU B CB  1 
ATOM   4156  C CG  . GLU B 1 279 ? 36.234  24.569  74.878  1.00 63.07 ? 277 GLU B CG  1 
ATOM   4157  C CD  . GLU B 1 279 ? 35.257  25.673  74.524  1.00 63.07 ? 277 GLU B CD  1 
ATOM   4158  O OE1 . GLU B 1 279 ? 35.334  26.188  73.390  1.00 63.07 ? 277 GLU B OE1 1 
ATOM   4159  O OE2 . GLU B 1 279 ? 34.407  26.020  75.373  1.00 63.07 ? 277 GLU B OE2 1 
ATOM   4160  N N   . ASP B 1 280 ? 39.907  25.398  75.775  1.00 37.02 ? 278 ASP B N   1 
ATOM   4161  C CA  . ASP B 1 280 ? 40.588  25.440  77.053  1.00 37.02 ? 278 ASP B CA  1 
ATOM   4162  C C   . ASP B 1 280 ? 41.275  26.754  77.292  1.00 37.02 ? 278 ASP B C   1 
ATOM   4163  O O   . ASP B 1 280 ? 41.290  27.235  78.422  1.00 37.02 ? 278 ASP B O   1 
ATOM   4164  C CB  . ASP B 1 280 ? 41.577  24.298  77.149  1.00 40.21 ? 278 ASP B CB  1 
ATOM   4165  C CG  . ASP B 1 280 ? 40.885  22.981  77.292  1.00 40.21 ? 278 ASP B CG  1 
ATOM   4166  O OD1 . ASP B 1 280 ? 40.339  22.711  78.378  1.00 40.21 ? 278 ASP B OD1 1 
ATOM   4167  O OD2 . ASP B 1 280 ? 40.857  22.222  76.311  1.00 40.21 ? 278 ASP B OD2 1 
ATOM   4168  N N   . ALA B 1 281 ? 41.840  27.346  76.244  1.00 35.65 ? 279 ALA B N   1 
ATOM   4169  C CA  . ALA B 1 281 ? 42.500  28.635  76.413  1.00 35.65 ? 279 ALA B CA  1 
ATOM   4170  C C   . ALA B 1 281 ? 41.452  29.596  76.945  1.00 35.65 ? 279 ALA B C   1 
ATOM   4171  O O   . ALA B 1 281 ? 41.777  30.505  77.713  1.00 35.65 ? 279 ALA B O   1 
ATOM   4172  C CB  . ALA B 1 281 ? 43.069  29.150  75.086  1.00 1.56  ? 279 ALA B CB  1 
ATOM   4173  N N   . THR B 1 282 ? 40.192  29.371  76.560  1.00 34.15 ? 280 THR B N   1 
ATOM   4174  C CA  . THR B 1 282 ? 39.071  30.220  76.992  1.00 34.15 ? 280 THR B CA  1 
ATOM   4175  C C   . THR B 1 282 ? 38.524  29.893  78.396  1.00 34.15 ? 280 THR B C   1 
ATOM   4176  O O   . THR B 1 282 ? 38.303  30.799  79.209  1.00 34.15 ? 280 THR B O   1 
ATOM   4177  C CB  . THR B 1 282 ? 37.929  30.159  75.984  1.00 40.43 ? 280 THR B CB  1 
ATOM   4178  O OG1 . THR B 1 282 ? 38.447  30.405  74.672  1.00 40.43 ? 280 THR B OG1 1 
ATOM   4179  C CG2 . THR B 1 282 ? 36.904  31.217  76.292  1.00 40.43 ? 280 THR B CG2 1 
ATOM   4180  N N   . LEU B 1 283 ? 38.308  28.611  78.679  1.00 23.39 ? 281 LEU B N   1 
ATOM   4181  C CA  . LEU B 1 283 ? 37.825  28.188  79.990  1.00 23.39 ? 281 LEU B CA  1 
ATOM   4182  C C   . LEU B 1 283 ? 38.809  28.656  81.075  1.00 23.39 ? 281 LEU B C   1 
ATOM   4183  O O   . LEU B 1 283 ? 38.417  29.113  82.163  1.00 23.39 ? 281 LEU B O   1 
ATOM   4184  C CB  . LEU B 1 283 ? 37.734  26.665  80.037  1.00 34.44 ? 281 LEU B CB  1 
ATOM   4185  C CG  . LEU B 1 283 ? 36.933  25.992  78.930  1.00 34.44 ? 281 LEU B CG  1 
ATOM   4186  C CD1 . LEU B 1 283 ? 37.113  24.487  79.027  1.00 34.44 ? 281 LEU B CD1 1 
ATOM   4187  C CD2 . LEU B 1 283 ? 35.464  26.370  79.048  1.00 34.44 ? 281 LEU B CD2 1 
ATOM   4188  N N   . ASN B 1 284 ? 40.097  28.512  80.767  1.00 34.12 ? 282 ASN B N   1 
ATOM   4189  C CA  . ASN B 1 284 ? 41.172  28.889  81.672  1.00 34.12 ? 282 ASN B CA  1 
ATOM   4190  C C   . ASN B 1 284 ? 41.367  30.396  81.757  1.00 34.12 ? 282 ASN B C   1 
ATOM   4191  O O   . ASN B 1 284 ? 41.707  30.913  82.814  1.00 34.12 ? 282 ASN B O   1 
ATOM   4192  C CB  . ASN B 1 284 ? 42.459  28.207  81.232  1.00 21.49 ? 282 ASN B CB  1 
ATOM   4193  C CG  . ASN B 1 284 ? 42.404  26.713  81.414  1.00 21.49 ? 282 ASN B CG  1 
ATOM   4194  O OD1 . ASN B 1 284 ? 41.329  26.129  81.462  1.00 21.49 ? 282 ASN B OD1 1 
ATOM   4195  N ND2 . ASN B 1 284 ? 43.567  26.081  81.504  1.00 21.49 ? 282 ASN B ND2 1 
ATOM   4196  N N   . LEU B 1 285 ? 41.168  31.110  80.654  1.00 24.43 ? 283 LEU B N   1 
ATOM   4197  C CA  . LEU B 1 285 ? 41.314  32.553  80.732  1.00 24.43 ? 283 LEU B CA  1 
ATOM   4198  C C   . LEU B 1 285 ? 40.099  33.108  81.446  1.00 24.43 ? 283 LEU B C   1 
ATOM   4199  O O   . LEU B 1 285 ? 40.169  34.154  82.091  1.00 24.43 ? 283 LEU B O   1 
ATOM   4200  C CB  . LEU B 1 285 ? 41.447  33.203  79.357  1.00 8.70  ? 283 LEU B CB  1 
ATOM   4201  C CG  . LEU B 1 285 ? 41.543  34.743  79.447  1.00 8.70  ? 283 LEU B CG  1 
ATOM   4202  C CD1 . LEU B 1 285 ? 42.463  35.195  80.590  1.00 8.70  ? 283 LEU B CD1 1 
ATOM   4203  C CD2 . LEU B 1 285 ? 42.044  35.270  78.118  1.00 8.70  ? 283 LEU B CD2 1 
ATOM   4204  N N   . ASN B 1 286 ? 38.973  32.419  81.317  1.00 27.10 ? 284 ASN B N   1 
ATOM   4205  C CA  . ASN B 1 286 ? 37.785  32.861  82.030  1.00 27.10 ? 284 ASN B CA  1 
ATOM   4206  C C   . ASN B 1 286 ? 38.054  32.511  83.498  1.00 27.10 ? 284 ASN B C   1 
ATOM   4207  O O   . ASN B 1 286 ? 38.135  33.387  84.352  1.00 27.10 ? 284 ASN B O   1 
ATOM   4208  C CB  . ASN B 1 286 ? 36.533  32.123  81.556  1.00 31.57 ? 284 ASN B CB  1 
ATOM   4209  C CG  . ASN B 1 286 ? 35.262  32.854  81.929  1.00 31.57 ? 284 ASN B CG  1 
ATOM   4210  O OD1 . ASN B 1 286 ? 34.768  33.661  81.158  1.00 31.57 ? 284 ASN B OD1 1 
ATOM   4211  N ND2 . ASN B 1 286 ? 34.745  32.597  83.124  1.00 31.57 ? 284 ASN B ND2 1 
ATOM   4212  N N   . ALA B 1 287 ? 38.213  31.220  83.772  1.00 41.23 ? 285 ALA B N   1 
ATOM   4213  C CA  . ALA B 1 287 ? 38.493  30.750  85.122  1.00 41.23 ? 285 ALA B CA  1 
ATOM   4214  C C   . ALA B 1 287 ? 39.444  31.734  85.843  1.00 41.23 ? 285 ALA B C   1 
ATOM   4215  O O   . ALA B 1 287 ? 39.060  32.384  86.807  1.00 41.23 ? 285 ALA B O   1 
ATOM   4216  C CB  . ALA B 1 287 ? 39.094  29.315  85.062  1.00 1.56  ? 285 ALA B CB  1 
ATOM   4217  N N   . ILE B 1 288 ? 40.670  31.856  85.354  1.00 28.60 ? 286 ILE B N   1 
ATOM   4218  C CA  . ILE B 1 288 ? 41.661  32.757  85.928  1.00 28.60 ? 286 ILE B CA  1 
ATOM   4219  C C   . ILE B 1 288 ? 41.102  34.138  86.179  1.00 28.60 ? 286 ILE B C   1 
ATOM   4220  O O   . ILE B 1 288 ? 41.562  34.836  87.064  1.00 28.60 ? 286 ILE B O   1 
ATOM   4221  C CB  . ILE B 1 288 ? 42.869  32.908  84.978  1.00 20.48 ? 286 ILE B CB  1 
ATOM   4222  C CG1 . ILE B 1 288 ? 43.719  31.639  85.029  1.00 20.48 ? 286 ILE B CG1 1 
ATOM   4223  C CG2 . ILE B 1 288 ? 43.675  34.162  85.319  1.00 20.48 ? 286 ILE B CG2 1 
ATOM   4224  C CD1 . ILE B 1 288 ? 44.707  31.527  83.900  1.00 20.48 ? 286 ILE B CD1 1 
ATOM   4225  N N   . ASN B 1 289 ? 40.122  34.547  85.389  1.00 40.27 ? 287 ASN B N   1 
ATOM   4226  C CA  . ASN B 1 289 ? 39.551  35.869  85.560  1.00 40.27 ? 287 ASN B CA  1 
ATOM   4227  C C   . ASN B 1 289 ? 38.479  35.939  86.649  1.00 40.27 ? 287 ASN B C   1 
ATOM   4228  O O   . ASN B 1 289 ? 38.106  37.027  87.085  1.00 40.27 ? 287 ASN B O   1 
ATOM   4229  C CB  . ASN B 1 289 ? 38.995  36.356  84.226  1.00 42.49 ? 287 ASN B CB  1 
ATOM   4230  C CG  . ASN B 1 289 ? 39.663  37.635  83.754  1.00 42.49 ? 287 ASN B CG  1 
ATOM   4231  O OD1 . ASN B 1 289 ? 40.031  37.767  82.586  1.00 42.49 ? 287 ASN B OD1 1 
ATOM   4232  N ND2 . ASN B 1 289 ? 39.814  38.590  84.664  1.00 42.49 ? 287 ASN B ND2 1 
ATOM   4233  N N   . LEU B 1 290 ? 37.991  34.780  87.087  1.00 48.88 ? 288 LEU B N   1 
ATOM   4234  C CA  . LEU B 1 290 ? 36.971  34.710  88.141  1.00 48.88 ? 288 LEU B CA  1 
ATOM   4235  C C   . LEU B 1 290 ? 37.563  34.255  89.484  1.00 48.88 ? 288 LEU B C   1 
ATOM   4236  O O   . LEU B 1 290 ? 36.882  34.319  90.509  1.00 48.88 ? 288 LEU B O   1 
ATOM   4237  C CB  . LEU B 1 290 ? 35.843  33.735  87.760  1.00 46.49 ? 288 LEU B CB  1 
ATOM   4238  C CG  . LEU B 1 290 ? 34.860  33.965  86.605  1.00 46.49 ? 288 LEU B CG  1 
ATOM   4239  C CD1 . LEU B 1 290 ? 33.957  32.746  86.493  1.00 46.49 ? 288 LEU B CD1 1 
ATOM   4240  C CD2 . LEU B 1 290 ? 34.039  35.225  86.828  1.00 46.49 ? 288 LEU B CD2 1 
ATOM   4241  N N   . CYS B 1 291 ? 38.813  33.782  89.467  1.00 57.85 ? 289 CYS B N   1 
ATOM   4242  C CA  . CYS B 1 291 ? 39.523  33.306  90.666  1.00 57.85 ? 289 CYS B CA  1 
ATOM   4243  C C   . CYS B 1 291 ? 39.462  34.338  91.792  1.00 57.85 ? 289 CYS B C   1 
ATOM   4244  O O   . CYS B 1 291 ? 39.921  35.473  91.642  1.00 57.85 ? 289 CYS B O   1 
ATOM   4245  C CB  . CYS B 1 291 ? 40.982  32.994  90.315  1.00 44.69 ? 289 CYS B CB  1 
ATOM   4246  S SG  . CYS B 1 291 ? 42.033  32.509  91.687  1.00 44.69 ? 289 CYS B SG  1 
ATOM   4247  N N   . PRO B 1 292 ? 38.906  33.941  92.947  1.00 34.57 ? 290 PRO B N   1 
ATOM   4248  C CA  . PRO B 1 292 ? 38.743  34.783  94.134  1.00 34.57 ? 290 PRO B CA  1 
ATOM   4249  C C   . PRO B 1 292 ? 40.040  35.208  94.781  1.00 34.57 ? 290 PRO B C   1 
ATOM   4250  O O   . PRO B 1 292 ? 40.258  34.924  95.959  1.00 34.57 ? 290 PRO B O   1 
ATOM   4251  C CB  . PRO B 1 292 ? 37.912  33.904  95.060  1.00 34.11 ? 290 PRO B CB  1 
ATOM   4252  C CG  . PRO B 1 292 ? 38.449  32.546  94.768  1.00 34.11 ? 290 PRO B CG  1 
ATOM   4253  C CD  . PRO B 1 292 ? 38.542  32.545  93.253  1.00 34.11 ? 290 PRO B CD  1 
ATOM   4254  N N   . LEU B 1 293 ? 40.898  35.871  94.012  1.00 55.18 ? 291 LEU B N   1 
ATOM   4255  C CA  . LEU B 1 293 ? 42.186  36.354  94.511  1.00 55.18 ? 291 LEU B CA  1 
ATOM   4256  C C   . LEU B 1 293 ? 42.345  37.801  94.110  1.00 55.18 ? 291 LEU B C   1 
ATOM   4257  O O   . LEU B 1 293 ? 41.478  38.370  93.444  1.00 55.18 ? 291 LEU B O   1 
ATOM   4258  C CB  . LEU B 1 293 ? 43.360  35.567  93.910  1.00 14.02 ? 291 LEU B CB  1 
ATOM   4259  C CG  . LEU B 1 293 ? 44.094  34.555  94.792  1.00 14.02 ? 291 LEU B CG  1 
ATOM   4260  C CD1 . LEU B 1 293 ? 44.121  35.112  96.203  1.00 14.02 ? 291 LEU B CD1 1 
ATOM   4261  C CD2 . LEU B 1 293 ? 43.429  33.174  94.758  1.00 14.02 ? 291 LEU B CD2 1 
ATOM   4262  N N   . PRO B 1 294 ? 43.451  38.429  94.519  1.00 40.05 ? 292 PRO B N   1 
ATOM   4263  C CA  . PRO B 1 294 ? 43.580  39.825  94.103  1.00 40.05 ? 292 PRO B CA  1 
ATOM   4264  C C   . PRO B 1 294 ? 44.150  39.791  92.690  1.00 40.05 ? 292 PRO B C   1 
ATOM   4265  O O   . PRO B 1 294 ? 44.898  38.882  92.341  1.00 40.05 ? 292 PRO B O   1 
ATOM   4266  C CB  . PRO B 1 294 ? 44.565  40.409  95.112  1.00 34.59 ? 292 PRO B CB  1 
ATOM   4267  C CG  . PRO B 1 294 ? 44.506  39.432  96.273  1.00 34.59 ? 292 PRO B CG  1 
ATOM   4268  C CD  . PRO B 1 294 ? 44.401  38.108  95.590  1.00 34.59 ? 292 PRO B CD  1 
ATOM   4269  N N   . LYS B 1 295 ? 43.781  40.763  91.871  1.00 34.88 ? 293 LYS B N   1 
ATOM   4270  C CA  . LYS B 1 295 ? 44.267  40.814  90.504  1.00 35.12 ? 293 LYS B CA  1 
ATOM   4271  C C   . LYS B 1 295 ? 44.300  42.274  90.063  1.00 34.08 ? 293 LYS B C   1 
ATOM   4272  O O   . LYS B 1 295 ? 43.422  42.735  89.346  1.00 38.44 ? 293 LYS B O   1 
ATOM   4273  C CB  . LYS B 1 295 ? 43.342  40.013  89.588  1.00 18.13 ? 293 LYS B CB  1 
ATOM   4274  C CG  . LYS B 1 295 ? 43.117  38.581  90.025  1.00 35.35 ? 293 LYS B CG  1 
ATOM   4275  C CD  . LYS B 1 295 ? 41.737  38.056  89.570  1.00 23.10 ? 293 LYS B CD  1 
ATOM   4276  C CE  . LYS B 1 295 ? 40.569  38.679  90.363  1.00 33.76 ? 293 LYS B CE  1 
ATOM   4277  N NZ  . LYS B 1 295 ? 39.295  37.967  90.076  1.00 45.69 ? 293 LYS B NZ  1 
ATOM   4278  N N   . PRO B 1 296 ? 45.330  43.015  90.480  1.00 58.74 ? 294 PRO B N   1 
ATOM   4279  C CA  . PRO B 1 296 ? 45.455  44.425  90.114  1.00 49.49 ? 294 PRO B CA  1 
ATOM   4280  C C   . PRO B 1 296 ? 45.594  44.649  88.608  1.00 58.33 ? 294 PRO B C   1 
ATOM   4281  O O   . PRO B 1 296 ? 45.474  45.778  88.124  1.00 55.59 ? 294 PRO B O   1 
ATOM   4282  C CB  . PRO B 1 296 ? 46.709  44.841  90.856  1.00 36.45 ? 294 PRO B CB  1 
ATOM   4283  C CG  . PRO B 1 296 ? 47.546  43.603  90.751  1.00 42.25 ? 294 PRO B CG  1 
ATOM   4284  C CD  . PRO B 1 296 ? 46.555  42.545  91.147  1.00 33.46 ? 294 PRO B CD  1 
ATOM   4285  N N   . TRP B 1 297 ? 45.832  43.568  87.871  1.00 39.24 ? 295 TRP B N   1 
ATOM   4286  C CA  . TRP B 1 297 ? 46.039  43.665  86.428  1.00 38.74 ? 295 TRP B CA  1 
ATOM   4287  C C   . TRP B 1 297 ? 45.210  42.808  85.468  1.00 41.89 ? 295 TRP B C   1 
ATOM   4288  O O   . TRP B 1 297 ? 44.911  41.639  85.726  1.00 46.01 ? 295 TRP B O   1 
ATOM   4289  C CB  . TRP B 1 297 ? 47.530  43.441  86.112  1.00 38.03 ? 295 TRP B CB  1 
ATOM   4290  C CG  . TRP B 1 297 ? 48.294  42.655  87.153  1.00 49.09 ? 295 TRP B CG  1 
ATOM   4291  C CD1 . TRP B 1 297 ? 49.496  42.990  87.700  1.00 52.18 ? 295 TRP B CD1 1 
ATOM   4292  C CD2 . TRP B 1 297 ? 47.901  41.429  87.774  1.00 50.73 ? 295 TRP B CD2 1 
ATOM   4293  N NE1 . TRP B 1 297 ? 49.874  42.055  88.625  1.00 39.64 ? 295 TRP B NE1 1 
ATOM   4294  C CE2 . TRP B 1 297 ? 48.910  41.086  88.693  1.00 52.60 ? 295 TRP B CE2 1 
ATOM   4295  C CE3 . TRP B 1 297 ? 46.793  40.591  87.648  1.00 55.87 ? 295 TRP B CE3 1 
ATOM   4296  C CZ2 . TRP B 1 297 ? 48.846  39.944  89.477  1.00 43.54 ? 295 TRP B CZ2 1 
ATOM   4297  C CZ3 . TRP B 1 297 ? 46.730  39.458  88.428  1.00 51.65 ? 295 TRP B CZ3 1 
ATOM   4298  C CH2 . TRP B 1 297 ? 47.749  39.146  89.334  1.00 46.18 ? 295 TRP B CH2 1 
ATOM   4299  N N   . LYS B 1 298 ? 44.876  43.417  84.334  1.00 23.71 ? 296 LYS B N   1 
ATOM   4300  C CA  . LYS B 1 298 ? 44.117  42.762  83.285  1.00 27.91 ? 296 LYS B CA  1 
ATOM   4301  C C   . LYS B 1 298 ? 44.727  41.392  82.991  1.00 22.34 ? 296 LYS B C   1 
ATOM   4302  O O   . LYS B 1 298 ? 45.930  41.271  82.812  1.00 26.09 ? 296 LYS B O   1 
ATOM   4303  C CB  . LYS B 1 298 ? 44.163  43.628  82.032  1.00 24.62 ? 296 LYS B CB  1 
ATOM   4304  C CG  . LYS B 1 298 ? 43.600  45.037  82.206  1.00 21.49 ? 296 LYS B CG  1 
ATOM   4305  C CD  . LYS B 1 298 ? 42.069  45.052  82.080  1.00 27.33 ? 296 LYS B CD  1 
ATOM   4306  C CE  . LYS B 1 298 ? 41.513  46.458  81.863  1.00 34.40 ? 296 LYS B CE  1 
ATOM   4307  N NZ  . LYS B 1 298 ? 40.048  46.445  81.561  1.00 49.69 ? 296 LYS B NZ  1 
ATOM   4308  N N   . LEU B 1 299 ? 43.904  40.355  82.961  1.00 45.61 ? 297 LEU B N   1 
ATOM   4309  C CA  . LEU B 1 299 ? 44.386  39.005  82.665  1.00 37.30 ? 297 LEU B CA  1 
ATOM   4310  C C   . LEU B 1 299 ? 43.752  38.616  81.322  1.00 42.25 ? 297 LEU B C   1 
ATOM   4311  O O   . LEU B 1 299 ? 42.614  38.136  81.254  1.00 49.39 ? 297 LEU B O   1 
ATOM   4312  C CB  . LEU B 1 299 ? 43.975  38.044  83.785  1.00 21.21 ? 297 LEU B CB  1 
ATOM   4313  C CG  . LEU B 1 299 ? 44.589  38.471  85.118  1.00 33.94 ? 297 LEU B CG  1 
ATOM   4314  C CD1 . LEU B 1 299 ? 43.807  37.908  86.288  1.00 22.56 ? 297 LEU B CD1 1 
ATOM   4315  C CD2 . LEU B 1 299 ? 46.028  38.025  85.154  1.00 19.73 ? 297 LEU B CD2 1 
ATOM   4316  N N   . SER B 1 300 ? 44.512  38.838  80.255  1.00 20.58 ? 298 SER B N   1 
ATOM   4317  C CA  . SER B 1 300 ? 44.053  38.596  78.900  1.00 17.28 ? 298 SER B CA  1 
ATOM   4318  C C   . SER B 1 300 ? 44.654  37.359  78.242  1.00 23.67 ? 298 SER B C   1 
ATOM   4319  O O   . SER B 1 300 ? 45.091  36.413  78.907  1.00 26.55 ? 298 SER B O   1 
ATOM   4320  C CB  . SER B 1 300 ? 44.360  39.844  78.050  1.00 17.73 ? 298 SER B CB  1 
ATOM   4321  O OG  . SER B 1 300 ? 43.758  39.799  76.771  1.00 24.82 ? 298 SER B OG  1 
ATOM   4322  N N   . PHE B 1 301 ? 44.652  37.404  76.912  1.00 23.54 ? 299 PHE B N   1 
ATOM   4323  C CA  . PHE B 1 301 ? 45.150  36.352  76.049  1.00 27.94 ? 299 PHE B CA  1 
ATOM   4324  C C   . PHE B 1 301 ? 46.019  36.963  74.953  1.00 27.60 ? 299 PHE B C   1 
ATOM   4325  O O   . PHE B 1 301 ? 45.731  38.049  74.447  1.00 29.04 ? 299 PHE B O   1 
ATOM   4326  C CB  . PHE B 1 301 ? 43.976  35.634  75.385  1.00 23.53 ? 299 PHE B CB  1 
ATOM   4327  C CG  . PHE B 1 301 ? 43.096  36.543  74.561  1.00 30.77 ? 299 PHE B CG  1 
ATOM   4328  C CD1 . PHE B 1 301 ? 42.209  37.421  75.171  1.00 24.02 ? 299 PHE B CD1 1 
ATOM   4329  C CD2 . PHE B 1 301 ? 43.188  36.556  73.175  1.00 20.33 ? 299 PHE B CD2 1 
ATOM   4330  C CE1 . PHE B 1 301 ? 41.428  38.298  74.418  1.00 25.49 ? 299 PHE B CE1 1 
ATOM   4331  C CE2 . PHE B 1 301 ? 42.411  37.433  72.409  1.00 26.21 ? 299 PHE B CE2 1 
ATOM   4332  C CZ  . PHE B 1 301 ? 41.531  38.304  73.035  1.00 23.42 ? 299 PHE B CZ  1 
ATOM   4333  N N   . SER B 1 302 ? 47.097  36.272  74.607  1.00 59.01 ? 300 SER B N   1 
ATOM   4334  C CA  . SER B 1 302 ? 47.969  36.697  73.519  1.00 59.60 ? 300 SER B CA  1 
ATOM   4335  C C   . SER B 1 302 ? 48.172  35.383  72.788  1.00 57.65 ? 300 SER B C   1 
ATOM   4336  O O   . SER B 1 302 ? 49.255  34.803  72.759  1.00 56.02 ? 300 SER B O   1 
ATOM   4337  C CB  . SER B 1 302 ? 49.288  37.251  74.024  1.00 10.39 ? 300 SER B CB  1 
ATOM   4338  O OG  . SER B 1 302 ? 49.804  38.148  73.051  1.00 15.84 ? 300 SER B OG  1 
ATOM   4339  N N   . TYR B 1 303 ? 47.055  34.940  72.221  1.00 32.77 ? 301 TYR B N   1 
ATOM   4340  C CA  . TYR B 1 303 ? 46.877  33.687  71.498  1.00 29.12 ? 301 TYR B CA  1 
ATOM   4341  C C   . TYR B 1 303 ? 47.169  33.644  70.000  1.00 37.24 ? 301 TYR B C   1 
ATOM   4342  O O   . TYR B 1 303 ? 47.020  34.618  69.256  1.00 40.22 ? 301 TYR B O   1 
ATOM   4343  C CB  . TYR B 1 303 ? 45.435  33.217  71.688  1.00 27.34 ? 301 TYR B CB  1 
ATOM   4344  C CG  . TYR B 1 303 ? 44.986  33.027  73.118  1.00 27.70 ? 301 TYR B CG  1 
ATOM   4345  C CD1 . TYR B 1 303 ? 43.648  32.763  73.400  1.00 32.73 ? 301 TYR B CD1 1 
ATOM   4346  C CD2 . TYR B 1 303 ? 45.899  33.002  74.163  1.00 28.93 ? 301 TYR B CD2 1 
ATOM   4347  C CE1 . TYR B 1 303 ? 43.231  32.467  74.659  1.00 28.52 ? 301 TYR B CE1 1 
ATOM   4348  C CE2 . TYR B 1 303 ? 45.492  32.702  75.441  1.00 29.38 ? 301 TYR B CE2 1 
ATOM   4349  C CZ  . TYR B 1 303 ? 44.152  32.430  75.677  1.00 23.45 ? 301 TYR B CZ  1 
ATOM   4350  O OH  . TYR B 1 303 ? 43.730  32.086  76.938  1.00 26.15 ? 301 TYR B OH  1 
ATOM   4351  N N   . GLY B 1 304 ? 47.554  32.452  69.576  1.00 43.48 ? 302 GLY B N   1 
ATOM   4352  C CA  . GLY B 1 304 ? 47.847  32.204  68.190  1.00 36.26 ? 302 GLY B CA  1 
ATOM   4353  C C   . GLY B 1 304 ? 47.079  30.939  67.926  1.00 43.19 ? 302 GLY B C   1 
ATOM   4354  O O   . GLY B 1 304 ? 45.921  30.992  67.541  1.00 45.63 ? 302 GLY B O   1 
ATOM   4355  N N   . ARG B 1 305 ? 47.703  29.797  68.172  1.00 22.95 ? 303 ARG B N   1 
ATOM   4356  C CA  . ARG B 1 305 ? 47.029  28.534  67.939  1.00 32.14 ? 303 ARG B CA  1 
ATOM   4357  C C   . ARG B 1 305 ? 45.581  28.610  68.443  1.00 33.35 ? 303 ARG B C   1 
ATOM   4358  O O   . ARG B 1 305 ? 44.648  28.204  67.748  1.00 40.28 ? 303 ARG B O   1 
ATOM   4359  C CB  . ARG B 1 305 ? 47.781  27.394  68.633  1.00 20.82 ? 303 ARG B CB  1 
ATOM   4360  C CG  . ARG B 1 305 ? 49.189  27.138  68.093  1.00 33.81 ? 303 ARG B CG  1 
ATOM   4361  C CD  . ARG B 1 305 ? 50.137  28.323  68.338  1.00 30.50 ? 303 ARG B CD  1 
ATOM   4362  N NE  . ARG B 1 305 ? 50.644  28.378  69.713  1.00 46.39 ? 303 ARG B NE  1 
ATOM   4363  C CZ  . ARG B 1 305 ? 50.830  29.502  70.405  1.00 63.98 ? 303 ARG B CZ  1 
ATOM   4364  N NH1 . ARG B 1 305 ? 50.552  30.680  69.864  1.00 33.47 ? 303 ARG B NH1 1 
ATOM   4365  N NH2 . ARG B 1 305 ? 51.297  29.449  71.643  1.00 70.98 ? 303 ARG B NH2 1 
ATOM   4366  N N   . ALA B 1 306 ? 45.382  29.170  69.630  1.00 85.41 ? 304 ALA B N   1 
ATOM   4367  C CA  . ALA B 1 306 ? 44.038  29.267  70.191  1.00 83.83 ? 304 ALA B CA  1 
ATOM   4368  C C   . ALA B 1 306 ? 43.034  30.169  69.434  1.00 87.83 ? 304 ALA B C   1 
ATOM   4369  O O   . ALA B 1 306 ? 41.821  29.999  69.577  1.00 87.69 ? 304 ALA B O   1 
ATOM   4370  C CB  . ALA B 1 306 ? 44.133  29.691  71.657  1.00 39.48 ? 304 ALA B CB  1 
ATOM   4371  N N   . LEU B 1 307 ? 43.522  31.120  68.640  1.00 36.55 ? 305 LEU B N   1 
ATOM   4372  C CA  . LEU B 1 307 ? 42.643  32.020  67.878  1.00 30.25 ? 305 LEU B CA  1 
ATOM   4373  C C   . LEU B 1 307 ? 42.528  31.673  66.373  1.00 38.17 ? 305 LEU B C   1 
ATOM   4374  O O   . LEU B 1 307 ? 41.458  31.809  65.760  1.00 41.91 ? 305 LEU B O   1 
ATOM   4375  C CB  . LEU B 1 307 ? 43.130  33.462  68.024  1.00 34.11 ? 305 LEU B CB  1 
ATOM   4376  C CG  . LEU B 1 307 ? 42.646  34.232  69.244  1.00 40.88 ? 305 LEU B CG  1 
ATOM   4377  C CD1 . LEU B 1 307 ? 43.577  35.393  69.533  1.00 38.25 ? 305 LEU B CD1 1 
ATOM   4378  C CD2 . LEU B 1 307 ? 41.247  34.727  68.987  1.00 31.02 ? 305 LEU B CD2 1 
ATOM   4379  N N   . GLN B 1 308 ? 43.632  31.223  65.782  1.00 41.74 ? 306 GLN B N   1 
ATOM   4380  C CA  . GLN B 1 308 ? 43.660  30.870  64.368  1.00 41.74 ? 306 GLN B CA  1 
ATOM   4381  C C   . GLN B 1 308 ? 43.332  29.416  64.086  1.00 41.74 ? 306 GLN B C   1 
ATOM   4382  O O   . GLN B 1 308 ? 42.952  29.087  62.972  1.00 41.74 ? 306 GLN B O   1 
ATOM   4383  C CB  . GLN B 1 308 ? 45.037  31.147  63.778  1.00 46.04 ? 306 GLN B CB  1 
ATOM   4384  C CG  . GLN B 1 308 ? 45.470  32.576  63.865  1.00 46.04 ? 306 GLN B CG  1 
ATOM   4385  C CD  . GLN B 1 308 ? 46.889  32.745  63.387  1.00 46.04 ? 306 GLN B CD  1 
ATOM   4386  O OE1 . GLN B 1 308 ? 47.227  32.387  62.257  1.00 46.04 ? 306 GLN B OE1 1 
ATOM   4387  N NE2 . GLN B 1 308 ? 47.735  33.288  64.250  1.00 46.04 ? 306 GLN B NE2 1 
ATOM   4388  N N   . ALA B 1 309 ? 43.500  28.549  65.081  1.00 36.94 ? 307 ALA B N   1 
ATOM   4389  C CA  . ALA B 1 309 ? 43.258  27.121  64.912  1.00 36.94 ? 307 ALA B CA  1 
ATOM   4390  C C   . ALA B 1 309 ? 42.080  26.791  64.006  1.00 36.94 ? 307 ALA B C   1 
ATOM   4391  O O   . ALA B 1 309 ? 42.274  26.364  62.863  1.00 36.94 ? 307 ALA B O   1 
ATOM   4392  C CB  . ALA B 1 309 ? 43.063  26.474  66.257  1.00 80.45 ? 307 ALA B CB  1 
ATOM   4393  N N   . SER B 1 310 ? 40.862  26.987  64.511  1.00 48.49 ? 308 SER B N   1 
ATOM   4394  C CA  . SER B 1 310 ? 39.656  26.686  63.740  1.00 48.49 ? 308 SER B CA  1 
ATOM   4395  C C   . SER B 1 310 ? 39.539  27.560  62.489  1.00 48.49 ? 308 SER B C   1 
ATOM   4396  O O   . SER B 1 310 ? 39.247  27.067  61.403  1.00 48.49 ? 308 SER B O   1 
ATOM   4397  C CB  . SER B 1 310 ? 38.417  26.866  64.617  1.00 48.82 ? 308 SER B CB  1 
ATOM   4398  O OG  . SER B 1 310 ? 38.295  28.207  65.057  1.00 48.82 ? 308 SER B OG  1 
ATOM   4399  N N   . ALA B 1 311 ? 39.779  28.858  62.650  1.00 40.64 ? 309 ALA B N   1 
ATOM   4400  C CA  . ALA B 1 311 ? 39.706  29.816  61.547  1.00 40.64 ? 309 ALA B CA  1 
ATOM   4401  C C   . ALA B 1 311 ? 40.591  29.428  60.370  1.00 40.64 ? 309 ALA B C   1 
ATOM   4402  O O   . ALA B 1 311 ? 40.372  29.866  59.249  1.00 40.64 ? 309 ALA B O   1 
ATOM   4403  C CB  . ALA B 1 311 ? 40.099  31.192  62.046  1.00 20.40 ? 309 ALA B CB  1 
ATOM   4404  N N   . LEU B 1 312 ? 41.589  28.597  60.633  1.00 31.46 ? 310 LEU B N   1 
ATOM   4405  C CA  . LEU B 1 312 ? 42.518  28.163  59.607  1.00 31.46 ? 310 LEU B CA  1 
ATOM   4406  C C   . LEU B 1 312 ? 42.102  26.823  59.028  1.00 31.46 ? 310 LEU B C   1 
ATOM   4407  O O   . LEU B 1 312 ? 42.377  26.529  57.872  1.00 31.46 ? 310 LEU B O   1 
ATOM   4408  C CB  . LEU B 1 312 ? 43.920  28.078  60.203  1.00 12.59 ? 310 LEU B CB  1 
ATOM   4409  C CG  . LEU B 1 312 ? 45.137  27.664  59.382  1.00 12.59 ? 310 LEU B CG  1 
ATOM   4410  C CD1 . LEU B 1 312 ? 45.218  28.389  58.060  1.00 12.59 ? 310 LEU B CD1 1 
ATOM   4411  C CD2 . LEU B 1 312 ? 46.347  27.969  60.210  1.00 12.59 ? 310 LEU B CD2 1 
ATOM   4412  N N   . ALA B 1 313 ? 41.427  26.004  59.820  1.00 43.06 ? 311 ALA B N   1 
ATOM   4413  C CA  . ALA B 1 313 ? 40.997  24.707  59.314  1.00 43.06 ? 311 ALA B CA  1 
ATOM   4414  C C   . ALA B 1 313 ? 39.783  24.829  58.393  1.00 43.06 ? 311 ALA B C   1 
ATOM   4415  O O   . ALA B 1 313 ? 39.598  24.011  57.498  1.00 43.06 ? 311 ALA B O   1 
ATOM   4416  C CB  . ALA B 1 313 ? 40.681  23.776  60.472  1.00 76.71 ? 311 ALA B CB  1 
ATOM   4417  N N   . ALA B 1 314 ? 38.967  25.859  58.616  1.00 67.57 ? 312 ALA B N   1 
ATOM   4418  C CA  . ALA B 1 314 ? 37.754  26.100  57.828  1.00 67.57 ? 312 ALA B CA  1 
ATOM   4419  C C   . ALA B 1 314 ? 38.045  26.680  56.458  1.00 67.57 ? 312 ALA B C   1 
ATOM   4420  O O   . ALA B 1 314 ? 37.203  26.650  55.561  1.00 67.57 ? 312 ALA B O   1 
ATOM   4421  C CB  . ALA B 1 314 ? 36.853  27.034  58.569  1.00 48.96 ? 312 ALA B CB  1 
ATOM   4422  N N   . TRP B 1 315 ? 39.240  27.233  56.324  1.00 41.54 ? 313 TRP B N   1 
ATOM   4423  C CA  . TRP B 1 315 ? 39.707  27.840  55.087  1.00 41.54 ? 313 TRP B CA  1 
ATOM   4424  C C   . TRP B 1 315 ? 40.340  26.766  54.209  1.00 41.54 ? 313 TRP B C   1 
ATOM   4425  O O   . TRP B 1 315 ? 40.163  26.763  52.996  1.00 41.54 ? 313 TRP B O   1 
ATOM   4426  C CB  . TRP B 1 315 ? 40.728  28.915  55.437  1.00 44.90 ? 313 TRP B CB  1 
ATOM   4427  C CG  . TRP B 1 315 ? 41.429  29.515  54.303  1.00 44.90 ? 313 TRP B CG  1 
ATOM   4428  C CD1 . TRP B 1 315 ? 40.895  30.280  53.323  1.00 44.90 ? 313 TRP B CD1 1 
ATOM   4429  C CD2 . TRP B 1 315 ? 42.829  29.452  54.053  1.00 44.90 ? 313 TRP B CD2 1 
ATOM   4430  N NE1 . TRP B 1 315 ? 41.877  30.709  52.471  1.00 44.90 ? 313 TRP B NE1 1 
ATOM   4431  C CE2 . TRP B 1 315 ? 43.079  30.213  52.901  1.00 44.90 ? 313 TRP B CE2 1 
ATOM   4432  C CE3 . TRP B 1 315 ? 43.904  28.825  54.698  1.00 44.90 ? 313 TRP B CE3 1 
ATOM   4433  C CZ2 . TRP B 1 315 ? 44.367  30.369  52.373  1.00 44.90 ? 313 TRP B CZ2 1 
ATOM   4434  C CZ3 . TRP B 1 315 ? 45.186  28.980  54.174  1.00 44.90 ? 313 TRP B CZ3 1 
ATOM   4435  C CH2 . TRP B 1 315 ? 45.404  29.747  53.024  1.00 44.90 ? 313 TRP B CH2 1 
ATOM   4436  N N   . GLY B 1 316 ? 41.077  25.855  54.836  1.00 57.12 ? 314 GLY B N   1 
ATOM   4437  C CA  . GLY B 1 316 ? 41.720  24.771  54.113  1.00 57.12 ? 314 GLY B CA  1 
ATOM   4438  C C   . GLY B 1 316 ? 42.448  25.189  52.856  1.00 57.12 ? 314 GLY B C   1 
ATOM   4439  O O   . GLY B 1 316 ? 42.655  24.372  51.959  1.00 57.12 ? 314 GLY B O   1 
ATOM   4440  N N   . GLY B 1 317 ? 42.833  26.458  52.782  1.00 47.89 ? 315 GLY B N   1 
ATOM   4441  C CA  . GLY B 1 317 ? 43.536  26.942  51.610  1.00 47.89 ? 315 GLY B CA  1 
ATOM   4442  C C   . GLY B 1 317 ? 42.663  27.215  50.392  1.00 47.89 ? 315 GLY B C   1 
ATOM   4443  O O   . GLY B 1 317 ? 43.178  27.581  49.331  1.00 47.89 ? 315 GLY B O   1 
ATOM   4444  N N   . LYS B 1 318 ? 41.349  27.040  50.531  1.00 50.90 ? 316 LYS B N   1 
ATOM   4445  C CA  . LYS B 1 318 ? 40.420  27.284  49.427  1.00 50.90 ? 316 LYS B CA  1 
ATOM   4446  C C   . LYS B 1 318 ? 39.821  28.685  49.568  1.00 50.90 ? 316 LYS B C   1 
ATOM   4447  O O   . LYS B 1 318 ? 38.960  28.913  50.405  1.00 50.90 ? 316 LYS B O   1 
ATOM   4448  C CB  . LYS B 1 318 ? 39.306  26.228  49.429  1.00 61.46 ? 316 LYS B CB  1 
ATOM   4449  C CG  . LYS B 1 318 ? 39.811  24.783  49.330  1.00 61.46 ? 316 LYS B CG  1 
ATOM   4450  C CD  . LYS B 1 318 ? 38.670  23.765  49.234  1.00 61.46 ? 316 LYS B CD  1 
ATOM   4451  C CE  . LYS B 1 318 ? 37.754  23.814  50.457  1.00 61.46 ? 316 LYS B CE  1 
ATOM   4452  N NZ  . LYS B 1 318 ? 36.665  22.796  50.421  1.00 61.46 ? 316 LYS B NZ  1 
ATOM   4453  N N   . ALA B 1 319 ? 40.280  29.621  48.745  1.00 42.18 ? 317 ALA B N   1 
ATOM   4454  C CA  . ALA B 1 319 ? 39.799  31.002  48.797  1.00 42.18 ? 317 ALA B CA  1 
ATOM   4455  C C   . ALA B 1 319 ? 38.277  31.112  48.724  1.00 42.18 ? 317 ALA B C   1 
ATOM   4456  O O   . ALA B 1 319 ? 37.708  32.201  48.855  1.00 42.18 ? 317 ALA B O   1 
ATOM   4457  C CB  . ALA B 1 319 ? 40.441  31.825  47.673  1.00 84.00 ? 317 ALA B CB  1 
ATOM   4458  N N   . ALA B 1 320 ? 37.613  29.988  48.512  1.00 29.48 ? 318 ALA B N   1 
ATOM   4459  C CA  . ALA B 1 320 ? 36.169  30.012  48.446  1.00 29.48 ? 318 ALA B CA  1 
ATOM   4460  C C   . ALA B 1 320 ? 35.580  30.206  49.845  1.00 29.48 ? 318 ALA B C   1 
ATOM   4461  O O   . ALA B 1 320 ? 34.509  30.803  50.015  1.00 29.48 ? 318 ALA B O   1 
ATOM   4462  C CB  . ALA B 1 320 ? 35.663  28.722  47.836  1.00 90.94 ? 318 ALA B CB  1 
ATOM   4463  N N   . ASN B 1 321 ? 36.300  29.719  50.850  1.00 39.96 ? 319 ASN B N   1 
ATOM   4464  C CA  . ASN B 1 321 ? 35.838  29.798  52.230  1.00 39.96 ? 319 ASN B CA  1 
ATOM   4465  C C   . ASN B 1 321 ? 36.267  31.033  53.018  1.00 39.96 ? 319 ASN B C   1 
ATOM   4466  O O   . ASN B 1 321 ? 36.314  30.981  54.242  1.00 39.96 ? 319 ASN B O   1 
ATOM   4467  C CB  . ASN B 1 321 ? 36.288  28.549  53.003  1.00 36.51 ? 319 ASN B CB  1 
ATOM   4468  C CG  . ASN B 1 321 ? 36.090  27.264  52.213  1.00 36.51 ? 319 ASN B CG  1 
ATOM   4469  O OD1 . ASN B 1 321 ? 35.296  27.213  51.276  1.00 36.51 ? 319 ASN B OD1 1 
ATOM   4470  N ND2 . ASN B 1 321 ? 36.803  26.214  52.602  1.00 36.51 ? 319 ASN B ND2 1 
ATOM   4471  N N   . LYS B 1 322 ? 36.583  32.136  52.344  1.00 46.21 ? 320 LYS B N   1 
ATOM   4472  C CA  . LYS B 1 322 ? 36.994  33.343  53.068  1.00 46.21 ? 320 LYS B CA  1 
ATOM   4473  C C   . LYS B 1 322 ? 35.929  33.621  54.111  1.00 46.21 ? 320 LYS B C   1 
ATOM   4474  O O   . LYS B 1 322 ? 36.233  34.032  55.239  1.00 46.21 ? 320 LYS B O   1 
ATOM   4475  C CB  . LYS B 1 322 ? 37.104  34.538  52.119  1.00 38.43 ? 320 LYS B CB  1 
ATOM   4476  C CG  . LYS B 1 322 ? 37.101  35.908  52.795  1.00 38.43 ? 320 LYS B CG  1 
ATOM   4477  C CD  . LYS B 1 322 ? 36.605  36.987  51.804  1.00 38.43 ? 320 LYS B CD  1 
ATOM   4478  C CE  . LYS B 1 322 ? 36.277  38.371  52.451  1.00 38.43 ? 320 LYS B CE  1 
ATOM   4479  N NZ  . LYS B 1 322 ? 37.399  39.390  52.533  1.00 38.43 ? 320 LYS B NZ  1 
ATOM   4480  N N   . GLU B 1 323 ? 34.680  33.366  53.718  1.00 28.92 ? 321 GLU B N   1 
ATOM   4481  C CA  . GLU B 1 323 ? 33.509  33.569  54.573  1.00 28.92 ? 321 GLU B CA  1 
ATOM   4482  C C   . GLU B 1 323 ? 33.647  32.777  55.877  1.00 28.92 ? 321 GLU B C   1 
ATOM   4483  O O   . GLU B 1 323 ? 33.809  33.341  56.960  1.00 28.92 ? 321 GLU B O   1 
ATOM   4484  C CB  . GLU B 1 323 ? 32.256  33.114  53.820  1.00 90.37 ? 321 GLU B CB  1 
ATOM   4485  C CG  . GLU B 1 323 ? 31.064  34.054  53.929  1.00 90.37 ? 321 GLU B CG  1 
ATOM   4486  C CD  . GLU B 1 323 ? 30.580  34.243  55.355  1.00 90.37 ? 321 GLU B CD  1 
ATOM   4487  O OE1 . GLU B 1 323 ? 31.325  34.829  56.170  1.00 90.37 ? 321 GLU B OE1 1 
ATOM   4488  O OE2 . GLU B 1 323 ? 29.451  33.802  55.660  1.00 90.37 ? 321 GLU B OE2 1 
ATOM   4489  N N   . ALA B 1 324 ? 33.585  31.457  55.750  1.00 65.37 ? 322 ALA B N   1 
ATOM   4490  C CA  . ALA B 1 324 ? 33.703  30.559  56.889  1.00 65.37 ? 322 ALA B CA  1 
ATOM   4491  C C   . ALA B 1 324 ? 34.840  30.983  57.812  1.00 65.37 ? 322 ALA B C   1 
ATOM   4492  O O   . ALA B 1 324 ? 34.613  31.248  58.993  1.00 65.37 ? 322 ALA B O   1 
ATOM   4493  C CB  . ALA B 1 324 ? 33.926  29.127  56.395  1.00 17.30 ? 322 ALA B CB  1 
ATOM   4494  N N   . THR B 1 325 ? 36.056  31.039  57.264  1.00 34.37 ? 323 THR B N   1 
ATOM   4495  C CA  . THR B 1 325 ? 37.251  31.419  58.008  1.00 34.37 ? 323 THR B CA  1 
ATOM   4496  C C   . THR B 1 325 ? 37.004  32.605  58.910  1.00 34.37 ? 323 THR B C   1 
ATOM   4497  O O   . THR B 1 325 ? 37.108  32.484  60.138  1.00 34.37 ? 323 THR B O   1 
ATOM   4498  C CB  . THR B 1 325 ? 38.392  31.790  57.076  1.00 31.42 ? 323 THR B CB  1 
ATOM   4499  O OG1 . THR B 1 325 ? 38.826  30.628  56.378  1.00 31.42 ? 323 THR B OG1 1 
ATOM   4500  C CG2 . THR B 1 325 ? 39.555  32.333  57.850  1.00 31.42 ? 323 THR B CG2 1 
ATOM   4501  N N   . GLN B 1 326 ? 36.686  33.754  58.314  1.00 40.43 ? 324 GLN B N   1 
ATOM   4502  C CA  . GLN B 1 326 ? 36.433  34.951  59.107  1.00 40.43 ? 324 GLN B CA  1 
ATOM   4503  C C   . GLN B 1 326 ? 35.419  34.744  60.242  1.00 40.43 ? 324 GLN B C   1 
ATOM   4504  O O   . GLN B 1 326 ? 35.451  35.466  61.241  1.00 40.43 ? 324 GLN B O   1 
ATOM   4505  C CB  . GLN B 1 326 ? 35.974  36.083  58.208  1.00 43.41 ? 324 GLN B CB  1 
ATOM   4506  C CG  . GLN B 1 326 ? 37.094  36.842  57.568  1.00 43.41 ? 324 GLN B CG  1 
ATOM   4507  C CD  . GLN B 1 326 ? 36.597  37.650  56.415  1.00 43.41 ? 324 GLN B CD  1 
ATOM   4508  O OE1 . GLN B 1 326 ? 36.127  37.094  55.434  1.00 43.41 ? 324 GLN B OE1 1 
ATOM   4509  N NE2 . GLN B 1 326 ? 36.677  38.968  56.521  1.00 43.41 ? 324 GLN B NE2 1 
ATOM   4510  N N   . GLU B 1 327 ? 34.522  33.767  60.088  1.00 19.37 ? 325 GLU B N   1 
ATOM   4511  C CA  . GLU B 1 327 ? 33.521  33.456  61.113  1.00 19.37 ? 325 GLU B CA  1 
ATOM   4512  C C   . GLU B 1 327 ? 34.221  32.867  62.333  1.00 19.37 ? 325 GLU B C   1 
ATOM   4513  O O   . GLU B 1 327 ? 34.192  33.455  63.413  1.00 19.37 ? 325 GLU B O   1 
ATOM   4514  C CB  . GLU B 1 327 ? 32.503  32.436  60.585  1.00 92.42 ? 325 GLU B CB  1 
ATOM   4515  C CG  . GLU B 1 327 ? 31.803  32.836  59.285  1.00 92.42 ? 325 GLU B CG  1 
ATOM   4516  C CD  . GLU B 1 327 ? 30.690  33.857  59.489  1.00 92.42 ? 325 GLU B CD  1 
ATOM   4517  O OE1 . GLU B 1 327 ? 30.912  34.830  60.242  1.00 92.42 ? 325 GLU B OE1 1 
ATOM   4518  O OE2 . GLU B 1 327 ? 29.601  33.692  58.889  1.00 92.42 ? 325 GLU B OE2 1 
ATOM   4519  N N   . ALA B 1 328 ? 34.857  31.709  62.154  1.00 31.54 ? 326 ALA B N   1 
ATOM   4520  C CA  . ALA B 1 328 ? 35.545  31.037  63.253  1.00 31.54 ? 326 ALA B CA  1 
ATOM   4521  C C   . ALA B 1 328 ? 36.507  31.962  63.956  1.00 31.54 ? 326 ALA B C   1 
ATOM   4522  O O   . ALA B 1 328 ? 36.605  31.923  65.173  1.00 31.54 ? 326 ALA B O   1 
ATOM   4523  C CB  . ALA B 1 328 ? 36.268  29.828  62.760  1.00 26.45 ? 326 ALA B CB  1 
ATOM   4524  N N   . PHE B 1 329 ? 37.233  32.791  63.214  1.00 8.02  ? 327 PHE B N   1 
ATOM   4525  C CA  . PHE B 1 329 ? 38.143  33.730  63.888  1.00 8.02  ? 327 PHE B CA  1 
ATOM   4526  C C   . PHE B 1 329 ? 37.296  34.653  64.800  1.00 8.02  ? 327 PHE B C   1 
ATOM   4527  O O   . PHE B 1 329 ? 37.430  34.629  66.030  1.00 8.02  ? 327 PHE B O   1 
ATOM   4528  C CB  . PHE B 1 329 ? 38.945  34.564  62.864  1.00 34.19 ? 327 PHE B CB  1 
ATOM   4529  C CG  . PHE B 1 329 ? 39.845  35.620  63.492  1.00 34.19 ? 327 PHE B CG  1 
ATOM   4530  C CD1 . PHE B 1 329 ? 40.662  35.311  64.570  1.00 34.19 ? 327 PHE B CD1 1 
ATOM   4531  C CD2 . PHE B 1 329 ? 39.868  36.928  62.996  1.00 34.19 ? 327 PHE B CD2 1 
ATOM   4532  C CE1 . PHE B 1 329 ? 41.488  36.289  65.148  1.00 34.19 ? 327 PHE B CE1 1 
ATOM   4533  C CE2 . PHE B 1 329 ? 40.694  37.908  63.571  1.00 34.19 ? 327 PHE B CE2 1 
ATOM   4534  C CZ  . PHE B 1 329 ? 41.501  37.585  64.646  1.00 34.19 ? 327 PHE B CZ  1 
ATOM   4535  N N   . MET B 1 330 ? 36.427  35.450  64.172  1.00 21.39 ? 328 MET B N   1 
ATOM   4536  C CA  . MET B 1 330 ? 35.524  36.357  64.867  1.00 21.39 ? 328 MET B CA  1 
ATOM   4537  C C   . MET B 1 330 ? 34.958  35.639  66.086  1.00 21.39 ? 328 MET B C   1 
ATOM   4538  O O   . MET B 1 330 ? 34.836  36.227  67.172  1.00 21.39 ? 328 MET B O   1 
ATOM   4539  C CB  . MET B 1 330 ? 34.368  36.755  63.944  1.00 82.96 ? 328 MET B CB  1 
ATOM   4540  C CG  . MET B 1 330 ? 34.571  38.033  63.164  1.00 82.96 ? 328 MET B CG  1 
ATOM   4541  S SD  . MET B 1 330 ? 34.610  39.455  64.267  1.00 82.96 ? 328 MET B SD  1 
ATOM   4542  C CE  . MET B 1 330 ? 32.843  39.747  64.533  1.00 82.96 ? 328 MET B CE  1 
ATOM   4543  N N   . LYS B 1 331 ? 34.615  34.362  65.897  1.00 26.10 ? 329 LYS B N   1 
ATOM   4544  C CA  . LYS B 1 331 ? 34.049  33.552  66.968  1.00 26.10 ? 329 LYS B CA  1 
ATOM   4545  C C   . LYS B 1 331 ? 35.014  33.418  68.137  1.00 26.10 ? 329 LYS B C   1 
ATOM   4546  O O   . LYS B 1 331 ? 34.665  33.763  69.271  1.00 26.10 ? 329 LYS B O   1 
ATOM   4547  C CB  . LYS B 1 331 ? 33.689  32.159  66.471  1.00 50.56 ? 329 LYS B CB  1 
ATOM   4548  C CG  . LYS B 1 331 ? 33.135  31.274  67.568  1.00 50.56 ? 329 LYS B CG  1 
ATOM   4549  C CD  . LYS B 1 331 ? 33.311  29.819  67.222  1.00 50.56 ? 329 LYS B CD  1 
ATOM   4550  C CE  . LYS B 1 331 ? 32.820  28.901  68.333  1.00 50.56 ? 329 LYS B CE  1 
ATOM   4551  N NZ  . LYS B 1 331 ? 32.928  27.440  67.968  1.00 50.56 ? 329 LYS B NZ  1 
ATOM   4552  N N   . ARG B 1 332 ? 36.227  32.916  67.876  1.00 20.69 ? 330 ARG B N   1 
ATOM   4553  C CA  . ARG B 1 332 ? 37.217  32.749  68.944  1.00 20.69 ? 330 ARG B CA  1 
ATOM   4554  C C   . ARG B 1 332 ? 37.644  34.117  69.441  1.00 20.69 ? 330 ARG B C   1 
ATOM   4555  O O   . ARG B 1 332 ? 37.920  34.288  70.615  1.00 20.69 ? 330 ARG B O   1 
ATOM   4556  C CB  . ARG B 1 332 ? 38.446  31.968  68.457  1.00 44.79 ? 330 ARG B CB  1 
ATOM   4557  C CG  . ARG B 1 332 ? 38.195  30.554  67.905  1.00 44.79 ? 330 ARG B CG  1 
ATOM   4558  C CD  . ARG B 1 332 ? 37.282  29.707  68.775  1.00 44.79 ? 330 ARG B CD  1 
ATOM   4559  N NE  . ARG B 1 332 ? 37.471  29.956  70.200  1.00 44.79 ? 330 ARG B NE  1 
ATOM   4560  C CZ  . ARG B 1 332 ? 36.656  29.485  71.142  1.00 44.79 ? 330 ARG B CZ  1 
ATOM   4561  N NH1 . ARG B 1 332 ? 35.622  28.741  70.790  1.00 44.79 ? 330 ARG B NH1 1 
ATOM   4562  N NH2 . ARG B 1 332 ? 36.835  29.785  72.425  1.00 44.79 ? 330 ARG B NH2 1 
ATOM   4563  N N   . ALA B 1 333 ? 37.686  35.093  68.538  1.00 12.06 ? 331 ALA B N   1 
ATOM   4564  C CA  . ALA B 1 333 ? 38.064  36.459  68.896  1.00 12.06 ? 331 ALA B CA  1 
ATOM   4565  C C   . ALA B 1 333 ? 37.158  37.051  69.976  1.00 12.06 ? 331 ALA B C   1 
ATOM   4566  O O   . ALA B 1 333 ? 37.655  37.624  70.939  1.00 12.06 ? 331 ALA B O   1 
ATOM   4567  C CB  . ALA B 1 333 ? 38.051  37.350  67.661  1.00 41.18 ? 331 ALA B CB  1 
ATOM   4568  N N   . MET B 1 334 ? 35.837  36.928  69.824  1.00 27.31 ? 332 MET B N   1 
ATOM   4569  C CA  . MET B 1 334 ? 34.910  37.458  70.824  1.00 27.31 ? 332 MET B CA  1 
ATOM   4570  C C   . MET B 1 334 ? 34.928  36.570  72.061  1.00 27.31 ? 332 MET B C   1 
ATOM   4571  O O   . MET B 1 334 ? 35.005  37.060  73.186  1.00 27.31 ? 332 MET B O   1 
ATOM   4572  C CB  . MET B 1 334 ? 33.496  37.507  70.264  1.00 41.01 ? 332 MET B CB  1 
ATOM   4573  C CG  . MET B 1 334 ? 33.319  38.421  69.065  1.00 41.01 ? 332 MET B CG  1 
ATOM   4574  S SD  . MET B 1 334 ? 31.596  38.435  68.484  1.00 41.01 ? 332 MET B SD  1 
ATOM   4575  C CE  . MET B 1 334 ? 31.721  37.554  66.953  1.00 41.01 ? 332 MET B CE  1 
ATOM   4576  N N   . ALA B 1 335 ? 34.862  35.259  71.828  1.00 33.90 ? 333 ALA B N   1 
ATOM   4577  C CA  . ALA B 1 335 ? 34.868  34.228  72.871  1.00 33.90 ? 333 ALA B CA  1 
ATOM   4578  C C   . ALA B 1 335 ? 35.873  34.500  73.970  1.00 33.90 ? 333 ALA B C   1 
ATOM   4579  O O   . ALA B 1 335 ? 35.521  34.517  75.137  1.00 33.90 ? 333 ALA B O   1 
ATOM   4580  C CB  . ALA B 1 335 ? 35.160  32.876  72.251  1.00 35.14 ? 333 ALA B CB  1 
ATOM   4581  N N   . ASN B 1 336 ? 37.130  34.696  73.590  1.00 70.29 ? 334 ASN B N   1 
ATOM   4582  C CA  . ASN B 1 336 ? 38.171  34.972  74.562  1.00 70.29 ? 334 ASN B CA  1 
ATOM   4583  C C   . ASN B 1 336 ? 38.008  36.321  75.235  1.00 70.29 ? 334 ASN B C   1 
ATOM   4584  O O   . ASN B 1 336 ? 38.358  36.462  76.402  1.00 70.29 ? 334 ASN B O   1 
ATOM   4585  C CB  . ASN B 1 336 ? 39.545  34.882  73.915  1.00 28.41 ? 334 ASN B CB  1 
ATOM   4586  C CG  . ASN B 1 336 ? 39.982  33.458  73.708  1.00 28.41 ? 334 ASN B CG  1 
ATOM   4587  O OD1 . ASN B 1 336 ? 39.958  32.662  74.634  1.00 28.41 ? 334 ASN B OD1 1 
ATOM   4588  N ND2 . ASN B 1 336 ? 40.381  33.126  72.495  1.00 28.41 ? 334 ASN B ND2 1 
ATOM   4589  N N   . CYS B 1 337 ? 37.491  37.316  74.516  1.00 46.20 ? 335 CYS B N   1 
ATOM   4590  C CA  . CYS B 1 337 ? 37.287  38.621  75.139  1.00 46.20 ? 335 CYS B CA  1 
ATOM   4591  C C   . CYS B 1 337 ? 36.398  38.393  76.342  1.00 46.20 ? 335 CYS B C   1 
ATOM   4592  O O   . CYS B 1 337 ? 36.616  38.959  77.414  1.00 46.20 ? 335 CYS B O   1 
ATOM   4593  C CB  . CYS B 1 337 ? 36.576  39.606  74.215  1.00 26.22 ? 335 CYS B CB  1 
ATOM   4594  S SG  . CYS B 1 337 ? 36.112  41.152  75.081  1.00 26.22 ? 335 CYS B SG  1 
ATOM   4595  N N   . GLN B 1 338 ? 35.377  37.568  76.160  1.00 2.35  ? 336 GLN B N   1 
ATOM   4596  C CA  . GLN B 1 338 ? 34.496  37.281  77.265  1.00 2.35  ? 336 GLN B CA  1 
ATOM   4597  C C   . GLN B 1 338 ? 35.263  36.661  78.411  1.00 2.35  ? 336 GLN B C   1 
ATOM   4598  O O   . GLN B 1 338 ? 35.108  37.092  79.552  1.00 2.35  ? 336 GLN B O   1 
ATOM   4599  C CB  . GLN B 1 338 ? 33.368  36.366  76.825  1.00 22.87 ? 336 GLN B CB  1 
ATOM   4600  C CG  . GLN B 1 338 ? 32.247  37.133  76.173  1.00 22.87 ? 336 GLN B CG  1 
ATOM   4601  C CD  . GLN B 1 338 ? 31.056  36.276  75.881  1.00 22.87 ? 336 GLN B CD  1 
ATOM   4602  O OE1 . GLN B 1 338 ? 31.100  35.401  75.007  1.00 22.87 ? 336 GLN B OE1 1 
ATOM   4603  N NE2 . GLN B 1 338 ? 29.975  36.513  76.613  1.00 22.87 ? 336 GLN B NE2 1 
ATOM   4604  N N   . ALA B 1 339 ? 36.092  35.658  78.112  1.00 27.76 ? 337 ALA B N   1 
ATOM   4605  C CA  . ALA B 1 339 ? 36.898  34.986  79.138  1.00 27.76 ? 337 ALA B CA  1 
ATOM   4606  C C   . ALA B 1 339 ? 37.685  36.026  79.924  1.00 27.76 ? 337 ALA B C   1 
ATOM   4607  O O   . ALA B 1 339 ? 37.903  35.876  81.125  1.00 27.76 ? 337 ALA B O   1 
ATOM   4608  C CB  . ALA B 1 339 ? 37.844  33.992  78.497  1.00 46.35 ? 337 ALA B CB  1 
ATOM   4609  N N   . ALA B 1 340 ? 38.095  37.083  79.223  1.00 30.35 ? 338 ALA B N   1 
ATOM   4610  C CA  . ALA B 1 340 ? 38.844  38.193  79.807  1.00 30.35 ? 338 ALA B CA  1 
ATOM   4611  C C   . ALA B 1 340 ? 37.948  38.999  80.740  1.00 30.35 ? 338 ALA B C   1 
ATOM   4612  O O   . ALA B 1 340 ? 38.429  39.741  81.584  1.00 30.35 ? 338 ALA B O   1 
ATOM   4613  C CB  . ALA B 1 340 ? 39.400  39.086  78.714  1.00 65.80 ? 338 ALA B CB  1 
ATOM   4614  N N   . LYS B 1 341 ? 36.638  38.855  80.581  1.00 21.30 ? 339 LYS B N   1 
ATOM   4615  C CA  . LYS B 1 341 ? 35.671  39.530  81.449  1.00 21.30 ? 339 LYS B CA  1 
ATOM   4616  C C   . LYS B 1 341 ? 35.108  38.481  82.390  1.00 21.30 ? 339 LYS B C   1 
ATOM   4617  O O   . LYS B 1 341 ? 34.236  38.769  83.197  1.00 21.30 ? 339 LYS B O   1 
ATOM   4618  C CB  . LYS B 1 341 ? 34.531  40.106  80.629  1.00 26.51 ? 339 LYS B CB  1 
ATOM   4619  C CG  . LYS B 1 341 ? 34.877  41.346  79.879  1.00 26.51 ? 339 LYS B CG  1 
ATOM   4620  C CD  . LYS B 1 341 ? 34.144  41.397  78.558  1.00 26.51 ? 339 LYS B CD  1 
ATOM   4621  C CE  . LYS B 1 341 ? 34.293  42.787  77.908  1.00 26.51 ? 339 LYS B CE  1 
ATOM   4622  N NZ  . LYS B 1 341 ? 33.716  43.930  78.726  1.00 26.51 ? 339 LYS B NZ  1 
ATOM   4623  N N   . GLY B 1 342 ? 35.609  37.255  82.268  1.00 48.87 ? 340 GLY B N   1 
ATOM   4624  C CA  . GLY B 1 342 ? 35.127  36.179  83.109  1.00 48.87 ? 340 GLY B CA  1 
ATOM   4625  C C   . GLY B 1 342 ? 33.699  35.861  82.728  1.00 48.87 ? 340 GLY B C   1 
ATOM   4626  O O   . GLY B 1 342 ? 33.103  34.883  83.200  1.00 48.87 ? 340 GLY B O   1 
ATOM   4627  N N   . GLN B 1 343 ? 33.169  36.706  81.846  1.00 38.85 ? 341 GLN B N   1 
ATOM   4628  C CA  . GLN B 1 343 ? 31.811  36.610  81.335  1.00 38.85 ? 341 GLN B CA  1 
ATOM   4629  C C   . GLN B 1 343 ? 31.710  35.596  80.212  1.00 38.85 ? 341 GLN B C   1 
ATOM   4630  O O   . GLN B 1 343 ? 31.242  35.950  79.137  1.00 38.85 ? 341 GLN B O   1 
ATOM   4631  C CB  . GLN B 1 343 ? 31.390  37.956  80.756  1.00 12.31 ? 341 GLN B CB  1 
ATOM   4632  C CG  . GLN B 1 343 ? 31.558  39.147  81.664  1.00 12.31 ? 341 GLN B CG  1 
ATOM   4633  C CD  . GLN B 1 343 ? 31.230  40.472  80.944  1.00 12.31 ? 341 GLN B CD  1 
ATOM   4634  O OE1 . GLN B 1 343 ? 31.047  40.482  79.713  1.00 12.31 ? 341 GLN B OE1 1 
ATOM   4635  N NE2 . GLN B 1 343 ? 31.164  41.596  81.707  1.00 12.31 ? 341 GLN B NE2 1 
ATOM   4636  N N   . TYR B 1 344 ? 32.127  34.353  80.412  1.00 14.18 ? 342 TYR B N   1 
ATOM   4637  C CA  . TYR B 1 344 ? 32.054  33.401  79.289  1.00 10.34 ? 342 TYR B CA  1 
ATOM   4638  C C   . TYR B 1 344 ? 31.412  32.093  79.681  1.00 10.97 ? 342 TYR B C   1 
ATOM   4639  O O   . TYR B 1 344 ? 31.758  31.496  80.698  1.00 36.76 ? 342 TYR B O   1 
ATOM   4640  C CB  . TYR B 1 344 ? 33.449  33.138  78.679  1.00 23.57 ? 342 TYR B CB  1 
ATOM   4641  C CG  . TYR B 1 344 ? 33.516  31.889  77.808  1.00 19.93 ? 342 TYR B CG  1 
ATOM   4642  C CD1 . TYR B 1 344 ? 33.323  31.946  76.425  1.00 46.66 ? 342 TYR B CD1 1 
ATOM   4643  C CD2 . TYR B 1 344 ? 33.739  30.630  78.385  1.00 32.63 ? 342 TYR B CD2 1 
ATOM   4644  C CE1 . TYR B 1 344 ? 33.354  30.767  75.645  1.00 47.23 ? 342 TYR B CE1 1 
ATOM   4645  C CE2 . TYR B 1 344 ? 33.765  29.464  77.617  1.00 43.71 ? 342 TYR B CE2 1 
ATOM   4646  C CZ  . TYR B 1 344 ? 33.572  29.534  76.261  1.00 44.22 ? 342 TYR B CZ  1 
ATOM   4647  O OH  . TYR B 1 344 ? 33.571  28.363  75.545  1.00 53.69 ? 342 TYR B OH  1 
ATOM   4648  N N   . VAL B 1 345 ? 30.500  31.630  78.843  1.00 43.28 ? 343 VAL B N   1 
ATOM   4649  C CA  . VAL B 1 345 ? 29.772  30.420  79.155  1.00 36.03 ? 343 VAL B CA  1 
ATOM   4650  C C   . VAL B 1 345 ? 29.956  29.289  78.165  1.00 47.23 ? 343 VAL B C   1 
ATOM   4651  O O   . VAL B 1 345 ? 29.786  29.481  76.960  1.00 45.83 ? 343 VAL B O   1 
ATOM   4652  C CB  . VAL B 1 345 ? 28.264  30.735  79.238  1.00 49.63 ? 343 VAL B CB  1 
ATOM   4653  C CG1 . VAL B 1 345 ? 27.521  29.585  79.897  1.00 26.45 ? 343 VAL B CG1 1 
ATOM   4654  C CG2 . VAL B 1 345 ? 28.046  32.043  79.986  1.00 36.29 ? 343 VAL B CG2 1 
ATOM   4655  N N   . HIS B 1 346 ? 30.303  28.110  78.665  1.00 75.66 ? 344 HIS B N   1 
ATOM   4656  C CA  . HIS B 1 346 ? 30.428  26.964  77.779  1.00 75.66 ? 344 HIS B CA  1 
ATOM   4657  C C   . HIS B 1 346 ? 29.024  26.364  77.774  1.00 75.66 ? 344 HIS B C   1 
ATOM   4658  O O   . HIS B 1 346 ? 28.238  26.639  78.683  1.00 75.66 ? 344 HIS B O   1 
ATOM   4659  C CB  . HIS B 1 346 ? 31.414  25.940  78.340  1.00 92.42 ? 344 HIS B CB  1 
ATOM   4660  C CG  . HIS B 1 346 ? 31.674  24.792  77.414  1.00 92.42 ? 344 HIS B CG  1 
ATOM   4661  N ND1 . HIS B 1 346 ? 30.662  24.102  76.780  1.00 92.42 ? 344 HIS B ND1 1 
ATOM   4662  C CD2 . HIS B 1 346 ? 32.832  24.222  77.002  1.00 92.42 ? 344 HIS B CD2 1 
ATOM   4663  C CE1 . HIS B 1 346 ? 31.185  23.160  76.015  1.00 92.42 ? 344 HIS B CE1 1 
ATOM   4664  N NE2 . HIS B 1 346 ? 32.499  23.211  76.132  1.00 92.42 ? 344 HIS B NE2 1 
ATOM   4665  N N   . THR B 1 347 ? 28.686  25.566  76.767  1.00 89.35 ? 345 THR B N   1 
ATOM   4666  C CA  . THR B 1 347 ? 27.360  24.953  76.746  1.00 89.35 ? 345 THR B CA  1 
ATOM   4667  C C   . THR B 1 347 ? 27.443  23.429  76.681  1.00 89.35 ? 345 THR B C   1 
ATOM   4668  O O   . THR B 1 347 ? 26.818  22.851  75.764  1.00 89.35 ? 345 THR B O   1 
ATOM   4669  C CB  . THR B 1 347 ? 26.514  25.451  75.559  1.00 55.42 ? 345 THR B CB  1 
ATOM   4670  O OG1 . THR B 1 347 ? 27.030  24.914  74.338  1.00 55.42 ? 345 THR B OG1 1 
ATOM   4671  C CG2 . THR B 1 347 ? 26.547  26.960  75.489  1.00 55.42 ? 345 THR B CG2 1 
ATOM   4672  N N   . ALA C 1 8   ? 81.648  21.851  78.798  1.00 83.68 ? 6   ALA C N   1 
ATOM   4673  C CA  . ALA C 1 8   ? 81.382  20.904  77.672  1.00 83.68 ? 6   ALA C CA  1 
ATOM   4674  C C   . ALA C 1 8   ? 82.677  20.277  77.173  1.00 83.68 ? 6   ALA C C   1 
ATOM   4675  O O   . ALA C 1 8   ? 82.733  19.072  76.901  1.00 83.68 ? 6   ALA C O   1 
ATOM   4676  C CB  . ALA C 1 8   ? 80.685  21.634  76.510  1.00 15.98 ? 6   ALA C CB  1 
ATOM   4677  N N   . LEU C 1 9   ? 83.707  21.114  77.061  1.00 61.55 ? 7   LEU C N   1 
ATOM   4678  C CA  . LEU C 1 9   ? 85.031  20.728  76.573  1.00 58.03 ? 7   LEU C CA  1 
ATOM   4679  C C   . LEU C 1 9   ? 85.508  19.304  76.829  1.00 63.48 ? 7   LEU C C   1 
ATOM   4680  O O   . LEU C 1 9   ? 85.233  18.698  77.865  1.00 67.54 ? 7   LEU C O   1 
ATOM   4681  C CB  . LEU C 1 9   ? 86.075  21.717  77.089  1.00 26.90 ? 7   LEU C CB  1 
ATOM   4682  C CG  . LEU C 1 9   ? 85.821  23.112  76.525  1.00 36.35 ? 7   LEU C CG  1 
ATOM   4683  C CD1 . LEU C 1 9   ? 86.805  24.125  77.080  1.00 41.78 ? 7   LEU C CD1 1 
ATOM   4684  C CD2 . LEU C 1 9   ? 85.921  23.033  75.012  1.00 34.01 ? 7   LEU C CD2 1 
ATOM   4685  N N   . THR C 1 10  ? 86.232  18.786  75.845  1.00 81.77 ? 8   THR C N   1 
ATOM   4686  C CA  . THR C 1 10  ? 86.788  17.446  75.891  1.00 81.77 ? 8   THR C CA  1 
ATOM   4687  C C   . THR C 1 10  ? 88.258  17.565  76.245  1.00 81.77 ? 8   THR C C   1 
ATOM   4688  O O   . THR C 1 10  ? 88.951  18.455  75.749  1.00 81.77 ? 8   THR C O   1 
ATOM   4689  C CB  . THR C 1 10  ? 86.662  16.769  74.531  1.00 90.20 ? 8   THR C CB  1 
ATOM   4690  O OG1 . THR C 1 10  ? 87.279  17.597  73.534  1.00 90.20 ? 8   THR C OG1 1 
ATOM   4691  C CG2 . THR C 1 10  ? 85.191  16.561  74.181  1.00 90.20 ? 8   THR C CG2 1 
ATOM   4692  N N   . GLN C 1 11  ? 88.733  16.661  77.094  1.00 84.84 ? 9   GLN C N   1 
ATOM   4693  C CA  . GLN C 1 11  ? 90.119  16.689  77.537  1.00 84.84 ? 9   GLN C CA  1 
ATOM   4694  C C   . GLN C 1 11  ? 91.088  17.114  76.437  1.00 84.84 ? 9   GLN C C   1 
ATOM   4695  O O   . GLN C 1 11  ? 91.872  18.049  76.610  1.00 84.84 ? 9   GLN C O   1 
ATOM   4696  C CB  . GLN C 1 11  ? 90.528  15.323  78.090  1.00 92.42 ? 9   GLN C CB  1 
ATOM   4697  C CG  . GLN C 1 11  ? 91.694  15.416  79.063  1.00 92.42 ? 9   GLN C CG  1 
ATOM   4698  C CD  . GLN C 1 11  ? 91.375  16.302  80.270  1.00 92.42 ? 9   GLN C CD  1 
ATOM   4699  O OE1 . GLN C 1 11  ? 92.265  16.658  81.052  1.00 92.42 ? 9   GLN C OE1 1 
ATOM   4700  N NE2 . GLN C 1 11  ? 90.099  16.653  80.429  1.00 92.42 ? 9   GLN C NE2 1 
ATOM   4701  N N   . GLU C 1 12  ? 91.018  16.431  75.302  1.00 85.30 ? 10  GLU C N   1 
ATOM   4702  C CA  . GLU C 1 12  ? 91.889  16.729  74.176  1.00 85.30 ? 10  GLU C CA  1 
ATOM   4703  C C   . GLU C 1 12  ? 91.698  18.139  73.618  1.00 85.30 ? 10  GLU C C   1 
ATOM   4704  O O   . GLU C 1 12  ? 92.654  18.754  73.147  1.00 85.30 ? 10  GLU C O   1 
ATOM   4705  C CB  . GLU C 1 12  ? 91.656  15.715  73.064  1.00 92.42 ? 10  GLU C CB  1 
ATOM   4706  C CG  . GLU C 1 12  ? 92.400  16.028  71.791  1.00 92.42 ? 10  GLU C CG  1 
ATOM   4707  C CD  . GLU C 1 12  ? 91.671  15.512  70.568  1.00 92.42 ? 10  GLU C CD  1 
ATOM   4708  O OE1 . GLU C 1 12  ? 90.509  15.925  70.346  1.00 92.42 ? 10  GLU C OE1 1 
ATOM   4709  O OE2 . GLU C 1 12  ? 92.258  14.692  69.830  1.00 92.42 ? 10  GLU C OE2 1 
ATOM   4710  N N   . GLN C 1 13  ? 90.468  18.642  73.661  1.00 54.03 ? 11  GLN C N   1 
ATOM   4711  C CA  . GLN C 1 13  ? 90.166  19.983  73.148  1.00 54.03 ? 11  GLN C CA  1 
ATOM   4712  C C   . GLN C 1 13  ? 90.690  21.091  74.075  1.00 54.03 ? 11  GLN C C   1 
ATOM   4713  O O   . GLN C 1 13  ? 90.742  22.271  73.695  1.00 54.03 ? 11  GLN C O   1 
ATOM   4714  C CB  . GLN C 1 13  ? 88.655  20.149  72.957  1.00 86.69 ? 11  GLN C CB  1 
ATOM   4715  C CG  . GLN C 1 13  ? 88.277  21.339  72.094  1.00 86.69 ? 11  GLN C CG  1 
ATOM   4716  C CD  . GLN C 1 13  ? 86.785  21.558  72.035  1.00 86.69 ? 11  GLN C CD  1 
ATOM   4717  O OE1 . GLN C 1 13  ? 86.007  20.678  72.401  1.00 86.69 ? 11  GLN C OE1 1 
ATOM   4718  N NE2 . GLN C 1 13  ? 86.375  22.732  71.563  1.00 86.69 ? 11  GLN C NE2 1 
ATOM   4719  N N   . LYS C 1 14  ? 91.048  20.700  75.299  1.00 70.45 ? 12  LYS C N   1 
ATOM   4720  C CA  . LYS C 1 14  ? 91.601  21.632  76.280  1.00 70.45 ? 12  LYS C CA  1 
ATOM   4721  C C   . LYS C 1 14  ? 93.060  21.828  75.886  1.00 70.45 ? 12  LYS C C   1 
ATOM   4722  O O   . LYS C 1 14  ? 93.570  22.945  75.862  1.00 70.45 ? 12  LYS C O   1 
ATOM   4723  C CB  . LYS C 1 14  ? 91.515  21.043  77.696  1.00 59.23 ? 12  LYS C CB  1 
ATOM   4724  C CG  . LYS C 1 14  ? 90.093  20.944  78.249  1.00 59.23 ? 12  LYS C CG  1 
ATOM   4725  C CD  . LYS C 1 14  ? 90.034  20.138  79.540  1.00 59.23 ? 12  LYS C CD  1 
ATOM   4726  C CE  . LYS C 1 14  ? 88.598  19.759  79.889  1.00 59.23 ? 12  LYS C CE  1 
ATOM   4727  N NZ  . LYS C 1 14  ? 88.500  18.690  80.928  1.00 59.23 ? 12  LYS C NZ  1 
ATOM   4728  N N   . LYS C 1 15  ? 93.705  20.714  75.557  1.00 81.92 ? 13  LYS C N   1 
ATOM   4729  C CA  . LYS C 1 15  ? 95.102  20.683  75.140  1.00 81.92 ? 13  LYS C CA  1 
ATOM   4730  C C   . LYS C 1 15  ? 95.393  21.746  74.077  1.00 81.92 ? 13  LYS C C   1 
ATOM   4731  O O   . LYS C 1 15  ? 96.398  22.453  74.147  1.00 81.92 ? 13  LYS C O   1 
ATOM   4732  C CB  . LYS C 1 15  ? 95.426  19.291  74.590  1.00 58.38 ? 13  LYS C CB  1 
ATOM   4733  C CG  . LYS C 1 15  ? 96.902  18.962  74.502  1.00 58.38 ? 13  LYS C CG  1 
ATOM   4734  C CD  . LYS C 1 15  ? 97.101  17.542  73.991  1.00 58.38 ? 13  LYS C CD  1 
ATOM   4735  C CE  . LYS C 1 15  ? 98.578  17.169  73.901  1.00 58.38 ? 13  LYS C CE  1 
ATOM   4736  N NZ  . LYS C 1 15  ? 98.784  15.817  73.295  1.00 58.38 ? 13  LYS C NZ  1 
ATOM   4737  N N   . GLU C 1 16  ? 94.510  21.846  73.090  1.00 47.50 ? 14  GLU C N   1 
ATOM   4738  C CA  . GLU C 1 16  ? 94.661  22.818  72.015  1.00 47.50 ? 14  GLU C CA  1 
ATOM   4739  C C   . GLU C 1 16  ? 94.483  24.228  72.591  1.00 47.50 ? 14  GLU C C   1 
ATOM   4740  O O   . GLU C 1 16  ? 95.342  25.093  72.422  1.00 47.50 ? 14  GLU C O   1 
ATOM   4741  C CB  . GLU C 1 16  ? 93.606  22.560  70.921  1.00 85.54 ? 14  GLU C CB  1 
ATOM   4742  C CG  . GLU C 1 16  ? 93.925  23.157  69.536  1.00 85.54 ? 14  GLU C CG  1 
ATOM   4743  C CD  . GLU C 1 16  ? 92.751  23.086  68.556  1.00 85.54 ? 14  GLU C CD  1 
ATOM   4744  O OE1 . GLU C 1 16  ? 91.980  24.071  68.459  1.00 85.54 ? 14  GLU C OE1 1 
ATOM   4745  O OE2 . GLU C 1 16  ? 92.596  22.040  67.887  1.00 85.54 ? 14  GLU C OE2 1 
ATOM   4746  N N   . LEU C 1 17  ? 93.363  24.451  73.272  1.00 41.36 ? 15  LEU C N   1 
ATOM   4747  C CA  . LEU C 1 17  ? 93.078  25.749  73.858  1.00 41.36 ? 15  LEU C CA  1 
ATOM   4748  C C   . LEU C 1 17  ? 94.224  26.147  74.760  1.00 41.36 ? 15  LEU C C   1 
ATOM   4749  O O   . LEU C 1 17  ? 94.670  27.291  74.758  1.00 41.36 ? 15  LEU C O   1 
ATOM   4750  C CB  . LEU C 1 17  ? 91.777  25.683  74.651  1.00 27.10 ? 15  LEU C CB  1 
ATOM   4751  C CG  . LEU C 1 17  ? 90.500  25.674  73.806  1.00 27.10 ? 15  LEU C CG  1 
ATOM   4752  C CD1 . LEU C 1 17  ? 89.269  25.625  74.695  1.00 27.10 ? 15  LEU C CD1 1 
ATOM   4753  C CD2 . LEU C 1 17  ? 90.479  26.930  72.948  1.00 27.10 ? 15  LEU C CD2 1 
ATOM   4754  N N   . SER C 1 18  ? 94.697  25.175  75.528  1.00 52.42 ? 16  SER C N   1 
ATOM   4755  C CA  . SER C 1 18  ? 95.815  25.352  76.452  1.00 52.42 ? 16  SER C CA  1 
ATOM   4756  C C   . SER C 1 18  ? 97.071  25.680  75.642  1.00 52.42 ? 16  SER C C   1 
ATOM   4757  O O   . SER C 1 18  ? 97.612  26.786  75.720  1.00 52.42 ? 16  SER C O   1 
ATOM   4758  C CB  . SER C 1 18  ? 96.018  24.049  77.242  1.00 89.89 ? 16  SER C CB  1 
ATOM   4759  O OG  . SER C 1 18  ? 97.053  24.154  78.200  1.00 89.89 ? 16  SER C OG  1 
ATOM   4760  N N   . GLU C 1 19  ? 97.511  24.699  74.856  1.00 77.09 ? 17  GLU C N   1 
ATOM   4761  C CA  . GLU C 1 19  ? 98.681  24.830  74.004  1.00 77.09 ? 17  GLU C CA  1 
ATOM   4762  C C   . GLU C 1 19  ? 98.675  26.104  73.182  1.00 77.09 ? 17  GLU C C   1 
ATOM   4763  O O   . GLU C 1 19  ? 99.735  26.633  72.870  1.00 77.09 ? 17  GLU C O   1 
ATOM   4764  C CB  . GLU C 1 19  ? 98.784  23.634  73.067  1.00 75.43 ? 17  GLU C CB  1 
ATOM   4765  C CG  . GLU C 1 19  ? 99.347  22.409  73.723  1.00 75.43 ? 17  GLU C CG  1 
ATOM   4766  C CD  . GLU C 1 19  ? 99.447  21.239  72.771  1.00 75.43 ? 17  GLU C CD  1 
ATOM   4767  O OE1 . GLU C 1 19  ? 99.937  21.424  71.635  1.00 75.43 ? 17  GLU C OE1 1 
ATOM   4768  O OE2 . GLU C 1 19  ? 99.045  20.127  73.165  1.00 75.43 ? 17  GLU C OE2 1 
ATOM   4769  N N   . ILE C 1 20  ? 97.492  26.592  72.820  1.00 51.87 ? 18  ILE C N   1 
ATOM   4770  C CA  . ILE C 1 20  ? 97.397  27.819  72.033  1.00 51.87 ? 18  ILE C CA  1 
ATOM   4771  C C   . ILE C 1 20  ? 97.631  29.066  72.889  1.00 51.87 ? 18  ILE C C   1 
ATOM   4772  O O   . ILE C 1 20  ? 98.451  29.914  72.540  1.00 51.87 ? 18  ILE C O   1 
ATOM   4773  C CB  . ILE C 1 20  ? 96.014  27.966  71.339  1.00 27.06 ? 18  ILE C CB  1 
ATOM   4774  C CG1 . ILE C 1 20  ? 95.832  26.873  70.289  1.00 27.06 ? 18  ILE C CG1 1 
ATOM   4775  C CG2 . ILE C 1 20  ? 95.891  29.353  70.681  1.00 27.06 ? 18  ILE C CG2 1 
ATOM   4776  C CD1 . ILE C 1 20  ? 94.519  26.991  69.533  1.00 27.06 ? 18  ILE C CD1 1 
ATOM   4777  N N   . ALA C 1 21  ? 96.918  29.173  74.007  1.00 65.40 ? 19  ALA C N   1 
ATOM   4778  C CA  . ALA C 1 21  ? 97.051  30.334  74.882  1.00 65.40 ? 19  ALA C CA  1 
ATOM   4779  C C   . ALA C 1 21  ? 98.451  30.496  75.471  1.00 65.40 ? 19  ALA C C   1 
ATOM   4780  O O   . ALA C 1 21  ? 98.912  31.620  75.679  1.00 65.40 ? 19  ALA C O   1 
ATOM   4781  C CB  . ALA C 1 21  ? 96.031  30.261  75.995  1.00 37.30 ? 19  ALA C CB  1 
ATOM   4782  N N   . GLN C 1 22  ? 99.127  29.380  75.735  1.00 58.54 ? 20  GLN C N   1 
ATOM   4783  C CA  . GLN C 1 22  ? 100.478 29.406  76.306  1.00 58.54 ? 20  GLN C CA  1 
ATOM   4784  C C   . GLN C 1 22  ? 101.525 29.740  75.261  1.00 58.54 ? 20  GLN C C   1 
ATOM   4785  O O   . GLN C 1 22  ? 102.444 30.522  75.498  1.00 58.54 ? 20  GLN C O   1 
ATOM   4786  C CB  . GLN C 1 22  ? 100.816 28.047  76.911  1.00 34.88 ? 20  GLN C CB  1 
ATOM   4787  C CG  . GLN C 1 22  ? 100.577 27.914  78.411  1.00 34.88 ? 20  GLN C CG  1 
ATOM   4788  C CD  . GLN C 1 22  ? 100.710 26.477  78.855  1.00 34.88 ? 20  GLN C CD  1 
ATOM   4789  O OE1 . GLN C 1 22  ? 100.774 26.178  80.040  1.00 34.88 ? 20  GLN C OE1 1 
ATOM   4790  N NE2 . GLN C 1 22  ? 100.747 25.572  77.888  1.00 34.88 ? 20  GLN C NE2 1 
ATOM   4791  N N   . SER C 1 23  ? 101.379 29.112  74.107  1.00 61.65 ? 21  SER C N   1 
ATOM   4792  C CA  . SER C 1 23  ? 102.284 29.310  72.999  1.00 61.65 ? 21  SER C CA  1 
ATOM   4793  C C   . SER C 1 23  ? 102.266 30.761  72.525  1.00 61.65 ? 21  SER C C   1 
ATOM   4794  O O   . SER C 1 23  ? 103.095 31.164  71.709  1.00 61.65 ? 21  SER C O   1 
ATOM   4795  C CB  . SER C 1 23  ? 101.881 28.387  71.862  1.00 79.80 ? 21  SER C CB  1 
ATOM   4796  O OG  . SER C 1 23  ? 100.506 28.559  71.580  1.00 79.80 ? 21  SER C OG  1 
ATOM   4797  N N   . ILE C 1 24  ? 101.317 31.545  73.024  1.00 36.18 ? 22  ILE C N   1 
ATOM   4798  C CA  . ILE C 1 24  ? 101.238 32.948  72.632  1.00 36.18 ? 22  ILE C CA  1 
ATOM   4799  C C   . ILE C 1 24  ? 102.197 33.750  73.500  1.00 36.18 ? 22  ILE C C   1 
ATOM   4800  O O   . ILE C 1 24  ? 102.802 34.727  73.056  1.00 36.18 ? 22  ILE C O   1 
ATOM   4801  C CB  . ILE C 1 24  ? 99.821  33.513  72.818  1.00 24.95 ? 22  ILE C CB  1 
ATOM   4802  C CG1 . ILE C 1 24  ? 98.847  32.777  71.912  1.00 24.95 ? 22  ILE C CG1 1 
ATOM   4803  C CG2 . ILE C 1 24  ? 99.798  34.982  72.476  1.00 24.95 ? 22  ILE C CG2 1 
ATOM   4804  C CD1 . ILE C 1 24  ? 97.436  33.259  72.041  1.00 24.95 ? 22  ILE C CD1 1 
ATOM   4805  N N   . VAL C 1 25  ? 102.323 33.333  74.751  1.00 53.77 ? 23  VAL C N   1 
ATOM   4806  C CA  . VAL C 1 25  ? 103.206 33.989  75.701  1.00 53.77 ? 23  VAL C CA  1 
ATOM   4807  C C   . VAL C 1 25  ? 104.020 32.875  76.322  1.00 53.77 ? 23  VAL C C   1 
ATOM   4808  O O   . VAL C 1 25  ? 103.753 32.440  77.440  1.00 53.77 ? 23  VAL C O   1 
ATOM   4809  C CB  . VAL C 1 25  ? 102.397 34.723  76.789  1.00 75.21 ? 23  VAL C CB  1 
ATOM   4810  C CG1 . VAL C 1 25  ? 102.009 36.100  76.305  1.00 75.21 ? 23  VAL C CG1 1 
ATOM   4811  C CG2 . VAL C 1 25  ? 101.131 33.931  77.114  1.00 75.21 ? 23  VAL C CG2 1 
ATOM   4812  N N   . ALA C 1 26  ? 105.006 32.398  75.575  1.00 92.42 ? 24  ALA C N   1 
ATOM   4813  C CA  . ALA C 1 26  ? 105.834 31.307  76.053  1.00 92.42 ? 24  ALA C CA  1 
ATOM   4814  C C   . ALA C 1 26  ? 107.213 31.754  76.495  1.00 92.42 ? 24  ALA C C   1 
ATOM   4815  O O   . ALA C 1 26  ? 107.640 31.477  77.619  1.00 92.42 ? 24  ALA C O   1 
ATOM   4816  C CB  . ALA C 1 26  ? 105.960 30.245  74.974  1.00 43.60 ? 24  ALA C CB  1 
ATOM   4817  N N   . ASN C 1 27  ? 107.915 32.445  75.611  1.00 38.00 ? 25  ASN C N   1 
ATOM   4818  C CA  . ASN C 1 27  ? 109.258 32.893  75.929  1.00 38.00 ? 25  ASN C CA  1 
ATOM   4819  C C   . ASN C 1 27  ? 109.273 34.408  76.041  1.00 38.00 ? 25  ASN C C   1 
ATOM   4820  O O   . ASN C 1 27  ? 109.910 35.108  75.246  1.00 38.00 ? 25  ASN C O   1 
ATOM   4821  C CB  . ASN C 1 27  ? 110.205 32.434  74.831  1.00 44.45 ? 25  ASN C CB  1 
ATOM   4822  C CG  . ASN C 1 27  ? 110.142 30.927  74.584  1.00 44.45 ? 25  ASN C CG  1 
ATOM   4823  O OD1 . ASN C 1 27  ? 110.276 30.478  73.437  1.00 44.45 ? 25  ASN C OD1 1 
ATOM   4824  N ND2 . ASN C 1 27  ? 109.961 30.141  75.651  1.00 44.45 ? 25  ASN C ND2 1 
ATOM   4825  N N   . GLY C 1 28  ? 108.563 34.915  77.040  1.00 47.92 ? 26  GLY C N   1 
ATOM   4826  C CA  . GLY C 1 28  ? 108.500 36.349  77.225  1.00 47.92 ? 26  GLY C CA  1 
ATOM   4827  C C   . GLY C 1 28  ? 108.011 36.991  75.950  1.00 47.92 ? 26  GLY C C   1 
ATOM   4828  O O   . GLY C 1 28  ? 108.390 38.116  75.637  1.00 47.92 ? 26  GLY C O   1 
ATOM   4829  N N   . LYS C 1 29  ? 107.177 36.263  75.210  1.00 47.72 ? 27  LYS C N   1 
ATOM   4830  C CA  . LYS C 1 29  ? 106.614 36.755  73.951  1.00 47.72 ? 27  LYS C CA  1 
ATOM   4831  C C   . LYS C 1 29  ? 105.259 37.456  74.160  1.00 47.72 ? 27  LYS C C   1 
ATOM   4832  O O   . LYS C 1 29  ? 104.507 37.133  75.092  1.00 47.72 ? 27  LYS C O   1 
ATOM   4833  C CB  . LYS C 1 29  ? 106.433 35.598  72.959  1.00 31.00 ? 27  LYS C CB  1 
ATOM   4834  C CG  . LYS C 1 29  ? 107.423 35.548  71.808  1.00 31.00 ? 27  LYS C CG  1 
ATOM   4835  C CD  . LYS C 1 29  ? 107.089 34.406  70.818  1.00 31.00 ? 27  LYS C CD  1 
ATOM   4836  C CE  . LYS C 1 29  ? 107.145 33.008  71.476  1.00 31.00 ? 27  LYS C CE  1 
ATOM   4837  N NZ  . LYS C 1 29  ? 106.844 31.876  70.549  1.00 31.00 ? 27  LYS C NZ  1 
ATOM   4838  N N   . GLY C 1 30  ? 104.952 38.405  73.278  1.00 65.31 ? 28  GLY C N   1 
ATOM   4839  C CA  . GLY C 1 30  ? 103.704 39.131  73.380  1.00 65.31 ? 28  GLY C CA  1 
ATOM   4840  C C   . GLY C 1 30  ? 102.733 38.981  72.224  1.00 65.31 ? 28  GLY C C   1 
ATOM   4841  O O   . GLY C 1 30  ? 102.834 38.081  71.392  1.00 65.31 ? 28  GLY C O   1 
ATOM   4842  N N   . ILE C 1 31  ? 101.789 39.908  72.173  1.00 62.26 ? 29  ILE C N   1 
ATOM   4843  C CA  . ILE C 1 31  ? 100.739 39.910  71.171  1.00 62.26 ? 29  ILE C CA  1 
ATOM   4844  C C   . ILE C 1 31  ? 100.666 41.275  70.480  1.00 62.26 ? 29  ILE C C   1 
ATOM   4845  O O   . ILE C 1 31  ? 100.729 42.315  71.148  1.00 62.26 ? 29  ILE C O   1 
ATOM   4846  C CB  . ILE C 1 31  ? 99.388  39.550  71.873  1.00 33.26 ? 29  ILE C CB  1 
ATOM   4847  C CG1 . ILE C 1 31  ? 99.295  38.027  72.045  1.00 33.26 ? 29  ILE C CG1 1 
ATOM   4848  C CG2 . ILE C 1 31  ? 98.207  40.146  71.132  1.00 33.26 ? 29  ILE C CG2 1 
ATOM   4849  C CD1 . ILE C 1 31  ? 97.977  37.529  72.613  1.00 33.26 ? 29  ILE C CD1 1 
ATOM   4850  N N   . LEU C 1 32  ? 100.549 41.269  69.149  1.00 59.87 ? 30  LEU C N   1 
ATOM   4851  C CA  . LEU C 1 32  ? 100.457 42.513  68.373  1.00 59.87 ? 30  LEU C CA  1 
ATOM   4852  C C   . LEU C 1 32  ? 99.018  42.908  68.038  1.00 59.87 ? 30  LEU C C   1 
ATOM   4853  O O   . LEU C 1 32  ? 98.202  42.073  67.643  1.00 59.87 ? 30  LEU C O   1 
ATOM   4854  C CB  . LEU C 1 32  ? 101.254 42.412  67.065  1.00 44.38 ? 30  LEU C CB  1 
ATOM   4855  C CG  . LEU C 1 32  ? 100.952 43.494  66.005  1.00 44.38 ? 30  LEU C CG  1 
ATOM   4856  C CD1 . LEU C 1 32  ? 101.158 44.902  66.568  1.00 44.38 ? 30  LEU C CD1 1 
ATOM   4857  C CD2 . LEU C 1 32  ? 101.842 43.272  64.805  1.00 44.38 ? 30  LEU C CD2 1 
ATOM   4858  N N   . ALA C 1 33  ? 98.722  44.196  68.173  1.00 73.21 ? 31  ALA C N   1 
ATOM   4859  C CA  . ALA C 1 33  ? 97.383  44.691  67.896  1.00 73.21 ? 31  ALA C CA  1 
ATOM   4860  C C   . ALA C 1 33  ? 97.237  45.322  66.516  1.00 73.21 ? 31  ALA C C   1 
ATOM   4861  O O   . ALA C 1 33  ? 97.096  46.540  66.384  1.00 73.21 ? 31  ALA C O   1 
ATOM   4862  C CB  . ALA C 1 33  ? 96.963  45.691  68.976  1.00 88.98 ? 31  ALA C CB  1 
ATOM   4863  N N   . ALA C 1 34  ? 97.275  44.488  65.486  1.00 61.82 ? 32  ALA C N   1 
ATOM   4864  C CA  . ALA C 1 34  ? 97.107  44.976  64.126  1.00 61.82 ? 32  ALA C CA  1 
ATOM   4865  C C   . ALA C 1 34  ? 95.633  44.774  63.809  1.00 61.82 ? 32  ALA C C   1 
ATOM   4866  O O   . ALA C 1 34  ? 95.258  44.451  62.676  1.00 61.82 ? 32  ALA C O   1 
ATOM   4867  C CB  . ALA C 1 34  ? 97.976  44.178  63.162  1.00 13.50 ? 32  ALA C CB  1 
ATOM   4868  N N   . ASP C 1 35  ? 94.805  44.963  64.836  1.00 61.56 ? 33  ASP C N   1 
ATOM   4869  C CA  . ASP C 1 35  ? 93.360  44.795  64.723  1.00 61.56 ? 33  ASP C CA  1 
ATOM   4870  C C   . ASP C 1 35  ? 92.605  46.115  64.824  1.00 61.56 ? 33  ASP C C   1 
ATOM   4871  O O   . ASP C 1 35  ? 91.443  46.127  65.229  1.00 61.56 ? 33  ASP C O   1 
ATOM   4872  C CB  . ASP C 1 35  ? 92.855  43.840  65.813  1.00 77.75 ? 33  ASP C CB  1 
ATOM   4873  C CG  . ASP C 1 35  ? 92.944  44.436  67.221  1.00 77.75 ? 33  ASP C CG  1 
ATOM   4874  O OD1 . ASP C 1 35  ? 92.778  43.680  68.204  1.00 77.75 ? 33  ASP C OD1 1 
ATOM   4875  O OD2 . ASP C 1 35  ? 93.169  45.656  67.355  1.00 77.75 ? 33  ASP C OD2 1 
ATOM   4876  N N   . GLU C 1 36  ? 93.258  47.221  64.472  1.00 52.78 ? 34  GLU C N   1 
ATOM   4877  C CA  . GLU C 1 36  ? 92.602  48.523  64.535  1.00 52.78 ? 34  GLU C CA  1 
ATOM   4878  C C   . GLU C 1 36  ? 91.397  48.565  63.599  1.00 52.78 ? 34  GLU C C   1 
ATOM   4879  O O   . GLU C 1 36  ? 91.545  48.502  62.380  1.00 52.78 ? 34  GLU C O   1 
ATOM   4880  C CB  . GLU C 1 36  ? 93.586  49.639  64.180  1.00 81.48 ? 34  GLU C CB  1 
ATOM   4881  C CG  . GLU C 1 36  ? 94.667  49.854  65.232  1.00 81.48 ? 34  GLU C CG  1 
ATOM   4882  C CD  . GLU C 1 36  ? 96.017  49.335  64.800  1.00 81.48 ? 34  GLU C CD  1 
ATOM   4883  O OE1 . GLU C 1 36  ? 96.082  48.204  64.266  1.00 81.48 ? 34  GLU C OE1 1 
ATOM   4884  O OE2 . GLU C 1 36  ? 97.014  50.061  65.004  1.00 81.48 ? 34  GLU C OE2 1 
ATOM   4885  N N   . SER C 1 37  ? 90.200  48.662  64.175  1.00 92.42 ? 35  SER C N   1 
ATOM   4886  C CA  . SER C 1 37  ? 88.976  48.696  63.375  1.00 92.42 ? 35  SER C CA  1 
ATOM   4887  C C   . SER C 1 37  ? 89.140  49.639  62.190  1.00 92.42 ? 35  SER C C   1 
ATOM   4888  O O   . SER C 1 37  ? 89.962  50.564  62.227  1.00 92.42 ? 35  SER C O   1 
ATOM   4889  C CB  . SER C 1 37  ? 87.769  49.111  64.237  1.00 81.34 ? 35  SER C CB  1 
ATOM   4890  O OG  . SER C 1 37  ? 87.947  50.375  64.853  1.00 81.34 ? 35  SER C OG  1 
ATOM   4891  N N   . VAL C 1 38  ? 88.365  49.388  61.138  1.00 92.42 ? 36  VAL C N   1 
ATOM   4892  C CA  . VAL C 1 38  ? 88.421  50.195  59.920  1.00 92.42 ? 36  VAL C CA  1 
ATOM   4893  C C   . VAL C 1 38  ? 88.638  51.673  60.220  1.00 92.42 ? 36  VAL C C   1 
ATOM   4894  O O   . VAL C 1 38  ? 89.599  52.279  59.736  1.00 92.42 ? 36  VAL C O   1 
ATOM   4895  C CB  . VAL C 1 38  ? 87.129  50.077  59.094  1.00 92.42 ? 36  VAL C CB  1 
ATOM   4896  C CG1 . VAL C 1 38  ? 87.404  50.520  57.666  1.00 92.42 ? 36  VAL C CG1 1 
ATOM   4897  C CG2 . VAL C 1 38  ? 86.592  48.652  59.140  1.00 92.42 ? 36  VAL C CG2 1 
ATOM   4898  N N   . GLY C 1 39  ? 87.734  52.247  61.013  1.00 79.82 ? 37  GLY C N   1 
ATOM   4899  C CA  . GLY C 1 39  ? 87.846  53.650  61.370  1.00 79.82 ? 37  GLY C CA  1 
ATOM   4900  C C   . GLY C 1 39  ? 89.121  53.935  62.142  1.00 79.82 ? 37  GLY C C   1 
ATOM   4901  O O   . GLY C 1 39  ? 89.907  54.809  61.767  1.00 79.82 ? 37  GLY C O   1 
ATOM   4902  N N   . THR C 1 40  ? 89.325  53.188  63.224  1.00 79.66 ? 38  THR C N   1 
ATOM   4903  C CA  . THR C 1 40  ? 90.505  53.347  64.067  1.00 79.66 ? 38  THR C CA  1 
ATOM   4904  C C   . THR C 1 40  ? 91.730  53.634  63.226  1.00 79.66 ? 38  THR C C   1 
ATOM   4905  O O   . THR C 1 40  ? 92.234  54.756  63.196  1.00 79.66 ? 38  THR C O   1 
ATOM   4906  C CB  . THR C 1 40  ? 90.780  52.071  64.893  1.00 92.42 ? 38  THR C CB  1 
ATOM   4907  O OG1 . THR C 1 40  ? 89.737  51.887  65.862  1.00 92.42 ? 38  THR C OG1 1 
ATOM   4908  C CG2 . THR C 1 40  ? 92.119  52.176  65.605  1.00 92.42 ? 38  THR C CG2 1 
ATOM   4909  N N   . MET C 1 41  ? 92.199  52.600  62.543  1.00 70.75 ? 39  MET C N   1 
ATOM   4910  C CA  . MET C 1 41  ? 93.370  52.709  61.688  1.00 70.75 ? 39  MET C CA  1 
ATOM   4911  C C   . MET C 1 41  ? 93.456  54.085  61.013  1.00 70.75 ? 39  MET C C   1 
ATOM   4912  O O   . MET C 1 41  ? 94.511  54.722  61.009  1.00 70.75 ? 39  MET C O   1 
ATOM   4913  C CB  . MET C 1 41  ? 93.320  51.607  60.627  1.00 89.22 ? 39  MET C CB  1 
ATOM   4914  C CG  . MET C 1 41  ? 94.645  51.338  59.935  1.00 89.22 ? 39  MET C CG  1 
ATOM   4915  S SD  . MET C 1 41  ? 95.875  50.649  61.057  1.00 89.22 ? 39  MET C SD  1 
ATOM   4916  C CE  . MET C 1 41  ? 96.813  52.110  61.454  1.00 89.22 ? 39  MET C CE  1 
ATOM   4917  N N   . GLY C 1 42  ? 92.333  54.534  60.457  1.00 89.34 ? 40  GLY C N   1 
ATOM   4918  C CA  . GLY C 1 42  ? 92.283  55.814  59.773  1.00 89.34 ? 40  GLY C CA  1 
ATOM   4919  C C   . GLY C 1 42  ? 92.912  56.969  60.525  1.00 89.34 ? 40  GLY C C   1 
ATOM   4920  O O   . GLY C 1 42  ? 93.707  57.725  59.967  1.00 89.34 ? 40  GLY C O   1 
ATOM   4921  N N   . ASN C 1 43  ? 92.553  57.112  61.794  1.00 92.42 ? 41  ASN C N   1 
ATOM   4922  C CA  . ASN C 1 43  ? 93.088  58.188  62.622  1.00 92.42 ? 41  ASN C CA  1 
ATOM   4923  C C   . ASN C 1 43  ? 94.543  57.901  62.986  1.00 92.42 ? 41  ASN C C   1 
ATOM   4924  O O   . ASN C 1 43  ? 95.226  58.745  63.574  1.00 92.42 ? 41  ASN C O   1 
ATOM   4925  C CB  . ASN C 1 43  ? 92.248  58.324  63.886  1.00 92.42 ? 41  ASN C CB  1 
ATOM   4926  C CG  . ASN C 1 43  ? 90.988  57.494  63.820  1.00 92.42 ? 41  ASN C CG  1 
ATOM   4927  O OD1 . ASN C 1 43  ? 90.130  57.707  62.957  1.00 92.42 ? 41  ASN C OD1 1 
ATOM   4928  N ND2 . ASN C 1 43  ? 90.873  56.525  64.724  1.00 92.42 ? 41  ASN C ND2 1 
ATOM   4929  N N   . ARG C 1 44  ? 95.004  56.700  62.644  1.00 84.84 ? 42  ARG C N   1 
ATOM   4930  C CA  . ARG C 1 44  ? 96.384  56.300  62.899  1.00 84.84 ? 42  ARG C CA  1 
ATOM   4931  C C   . ARG C 1 44  ? 97.202  56.815  61.725  1.00 84.84 ? 42  ARG C C   1 
ATOM   4932  O O   . ARG C 1 44  ? 98.320  57.302  61.891  1.00 84.84 ? 42  ARG C O   1 
ATOM   4933  C CB  . ARG C 1 44  ? 96.501  54.776  62.964  1.00 87.91 ? 42  ARG C CB  1 
ATOM   4934  C CG  . ARG C 1 44  ? 95.832  54.124  64.165  1.00 87.91 ? 42  ARG C CG  1 
ATOM   4935  C CD  . ARG C 1 44  ? 96.792  53.967  65.345  1.00 87.91 ? 42  ARG C CD  1 
ATOM   4936  N NE  . ARG C 1 44  ? 96.146  53.313  66.479  1.00 87.91 ? 42  ARG C NE  1 
ATOM   4937  C CZ  . ARG C 1 44  ? 95.204  53.878  67.229  1.00 87.91 ? 42  ARG C CZ  1 
ATOM   4938  N NH1 . ARG C 1 44  ? 94.796  55.116  66.971  1.00 87.91 ? 42  ARG C NH1 1 
ATOM   4939  N NH2 . ARG C 1 44  ? 94.661  53.201  68.232  1.00 87.91 ? 42  ARG C NH2 1 
ATOM   4940  N N   . LEU C 1 45  ? 96.623  56.697  60.535  1.00 65.78 ? 43  LEU C N   1 
ATOM   4941  C CA  . LEU C 1 45  ? 97.265  57.148  59.310  1.00 65.78 ? 43  LEU C CA  1 
ATOM   4942  C C   . LEU C 1 45  ? 97.017  58.642  59.241  1.00 65.78 ? 43  LEU C C   1 
ATOM   4943  O O   . LEU C 1 45  ? 97.456  59.326  58.328  1.00 65.78 ? 43  LEU C O   1 
ATOM   4944  C CB  . LEU C 1 45  ? 96.640  56.438  58.109  1.00 58.67 ? 43  LEU C CB  1 
ATOM   4945  C CG  . LEU C 1 45  ? 96.244  54.975  58.382  1.00 58.67 ? 43  LEU C CG  1 
ATOM   4946  C CD1 . LEU C 1 45  ? 95.823  54.280  57.083  1.00 58.67 ? 43  LEU C CD1 1 
ATOM   4947  C CD2 . LEU C 1 45  ? 97.407  54.232  59.020  1.00 58.67 ? 43  LEU C CD2 1 
ATOM   4948  N N   . GLN C 1 46  ? 96.297  59.130  60.239  1.00 74.37 ? 44  GLN C N   1 
ATOM   4949  C CA  . GLN C 1 46  ? 95.974  60.537  60.356  1.00 74.37 ? 44  GLN C CA  1 
ATOM   4950  C C   . GLN C 1 46  ? 97.247  61.253  60.790  1.00 74.37 ? 44  GLN C C   1 
ATOM   4951  O O   . GLN C 1 46  ? 97.708  62.183  60.129  1.00 74.37 ? 44  GLN C O   1 
ATOM   4952  C CB  . GLN C 1 46  ? 94.893  60.724  61.425  1.00 92.42 ? 44  GLN C CB  1 
ATOM   4953  C CG  . GLN C 1 46  ? 94.367  62.141  61.587  1.00 92.42 ? 44  GLN C CG  1 
ATOM   4954  C CD  . GLN C 1 46  ? 93.286  62.474  60.579  1.00 92.42 ? 44  GLN C CD  1 
ATOM   4955  O OE1 . GLN C 1 46  ? 92.282  61.764  60.482  1.00 92.42 ? 44  GLN C OE1 1 
ATOM   4956  N NE2 . GLN C 1 46  ? 93.480  63.557  59.825  1.00 92.42 ? 44  GLN C NE2 1 
ATOM   4957  N N   . ARG C 1 47  ? 97.807  60.796  61.910  1.00 92.42 ? 45  ARG C N   1 
ATOM   4958  C CA  . ARG C 1 47  ? 99.020  61.376  62.482  1.00 92.42 ? 45  ARG C CA  1 
ATOM   4959  C C   . ARG C 1 47  ? 100.160 61.546  61.472  1.00 92.42 ? 45  ARG C C   1 
ATOM   4960  O O   . ARG C 1 47  ? 100.792 62.608  61.417  1.00 92.42 ? 45  ARG C O   1 
ATOM   4961  C CB  . ARG C 1 47  ? 99.501  60.537  63.686  1.00 92.42 ? 45  ARG C CB  1 
ATOM   4962  C CG  . ARG C 1 47  ? 98.686  60.710  64.989  1.00 92.42 ? 45  ARG C CG  1 
ATOM   4963  C CD  . ARG C 1 47  ? 97.789  59.499  65.312  1.00 92.42 ? 45  ARG C CD  1 
ATOM   4964  N NE  . ARG C 1 47  ? 96.992  59.697  66.530  1.00 92.42 ? 45  ARG C NE  1 
ATOM   4965  C CZ  . ARG C 1 47  ? 96.041  58.866  66.966  1.00 92.42 ? 45  ARG C CZ  1 
ATOM   4966  N NH1 . ARG C 1 47  ? 95.754  57.760  66.289  1.00 92.42 ? 45  ARG C NH1 1 
ATOM   4967  N NH2 . ARG C 1 47  ? 95.361  59.145  68.075  1.00 92.42 ? 45  ARG C NH2 1 
ATOM   4968  N N   . ILE C 1 48  ? 100.424 60.509  60.678  1.00 85.51 ? 46  ILE C N   1 
ATOM   4969  C CA  . ILE C 1 48  ? 101.492 60.574  59.680  1.00 85.51 ? 46  ILE C CA  1 
ATOM   4970  C C   . ILE C 1 48  ? 101.032 61.340  58.437  1.00 85.51 ? 46  ILE C C   1 
ATOM   4971  O O   . ILE C 1 48  ? 101.808 61.559  57.501  1.00 85.51 ? 46  ILE C O   1 
ATOM   4972  C CB  . ILE C 1 48  ? 101.980 59.152  59.267  1.00 53.26 ? 46  ILE C CB  1 
ATOM   4973  C CG1 . ILE C 1 48  ? 100.790 58.277  58.851  1.00 53.26 ? 46  ILE C CG1 1 
ATOM   4974  C CG2 . ILE C 1 48  ? 102.763 58.523  60.416  1.00 53.26 ? 46  ILE C CG2 1 
ATOM   4975  C CD1 . ILE C 1 48  ? 101.181 56.961  58.213  1.00 53.26 ? 46  ILE C CD1 1 
ATOM   4976  N N   . LYS C 1 49  ? 99.762  61.743  58.448  1.00 72.94 ? 47  LYS C N   1 
ATOM   4977  C CA  . LYS C 1 49  ? 99.156  62.507  57.360  1.00 72.94 ? 47  LYS C CA  1 
ATOM   4978  C C   . LYS C 1 49  ? 99.083  61.707  56.060  1.00 72.94 ? 47  LYS C C   1 
ATOM   4979  O O   . LYS C 1 49  ? 99.708  62.062  55.064  1.00 72.94 ? 47  LYS C O   1 
ATOM   4980  C CB  . LYS C 1 49  ? 99.944  63.806  57.156  1.00 92.42 ? 47  LYS C CB  1 
ATOM   4981  C CG  . LYS C 1 49  ? 100.287 64.495  58.479  1.00 92.42 ? 47  LYS C CG  1 
ATOM   4982  C CD  . LYS C 1 49  ? 101.258 65.658  58.324  1.00 92.42 ? 47  LYS C CD  1 
ATOM   4983  C CE  . LYS C 1 49  ? 100.589 66.879  57.710  1.00 92.42 ? 47  LYS C CE  1 
ATOM   4984  N NZ  . LYS C 1 49  ? 101.493 68.073  57.725  1.00 92.42 ? 47  LYS C NZ  1 
ATOM   4985  N N   . VAL C 1 50  ? 98.316  60.620  56.091  1.00 92.42 ? 48  VAL C N   1 
ATOM   4986  C CA  . VAL C 1 50  ? 98.117  59.746  54.935  1.00 92.42 ? 48  VAL C CA  1 
ATOM   4987  C C   . VAL C 1 50  ? 96.618  59.437  54.816  1.00 92.42 ? 48  VAL C C   1 
ATOM   4988  O O   . VAL C 1 50  ? 95.874  59.549  55.793  1.00 92.42 ? 48  VAL C O   1 
ATOM   4989  C CB  . VAL C 1 50  ? 98.881  58.407  55.093  1.00 70.63 ? 48  VAL C CB  1 
ATOM   4990  C CG1 . VAL C 1 50  ? 98.753  57.581  53.812  1.00 70.63 ? 48  VAL C CG1 1 
ATOM   4991  C CG2 . VAL C 1 50  ? 100.345 58.667  55.435  1.00 70.63 ? 48  VAL C CG2 1 
ATOM   4992  N N   . GLU C 1 51  ? 96.174  59.045  53.628  1.00 92.42 ? 49  GLU C N   1 
ATOM   4993  C CA  . GLU C 1 51  ? 94.759  58.739  53.414  1.00 92.42 ? 49  GLU C CA  1 
ATOM   4994  C C   . GLU C 1 51  ? 94.398  57.322  53.859  1.00 92.42 ? 49  GLU C C   1 
ATOM   4995  O O   . GLU C 1 51  ? 95.250  56.434  53.855  1.00 92.42 ? 49  GLU C O   1 
ATOM   4996  C CB  . GLU C 1 51  ? 94.405  58.916  51.930  1.00 92.42 ? 49  GLU C CB  1 
ATOM   4997  C CG  . GLU C 1 51  ? 94.489  60.359  51.419  1.00 92.42 ? 49  GLU C CG  1 
ATOM   4998  C CD  . GLU C 1 51  ? 93.447  61.276  52.047  1.00 92.42 ? 49  GLU C CD  1 
ATOM   4999  O OE1 . GLU C 1 51  ? 93.444  62.478  51.712  1.00 92.42 ? 49  GLU C OE1 1 
ATOM   5000  O OE2 . GLU C 1 51  ? 92.633  60.800  52.869  1.00 92.42 ? 49  GLU C OE2 1 
ATOM   5001  N N   . ASN C 1 52  ? 93.139  57.117  54.249  1.00 79.36 ? 50  ASN C N   1 
ATOM   5002  C CA  . ASN C 1 52  ? 92.688  55.793  54.672  1.00 79.36 ? 50  ASN C CA  1 
ATOM   5003  C C   . ASN C 1 52  ? 92.223  55.004  53.450  1.00 79.36 ? 50  ASN C C   1 
ATOM   5004  O O   . ASN C 1 52  ? 91.197  55.318  52.844  1.00 79.36 ? 50  ASN C O   1 
ATOM   5005  C CB  . ASN C 1 52  ? 91.546  55.894  55.686  1.00 63.95 ? 50  ASN C CB  1 
ATOM   5006  C CG  . ASN C 1 52  ? 91.271  54.567  56.390  1.00 63.95 ? 50  ASN C CG  1 
ATOM   5007  O OD1 . ASN C 1 52  ? 90.438  54.485  57.293  1.00 63.95 ? 50  ASN C OD1 1 
ATOM   5008  N ND2 . ASN C 1 52  ? 91.982  53.525  55.979  1.00 63.95 ? 50  ASN C ND2 1 
ATOM   5009  N N   . THR C 1 53  ? 92.984  53.971  53.104  1.00 72.18 ? 51  THR C N   1 
ATOM   5010  C CA  . THR C 1 53  ? 92.678  53.152  51.942  1.00 72.18 ? 51  THR C CA  1 
ATOM   5011  C C   . THR C 1 53  ? 92.620  51.659  52.232  1.00 72.18 ? 51  THR C C   1 
ATOM   5012  O O   . THR C 1 53  ? 93.261  51.160  53.153  1.00 72.18 ? 51  THR C O   1 
ATOM   5013  C CB  . THR C 1 53  ? 93.729  53.373  50.849  1.00 83.18 ? 51  THR C CB  1 
ATOM   5014  O OG1 . THR C 1 53  ? 93.885  54.776  50.630  1.00 83.18 ? 51  THR C OG1 1 
ATOM   5015  C CG2 . THR C 1 53  ? 93.307  52.707  49.548  1.00 83.18 ? 51  THR C CG2 1 
ATOM   5016  N N   . GLU C 1 54  ? 91.845  50.952  51.420  1.00 92.42 ? 52  GLU C N   1 
ATOM   5017  C CA  . GLU C 1 54  ? 91.709  49.506  51.537  1.00 92.42 ? 52  GLU C CA  1 
ATOM   5018  C C   . GLU C 1 54  ? 93.100  48.985  51.177  1.00 92.42 ? 52  GLU C C   1 
ATOM   5019  O O   . GLU C 1 54  ? 93.401  47.798  51.309  1.00 92.42 ? 52  GLU C O   1 
ATOM   5020  C CB  . GLU C 1 54  ? 90.663  49.007  50.524  1.00 92.42 ? 52  GLU C CB  1 
ATOM   5021  C CG  . GLU C 1 54  ? 89.911  47.727  50.900  1.00 92.42 ? 52  GLU C CG  1 
ATOM   5022  C CD  . GLU C 1 54  ? 90.784  46.487  50.862  1.00 92.42 ? 52  GLU C CD  1 
ATOM   5023  O OE1 . GLU C 1 54  ? 91.457  46.270  49.828  1.00 92.42 ? 52  GLU C OE1 1 
ATOM   5024  O OE2 . GLU C 1 54  ? 90.789  45.728  51.859  1.00 92.42 ? 52  GLU C OE2 1 
ATOM   5025  N N   . GLU C 1 55  ? 93.944  49.910  50.730  1.00 92.42 ? 53  GLU C N   1 
ATOM   5026  C CA  . GLU C 1 55  ? 95.306  49.601  50.324  1.00 92.42 ? 53  GLU C CA  1 
ATOM   5027  C C   . GLU C 1 55  ? 96.336  50.003  51.382  1.00 92.42 ? 53  GLU C C   1 
ATOM   5028  O O   . GLU C 1 55  ? 97.096  49.157  51.861  1.00 92.42 ? 53  GLU C O   1 
ATOM   5029  C CB  . GLU C 1 55  ? 95.615  50.301  48.997  1.00 86.14 ? 53  GLU C CB  1 
ATOM   5030  C CG  . GLU C 1 55  ? 96.920  49.874  48.357  1.00 86.14 ? 53  GLU C CG  1 
ATOM   5031  C CD  . GLU C 1 55  ? 97.061  48.369  48.303  1.00 86.14 ? 53  GLU C CD  1 
ATOM   5032  O OE1 . GLU C 1 55  ? 96.094  47.699  47.878  1.00 86.14 ? 53  GLU C OE1 1 
ATOM   5033  O OE2 . GLU C 1 55  ? 98.139  47.860  48.683  1.00 86.14 ? 53  GLU C OE2 1 
ATOM   5034  N N   . ASN C 1 56  ? 96.369  51.286  51.742  1.00 67.14 ? 54  ASN C N   1 
ATOM   5035  C CA  . ASN C 1 56  ? 97.322  51.768  52.746  1.00 67.14 ? 54  ASN C CA  1 
ATOM   5036  C C   . ASN C 1 56  ? 97.416  50.790  53.916  1.00 67.14 ? 54  ASN C C   1 
ATOM   5037  O O   . ASN C 1 56  ? 98.508  50.355  54.286  1.00 67.14 ? 54  ASN C O   1 
ATOM   5038  C CB  . ASN C 1 56  ? 96.906  53.151  53.270  1.00 90.42 ? 54  ASN C CB  1 
ATOM   5039  C CG  . ASN C 1 56  ? 96.889  54.206  52.184  1.00 90.42 ? 54  ASN C CG  1 
ATOM   5040  O OD1 . ASN C 1 56  ? 97.852  54.360  51.431  1.00 90.42 ? 54  ASN C OD1 1 
ATOM   5041  N ND2 . ASN C 1 56  ? 95.796  54.944  52.104  1.00 90.42 ? 54  ASN C ND2 1 
ATOM   5042  N N   . ARG C 1 57  ? 96.260  50.456  54.488  1.00 91.37 ? 55  ARG C N   1 
ATOM   5043  C CA  . ARG C 1 57  ? 96.187  49.518  55.597  1.00 91.37 ? 55  ARG C CA  1 
ATOM   5044  C C   . ARG C 1 57  ? 96.953  48.257  55.237  1.00 91.37 ? 55  ARG C C   1 
ATOM   5045  O O   . ARG C 1 57  ? 97.949  47.919  55.875  1.00 91.37 ? 55  ARG C O   1 
ATOM   5046  C CB  . ARG C 1 57  ? 94.734  49.167  55.895  1.00 65.51 ? 55  ARG C CB  1 
ATOM   5047  C CG  . ARG C 1 57  ? 93.914  50.371  56.274  1.00 65.51 ? 55  ARG C CG  1 
ATOM   5048  C CD  . ARG C 1 57  ? 92.692  49.952  57.048  1.00 65.51 ? 55  ARG C CD  1 
ATOM   5049  N NE  . ARG C 1 57  ? 91.662  49.380  56.195  1.00 65.51 ? 55  ARG C NE  1 
ATOM   5050  C CZ  . ARG C 1 57  ? 90.878  50.096  55.404  1.00 65.51 ? 55  ARG C CZ  1 
ATOM   5051  N NH1 . ARG C 1 57  ? 91.008  51.412  55.359  1.00 65.51 ? 55  ARG C NH1 1 
ATOM   5052  N NH2 . ARG C 1 57  ? 89.960  49.496  54.663  1.00 65.51 ? 55  ARG C NH2 1 
ATOM   5053  N N   . ARG C 1 58  ? 96.483  47.571  54.201  1.00 92.42 ? 56  ARG C N   1 
ATOM   5054  C CA  . ARG C 1 58  ? 97.118  46.341  53.726  1.00 92.42 ? 56  ARG C CA  1 
ATOM   5055  C C   . ARG C 1 58  ? 98.638  46.507  53.619  1.00 92.42 ? 56  ARG C C   1 
ATOM   5056  O O   . ARG C 1 58  ? 99.408  45.672  54.109  1.00 92.42 ? 56  ARG C O   1 
ATOM   5057  C CB  . ARG C 1 58  ? 96.551  45.959  52.348  1.00 76.98 ? 56  ARG C CB  1 
ATOM   5058  C CG  . ARG C 1 58  ? 96.971  44.583  51.836  1.00 76.98 ? 56  ARG C CG  1 
ATOM   5059  C CD  . ARG C 1 58  ? 96.911  44.537  50.327  1.00 76.98 ? 56  ARG C CD  1 
ATOM   5060  N NE  . ARG C 1 58  ? 97.948  45.381  49.735  1.00 76.98 ? 56  ARG C NE  1 
ATOM   5061  C CZ  . ARG C 1 58  ? 99.235  45.052  49.670  1.00 76.98 ? 56  ARG C CZ  1 
ATOM   5062  N NH1 . ARG C 1 58  ? 99.646  43.892  50.160  1.00 76.98 ? 56  ARG C NH1 1 
ATOM   5063  N NH2 . ARG C 1 58  ? 100.112 45.876  49.108  1.00 76.98 ? 56  ARG C NH2 1 
ATOM   5064  N N   . GLN C 1 59  ? 99.059  47.593  52.977  1.00 82.27 ? 57  GLN C N   1 
ATOM   5065  C CA  . GLN C 1 59  ? 100.476 47.855  52.786  1.00 82.27 ? 57  GLN C CA  1 
ATOM   5066  C C   . GLN C 1 59  ? 101.275 48.005  54.085  1.00 82.27 ? 57  GLN C C   1 
ATOM   5067  O O   . GLN C 1 59  ? 102.148 47.183  54.355  1.00 82.27 ? 57  GLN C O   1 
ATOM   5068  C CB  . GLN C 1 59  ? 100.669 49.057  51.835  1.00 92.42 ? 57  GLN C CB  1 
ATOM   5069  C CG  . GLN C 1 59  ? 100.507 48.644  50.335  1.00 92.42 ? 57  GLN C CG  1 
ATOM   5070  C CD  . GLN C 1 59  ? 100.744 49.768  49.313  1.00 92.42 ? 57  GLN C CD  1 
ATOM   5071  O OE1 . GLN C 1 59  ? 101.729 50.509  49.393  1.00 92.42 ? 57  GLN C OE1 1 
ATOM   5072  N NE2 . GLN C 1 59  ? 99.847  49.874  48.333  1.00 92.42 ? 57  GLN C NE2 1 
ATOM   5073  N N   . PHE C 1 60  ? 100.989 49.017  54.901  1.00 72.11 ? 58  PHE C N   1 
ATOM   5074  C CA  . PHE C 1 60  ? 101.737 49.162  56.151  1.00 72.11 ? 58  PHE C CA  1 
ATOM   5075  C C   . PHE C 1 60  ? 101.807 47.809  56.836  1.00 72.11 ? 58  PHE C C   1 
ATOM   5076  O O   . PHE C 1 60  ? 102.852 47.421  57.346  1.00 72.11 ? 58  PHE C O   1 
ATOM   5077  C CB  . PHE C 1 60  ? 101.073 50.172  57.098  1.00 84.89 ? 58  PHE C CB  1 
ATOM   5078  C CG  . PHE C 1 60  ? 101.735 50.263  58.462  1.00 84.89 ? 58  PHE C CG  1 
ATOM   5079  C CD1 . PHE C 1 60  ? 103.064 50.654  58.590  1.00 84.89 ? 58  PHE C CD1 1 
ATOM   5080  C CD2 . PHE C 1 60  ? 101.027 49.946  59.621  1.00 84.89 ? 58  PHE C CD2 1 
ATOM   5081  C CE1 . PHE C 1 60  ? 103.673 50.725  59.851  1.00 84.89 ? 58  PHE C CE1 1 
ATOM   5082  C CE2 . PHE C 1 60  ? 101.630 50.016  60.886  1.00 84.89 ? 58  PHE C CE2 1 
ATOM   5083  C CZ  . PHE C 1 60  ? 102.950 50.404  60.999  1.00 84.89 ? 58  PHE C CZ  1 
ATOM   5084  N N   . ARG C 1 61  ? 100.691 47.087  56.822  1.00 63.13 ? 59  ARG C N   1 
ATOM   5085  C CA  . ARG C 1 61  ? 100.615 45.772  57.456  1.00 63.13 ? 59  ARG C CA  1 
ATOM   5086  C C   . ARG C 1 61  ? 101.379 44.682  56.699  1.00 63.13 ? 59  ARG C C   1 
ATOM   5087  O O   . ARG C 1 61  ? 101.814 43.697  57.299  1.00 63.13 ? 59  ARG C O   1 
ATOM   5088  C CB  . ARG C 1 61  ? 99.146  45.371  57.658  1.00 75.53 ? 59  ARG C CB  1 
ATOM   5089  C CG  . ARG C 1 61  ? 98.351  46.436  58.404  1.00 75.53 ? 59  ARG C CG  1 
ATOM   5090  C CD  . ARG C 1 61  ? 96.962  45.975  58.812  1.00 75.53 ? 59  ARG C CD  1 
ATOM   5091  N NE  . ARG C 1 61  ? 96.228  47.043  59.492  1.00 75.53 ? 59  ARG C NE  1 
ATOM   5092  C CZ  . ARG C 1 61  ? 95.085  46.874  60.149  1.00 75.53 ? 59  ARG C CZ  1 
ATOM   5093  N NH1 . ARG C 1 61  ? 94.525  45.671  60.226  1.00 75.53 ? 59  ARG C NH1 1 
ATOM   5094  N NH2 . ARG C 1 61  ? 94.508  47.911  60.734  1.00 75.53 ? 59  ARG C NH2 1 
ATOM   5095  N N   . GLU C 1 62  ? 101.536 44.840  55.390  1.00 92.42 ? 60  GLU C N   1 
ATOM   5096  C CA  . GLU C 1 62  ? 102.304 43.855  54.642  1.00 92.42 ? 60  GLU C CA  1 
ATOM   5097  C C   . GLU C 1 62  ? 103.750 43.989  55.135  1.00 92.42 ? 60  GLU C C   1 
ATOM   5098  O O   . GLU C 1 62  ? 104.476 42.995  55.266  1.00 92.42 ? 60  GLU C O   1 
ATOM   5099  C CB  . GLU C 1 62  ? 102.248 44.128  53.133  1.00 79.05 ? 60  GLU C CB  1 
ATOM   5100  C CG  . GLU C 1 62  ? 103.197 43.228  52.319  1.00 79.05 ? 60  GLU C CG  1 
ATOM   5101  C CD  . GLU C 1 62  ? 103.245 43.567  50.833  1.00 79.05 ? 60  GLU C CD  1 
ATOM   5102  O OE1 . GLU C 1 62  ? 104.079 42.968  50.120  1.00 79.05 ? 60  GLU C OE1 1 
ATOM   5103  O OE2 . GLU C 1 62  ? 102.455 44.421  50.377  1.00 79.05 ? 60  GLU C OE2 1 
ATOM   5104  N N   . ILE C 1 63  ? 104.145 45.233  55.413  1.00 71.84 ? 61  ILE C N   1 
ATOM   5105  C CA  . ILE C 1 63  ? 105.485 45.569  55.894  1.00 71.84 ? 61  ILE C CA  1 
ATOM   5106  C C   . ILE C 1 63  ? 105.795 44.837  57.191  1.00 71.84 ? 61  ILE C C   1 
ATOM   5107  O O   . ILE C 1 63  ? 106.810 44.150  57.301  1.00 71.84 ? 61  ILE C O   1 
ATOM   5108  C CB  . ILE C 1 63  ? 105.604 47.077  56.185  1.00 42.02 ? 61  ILE C CB  1 
ATOM   5109  C CG1 . ILE C 1 63  ? 105.269 47.882  54.935  1.00 42.02 ? 61  ILE C CG1 1 
ATOM   5110  C CG2 . ILE C 1 63  ? 107.003 47.407  56.683  1.00 42.02 ? 61  ILE C CG2 1 
ATOM   5111  C CD1 . ILE C 1 63  ? 105.257 49.371  55.171  1.00 42.02 ? 61  ILE C CD1 1 
ATOM   5112  N N   . LEU C 1 64  ? 104.906 45.003  58.169  1.00 73.16 ? 62  LEU C N   1 
ATOM   5113  C CA  . LEU C 1 64  ? 105.044 44.395  59.488  1.00 70.83 ? 62  LEU C CA  1 
ATOM   5114  C C   . LEU C 1 64  ? 105.133 42.874  59.438  1.00 75.80 ? 62  LEU C C   1 
ATOM   5115  O O   . LEU C 1 64  ? 106.052 42.279  59.988  1.00 73.89 ? 62  LEU C O   1 
ATOM   5116  C CB  . LEU C 1 64  ? 103.866 44.807  60.382  1.00 44.27 ? 62  LEU C CB  1 
ATOM   5117  C CG  . LEU C 1 64  ? 103.639 46.319  60.527  1.00 52.88 ? 62  LEU C CG  1 
ATOM   5118  C CD1 . LEU C 1 64  ? 102.355 46.594  61.286  1.00 45.13 ? 62  LEU C CD1 1 
ATOM   5119  C CD2 . LEU C 1 64  ? 104.814 46.951  61.241  1.00 46.38 ? 62  LEU C CD2 1 
ATOM   5120  N N   . PHE C 1 65  ? 104.184 42.250  58.758  1.00 51.30 ? 63  PHE C N   1 
ATOM   5121  C CA  . PHE C 1 65  ? 104.133 40.794  58.672  1.00 49.56 ? 63  PHE C CA  1 
ATOM   5122  C C   . PHE C 1 65  ? 105.253 40.108  57.885  1.00 56.85 ? 63  PHE C C   1 
ATOM   5123  O O   . PHE C 1 65  ? 105.496 38.906  58.049  1.00 56.74 ? 63  PHE C O   1 
ATOM   5124  C CB  . PHE C 1 65  ? 102.771 40.382  58.100  1.00 87.96 ? 63  PHE C CB  1 
ATOM   5125  C CG  . PHE C 1 65  ? 101.598 40.904  58.889  1.00 87.96 ? 63  PHE C CG  1 
ATOM   5126  C CD1 . PHE C 1 65  ? 100.367 41.085  58.281  1.00 87.96 ? 63  PHE C CD1 1 
ATOM   5127  C CD2 . PHE C 1 65  ? 101.721 41.203  60.239  1.00 87.96 ? 63  PHE C CD2 1 
ATOM   5128  C CE1 . PHE C 1 65  ? 99.277  41.557  59.006  1.00 87.96 ? 63  PHE C CE1 1 
ATOM   5129  C CE2 . PHE C 1 65  ? 100.638 41.673  60.970  1.00 87.96 ? 63  PHE C CE2 1 
ATOM   5130  C CZ  . PHE C 1 65  ? 99.416  41.850  60.353  1.00 87.96 ? 63  PHE C CZ  1 
ATOM   5131  N N   . SER C 1 66  ? 105.932 40.866  57.033  1.00 77.19 ? 64  SER C N   1 
ATOM   5132  C CA  . SER C 1 66  ? 107.003 40.306  56.218  1.00 81.46 ? 64  SER C CA  1 
ATOM   5133  C C   . SER C 1 66  ? 108.363 40.335  56.908  1.00 81.46 ? 64  SER C C   1 
ATOM   5134  O O   . SER C 1 66  ? 109.269 39.579  56.549  1.00 81.46 ? 64  SER C O   1 
ATOM   5135  C CB  . SER C 1 66  ? 107.079 41.067  54.894  1.00 92.42 ? 64  SER C CB  1 
ATOM   5136  O OG  . SER C 1 66  ? 107.164 42.467  55.119  1.00 92.42 ? 64  SER C OG  1 
ATOM   5137  N N   . VAL C 1 67  ? 108.488 41.209  57.901  1.00 90.37 ? 65  VAL C N   1 
ATOM   5138  C CA  . VAL C 1 67  ? 109.718 41.396  58.671  1.00 80.76 ? 65  VAL C CA  1 
ATOM   5139  C C   . VAL C 1 67  ? 110.453 40.082  58.987  1.00 87.48 ? 65  VAL C C   1 
ATOM   5140  O O   . VAL C 1 67  ? 109.829 39.025  59.093  1.00 82.71 ? 65  VAL C O   1 
ATOM   5141  C CB  . VAL C 1 67  ? 109.396 42.172  59.986  1.00 39.87 ? 65  VAL C CB  1 
ATOM   5142  C CG1 . VAL C 1 67  ? 109.236 41.203  61.162  1.00 29.82 ? 65  VAL C CG1 1 
ATOM   5143  C CG2 . VAL C 1 67  ? 110.457 43.243  60.235  1.00 34.73 ? 65  VAL C CG2 1 
ATOM   5144  N N   . ASP C 1 68  ? 111.777 40.157  59.124  1.00 58.58 ? 66  ASP C N   1 
ATOM   5145  C CA  . ASP C 1 68  ? 112.607 38.984  59.414  1.00 50.76 ? 66  ASP C CA  1 
ATOM   5146  C C   . ASP C 1 68  ? 111.904 37.967  60.294  1.00 52.36 ? 66  ASP C C   1 
ATOM   5147  O O   . ASP C 1 68  ? 111.142 38.338  61.187  1.00 52.86 ? 66  ASP C O   1 
ATOM   5148  C CB  . ASP C 1 68  ? 113.900 39.393  60.122  1.00 92.42 ? 66  ASP C CB  1 
ATOM   5149  C CG  . ASP C 1 68  ? 114.822 40.200  59.242  1.00 92.42 ? 66  ASP C CG  1 
ATOM   5150  O OD1 . ASP C 1 68  ? 116.021 40.311  59.585  1.00 92.42 ? 66  ASP C OD1 1 
ATOM   5151  O OD2 . ASP C 1 68  ? 114.345 40.728  58.217  1.00 92.42 ? 66  ASP C OD2 1 
ATOM   5152  N N   . SER C 1 69  ? 112.181 36.686  60.074  1.00 52.35 ? 67  SER C N   1 
ATOM   5153  C CA  . SER C 1 69  ? 111.538 35.670  60.895  1.00 56.33 ? 67  SER C CA  1 
ATOM   5154  C C   . SER C 1 69  ? 111.956 35.779  62.373  1.00 55.27 ? 67  SER C C   1 
ATOM   5155  O O   . SER C 1 69  ? 111.497 35.007  63.218  1.00 48.84 ? 67  SER C O   1 
ATOM   5156  C CB  . SER C 1 69  ? 111.823 34.256  60.343  1.00 43.94 ? 67  SER C CB  1 
ATOM   5157  O OG  . SER C 1 69  ? 112.884 33.603  61.013  1.00 76.34 ? 67  SER C OG  1 
ATOM   5158  N N   . SER C 1 70  ? 112.806 36.755  62.689  1.00 92.42 ? 68  SER C N   1 
ATOM   5159  C CA  . SER C 1 70  ? 113.262 36.950  64.067  1.00 92.42 ? 68  SER C CA  1 
ATOM   5160  C C   . SER C 1 70  ? 112.137 37.523  64.922  1.00 92.42 ? 68  SER C C   1 
ATOM   5161  O O   . SER C 1 70  ? 112.119 37.343  66.142  1.00 92.42 ? 68  SER C O   1 
ATOM   5162  C CB  . SER C 1 70  ? 114.447 37.912  64.116  1.00 30.95 ? 68  SER C CB  1 
ATOM   5163  O OG  . SER C 1 70  ? 114.015 39.248  63.935  1.00 44.08 ? 68  SER C OG  1 
ATOM   5164  N N   . ILE C 1 71  ? 111.211 38.229  64.278  1.00 39.35 ? 69  ILE C N   1 
ATOM   5165  C CA  . ILE C 1 71  ? 110.084 38.817  64.984  1.00 43.17 ? 69  ILE C CA  1 
ATOM   5166  C C   . ILE C 1 71  ? 109.386 37.714  65.749  1.00 43.22 ? 69  ILE C C   1 
ATOM   5167  O O   . ILE C 1 71  ? 108.768 37.976  66.782  1.00 42.63 ? 69  ILE C O   1 
ATOM   5168  C CB  . ILE C 1 71  ? 109.055 39.434  64.012  1.00 43.95 ? 69  ILE C CB  1 
ATOM   5169  C CG1 . ILE C 1 71  ? 108.046 40.287  64.786  1.00 35.10 ? 69  ILE C CG1 1 
ATOM   5170  C CG2 . ILE C 1 71  ? 108.328 38.326  63.248  1.00 33.86 ? 69  ILE C CG2 1 
ATOM   5171  C CD1 . ILE C 1 71  ? 108.635 41.555  65.363  1.00 45.47 ? 69  ILE C CD1 1 
ATOM   5172  N N   . ASN C 1 72  ? 109.489 36.480  65.242  1.00 36.69 ? 70  ASN C N   1 
ATOM   5173  C CA  . ASN C 1 72  ? 108.831 35.355  65.892  1.00 39.60 ? 70  ASN C CA  1 
ATOM   5174  C C   . ASN C 1 72  ? 109.416 34.997  67.258  1.00 47.23 ? 70  ASN C C   1 
ATOM   5175  O O   . ASN C 1 72  ? 109.018 34.010  67.873  1.00 49.28 ? 70  ASN C O   1 
ATOM   5176  C CB  . ASN C 1 72  ? 108.782 34.127  64.962  1.00 26.12 ? 70  ASN C CB  1 
ATOM   5177  C CG  . ASN C 1 72  ? 109.979 33.204  65.104  1.00 38.88 ? 70  ASN C CG  1 
ATOM   5178  O OD1 . ASN C 1 72  ? 110.491 32.994  66.193  1.00 42.10 ? 70  ASN C OD1 1 
ATOM   5179  N ND2 . ASN C 1 72  ? 110.405 32.615  63.992  1.00 39.98 ? 70  ASN C ND2 1 
ATOM   5180  N N   . GLN C 1 73  ? 110.350 35.812  67.742  1.00 47.66 ? 71  GLN C N   1 
ATOM   5181  C CA  . GLN C 1 73  ? 110.962 35.585  69.050  1.00 59.36 ? 71  GLN C CA  1 
ATOM   5182  C C   . GLN C 1 73  ? 110.429 36.628  70.017  1.00 58.36 ? 71  GLN C C   1 
ATOM   5183  O O   . GLN C 1 73  ? 110.710 36.574  71.206  1.00 57.20 ? 71  GLN C O   1 
ATOM   5184  C CB  . GLN C 1 73  ? 112.496 35.676  68.956  1.00 46.03 ? 71  GLN C CB  1 
ATOM   5185  C CG  . GLN C 1 73  ? 113.121 34.520  68.157  1.00 64.27 ? 71  GLN C CG  1 
ATOM   5186  C CD  . GLN C 1 73  ? 114.648 34.513  68.137  1.00 78.35 ? 71  GLN C CD  1 
ATOM   5187  O OE1 . GLN C 1 73  ? 115.301 34.142  69.113  1.00 77.53 ? 71  GLN C OE1 1 
ATOM   5188  N NE2 . GLN C 1 73  ? 115.218 34.919  67.012  1.00 68.03 ? 71  GLN C NE2 1 
ATOM   5189  N N   . SER C 1 74  ? 109.651 37.571  69.488  1.00 42.35 ? 72  SER C N   1 
ATOM   5190  C CA  . SER C 1 74  ? 109.057 38.643  70.286  1.00 50.34 ? 72  SER C CA  1 
ATOM   5191  C C   . SER C 1 74  ? 107.528 38.632  70.289  1.00 53.64 ? 72  SER C C   1 
ATOM   5192  O O   . SER C 1 74  ? 106.909 38.814  71.338  1.00 51.86 ? 72  SER C O   1 
ATOM   5193  C CB  . SER C 1 74  ? 109.528 40.012  69.793  1.00 6.69  ? 72  SER C CB  1 
ATOM   5194  O OG  . SER C 1 74  ? 110.790 40.340  70.325  1.00 19.47 ? 72  SER C OG  1 
ATOM   5195  N N   . ILE C 1 75  ? 106.928 38.444  69.113  1.00 46.15 ? 73  ILE C N   1 
ATOM   5196  C CA  . ILE C 1 75  ? 105.471 38.405  68.980  1.00 46.15 ? 73  ILE C CA  1 
ATOM   5197  C C   . ILE C 1 75  ? 105.063 36.965  68.712  1.00 46.15 ? 73  ILE C C   1 
ATOM   5198  O O   . ILE C 1 75  ? 105.216 36.481  67.602  1.00 46.15 ? 73  ILE C O   1 
ATOM   5199  C CB  . ILE C 1 75  ? 104.991 39.263  67.797  1.00 46.38 ? 73  ILE C CB  1 
ATOM   5200  C CG1 . ILE C 1 75  ? 105.589 40.668  67.881  1.00 46.38 ? 73  ILE C CG1 1 
ATOM   5201  C CG2 . ILE C 1 75  ? 103.494 39.348  67.804  1.00 46.38 ? 73  ILE C CG2 1 
ATOM   5202  C CD1 . ILE C 1 75  ? 105.283 41.420  69.162  1.00 46.38 ? 73  ILE C CD1 1 
ATOM   5203  N N   . GLY C 1 76  ? 104.554 36.277  69.726  1.00 60.18 ? 74  GLY C N   1 
ATOM   5204  C CA  . GLY C 1 76  ? 104.151 34.894  69.541  1.00 60.18 ? 74  GLY C CA  1 
ATOM   5205  C C   . GLY C 1 76  ? 102.704 34.772  69.109  1.00 60.18 ? 74  GLY C C   1 
ATOM   5206  O O   . GLY C 1 76  ? 102.172 33.666  68.991  1.00 60.18 ? 74  GLY C O   1 
ATOM   5207  N N   . GLY C 1 77  ? 102.069 35.921  68.882  1.00 54.75 ? 75  GLY C N   1 
ATOM   5208  C CA  . GLY C 1 77  ? 100.683 35.949  68.451  1.00 54.75 ? 75  GLY C CA  1 
ATOM   5209  C C   . GLY C 1 77  ? 100.251 37.327  67.967  1.00 54.75 ? 75  GLY C C   1 
ATOM   5210  O O   . GLY C 1 77  ? 100.506 38.339  68.637  1.00 54.75 ? 75  GLY C O   1 
ATOM   5211  N N   . VAL C 1 78  ? 99.605  37.374  66.801  1.00 39.06 ? 76  VAL C N   1 
ATOM   5212  C CA  . VAL C 1 78  ? 99.130  38.640  66.246  1.00 39.06 ? 76  VAL C CA  1 
ATOM   5213  C C   . VAL C 1 78  ? 97.607  38.654  66.067  1.00 39.06 ? 76  VAL C C   1 
ATOM   5214  O O   . VAL C 1 78  ? 97.030  37.732  65.486  1.00 39.06 ? 76  VAL C O   1 
ATOM   5215  C CB  . VAL C 1 78  ? 99.786  38.937  64.883  1.00 40.66 ? 76  VAL C CB  1 
ATOM   5216  C CG1 . VAL C 1 78  ? 99.294  40.278  64.343  1.00 40.66 ? 76  VAL C CG1 1 
ATOM   5217  C CG2 . VAL C 1 78  ? 101.292 38.946  65.029  1.00 40.66 ? 76  VAL C CG2 1 
ATOM   5218  N N   . ILE C 1 79  ? 96.968  39.697  66.596  1.00 67.48 ? 77  ILE C N   1 
ATOM   5219  C CA  . ILE C 1 79  ? 95.523  39.859  66.483  1.00 67.48 ? 77  ILE C CA  1 
ATOM   5220  C C   . ILE C 1 79  ? 95.304  40.629  65.191  1.00 67.48 ? 77  ILE C C   1 
ATOM   5221  O O   . ILE C 1 79  ? 96.030  41.586  64.914  1.00 67.48 ? 77  ILE C O   1 
ATOM   5222  C CB  . ILE C 1 79  ? 94.926  40.688  67.659  1.00 38.07 ? 77  ILE C CB  1 
ATOM   5223  C CG1 . ILE C 1 79  ? 95.041  39.919  68.981  1.00 38.07 ? 77  ILE C CG1 1 
ATOM   5224  C CG2 . ILE C 1 79  ? 93.466  40.998  67.382  1.00 38.07 ? 77  ILE C CG2 1 
ATOM   5225  C CD1 . ILE C 1 79  ? 94.356  40.616  70.174  1.00 38.07 ? 77  ILE C CD1 1 
ATOM   5226  N N   . LEU C 1 80  ? 94.314  40.210  64.404  1.00 68.85 ? 78  LEU C N   1 
ATOM   5227  C CA  . LEU C 1 80  ? 94.011  40.857  63.125  1.00 68.85 ? 78  LEU C CA  1 
ATOM   5228  C C   . LEU C 1 80  ? 92.595  41.372  63.032  1.00 68.85 ? 78  LEU C C   1 
ATOM   5229  O O   . LEU C 1 80  ? 91.712  40.945  63.775  1.00 68.85 ? 78  LEU C O   1 
ATOM   5230  C CB  . LEU C 1 80  ? 94.233  39.892  61.956  1.00 22.33 ? 78  LEU C CB  1 
ATOM   5231  C CG  . LEU C 1 80  ? 95.651  39.775  61.389  1.00 22.33 ? 78  LEU C CG  1 
ATOM   5232  C CD1 . LEU C 1 80  ? 95.789  38.463  60.620  1.00 22.33 ? 78  LEU C CD1 1 
ATOM   5233  C CD2 . LEU C 1 80  ? 95.954  40.978  60.522  1.00 22.33 ? 78  LEU C CD2 1 
ATOM   5234  N N   . PHE C 1 81  ? 92.388  42.293  62.101  1.00 77.21 ? 79  PHE C N   1 
ATOM   5235  C CA  . PHE C 1 81  ? 91.071  42.853  61.886  1.00 77.21 ? 79  PHE C CA  1 
ATOM   5236  C C   . PHE C 1 81  ? 90.345  42.040  60.811  1.00 77.21 ? 79  PHE C C   1 
ATOM   5237  O O   . PHE C 1 81  ? 90.964  41.541  59.867  1.00 77.21 ? 79  PHE C O   1 
ATOM   5238  C CB  . PHE C 1 81  ? 91.170  44.320  61.455  1.00 76.34 ? 79  PHE C CB  1 
ATOM   5239  C CG  . PHE C 1 81  ? 89.833  44.969  61.242  1.00 76.34 ? 79  PHE C CG  1 
ATOM   5240  C CD1 . PHE C 1 81  ? 88.970  45.180  62.315  1.00 76.34 ? 79  PHE C CD1 1 
ATOM   5241  C CD2 . PHE C 1 81  ? 89.406  45.311  59.966  1.00 76.34 ? 79  PHE C CD2 1 
ATOM   5242  C CE1 . PHE C 1 81  ? 87.701  45.716  62.122  1.00 76.34 ? 79  PHE C CE1 1 
ATOM   5243  C CE2 . PHE C 1 81  ? 88.140  45.846  59.762  1.00 76.34 ? 79  PHE C CE2 1 
ATOM   5244  C CZ  . PHE C 1 81  ? 87.285  46.048  60.846  1.00 76.34 ? 79  PHE C CZ  1 
ATOM   5245  N N   . HIS C 1 82  ? 89.032  41.911  60.983  1.00 72.99 ? 80  HIS C N   1 
ATOM   5246  C CA  . HIS C 1 82  ? 88.130  41.185  60.079  1.00 72.99 ? 80  HIS C CA  1 
ATOM   5247  C C   . HIS C 1 82  ? 88.539  41.240  58.601  1.00 72.99 ? 80  HIS C C   1 
ATOM   5248  O O   . HIS C 1 82  ? 88.628  40.215  57.923  1.00 72.99 ? 80  HIS C O   1 
ATOM   5249  C CB  . HIS C 1 82  ? 86.717  41.760  60.262  1.00 92.42 ? 80  HIS C CB  1 
ATOM   5250  C CG  . HIS C 1 82  ? 85.668  41.129  59.398  1.00 92.42 ? 80  HIS C CG  1 
ATOM   5251  N ND1 . HIS C 1 82  ? 84.331  41.450  59.507  1.00 92.42 ? 80  HIS C ND1 1 
ATOM   5252  C CD2 . HIS C 1 82  ? 85.755  40.210  58.405  1.00 92.42 ? 80  HIS C CD2 1 
ATOM   5253  C CE1 . HIS C 1 82  ? 83.639  40.758  58.620  1.00 92.42 ? 80  HIS C CE1 1 
ATOM   5254  N NE2 . HIS C 1 82  ? 84.480  39.998  57.938  1.00 92.42 ? 80  HIS C NE2 1 
ATOM   5255  N N   . GLU C 1 83  ? 88.760  42.458  58.120  1.00 83.82 ? 81  GLU C N   1 
ATOM   5256  C CA  . GLU C 1 83  ? 89.165  42.731  56.746  1.00 83.82 ? 81  GLU C CA  1 
ATOM   5257  C C   . GLU C 1 83  ? 90.499  42.067  56.414  1.00 83.82 ? 81  GLU C C   1 
ATOM   5258  O O   . GLU C 1 83  ? 90.582  41.158  55.585  1.00 83.82 ? 81  GLU C O   1 
ATOM   5259  C CB  . GLU C 1 83  ? 89.282  44.253  56.568  1.00 71.98 ? 81  GLU C CB  1 
ATOM   5260  C CG  . GLU C 1 83  ? 90.271  44.716  55.507  1.00 71.98 ? 81  GLU C CG  1 
ATOM   5261  C CD  . GLU C 1 83  ? 90.623  46.187  55.652  1.00 71.98 ? 81  GLU C CD  1 
ATOM   5262  O OE1 . GLU C 1 83  ? 89.692  47.017  55.667  1.00 71.98 ? 81  GLU C OE1 1 
ATOM   5263  O OE2 . GLU C 1 83  ? 91.828  46.514  55.750  1.00 71.98 ? 81  GLU C OE2 1 
ATOM   5264  N N   . THR C 1 84  ? 91.533  42.544  57.092  1.00 59.39 ? 82  THR C N   1 
ATOM   5265  C CA  . THR C 1 84  ? 92.898  42.085  56.920  1.00 59.39 ? 82  THR C CA  1 
ATOM   5266  C C   . THR C 1 84  ? 93.141  40.580  56.939  1.00 59.39 ? 82  THR C C   1 
ATOM   5267  O O   . THR C 1 84  ? 94.030  40.107  56.239  1.00 59.39 ? 82  THR C O   1 
ATOM   5268  C CB  . THR C 1 84  ? 93.796  42.722  57.974  1.00 60.33 ? 82  THR C CB  1 
ATOM   5269  O OG1 . THR C 1 84  ? 93.548  44.133  58.019  1.00 60.33 ? 82  THR C OG1 1 
ATOM   5270  C CG2 . THR C 1 84  ? 95.253  42.472  57.638  1.00 60.33 ? 82  THR C CG2 1 
ATOM   5271  N N   . LEU C 1 85  ? 92.382  39.827  57.733  1.00 50.38 ? 83  LEU C N   1 
ATOM   5272  C CA  . LEU C 1 85  ? 92.580  38.377  57.792  1.00 50.38 ? 83  LEU C CA  1 
ATOM   5273  C C   . LEU C 1 85  ? 92.611  37.763  56.404  1.00 50.38 ? 83  LEU C C   1 
ATOM   5274  O O   . LEU C 1 85  ? 93.346  36.797  56.148  1.00 50.38 ? 83  LEU C O   1 
ATOM   5275  C CB  . LEU C 1 85  ? 91.471  37.686  58.601  1.00 37.92 ? 83  LEU C CB  1 
ATOM   5276  C CG  . LEU C 1 85  ? 91.347  36.159  58.377  1.00 37.92 ? 83  LEU C CG  1 
ATOM   5277  C CD1 . LEU C 1 85  ? 92.700  35.485  58.555  1.00 37.92 ? 83  LEU C CD1 1 
ATOM   5278  C CD2 . LEU C 1 85  ? 90.336  35.549  59.337  1.00 37.92 ? 83  LEU C CD2 1 
ATOM   5279  N N   . TYR C 1 86  ? 91.812  38.336  55.508  1.00 82.13 ? 84  TYR C N   1 
ATOM   5280  C CA  . TYR C 1 86  ? 91.702  37.834  54.147  1.00 82.13 ? 84  TYR C CA  1 
ATOM   5281  C C   . TYR C 1 86  ? 92.530  38.569  53.107  1.00 82.13 ? 84  TYR C C   1 
ATOM   5282  O O   . TYR C 1 86  ? 92.507  38.210  51.936  1.00 82.13 ? 84  TYR C O   1 
ATOM   5283  C CB  . TYR C 1 86  ? 90.230  37.818  53.739  1.00 64.91 ? 84  TYR C CB  1 
ATOM   5284  C CG  . TYR C 1 86  ? 89.389  36.977  54.676  1.00 64.91 ? 84  TYR C CG  1 
ATOM   5285  C CD1 . TYR C 1 86  ? 88.760  37.540  55.790  1.00 64.91 ? 84  TYR C CD1 1 
ATOM   5286  C CD2 . TYR C 1 86  ? 89.267  35.603  54.481  1.00 64.91 ? 84  TYR C CD2 1 
ATOM   5287  C CE1 . TYR C 1 86  ? 88.026  36.745  56.690  1.00 64.91 ? 84  TYR C CE1 1 
ATOM   5288  C CE2 . TYR C 1 86  ? 88.542  34.804  55.371  1.00 64.91 ? 84  TYR C CE2 1 
ATOM   5289  C CZ  . TYR C 1 86  ? 87.924  35.379  56.469  1.00 64.91 ? 84  TYR C CZ  1 
ATOM   5290  O OH  . TYR C 1 86  ? 87.190  34.589  57.323  1.00 64.91 ? 84  TYR C OH  1 
ATOM   5291  N N   . GLN C 1 87  ? 93.272  39.585  53.532  1.00 71.23 ? 85  GLN C N   1 
ATOM   5292  C CA  . GLN C 1 87  ? 94.107  40.347  52.616  1.00 71.23 ? 85  GLN C CA  1 
ATOM   5293  C C   . GLN C 1 87  ? 95.371  39.592  52.217  1.00 71.23 ? 85  GLN C C   1 
ATOM   5294  O O   . GLN C 1 87  ? 95.604  38.466  52.662  1.00 71.23 ? 85  GLN C O   1 
ATOM   5295  C CB  . GLN C 1 87  ? 94.494  41.684  53.237  1.00 80.80 ? 85  GLN C CB  1 
ATOM   5296  C CG  . GLN C 1 87  ? 93.350  42.663  53.350  1.00 80.80 ? 85  GLN C CG  1 
ATOM   5297  C CD  . GLN C 1 87  ? 93.823  44.029  53.797  1.00 80.80 ? 85  GLN C CD  1 
ATOM   5298  O OE1 . GLN C 1 87  ? 94.340  44.185  54.904  1.00 80.80 ? 85  GLN C OE1 1 
ATOM   5299  N NE2 . GLN C 1 87  ? 93.656  45.028  52.935  1.00 80.80 ? 85  GLN C NE2 1 
ATOM   5300  N N   . LYS C 1 88  ? 96.180  40.226  51.371  1.00 77.11 ? 86  LYS C N   1 
ATOM   5301  C CA  . LYS C 1 88  ? 97.426  39.638  50.890  1.00 77.11 ? 86  LYS C CA  1 
ATOM   5302  C C   . LYS C 1 88  ? 98.469  40.698  50.574  1.00 77.11 ? 86  LYS C C   1 
ATOM   5303  O O   . LYS C 1 88  ? 98.147  41.876  50.410  1.00 77.11 ? 86  LYS C O   1 
ATOM   5304  C CB  . LYS C 1 88  ? 97.184  38.822  49.617  1.00 66.15 ? 86  LYS C CB  1 
ATOM   5305  C CG  . LYS C 1 88  ? 96.534  37.456  49.803  1.00 66.15 ? 86  LYS C CG  1 
ATOM   5306  C CD  . LYS C 1 88  ? 96.460  36.749  48.446  1.00 66.15 ? 86  LYS C CD  1 
ATOM   5307  C CE  . LYS C 1 88  ? 95.902  35.344  48.537  1.00 66.15 ? 86  LYS C CE  1 
ATOM   5308  N NZ  . LYS C 1 88  ? 95.940  34.676  47.207  1.00 66.15 ? 86  LYS C NZ  1 
ATOM   5309  N N   . ASP C 1 89  ? 99.718  40.255  50.477  1.00 86.18 ? 87  ASP C N   1 
ATOM   5310  C CA  . ASP C 1 89  ? 100.835 41.132  50.151  1.00 86.18 ? 87  ASP C CA  1 
ATOM   5311  C C   . ASP C 1 89  ? 100.887 41.305  48.637  1.00 86.18 ? 87  ASP C C   1 
ATOM   5312  O O   . ASP C 1 89  ? 100.000 40.833  47.915  1.00 86.18 ? 87  ASP C O   1 
ATOM   5313  C CB  . ASP C 1 89  ? 102.161 40.528  50.632  1.00 75.10 ? 87  ASP C CB  1 
ATOM   5314  C CG  . ASP C 1 89  ? 102.440 39.167  50.018  1.00 75.10 ? 87  ASP C CG  1 
ATOM   5315  O OD1 . ASP C 1 89  ? 103.592 38.683  50.092  1.00 75.10 ? 87  ASP C OD1 1 
ATOM   5316  O OD2 . ASP C 1 89  ? 101.493 38.576  49.464  1.00 75.10 ? 87  ASP C OD2 1 
ATOM   5317  N N   . SER C 1 90  ? 101.937 41.969  48.161  1.00 81.84 ? 88  SER C N   1 
ATOM   5318  C CA  . SER C 1 90  ? 102.111 42.204  46.730  1.00 81.84 ? 88  SER C CA  1 
ATOM   5319  C C   . SER C 1 90  ? 102.161 40.892  45.977  1.00 81.84 ? 88  SER C C   1 
ATOM   5320  O O   . SER C 1 90  ? 101.291 40.603  45.156  1.00 81.84 ? 88  SER C O   1 
ATOM   5321  C CB  . SER C 1 90  ? 103.405 42.980  46.462  1.00 65.34 ? 88  SER C CB  1 
ATOM   5322  O OG  . SER C 1 90  ? 103.343 44.281  47.018  1.00 65.34 ? 88  SER C OG  1 
ATOM   5323  N N   . GLN C 1 91  ? 103.183 40.100  46.282  1.00 65.05 ? 89  GLN C N   1 
ATOM   5324  C CA  . GLN C 1 91  ? 103.398 38.813  45.635  1.00 65.05 ? 89  GLN C CA  1 
ATOM   5325  C C   . GLN C 1 91  ? 102.249 37.810  45.770  1.00 65.05 ? 89  GLN C C   1 
ATOM   5326  O O   . GLN C 1 91  ? 102.450 36.597  45.646  1.00 65.05 ? 89  GLN C O   1 
ATOM   5327  C CB  . GLN C 1 91  ? 104.699 38.208  46.156  1.00 92.42 ? 89  GLN C CB  1 
ATOM   5328  C CG  . GLN C 1 91  ? 105.853 39.189  46.091  1.00 92.42 ? 89  GLN C CG  1 
ATOM   5329  C CD  . GLN C 1 91  ? 107.183 38.542  46.392  1.00 92.42 ? 89  GLN C CD  1 
ATOM   5330  O OE1 . GLN C 1 91  ? 107.603 37.616  45.695  1.00 92.42 ? 89  GLN C OE1 1 
ATOM   5331  N NE2 . GLN C 1 91  ? 107.861 39.025  47.435  1.00 92.42 ? 89  GLN C NE2 1 
ATOM   5332  N N   . GLY C 1 92  ? 101.048 38.328  46.020  1.00 80.00 ? 90  GLY C N   1 
ATOM   5333  C CA  . GLY C 1 92  ? 99.863  37.493  46.143  1.00 80.00 ? 90  GLY C CA  1 
ATOM   5334  C C   . GLY C 1 92  ? 99.845  36.400  47.201  1.00 80.00 ? 90  GLY C C   1 
ATOM   5335  O O   . GLY C 1 92  ? 99.289  35.325  46.969  1.00 80.00 ? 90  GLY C O   1 
ATOM   5336  N N   . LYS C 1 93  ? 100.438 36.656  48.364  1.00 85.36 ? 91  LYS C N   1 
ATOM   5337  C CA  . LYS C 1 93  ? 100.441 35.657  49.430  1.00 85.36 ? 91  LYS C CA  1 
ATOM   5338  C C   . LYS C 1 93  ? 99.508  36.116  50.543  1.00 85.36 ? 91  LYS C C   1 
ATOM   5339  O O   . LYS C 1 93  ? 99.332  37.316  50.765  1.00 85.36 ? 91  LYS C O   1 
ATOM   5340  C CB  . LYS C 1 93  ? 101.862 35.436  49.975  1.00 40.02 ? 91  LYS C CB  1 
ATOM   5341  C CG  . LYS C 1 93  ? 102.003 34.150  50.781  1.00 40.02 ? 91  LYS C CG  1 
ATOM   5342  C CD  . LYS C 1 93  ? 101.306 32.990  50.071  1.00 40.02 ? 91  LYS C CD  1 
ATOM   5343  C CE  . LYS C 1 93  ? 101.299 31.721  50.905  1.00 40.02 ? 91  LYS C CE  1 
ATOM   5344  N NZ  . LYS C 1 93  ? 100.375 30.705  50.318  1.00 40.02 ? 91  LYS C NZ  1 
ATOM   5345  N N   . LEU C 1 94  ? 98.906  35.156  51.237  1.00 72.86 ? 92  LEU C N   1 
ATOM   5346  C CA  . LEU C 1 94  ? 97.974  35.463  52.316  1.00 72.86 ? 92  LEU C CA  1 
ATOM   5347  C C   . LEU C 1 94  ? 98.586  35.874  53.668  1.00 72.86 ? 92  LEU C C   1 
ATOM   5348  O O   . LEU C 1 94  ? 99.247  35.069  54.345  1.00 72.86 ? 92  LEU C O   1 
ATOM   5349  C CB  . LEU C 1 94  ? 97.036  34.275  52.523  1.00 72.47 ? 92  LEU C CB  1 
ATOM   5350  C CG  . LEU C 1 94  ? 95.612  34.478  52.012  1.00 72.47 ? 92  LEU C CG  1 
ATOM   5351  C CD1 . LEU C 1 94  ? 94.830  33.184  52.202  1.00 72.47 ? 92  LEU C CD1 1 
ATOM   5352  C CD2 . LEU C 1 94  ? 94.952  35.639  52.762  1.00 72.47 ? 92  LEU C CD2 1 
ATOM   5353  N N   . PHE C 1 95  ? 98.345  37.129  54.055  1.00 64.57 ? 93  PHE C N   1 
ATOM   5354  C CA  . PHE C 1 95  ? 98.834  37.672  55.325  1.00 64.57 ? 93  PHE C CA  1 
ATOM   5355  C C   . PHE C 1 95  ? 98.731  36.616  56.410  1.00 64.57 ? 93  PHE C C   1 
ATOM   5356  O O   . PHE C 1 95  ? 99.549  36.559  57.326  1.00 64.57 ? 93  PHE C O   1 
ATOM   5357  C CB  . PHE C 1 95  ? 97.988  38.863  55.767  1.00 41.38 ? 93  PHE C CB  1 
ATOM   5358  C CG  . PHE C 1 95  ? 98.399  40.173  55.166  1.00 41.38 ? 93  PHE C CG  1 
ATOM   5359  C CD1 . PHE C 1 95  ? 99.696  40.372  54.705  1.00 41.38 ? 93  PHE C CD1 1 
ATOM   5360  C CD2 . PHE C 1 95  ? 97.510  41.250  55.159  1.00 41.38 ? 93  PHE C CD2 1 
ATOM   5361  C CE1 . PHE C 1 95  ? 100.105 41.624  54.256  1.00 41.38 ? 93  PHE C CE1 1 
ATOM   5362  C CE2 . PHE C 1 95  ? 97.904  42.508  54.713  1.00 41.38 ? 93  PHE C CE2 1 
ATOM   5363  C CZ  . PHE C 1 95  ? 99.204  42.701  54.261  1.00 41.38 ? 93  PHE C CZ  1 
ATOM   5364  N N   . ARG C 1 96  ? 97.692  35.797  56.286  1.00 55.18 ? 94  ARG C N   1 
ATOM   5365  C CA  . ARG C 1 96  ? 97.383  34.719  57.218  1.00 55.18 ? 94  ARG C CA  1 
ATOM   5366  C C   . ARG C 1 96  ? 98.453  33.655  57.309  1.00 55.18 ? 94  ARG C C   1 
ATOM   5367  O O   . ARG C 1 96  ? 98.794  33.195  58.398  1.00 55.18 ? 94  ARG C O   1 
ATOM   5368  C CB  . ARG C 1 96  ? 96.069  34.045  56.816  1.00 74.36 ? 94  ARG C CB  1 
ATOM   5369  C CG  . ARG C 1 96  ? 95.838  32.708  57.511  1.00 74.36 ? 94  ARG C CG  1 
ATOM   5370  C CD  . ARG C 1 96  ? 94.642  31.973  56.946  1.00 74.36 ? 94  ARG C CD  1 
ATOM   5371  N NE  . ARG C 1 96  ? 93.598  32.895  56.673  1.00 74.36 ? 94  ARG C NE  1 
ATOM   5372  C CZ  . ARG C 1 96  ? 92.850  33.106  55.605  1.00 74.36 ? 94  ARG C CZ  1 
ATOM   5373  N NH1 . ARG C 1 96  ? 92.904  32.438  54.457  1.00 74.36 ? 94  ARG C NH1 1 
ATOM   5374  N NH2 . ARG C 1 96  ? 92.019  34.113  55.745  1.00 74.36 ? 94  ARG C NH2 1 
ATOM   5375  N N   . ASN C 1 97  ? 98.972  33.257  56.159  1.00 42.60 ? 95  ASN C N   1 
ATOM   5376  C CA  . ASN C 1 97  ? 99.981  32.225  56.135  1.00 42.60 ? 95  ASN C CA  1 
ATOM   5377  C C   . ASN C 1 97  ? 101.404 32.706  56.308  1.00 42.60 ? 95  ASN C C   1 
ATOM   5378  O O   . ASN C 1 97  ? 102.263 31.944  56.750  1.00 42.60 ? 95  ASN C O   1 
ATOM   5379  C CB  . ASN C 1 97  ? 99.831  31.407  54.868  1.00 92.42 ? 95  ASN C CB  1 
ATOM   5380  C CG  . ASN C 1 97  ? 98.575  30.573  54.887  1.00 92.42 ? 95  ASN C CG  1 
ATOM   5381  O OD1 . ASN C 1 97  ? 98.417  29.691  55.738  1.00 92.42 ? 95  ASN C OD1 1 
ATOM   5382  N ND2 . ASN C 1 97  ? 97.662  30.854  53.961  1.00 92.42 ? 95  ASN C ND2 1 
ATOM   5383  N N   . ILE C 1 98  ? 101.666 33.963  55.976  1.00 61.18 ? 96  ILE C N   1 
ATOM   5384  C CA  . ILE C 1 98  ? 103.011 34.498  56.167  1.00 61.18 ? 96  ILE C CA  1 
ATOM   5385  C C   . ILE C 1 98  ? 103.349 34.302  57.642  1.00 61.18 ? 96  ILE C C   1 
ATOM   5386  O O   . ILE C 1 98  ? 104.469 33.932  58.010  1.00 61.18 ? 96  ILE C O   1 
ATOM   5387  C CB  . ILE C 1 98  ? 103.061 35.999  55.888  1.00 48.17 ? 96  ILE C CB  1 
ATOM   5388  C CG1 . ILE C 1 98  ? 102.663 36.278  54.441  1.00 48.17 ? 96  ILE C CG1 1 
ATOM   5389  C CG2 . ILE C 1 98  ? 104.450 36.532  56.217  1.00 48.17 ? 96  ILE C CG2 1 
ATOM   5390  C CD1 . ILE C 1 98  ? 102.580 37.745  54.128  1.00 48.17 ? 96  ILE C CD1 1 
ATOM   5391  N N   . LEU C 1 99  ? 102.341 34.558  58.470  1.00 46.08 ? 97  LEU C N   1 
ATOM   5392  C CA  . LEU C 1 99  ? 102.436 34.456  59.914  1.00 46.08 ? 97  LEU C CA  1 
ATOM   5393  C C   . LEU C 1 99  ? 102.347 33.013  60.384  1.00 46.08 ? 97  LEU C C   1 
ATOM   5394  O O   . LEU C 1 99  ? 102.818 32.698  61.466  1.00 46.08 ? 97  LEU C O   1 
ATOM   5395  C CB  . LEU C 1 99  ? 101.331 35.300  60.568  1.00 47.85 ? 97  LEU C CB  1 
ATOM   5396  C CG  . LEU C 1 99  ? 101.188 36.740  60.041  1.00 47.85 ? 97  LEU C CG  1 
ATOM   5397  C CD1 . LEU C 1 99  ? 99.916  37.383  60.566  1.00 47.85 ? 97  LEU C CD1 1 
ATOM   5398  C CD2 . LEU C 1 99  ? 102.396 37.550  60.437  1.00 47.85 ? 97  LEU C CD2 1 
ATOM   5399  N N   . LYS C 1 100 ? 101.742 32.129  59.596  1.00 38.26 ? 98  LYS C N   1 
ATOM   5400  C CA  . LYS C 1 100 ? 101.668 30.722  60.000  1.00 38.26 ? 98  LYS C CA  1 
ATOM   5401  C C   . LYS C 1 100 ? 103.065 30.132  59.890  1.00 38.26 ? 98  LYS C C   1 
ATOM   5402  O O   . LYS C 1 100 ? 103.438 29.249  60.655  1.00 38.26 ? 98  LYS C O   1 
ATOM   5403  C CB  . LYS C 1 100 ? 100.707 29.934  59.106  1.00 87.55 ? 98  LYS C CB  1 
ATOM   5404  C CG  . LYS C 1 100 ? 99.251  30.276  59.324  1.00 87.55 ? 98  LYS C CG  1 
ATOM   5405  C CD  . LYS C 1 100 ? 98.895  30.163  60.798  1.00 87.55 ? 98  LYS C CD  1 
ATOM   5406  C CE  . LYS C 1 100 ? 97.439  30.526  61.064  1.00 87.55 ? 98  LYS C CE  1 
ATOM   5407  N NZ  . LYS C 1 100 ? 96.501  29.585  60.391  1.00 87.55 ? 98  LYS C NZ  1 
ATOM   5408  N N   . GLU C 1 101 ? 103.829 30.635  58.924  1.00 71.02 ? 99  GLU C N   1 
ATOM   5409  C CA  . GLU C 1 101 ? 105.203 30.196  58.706  1.00 71.02 ? 99  GLU C CA  1 
ATOM   5410  C C   . GLU C 1 101 ? 106.110 30.809  59.769  1.00 71.02 ? 99  GLU C C   1 
ATOM   5411  O O   . GLU C 1 101 ? 106.835 30.098  60.470  1.00 71.02 ? 99  GLU C O   1 
ATOM   5412  C CB  . GLU C 1 101 ? 105.697 30.633  57.323  1.00 92.42 ? 99  GLU C CB  1 
ATOM   5413  C CG  . GLU C 1 101 ? 105.314 29.699  56.186  1.00 92.42 ? 99  GLU C CG  1 
ATOM   5414  C CD  . GLU C 1 101 ? 103.825 29.692  55.880  1.00 92.42 ? 99  GLU C CD  1 
ATOM   5415  O OE1 . GLU C 1 101 ? 103.018 29.584  56.830  1.00 92.42 ? 99  GLU C OE1 1 
ATOM   5416  O OE2 . GLU C 1 101 ? 103.468 29.779  54.682  1.00 92.42 ? 99  GLU C OE2 1 
ATOM   5417  N N   . LYS C 1 102 ? 106.060 32.135  59.879  1.00 76.23 ? 100 LYS C N   1 
ATOM   5418  C CA  . LYS C 1 102 ? 106.871 32.863  60.844  1.00 76.23 ? 100 LYS C CA  1 
ATOM   5419  C C   . LYS C 1 102 ? 106.552 32.535  62.299  1.00 76.23 ? 100 LYS C C   1 
ATOM   5420  O O   . LYS C 1 102 ? 106.529 33.428  63.149  1.00 76.23 ? 100 LYS C O   1 
ATOM   5421  C CB  . LYS C 1 102 ? 106.719 34.366  60.629  1.00 39.04 ? 100 LYS C CB  1 
ATOM   5422  C CG  . LYS C 1 102 ? 107.418 34.897  59.404  1.00 39.04 ? 100 LYS C CG  1 
ATOM   5423  C CD  . LYS C 1 102 ? 107.415 36.426  59.409  1.00 39.04 ? 100 LYS C CD  1 
ATOM   5424  C CE  . LYS C 1 102 ? 108.130 36.997  58.190  1.00 39.04 ? 100 LYS C CE  1 
ATOM   5425  N NZ  . LYS C 1 102 ? 107.475 36.585  56.912  1.00 39.04 ? 100 LYS C NZ  1 
ATOM   5426  N N   . GLY C 1 103 ? 106.307 31.260  62.583  1.00 64.75 ? 101 GLY C N   1 
ATOM   5427  C CA  . GLY C 1 103 ? 106.006 30.839  63.942  1.00 64.75 ? 101 GLY C CA  1 
ATOM   5428  C C   . GLY C 1 103 ? 105.169 31.791  64.782  1.00 64.75 ? 101 GLY C C   1 
ATOM   5429  O O   . GLY C 1 103 ? 105.344 31.874  65.996  1.00 64.75 ? 101 GLY C O   1 
ATOM   5430  N N   . ILE C 1 104 ? 104.265 32.518  64.138  1.00 32.57 ? 102 ILE C N   1 
ATOM   5431  C CA  . ILE C 1 104 ? 103.384 33.450  64.830  1.00 32.57 ? 102 ILE C CA  1 
ATOM   5432  C C   . ILE C 1 104 ? 101.976 32.887  64.774  1.00 32.57 ? 102 ILE C C   1 
ATOM   5433  O O   . ILE C 1 104 ? 101.628 32.168  63.847  1.00 32.57 ? 102 ILE C O   1 
ATOM   5434  C CB  . ILE C 1 104 ? 103.387 34.842  64.161  1.00 30.31 ? 102 ILE C CB  1 
ATOM   5435  C CG1 . ILE C 1 104 ? 104.696 35.559  64.488  1.00 30.31 ? 102 ILE C CG1 1 
ATOM   5436  C CG2 . ILE C 1 104 ? 102.153 35.647  64.589  1.00 30.31 ? 102 ILE C CG2 1 
ATOM   5437  C CD1 . ILE C 1 104 ? 104.700 37.035  64.137  1.00 30.31 ? 102 ILE C CD1 1 
ATOM   5438  N N   . VAL C 1 105 ? 101.160 33.204  65.765  1.00 46.62 ? 103 VAL C N   1 
ATOM   5439  C CA  . VAL C 1 105 ? 99.804  32.696  65.763  1.00 46.62 ? 103 VAL C CA  1 
ATOM   5440  C C   . VAL C 1 105 ? 98.856  33.835  65.402  1.00 46.62 ? 103 VAL C C   1 
ATOM   5441  O O   . VAL C 1 105 ? 99.037  34.980  65.842  1.00 46.62 ? 103 VAL C O   1 
ATOM   5442  C CB  . VAL C 1 105 ? 99.448  32.089  67.133  1.00 34.29 ? 103 VAL C CB  1 
ATOM   5443  C CG1 . VAL C 1 105 ? 98.745  33.121  67.999  1.00 34.29 ? 103 VAL C CG1 1 
ATOM   5444  C CG2 . VAL C 1 105 ? 98.622  30.829  66.939  1.00 34.29 ? 103 VAL C CG2 1 
ATOM   5445  N N   . VAL C 1 106 ? 97.856  33.513  64.585  1.00 71.27 ? 104 VAL C N   1 
ATOM   5446  C CA  . VAL C 1 106 ? 96.889  34.499  64.120  1.00 71.27 ? 104 VAL C CA  1 
ATOM   5447  C C   . VAL C 1 106 ? 95.683  34.615  65.036  1.00 71.27 ? 104 VAL C C   1 
ATOM   5448  O O   . VAL C 1 106 ? 95.137  33.608  65.496  1.00 71.27 ? 104 VAL C O   1 
ATOM   5449  C CB  . VAL C 1 106 ? 96.386  34.161  62.698  1.00 66.26 ? 104 VAL C CB  1 
ATOM   5450  C CG1 . VAL C 1 106 ? 95.602  35.344  62.133  1.00 66.26 ? 104 VAL C CG1 1 
ATOM   5451  C CG2 . VAL C 1 106 ? 97.558  33.814  61.792  1.00 66.26 ? 104 VAL C CG2 1 
ATOM   5452  N N   . GLY C 1 107 ? 95.273  35.856  65.288  1.00 70.86 ? 105 GLY C N   1 
ATOM   5453  C CA  . GLY C 1 107 ? 94.129  36.115  66.144  1.00 70.86 ? 105 GLY C CA  1 
ATOM   5454  C C   . GLY C 1 107 ? 93.094  36.954  65.424  1.00 70.86 ? 105 GLY C C   1 
ATOM   5455  O O   . GLY C 1 107 ? 93.446  37.793  64.598  1.00 70.86 ? 105 GLY C O   1 
ATOM   5456  N N   . ILE C 1 108 ? 91.819  36.744  65.747  1.00 69.58 ? 106 ILE C N   1 
ATOM   5457  C CA  . ILE C 1 108 ? 90.742  37.485  65.096  1.00 65.13 ? 106 ILE C CA  1 
ATOM   5458  C C   . ILE C 1 108 ? 89.812  38.270  65.997  1.00 67.62 ? 106 ILE C C   1 
ATOM   5459  O O   . ILE C 1 108 ? 89.142  37.721  66.867  1.00 69.26 ? 106 ILE C O   1 
ATOM   5460  C CB  . ILE C 1 108 ? 89.844  36.565  64.253  1.00 65.16 ? 106 ILE C CB  1 
ATOM   5461  C CG1 . ILE C 1 108 ? 88.781  37.400  63.522  1.00 61.65 ? 106 ILE C CG1 1 
ATOM   5462  C CG2 . ILE C 1 108 ? 89.164  35.539  65.158  1.00 59.13 ? 106 ILE C CG2 1 
ATOM   5463  C CD1 . ILE C 1 108 ? 89.327  38.391  62.501  1.00 72.35 ? 106 ILE C CD1 1 
ATOM   5464  N N   . LYS C 1 109 ? 89.769  39.567  65.747  1.00 72.47 ? 107 LYS C N   1 
ATOM   5465  C CA  . LYS C 1 109 ? 88.903  40.470  66.478  1.00 75.18 ? 107 LYS C CA  1 
ATOM   5466  C C   . LYS C 1 109 ? 87.492  40.009  66.141  1.00 75.18 ? 107 LYS C C   1 
ATOM   5467  O O   . LYS C 1 109 ? 87.144  39.917  64.965  1.00 75.18 ? 107 LYS C O   1 
ATOM   5468  C CB  . LYS C 1 109 ? 89.132  41.884  65.961  1.00 10.82 ? 107 LYS C CB  1 
ATOM   5469  C CG  . LYS C 1 109 ? 88.427  42.965  66.699  1.00 18.21 ? 107 LYS C CG  1 
ATOM   5470  C CD  . LYS C 1 109 ? 88.904  44.302  66.167  1.00 15.77 ? 107 LYS C CD  1 
ATOM   5471  C CE  . LYS C 1 109 ? 88.621  45.443  67.142  1.00 24.35 ? 107 LYS C CE  1 
ATOM   5472  N NZ  . LYS C 1 109 ? 89.143  46.759  66.655  1.00 53.44 ? 107 LYS C NZ  1 
ATOM   5473  N N   . LEU C 1 110 ? 86.683  39.697  67.148  1.00 45.54 ? 108 LEU C N   1 
ATOM   5474  C CA  . LEU C 1 110 ? 85.321  39.252  66.874  1.00 45.62 ? 108 LEU C CA  1 
ATOM   5475  C C   . LEU C 1 110 ? 84.301  40.353  67.075  1.00 40.23 ? 108 LEU C C   1 
ATOM   5476  O O   . LEU C 1 110 ? 83.108  40.078  67.199  1.00 48.06 ? 108 LEU C O   1 
ATOM   5477  C CB  . LEU C 1 110 ? 84.935  38.058  67.743  1.00 10.45 ? 108 LEU C CB  1 
ATOM   5478  C CG  . LEU C 1 110 ? 85.509  36.692  67.395  1.00 25.57 ? 108 LEU C CG  1 
ATOM   5479  C CD1 . LEU C 1 110 ? 84.675  35.612  68.030  1.00 13.27 ? 108 LEU C CD1 1 
ATOM   5480  C CD2 . LEU C 1 110 ? 85.481  36.512  65.923  1.00 17.26 ? 108 LEU C CD2 1 
ATOM   5481  N N   . ASP C 1 111 ? 84.782  41.595  67.101  1.00 81.84 ? 109 ASP C N   1 
ATOM   5482  C CA  . ASP C 1 111 ? 83.937  42.776  67.271  1.00 81.84 ? 109 ASP C CA  1 
ATOM   5483  C C   . ASP C 1 111 ? 83.179  43.106  65.986  1.00 81.84 ? 109 ASP C C   1 
ATOM   5484  O O   . ASP C 1 111 ? 83.767  43.576  65.009  1.00 81.84 ? 109 ASP C O   1 
ATOM   5485  C CB  . ASP C 1 111 ? 84.796  43.979  67.682  1.00 92.42 ? 109 ASP C CB  1 
ATOM   5486  C CG  . ASP C 1 111 ? 85.078  44.018  69.181  1.00 92.42 ? 109 ASP C CG  1 
ATOM   5487  O OD1 . ASP C 1 111 ? 85.909  44.852  69.619  1.00 92.42 ? 109 ASP C OD1 1 
ATOM   5488  O OD2 . ASP C 1 111 ? 84.458  43.221  69.923  1.00 92.42 ? 109 ASP C OD2 1 
ATOM   5489  N N   . LEU C 1 132 ? 77.246  34.612  66.802  1.00 75.73 ? 130 LEU C N   1 
ATOM   5490  C CA  . LEU C 1 132 ? 78.693  34.692  66.959  1.00 75.73 ? 130 LEU C CA  1 
ATOM   5491  C C   . LEU C 1 132 ? 79.415  33.362  66.761  1.00 75.73 ? 130 LEU C C   1 
ATOM   5492  O O   . LEU C 1 132 ? 80.272  33.268  65.885  1.00 75.73 ? 130 LEU C O   1 
ATOM   5493  C CB  . LEU C 1 132 ? 79.059  35.259  68.338  1.00 67.66 ? 130 LEU C CB  1 
ATOM   5494  C CG  . LEU C 1 132 ? 80.547  35.187  68.726  1.00 70.39 ? 130 LEU C CG  1 
ATOM   5495  C CD1 . LEU C 1 132 ? 81.378  35.961  67.701  1.00 57.16 ? 130 LEU C CD1 1 
ATOM   5496  C CD2 . LEU C 1 132 ? 80.756  35.734  70.142  1.00 59.44 ? 130 LEU C CD2 1 
ATOM   5497  N N   . SER C 1 133 ? 79.088  32.346  67.565  1.00 35.77 ? 131 SER C N   1 
ATOM   5498  C CA  . SER C 1 133 ? 79.758  31.053  67.434  1.00 35.77 ? 131 SER C CA  1 
ATOM   5499  C C   . SER C 1 133 ? 80.050  30.782  65.981  1.00 35.77 ? 131 SER C C   1 
ATOM   5500  O O   . SER C 1 133 ? 81.140  30.330  65.622  1.00 35.77 ? 131 SER C O   1 
ATOM   5501  C CB  . SER C 1 133 ? 78.896  29.900  67.962  1.00 13.58 ? 131 SER C CB  1 
ATOM   5502  O OG  . SER C 1 133 ? 79.467  28.617  67.640  1.00 13.58 ? 131 SER C OG  1 
ATOM   5503  N N   . GLU C 1 134 ? 79.048  31.068  65.157  1.00 39.94 ? 132 GLU C N   1 
ATOM   5504  C CA  . GLU C 1 134 ? 79.101  30.869  63.714  1.00 39.94 ? 132 GLU C CA  1 
ATOM   5505  C C   . GLU C 1 134 ? 80.401  31.441  63.152  1.00 39.94 ? 132 GLU C C   1 
ATOM   5506  O O   . GLU C 1 134 ? 81.213  30.712  62.578  1.00 39.94 ? 132 GLU C O   1 
ATOM   5507  C CB  . GLU C 1 134 ? 77.873  31.533  63.065  1.00 81.86 ? 132 GLU C CB  1 
ATOM   5508  C CG  . GLU C 1 134 ? 76.490  31.092  63.633  1.00 81.86 ? 132 GLU C CG  1 
ATOM   5509  C CD  . GLU C 1 134 ? 76.248  31.506  65.096  1.00 81.86 ? 132 GLU C CD  1 
ATOM   5510  O OE1 . GLU C 1 134 ? 76.480  32.686  65.444  1.00 81.86 ? 132 GLU C OE1 1 
ATOM   5511  O OE2 . GLU C 1 134 ? 75.809  30.651  65.899  1.00 81.86 ? 132 GLU C OE2 1 
ATOM   5512  N N   . ARG C 1 135 ? 80.596  32.742  63.352  1.00 70.47 ? 133 ARG C N   1 
ATOM   5513  C CA  . ARG C 1 135 ? 81.792  33.439  62.884  1.00 70.47 ? 133 ARG C CA  1 
ATOM   5514  C C   . ARG C 1 135 ? 83.084  32.793  63.380  1.00 70.47 ? 133 ARG C C   1 
ATOM   5515  O O   . ARG C 1 135 ? 84.101  32.790  62.682  1.00 70.47 ? 133 ARG C O   1 
ATOM   5516  C CB  . ARG C 1 135 ? 81.732  34.903  63.321  1.00 89.81 ? 133 ARG C CB  1 
ATOM   5517  C CG  . ARG C 1 135 ? 80.629  35.667  62.627  1.00 89.81 ? 133 ARG C CG  1 
ATOM   5518  C CD  . ARG C 1 135 ? 79.985  36.684  63.535  1.00 89.81 ? 133 ARG C CD  1 
ATOM   5519  N NE  . ARG C 1 135 ? 80.886  37.778  63.872  1.00 89.81 ? 133 ARG C NE  1 
ATOM   5520  C CZ  . ARG C 1 135 ? 80.618  38.705  64.789  1.00 89.81 ? 133 ARG C CZ  1 
ATOM   5521  N NH1 . ARG C 1 135 ? 79.470  38.668  65.462  1.00 89.81 ? 133 ARG C NH1 1 
ATOM   5522  N NH2 . ARG C 1 135 ? 81.501  39.668  65.033  1.00 89.81 ? 133 ARG C NH2 1 
ATOM   5523  N N   . CYS C 1 136 ? 83.039  32.244  64.590  1.00 64.47 ? 134 CYS C N   1 
ATOM   5524  C CA  . CYS C 1 136 ? 84.202  31.589  65.172  1.00 64.47 ? 134 CYS C CA  1 
ATOM   5525  C C   . CYS C 1 136 ? 84.531  30.321  64.398  1.00 64.47 ? 134 CYS C C   1 
ATOM   5526  O O   . CYS C 1 136 ? 85.475  30.300  63.609  1.00 64.47 ? 134 CYS C O   1 
ATOM   5527  C CB  . CYS C 1 136 ? 83.941  31.243  66.641  1.00 65.97 ? 134 CYS C CB  1 
ATOM   5528  S SG  . CYS C 1 136 ? 84.036  32.642  67.761  1.00 65.97 ? 134 CYS C SG  1 
ATOM   5529  N N   . ALA C 1 137 ? 83.743  29.272  64.637  1.00 56.07 ? 135 ALA C N   1 
ATOM   5530  C CA  . ALA C 1 137 ? 83.934  27.983  63.984  1.00 56.07 ? 135 ALA C CA  1 
ATOM   5531  C C   . ALA C 1 137 ? 84.516  28.185  62.592  1.00 56.07 ? 135 ALA C C   1 
ATOM   5532  O O   . ALA C 1 137 ? 85.428  27.471  62.176  1.00 56.07 ? 135 ALA C O   1 
ATOM   5533  C CB  . ALA C 1 137 ? 82.610  27.246  63.901  1.00 88.57 ? 135 ALA C CB  1 
ATOM   5534  N N   . GLN C 1 138 ? 83.977  29.165  61.877  1.00 92.42 ? 136 GLN C N   1 
ATOM   5535  C CA  . GLN C 1 138 ? 84.455  29.481  60.541  1.00 92.42 ? 136 GLN C CA  1 
ATOM   5536  C C   . GLN C 1 138 ? 85.893  29.983  60.621  1.00 92.42 ? 136 GLN C C   1 
ATOM   5537  O O   . GLN C 1 138 ? 86.799  29.379  60.042  1.00 92.42 ? 136 GLN C O   1 
ATOM   5538  C CB  . GLN C 1 138 ? 83.563  30.551  59.896  1.00 81.64 ? 136 GLN C CB  1 
ATOM   5539  C CG  . GLN C 1 138 ? 84.226  31.358  58.771  1.00 81.64 ? 136 GLN C CG  1 
ATOM   5540  C CD  . GLN C 1 138 ? 84.617  30.516  57.564  1.00 81.64 ? 136 GLN C CD  1 
ATOM   5541  O OE1 . GLN C 1 138 ? 85.201  31.027  56.610  1.00 81.64 ? 136 GLN C OE1 1 
ATOM   5542  N NE2 . GLN C 1 138 ? 84.295  29.226  57.600  1.00 81.64 ? 136 GLN C NE2 1 
ATOM   5543  N N   . TYR C 1 139 ? 86.096  31.087  61.339  1.00 59.44 ? 137 TYR C N   1 
ATOM   5544  C CA  . TYR C 1 139 ? 87.423  31.670  61.489  1.00 59.44 ? 137 TYR C CA  1 
ATOM   5545  C C   . TYR C 1 139 ? 88.483  30.631  61.810  1.00 59.44 ? 137 TYR C C   1 
ATOM   5546  O O   . TYR C 1 139 ? 89.611  30.710  61.321  1.00 59.44 ? 137 TYR C O   1 
ATOM   5547  C CB  . TYR C 1 139 ? 87.419  32.730  62.581  1.00 33.70 ? 137 TYR C CB  1 
ATOM   5548  C CG  . TYR C 1 139 ? 86.785  34.038  62.185  1.00 33.70 ? 137 TYR C CG  1 
ATOM   5549  C CD1 . TYR C 1 139 ? 86.952  34.566  60.913  1.00 33.70 ? 137 TYR C CD1 1 
ATOM   5550  C CD2 . TYR C 1 139 ? 86.098  34.798  63.119  1.00 33.70 ? 137 TYR C CD2 1 
ATOM   5551  C CE1 . TYR C 1 139 ? 86.454  35.834  60.586  1.00 33.70 ? 137 TYR C CE1 1 
ATOM   5552  C CE2 . TYR C 1 139 ? 85.602  36.062  62.808  1.00 33.70 ? 137 TYR C CE2 1 
ATOM   5553  C CZ  . TYR C 1 139 ? 85.786  36.579  61.548  1.00 33.70 ? 137 TYR C CZ  1 
ATOM   5554  O OH  . TYR C 1 139 ? 85.350  37.860  61.282  1.00 33.70 ? 137 TYR C OH  1 
ATOM   5555  N N   . LYS C 1 140 ? 88.117  29.659  62.637  1.00 50.22 ? 138 LYS C N   1 
ATOM   5556  C CA  . LYS C 1 140 ? 89.047  28.606  63.007  1.00 50.22 ? 138 LYS C CA  1 
ATOM   5557  C C   . LYS C 1 140 ? 89.483  27.846  61.763  1.00 50.22 ? 138 LYS C C   1 
ATOM   5558  O O   . LYS C 1 140 ? 90.659  27.532  61.614  1.00 50.22 ? 138 LYS C O   1 
ATOM   5559  C CB  . LYS C 1 140 ? 88.407  27.646  64.010  1.00 57.82 ? 138 LYS C CB  1 
ATOM   5560  C CG  . LYS C 1 140 ? 89.348  26.567  64.548  1.00 57.82 ? 138 LYS C CG  1 
ATOM   5561  C CD  . LYS C 1 140 ? 90.556  27.141  65.292  1.00 57.82 ? 138 LYS C CD  1 
ATOM   5562  C CE  . LYS C 1 140 ? 91.389  26.024  65.918  1.00 57.82 ? 138 LYS C CE  1 
ATOM   5563  N NZ  . LYS C 1 140 ? 92.642  26.499  66.575  1.00 57.82 ? 138 LYS C NZ  1 
ATOM   5564  N N   . LYS C 1 141 ? 88.540  27.546  60.873  1.00 75.60 ? 139 LYS C N   1 
ATOM   5565  C CA  . LYS C 1 141 ? 88.876  26.841  59.635  1.00 75.60 ? 139 LYS C CA  1 
ATOM   5566  C C   . LYS C 1 141 ? 89.897  27.694  58.901  1.00 75.60 ? 139 LYS C C   1 
ATOM   5567  O O   . LYS C 1 141 ? 90.992  27.242  58.576  1.00 75.60 ? 139 LYS C O   1 
ATOM   5568  C CB  . LYS C 1 141 ? 87.652  26.673  58.726  1.00 92.42 ? 139 LYS C CB  1 
ATOM   5569  C CG  . LYS C 1 141 ? 86.618  25.623  59.137  1.00 92.42 ? 139 LYS C CG  1 
ATOM   5570  C CD  . LYS C 1 141 ? 85.667  25.368  57.954  1.00 92.42 ? 139 LYS C CD  1 
ATOM   5571  C CE  . LYS C 1 141 ? 84.484  24.468  58.303  1.00 92.42 ? 139 LYS C CE  1 
ATOM   5572  N NZ  . LYS C 1 141 ? 83.465  25.141  59.161  1.00 92.42 ? 139 LYS C NZ  1 
ATOM   5573  N N   . ASP C 1 142 ? 89.514  28.941  58.651  1.00 62.14 ? 140 ASP C N   1 
ATOM   5574  C CA  . ASP C 1 142 ? 90.368  29.889  57.959  1.00 62.14 ? 140 ASP C CA  1 
ATOM   5575  C C   . ASP C 1 142 ? 91.791  29.941  58.494  1.00 62.14 ? 140 ASP C C   1 
ATOM   5576  O O   . ASP C 1 142 ? 92.725  30.226  57.745  1.00 62.14 ? 140 ASP C O   1 
ATOM   5577  C CB  . ASP C 1 142 ? 89.730  31.270  58.003  1.00 59.75 ? 140 ASP C CB  1 
ATOM   5578  C CG  . ASP C 1 142 ? 88.478  31.336  57.160  1.00 59.75 ? 140 ASP C CG  1 
ATOM   5579  O OD1 . ASP C 1 142 ? 87.700  30.360  57.201  1.00 59.75 ? 140 ASP C OD1 1 
ATOM   5580  O OD2 . ASP C 1 142 ? 88.268  32.348  56.461  1.00 59.75 ? 140 ASP C OD2 1 
ATOM   5581  N N   . GLY C 1 143 ? 91.967  29.665  59.781  1.00 87.33 ? 141 GLY C N   1 
ATOM   5582  C CA  . GLY C 1 143 ? 93.308  29.675  60.335  1.00 87.33 ? 141 GLY C CA  1 
ATOM   5583  C C   . GLY C 1 143 ? 93.514  30.448  61.622  1.00 87.33 ? 141 GLY C C   1 
ATOM   5584  O O   . GLY C 1 143 ? 94.656  30.704  62.010  1.00 87.33 ? 141 GLY C O   1 
ATOM   5585  N N   . VAL C 1 144 ? 92.428  30.837  62.283  1.00 54.48 ? 142 VAL C N   1 
ATOM   5586  C CA  . VAL C 1 144 ? 92.561  31.563  63.537  1.00 54.48 ? 142 VAL C CA  1 
ATOM   5587  C C   . VAL C 1 144 ? 92.562  30.541  64.678  1.00 54.48 ? 142 VAL C C   1 
ATOM   5588  O O   . VAL C 1 144 ? 91.980  29.458  64.560  1.00 54.48 ? 142 VAL C O   1 
ATOM   5589  C CB  . VAL C 1 144 ? 91.420  32.605  63.732  1.00 49.87 ? 142 VAL C CB  1 
ATOM   5590  C CG1 . VAL C 1 144 ? 91.564  33.295  65.083  1.00 49.87 ? 142 VAL C CG1 1 
ATOM   5591  C CG2 . VAL C 1 144 ? 91.478  33.651  62.633  1.00 49.87 ? 142 VAL C CG2 1 
ATOM   5592  N N   . ASP C 1 145 ? 93.240  30.884  65.772  1.00 76.42 ? 143 ASP C N   1 
ATOM   5593  C CA  . ASP C 1 145 ? 93.343  29.998  66.925  1.00 76.42 ? 143 ASP C CA  1 
ATOM   5594  C C   . ASP C 1 145 ? 92.901  30.680  68.219  1.00 76.42 ? 143 ASP C C   1 
ATOM   5595  O O   . ASP C 1 145 ? 92.697  30.018  69.239  1.00 76.42 ? 143 ASP C O   1 
ATOM   5596  C CB  . ASP C 1 145 ? 94.788  29.508  67.069  1.00 92.42 ? 143 ASP C CB  1 
ATOM   5597  C CG  . ASP C 1 145 ? 95.291  28.775  65.829  1.00 92.42 ? 143 ASP C CG  1 
ATOM   5598  O OD1 . ASP C 1 145 ? 94.789  27.659  65.552  1.00 92.42 ? 143 ASP C OD1 1 
ATOM   5599  O OD2 . ASP C 1 145 ? 96.187  29.320  65.137  1.00 92.42 ? 143 ASP C OD2 1 
ATOM   5600  N N   . PHE C 1 146 ? 92.761  32.004  68.179  1.00 52.11 ? 144 PHE C N   1 
ATOM   5601  C CA  . PHE C 1 146 ? 92.338  32.758  69.358  1.00 52.11 ? 144 PHE C CA  1 
ATOM   5602  C C   . PHE C 1 146 ? 91.602  34.032  68.954  1.00 52.11 ? 144 PHE C C   1 
ATOM   5603  O O   . PHE C 1 146 ? 91.759  34.511  67.828  1.00 52.11 ? 144 PHE C O   1 
ATOM   5604  C CB  . PHE C 1 146 ? 93.556  33.083  70.250  1.00 41.84 ? 144 PHE C CB  1 
ATOM   5605  C CG  . PHE C 1 146 ? 94.364  34.284  69.807  1.00 41.84 ? 144 PHE C CG  1 
ATOM   5606  C CD1 . PHE C 1 146 ? 93.833  35.575  69.882  1.00 41.84 ? 144 PHE C CD1 1 
ATOM   5607  C CD2 . PHE C 1 146 ? 95.670  34.129  69.364  1.00 41.84 ? 144 PHE C CD2 1 
ATOM   5608  C CE1 . PHE C 1 146 ? 94.589  36.690  69.525  1.00 41.84 ? 144 PHE C CE1 1 
ATOM   5609  C CE2 . PHE C 1 146 ? 96.435  35.247  69.004  1.00 41.84 ? 144 PHE C CE2 1 
ATOM   5610  C CZ  . PHE C 1 146 ? 95.890  36.530  69.087  1.00 41.84 ? 144 PHE C CZ  1 
ATOM   5611  N N   . GLY C 1 147 ? 90.811  34.587  69.872  1.00 50.02 ? 145 GLY C N   1 
ATOM   5612  C CA  . GLY C 1 147 ? 90.067  35.792  69.537  1.00 44.03 ? 145 GLY C CA  1 
ATOM   5613  C C   . GLY C 1 147 ? 89.824  36.839  70.612  1.00 49.09 ? 145 GLY C C   1 
ATOM   5614  O O   . GLY C 1 147 ? 89.873  36.548  71.811  1.00 53.10 ? 145 GLY C O   1 
ATOM   5615  N N   . LYS C 1 148 ? 89.549  38.066  70.169  1.00 48.76 ? 146 LYS C N   1 
ATOM   5616  C CA  . LYS C 1 148 ? 89.284  39.188  71.063  1.00 49.39 ? 146 LYS C CA  1 
ATOM   5617  C C   . LYS C 1 148 ? 87.816  39.633  70.971  1.00 56.78 ? 146 LYS C C   1 
ATOM   5618  O O   . LYS C 1 148 ? 87.141  39.350  69.977  1.00 58.56 ? 146 LYS C O   1 
ATOM   5619  C CB  . LYS C 1 148 ? 90.177  40.366  70.688  1.00 41.64 ? 146 LYS C CB  1 
ATOM   5620  C CG  . LYS C 1 148 ? 89.870  41.633  71.467  1.00 44.51 ? 146 LYS C CG  1 
ATOM   5621  C CD  . LYS C 1 148 ? 90.190  42.887  70.666  1.00 42.49 ? 146 LYS C CD  1 
ATOM   5622  C CE  . LYS C 1 148 ? 89.689  44.141  71.382  1.00 54.80 ? 146 LYS C CE  1 
ATOM   5623  N NZ  . LYS C 1 148 ? 90.025  45.397  70.643  1.00 51.70 ? 146 LYS C NZ  1 
ATOM   5624  N N   . TRP C 1 149 ? 87.327  40.322  72.008  1.00 92.42 ? 147 TRP C N   1 
ATOM   5625  C CA  . TRP C 1 149 ? 85.956  40.847  72.033  1.00 92.42 ? 147 TRP C CA  1 
ATOM   5626  C C   . TRP C 1 149 ? 85.964  42.384  72.050  1.00 92.42 ? 147 TRP C C   1 
ATOM   5627  O O   . TRP C 1 149 ? 86.193  43.022  73.084  1.00 92.42 ? 147 TRP C O   1 
ATOM   5628  C CB  . TRP C 1 149 ? 85.182  40.328  73.249  1.00 92.42 ? 147 TRP C CB  1 
ATOM   5629  C CG  . TRP C 1 149 ? 83.863  41.038  73.460  1.00 92.42 ? 147 TRP C CG  1 
ATOM   5630  C CD1 . TRP C 1 149 ? 83.672  42.283  74.009  1.00 92.42 ? 147 TRP C CD1 1 
ATOM   5631  C CD2 . TRP C 1 149 ? 82.563  40.560  73.101  1.00 92.42 ? 147 TRP C CD2 1 
ATOM   5632  N NE1 . TRP C 1 149 ? 82.335  42.604  74.012  1.00 92.42 ? 147 TRP C NE1 1 
ATOM   5633  C CE2 . TRP C 1 149 ? 81.631  41.565  73.462  1.00 92.42 ? 147 TRP C CE2 1 
ATOM   5634  C CE3 . TRP C 1 149 ? 82.092  39.381  72.511  1.00 92.42 ? 147 TRP C CE3 1 
ATOM   5635  C CZ2 . TRP C 1 149 ? 80.258  41.424  73.251  1.00 92.42 ? 147 TRP C CZ2 1 
ATOM   5636  C CZ3 . TRP C 1 149 ? 80.723  39.241  72.301  1.00 92.42 ? 147 TRP C CZ3 1 
ATOM   5637  C CH2 . TRP C 1 149 ? 79.824  40.260  72.671  1.00 92.42 ? 147 TRP C CH2 1 
ATOM   5638  N N   . SER C 1 161 ? 78.528  51.640  88.703  1.00 72.60 ? 159 SER C N   1 
ATOM   5639  C CA  . SER C 1 161 ? 77.414  50.784  89.098  1.00 71.30 ? 159 SER C CA  1 
ATOM   5640  C C   . SER C 1 161 ? 77.768  49.307  88.960  1.00 72.60 ? 159 SER C C   1 
ATOM   5641  O O   . SER C 1 161 ? 78.331  48.876  87.951  1.00 72.60 ? 159 SER C O   1 
ATOM   5642  C CB  . SER C 1 161 ? 76.175  51.092  88.247  1.00 66.99 ? 159 SER C CB  1 
ATOM   5643  O OG  . SER C 1 161 ? 75.076  50.261  88.599  1.00 80.82 ? 159 SER C OG  1 
ATOM   5644  N N   . SER C 1 162 ? 77.433  48.530  89.980  1.00 72.73 ? 160 SER C N   1 
ATOM   5645  C CA  . SER C 1 162 ? 77.716  47.105  89.959  1.00 72.73 ? 160 SER C CA  1 
ATOM   5646  C C   . SER C 1 162 ? 76.861  46.413  88.906  1.00 72.73 ? 160 SER C C   1 
ATOM   5647  O O   . SER C 1 162 ? 77.080  45.246  88.585  1.00 72.73 ? 160 SER C O   1 
ATOM   5648  C CB  . SER C 1 162 ? 77.425  46.495  91.327  1.00 92.42 ? 160 SER C CB  1 
ATOM   5649  O OG  . SER C 1 162 ? 76.068  46.694  91.686  1.00 92.42 ? 160 SER C OG  1 
ATOM   5650  N N   . LEU C 1 163 ? 75.881  47.138  88.377  1.00 66.70 ? 161 LEU C N   1 
ATOM   5651  C CA  . LEU C 1 163 ? 74.986  46.594  87.362  1.00 66.70 ? 161 LEU C CA  1 
ATOM   5652  C C   . LEU C 1 163 ? 75.770  46.290  86.097  1.00 66.70 ? 161 LEU C C   1 
ATOM   5653  O O   . LEU C 1 163 ? 75.601  45.232  85.493  1.00 66.70 ? 161 LEU C O   1 
ATOM   5654  C CB  . LEU C 1 163 ? 73.865  47.591  87.039  1.00 46.91 ? 161 LEU C CB  1 
ATOM   5655  C CG  . LEU C 1 163 ? 72.762  47.084  86.089  1.00 46.91 ? 161 LEU C CG  1 
ATOM   5656  C CD1 . LEU C 1 163 ? 72.064  45.862  86.711  1.00 46.91 ? 161 LEU C CD1 1 
ATOM   5657  C CD2 . LEU C 1 163 ? 71.767  48.206  85.798  1.00 46.91 ? 161 LEU C CD2 1 
ATOM   5658  N N   . ALA C 1 164 ? 76.627  47.225  85.700  1.00 75.33 ? 162 ALA C N   1 
ATOM   5659  C CA  . ALA C 1 164 ? 77.439  47.048  84.504  1.00 75.33 ? 162 ALA C CA  1 
ATOM   5660  C C   . ALA C 1 164 ? 78.485  45.966  84.735  1.00 75.33 ? 162 ALA C C   1 
ATOM   5661  O O   . ALA C 1 164 ? 78.557  44.987  83.987  1.00 75.33 ? 162 ALA C O   1 
ATOM   5662  C CB  . ALA C 1 164 ? 78.115  48.355  84.136  1.00 50.39 ? 162 ALA C CB  1 
ATOM   5663  N N   . ILE C 1 165 ? 79.291  46.144  85.779  1.00 51.92 ? 163 ILE C N   1 
ATOM   5664  C CA  . ILE C 1 165 ? 80.342  45.186  86.110  1.00 51.92 ? 163 ILE C CA  1 
ATOM   5665  C C   . ILE C 1 165 ? 79.783  43.763  86.153  1.00 51.92 ? 163 ILE C C   1 
ATOM   5666  O O   . ILE C 1 165 ? 80.505  42.793  85.939  1.00 51.92 ? 163 ILE C O   1 
ATOM   5667  C CB  . ILE C 1 165 ? 80.993  45.542  87.471  1.00 24.28 ? 163 ILE C CB  1 
ATOM   5668  C CG1 . ILE C 1 165 ? 81.505  46.989  87.427  1.00 24.28 ? 163 ILE C CG1 1 
ATOM   5669  C CG2 . ILE C 1 165 ? 82.131  44.563  87.796  1.00 24.28 ? 163 ILE C CG2 1 
ATOM   5670  C CD1 . ILE C 1 165 ? 81.971  47.519  88.758  1.00 24.28 ? 163 ILE C CD1 1 
ATOM   5671  N N   . GLN C 1 166 ? 78.489  43.651  86.423  1.00 32.90 ? 164 GLN C N   1 
ATOM   5672  C CA  . GLN C 1 166 ? 77.817  42.361  86.486  1.00 32.90 ? 164 GLN C CA  1 
ATOM   5673  C C   . GLN C 1 166 ? 77.524  41.861  85.074  1.00 32.90 ? 164 GLN C C   1 
ATOM   5674  O O   . GLN C 1 166 ? 77.898  40.754  84.709  1.00 32.90 ? 164 GLN C O   1 
ATOM   5675  C CB  . GLN C 1 166 ? 76.507  42.503  87.255  1.00 82.87 ? 164 GLN C CB  1 
ATOM   5676  C CG  . GLN C 1 166 ? 75.711  41.221  87.386  1.00 82.87 ? 164 GLN C CG  1 
ATOM   5677  C CD  . GLN C 1 166 ? 74.254  41.475  87.764  1.00 82.87 ? 164 GLN C CD  1 
ATOM   5678  O OE1 . GLN C 1 166 ? 73.521  40.543  88.105  1.00 82.87 ? 164 GLN C OE1 1 
ATOM   5679  N NE2 . GLN C 1 166 ? 73.827  42.739  87.692  1.00 82.87 ? 164 GLN C NE2 1 
ATOM   5680  N N   . GLU C 1 167 ? 76.847  42.683  84.279  1.00 54.04 ? 165 GLU C N   1 
ATOM   5681  C CA  . GLU C 1 167 ? 76.507  42.306  82.911  1.00 54.04 ? 165 GLU C CA  1 
ATOM   5682  C C   . GLU C 1 167 ? 77.763  41.902  82.145  1.00 54.04 ? 165 GLU C C   1 
ATOM   5683  O O   . GLU C 1 167 ? 77.929  40.739  81.772  1.00 54.04 ? 165 GLU C O   1 
ATOM   5684  C CB  . GLU C 1 167 ? 75.841  43.479  82.178  1.00 68.95 ? 165 GLU C CB  1 
ATOM   5685  C CG  . GLU C 1 167 ? 74.576  44.061  82.821  1.00 68.95 ? 165 GLU C CG  1 
ATOM   5686  C CD  . GLU C 1 167 ? 73.341  43.179  82.669  1.00 68.95 ? 165 GLU C CD  1 
ATOM   5687  O OE1 . GLU C 1 167 ? 72.228  43.682  82.918  1.00 68.95 ? 165 GLU C OE1 1 
ATOM   5688  O OE2 . GLU C 1 167 ? 73.474  41.988  82.314  1.00 68.95 ? 165 GLU C OE2 1 
ATOM   5689  N N   . ASN C 1 168 ? 78.640  42.883  81.927  1.00 51.89 ? 166 ASN C N   1 
ATOM   5690  C CA  . ASN C 1 168 ? 79.893  42.705  81.194  1.00 51.89 ? 166 ASN C CA  1 
ATOM   5691  C C   . ASN C 1 168 ? 80.613  41.428  81.565  1.00 51.89 ? 166 ASN C C   1 
ATOM   5692  O O   . ASN C 1 168 ? 81.051  40.680  80.694  1.00 51.89 ? 166 ASN C O   1 
ATOM   5693  C CB  . ASN C 1 168 ? 80.833  43.885  81.439  1.00 86.11 ? 166 ASN C CB  1 
ATOM   5694  C CG  . ASN C 1 168 ? 80.182  45.224  81.151  1.00 86.11 ? 166 ASN C CG  1 
ATOM   5695  O OD1 . ASN C 1 168 ? 80.835  46.265  81.220  1.00 86.11 ? 166 ASN C OD1 1 
ATOM   5696  N ND2 . ASN C 1 168 ? 78.889  45.208  80.834  1.00 86.11 ? 166 ASN C ND2 1 
ATOM   5697  N N   . ALA C 1 169 ? 80.748  41.186  82.861  1.00 37.28 ? 167 ALA C N   1 
ATOM   5698  C CA  . ALA C 1 169 ? 81.421  39.987  83.320  1.00 37.28 ? 167 ALA C CA  1 
ATOM   5699  C C   . ALA C 1 169 ? 80.813  38.774  82.634  1.00 37.28 ? 167 ALA C C   1 
ATOM   5700  O O   . ALA C 1 169 ? 81.516  38.004  81.970  1.00 37.28 ? 167 ALA C O   1 
ATOM   5701  C CB  . ALA C 1 169 ? 81.292  39.845  84.823  1.00 1.62  ? 167 ALA C CB  1 
ATOM   5702  N N   . ASN C 1 170 ? 79.502  38.612  82.785  1.00 65.90 ? 168 ASN C N   1 
ATOM   5703  C CA  . ASN C 1 170 ? 78.786  37.483  82.199  1.00 65.90 ? 168 ASN C CA  1 
ATOM   5704  C C   . ASN C 1 170 ? 78.833  37.450  80.675  1.00 65.90 ? 168 ASN C C   1 
ATOM   5705  O O   . ASN C 1 170 ? 78.963  36.382  80.067  1.00 65.90 ? 168 ASN C O   1 
ATOM   5706  C CB  . ASN C 1 170 ? 77.354  37.512  82.693  1.00 34.48 ? 168 ASN C CB  1 
ATOM   5707  C CG  . ASN C 1 170 ? 77.271  37.320  84.180  1.00 34.48 ? 168 ASN C CG  1 
ATOM   5708  O OD1 . ASN C 1 170 ? 77.458  36.210  84.683  1.00 34.48 ? 168 ASN C OD1 1 
ATOM   5709  N ND2 . ASN C 1 170 ? 77.013  38.402  84.905  1.00 34.48 ? 168 ASN C ND2 1 
ATOM   5710  N N   . ALA C 1 171 ? 78.714  38.615  80.050  1.00 54.83 ? 169 ALA C N   1 
ATOM   5711  C CA  . ALA C 1 171 ? 78.785  38.663  78.602  1.00 54.83 ? 169 ALA C CA  1 
ATOM   5712  C C   . ALA C 1 171 ? 80.101  37.976  78.306  1.00 54.83 ? 169 ALA C C   1 
ATOM   5713  O O   . ALA C 1 171 ? 80.123  36.852  77.806  1.00 54.83 ? 169 ALA C O   1 
ATOM   5714  C CB  . ALA C 1 171 ? 78.820  40.105  78.118  1.00 11.72 ? 169 ALA C CB  1 
ATOM   5715  N N   . LEU C 1 172 ? 81.193  38.654  78.660  1.00 27.12 ? 170 LEU C N   1 
ATOM   5716  C CA  . LEU C 1 172 ? 82.522  38.119  78.456  1.00 27.12 ? 170 LEU C CA  1 
ATOM   5717  C C   . LEU C 1 172 ? 82.469  36.646  78.801  1.00 27.12 ? 170 LEU C C   1 
ATOM   5718  O O   . LEU C 1 172 ? 82.802  35.784  77.986  1.00 27.12 ? 170 LEU C O   1 
ATOM   5719  C CB  . LEU C 1 172 ? 83.526  38.852  79.346  1.00 33.00 ? 170 LEU C CB  1 
ATOM   5720  C CG  . LEU C 1 172 ? 83.940  40.238  78.842  1.00 33.00 ? 170 LEU C CG  1 
ATOM   5721  C CD1 . LEU C 1 172 ? 84.578  41.035  79.943  1.00 33.00 ? 170 LEU C CD1 1 
ATOM   5722  C CD2 . LEU C 1 172 ? 84.908  40.085  77.696  1.00 33.00 ? 170 LEU C CD2 1 
ATOM   5723  N N   . ALA C 1 173 ? 82.003  36.356  80.005  1.00 19.15 ? 171 ALA C N   1 
ATOM   5724  C CA  . ALA C 1 173 ? 81.900  34.974  80.459  1.00 19.15 ? 171 ALA C CA  1 
ATOM   5725  C C   . ALA C 1 173 ? 81.394  34.067  79.339  1.00 19.15 ? 171 ALA C C   1 
ATOM   5726  O O   . ALA C 1 173 ? 81.989  33.030  79.053  1.00 19.15 ? 171 ALA C O   1 
ATOM   5727  C CB  . ALA C 1 173 ? 80.975  34.887  81.670  1.00 90.39 ? 171 ALA C CB  1 
ATOM   5728  N N   . ARG C 1 174 ? 80.294  34.465  78.711  1.00 73.13 ? 172 ARG C N   1 
ATOM   5729  C CA  . ARG C 1 174 ? 79.713  33.685  77.631  1.00 73.13 ? 172 ARG C CA  1 
ATOM   5730  C C   . ARG C 1 174 ? 80.559  33.717  76.363  1.00 73.13 ? 172 ARG C C   1 
ATOM   5731  O O   . ARG C 1 174 ? 80.954  32.666  75.850  1.00 73.13 ? 172 ARG C O   1 
ATOM   5732  C CB  . ARG C 1 174 ? 78.303  34.182  77.331  1.00 34.88 ? 172 ARG C CB  1 
ATOM   5733  C CG  . ARG C 1 174 ? 77.211  33.313  77.936  1.00 34.88 ? 172 ARG C CG  1 
ATOM   5734  C CD  . ARG C 1 174 ? 75.793  33.836  77.644  1.00 34.88 ? 172 ARG C CD  1 
ATOM   5735  N NE  . ARG C 1 174 ? 75.421  34.984  78.474  1.00 34.88 ? 172 ARG C NE  1 
ATOM   5736  C CZ  . ARG C 1 174 ? 75.576  36.255  78.113  1.00 34.88 ? 172 ARG C CZ  1 
ATOM   5737  N NH1 . ARG C 1 174 ? 76.098  36.547  76.930  1.00 34.88 ? 172 ARG C NH1 1 
ATOM   5738  N NH2 . ARG C 1 174 ? 75.202  37.236  78.928  1.00 34.88 ? 172 ARG C NH2 1 
ATOM   5739  N N   . TYR C 1 175 ? 80.836  34.918  75.857  1.00 65.66 ? 173 TYR C N   1 
ATOM   5740  C CA  . TYR C 1 175 ? 81.643  35.075  74.646  1.00 65.66 ? 173 TYR C CA  1 
ATOM   5741  C C   . TYR C 1 175 ? 82.856  34.156  74.746  1.00 65.66 ? 173 TYR C C   1 
ATOM   5742  O O   . TYR C 1 175 ? 83.374  33.679  73.744  1.00 65.66 ? 173 TYR C O   1 
ATOM   5743  C CB  . TYR C 1 175 ? 82.069  36.541  74.493  1.00 77.66 ? 173 TYR C CB  1 
ATOM   5744  C CG  . TYR C 1 175 ? 83.515  36.747  74.104  1.00 77.66 ? 173 TYR C CG  1 
ATOM   5745  C CD1 . TYR C 1 175 ? 83.975  36.437  72.823  1.00 77.66 ? 173 TYR C CD1 1 
ATOM   5746  C CD2 . TYR C 1 175 ? 84.434  37.237  75.030  1.00 77.66 ? 173 TYR C CD2 1 
ATOM   5747  C CE1 . TYR C 1 175 ? 85.318  36.609  72.478  1.00 77.66 ? 173 TYR C CE1 1 
ATOM   5748  C CE2 . TYR C 1 175 ? 85.773  37.410  74.697  1.00 77.66 ? 173 TYR C CE2 1 
ATOM   5749  C CZ  . TYR C 1 175 ? 86.207  37.094  73.425  1.00 77.66 ? 173 TYR C CZ  1 
ATOM   5750  O OH  . TYR C 1 175 ? 87.535  37.249  73.121  1.00 77.66 ? 173 TYR C OH  1 
ATOM   5751  N N   . ALA C 1 176 ? 83.289  33.901  75.973  1.00 56.37 ? 174 ALA C N   1 
ATOM   5752  C CA  . ALA C 1 176 ? 84.418  33.023  76.225  1.00 56.37 ? 174 ALA C CA  1 
ATOM   5753  C C   . ALA C 1 176 ? 84.042  31.586  75.892  1.00 56.37 ? 174 ALA C C   1 
ATOM   5754  O O   . ALA C 1 176 ? 84.514  31.019  74.909  1.00 56.37 ? 174 ALA C O   1 
ATOM   5755  C CB  . ALA C 1 176 ? 84.820  33.117  77.680  1.00 15.91 ? 174 ALA C CB  1 
ATOM   5756  N N   . SER C 1 177 ? 83.184  31.009  76.726  1.00 64.67 ? 175 SER C N   1 
ATOM   5757  C CA  . SER C 1 177 ? 82.731  29.636  76.559  1.00 64.67 ? 175 SER C CA  1 
ATOM   5758  C C   . SER C 1 177 ? 82.358  29.284  75.123  1.00 64.67 ? 175 SER C C   1 
ATOM   5759  O O   . SER C 1 177 ? 82.317  28.108  74.761  1.00 64.67 ? 175 SER C O   1 
ATOM   5760  C CB  . SER C 1 177 ? 81.551  29.368  77.492  1.00 53.38 ? 175 SER C CB  1 
ATOM   5761  O OG  . SER C 1 177 ? 80.553  30.359  77.330  1.00 53.38 ? 175 SER C OG  1 
ATOM   5762  N N   . ILE C 1 178 ? 82.073  30.291  74.303  1.00 66.95 ? 176 ILE C N   1 
ATOM   5763  C CA  . ILE C 1 178 ? 81.742  30.031  72.904  1.00 66.95 ? 176 ILE C CA  1 
ATOM   5764  C C   . ILE C 1 178 ? 83.010  29.611  72.170  1.00 66.95 ? 176 ILE C C   1 
ATOM   5765  O O   . ILE C 1 178 ? 83.100  28.493  71.658  1.00 66.95 ? 176 ILE C O   1 
ATOM   5766  C CB  . ILE C 1 178 ? 81.173  31.282  72.204  1.00 53.07 ? 176 ILE C CB  1 
ATOM   5767  C CG1 . ILE C 1 178 ? 79.668  31.345  72.399  1.00 53.07 ? 176 ILE C CG1 1 
ATOM   5768  C CG2 . ILE C 1 178 ? 81.478  31.244  70.716  1.00 53.07 ? 176 ILE C CG2 1 
ATOM   5769  C CD1 . ILE C 1 178 ? 79.025  32.453  71.606  1.00 53.07 ? 176 ILE C CD1 1 
ATOM   5770  N N   . CYS C 1 179 ? 83.979  30.527  72.123  1.00 42.95 ? 177 CYS C N   1 
ATOM   5771  C CA  . CYS C 1 179 ? 85.256  30.297  71.465  1.00 42.95 ? 177 CYS C CA  1 
ATOM   5772  C C   . CYS C 1 179 ? 85.759  28.952  71.894  1.00 42.95 ? 177 CYS C C   1 
ATOM   5773  O O   . CYS C 1 179 ? 86.216  28.168  71.073  1.00 42.95 ? 177 CYS C O   1 
ATOM   5774  C CB  . CYS C 1 179 ? 86.269  31.347  71.886  1.00 43.56 ? 177 CYS C CB  1 
ATOM   5775  S SG  . CYS C 1 179 ? 85.651  33.015  71.809  1.00 43.56 ? 177 CYS C SG  1 
ATOM   5776  N N   . GLN C 1 180 ? 85.675  28.695  73.193  1.00 34.15 ? 178 GLN C N   1 
ATOM   5777  C CA  . GLN C 1 180 ? 86.119  27.420  73.759  1.00 34.15 ? 178 GLN C CA  1 
ATOM   5778  C C   . GLN C 1 180 ? 85.559  26.249  72.939  1.00 34.15 ? 178 GLN C C   1 
ATOM   5779  O O   . GLN C 1 180 ? 86.246  25.255  72.690  1.00 34.15 ? 178 GLN C O   1 
ATOM   5780  C CB  . GLN C 1 180 ? 85.645  27.290  75.214  1.00 69.30 ? 178 GLN C CB  1 
ATOM   5781  C CG  . GLN C 1 180 ? 86.048  28.438  76.129  1.00 69.30 ? 178 GLN C CG  1 
ATOM   5782  C CD  . GLN C 1 180 ? 87.512  28.396  76.497  1.00 69.30 ? 178 GLN C CD  1 
ATOM   5783  O OE1 . GLN C 1 180 ? 87.987  27.409  77.051  1.00 69.30 ? 178 GLN C OE1 1 
ATOM   5784  N NE2 . GLN C 1 180 ? 88.236  29.467  76.194  1.00 69.30 ? 178 GLN C NE2 1 
ATOM   5785  N N   . GLN C 1 181 ? 84.299  26.376  72.529  1.00 76.88 ? 179 GLN C N   1 
ATOM   5786  C CA  . GLN C 1 181 ? 83.643  25.346  71.737  1.00 76.88 ? 179 GLN C CA  1 
ATOM   5787  C C   . GLN C 1 181 ? 84.245  25.340  70.338  1.00 76.88 ? 179 GLN C C   1 
ATOM   5788  O O   . GLN C 1 181 ? 84.628  24.294  69.818  1.00 76.88 ? 179 GLN C O   1 
ATOM   5789  C CB  . GLN C 1 181 ? 82.140  25.626  71.657  1.00 69.46 ? 179 GLN C CB  1 
ATOM   5790  C CG  . GLN C 1 181 ? 81.263  24.598  72.355  1.00 69.46 ? 179 GLN C CG  1 
ATOM   5791  C CD  . GLN C 1 181 ? 81.618  24.428  73.819  1.00 69.46 ? 179 GLN C CD  1 
ATOM   5792  O OE1 . GLN C 1 181 ? 81.675  25.401  74.573  1.00 69.46 ? 179 GLN C OE1 1 
ATOM   5793  N NE2 . GLN C 1 181 ? 81.853  23.185  74.233  1.00 69.46 ? 179 GLN C NE2 1 
ATOM   5794  N N   . ASN C 1 182 ? 84.339  26.523  69.744  1.00 85.57 ? 180 ASN C N   1 
ATOM   5795  C CA  . ASN C 1 182 ? 84.883  26.668  68.401  1.00 85.57 ? 180 ASN C CA  1 
ATOM   5796  C C   . ASN C 1 182 ? 86.401  26.465  68.305  1.00 85.57 ? 180 ASN C C   1 
ATOM   5797  O O   . ASN C 1 182 ? 86.990  26.646  67.240  1.00 85.57 ? 180 ASN C O   1 
ATOM   5798  C CB  . ASN C 1 182 ? 84.506  28.041  67.843  1.00 73.66 ? 180 ASN C CB  1 
ATOM   5799  C CG  . ASN C 1 182 ? 83.008  28.223  67.709  1.00 73.66 ? 180 ASN C CG  1 
ATOM   5800  O OD1 . ASN C 1 182 ? 82.351  27.537  66.926  1.00 73.66 ? 180 ASN C OD1 1 
ATOM   5801  N ND2 . ASN C 1 182 ? 82.460  29.152  68.480  1.00 73.66 ? 180 ASN C ND2 1 
ATOM   5802  N N   . GLY C 1 183 ? 87.037  26.092  69.410  1.00 49.19 ? 181 GLY C N   1 
ATOM   5803  C CA  . GLY C 1 183 ? 88.469  25.861  69.379  1.00 49.19 ? 181 GLY C CA  1 
ATOM   5804  C C   . GLY C 1 183 ? 89.327  27.105  69.408  1.00 49.19 ? 181 GLY C C   1 
ATOM   5805  O O   . GLY C 1 183 ? 90.486  27.064  69.008  1.00 49.19 ? 181 GLY C O   1 
ATOM   5806  N N   . LEU C 1 184 ? 88.762  28.211  69.878  1.00 92.42 ? 182 LEU C N   1 
ATOM   5807  C CA  . LEU C 1 184 ? 89.496  29.471  69.978  1.00 92.42 ? 182 LEU C CA  1 
ATOM   5808  C C   . LEU C 1 184 ? 89.850  29.827  71.426  1.00 92.42 ? 182 LEU C C   1 
ATOM   5809  O O   . LEU C 1 184 ? 89.252  29.314  72.374  1.00 92.42 ? 182 LEU C O   1 
ATOM   5810  C CB  . LEU C 1 184 ? 88.684  30.620  69.379  1.00 47.30 ? 182 LEU C CB  1 
ATOM   5811  C CG  . LEU C 1 184 ? 88.452  30.640  67.872  1.00 47.30 ? 182 LEU C CG  1 
ATOM   5812  C CD1 . LEU C 1 184 ? 88.222  32.083  67.420  1.00 47.30 ? 182 LEU C CD1 1 
ATOM   5813  C CD2 . LEU C 1 184 ? 89.666  30.067  67.162  1.00 47.30 ? 182 LEU C CD2 1 
ATOM   5814  N N   . VAL C 1 185 ? 90.826  30.708  71.604  1.00 26.05 ? 183 VAL C N   1 
ATOM   5815  C CA  . VAL C 1 185 ? 91.197  31.103  72.947  1.00 26.05 ? 183 VAL C CA  1 
ATOM   5816  C C   . VAL C 1 185 ? 90.827  32.559  73.182  1.00 26.05 ? 183 VAL C C   1 
ATOM   5817  O O   . VAL C 1 185 ? 91.398  33.468  72.596  1.00 26.05 ? 183 VAL C O   1 
ATOM   5818  C CB  . VAL C 1 185 ? 92.686  30.894  73.198  1.00 36.34 ? 183 VAL C CB  1 
ATOM   5819  C CG1 . VAL C 1 185 ? 93.044  31.345  74.612  1.00 36.34 ? 183 VAL C CG1 1 
ATOM   5820  C CG2 . VAL C 1 185 ? 93.026  29.422  73.000  1.00 36.34 ? 183 VAL C CG2 1 
ATOM   5821  N N   . PRO C 1 186 ? 89.832  32.785  74.045  1.00 55.51 ? 184 PRO C N   1 
ATOM   5822  C CA  . PRO C 1 186 ? 89.334  34.110  74.396  1.00 54.93 ? 184 PRO C CA  1 
ATOM   5823  C C   . PRO C 1 186 ? 90.428  34.997  74.942  1.00 52.13 ? 184 PRO C C   1 
ATOM   5824  O O   . PRO C 1 186 ? 91.446  34.513  75.429  1.00 59.54 ? 184 PRO C O   1 
ATOM   5825  C CB  . PRO C 1 186 ? 88.289  33.812  75.468  1.00 35.42 ? 184 PRO C CB  1 
ATOM   5826  C CG  . PRO C 1 186 ? 87.814  32.444  75.129  1.00 38.39 ? 184 PRO C CG  1 
ATOM   5827  C CD  . PRO C 1 186 ? 89.093  31.741  74.777  1.00 40.66 ? 184 PRO C CD  1 
ATOM   5828  N N   . ILE C 1 187 ? 90.206  36.301  74.842  1.00 58.61 ? 185 ILE C N   1 
ATOM   5829  C CA  . ILE C 1 187 ? 91.121  37.291  75.386  1.00 51.47 ? 185 ILE C CA  1 
ATOM   5830  C C   . ILE C 1 187 ? 90.202  38.190  76.217  1.00 61.23 ? 185 ILE C C   1 
ATOM   5831  O O   . ILE C 1 187 ? 90.144  39.416  76.054  1.00 59.27 ? 185 ILE C O   1 
ATOM   5832  C CB  . ILE C 1 187 ? 91.871  38.069  74.271  1.00 22.54 ? 185 ILE C CB  1 
ATOM   5833  C CG1 . ILE C 1 187 ? 92.997  37.207  73.721  1.00 25.75 ? 185 ILE C CG1 1 
ATOM   5834  C CG2 . ILE C 1 187 ? 92.542  39.323  74.822  1.00 18.61 ? 185 ILE C CG2 1 
ATOM   5835  C CD1 . ILE C 1 187 ? 93.840  37.935  72.708  1.00 26.44 ? 185 ILE C CD1 1 
ATOM   5836  N N   . VAL C 1 188 ? 89.458  37.522  77.100  1.00 33.51 ? 186 VAL C N   1 
ATOM   5837  C CA  . VAL C 1 188 ? 88.510  38.158  78.013  1.00 31.56 ? 186 VAL C CA  1 
ATOM   5838  C C   . VAL C 1 188 ? 89.077  39.506  78.419  1.00 30.93 ? 186 VAL C C   1 
ATOM   5839  O O   . VAL C 1 188 ? 90.081  39.575  79.107  1.00 35.92 ? 186 VAL C O   1 
ATOM   5840  C CB  . VAL C 1 188 ? 88.268  37.245  79.255  1.00 24.45 ? 186 VAL C CB  1 
ATOM   5841  C CG1 . VAL C 1 188 ? 89.063  35.943  79.109  1.00 25.32 ? 186 VAL C CG1 1 
ATOM   5842  C CG2 . VAL C 1 188 ? 88.620  37.972  80.533  1.00 25.06 ? 186 VAL C CG2 1 
ATOM   5843  N N   . GLU C 1 189 ? 88.447  40.588  78.003  1.00 44.81 ? 187 GLU C N   1 
ATOM   5844  C CA  . GLU C 1 189 ? 89.028  41.874  78.315  1.00 46.70 ? 187 GLU C CA  1 
ATOM   5845  C C   . GLU C 1 189 ? 88.276  42.828  79.241  1.00 48.05 ? 187 GLU C C   1 
ATOM   5846  O O   . GLU C 1 189 ? 87.504  43.669  78.793  1.00 48.01 ? 187 GLU C O   1 
ATOM   5847  C CB  . GLU C 1 189 ? 89.348  42.576  77.006  1.00 31.21 ? 187 GLU C CB  1 
ATOM   5848  C CG  . GLU C 1 189 ? 90.075  43.883  77.172  1.00 33.06 ? 187 GLU C CG  1 
ATOM   5849  C CD  . GLU C 1 189 ? 90.176  44.645  75.860  1.00 53.29 ? 187 GLU C CD  1 
ATOM   5850  O OE1 . GLU C 1 189 ? 90.381  43.999  74.793  1.00 46.38 ? 187 GLU C OE1 1 
ATOM   5851  O OE2 . GLU C 1 189 ? 90.054  45.895  75.902  1.00 54.16 ? 187 GLU C OE2 1 
ATOM   5852  N N   . PRO C 1 190 ? 88.503  42.724  80.555  1.00 82.44 ? 188 PRO C N   1 
ATOM   5853  C CA  . PRO C 1 190 ? 87.787  43.647  81.438  1.00 82.44 ? 188 PRO C CA  1 
ATOM   5854  C C   . PRO C 1 190 ? 88.165  45.076  81.061  1.00 82.44 ? 188 PRO C C   1 
ATOM   5855  O O   . PRO C 1 190 ? 89.338  45.394  80.838  1.00 82.44 ? 188 PRO C O   1 
ATOM   5856  C CB  . PRO C 1 190 ? 88.280  43.247  82.820  1.00 92.42 ? 188 PRO C CB  1 
ATOM   5857  C CG  . PRO C 1 190 ? 89.684  42.778  82.540  1.00 92.42 ? 188 PRO C CG  1 
ATOM   5858  C CD  . PRO C 1 190 ? 89.487  41.931  81.308  1.00 92.42 ? 188 PRO C CD  1 
ATOM   5859  N N   . GLU C 1 191 ? 87.154  45.927  80.989  1.00 79.47 ? 189 GLU C N   1 
ATOM   5860  C CA  . GLU C 1 191 ? 87.319  47.322  80.602  1.00 79.47 ? 189 GLU C CA  1 
ATOM   5861  C C   . GLU C 1 191 ? 87.263  48.313  81.764  1.00 79.47 ? 189 GLU C C   1 
ATOM   5862  O O   . GLU C 1 191 ? 86.196  48.850  82.072  1.00 79.47 ? 189 GLU C O   1 
ATOM   5863  C CB  . GLU C 1 191 ? 86.230  47.675  79.584  1.00 92.42 ? 189 GLU C CB  1 
ATOM   5864  C CG  . GLU C 1 191 ? 85.032  46.701  79.591  1.00 92.42 ? 189 GLU C CG  1 
ATOM   5865  C CD  . GLU C 1 191 ? 84.273  46.638  80.932  1.00 92.42 ? 189 GLU C CD  1 
ATOM   5866  O OE1 . GLU C 1 191 ? 83.767  45.539  81.276  1.00 92.42 ? 189 GLU C OE1 1 
ATOM   5867  O OE2 . GLU C 1 191 ? 84.162  47.678  81.630  1.00 92.42 ? 189 GLU C OE2 1 
ATOM   5868  N N   . VAL C 1 192 ? 88.398  48.582  82.401  1.00 66.88 ? 190 VAL C N   1 
ATOM   5869  C CA  . VAL C 1 192 ? 88.384  49.521  83.517  1.00 65.37 ? 190 VAL C CA  1 
ATOM   5870  C C   . VAL C 1 192 ? 88.240  50.960  83.048  1.00 67.64 ? 190 VAL C C   1 
ATOM   5871  O O   . VAL C 1 192 ? 88.996  51.441  82.204  1.00 67.64 ? 190 VAL C O   1 
ATOM   5872  C CB  . VAL C 1 192 ? 89.626  49.366  84.390  1.00 49.75 ? 190 VAL C CB  1 
ATOM   5873  C CG1 . VAL C 1 192 ? 89.631  50.411  85.497  1.00 39.03 ? 190 VAL C CG1 1 
ATOM   5874  C CG2 . VAL C 1 192 ? 89.617  47.986  85.002  1.00 42.16 ? 190 VAL C CG2 1 
ATOM   5875  N N   . ILE C 1 193 ? 87.246  51.630  83.624  1.00 90.24 ? 191 ILE C N   1 
ATOM   5876  C CA  . ILE C 1 193 ? 86.889  53.008  83.299  1.00 90.24 ? 191 ILE C CA  1 
ATOM   5877  C C   . ILE C 1 193 ? 87.577  54.135  84.108  1.00 90.24 ? 191 ILE C C   1 
ATOM   5878  O O   . ILE C 1 193 ? 88.049  55.113  83.520  1.00 90.24 ? 191 ILE C O   1 
ATOM   5879  C CB  . ILE C 1 193 ? 85.333  53.183  83.405  1.00 92.42 ? 191 ILE C CB  1 
ATOM   5880  C CG1 . ILE C 1 193 ? 84.624  52.130  82.535  1.00 92.42 ? 191 ILE C CG1 1 
ATOM   5881  C CG2 . ILE C 1 193 ? 84.923  54.591  82.976  1.00 92.42 ? 191 ILE C CG2 1 
ATOM   5882  C CD1 . ILE C 1 193 ? 83.101  52.131  82.658  1.00 92.42 ? 191 ILE C CD1 1 
ATOM   5883  N N   . PRO C 1 194 ? 87.660  54.001  85.454  1.00 92.42 ? 192 PRO C N   1 
ATOM   5884  C CA  . PRO C 1 194 ? 88.271  54.981  86.374  1.00 92.42 ? 192 PRO C CA  1 
ATOM   5885  C C   . PRO C 1 194 ? 89.234  56.012  85.788  1.00 92.42 ? 192 PRO C C   1 
ATOM   5886  O O   . PRO C 1 194 ? 89.489  57.048  86.408  1.00 92.42 ? 192 PRO C O   1 
ATOM   5887  C CB  . PRO C 1 194 ? 88.946  54.093  87.413  1.00 92.42 ? 192 PRO C CB  1 
ATOM   5888  C CG  . PRO C 1 194 ? 87.938  53.017  87.581  1.00 92.42 ? 192 PRO C CG  1 
ATOM   5889  C CD  . PRO C 1 194 ? 87.494  52.705  86.146  1.00 92.42 ? 192 PRO C CD  1 
ATOM   5890  N N   . ASP C 1 199 ? 92.687  58.076  93.102  1.00 85.45 ? 197 ASP C N   1 
ATOM   5891  C CA  . ASP C 1 199 ? 94.077  57.993  92.663  1.00 85.45 ? 197 ASP C CA  1 
ATOM   5892  C C   . ASP C 1 199 ? 94.429  56.577  92.213  1.00 85.45 ? 197 ASP C C   1 
ATOM   5893  O O   . ASP C 1 199 ? 93.557  55.816  91.786  1.00 85.45 ? 197 ASP C O   1 
ATOM   5894  C CB  . ASP C 1 199 ? 95.017  58.409  93.801  1.00 92.42 ? 197 ASP C CB  1 
ATOM   5895  C CG  . ASP C 1 199 ? 95.163  57.332  94.873  1.00 92.42 ? 197 ASP C CG  1 
ATOM   5896  O OD1 . ASP C 1 199 ? 94.144  56.955  95.498  1.00 92.42 ? 197 ASP C OD1 1 
ATOM   5897  O OD2 . ASP C 1 199 ? 96.307  56.867  95.086  1.00 92.42 ? 197 ASP C OD2 1 
ATOM   5898  N N   . LEU C 1 200 ? 95.711  56.231  92.304  1.00 49.54 ? 198 LEU C N   1 
ATOM   5899  C CA  . LEU C 1 200 ? 96.157  54.900  91.921  1.00 51.75 ? 198 LEU C CA  1 
ATOM   5900  C C   . LEU C 1 200 ? 95.283  53.946  92.714  1.00 51.34 ? 198 LEU C C   1 
ATOM   5901  O O   . LEU C 1 200 ? 94.643  53.058  92.154  1.00 50.14 ? 198 LEU C O   1 
ATOM   5902  C CB  . LEU C 1 200 ? 97.624  54.696  92.295  1.00 63.62 ? 198 LEU C CB  1 
ATOM   5903  C CG  . LEU C 1 200 ? 98.423  53.815  91.335  1.00 67.20 ? 198 LEU C CG  1 
ATOM   5904  C CD1 . LEU C 1 200 ? 98.551  54.542  90.016  1.00 56.00 ? 198 LEU C CD1 1 
ATOM   5905  C CD2 . LEU C 1 200 ? 99.802  53.519  91.889  1.00 57.53 ? 198 LEU C CD2 1 
ATOM   5906  N N   . GLU C 1 201 ? 95.249  54.165  94.025  1.00 84.46 ? 199 GLU C N   1 
ATOM   5907  C CA  . GLU C 1 201 ? 94.450  53.361  94.944  1.00 84.46 ? 199 GLU C CA  1 
ATOM   5908  C C   . GLU C 1 201 ? 93.049  53.174  94.373  1.00 84.46 ? 199 GLU C C   1 
ATOM   5909  O O   . GLU C 1 201 ? 92.506  52.071  94.375  1.00 84.46 ? 199 GLU C O   1 
ATOM   5910  C CB  . GLU C 1 201 ? 94.380  54.064  96.306  1.00 92.42 ? 199 GLU C CB  1 
ATOM   5911  C CG  . GLU C 1 201 ? 93.502  53.379  97.356  1.00 92.42 ? 199 GLU C CG  1 
ATOM   5912  C CD  . GLU C 1 201 ? 93.556  54.074  98.723  1.00 92.42 ? 199 GLU C CD  1 
ATOM   5913  O OE1 . GLU C 1 201 ? 93.353  55.308  98.770  1.00 92.42 ? 199 GLU C OE1 1 
ATOM   5914  O OE2 . GLU C 1 201 ? 93.796  53.386  99.748  1.00 92.42 ? 199 GLU C OE2 1 
ATOM   5915  N N   . HIS C 1 202 ? 92.475  54.261  93.871  1.00 65.74 ? 200 HIS C N   1 
ATOM   5916  C CA  . HIS C 1 202 ? 91.139  54.233  93.288  1.00 66.28 ? 200 HIS C CA  1 
ATOM   5917  C C   . HIS C 1 202 ? 91.108  53.279  92.099  1.00 68.98 ? 200 HIS C C   1 
ATOM   5918  O O   . HIS C 1 202 ? 90.419  52.257  92.137  1.00 68.90 ? 200 HIS C O   1 
ATOM   5919  C CB  . HIS C 1 202 ? 90.747  55.642  92.829  1.00 61.00 ? 200 HIS C CB  1 
ATOM   5920  C CG  . HIS C 1 202 ? 89.275  55.838  92.635  1.00 78.99 ? 200 HIS C CG  1 
ATOM   5921  N ND1 . HIS C 1 202 ? 88.524  55.072  91.770  1.00 78.99 ? 200 HIS C ND1 1 
ATOM   5922  C CD2 . HIS C 1 202 ? 88.418  56.731  93.186  1.00 78.99 ? 200 HIS C CD2 1 
ATOM   5923  C CE1 . HIS C 1 202 ? 87.269  55.484  91.797  1.00 68.00 ? 200 HIS C CE1 1 
ATOM   5924  N NE2 . HIS C 1 202 ? 87.179  56.490  92.648  1.00 78.99 ? 200 HIS C NE2 1 
ATOM   5925  N N   . CYS C 1 203 ? 91.865  53.620  91.055  1.00 70.15 ? 201 CYS C N   1 
ATOM   5926  C CA  . CYS C 1 203 ? 91.919  52.809  89.843  1.00 66.17 ? 201 CYS C CA  1 
ATOM   5927  C C   . CYS C 1 203 ? 92.318  51.377  90.164  1.00 63.82 ? 201 CYS C C   1 
ATOM   5928  O O   . CYS C 1 203 ? 92.190  50.487  89.320  1.00 69.74 ? 201 CYS C O   1 
ATOM   5929  C CB  . CYS C 1 203 ? 92.905  53.406  88.825  1.00 58.93 ? 201 CYS C CB  1 
ATOM   5930  S SG  . CYS C 1 203 ? 92.950  52.564  87.184  1.00 63.11 ? 201 CYS C SG  1 
ATOM   5931  N N   . GLN C 1 204 ? 92.799  51.151  91.382  1.00 49.79 ? 202 GLN C N   1 
ATOM   5932  C CA  . GLN C 1 204 ? 93.200  49.812  91.776  1.00 49.79 ? 202 GLN C CA  1 
ATOM   5933  C C   . GLN C 1 204 ? 92.058  49.102  92.488  1.00 49.79 ? 202 GLN C C   1 
ATOM   5934  O O   . GLN C 1 204 ? 91.816  47.915  92.257  1.00 49.79 ? 202 GLN C O   1 
ATOM   5935  C CB  . GLN C 1 204 ? 94.428  49.856  92.684  1.00 52.92 ? 202 GLN C CB  1 
ATOM   5936  C CG  . GLN C 1 204 ? 94.880  48.477  93.128  1.00 52.92 ? 202 GLN C CG  1 
ATOM   5937  C CD  . GLN C 1 204 ? 95.902  48.522  94.240  1.00 52.92 ? 202 GLN C CD  1 
ATOM   5938  O OE1 . GLN C 1 204 ? 97.037  48.945  94.035  1.00 52.92 ? 202 GLN C OE1 1 
ATOM   5939  N NE2 . GLN C 1 204 ? 95.502  48.087  95.434  1.00 52.92 ? 202 GLN C NE2 1 
ATOM   5940  N N   . TYR C 1 205 ? 91.355  49.822  93.358  1.00 72.96 ? 203 TYR C N   1 
ATOM   5941  C CA  . TYR C 1 205 ? 90.238  49.218  94.076  1.00 72.96 ? 203 TYR C CA  1 
ATOM   5942  C C   . TYR C 1 205 ? 89.257  48.746  93.029  1.00 72.96 ? 203 TYR C C   1 
ATOM   5943  O O   . TYR C 1 205 ? 88.785  47.607  93.050  1.00 72.96 ? 203 TYR C O   1 
ATOM   5944  C CB  . TYR C 1 205 ? 89.553  50.230  94.997  1.00 80.31 ? 203 TYR C CB  1 
ATOM   5945  C CG  . TYR C 1 205 ? 88.207  49.752  95.498  1.00 80.31 ? 203 TYR C CG  1 
ATOM   5946  C CD1 . TYR C 1 205 ? 88.042  48.448  95.974  1.00 80.31 ? 203 TYR C CD1 1 
ATOM   5947  C CD2 . TYR C 1 205 ? 87.088  50.589  95.462  1.00 80.31 ? 203 TYR C CD2 1 
ATOM   5948  C CE1 . TYR C 1 205 ? 86.800  47.987  96.392  1.00 80.31 ? 203 TYR C CE1 1 
ATOM   5949  C CE2 . TYR C 1 205 ? 85.842  50.139  95.879  1.00 80.31 ? 203 TYR C CE2 1 
ATOM   5950  C CZ  . TYR C 1 205 ? 85.709  48.837  96.341  1.00 80.31 ? 203 TYR C CZ  1 
ATOM   5951  O OH  . TYR C 1 205 ? 84.484  48.378  96.746  1.00 80.31 ? 203 TYR C OH  1 
ATOM   5952  N N   . VAL C 1 206 ? 88.974  49.645  92.099  1.00 66.01 ? 204 VAL C N   1 
ATOM   5953  C CA  . VAL C 1 206 ? 88.058  49.367  91.011  1.00 66.01 ? 204 VAL C CA  1 
ATOM   5954  C C   . VAL C 1 206 ? 88.491  48.123  90.227  1.00 66.01 ? 204 VAL C C   1 
ATOM   5955  O O   . VAL C 1 206 ? 87.814  47.090  90.240  1.00 66.01 ? 204 VAL C O   1 
ATOM   5956  C CB  . VAL C 1 206 ? 87.997  50.567  90.051  1.00 17.48 ? 204 VAL C CB  1 
ATOM   5957  C CG1 . VAL C 1 206 ? 86.823  50.404  89.101  1.00 17.48 ? 204 VAL C CG1 1 
ATOM   5958  C CG2 . VAL C 1 206 ? 87.912  51.863  90.846  1.00 17.48 ? 204 VAL C CG2 1 
ATOM   5959  N N   . THR C 1 207 ? 89.626  48.243  89.546  1.00 50.24 ? 205 THR C N   1 
ATOM   5960  C CA  . THR C 1 207 ? 90.182  47.162  88.747  1.00 50.24 ? 205 THR C CA  1 
ATOM   5961  C C   . THR C 1 207 ? 90.000  45.809  89.443  1.00 50.24 ? 205 THR C C   1 
ATOM   5962  O O   . THR C 1 207 ? 89.755  44.794  88.787  1.00 50.24 ? 205 THR C O   1 
ATOM   5963  C CB  . THR C 1 207 ? 91.707  47.404  88.465  1.00 40.80 ? 205 THR C CB  1 
ATOM   5964  O OG1 . THR C 1 207 ? 91.880  48.566  87.635  1.00 40.80 ? 205 THR C OG1 1 
ATOM   5965  C CG2 . THR C 1 207 ? 92.323  46.195  87.768  1.00 40.80 ? 205 THR C CG2 1 
ATOM   5966  N N   . GLU C 1 208 ? 90.113  45.803  90.770  1.00 65.00 ? 206 GLU C N   1 
ATOM   5967  C CA  . GLU C 1 208 ? 89.981  44.568  91.530  1.00 65.00 ? 206 GLU C CA  1 
ATOM   5968  C C   . GLU C 1 208 ? 88.568  44.033  91.512  1.00 65.00 ? 206 GLU C C   1 
ATOM   5969  O O   . GLU C 1 208 ? 88.360  42.855  91.248  1.00 65.00 ? 206 GLU C O   1 
ATOM   5970  C CB  . GLU C 1 208 ? 90.453  44.773  92.972  1.00 92.24 ? 206 GLU C CB  1 
ATOM   5971  C CG  . GLU C 1 208 ? 91.962  44.949  93.079  1.00 92.24 ? 206 GLU C CG  1 
ATOM   5972  C CD  . GLU C 1 208 ? 92.444  45.153  94.502  1.00 92.24 ? 206 GLU C CD  1 
ATOM   5973  O OE1 . GLU C 1 208 ? 91.996  46.132  95.138  1.00 92.24 ? 206 GLU C OE1 1 
ATOM   5974  O OE2 . GLU C 1 208 ? 93.275  44.339  94.978  1.00 92.24 ? 206 GLU C OE2 1 
ATOM   5975  N N   . LYS C 1 209 ? 87.593  44.892  91.790  1.00 48.28 ? 207 LYS C N   1 
ATOM   5976  C CA  . LYS C 1 209 ? 86.195  44.469  91.786  1.00 48.28 ? 207 LYS C CA  1 
ATOM   5977  C C   . LYS C 1 209 ? 85.836  43.904  90.421  1.00 48.28 ? 207 LYS C C   1 
ATOM   5978  O O   . LYS C 1 209 ? 85.317  42.801  90.292  1.00 48.28 ? 207 LYS C O   1 
ATOM   5979  C CB  . LYS C 1 209 ? 85.279  45.648  92.104  1.00 71.59 ? 207 LYS C CB  1 
ATOM   5980  C CG  . LYS C 1 209 ? 85.267  46.045  93.567  1.00 71.59 ? 207 LYS C CG  1 
ATOM   5981  C CD  . LYS C 1 209 ? 83.929  46.667  93.936  1.00 71.59 ? 207 LYS C CD  1 
ATOM   5982  C CE  . LYS C 1 209 ? 82.779  45.676  93.741  1.00 71.59 ? 207 LYS C CE  1 
ATOM   5983  N NZ  . LYS C 1 209 ? 81.444  46.301  93.947  1.00 71.59 ? 207 LYS C NZ  1 
ATOM   5984  N N   . VAL C 1 210 ? 86.129  44.688  89.402  1.00 16.65 ? 208 VAL C N   1 
ATOM   5985  C CA  . VAL C 1 210 ? 85.873  44.317  88.023  1.00 16.65 ? 208 VAL C CA  1 
ATOM   5986  C C   . VAL C 1 210 ? 86.523  42.986  87.620  1.00 16.65 ? 208 VAL C C   1 
ATOM   5987  O O   . VAL C 1 210 ? 85.913  42.173  86.927  1.00 16.65 ? 208 VAL C O   1 
ATOM   5988  C CB  . VAL C 1 210 ? 86.399  45.426  87.104  1.00 1.62  ? 208 VAL C CB  1 
ATOM   5989  C CG1 . VAL C 1 210 ? 86.137  45.082  85.645  1.00 1.62  ? 208 VAL C CG1 1 
ATOM   5990  C CG2 . VAL C 1 210 ? 85.787  46.766  87.522  1.00 1.62  ? 208 VAL C CG2 1 
ATOM   5991  N N   . LEU C 1 211 ? 87.768  42.772  88.033  1.00 43.97 ? 209 LEU C N   1 
ATOM   5992  C CA  . LEU C 1 211 ? 88.454  41.534  87.692  1.00 43.97 ? 209 LEU C CA  1 
ATOM   5993  C C   . LEU C 1 211 ? 87.793  40.355  88.391  1.00 43.97 ? 209 LEU C C   1 
ATOM   5994  O O   . LEU C 1 211 ? 87.715  39.270  87.826  1.00 43.97 ? 209 LEU C O   1 
ATOM   5995  C CB  . LEU C 1 211 ? 89.945  41.614  88.056  1.00 38.36 ? 209 LEU C CB  1 
ATOM   5996  C CG  . LEU C 1 211 ? 90.795  42.556  87.193  1.00 38.36 ? 209 LEU C CG  1 
ATOM   5997  C CD1 . LEU C 1 211 ? 92.294  42.351  87.431  1.00 38.36 ? 209 LEU C CD1 1 
ATOM   5998  C CD2 . LEU C 1 211 ? 90.493  42.263  85.752  1.00 38.36 ? 209 LEU C CD2 1 
ATOM   5999  N N   . ALA C 1 212 ? 87.312  40.576  89.613  1.00 69.45 ? 210 ALA C N   1 
ATOM   6000  C CA  . ALA C 1 212 ? 86.634  39.531  90.379  1.00 69.45 ? 210 ALA C CA  1 
ATOM   6001  C C   . ALA C 1 212 ? 85.335  39.209  89.665  1.00 69.45 ? 210 ALA C C   1 
ATOM   6002  O O   . ALA C 1 212 ? 85.063  38.057  89.318  1.00 69.45 ? 210 ALA C O   1 
ATOM   6003  C CB  . ALA C 1 212 ? 86.330  40.016  91.784  1.00 1.62  ? 210 ALA C CB  1 
ATOM   6004  N N   . ALA C 1 213 ? 84.535  40.249  89.459  1.00 45.76 ? 211 ALA C N   1 
ATOM   6005  C CA  . ALA C 1 213 ? 83.258  40.123  88.780  1.00 45.76 ? 211 ALA C CA  1 
ATOM   6006  C C   . ALA C 1 213 ? 83.464  39.233  87.576  1.00 45.76 ? 211 ALA C C   1 
ATOM   6007  O O   . ALA C 1 213 ? 82.717  38.279  87.360  1.00 45.76 ? 211 ALA C O   1 
ATOM   6008  C CB  . ALA C 1 213 ? 82.770  41.487  88.338  1.00 46.98 ? 211 ALA C CB  1 
ATOM   6009  N N   . VAL C 1 214 ? 84.501  39.543  86.805  1.00 36.99 ? 212 VAL C N   1 
ATOM   6010  C CA  . VAL C 1 214 ? 84.814  38.778  85.612  1.00 36.99 ? 212 VAL C CA  1 
ATOM   6011  C C   . VAL C 1 214 ? 85.225  37.336  85.925  1.00 36.99 ? 212 VAL C C   1 
ATOM   6012  O O   . VAL C 1 214 ? 84.544  36.395  85.536  1.00 36.99 ? 212 VAL C O   1 
ATOM   6013  C CB  . VAL C 1 214 ? 85.936  39.455  84.783  1.00 27.51 ? 212 VAL C CB  1 
ATOM   6014  C CG1 . VAL C 1 214 ? 86.289  38.584  83.595  1.00 27.51 ? 212 VAL C CG1 1 
ATOM   6015  C CG2 . VAL C 1 214 ? 85.491  40.825  84.304  1.00 27.51 ? 212 VAL C CG2 1 
ATOM   6016  N N   . TYR C 1 215 ? 86.327  37.146  86.634  1.00 52.17 ? 213 TYR C N   1 
ATOM   6017  C CA  . TYR C 1 215 ? 86.757  35.783  86.912  1.00 52.17 ? 213 TYR C CA  1 
ATOM   6018  C C   . TYR C 1 215 ? 85.750  34.962  87.697  1.00 52.17 ? 213 TYR C C   1 
ATOM   6019  O O   . TYR C 1 215 ? 85.838  33.733  87.727  1.00 52.17 ? 213 TYR C O   1 
ATOM   6020  C CB  . TYR C 1 215 ? 88.152  35.785  87.566  1.00 24.30 ? 213 TYR C CB  1 
ATOM   6021  C CG  . TYR C 1 215 ? 89.231  36.018  86.527  1.00 24.30 ? 213 TYR C CG  1 
ATOM   6022  C CD1 . TYR C 1 215 ? 89.650  34.979  85.685  1.00 24.30 ? 213 TYR C CD1 1 
ATOM   6023  C CD2 . TYR C 1 215 ? 89.713  37.308  86.278  1.00 24.30 ? 213 TYR C CD2 1 
ATOM   6024  C CE1 . TYR C 1 215 ? 90.504  35.228  84.619  1.00 24.30 ? 213 TYR C CE1 1 
ATOM   6025  C CE2 . TYR C 1 215 ? 90.565  37.572  85.218  1.00 24.30 ? 213 TYR C CE2 1 
ATOM   6026  C CZ  . TYR C 1 215 ? 90.956  36.539  84.385  1.00 24.30 ? 213 TYR C CZ  1 
ATOM   6027  O OH  . TYR C 1 215 ? 91.763  36.826  83.293  1.00 24.30 ? 213 TYR C OH  1 
ATOM   6028  N N   . LYS C 1 216 ? 84.785  35.634  88.318  1.00 71.59 ? 214 LYS C N   1 
ATOM   6029  C CA  . LYS C 1 216 ? 83.741  34.923  89.051  1.00 71.59 ? 214 LYS C CA  1 
ATOM   6030  C C   . LYS C 1 216 ? 82.754  34.457  87.993  1.00 71.59 ? 214 LYS C C   1 
ATOM   6031  O O   . LYS C 1 216 ? 82.388  33.279  87.931  1.00 71.59 ? 214 LYS C O   1 
ATOM   6032  C CB  . LYS C 1 216 ? 83.025  35.845  90.043  1.00 69.23 ? 214 LYS C CB  1 
ATOM   6033  C CG  . LYS C 1 216 ? 81.669  35.302  90.518  1.00 69.23 ? 214 LYS C CG  1 
ATOM   6034  C CD  . LYS C 1 216 ? 81.799  33.985  91.281  1.00 69.23 ? 214 LYS C CD  1 
ATOM   6035  C CE  . LYS C 1 216 ? 80.493  33.180  91.285  1.00 69.23 ? 214 LYS C CE  1 
ATOM   6036  N NZ  . LYS C 1 216 ? 79.318  33.912  91.822  1.00 69.23 ? 214 LYS C NZ  1 
ATOM   6037  N N   . ALA C 1 217 ? 82.330  35.406  87.163  1.00 61.86 ? 215 ALA C N   1 
ATOM   6038  C CA  . ALA C 1 217 ? 81.407  35.118  86.076  1.00 61.86 ? 215 ALA C CA  1 
ATOM   6039  C C   . ALA C 1 217 ? 81.935  33.885  85.346  1.00 61.86 ? 215 ALA C C   1 
ATOM   6040  O O   . ALA C 1 217 ? 81.284  32.844  85.324  1.00 61.86 ? 215 ALA C O   1 
ATOM   6041  C CB  . ALA C 1 217 ? 81.330  36.325  85.105  1.00 2.89  ? 215 ALA C CB  1 
ATOM   6042  N N   . LEU C 1 218 ? 83.131  34.020  84.778  1.00 51.00 ? 216 LEU C N   1 
ATOM   6043  C CA  . LEU C 1 218 ? 83.782  32.958  84.026  1.00 51.00 ? 216 LEU C CA  1 
ATOM   6044  C C   . LEU C 1 218 ? 83.696  31.595  84.702  1.00 51.00 ? 216 LEU C C   1 
ATOM   6045  O O   . LEU C 1 218 ? 83.603  30.567  84.020  1.00 51.00 ? 216 LEU C O   1 
ATOM   6046  C CB  . LEU C 1 218 ? 85.244  33.329  83.777  1.00 37.55 ? 216 LEU C CB  1 
ATOM   6047  C CG  . LEU C 1 218 ? 85.434  34.515  82.833  1.00 37.55 ? 216 LEU C CG  1 
ATOM   6048  C CD1 . LEU C 1 218 ? 86.597  35.375  83.278  1.00 37.55 ? 216 LEU C CD1 1 
ATOM   6049  C CD2 . LEU C 1 218 ? 85.645  34.000  81.431  1.00 37.55 ? 216 LEU C CD2 1 
ATOM   6050  N N   . ASN C 1 219 ? 83.731  31.571  86.034  1.00 76.34 ? 217 ASN C N   1 
ATOM   6051  C CA  . ASN C 1 219 ? 83.643  30.297  86.739  1.00 76.34 ? 217 ASN C CA  1 
ATOM   6052  C C   . ASN C 1 219 ? 82.215  29.775  86.673  1.00 76.34 ? 217 ASN C C   1 
ATOM   6053  O O   . ASN C 1 219 ? 81.999  28.584  86.478  1.00 76.34 ? 217 ASN C O   1 
ATOM   6054  C CB  . ASN C 1 219 ? 84.064  30.432  88.200  1.00 63.02 ? 217 ASN C CB  1 
ATOM   6055  C CG  . ASN C 1 219 ? 84.086  29.094  88.916  1.00 63.02 ? 217 ASN C CG  1 
ATOM   6056  O OD1 . ASN C 1 219 ? 83.113  28.341  88.882  1.00 63.02 ? 217 ASN C OD1 1 
ATOM   6057  N ND2 . ASN C 1 219 ? 85.200  28.790  89.570  1.00 63.02 ? 217 ASN C ND2 1 
ATOM   6058  N N   . ASP C 1 220 ? 81.242  30.664  86.841  1.00 73.87 ? 218 ASP C N   1 
ATOM   6059  C CA  . ASP C 1 220 ? 79.842  30.262  86.772  1.00 73.87 ? 218 ASP C CA  1 
ATOM   6060  C C   . ASP C 1 220 ? 79.553  29.664  85.397  1.00 73.87 ? 218 ASP C C   1 
ATOM   6061  O O   . ASP C 1 220 ? 78.739  28.750  85.271  1.00 73.87 ? 218 ASP C O   1 
ATOM   6062  C CB  . ASP C 1 220 ? 78.909  31.461  86.978  1.00 49.17 ? 218 ASP C CB  1 
ATOM   6063  C CG  . ASP C 1 220 ? 79.074  32.105  88.331  1.00 49.17 ? 218 ASP C CG  1 
ATOM   6064  O OD1 . ASP C 1 220 ? 79.295  31.364  89.310  1.00 49.17 ? 218 ASP C OD1 1 
ATOM   6065  O OD2 . ASP C 1 220 ? 78.964  33.351  88.412  1.00 49.17 ? 218 ASP C OD2 1 
ATOM   6066  N N   . HIS C 1 221 ? 80.222  30.189  84.370  1.00 37.76 ? 219 HIS C N   1 
ATOM   6067  C CA  . HIS C 1 221 ? 80.026  29.738  82.992  1.00 37.76 ? 219 HIS C CA  1 
ATOM   6068  C C   . HIS C 1 221 ? 80.972  28.619  82.591  1.00 37.76 ? 219 HIS C C   1 
ATOM   6069  O O   . HIS C 1 221 ? 81.196  28.375  81.408  1.00 37.76 ? 219 HIS C O   1 
ATOM   6070  C CB  . HIS C 1 221 ? 80.185  30.913  82.023  1.00 64.84 ? 219 HIS C CB  1 
ATOM   6071  C CG  . HIS C 1 221 ? 79.226  32.036  82.269  1.00 64.84 ? 219 HIS C CG  1 
ATOM   6072  N ND1 . HIS C 1 221 ? 78.397  32.532  81.288  1.00 64.84 ? 219 HIS C ND1 1 
ATOM   6073  C CD2 . HIS C 1 221 ? 78.984  32.778  83.377  1.00 64.84 ? 219 HIS C CD2 1 
ATOM   6074  C CE1 . HIS C 1 221 ? 77.687  33.533  81.779  1.00 64.84 ? 219 HIS C CE1 1 
ATOM   6075  N NE2 . HIS C 1 221 ? 78.024  33.703  83.045  1.00 64.84 ? 219 HIS C NE2 1 
ATOM   6076  N N   . HIS C 1 222 ? 81.539  27.953  83.586  1.00 41.96 ? 220 HIS C N   1 
ATOM   6077  C CA  . HIS C 1 222 ? 82.444  26.841  83.352  1.00 41.96 ? 220 HIS C CA  1 
ATOM   6078  C C   . HIS C 1 222 ? 83.437  27.108  82.234  1.00 41.96 ? 220 HIS C C   1 
ATOM   6079  O O   . HIS C 1 222 ? 83.698  26.236  81.406  1.00 41.96 ? 220 HIS C O   1 
ATOM   6080  C CB  . HIS C 1 222 ? 81.634  25.601  83.017  1.00 53.85 ? 220 HIS C CB  1 
ATOM   6081  C CG  . HIS C 1 222 ? 82.362  24.324  83.270  1.00 53.85 ? 220 HIS C CG  1 
ATOM   6082  N ND1 . HIS C 1 222 ? 82.901  24.012  84.499  1.00 53.85 ? 220 HIS C ND1 1 
ATOM   6083  C CD2 . HIS C 1 222 ? 82.609  23.263  82.467  1.00 53.85 ? 220 HIS C CD2 1 
ATOM   6084  C CE1 . HIS C 1 222 ? 83.447  22.811  84.444  1.00 53.85 ? 220 HIS C CE1 1 
ATOM   6085  N NE2 . HIS C 1 222 ? 83.283  22.334  83.223  1.00 53.85 ? 220 HIS C NE2 1 
ATOM   6086  N N   . VAL C 1 223 ? 83.987  28.314  82.198  1.00 35.29 ? 221 VAL C N   1 
ATOM   6087  C CA  . VAL C 1 223 ? 84.959  28.660  81.174  1.00 35.29 ? 221 VAL C CA  1 
ATOM   6088  C C   . VAL C 1 223 ? 86.175  27.783  81.423  1.00 35.29 ? 221 VAL C C   1 
ATOM   6089  O O   . VAL C 1 223 ? 86.242  27.082  82.427  1.00 35.29 ? 221 VAL C O   1 
ATOM   6090  C CB  . VAL C 1 223 ? 85.370  30.144  81.285  1.00 49.92 ? 221 VAL C CB  1 
ATOM   6091  C CG1 . VAL C 1 223 ? 86.389  30.494  80.219  1.00 49.92 ? 221 VAL C CG1 1 
ATOM   6092  C CG2 . VAL C 1 223 ? 84.151  31.023  81.133  1.00 49.92 ? 221 VAL C CG2 1 
ATOM   6093  N N   . TYR C 1 224 ? 87.134  27.802  80.512  1.00 61.14 ? 222 TYR C N   1 
ATOM   6094  C CA  . TYR C 1 224 ? 88.334  27.011  80.710  1.00 61.14 ? 222 TYR C CA  1 
ATOM   6095  C C   . TYR C 1 224 ? 89.507  27.958  80.908  1.00 61.14 ? 222 TYR C C   1 
ATOM   6096  O O   . TYR C 1 224 ? 90.270  28.225  79.982  1.00 61.14 ? 222 TYR C O   1 
ATOM   6097  C CB  . TYR C 1 224 ? 88.590  26.112  79.508  1.00 65.86 ? 222 TYR C CB  1 
ATOM   6098  C CG  . TYR C 1 224 ? 89.798  25.217  79.660  1.00 65.86 ? 222 TYR C CG  1 
ATOM   6099  C CD1 . TYR C 1 224 ? 89.770  24.119  80.508  1.00 65.86 ? 222 TYR C CD1 1 
ATOM   6100  C CD2 . TYR C 1 224 ? 90.965  25.471  78.949  1.00 65.86 ? 222 TYR C CD2 1 
ATOM   6101  C CE1 . TYR C 1 224 ? 90.872  23.295  80.642  1.00 65.86 ? 222 TYR C CE1 1 
ATOM   6102  C CE2 . TYR C 1 224 ? 92.071  24.657  79.076  1.00 65.86 ? 222 TYR C CE2 1 
ATOM   6103  C CZ  . TYR C 1 224 ? 92.020  23.570  79.924  1.00 65.86 ? 222 TYR C CZ  1 
ATOM   6104  O OH  . TYR C 1 224 ? 93.123  22.757  80.058  1.00 65.86 ? 222 TYR C OH  1 
ATOM   6105  N N   . LEU C 1 225 ? 89.628  28.475  82.125  1.00 68.69 ? 223 LEU C N   1 
ATOM   6106  C CA  . LEU C 1 225 ? 90.696  29.397  82.488  1.00 68.69 ? 223 LEU C CA  1 
ATOM   6107  C C   . LEU C 1 225 ? 92.035  28.995  81.884  1.00 68.69 ? 223 LEU C C   1 
ATOM   6108  O O   . LEU C 1 225 ? 92.709  29.814  81.259  1.00 68.69 ? 223 LEU C O   1 
ATOM   6109  C CB  . LEU C 1 225 ? 90.811  29.465  84.009  1.00 45.55 ? 223 LEU C CB  1 
ATOM   6110  C CG  . LEU C 1 225 ? 89.597  30.097  84.691  1.00 45.55 ? 223 LEU C CG  1 
ATOM   6111  C CD1 . LEU C 1 225 ? 89.429  29.489  86.075  1.00 45.55 ? 223 LEU C CD1 1 
ATOM   6112  C CD2 . LEU C 1 225 ? 89.748  31.633  84.740  1.00 45.55 ? 223 LEU C CD2 1 
ATOM   6113  N N   . GLU C 1 226 ? 92.413  27.731  82.072  1.00 60.54 ? 224 GLU C N   1 
ATOM   6114  C CA  . GLU C 1 226 ? 93.673  27.227  81.546  1.00 60.54 ? 224 GLU C CA  1 
ATOM   6115  C C   . GLU C 1 226 ? 93.867  27.587  80.080  1.00 60.54 ? 224 GLU C C   1 
ATOM   6116  O O   . GLU C 1 226 ? 95.005  27.721  79.619  1.00 60.54 ? 224 GLU C O   1 
ATOM   6117  C CB  . GLU C 1 226 ? 93.765  25.711  81.716  1.00 47.47 ? 224 GLU C CB  1 
ATOM   6118  C CG  . GLU C 1 226 ? 94.250  25.272  83.075  1.00 47.47 ? 224 GLU C CG  1 
ATOM   6119  C CD  . GLU C 1 226 ? 93.127  25.080  84.067  1.00 47.47 ? 224 GLU C CD  1 
ATOM   6120  O OE1 . GLU C 1 226 ? 92.257  25.972  84.179  1.00 47.47 ? 224 GLU C OE1 1 
ATOM   6121  O OE2 . GLU C 1 226 ? 93.117  24.031  84.746  1.00 47.47 ? 224 GLU C OE2 1 
ATOM   6122  N N   . GLY C 1 227 ? 92.759  27.742  79.354  1.00 69.62 ? 225 GLY C N   1 
ATOM   6123  C CA  . GLY C 1 227 ? 92.820  28.089  77.939  1.00 59.21 ? 225 GLY C CA  1 
ATOM   6124  C C   . GLY C 1 227 ? 92.331  29.505  77.709  1.00 70.82 ? 225 GLY C C   1 
ATOM   6125  O O   . GLY C 1 227 ? 91.705  29.806  76.698  1.00 73.25 ? 225 GLY C O   1 
ATOM   6126  N N   . THR C 1 228 ? 92.650  30.379  78.655  1.00 43.94 ? 226 THR C N   1 
ATOM   6127  C CA  . THR C 1 228 ? 92.227  31.768  78.625  1.00 44.27 ? 226 THR C CA  1 
ATOM   6128  C C   . THR C 1 228 ? 93.443  32.679  78.471  1.00 46.34 ? 226 THR C C   1 
ATOM   6129  O O   . THR C 1 228 ? 94.557  32.202  78.269  1.00 45.09 ? 226 THR C O   1 
ATOM   6130  C CB  . THR C 1 228 ? 91.479  32.085  79.955  1.00 37.26 ? 226 THR C CB  1 
ATOM   6131  O OG1 . THR C 1 228 ? 90.409  31.146  80.125  1.00 51.58 ? 226 THR C OG1 1 
ATOM   6132  C CG2 . THR C 1 228 ? 90.914  33.496  79.968  1.00 31.92 ? 226 THR C CG2 1 
ATOM   6133  N N   . LEU C 1 229 ? 93.205  33.986  78.561  1.00 20.77 ? 227 LEU C N   1 
ATOM   6134  C CA  . LEU C 1 229 ? 94.229  35.023  78.483  1.00 25.85 ? 227 LEU C CA  1 
ATOM   6135  C C   . LEU C 1 229 ? 93.614  36.394  78.774  1.00 32.78 ? 227 LEU C C   1 
ATOM   6136  O O   . LEU C 1 229 ? 92.804  36.896  78.003  1.00 30.46 ? 227 LEU C O   1 
ATOM   6137  C CB  . LEU C 1 229 ? 94.885  35.051  77.101  1.00 30.00 ? 227 LEU C CB  1 
ATOM   6138  C CG  . LEU C 1 229 ? 96.108  34.168  76.841  1.00 42.01 ? 227 LEU C CG  1 
ATOM   6139  C CD1 . LEU C 1 229 ? 96.779  34.602  75.551  1.00 26.55 ? 227 LEU C CD1 1 
ATOM   6140  C CD2 . LEU C 1 229 ? 97.093  34.296  77.994  1.00 28.97 ? 227 LEU C CD2 1 
ATOM   6141  N N   . LEU C 1 230 ? 94.014  36.999  79.887  1.00 36.23 ? 228 LEU C N   1 
ATOM   6142  C CA  . LEU C 1 230 ? 93.509  38.312  80.306  1.00 33.57 ? 228 LEU C CA  1 
ATOM   6143  C C   . LEU C 1 230 ? 94.254  39.467  79.669  1.00 40.85 ? 228 LEU C C   1 
ATOM   6144  O O   . LEU C 1 230 ? 95.472  39.454  79.598  1.00 43.32 ? 228 LEU C O   1 
ATOM   6145  C CB  . LEU C 1 230 ? 93.635  38.457  81.820  1.00 18.58 ? 228 LEU C CB  1 
ATOM   6146  C CG  . LEU C 1 230 ? 93.095  39.737  82.438  1.00 32.34 ? 228 LEU C CG  1 
ATOM   6147  C CD1 . LEU C 1 230 ? 91.588  39.675  82.546  1.00 21.18 ? 228 LEU C CD1 1 
ATOM   6148  C CD2 . LEU C 1 230 ? 93.686  39.880  83.802  1.00 19.49 ? 228 LEU C CD2 1 
ATOM   6149  N N   . LYS C 1 231 ? 93.533  40.485  79.235  1.00 37.03 ? 229 LYS C N   1 
ATOM   6150  C CA  . LYS C 1 231 ? 94.188  41.636  78.633  1.00 31.83 ? 229 LYS C CA  1 
ATOM   6151  C C   . LYS C 1 231 ? 93.868  42.876  79.467  1.00 36.07 ? 229 LYS C C   1 
ATOM   6152  O O   . LYS C 1 231 ? 93.401  43.887  78.940  1.00 39.26 ? 229 LYS C O   1 
ATOM   6153  C CB  . LYS C 1 231 ? 93.710  41.811  77.178  1.00 31.23 ? 229 LYS C CB  1 
ATOM   6154  C CG  . LYS C 1 231 ? 94.283  43.012  76.411  1.00 23.16 ? 229 LYS C CG  1 
ATOM   6155  C CD  . LYS C 1 231 ? 93.951  42.893  74.937  1.00 31.52 ? 229 LYS C CD  1 
ATOM   6156  C CE  . LYS C 1 231 ? 94.500  44.053  74.097  1.00 31.05 ? 229 LYS C CE  1 
ATOM   6157  N NZ  . LYS C 1 231 ? 94.176  43.870  72.636  1.00 39.84 ? 229 LYS C NZ  1 
ATOM   6158  N N   . PRO C 1 232 ? 94.141  42.827  80.783  1.00 34.66 ? 230 PRO C N   1 
ATOM   6159  C CA  . PRO C 1 232 ? 93.874  43.945  81.696  1.00 31.10 ? 230 PRO C CA  1 
ATOM   6160  C C   . PRO C 1 232 ? 94.497  45.284  81.326  1.00 37.77 ? 230 PRO C C   1 
ATOM   6161  O O   . PRO C 1 232 ? 95.148  45.434  80.303  1.00 47.01 ? 230 PRO C O   1 
ATOM   6162  C CB  . PRO C 1 232 ? 94.411  43.429  83.016  1.00 34.72 ? 230 PRO C CB  1 
ATOM   6163  C CG  . PRO C 1 232 ? 95.596  42.684  82.587  1.00 44.41 ? 230 PRO C CG  1 
ATOM   6164  C CD  . PRO C 1 232 ? 95.040  41.862  81.434  1.00 39.84 ? 230 PRO C CD  1 
ATOM   6165  N N   . ASN C 1 233 ? 94.273  46.260  82.185  1.00 46.80 ? 231 ASN C N   1 
ATOM   6166  C CA  . ASN C 1 233 ? 94.805  47.597  81.999  1.00 47.46 ? 231 ASN C CA  1 
ATOM   6167  C C   . ASN C 1 233 ? 95.808  47.831  83.117  1.00 54.92 ? 231 ASN C C   1 
ATOM   6168  O O   . ASN C 1 233 ? 95.596  47.405  84.245  1.00 51.90 ? 231 ASN C O   1 
ATOM   6169  C CB  . ASN C 1 233 ? 93.679  48.621  82.112  1.00 63.85 ? 231 ASN C CB  1 
ATOM   6170  C CG  . ASN C 1 233 ? 92.855  48.443  83.385  1.00 71.30 ? 231 ASN C CG  1 
ATOM   6171  O OD1 . ASN C 1 233 ? 93.108  49.077  84.417  1.00 71.19 ? 231 ASN C OD1 1 
ATOM   6172  N ND2 . ASN C 1 233 ? 91.871  47.558  83.317  1.00 63.79 ? 231 ASN C ND2 1 
ATOM   6173  N N   . MET C 1 234 ? 96.913  48.490  82.826  1.00 65.11 ? 232 MET C N   1 
ATOM   6174  C CA  . MET C 1 234 ? 97.851  48.738  83.899  1.00 61.10 ? 232 MET C CA  1 
ATOM   6175  C C   . MET C 1 234 ? 97.216  49.787  84.797  1.00 63.71 ? 232 MET C C   1 
ATOM   6176  O O   . MET C 1 234 ? 96.777  50.835  84.327  1.00 69.00 ? 232 MET C O   1 
ATOM   6177  C CB  . MET C 1 234 ? 99.174  49.233  83.338  1.00 39.97 ? 232 MET C CB  1 
ATOM   6178  C CG  . MET C 1 234 ? 100.006 48.142  82.718  1.00 38.41 ? 232 MET C CG  1 
ATOM   6179  S SD  . MET C 1 234 ? 101.535 48.824  82.122  1.00 47.36 ? 232 MET C SD  1 
ATOM   6180  C CE  . MET C 1 234 ? 101.588 48.067  80.572  1.00 41.36 ? 232 MET C CE  1 
ATOM   6181  N N   . VAL C 1 235 ? 97.147  49.496  86.089  1.00 64.21 ? 233 VAL C N   1 
ATOM   6182  C CA  . VAL C 1 235 ? 96.551  50.420  87.046  1.00 57.99 ? 233 VAL C CA  1 
ATOM   6183  C C   . VAL C 1 235 ? 97.353  51.721  87.105  1.00 59.39 ? 233 VAL C C   1 
ATOM   6184  O O   . VAL C 1 235 ? 98.564  51.693  87.330  1.00 70.30 ? 233 VAL C O   1 
ATOM   6185  C CB  . VAL C 1 235 ? 96.500  49.776  88.447  1.00 66.44 ? 233 VAL C CB  1 
ATOM   6186  C CG1 . VAL C 1 235 ? 95.856  50.720  89.431  1.00 54.56 ? 233 VAL C CG1 1 
ATOM   6187  C CG2 . VAL C 1 235 ? 95.718  48.469  88.389  1.00 60.64 ? 233 VAL C CG2 1 
ATOM   6188  N N   . THR C 1 236 ? 96.678  52.853  86.895  1.00 27.11 ? 234 THR C N   1 
ATOM   6189  C CA  . THR C 1 236 ? 97.345  54.160  86.912  1.00 29.41 ? 234 THR C CA  1 
ATOM   6190  C C   . THR C 1 236 ? 96.501  55.265  87.565  1.00 39.37 ? 234 THR C C   1 
ATOM   6191  O O   . THR C 1 236 ? 95.993  56.175  86.900  1.00 43.62 ? 234 THR C O   1 
ATOM   6192  C CB  . THR C 1 236 ? 97.715  54.615  85.484  1.00 55.88 ? 234 THR C CB  1 
ATOM   6193  O OG1 . THR C 1 236 ? 96.557  55.161  84.841  1.00 51.88 ? 234 THR C OG1 1 
ATOM   6194  C CG2 . THR C 1 236 ? 98.225  53.437  84.661  1.00 42.70 ? 234 THR C CG2 1 
ATOM   6195  N N   . LYS C 1 243 ? 98.614  62.383  91.673  1.00 92.42 ? 241 LYS C N   1 
ATOM   6196  C CA  . LYS C 1 243 ? 100.040 62.586  91.919  1.00 92.42 ? 241 LYS C CA  1 
ATOM   6197  C C   . LYS C 1 243 ? 100.873 62.119  90.722  1.00 92.42 ? 241 LYS C C   1 
ATOM   6198  O O   . LYS C 1 243 ? 100.370 62.004  89.605  1.00 92.42 ? 241 LYS C O   1 
ATOM   6199  C CB  . LYS C 1 243 ? 100.480 61.819  93.177  1.00 92.42 ? 241 LYS C CB  1 
ATOM   6200  C CG  . LYS C 1 243 ? 99.741  62.201  94.461  1.00 92.42 ? 241 LYS C CG  1 
ATOM   6201  C CD  . LYS C 1 243 ? 100.280 61.427  95.672  1.00 92.42 ? 241 LYS C CD  1 
ATOM   6202  C CE  . LYS C 1 243 ? 99.567  61.822  96.966  1.00 92.42 ? 241 LYS C CE  1 
ATOM   6203  N NZ  . LYS C 1 243 ? 100.096 61.104  98.165  1.00 92.42 ? 241 LYS C NZ  1 
ATOM   6204  N N   . LYS C 1 244 ? 102.153 61.861  90.972  1.00 92.42 ? 242 LYS C N   1 
ATOM   6205  C CA  . LYS C 1 244 ? 103.087 61.392  89.948  1.00 92.42 ? 242 LYS C CA  1 
ATOM   6206  C C   . LYS C 1 244 ? 103.503 59.970  90.355  1.00 92.42 ? 242 LYS C C   1 
ATOM   6207  O O   . LYS C 1 244 ? 104.201 59.794  91.357  1.00 92.42 ? 242 LYS C O   1 
ATOM   6208  C CB  . LYS C 1 244 ? 104.309 62.321  89.915  1.00 86.37 ? 242 LYS C CB  1 
ATOM   6209  C CG  . LYS C 1 244 ? 105.401 61.954  88.915  1.00 86.37 ? 242 LYS C CG  1 
ATOM   6210  C CD  . LYS C 1 244 ? 106.594 62.909  89.050  1.00 86.37 ? 242 LYS C CD  1 
ATOM   6211  C CE  . LYS C 1 244 ? 107.679 62.646  88.006  1.00 86.37 ? 242 LYS C CE  1 
ATOM   6212  N NZ  . LYS C 1 244 ? 108.784 63.656  88.054  1.00 86.37 ? 242 LYS C NZ  1 
ATOM   6213  N N   . TYR C 1 245 ? 103.076 58.959  89.596  1.00 80.97 ? 243 TYR C N   1 
ATOM   6214  C CA  . TYR C 1 245 ? 103.406 57.573  89.943  1.00 75.33 ? 243 TYR C CA  1 
ATOM   6215  C C   . TYR C 1 245 ? 104.523 56.962  89.100  1.00 74.33 ? 243 TYR C C   1 
ATOM   6216  O O   . TYR C 1 245 ? 104.502 57.028  87.874  1.00 82.56 ? 243 TYR C O   1 
ATOM   6217  C CB  . TYR C 1 245 ? 102.149 56.689  89.876  1.00 81.39 ? 243 TYR C CB  1 
ATOM   6218  C CG  . TYR C 1 245 ? 100.962 57.247  90.644  1.00 81.39 ? 243 TYR C CG  1 
ATOM   6219  C CD1 . TYR C 1 245 ? 100.141 58.228  90.087  1.00 81.39 ? 243 TYR C CD1 1 
ATOM   6220  C CD2 . TYR C 1 245 ? 100.669 56.807  91.933  1.00 81.39 ? 243 TYR C CD2 1 
ATOM   6221  C CE1 . TYR C 1 245 ? 99.056  58.754  90.793  1.00 81.39 ? 243 TYR C CE1 1 
ATOM   6222  C CE2 . TYR C 1 245 ? 99.588  57.330  92.648  1.00 81.39 ? 243 TYR C CE2 1 
ATOM   6223  C CZ  . TYR C 1 245 ? 98.788  58.299  92.070  1.00 81.39 ? 243 TYR C CZ  1 
ATOM   6224  O OH  . TYR C 1 245 ? 97.718  58.804  92.765  1.00 81.39 ? 243 TYR C OH  1 
ATOM   6225  N N   . THR C 1 246 ? 105.497 56.366  89.781  1.00 50.02 ? 244 THR C N   1 
ATOM   6226  C CA  . THR C 1 246 ? 106.642 55.750  89.121  1.00 36.92 ? 244 THR C CA  1 
ATOM   6227  C C   . THR C 1 246 ? 106.321 54.364  88.605  1.00 46.87 ? 244 THR C C   1 
ATOM   6228  O O   . THR C 1 246 ? 105.398 53.716  89.084  1.00 52.67 ? 244 THR C O   1 
ATOM   6229  C CB  . THR C 1 246 ? 107.884 55.652  90.078  1.00 32.61 ? 244 THR C CB  1 
ATOM   6230  O OG1 . THR C 1 246 ? 108.876 54.801  89.494  1.00 51.91 ? 244 THR C OG1 1 
ATOM   6231  C CG2 . THR C 1 246 ? 107.500 55.089  91.434  1.00 23.50 ? 244 THR C CG2 1 
ATOM   6232  N N   . PRO C 1 247 ? 107.074 53.901  87.600  1.00 31.09 ? 245 PRO C N   1 
ATOM   6233  C CA  . PRO C 1 247 ? 106.850 52.572  87.038  1.00 25.26 ? 245 PRO C CA  1 
ATOM   6234  C C   . PRO C 1 247 ? 106.976 51.533  88.148  1.00 30.38 ? 245 PRO C C   1 
ATOM   6235  O O   . PRO C 1 247 ? 106.636 50.355  87.977  1.00 36.41 ? 245 PRO C O   1 
ATOM   6236  C CB  . PRO C 1 247 ? 107.956 52.455  85.994  1.00 41.73 ? 245 PRO C CB  1 
ATOM   6237  C CG  . PRO C 1 247 ? 108.089 53.854  85.510  1.00 37.70 ? 245 PRO C CG  1 
ATOM   6238  C CD  . PRO C 1 247 ? 108.072 54.635  86.803  1.00 41.95 ? 245 PRO C CD  1 
ATOM   6239  N N   . GLU C 1 248 ? 107.478 51.981  89.295  1.00 50.88 ? 246 GLU C N   1 
ATOM   6240  C CA  . GLU C 1 248 ? 107.641 51.098  90.435  1.00 50.88 ? 246 GLU C CA  1 
ATOM   6241  C C   . GLU C 1 248 ? 106.282 50.966  91.075  1.00 50.88 ? 246 GLU C C   1 
ATOM   6242  O O   . GLU C 1 248 ? 105.820 49.863  91.344  1.00 50.88 ? 246 GLU C O   1 
ATOM   6243  C CB  . GLU C 1 248 ? 108.648 51.683  91.421  1.00 84.47 ? 246 GLU C CB  1 
ATOM   6244  C CG  . GLU C 1 248 ? 110.075 51.186  91.208  1.00 84.47 ? 246 GLU C CG  1 
ATOM   6245  C CD  . GLU C 1 248 ? 110.629 51.476  89.821  1.00 84.47 ? 246 GLU C CD  1 
ATOM   6246  O OE1 . GLU C 1 248 ? 110.754 52.665  89.459  1.00 84.47 ? 246 GLU C OE1 1 
ATOM   6247  O OE2 . GLU C 1 248 ? 110.948 50.510  89.094  1.00 84.47 ? 246 GLU C OE2 1 
ATOM   6248  N N   . GLN C 1 249 ? 105.640 52.109  91.282  1.00 35.39 ? 247 GLN C N   1 
ATOM   6249  C CA  . GLN C 1 249 ? 104.315 52.173  91.883  1.00 35.39 ? 247 GLN C CA  1 
ATOM   6250  C C   . GLN C 1 249 ? 103.276 51.576  90.958  1.00 35.39 ? 247 GLN C C   1 
ATOM   6251  O O   . GLN C 1 249 ? 102.499 50.713  91.357  1.00 35.39 ? 247 GLN C O   1 
ATOM   6252  C CB  . GLN C 1 249 ? 103.951 53.625  92.176  1.00 74.13 ? 247 GLN C CB  1 
ATOM   6253  C CG  . GLN C 1 249 ? 104.947 54.311  93.078  1.00 74.13 ? 247 GLN C CG  1 
ATOM   6254  C CD  . GLN C 1 249 ? 104.625 55.763  93.288  1.00 74.13 ? 247 GLN C CD  1 
ATOM   6255  O OE1 . GLN C 1 249 ? 104.425 56.499  92.329  1.00 74.13 ? 247 GLN C OE1 1 
ATOM   6256  N NE2 . GLN C 1 249 ? 104.578 56.189  94.546  1.00 74.13 ? 247 GLN C NE2 1 
ATOM   6257  N N   . VAL C 1 250 ? 103.259 52.051  89.720  1.00 52.46 ? 248 VAL C N   1 
ATOM   6258  C CA  . VAL C 1 250 ? 102.309 51.554  88.747  1.00 52.46 ? 248 VAL C CA  1 
ATOM   6259  C C   . VAL C 1 250 ? 102.406 50.042  88.770  1.00 52.46 ? 248 VAL C C   1 
ATOM   6260  O O   . VAL C 1 250 ? 101.394 49.339  88.769  1.00 52.46 ? 248 VAL C O   1 
ATOM   6261  C CB  . VAL C 1 250 ? 102.631 52.059  87.331  1.00 88.94 ? 248 VAL C CB  1 
ATOM   6262  C CG1 . VAL C 1 250 ? 101.531 51.650  86.377  1.00 88.94 ? 248 VAL C CG1 1 
ATOM   6263  C CG2 . VAL C 1 250 ? 102.787 53.567  87.340  1.00 88.94 ? 248 VAL C CG2 1 
ATOM   6264  N N   . ALA C 1 251 ? 103.632 49.543  88.824  1.00 41.24 ? 249 ALA C N   1 
ATOM   6265  C CA  . ALA C 1 251 ? 103.852 48.104  88.846  1.00 41.24 ? 249 ALA C CA  1 
ATOM   6266  C C   . ALA C 1 251 ? 103.189 47.455  90.056  1.00 41.24 ? 249 ALA C C   1 
ATOM   6267  O O   . ALA C 1 251 ? 102.341 46.582  89.900  1.00 41.24 ? 249 ALA C O   1 
ATOM   6268  C CB  . ALA C 1 251 ? 105.354 47.797  88.835  1.00 92.42 ? 249 ALA C CB  1 
ATOM   6269  N N   . MET C 1 252 ? 103.583 47.879  91.253  1.00 41.27 ? 250 MET C N   1 
ATOM   6270  C CA  . MET C 1 252 ? 103.022 47.332  92.485  1.00 41.27 ? 250 MET C CA  1 
ATOM   6271  C C   . MET C 1 252 ? 101.497 47.358  92.426  1.00 41.27 ? 250 MET C C   1 
ATOM   6272  O O   . MET C 1 252 ? 100.835 46.308  92.406  1.00 41.27 ? 250 MET C O   1 
ATOM   6273  C CB  . MET C 1 252 ? 103.496 48.148  93.691  1.00 36.67 ? 250 MET C CB  1 
ATOM   6274  C CG  . MET C 1 252 ? 103.106 47.576  95.052  1.00 36.67 ? 250 MET C CG  1 
ATOM   6275  S SD  . MET C 1 252 ? 103.735 45.887  95.343  1.00 36.67 ? 250 MET C SD  1 
ATOM   6276  C CE  . MET C 1 252 ? 102.385 45.189  96.372  1.00 36.67 ? 250 MET C CE  1 
ATOM   6277  N N   . ALA C 1 253 ? 100.944 48.565  92.409  1.00 48.87 ? 251 ALA C N   1 
ATOM   6278  C CA  . ALA C 1 253 ? 99.507  48.727  92.336  1.00 48.87 ? 251 ALA C CA  1 
ATOM   6279  C C   . ALA C 1 253 ? 98.919  47.612  91.470  1.00 48.87 ? 251 ALA C C   1 
ATOM   6280  O O   . ALA C 1 253 ? 98.070  46.841  91.924  1.00 48.87 ? 251 ALA C O   1 
ATOM   6281  C CB  . ALA C 1 253 ? 99.179  50.084  91.739  1.00 11.59 ? 251 ALA C CB  1 
ATOM   6282  N N   . THR C 1 254 ? 99.410  47.512  90.235  1.00 53.89 ? 252 THR C N   1 
ATOM   6283  C CA  . THR C 1 254 ? 98.927  46.516  89.279  1.00 53.89 ? 252 THR C CA  1 
ATOM   6284  C C   . THR C 1 254 ? 99.029  45.040  89.661  1.00 53.89 ? 252 THR C C   1 
ATOM   6285  O O   . THR C 1 254 ? 98.054  44.299  89.513  1.00 53.89 ? 252 THR C O   1 
ATOM   6286  C CB  . THR C 1 254 ? 99.613  46.666  87.912  1.00 38.77 ? 252 THR C CB  1 
ATOM   6287  O OG1 . THR C 1 254 ? 99.327  47.964  87.365  1.00 38.77 ? 252 THR C OG1 1 
ATOM   6288  C CG2 . THR C 1 254 ? 99.113  45.580  86.955  1.00 38.77 ? 252 THR C CG2 1 
ATOM   6289  N N   . VAL C 1 255 ? 100.193 44.591  90.122  1.00 47.89 ? 253 VAL C N   1 
ATOM   6290  C CA  . VAL C 1 255 ? 100.338 43.184  90.482  1.00 47.89 ? 253 VAL C CA  1 
ATOM   6291  C C   . VAL C 1 255 ? 99.581  42.866  91.761  1.00 47.89 ? 253 VAL C C   1 
ATOM   6292  O O   . VAL C 1 255 ? 99.016  41.785  91.906  1.00 47.89 ? 253 VAL C O   1 
ATOM   6293  C CB  . VAL C 1 255 ? 101.798 42.801  90.683  1.00 29.14 ? 253 VAL C CB  1 
ATOM   6294  C CG1 . VAL C 1 255 ? 101.964 41.279  90.566  1.00 29.14 ? 253 VAL C CG1 1 
ATOM   6295  C CG2 . VAL C 1 255 ? 102.654 43.538  89.678  1.00 29.14 ? 253 VAL C CG2 1 
ATOM   6296  N N   . THR C 1 256 ? 99.579  43.805  92.696  1.00 39.82 ? 254 THR C N   1 
ATOM   6297  C CA  . THR C 1 256 ? 98.866  43.606  93.944  1.00 39.82 ? 254 THR C CA  1 
ATOM   6298  C C   . THR C 1 256 ? 97.446  43.259  93.561  1.00 39.82 ? 254 THR C C   1 
ATOM   6299  O O   . THR C 1 256 ? 96.868  42.302  94.056  1.00 39.82 ? 254 THR C O   1 
ATOM   6300  C CB  . THR C 1 256 ? 98.809  44.888  94.743  1.00 40.16 ? 254 THR C CB  1 
ATOM   6301  O OG1 . THR C 1 256 ? 100.038 45.596  94.578  1.00 40.16 ? 254 THR C OG1 1 
ATOM   6302  C CG2 . THR C 1 256 ? 98.592  44.592  96.208  1.00 40.16 ? 254 THR C CG2 1 
ATOM   6303  N N   . ALA C 1 257 ? 96.898  44.062  92.656  1.00 45.29 ? 255 ALA C N   1 
ATOM   6304  C CA  . ALA C 1 257 ? 95.541  43.892  92.177  1.00 45.29 ? 255 ALA C CA  1 
ATOM   6305  C C   . ALA C 1 257 ? 95.348  42.588  91.422  1.00 45.29 ? 255 ALA C C   1 
ATOM   6306  O O   . ALA C 1 257 ? 94.367  41.881  91.637  1.00 45.29 ? 255 ALA C O   1 
ATOM   6307  C CB  . ALA C 1 257 ? 95.171  45.062  91.300  1.00 7.03  ? 255 ALA C CB  1 
ATOM   6308  N N   . LEU C 1 258 ? 96.278  42.259  90.538  1.00 37.11 ? 256 LEU C N   1 
ATOM   6309  C CA  . LEU C 1 258 ? 96.139  41.020  89.778  1.00 37.11 ? 256 LEU C CA  1 
ATOM   6310  C C   . LEU C 1 258 ? 96.234  39.754  90.656  1.00 37.11 ? 256 LEU C C   1 
ATOM   6311  O O   . LEU C 1 258 ? 95.424  38.836  90.528  1.00 37.11 ? 256 LEU C O   1 
ATOM   6312  C CB  . LEU C 1 258 ? 97.183  40.957  88.635  1.00 17.52 ? 256 LEU C CB  1 
ATOM   6313  C CG  . LEU C 1 258 ? 97.230  42.119  87.624  1.00 17.52 ? 256 LEU C CG  1 
ATOM   6314  C CD1 . LEU C 1 258 ? 98.125  41.761  86.444  1.00 17.52 ? 256 LEU C CD1 1 
ATOM   6315  C CD2 . LEU C 1 258 ? 95.825  42.422  87.122  1.00 17.52 ? 256 LEU C CD2 1 
ATOM   6316  N N   . HIS C 1 259 ? 97.205  39.716  91.563  1.00 46.65 ? 257 HIS C N   1 
ATOM   6317  C CA  . HIS C 1 259 ? 97.390  38.531  92.390  1.00 46.65 ? 257 HIS C CA  1 
ATOM   6318  C C   . HIS C 1 259 ? 96.298  38.350  93.435  1.00 46.65 ? 257 HIS C C   1 
ATOM   6319  O O   . HIS C 1 259 ? 96.256  37.334  94.130  1.00 46.65 ? 257 HIS C O   1 
ATOM   6320  C CB  . HIS C 1 259 ? 98.812  38.524  93.017  1.00 9.00  ? 257 HIS C CB  1 
ATOM   6321  C CG  . HIS C 1 259 ? 98.906  39.149  94.376  1.00 9.00  ? 257 HIS C CG  1 
ATOM   6322  N ND1 . HIS C 1 259 ? 98.616  40.480  94.616  1.00 9.00  ? 257 HIS C ND1 1 
ATOM   6323  C CD2 . HIS C 1 259 ? 99.266  38.619  95.573  1.00 9.00  ? 257 HIS C CD2 1 
ATOM   6324  C CE1 . HIS C 1 259 ? 98.789  40.738  95.901  1.00 9.00  ? 257 HIS C CE1 1 
ATOM   6325  N NE2 . HIS C 1 259 ? 99.183  39.627  96.504  1.00 9.00  ? 257 HIS C NE2 1 
ATOM   6326  N N   . ARG C 1 260 ? 95.395  39.323  93.524  1.00 48.09 ? 258 ARG C N   1 
ATOM   6327  C CA  . ARG C 1 260 ? 94.289  39.237  94.481  1.00 48.09 ? 258 ARG C CA  1 
ATOM   6328  C C   . ARG C 1 260 ? 93.019  38.707  93.820  1.00 48.09 ? 258 ARG C C   1 
ATOM   6329  O O   . ARG C 1 260 ? 92.144  38.161  94.490  1.00 48.09 ? 258 ARG C O   1 
ATOM   6330  C CB  . ARG C 1 260 ? 93.985  40.608  95.092  1.00 39.62 ? 258 ARG C CB  1 
ATOM   6331  C CG  . ARG C 1 260 ? 95.123  41.190  95.878  1.00 39.62 ? 258 ARG C CG  1 
ATOM   6332  C CD  . ARG C 1 260 ? 94.612  41.928  97.098  1.00 39.62 ? 258 ARG C CD  1 
ATOM   6333  N NE  . ARG C 1 260 ? 94.912  43.356  97.070  1.00 39.62 ? 258 ARG C NE  1 
ATOM   6334  C CZ  . ARG C 1 260 ? 95.336  44.045  98.126  1.00 39.62 ? 258 ARG C CZ  1 
ATOM   6335  N NH1 . ARG C 1 260 ? 95.518  43.450  99.294  1.00 39.62 ? 258 ARG C NH1 1 
ATOM   6336  N NH2 . ARG C 1 260 ? 95.576  45.336  98.013  1.00 39.62 ? 258 ARG C NH2 1 
ATOM   6337  N N   . THR C 1 261 ? 92.949  38.860  92.498  1.00 21.68 ? 259 THR C N   1 
ATOM   6338  C CA  . THR C 1 261 ? 91.795  38.449  91.711  1.00 21.68 ? 259 THR C CA  1 
ATOM   6339  C C   . THR C 1 261 ? 92.039  37.310  90.700  1.00 21.68 ? 259 THR C C   1 
ATOM   6340  O O   . THR C 1 261 ? 91.516  36.202  90.846  1.00 21.68 ? 259 THR C O   1 
ATOM   6341  C CB  . THR C 1 261 ? 91.279  39.649  90.940  1.00 20.78 ? 259 THR C CB  1 
ATOM   6342  O OG1 . THR C 1 261 ? 92.260  40.018  89.963  1.00 20.78 ? 259 THR C OG1 1 
ATOM   6343  C CG2 . THR C 1 261 ? 91.052  40.833  91.884  1.00 20.78 ? 259 THR C CG2 1 
ATOM   6344  N N   . VAL C 1 262 ? 92.835  37.600  89.675  1.00 14.81 ? 260 VAL C N   1 
ATOM   6345  C CA  . VAL C 1 262 ? 93.132  36.644  88.607  1.00 14.81 ? 260 VAL C CA  1 
ATOM   6346  C C   . VAL C 1 262 ? 93.738  35.311  89.004  1.00 14.81 ? 260 VAL C C   1 
ATOM   6347  O O   . VAL C 1 262 ? 94.936  35.219  89.258  1.00 14.81 ? 260 VAL C O   1 
ATOM   6348  C CB  . VAL C 1 262 ? 94.065  37.260  87.567  1.00 20.41 ? 260 VAL C CB  1 
ATOM   6349  C CG1 . VAL C 1 262 ? 94.155  36.328  86.368  1.00 20.41 ? 260 VAL C CG1 1 
ATOM   6350  C CG2 . VAL C 1 262 ? 93.575  38.668  87.179  1.00 20.41 ? 260 VAL C CG2 1 
ATOM   6351  N N   . PRO C 1 263 ? 92.920  34.250  89.016  1.00 30.94 ? 261 PRO C N   1 
ATOM   6352  C CA  . PRO C 1 263 ? 93.321  32.885  89.374  1.00 30.94 ? 261 PRO C CA  1 
ATOM   6353  C C   . PRO C 1 263 ? 94.681  32.490  88.847  1.00 30.94 ? 261 PRO C C   1 
ATOM   6354  O O   . PRO C 1 263 ? 95.117  32.981  87.804  1.00 30.94 ? 261 PRO C O   1 
ATOM   6355  C CB  . PRO C 1 263 ? 92.219  32.036  88.764  1.00 33.65 ? 261 PRO C CB  1 
ATOM   6356  C CG  . PRO C 1 263 ? 91.040  32.893  88.942  1.00 33.65 ? 261 PRO C CG  1 
ATOM   6357  C CD  . PRO C 1 263 ? 91.531  34.263  88.535  1.00 33.65 ? 261 PRO C CD  1 
ATOM   6358  N N   . ALA C 1 264 ? 95.335  31.585  89.565  1.00 40.96 ? 262 ALA C N   1 
ATOM   6359  C CA  . ALA C 1 264 ? 96.651  31.118  89.173  1.00 40.96 ? 262 ALA C CA  1 
ATOM   6360  C C   . ALA C 1 264 ? 96.611  30.270  87.913  1.00 40.96 ? 262 ALA C C   1 
ATOM   6361  O O   . ALA C 1 264 ? 97.639  30.049  87.291  1.00 40.96 ? 262 ALA C O   1 
ATOM   6362  C CB  . ALA C 1 264 ? 97.267  30.321  90.293  1.00 27.13 ? 262 ALA C CB  1 
ATOM   6363  N N   . ALA C 1 265 ? 95.434  29.795  87.531  1.00 39.37 ? 263 ALA C N   1 
ATOM   6364  C CA  . ALA C 1 265 ? 95.321  28.954  86.345  1.00 30.69 ? 263 ALA C CA  1 
ATOM   6365  C C   . ALA C 1 265 ? 95.411  29.698  85.003  1.00 30.77 ? 263 ALA C C   1 
ATOM   6366  O O   . ALA C 1 265 ? 95.703  29.089  83.977  1.00 38.26 ? 263 ALA C O   1 
ATOM   6367  C CB  . ALA C 1 265 ? 94.044  28.146  86.412  1.00 23.36 ? 263 ALA C CB  1 
ATOM   6368  N N   . VAL C 1 266 ? 95.145  30.999  84.993  1.00 41.11 ? 264 VAL C N   1 
ATOM   6369  C CA  . VAL C 1 266 ? 95.251  31.768  83.754  1.00 36.59 ? 264 VAL C CA  1 
ATOM   6370  C C   . VAL C 1 266 ? 96.727  31.691  83.375  1.00 48.01 ? 264 VAL C C   1 
ATOM   6371  O O   . VAL C 1 266 ? 97.593  31.990  84.209  1.00 50.62 ? 264 VAL C O   1 
ATOM   6372  C CB  . VAL C 1 266 ? 94.872  33.228  84.004  1.00 37.30 ? 264 VAL C CB  1 
ATOM   6373  C CG1 . VAL C 1 266 ? 94.909  34.017  82.723  1.00 20.39 ? 264 VAL C CG1 1 
ATOM   6374  C CG2 . VAL C 1 266 ? 93.509  33.286  84.622  1.00 30.94 ? 264 VAL C CG2 1 
ATOM   6375  N N   . PRO C 1 267 ? 97.046  31.298  82.124  1.00 44.48 ? 265 PRO C N   1 
ATOM   6376  C CA  . PRO C 1 267 ? 98.461  31.205  81.738  1.00 36.88 ? 265 PRO C CA  1 
ATOM   6377  C C   . PRO C 1 267 ? 99.192  32.503  81.373  1.00 37.51 ? 265 PRO C C   1 
ATOM   6378  O O   . PRO C 1 267 ? 100.422 32.532  81.306  1.00 51.93 ? 265 PRO C O   1 
ATOM   6379  C CB  . PRO C 1 267 ? 98.429  30.195  80.594  1.00 43.77 ? 265 PRO C CB  1 
ATOM   6380  C CG  . PRO C 1 267 ? 97.145  30.532  79.910  1.00 51.49 ? 265 PRO C CG  1 
ATOM   6381  C CD  . PRO C 1 267 ? 96.179  30.736  81.072  1.00 45.63 ? 265 PRO C CD  1 
ATOM   6382  N N   . GLY C 1 268 ? 98.454  33.580  81.157  1.00 21.27 ? 266 GLY C N   1 
ATOM   6383  C CA  . GLY C 1 268 ? 99.128  34.814  80.809  1.00 12.43 ? 266 GLY C CA  1 
ATOM   6384  C C   . GLY C 1 268 ? 98.256  36.037  80.910  1.00 22.28 ? 266 GLY C C   1 
ATOM   6385  O O   . GLY C 1 268 ? 97.066  35.966  80.701  1.00 23.35 ? 266 GLY C O   1 
ATOM   6386  N N   . ILE C 1 269 ? 98.866  37.169  81.214  1.00 13.36 ? 267 ILE C N   1 
ATOM   6387  C CA  . ILE C 1 269 ? 98.154  38.434  81.370  1.00 4.42  ? 267 ILE C CA  1 
ATOM   6388  C C   . ILE C 1 269 ? 98.831  39.480  80.473  1.00 16.84 ? 267 ILE C C   1 
ATOM   6389  O O   . ILE C 1 269 ? 99.650  40.277  80.920  1.00 19.17 ? 267 ILE C O   1 
ATOM   6390  C CB  . ILE C 1 269 ? 98.209  38.888  82.864  1.00 28.40 ? 267 ILE C CB  1 
ATOM   6391  C CG1 . ILE C 1 269 ? 97.596  37.804  83.768  1.00 21.92 ? 267 ILE C CG1 1 
ATOM   6392  C CG2 . ILE C 1 269 ? 97.502  40.214  83.041  1.00 21.59 ? 267 ILE C CG2 1 
ATOM   6393  C CD1 . ILE C 1 269 ? 97.587  38.136  85.267  1.00 50.04 ? 267 ILE C CD1 1 
ATOM   6394  N N   . CYS C 1 270 ? 98.495  39.450  79.195  1.00 13.42 ? 268 CYS C N   1 
ATOM   6395  C CA  . CYS C 1 270 ? 99.084  40.369  78.245  1.00 12.33 ? 268 CYS C CA  1 
ATOM   6396  C C   . CYS C 1 270 ? 98.370  41.707  78.352  1.00 20.95 ? 268 CYS C C   1 
ATOM   6397  O O   . CYS C 1 270 ? 97.331  41.908  77.745  1.00 18.64 ? 268 CYS C O   1 
ATOM   6398  C CB  . CYS C 1 270 ? 98.950  39.832  76.809  1.00 20.58 ? 268 CYS C CB  1 
ATOM   6399  S SG  . CYS C 1 270 ? 99.404  38.063  76.521  1.00 36.83 ? 268 CYS C SG  1 
ATOM   6400  N N   . PHE C 1 271 ? 98.941  42.626  79.123  1.00 23.72 ? 269 PHE C N   1 
ATOM   6401  C CA  . PHE C 1 271 ? 98.371  43.959  79.317  1.00 23.29 ? 269 PHE C CA  1 
ATOM   6402  C C   . PHE C 1 271 ? 98.005  44.683  78.049  1.00 23.40 ? 269 PHE C C   1 
ATOM   6403  O O   . PHE C 1 271 ? 98.269  44.221  76.950  1.00 28.97 ? 269 PHE C O   1 
ATOM   6404  C CB  . PHE C 1 271 ? 99.351  44.856  80.083  1.00 49.33 ? 269 PHE C CB  1 
ATOM   6405  C CG  . PHE C 1 271 ? 99.667  44.370  81.460  1.00 56.05 ? 269 PHE C CG  1 
ATOM   6406  C CD1 . PHE C 1 271 ? 100.656 43.421  81.661  1.00 47.27 ? 269 PHE C CD1 1 
ATOM   6407  C CD2 . PHE C 1 271 ? 98.939  44.827  82.547  1.00 55.66 ? 269 PHE C CD2 1 
ATOM   6408  C CE1 . PHE C 1 271 ? 100.918 42.929  82.930  1.00 57.03 ? 269 PHE C CE1 1 
ATOM   6409  C CE2 . PHE C 1 271 ? 99.188  44.346  83.817  1.00 56.37 ? 269 PHE C CE2 1 
ATOM   6410  C CZ  . PHE C 1 271 ? 100.181 43.390  84.015  1.00 62.39 ? 269 PHE C CZ  1 
ATOM   6411  N N   . LEU C 1 272 ? 97.391  45.839  78.228  1.00 42.98 ? 270 LEU C N   1 
ATOM   6412  C CA  . LEU C 1 272 ? 97.015  46.695  77.115  1.00 38.93 ? 270 LEU C CA  1 
ATOM   6413  C C   . LEU C 1 272 ? 97.748  47.983  77.448  1.00 44.72 ? 270 LEU C C   1 
ATOM   6414  O O   . LEU C 1 272 ? 97.705  48.432  78.593  1.00 44.77 ? 270 LEU C O   1 
ATOM   6415  C CB  . LEU C 1 272 ? 95.493  46.927  77.080  1.00 92.42 ? 270 LEU C CB  1 
ATOM   6416  C CG  . LEU C 1 272 ? 94.805  47.723  78.200  1.00 92.42 ? 270 LEU C CG  1 
ATOM   6417  C CD1 . LEU C 1 272 ? 95.098  49.228  78.081  1.00 92.42 ? 270 LEU C CD1 1 
ATOM   6418  C CD2 . LEU C 1 272 ? 93.305  47.481  78.112  1.00 92.42 ? 270 LEU C CD2 1 
ATOM   6419  N N   . SER C 1 273 ? 98.439  48.558  76.471  1.00 67.39 ? 271 SER C N   1 
ATOM   6420  C CA  . SER C 1 273 ? 99.189  49.793  76.697  1.00 67.29 ? 271 SER C CA  1 
ATOM   6421  C C   . SER C 1 273 ? 98.239  50.977  76.805  1.00 73.11 ? 271 SER C C   1 
ATOM   6422  O O   . SER C 1 273 ? 98.383  51.832  77.676  1.00 74.69 ? 271 SER C O   1 
ATOM   6423  C CB  . SER C 1 273 ? 100.176 50.036  75.549  1.00 90.23 ? 271 SER C CB  1 
ATOM   6424  O OG  . SER C 1 273 ? 99.497  50.328  74.331  1.00 92.42 ? 271 SER C OG  1 
ATOM   6425  N N   . GLY C 1 274 ? 97.272  51.009  75.896  1.00 65.26 ? 272 GLY C N   1 
ATOM   6426  C CA  . GLY C 1 274 ? 96.291  52.071  75.876  1.00 68.36 ? 272 GLY C CA  1 
ATOM   6427  C C   . GLY C 1 274 ? 96.814  53.446  76.232  1.00 74.58 ? 272 GLY C C   1 
ATOM   6428  O O   . GLY C 1 274 ? 96.749  53.862  77.387  1.00 84.32 ? 272 GLY C O   1 
ATOM   6429  N N   . GLY C 1 275 ? 97.358  54.150  75.251  1.00 67.14 ? 273 GLY C N   1 
ATOM   6430  C CA  . GLY C 1 275 ? 97.828  55.499  75.509  1.00 74.22 ? 273 GLY C CA  1 
ATOM   6431  C C   . GLY C 1 275 ? 99.159  55.722  76.196  1.00 75.81 ? 273 GLY C C   1 
ATOM   6432  O O   . GLY C 1 275 ? 99.520  56.864  76.461  1.00 80.43 ? 273 GLY C O   1 
ATOM   6433  N N   . MET C 1 276 ? 99.891  54.664  76.516  1.00 77.47 ? 274 MET C N   1 
ATOM   6434  C CA  . MET C 1 276 ? 101.195 54.862  77.139  1.00 73.04 ? 274 MET C CA  1 
ATOM   6435  C C   . MET C 1 276 ? 102.185 54.949  75.984  1.00 76.48 ? 274 MET C C   1 
ATOM   6436  O O   . MET C 1 276 ? 101.936 54.378  74.925  1.00 80.22 ? 274 MET C O   1 
ATOM   6437  C CB  . MET C 1 276 ? 101.576 53.678  78.034  1.00 42.59 ? 274 MET C CB  1 
ATOM   6438  C CG  . MET C 1 276 ? 100.752 53.494  79.304  1.00 38.23 ? 274 MET C CG  1 
ATOM   6439  S SD  . MET C 1 276 ? 101.339 52.056  80.248  1.00 54.73 ? 274 MET C SD  1 
ATOM   6440  C CE  . MET C 1 276 ? 101.031 50.781  79.055  1.00 64.72 ? 274 MET C CE  1 
ATOM   6441  N N   . SER C 1 277 ? 103.294 55.659  76.170  1.00 46.34 ? 275 SER C N   1 
ATOM   6442  C CA  . SER C 1 277 ? 104.286 55.762  75.101  1.00 43.39 ? 275 SER C CA  1 
ATOM   6443  C C   . SER C 1 277 ? 104.866 54.372  74.908  1.00 42.52 ? 275 SER C C   1 
ATOM   6444  O O   . SER C 1 277 ? 104.716 53.516  75.777  1.00 49.07 ? 275 SER C O   1 
ATOM   6445  C CB  . SER C 1 277 ? 105.415 56.724  75.476  1.00 50.44 ? 275 SER C CB  1 
ATOM   6446  O OG  . SER C 1 277 ? 106.478 56.044  76.120  1.00 68.94 ? 275 SER C OG  1 
ATOM   6447  N N   . GLU C 1 278 ? 105.525 54.147  73.777  1.00 80.76 ? 276 GLU C N   1 
ATOM   6448  C CA  . GLU C 1 278 ? 106.121 52.840  73.504  1.00 80.76 ? 276 GLU C CA  1 
ATOM   6449  C C   . GLU C 1 278 ? 107.050 52.487  74.651  1.00 80.76 ? 276 GLU C C   1 
ATOM   6450  O O   . GLU C 1 278 ? 107.261 51.307  74.944  1.00 80.76 ? 276 GLU C O   1 
ATOM   6451  C CB  . GLU C 1 278 ? 106.943 52.869  72.216  1.00 73.99 ? 276 GLU C CB  1 
ATOM   6452  C CG  . GLU C 1 278 ? 106.246 53.448  71.012  1.00 73.99 ? 276 GLU C CG  1 
ATOM   6453  C CD  . GLU C 1 278 ? 107.193 53.591  69.852  1.00 73.99 ? 276 GLU C CD  1 
ATOM   6454  O OE1 . GLU C 1 278 ? 108.208 54.303  70.009  1.00 73.99 ? 276 GLU C OE1 1 
ATOM   6455  O OE2 . GLU C 1 278 ? 106.930 52.991  68.791  1.00 73.99 ? 276 GLU C OE2 1 
ATOM   6456  N N   . GLU C 1 279 ? 107.603 53.528  75.278  1.00 81.05 ? 277 GLU C N   1 
ATOM   6457  C CA  . GLU C 1 279 ? 108.531 53.394  76.399  1.00 81.05 ? 277 GLU C CA  1 
ATOM   6458  C C   . GLU C 1 279 ? 107.796 53.069  77.700  1.00 81.05 ? 277 GLU C C   1 
ATOM   6459  O O   . GLU C 1 279 ? 108.086 52.067  78.351  1.00 81.05 ? 277 GLU C O   1 
ATOM   6460  C CB  . GLU C 1 279 ? 109.340 54.686  76.571  1.00 79.64 ? 277 GLU C CB  1 
ATOM   6461  C CG  . GLU C 1 279 ? 110.510 54.562  77.542  1.00 79.64 ? 277 GLU C CG  1 
ATOM   6462  C CD  . GLU C 1 279 ? 111.636 53.677  77.015  1.00 79.64 ? 277 GLU C CD  1 
ATOM   6463  O OE1 . GLU C 1 279 ? 111.351 52.644  76.374  1.00 79.64 ? 277 GLU C OE1 1 
ATOM   6464  O OE2 . GLU C 1 279 ? 112.816 54.008  77.254  1.00 79.64 ? 277 GLU C OE2 1 
ATOM   6465  N N   . ASP C 1 280 ? 106.853 53.921  78.081  1.00 63.61 ? 278 ASP C N   1 
ATOM   6466  C CA  . ASP C 1 280 ? 106.077 53.690  79.291  1.00 63.61 ? 278 ASP C CA  1 
ATOM   6467  C C   . ASP C 1 280 ? 105.476 52.295  79.256  1.00 63.61 ? 278 ASP C C   1 
ATOM   6468  O O   . ASP C 1 280 ? 105.364 51.633  80.287  1.00 63.61 ? 278 ASP C O   1 
ATOM   6469  C CB  . ASP C 1 280 ? 104.955 54.708  79.396  1.00 43.26 ? 278 ASP C CB  1 
ATOM   6470  C CG  . ASP C 1 280 ? 105.470 56.111  79.548  1.00 43.26 ? 278 ASP C CG  1 
ATOM   6471  O OD1 . ASP C 1 280 ? 105.608 56.566  80.699  1.00 43.26 ? 278 ASP C OD1 1 
ATOM   6472  O OD2 . ASP C 1 280 ? 105.750 56.755  78.512  1.00 43.26 ? 278 ASP C OD2 1 
ATOM   6473  N N   . ALA C 1 281 ? 105.077 51.853  78.069  1.00 55.02 ? 279 ALA C N   1 
ATOM   6474  C CA  . ALA C 1 281 ? 104.496 50.525  77.937  1.00 55.02 ? 279 ALA C CA  1 
ATOM   6475  C C   . ALA C 1 281 ? 105.568 49.475  78.176  1.00 55.02 ? 279 ALA C C   1 
ATOM   6476  O O   . ALA C 1 281 ? 105.270 48.363  78.620  1.00 55.02 ? 279 ALA C O   1 
ATOM   6477  C CB  . ALA C 1 281 ? 103.878 50.339  76.550  1.00 38.84 ? 279 ALA C CB  1 
ATOM   6478  N N   . THR C 1 282 ? 106.819 49.825  77.887  1.00 49.53 ? 280 THR C N   1 
ATOM   6479  C CA  . THR C 1 282 ? 107.913 48.885  78.083  1.00 49.53 ? 280 THR C CA  1 
ATOM   6480  C C   . THR C 1 282 ? 108.417 48.953  79.525  1.00 49.53 ? 280 THR C C   1 
ATOM   6481  O O   . THR C 1 282 ? 108.661 47.921  80.159  1.00 49.53 ? 280 THR C O   1 
ATOM   6482  C CB  . THR C 1 282 ? 109.068 49.167  77.111  1.00 77.16 ? 280 THR C CB  1 
ATOM   6483  O OG1 . THR C 1 282 ? 108.540 49.389  75.797  1.00 77.16 ? 280 THR C OG1 1 
ATOM   6484  C CG2 . THR C 1 282 ? 110.013 47.972  77.055  1.00 77.16 ? 280 THR C CG2 1 
ATOM   6485  N N   . LEU C 1 283 ? 108.555 50.167  80.048  1.00 44.14 ? 281 LEU C N   1 
ATOM   6486  C CA  . LEU C 1 283 ? 109.014 50.354  81.422  1.00 44.14 ? 281 LEU C CA  1 
ATOM   6487  C C   . LEU C 1 283 ? 108.079 49.617  82.378  1.00 44.14 ? 281 LEU C C   1 
ATOM   6488  O O   . LEU C 1 283 ? 108.502 48.730  83.133  1.00 44.14 ? 281 LEU C O   1 
ATOM   6489  C CB  . LEU C 1 283 ? 109.026 51.844  81.785  1.00 63.26 ? 281 LEU C CB  1 
ATOM   6490  C CG  . LEU C 1 283 ? 109.876 52.768  80.911  1.00 63.26 ? 281 LEU C CG  1 
ATOM   6491  C CD1 . LEU C 1 283 ? 109.728 54.205  81.383  1.00 63.26 ? 281 LEU C CD1 1 
ATOM   6492  C CD2 . LEU C 1 283 ? 111.328 52.324  80.966  1.00 63.26 ? 281 LEU C CD2 1 
ATOM   6493  N N   . ASN C 1 284 ? 106.805 50.000  82.326  1.00 49.79 ? 282 ASN C N   1 
ATOM   6494  C CA  . ASN C 1 284 ? 105.777 49.419  83.174  1.00 49.79 ? 282 ASN C CA  1 
ATOM   6495  C C   . ASN C 1 284 ? 105.629 47.915  83.030  1.00 49.79 ? 282 ASN C C   1 
ATOM   6496  O O   . ASN C 1 284 ? 105.431 47.232  84.032  1.00 49.79 ? 282 ASN C O   1 
ATOM   6497  C CB  . ASN C 1 284 ? 104.444 50.112  82.916  1.00 28.60 ? 282 ASN C CB  1 
ATOM   6498  C CG  . ASN C 1 284 ? 104.490 51.570  83.268  1.00 28.60 ? 282 ASN C CG  1 
ATOM   6499  O OD1 . ASN C 1 284 ? 105.569 52.138  83.427  1.00 28.60 ? 282 ASN C OD1 1 
ATOM   6500  N ND2 . ASN C 1 284 ? 103.327 52.193  83.387  1.00 28.60 ? 282 ASN C ND2 1 
ATOM   6501  N N   . LEU C 1 285 ? 105.706 47.379  81.812  1.00 27.43 ? 283 LEU C N   1 
ATOM   6502  C CA  . LEU C 1 285 ? 105.592 45.932  81.699  1.00 27.43 ? 283 LEU C CA  1 
ATOM   6503  C C   . LEU C 1 285 ? 106.795 45.347  82.425  1.00 27.43 ? 283 LEU C C   1 
ATOM   6504  O O   . LEU C 1 285 ? 106.670 44.376  83.185  1.00 27.43 ? 283 LEU C O   1 
ATOM   6505  C CB  . LEU C 1 285 ? 105.587 45.457  80.246  1.00 18.82 ? 283 LEU C CB  1 
ATOM   6506  C CG  . LEU C 1 285 ? 105.953 43.956  80.097  1.00 18.82 ? 283 LEU C CG  1 
ATOM   6507  C CD1 . LEU C 1 285 ? 105.335 43.105  81.188  1.00 18.82 ? 283 LEU C CD1 1 
ATOM   6508  C CD2 . LEU C 1 285 ? 105.491 43.446  78.752  1.00 18.82 ? 283 LEU C CD2 1 
ATOM   6509  N N   . ASN C 1 286 ? 107.959 45.948  82.182  1.00 47.15 ? 284 ASN C N   1 
ATOM   6510  C CA  . ASN C 1 286 ? 109.196 45.511  82.813  1.00 47.15 ? 284 ASN C CA  1 
ATOM   6511  C C   . ASN C 1 286 ? 108.982 45.602  84.318  1.00 47.15 ? 284 ASN C C   1 
ATOM   6512  O O   . ASN C 1 286 ? 108.983 44.587  85.024  1.00 47.15 ? 284 ASN C O   1 
ATOM   6513  C CB  . ASN C 1 286 ? 110.362 46.422  82.383  1.00 58.39 ? 284 ASN C CB  1 
ATOM   6514  C CG  . ASN C 1 286 ? 111.721 45.975  82.950  1.00 58.39 ? 284 ASN C CG  1 
ATOM   6515  O OD1 . ASN C 1 286 ? 112.278 44.945  82.554  1.00 58.39 ? 284 ASN C OD1 1 
ATOM   6516  N ND2 . ASN C 1 286 ? 112.254 46.763  83.881  1.00 58.39 ? 284 ASN C ND2 1 
ATOM   6517  N N   . ALA C 1 287 ? 108.775 46.825  84.798  1.00 40.85 ? 285 ALA C N   1 
ATOM   6518  C CA  . ALA C 1 287 ? 108.564 47.061  86.222  1.00 40.85 ? 285 ALA C CA  1 
ATOM   6519  C C   . ALA C 1 287 ? 107.617 46.019  86.834  1.00 40.85 ? 285 ALA C C   1 
ATOM   6520  O O   . ALA C 1 287 ? 107.825 45.550  87.949  1.00 40.85 ? 285 ALA C O   1 
ATOM   6521  C CB  . ALA C 1 287 ? 108.022 48.484  86.442  1.00 5.08  ? 285 ALA C CB  1 
ATOM   6522  N N   . ILE C 1 288 ? 106.585 45.654  86.084  1.00 53.64 ? 286 ILE C N   1 
ATOM   6523  C CA  . ILE C 1 288 ? 105.614 44.666  86.529  1.00 53.64 ? 286 ILE C CA  1 
ATOM   6524  C C   . ILE C 1 288 ? 106.229 43.277  86.701  1.00 53.64 ? 286 ILE C C   1 
ATOM   6525  O O   . ILE C 1 288 ? 105.857 42.545  87.613  1.00 53.64 ? 286 ILE C O   1 
ATOM   6526  C CB  . ILE C 1 288 ? 104.427 44.604  85.545  1.00 31.61 ? 286 ILE C CB  1 
ATOM   6527  C CG1 . ILE C 1 288 ? 103.523 45.810  85.790  1.00 31.61 ? 286 ILE C CG1 1 
ATOM   6528  C CG2 . ILE C 1 288 ? 103.655 43.307  85.699  1.00 31.61 ? 286 ILE C CG2 1 
ATOM   6529  C CD1 . ILE C 1 288 ? 102.493 46.033  84.719  1.00 31.61 ? 286 ILE C CD1 1 
ATOM   6530  N N   . ASN C 1 289 ? 107.159 42.899  85.834  1.00 50.87 ? 287 ASN C N   1 
ATOM   6531  C CA  . ASN C 1 289 ? 107.778 41.594  85.991  1.00 50.87 ? 287 ASN C CA  1 
ATOM   6532  C C   . ASN C 1 289 ? 108.891 41.673  87.013  1.00 50.87 ? 287 ASN C C   1 
ATOM   6533  O O   . ASN C 1 289 ? 109.527 40.666  87.336  1.00 50.87 ? 287 ASN C O   1 
ATOM   6534  C CB  . ASN C 1 289 ? 108.314 41.090  84.667  1.00 64.97 ? 287 ASN C CB  1 
ATOM   6535  C CG  . ASN C 1 289 ? 107.218 40.798  83.702  1.00 64.97 ? 287 ASN C CG  1 
ATOM   6536  O OD1 . ASN C 1 289 ? 106.432 41.686  83.368  1.00 64.97 ? 287 ASN C OD1 1 
ATOM   6537  N ND2 . ASN C 1 289 ? 107.135 39.549  83.251  1.00 64.97 ? 287 ASN C ND2 1 
ATOM   6538  N N   . LEU C 1 290 ? 109.127 42.876  87.523  1.00 37.39 ? 288 LEU C N   1 
ATOM   6539  C CA  . LEU C 1 290 ? 110.154 43.060  88.537  1.00 37.39 ? 288 LEU C CA  1 
ATOM   6540  C C   . LEU C 1 290 ? 109.553 43.431  89.898  1.00 37.39 ? 288 LEU C C   1 
ATOM   6541  O O   . LEU C 1 290 ? 110.274 43.693  90.857  1.00 37.39 ? 288 LEU C O   1 
ATOM   6542  C CB  . LEU C 1 290 ? 111.166 44.115  88.091  1.00 21.89 ? 288 LEU C CB  1 
ATOM   6543  C CG  . LEU C 1 290 ? 112.169 43.673  87.021  1.00 21.89 ? 288 LEU C CG  1 
ATOM   6544  C CD1 . LEU C 1 290 ? 112.950 44.881  86.519  1.00 21.89 ? 288 LEU C CD1 1 
ATOM   6545  C CD2 . LEU C 1 290 ? 113.091 42.619  87.590  1.00 21.89 ? 288 LEU C CD2 1 
ATOM   6546  N N   . CYS C 1 291 ? 108.229 43.454  89.970  1.00 58.13 ? 289 CYS C N   1 
ATOM   6547  C CA  . CYS C 1 291 ? 107.520 43.750  91.208  1.00 58.13 ? 289 CYS C CA  1 
ATOM   6548  C C   . CYS C 1 291 ? 107.781 42.529  92.100  1.00 58.13 ? 289 CYS C C   1 
ATOM   6549  O O   . CYS C 1 291 ? 107.724 41.390  91.627  1.00 58.13 ? 289 CYS C O   1 
ATOM   6550  C CB  . CYS C 1 291 ? 106.023 43.892  90.905  1.00 59.64 ? 289 CYS C CB  1 
ATOM   6551  S SG  . CYS C 1 291 ? 104.926 44.267  92.293  1.00 59.64 ? 289 CYS C SG  1 
ATOM   6552  N N   . PRO C 1 292 ? 108.084 42.747  93.396  1.00 75.38 ? 290 PRO C N   1 
ATOM   6553  C CA  . PRO C 1 292 ? 108.356 41.648  94.331  1.00 75.38 ? 290 PRO C CA  1 
ATOM   6554  C C   . PRO C 1 292 ? 107.112 40.994  94.915  1.00 75.38 ? 290 PRO C C   1 
ATOM   6555  O O   . PRO C 1 292 ? 107.007 40.852  96.129  1.00 75.38 ? 290 PRO C O   1 
ATOM   6556  C CB  . PRO C 1 292 ? 109.190 42.324  95.409  1.00 28.63 ? 290 PRO C CB  1 
ATOM   6557  C CG  . PRO C 1 292 ? 108.545 43.666  95.508  1.00 28.63 ? 290 PRO C CG  1 
ATOM   6558  C CD  . PRO C 1 292 ? 108.314 44.051  94.048  1.00 28.63 ? 290 PRO C CD  1 
ATOM   6559  N N   . LEU C 1 293 ? 106.179 40.600  94.054  1.00 56.76 ? 291 LEU C N   1 
ATOM   6560  C CA  . LEU C 1 293 ? 104.938 39.963  94.488  1.00 56.76 ? 291 LEU C CA  1 
ATOM   6561  C C   . LEU C 1 293 ? 104.800 38.604  93.871  1.00 56.76 ? 291 LEU C C   1 
ATOM   6562  O O   . LEU C 1 293 ? 105.682 38.130  93.157  1.00 56.76 ? 291 LEU C O   1 
ATOM   6563  C CB  . LEU C 1 293 ? 103.723 40.767  94.031  1.00 17.26 ? 291 LEU C CB  1 
ATOM   6564  C CG  . LEU C 1 293 ? 103.160 41.828  94.951  1.00 17.26 ? 291 LEU C CG  1 
ATOM   6565  C CD1 . LEU C 1 293 ? 102.530 41.182  96.156  1.00 17.26 ? 291 LEU C CD1 1 
ATOM   6566  C CD2 . LEU C 1 293 ? 104.284 42.768  95.331  1.00 17.26 ? 291 LEU C CD2 1 
ATOM   6567  N N   . PRO C 1 294 ? 103.691 37.934  94.176  1.00 47.22 ? 292 PRO C N   1 
ATOM   6568  C CA  . PRO C 1 294 ? 103.497 36.618  93.575  1.00 47.22 ? 292 PRO C CA  1 
ATOM   6569  C C   . PRO C 1 294 ? 102.963 36.966  92.190  1.00 47.22 ? 292 PRO C C   1 
ATOM   6570  O O   . PRO C 1 294 ? 102.368 38.027  91.995  1.00 47.22 ? 292 PRO C O   1 
ATOM   6571  C CB  . PRO C 1 294 ? 102.430 35.976  94.456  1.00 26.49 ? 292 PRO C CB  1 
ATOM   6572  C CG  . PRO C 1 294 ? 102.649 36.639  95.768  1.00 26.49 ? 292 PRO C CG  1 
ATOM   6573  C CD  . PRO C 1 294 ? 102.868 38.081  95.383  1.00 26.49 ? 292 PRO C CD  1 
ATOM   6574  N N   . LYS C 1 295 ? 103.196 36.091  91.229  1.00 41.12 ? 293 LYS C N   1 
ATOM   6575  C CA  . LYS C 1 295 ? 102.750 36.305  89.871  1.00 42.51 ? 293 LYS C CA  1 
ATOM   6576  C C   . LYS C 1 295 ? 102.859 34.923  89.294  1.00 42.34 ? 293 LYS C C   1 
ATOM   6577  O O   . LYS C 1 295 ? 103.790 34.634  88.554  1.00 46.05 ? 293 LYS C O   1 
ATOM   6578  C CB  . LYS C 1 295 ? 103.703 37.251  89.144  1.00 28.49 ? 293 LYS C CB  1 
ATOM   6579  C CG  . LYS C 1 295 ? 103.699 38.690  89.675  1.00 47.87 ? 293 LYS C CG  1 
ATOM   6580  C CD  . LYS C 1 295 ? 104.977 39.458  89.301  1.00 35.07 ? 293 LYS C CD  1 
ATOM   6581  C CE  . LYS C 1 295 ? 106.213 38.847  89.976  1.00 42.99 ? 293 LYS C CE  1 
ATOM   6582  N NZ  . LYS C 1 295 ? 107.448 39.603  89.677  1.00 55.67 ? 293 LYS C NZ  1 
ATOM   6583  N N   . PRO C 1 296 ? 101.919 34.036  89.646  1.00 57.80 ? 294 PRO C N   1 
ATOM   6584  C CA  . PRO C 1 296 ? 101.908 32.656  89.163  1.00 47.32 ? 294 PRO C CA  1 
ATOM   6585  C C   . PRO C 1 296 ? 101.687 32.605  87.653  1.00 55.62 ? 294 PRO C C   1 
ATOM   6586  O O   . PRO C 1 296 ? 101.598 31.521  87.071  1.00 57.37 ? 294 PRO C O   1 
ATOM   6587  C CB  . PRO C 1 296 ? 100.738 32.052  89.919  1.00 65.60 ? 294 PRO C CB  1 
ATOM   6588  C CG  . PRO C 1 296 ? 99.764  33.179  89.893  1.00 71.00 ? 294 PRO C CG  1 
ATOM   6589  C CD  . PRO C 1 296 ? 100.638 34.356  90.297  1.00 66.19 ? 294 PRO C CD  1 
ATOM   6590  N N   . TRP C 1 297 ? 101.597 33.779  87.025  1.00 35.23 ? 295 TRP C N   1 
ATOM   6591  C CA  . TRP C 1 297 ? 101.365 33.851  85.585  1.00 28.87 ? 295 TRP C CA  1 
ATOM   6592  C C   . TRP C 1 297 ? 102.125 34.906  84.742  1.00 35.72 ? 295 TRP C C   1 
ATOM   6593  O O   . TRP C 1 297 ? 102.337 36.051  85.150  1.00 41.37 ? 295 TRP C O   1 
ATOM   6594  C CB  . TRP C 1 297 ? 99.844  33.969  85.313  1.00 43.91 ? 295 TRP C CB  1 
ATOM   6595  C CG  . TRP C 1 297 ? 99.012  34.555  86.435  1.00 55.08 ? 295 TRP C CG  1 
ATOM   6596  C CD1 . TRP C 1 297 ? 97.881  34.018  86.962  1.00 57.72 ? 295 TRP C CD1 1 
ATOM   6597  C CD2 . TRP C 1 297 ? 99.230  35.790  87.133  1.00 52.87 ? 295 TRP C CD2 1 
ATOM   6598  N NE1 . TRP C 1 297 ? 97.378  34.833  87.939  1.00 48.53 ? 295 TRP C NE1 1 
ATOM   6599  C CE2 . TRP C 1 297 ? 98.187  35.929  88.063  1.00 59.34 ? 295 TRP C CE2 1 
ATOM   6600  C CE3 . TRP C 1 297 ? 100.202 36.789  87.058  1.00 58.34 ? 295 TRP C CE3 1 
ATOM   6601  C CZ2 . TRP C 1 297 ? 98.088  37.028  88.915  1.00 49.53 ? 295 TRP C CZ2 1 
ATOM   6602  C CZ3 . TRP C 1 297 ? 100.101 37.881  87.905  1.00 57.06 ? 295 TRP C CZ3 1 
ATOM   6603  C CH2 . TRP C 1 297 ? 99.053  37.992  88.819  1.00 52.93 ? 295 TRP C CH2 1 
ATOM   6604  N N   . LYS C 1 298 ? 102.508 34.478  83.543  1.00 12.94 ? 296 LYS C N   1 
ATOM   6605  C CA  . LYS C 1 298 ? 103.214 35.292  82.570  1.00 12.44 ? 296 LYS C CA  1 
ATOM   6606  C C   . LYS C 1 298 ? 102.579 36.666  82.374  1.00 10.42 ? 296 LYS C C   1 
ATOM   6607  O O   . LYS C 1 298 ? 101.461 36.756  81.893  1.00 16.58 ? 296 LYS C O   1 
ATOM   6608  C CB  . LYS C 1 298 ? 103.196 34.553  81.240  1.00 35.07 ? 296 LYS C CB  1 
ATOM   6609  C CG  . LYS C 1 298 ? 103.611 33.082  81.314  1.00 31.95 ? 296 LYS C CG  1 
ATOM   6610  C CD  . LYS C 1 298 ? 105.136 32.927  81.237  1.00 41.44 ? 296 LYS C CD  1 
ATOM   6611  C CE  . LYS C 1 298 ? 105.550 31.699  80.430  1.00 46.28 ? 296 LYS C CE  1 
ATOM   6612  N NZ  . LYS C 1 298 ? 107.018 31.677  80.187  1.00 60.94 ? 296 LYS C NZ  1 
ATOM   6613  N N   . LEU C 1 299 ? 103.285 37.733  82.737  1.00 46.43 ? 297 LEU C N   1 
ATOM   6614  C CA  . LEU C 1 299 ? 102.769 39.098  82.559  1.00 38.27 ? 297 LEU C CA  1 
ATOM   6615  C C   . LEU C 1 299 ? 103.391 39.605  81.270  1.00 48.69 ? 297 LEU C C   1 
ATOM   6616  O O   . LEU C 1 299 ? 104.558 39.996  81.247  1.00 53.10 ? 297 LEU C O   1 
ATOM   6617  C CB  . LEU C 1 299 ? 103.194 39.994  83.720  1.00 10.01 ? 297 LEU C CB  1 
ATOM   6618  C CG  . LEU C 1 299 ? 102.617 39.608  85.080  1.00 27.43 ? 297 LEU C CG  1 
ATOM   6619  C CD1 . LEU C 1 299 ? 103.513 40.103  86.185  1.00 17.44 ? 297 LEU C CD1 1 
ATOM   6620  C CD2 . LEU C 1 299 ? 101.219 40.178  85.226  1.00 12.34 ? 297 LEU C CD2 1 
ATOM   6621  N N   . SER C 1 300 ? 102.610 39.605  80.197  1.00 24.50 ? 298 SER C N   1 
ATOM   6622  C CA  . SER C 1 300 ? 103.124 40.013  78.902  1.00 17.71 ? 298 SER C CA  1 
ATOM   6623  C C   . SER C 1 300 ? 102.491 41.305  78.407  1.00 29.20 ? 298 SER C C   1 
ATOM   6624  O O   . SER C 1 300 ? 102.185 42.200  79.198  1.00 31.76 ? 298 SER C O   1 
ATOM   6625  C CB  . SER C 1 300 ? 102.893 38.876  77.905  1.00 19.71 ? 298 SER C CB  1 
ATOM   6626  O OG  . SER C 1 300 ? 103.582 39.079  76.693  1.00 29.13 ? 298 SER C OG  1 
ATOM   6627  N N   . PHE C 1 301 ? 102.299 41.398  77.093  1.00 70.10 ? 299 PHE C N   1 
ATOM   6628  C CA  . PHE C 1 301 ? 101.710 42.583  76.478  1.00 76.30 ? 299 PHE C CA  1 
ATOM   6629  C C   . PHE C 1 301 ? 100.820 42.225  75.278  1.00 78.95 ? 299 PHE C C   1 
ATOM   6630  O O   . PHE C 1 301 ? 100.928 41.136  74.714  1.00 80.11 ? 299 PHE C O   1 
ATOM   6631  C CB  . PHE C 1 301 ? 102.820 43.545  76.032  1.00 33.52 ? 299 PHE C CB  1 
ATOM   6632  C CG  . PHE C 1 301 ? 103.770 42.953  75.037  1.00 40.32 ? 299 PHE C CG  1 
ATOM   6633  C CD1 . PHE C 1 301 ? 104.654 41.953  75.416  1.00 35.99 ? 299 PHE C CD1 1 
ATOM   6634  C CD2 . PHE C 1 301 ? 103.746 43.354  73.711  1.00 29.98 ? 299 PHE C CD2 1 
ATOM   6635  C CE1 . PHE C 1 301 ? 105.507 41.348  74.490  1.00 35.28 ? 299 PHE C CE1 1 
ATOM   6636  C CE2 . PHE C 1 301 ? 104.586 42.762  72.774  1.00 36.80 ? 299 PHE C CE2 1 
ATOM   6637  C CZ  . PHE C 1 301 ? 105.473 41.750  73.168  1.00 32.87 ? 299 PHE C CZ  1 
ATOM   6638  N N   . SER C 1 302 ? 99.934  43.152  74.914  1.00 61.10 ? 300 SER C N   1 
ATOM   6639  C CA  . SER C 1 302 ? 99.013  43.011  73.780  1.00 62.58 ? 300 SER C CA  1 
ATOM   6640  C C   . SER C 1 302 ? 98.819  44.452  73.331  1.00 62.01 ? 300 SER C C   1 
ATOM   6641  O O   . SER C 1 302 ? 97.721  45.012  73.380  1.00 63.68 ? 300 SER C O   1 
ATOM   6642  C CB  . SER C 1 302 ? 97.675  42.415  74.226  1.00 34.42 ? 300 SER C CB  1 
ATOM   6643  O OG  . SER C 1 302 ? 96.923  41.975  73.108  1.00 41.43 ? 300 SER C OG  1 
ATOM   6644  N N   . TYR C 1 303 ? 99.930  45.040  72.912  1.00 59.59 ? 301 TYR C N   1 
ATOM   6645  C CA  . TYR C 1 303 ? 99.980  46.428  72.486  1.00 55.17 ? 301 TYR C CA  1 
ATOM   6646  C C   . TYR C 1 303 ? 99.709  46.690  71.007  1.00 59.89 ? 301 TYR C C   1 
ATOM   6647  O O   . TYR C 1 303 ? 99.992  45.859  70.133  1.00 65.79 ? 301 TYR C O   1 
ATOM   6648  C CB  . TYR C 1 303 ? 101.359 47.025  72.787  1.00 63.21 ? 301 TYR C CB  1 
ATOM   6649  C CG  . TYR C 1 303 ? 101.890 46.883  74.197  1.00 70.05 ? 301 TYR C CG  1 
ATOM   6650  C CD1 . TYR C 1 303 ? 103.265 46.884  74.424  1.00 71.39 ? 301 TYR C CD1 1 
ATOM   6651  C CD2 . TYR C 1 303 ? 101.038 46.785  75.297  1.00 68.84 ? 301 TYR C CD2 1 
ATOM   6652  C CE1 . TYR C 1 303 ? 103.781 46.792  75.690  1.00 67.29 ? 301 TYR C CE1 1 
ATOM   6653  C CE2 . TYR C 1 303 ? 101.551 46.693  76.585  1.00 68.21 ? 301 TYR C CE2 1 
ATOM   6654  C CZ  . TYR C 1 303 ? 102.929 46.695  76.768  1.00 65.46 ? 301 TYR C CZ  1 
ATOM   6655  O OH  . TYR C 1 303 ? 103.471 46.574  78.024  1.00 66.43 ? 301 TYR C OH  1 
ATOM   6656  N N   . GLY C 1 304 ? 99.196  47.893  70.760  1.00 53.01 ? 302 GLY C N   1 
ATOM   6657  C CA  . GLY C 1 304 ? 98.908  48.363  69.422  1.00 51.05 ? 302 GLY C CA  1 
ATOM   6658  C C   . GLY C 1 304 ? 99.751  49.605  69.241  1.00 58.71 ? 302 GLY C C   1 
ATOM   6659  O O   . GLY C 1 304 ? 100.837 49.538  68.684  1.00 59.74 ? 302 GLY C O   1 
ATOM   6660  N N   . ARG C 1 305 ? 99.258  50.734  69.737  1.00 88.23 ? 303 ARG C N   1 
ATOM   6661  C CA  . ARG C 1 305 ? 99.979  52.001  69.648  1.00 91.29 ? 303 ARG C CA  1 
ATOM   6662  C C   . ARG C 1 305 ? 101.437 51.779  70.075  1.00 91.29 ? 303 ARG C C   1 
ATOM   6663  O O   . ARG C 1 305 ? 102.373 52.140  69.357  1.00 91.29 ? 303 ARG C O   1 
ATOM   6664  C CB  . ARG C 1 305 ? 99.349  53.057  70.579  1.00 36.86 ? 303 ARG C CB  1 
ATOM   6665  C CG  . ARG C 1 305 ? 97.906  53.532  70.255  1.00 54.12 ? 303 ARG C CG  1 
ATOM   6666  C CD  . ARG C 1 305 ? 96.851  52.397  70.183  1.00 49.80 ? 303 ARG C CD  1 
ATOM   6667  N NE  . ARG C 1 305 ? 96.732  51.603  71.406  1.00 59.99 ? 303 ARG C NE  1 
ATOM   6668  C CZ  . ARG C 1 305 ? 96.173  50.399  71.456  1.00 79.34 ? 303 ARG C CZ  1 
ATOM   6669  N NH1 . ARG C 1 305 ? 95.680  49.849  70.361  1.00 52.66 ? 303 ARG C NH1 1 
ATOM   6670  N NH2 . ARG C 1 305 ? 96.127  49.734  72.595  1.00 82.86 ? 303 ARG C NH2 1 
ATOM   6671  N N   . ALA C 1 306 ? 101.614 51.169  71.245  1.00 80.97 ? 304 ALA C N   1 
ATOM   6672  C CA  . ALA C 1 306 ? 102.936 50.908  71.815  1.00 79.37 ? 304 ALA C CA  1 
ATOM   6673  C C   . ALA C 1 306 ? 103.873 50.060  70.962  1.00 83.09 ? 304 ALA C C   1 
ATOM   6674  O O   . ALA C 1 306 ? 105.058 49.932  71.279  1.00 83.09 ? 304 ALA C O   1 
ATOM   6675  C CB  . ALA C 1 306 ? 102.782 50.278  73.198  1.00 55.09 ? 304 ALA C CB  1 
ATOM   6676  N N   . LEU C 1 307 ? 103.355 49.468  69.895  1.00 44.96 ? 305 LEU C N   1 
ATOM   6677  C CA  . LEU C 1 307 ? 104.201 48.667  69.029  1.00 44.01 ? 305 LEU C CA  1 
ATOM   6678  C C   . LEU C 1 307 ? 104.304 49.250  67.614  1.00 49.29 ? 305 LEU C C   1 
ATOM   6679  O O   . LEU C 1 307 ? 105.241 48.935  66.860  1.00 51.48 ? 305 LEU C O   1 
ATOM   6680  C CB  . LEU C 1 307 ? 103.696 47.218  68.968  1.00 36.56 ? 305 LEU C CB  1 
ATOM   6681  C CG  . LEU C 1 307 ? 104.421 46.243  69.901  1.00 49.67 ? 305 LEU C CG  1 
ATOM   6682  C CD1 . LEU C 1 307 ? 103.941 44.822  69.698  1.00 43.00 ? 305 LEU C CD1 1 
ATOM   6683  C CD2 . LEU C 1 307 ? 105.894 46.303  69.614  1.00 39.85 ? 305 LEU C CD2 1 
ATOM   6684  N N   . GLN C 1 308 ? 103.371 50.131  67.266  1.00 70.45 ? 306 GLN C N   1 
ATOM   6685  C CA  . GLN C 1 308 ? 103.353 50.699  65.926  1.00 70.45 ? 306 GLN C CA  1 
ATOM   6686  C C   . GLN C 1 308 ? 103.791 52.154  65.756  1.00 70.45 ? 306 GLN C C   1 
ATOM   6687  O O   . GLN C 1 308 ? 104.617 52.435  64.898  1.00 70.45 ? 306 GLN C O   1 
ATOM   6688  C CB  . GLN C 1 308 ? 101.960 50.489  65.311  1.00 77.95 ? 306 GLN C CB  1 
ATOM   6689  C CG  . GLN C 1 308 ? 101.468 49.036  65.437  1.00 77.95 ? 306 GLN C CG  1 
ATOM   6690  C CD  . GLN C 1 308 ? 100.101 48.794  64.816  1.00 77.95 ? 306 GLN C CD  1 
ATOM   6691  O OE1 . GLN C 1 308 ? 99.957  48.764  63.596  1.00 77.95 ? 306 GLN C OE1 1 
ATOM   6692  N NE2 . GLN C 1 308 ? 99.090  48.619  65.660  1.00 77.95 ? 306 GLN C NE2 1 
ATOM   6693  N N   . ALA C 1 309 ? 103.259 53.071  66.561  1.00 90.96 ? 307 ALA C N   1 
ATOM   6694  C CA  . ALA C 1 309 ? 103.600 54.499  66.449  1.00 90.96 ? 307 ALA C CA  1 
ATOM   6695  C C   . ALA C 1 309 ? 104.891 54.853  65.702  1.00 90.96 ? 307 ALA C C   1 
ATOM   6696  O O   . ALA C 1 309 ? 104.838 55.541  64.679  1.00 90.96 ? 307 ALA C O   1 
ATOM   6697  C CB  . ALA C 1 309 ? 103.626 55.143  67.826  1.00 27.53 ? 307 ALA C CB  1 
ATOM   6698  N N   . SER C 1 310 ? 106.040 54.396  66.204  1.00 78.16 ? 308 SER C N   1 
ATOM   6699  C CA  . SER C 1 310 ? 107.325 54.701  65.567  1.00 78.16 ? 308 SER C CA  1 
ATOM   6700  C C   . SER C 1 310 ? 107.492 54.087  64.171  1.00 78.16 ? 308 SER C C   1 
ATOM   6701  O O   . SER C 1 310 ? 107.918 54.777  63.241  1.00 78.16 ? 308 SER C O   1 
ATOM   6702  C CB  . SER C 1 310 ? 108.484 54.258  66.462  1.00 74.11 ? 308 SER C CB  1 
ATOM   6703  O OG  . SER C 1 310 ? 108.502 52.851  66.605  1.00 74.11 ? 308 SER C OG  1 
ATOM   6704  N N   . ALA C 1 311 ? 107.166 52.802  64.019  1.00 69.12 ? 309 ALA C N   1 
ATOM   6705  C CA  . ALA C 1 311 ? 107.287 52.137  62.715  1.00 69.12 ? 309 ALA C CA  1 
ATOM   6706  C C   . ALA C 1 311 ? 106.269 52.702  61.738  1.00 69.12 ? 309 ALA C C   1 
ATOM   6707  O O   . ALA C 1 311 ? 106.359 52.479  60.533  1.00 69.12 ? 309 ALA C O   1 
ATOM   6708  C CB  . ALA C 1 311 ? 107.081 50.624  62.849  1.00 16.10 ? 309 ALA C CB  1 
ATOM   6709  N N   . LEU C 1 312 ? 105.301 53.438  62.268  1.00 92.42 ? 310 LEU C N   1 
ATOM   6710  C CA  . LEU C 1 312 ? 104.269 54.029  61.437  1.00 92.42 ? 310 LEU C CA  1 
ATOM   6711  C C   . LEU C 1 312 ? 104.660 55.447  61.017  1.00 92.42 ? 310 LEU C C   1 
ATOM   6712  O O   . LEU C 1 312 ? 104.204 55.936  59.987  1.00 92.42 ? 310 LEU C O   1 
ATOM   6713  C CB  . LEU C 1 312 ? 102.923 54.019  62.183  1.00 38.33 ? 310 LEU C CB  1 
ATOM   6714  C CG  . LEU C 1 312 ? 101.625 54.166  61.367  1.00 38.33 ? 310 LEU C CG  1 
ATOM   6715  C CD1 . LEU C 1 312 ? 101.650 53.280  60.114  1.00 38.33 ? 310 LEU C CD1 1 
ATOM   6716  C CD2 . LEU C 1 312 ? 100.446 53.799  62.257  1.00 38.33 ? 310 LEU C CD2 1 
ATOM   6717  N N   . ALA C 1 313 ? 105.510 56.105  61.800  1.00 80.02 ? 311 ALA C N   1 
ATOM   6718  C CA  . ALA C 1 313 ? 105.947 57.454  61.456  1.00 80.02 ? 311 ALA C CA  1 
ATOM   6719  C C   . ALA C 1 313 ? 107.137 57.353  60.507  1.00 80.02 ? 311 ALA C C   1 
ATOM   6720  O O   . ALA C 1 313 ? 107.372 58.234  59.680  1.00 80.02 ? 311 ALA C O   1 
ATOM   6721  C CB  . ALA C 1 313 ? 106.338 58.221  62.714  1.00 26.24 ? 311 ALA C CB  1 
ATOM   6722  N N   . ALA C 1 314 ? 107.877 56.258  60.627  1.00 58.74 ? 312 ALA C N   1 
ATOM   6723  C CA  . ALA C 1 314 ? 109.043 56.025  59.787  1.00 58.74 ? 312 ALA C CA  1 
ATOM   6724  C C   . ALA C 1 314 ? 108.642 55.721  58.344  1.00 58.74 ? 312 ALA C C   1 
ATOM   6725  O O   . ALA C 1 314 ? 109.388 55.992  57.404  1.00 58.74 ? 312 ALA C O   1 
ATOM   6726  C CB  . ALA C 1 314 ? 109.855 54.877  60.353  1.00 32.73 ? 312 ALA C CB  1 
ATOM   6727  N N   . TRP C 1 315 ? 107.457 55.151  58.178  1.00 91.33 ? 313 TRP C N   1 
ATOM   6728  C CA  . TRP C 1 315 ? 106.946 54.811  56.855  1.00 91.33 ? 313 TRP C CA  1 
ATOM   6729  C C   . TRP C 1 315 ? 106.319 56.048  56.234  1.00 91.33 ? 313 TRP C C   1 
ATOM   6730  O O   . TRP C 1 315 ? 106.669 56.441  55.122  1.00 91.33 ? 313 TRP C O   1 
ATOM   6731  C CB  . TRP C 1 315 ? 105.896 53.710  56.985  1.00 91.35 ? 313 TRP C CB  1 
ATOM   6732  C CG  . TRP C 1 315 ? 105.357 53.157  55.694  1.00 91.35 ? 313 TRP C CG  1 
ATOM   6733  C CD1 . TRP C 1 315 ? 106.074 52.578  54.683  1.00 91.35 ? 313 TRP C CD1 1 
ATOM   6734  C CD2 . TRP C 1 315 ? 103.974 53.017  55.336  1.00 91.35 ? 313 TRP C CD2 1 
ATOM   6735  N NE1 . TRP C 1 315 ? 105.222 52.077  53.724  1.00 91.35 ? 313 TRP C NE1 1 
ATOM   6736  C CE2 . TRP C 1 315 ? 103.928 52.333  54.100  1.00 91.35 ? 313 TRP C CE2 1 
ATOM   6737  C CE3 . TRP C 1 315 ? 102.767 53.399  55.945  1.00 91.35 ? 313 TRP C CE3 1 
ATOM   6738  C CZ2 . TRP C 1 315 ? 102.722 52.019  53.460  1.00 91.35 ? 313 TRP C CZ2 1 
ATOM   6739  C CZ3 . TRP C 1 315 ? 101.568 53.085  55.309  1.00 91.35 ? 313 TRP C CZ3 1 
ATOM   6740  C CH2 . TRP C 1 315 ? 101.557 52.400  54.080  1.00 91.35 ? 313 TRP C CH2 1 
ATOM   6741  N N   . GLY C 1 316 ? 105.389 56.654  56.967  1.00 92.42 ? 314 GLY C N   1 
ATOM   6742  C CA  . GLY C 1 316 ? 104.718 57.848  56.489  1.00 92.42 ? 314 GLY C CA  1 
ATOM   6743  C C   . GLY C 1 316 ? 104.170 57.669  55.088  1.00 92.42 ? 314 GLY C C   1 
ATOM   6744  O O   . GLY C 1 316 ? 103.865 58.646  54.399  1.00 92.42 ? 314 GLY C O   1 
ATOM   6745  N N   . GLY C 1 317 ? 104.051 56.417  54.659  1.00 83.30 ? 315 GLY C N   1 
ATOM   6746  C CA  . GLY C 1 317 ? 103.534 56.156  53.329  1.00 83.30 ? 315 GLY C CA  1 
ATOM   6747  C C   . GLY C 1 317 ? 104.567 55.796  52.273  1.00 83.30 ? 315 GLY C C   1 
ATOM   6748  O O   . GLY C 1 317 ? 104.333 54.879  51.484  1.00 83.30 ? 315 GLY C O   1 
ATOM   6749  N N   . LYS C 1 318 ? 105.699 56.502  52.245  1.00 75.44 ? 316 LYS C N   1 
ATOM   6750  C CA  . LYS C 1 318 ? 106.746 56.227  51.256  1.00 75.44 ? 316 LYS C CA  1 
ATOM   6751  C C   . LYS C 1 318 ? 107.094 54.744  51.267  1.00 75.44 ? 316 LYS C C   1 
ATOM   6752  O O   . LYS C 1 318 ? 107.984 54.326  52.001  1.00 75.44 ? 316 LYS C O   1 
ATOM   6753  C CB  . LYS C 1 318 ? 108.024 57.026  51.554  1.00 92.42 ? 316 LYS C CB  1 
ATOM   6754  C CG  . LYS C 1 318 ? 107.836 58.517  51.823  1.00 92.42 ? 316 LYS C CG  1 
ATOM   6755  C CD  . LYS C 1 318 ? 109.170 59.272  51.679  1.00 92.42 ? 316 LYS C CD  1 
ATOM   6756  C CE  . LYS C 1 318 ? 109.214 60.581  52.486  1.00 92.42 ? 316 LYS C CE  1 
ATOM   6757  N NZ  . LYS C 1 318 ? 109.480 60.374  53.951  1.00 92.42 ? 316 LYS C NZ  1 
ATOM   6758  N N   . ALA C 1 319 ? 106.398 53.951  50.455  1.00 76.16 ? 317 ALA C N   1 
ATOM   6759  C CA  . ALA C 1 319 ? 106.642 52.513  50.388  1.00 76.16 ? 317 ALA C CA  1 
ATOM   6760  C C   . ALA C 1 319 ? 108.096 52.221  50.007  1.00 76.16 ? 317 ALA C C   1 
ATOM   6761  O O   . ALA C 1 319 ? 108.443 51.098  49.628  1.00 76.16 ? 317 ALA C O   1 
ATOM   6762  C CB  . ALA C 1 319 ? 105.687 51.865  49.385  1.00 88.65 ? 317 ALA C CB  1 
ATOM   6763  N N   . ALA C 1 320 ? 108.935 53.250  50.111  1.00 92.42 ? 318 ALA C N   1 
ATOM   6764  C CA  . ALA C 1 320 ? 110.359 53.150  49.812  1.00 92.42 ? 318 ALA C CA  1 
ATOM   6765  C C   . ALA C 1 320 ? 111.143 53.029  51.126  1.00 92.42 ? 318 ALA C C   1 
ATOM   6766  O O   . ALA C 1 320 ? 112.345 52.755  51.119  1.00 92.42 ? 318 ALA C O   1 
ATOM   6767  C CB  . ALA C 1 320 ? 110.816 54.382  49.031  1.00 54.01 ? 318 ALA C CB  1 
ATOM   6768  N N   . ASN C 1 321 ? 110.450 53.240  52.248  1.00 46.92 ? 319 ASN C N   1 
ATOM   6769  C CA  . ASN C 1 321 ? 111.057 53.146  53.576  1.00 46.92 ? 319 ASN C CA  1 
ATOM   6770  C C   . ASN C 1 321 ? 110.663 51.831  54.234  1.00 46.92 ? 319 ASN C C   1 
ATOM   6771  O O   . ASN C 1 321 ? 110.441 51.795  55.442  1.00 46.92 ? 319 ASN C O   1 
ATOM   6772  C CB  . ASN C 1 321 ? 110.605 54.301  54.489  1.00 92.42 ? 319 ASN C CB  1 
ATOM   6773  C CG  . ASN C 1 321 ? 110.998 55.677  53.958  1.00 92.42 ? 319 ASN C CG  1 
ATOM   6774  O OD1 . ASN C 1 321 ? 112.068 55.850  53.367  1.00 92.42 ? 319 ASN C OD1 1 
ATOM   6775  N ND2 . ASN C 1 321 ? 110.138 56.668  54.189  1.00 92.42 ? 319 ASN C ND2 1 
ATOM   6776  N N   . LYS C 1 322 ? 110.576 50.761  53.439  1.00 60.04 ? 320 LYS C N   1 
ATOM   6777  C CA  . LYS C 1 322 ? 110.204 49.432  53.935  1.00 60.04 ? 320 LYS C CA  1 
ATOM   6778  C C   . LYS C 1 322 ? 111.081 48.995  55.119  1.00 60.04 ? 320 LYS C C   1 
ATOM   6779  O O   . LYS C 1 322 ? 110.567 48.504  56.133  1.00 60.04 ? 320 LYS C O   1 
ATOM   6780  C CB  . LYS C 1 322 ? 110.301 48.402  52.801  1.00 65.21 ? 320 LYS C CB  1 
ATOM   6781  C CG  . LYS C 1 322 ? 109.886 46.968  53.184  1.00 65.21 ? 320 LYS C CG  1 
ATOM   6782  C CD  . LYS C 1 322 ? 110.160 45.967  52.039  1.00 65.21 ? 320 LYS C CD  1 
ATOM   6783  C CE  . LYS C 1 322 ? 109.830 44.508  52.396  1.00 65.21 ? 320 LYS C CE  1 
ATOM   6784  N NZ  . LYS C 1 322 ? 108.365 44.226  52.446  1.00 65.21 ? 320 LYS C NZ  1 
ATOM   6785  N N   . GLU C 1 323 ? 112.397 49.179  54.982  1.00 62.34 ? 321 GLU C N   1 
ATOM   6786  C CA  . GLU C 1 323 ? 113.362 48.828  56.027  1.00 62.34 ? 321 GLU C CA  1 
ATOM   6787  C C   . GLU C 1 323 ? 113.257 49.759  57.229  1.00 62.34 ? 321 GLU C C   1 
ATOM   6788  O O   . GLU C 1 323 ? 112.972 49.317  58.341  1.00 62.34 ? 321 GLU C O   1 
ATOM   6789  C CB  . GLU C 1 323 ? 114.797 48.917  55.506  1.00 92.42 ? 321 GLU C CB  1 
ATOM   6790  C CG  . GLU C 1 323 ? 115.245 47.815  54.567  1.00 92.42 ? 321 GLU C CG  1 
ATOM   6791  C CD  . GLU C 1 323 ? 116.770 47.766  54.438  1.00 92.42 ? 321 GLU C CD  1 
ATOM   6792  O OE1 . GLU C 1 323 ? 117.444 47.493  55.463  1.00 92.42 ? 321 GLU C OE1 1 
ATOM   6793  O OE2 . GLU C 1 323 ? 117.294 48.004  53.321  1.00 92.42 ? 321 GLU C OE2 1 
ATOM   6794  N N   . ALA C 1 324 ? 113.510 51.047  56.998  1.00 47.95 ? 322 ALA C N   1 
ATOM   6795  C CA  . ALA C 1 324 ? 113.463 52.062  58.052  1.00 47.95 ? 322 ALA C CA  1 
ATOM   6796  C C   . ALA C 1 324 ? 112.259 51.882  58.961  1.00 47.95 ? 322 ALA C C   1 
ATOM   6797  O O   . ALA C 1 324 ? 112.346 52.089  60.174  1.00 47.95 ? 322 ALA C O   1 
ATOM   6798  C CB  . ALA C 1 324 ? 113.434 53.454  57.434  1.00 46.82 ? 322 ALA C CB  1 
ATOM   6799  N N   . THR C 1 325 ? 111.139 51.495  58.357  1.00 80.34 ? 323 THR C N   1 
ATOM   6800  C CA  . THR C 1 325 ? 109.880 51.270  59.061  1.00 80.34 ? 323 THR C CA  1 
ATOM   6801  C C   . THR C 1 325 ? 109.842 49.976  59.876  1.00 80.34 ? 323 THR C C   1 
ATOM   6802  O O   . THR C 1 325 ? 109.363 49.974  61.012  1.00 80.34 ? 323 THR C O   1 
ATOM   6803  C CB  . THR C 1 325 ? 108.713 51.282  58.061  1.00 63.03 ? 323 THR C CB  1 
ATOM   6804  O OG1 . THR C 1 325 ? 108.373 52.641  57.768  1.00 63.03 ? 323 THR C OG1 1 
ATOM   6805  C CG2 . THR C 1 325 ? 107.503 50.546  58.608  1.00 63.03 ? 323 THR C CG2 1 
ATOM   6806  N N   . GLN C 1 326 ? 110.337 48.884  59.295  1.00 92.42 ? 324 GLN C N   1 
ATOM   6807  C CA  . GLN C 1 326 ? 110.368 47.594  59.985  1.00 92.42 ? 324 GLN C CA  1 
ATOM   6808  C C   . GLN C 1 326 ? 111.317 47.591  61.196  1.00 92.42 ? 324 GLN C C   1 
ATOM   6809  O O   . GLN C 1 326 ? 111.214 46.734  62.075  1.00 92.42 ? 324 GLN C O   1 
ATOM   6810  C CB  . GLN C 1 326 ? 110.780 46.482  59.022  1.00 73.04 ? 324 GLN C CB  1 
ATOM   6811  C CG  . GLN C 1 326 ? 109.820 46.234  57.882  1.00 73.04 ? 324 GLN C CG  1 
ATOM   6812  C CD  . GLN C 1 326 ? 110.296 45.115  56.974  1.00 73.04 ? 324 GLN C CD  1 
ATOM   6813  O OE1 . GLN C 1 326 ? 111.348 45.219  56.337  1.00 73.04 ? 324 GLN C OE1 1 
ATOM   6814  N NE2 . GLN C 1 326 ? 109.527 44.034  56.916  1.00 73.04 ? 324 GLN C NE2 1 
ATOM   6815  N N   . GLU C 1 327 ? 112.253 48.537  61.230  1.00 79.18 ? 325 GLU C N   1 
ATOM   6816  C CA  . GLU C 1 327 ? 113.193 48.653  62.346  1.00 79.18 ? 325 GLU C CA  1 
ATOM   6817  C C   . GLU C 1 327 ? 112.413 49.060  63.583  1.00 79.18 ? 325 GLU C C   1 
ATOM   6818  O O   . GLU C 1 327 ? 112.343 48.327  64.563  1.00 79.18 ? 325 GLU C O   1 
ATOM   6819  C CB  . GLU C 1 327 ? 114.226 49.738  62.057  1.00 92.42 ? 325 GLU C CB  1 
ATOM   6820  C CG  . GLU C 1 327 ? 115.103 49.457  60.867  1.00 92.42 ? 325 GLU C CG  1 
ATOM   6821  C CD  . GLU C 1 327 ? 116.185 48.449  61.175  1.00 92.42 ? 325 GLU C CD  1 
ATOM   6822  O OE1 . GLU C 1 327 ? 115.861 47.316  61.611  1.00 92.42 ? 325 GLU C OE1 1 
ATOM   6823  O OE2 . GLU C 1 327 ? 117.365 48.804  60.974  1.00 92.42 ? 325 GLU C OE2 1 
ATOM   6824  N N   . ALA C 1 328 ? 111.830 50.252  63.514  1.00 91.35 ? 326 ALA C N   1 
ATOM   6825  C CA  . ALA C 1 328 ? 111.040 50.802  64.603  1.00 91.35 ? 326 ALA C CA  1 
ATOM   6826  C C   . ALA C 1 328 ? 110.025 49.801  65.147  1.00 91.35 ? 326 ALA C C   1 
ATOM   6827  O O   . ALA C 1 328 ? 109.498 49.985  66.243  1.00 91.35 ? 326 ALA C O   1 
ATOM   6828  C CB  . ALA C 1 328 ? 110.333 52.064  64.134  1.00 92.42 ? 326 ALA C CB  1 
ATOM   6829  N N   . PHE C 1 329 ? 109.738 48.753  64.377  1.00 64.61 ? 327 PHE C N   1 
ATOM   6830  C CA  . PHE C 1 329 ? 108.798 47.728  64.818  1.00 64.61 ? 327 PHE C CA  1 
ATOM   6831  C C   . PHE C 1 329 ? 109.572 46.546  65.363  1.00 64.61 ? 327 PHE C C   1 
ATOM   6832  O O   . PHE C 1 329 ? 109.166 45.923  66.333  1.00 64.61 ? 327 PHE C O   1 
ATOM   6833  C CB  . PHE C 1 329 ? 107.910 47.244  63.677  1.00 46.60 ? 327 PHE C CB  1 
ATOM   6834  C CG  . PHE C 1 329 ? 107.114 46.031  64.030  1.00 46.60 ? 327 PHE C CG  1 
ATOM   6835  C CD1 . PHE C 1 329 ? 106.093 46.107  64.964  1.00 46.60 ? 327 PHE C CD1 1 
ATOM   6836  C CD2 . PHE C 1 329 ? 107.414 44.795  63.470  1.00 46.60 ? 327 PHE C CD2 1 
ATOM   6837  C CE1 . PHE C 1 329 ? 105.373 44.961  65.343  1.00 46.60 ? 327 PHE C CE1 1 
ATOM   6838  C CE2 . PHE C 1 329 ? 106.704 43.641  63.839  1.00 46.60 ? 327 PHE C CE2 1 
ATOM   6839  C CZ  . PHE C 1 329 ? 105.682 43.725  64.778  1.00 46.60 ? 327 PHE C CZ  1 
ATOM   6840  N N   . MET C 1 330 ? 110.690 46.234  64.725  1.00 88.60 ? 328 MET C N   1 
ATOM   6841  C CA  . MET C 1 330 ? 111.531 45.128  65.155  1.00 88.60 ? 328 MET C CA  1 
ATOM   6842  C C   . MET C 1 330 ? 112.177 45.432  66.512  1.00 88.60 ? 328 MET C C   1 
ATOM   6843  O O   . MET C 1 330 ? 112.557 44.527  67.252  1.00 88.60 ? 328 MET C O   1 
ATOM   6844  C CB  . MET C 1 330 ? 112.616 44.871  64.108  1.00 83.08 ? 328 MET C CB  1 
ATOM   6845  C CG  . MET C 1 330 ? 112.364 43.672  63.217  1.00 83.08 ? 328 MET C CG  1 
ATOM   6846  S SD  . MET C 1 330 ? 112.547 42.123  64.112  1.00 83.08 ? 328 MET C SD  1 
ATOM   6847  C CE  . MET C 1 330 ? 114.363 41.981  64.199  1.00 83.08 ? 328 MET C CE  1 
ATOM   6848  N N   . LYS C 1 331 ? 112.289 46.714  66.838  1.00 83.73 ? 329 LYS C N   1 
ATOM   6849  C CA  . LYS C 1 331 ? 112.904 47.137  68.088  1.00 83.73 ? 329 LYS C CA  1 
ATOM   6850  C C   . LYS C 1 331 ? 111.906 47.064  69.233  1.00 83.73 ? 329 LYS C C   1 
ATOM   6851  O O   . LYS C 1 331 ? 112.187 46.464  70.272  1.00 83.73 ? 329 LYS C O   1 
ATOM   6852  C CB  . LYS C 1 331 ? 113.420 48.565  67.935  1.00 49.05 ? 329 LYS C CB  1 
ATOM   6853  C CG  . LYS C 1 331 ? 114.228 49.108  69.091  1.00 49.05 ? 329 LYS C CG  1 
ATOM   6854  C CD  . LYS C 1 331 ? 114.449 50.588  68.835  1.00 49.05 ? 329 LYS C CD  1 
ATOM   6855  C CE  . LYS C 1 331 ? 115.195 51.277  69.951  1.00 49.05 ? 329 LYS C CE  1 
ATOM   6856  N NZ  . LYS C 1 331 ? 115.117 52.755  69.803  1.00 49.05 ? 329 LYS C NZ  1 
ATOM   6857  N N   . ARG C 1 332 ? 110.741 47.678  69.040  1.00 53.27 ? 330 ARG C N   1 
ATOM   6858  C CA  . ARG C 1 332 ? 109.709 47.673  70.070  1.00 53.27 ? 330 ARG C CA  1 
ATOM   6859  C C   . ARG C 1 332 ? 109.285 46.242  70.331  1.00 53.27 ? 330 ARG C C   1 
ATOM   6860  O O   . ARG C 1 332 ? 108.902 45.887  71.436  1.00 53.27 ? 330 ARG C O   1 
ATOM   6861  C CB  . ARG C 1 332 ? 108.492 48.487  69.630  1.00 65.14 ? 330 ARG C CB  1 
ATOM   6862  C CG  . ARG C 1 332 ? 108.806 49.898  69.181  1.00 65.14 ? 330 ARG C CG  1 
ATOM   6863  C CD  . ARG C 1 332 ? 109.768 50.580  70.126  1.00 65.14 ? 330 ARG C CD  1 
ATOM   6864  N NE  . ARG C 1 332 ? 109.496 50.209  71.507  1.00 65.14 ? 330 ARG C NE  1 
ATOM   6865  C CZ  . ARG C 1 332 ? 110.057 50.788  72.564  1.00 65.14 ? 330 ARG C CZ  1 
ATOM   6866  N NH1 . ARG C 1 332 ? 110.927 51.778  72.401  1.00 65.14 ? 330 ARG C NH1 1 
ATOM   6867  N NH2 . ARG C 1 332 ? 109.749 50.370  73.784  1.00 65.14 ? 330 ARG C NH2 1 
ATOM   6868  N N   . ALA C 1 333 ? 109.362 45.413  69.301  1.00 40.49 ? 331 ALA C N   1 
ATOM   6869  C CA  . ALA C 1 333 ? 108.969 44.017  69.441  1.00 40.49 ? 331 ALA C CA  1 
ATOM   6870  C C   . ALA C 1 333 ? 109.894 43.319  70.402  1.00 40.49 ? 331 ALA C C   1 
ATOM   6871  O O   . ALA C 1 333 ? 109.441 42.588  71.272  1.00 40.49 ? 331 ALA C O   1 
ATOM   6872  C CB  . ALA C 1 333 ? 109.000 43.318  68.092  1.00 92.42 ? 331 ALA C CB  1 
ATOM   6873  N N   . MET C 1 334 ? 111.192 43.544  70.235  1.00 50.45 ? 332 MET C N   1 
ATOM   6874  C CA  . MET C 1 334 ? 112.173 42.928  71.106  1.00 50.45 ? 332 MET C CA  1 
ATOM   6875  C C   . MET C 1 334 ? 112.192 43.673  72.440  1.00 50.45 ? 332 MET C C   1 
ATOM   6876  O O   . MET C 1 334 ? 112.391 43.068  73.499  1.00 50.45 ? 332 MET C O   1 
ATOM   6877  C CB  . MET C 1 334 ? 113.556 42.932  70.432  1.00 78.50 ? 332 MET C CB  1 
ATOM   6878  C CG  . MET C 1 334 ? 113.600 42.104  69.132  1.00 78.50 ? 332 MET C CG  1 
ATOM   6879  S SD  . MET C 1 334 ? 115.257 41.719  68.458  1.00 78.50 ? 332 MET C SD  1 
ATOM   6880  C CE  . MET C 1 334 ? 115.466 43.023  67.198  1.00 78.50 ? 332 MET C CE  1 
ATOM   6881  N N   . ALA C 1 335 ? 111.950 44.980  72.382  1.00 43.97 ? 333 ALA C N   1 
ATOM   6882  C CA  . ALA C 1 335 ? 111.922 45.822  73.578  1.00 43.97 ? 333 ALA C CA  1 
ATOM   6883  C C   . ALA C 1 335 ? 110.932 45.278  74.598  1.00 43.97 ? 333 ALA C C   1 
ATOM   6884  O O   . ALA C 1 335 ? 111.297 44.832  75.684  1.00 43.97 ? 333 ALA C O   1 
ATOM   6885  C CB  . ALA C 1 335 ? 111.522 47.234  73.201  1.00 9.99  ? 333 ALA C CB  1 
ATOM   6886  N N   . ASN C 1 336 ? 109.663 45.327  74.226  1.00 72.82 ? 334 ASN C N   1 
ATOM   6887  C CA  . ASN C 1 336 ? 108.599 44.856  75.079  1.00 72.82 ? 334 ASN C CA  1 
ATOM   6888  C C   . ASN C 1 336 ? 108.658 43.356  75.312  1.00 72.82 ? 334 ASN C C   1 
ATOM   6889  O O   . ASN C 1 336 ? 107.811 42.803  75.992  1.00 72.82 ? 334 ASN C O   1 
ATOM   6890  C CB  . ASN C 1 336 ? 107.266 45.285  74.481  1.00 32.90 ? 334 ASN C CB  1 
ATOM   6891  C CG  . ASN C 1 336 ? 107.133 46.798  74.430  1.00 32.90 ? 334 ASN C CG  1 
ATOM   6892  O OD1 . ASN C 1 336 ? 107.234 47.455  75.461  1.00 32.90 ? 334 ASN C OD1 1 
ATOM   6893  N ND2 . ASN C 1 336 ? 106.926 47.361  73.238  1.00 32.90 ? 334 ASN C ND2 1 
ATOM   6894  N N   . CYS C 1 337 ? 109.650 42.686  74.738  1.00 49.75 ? 335 CYS C N   1 
ATOM   6895  C CA  . CYS C 1 337 ? 109.791 41.262  74.989  1.00 49.75 ? 335 CYS C CA  1 
ATOM   6896  C C   . CYS C 1 337 ? 110.606 41.193  76.259  1.00 49.75 ? 335 CYS C C   1 
ATOM   6897  O O   . CYS C 1 337 ? 110.242 40.499  77.207  1.00 49.75 ? 335 CYS C O   1 
ATOM   6898  C CB  . CYS C 1 337 ? 110.565 40.539  73.898  1.00 47.31 ? 335 CYS C CB  1 
ATOM   6899  S SG  . CYS C 1 337 ? 110.998 38.865  74.454  1.00 47.31 ? 335 CYS C SG  1 
ATOM   6900  N N   . GLN C 1 338 ? 111.720 41.923  76.270  1.00 57.61 ? 336 GLN C N   1 
ATOM   6901  C CA  . GLN C 1 338 ? 112.589 41.972  77.444  1.00 57.61 ? 336 GLN C CA  1 
ATOM   6902  C C   . GLN C 1 338 ? 111.804 42.558  78.609  1.00 57.61 ? 336 GLN C C   1 
ATOM   6903  O O   . GLN C 1 338 ? 112.035 42.210  79.760  1.00 57.61 ? 336 GLN C O   1 
ATOM   6904  C CB  . GLN C 1 338 ? 113.803 42.863  77.194  1.00 59.01 ? 336 GLN C CB  1 
ATOM   6905  C CG  . GLN C 1 338 ? 114.602 42.558  75.932  1.00 59.01 ? 336 GLN C CG  1 
ATOM   6906  C CD  . GLN C 1 338 ? 115.974 43.194  75.979  1.00 59.01 ? 336 GLN C CD  1 
ATOM   6907  O OE1 . GLN C 1 338 ? 116.906 42.640  76.571  1.00 59.01 ? 336 GLN C OE1 1 
ATOM   6908  N NE2 . GLN C 1 338 ? 116.101 44.376  75.379  1.00 59.01 ? 336 GLN C NE2 1 
ATOM   6909  N N   . ALA C 1 339 ? 110.892 43.473  78.296  1.00 50.15 ? 337 ALA C N   1 
ATOM   6910  C CA  . ALA C 1 339 ? 110.053 44.097  79.306  1.00 50.15 ? 337 ALA C CA  1 
ATOM   6911  C C   . ALA C 1 339 ? 109.280 42.987  80.005  1.00 50.15 ? 337 ALA C C   1 
ATOM   6912  O O   . ALA C 1 339 ? 109.081 43.020  81.218  1.00 50.15 ? 337 ALA C O   1 
ATOM   6913  C CB  . ALA C 1 339 ? 109.097 45.079  78.652  1.00 49.94 ? 337 ALA C CB  1 
ATOM   6914  N N   . ALA C 1 340 ? 108.852 41.998  79.231  1.00 34.05 ? 338 ALA C N   1 
ATOM   6915  C CA  . ALA C 1 340 ? 108.117 40.872  79.785  1.00 34.05 ? 338 ALA C CA  1 
ATOM   6916  C C   . ALA C 1 340 ? 109.105 39.948  80.458  1.00 34.05 ? 338 ALA C C   1 
ATOM   6917  O O   . ALA C 1 340 ? 108.727 39.089  81.239  1.00 34.05 ? 338 ALA C O   1 
ATOM   6918  C CB  . ALA C 1 340 ? 107.393 40.128  78.690  1.00 48.61 ? 338 ALA C CB  1 
ATOM   6919  N N   . LYS C 1 341 ? 110.378 40.133  80.131  1.00 36.42 ? 339 LYS C N   1 
ATOM   6920  C CA  . LYS C 1 341 ? 111.474 39.330  80.677  1.00 36.42 ? 339 LYS C CA  1 
ATOM   6921  C C   . LYS C 1 341 ? 111.950 39.879  82.035  1.00 36.42 ? 339 LYS C C   1 
ATOM   6922  O O   . LYS C 1 341 ? 112.339 39.128  82.932  1.00 36.42 ? 339 LYS C O   1 
ATOM   6923  C CB  . LYS C 1 341 ? 112.645 39.363  79.691  1.00 41.79 ? 339 LYS C CB  1 
ATOM   6924  C CG  . LYS C 1 341 ? 112.401 38.724  78.333  1.00 41.79 ? 339 LYS C CG  1 
ATOM   6925  C CD  . LYS C 1 341 ? 112.700 37.232  78.387  1.00 41.79 ? 339 LYS C CD  1 
ATOM   6926  C CE  . LYS C 1 341 ? 112.623 36.607  77.009  1.00 41.79 ? 339 LYS C CE  1 
ATOM   6927  N NZ  . LYS C 1 341 ? 113.119 35.205  77.032  1.00 41.79 ? 339 LYS C NZ  1 
ATOM   6928  N N   . GLY C 1 342 ? 111.903 41.204  82.159  1.00 65.71 ? 340 GLY C N   1 
ATOM   6929  C CA  . GLY C 1 342 ? 112.361 41.885  83.356  1.00 65.71 ? 340 GLY C CA  1 
ATOM   6930  C C   . GLY C 1 342 ? 113.738 42.407  83.004  1.00 65.71 ? 340 GLY C C   1 
ATOM   6931  O O   . GLY C 1 342 ? 114.265 43.336  83.618  1.00 65.71 ? 340 GLY C O   1 
ATOM   6932  N N   . GLN C 1 343 ? 114.289 41.786  81.963  1.00 67.01 ? 341 GLN C N   1 
ATOM   6933  C CA  . GLN C 1 343 ? 115.611 42.065  81.416  1.00 67.01 ? 341 GLN C CA  1 
ATOM   6934  C C   . GLN C 1 343 ? 115.671 43.290  80.517  1.00 67.01 ? 341 GLN C C   1 
ATOM   6935  O O   . GLN C 1 343 ? 116.390 43.253  79.517  1.00 67.01 ? 341 GLN C O   1 
ATOM   6936  C CB  . GLN C 1 343 ? 116.068 40.896  80.557  1.00 9.47  ? 341 GLN C CB  1 
ATOM   6937  C CG  . GLN C 1 343 ? 115.970 39.503  81.160  1.00 9.47  ? 341 GLN C CG  1 
ATOM   6938  C CD  . GLN C 1 343 ? 116.247 38.463  80.070  1.00 9.47  ? 341 GLN C CD  1 
ATOM   6939  O OE1 . GLN C 1 343 ? 116.711 38.840  78.978  1.00 9.47  ? 341 GLN C OE1 1 
ATOM   6940  N NE2 . GLN C 1 343 ? 115.964 37.168  80.340  1.00 9.47  ? 341 GLN C NE2 1 
ATOM   6941  N N   . TYR C 1 344 ? 114.948 44.362  80.834  1.00 21.95 ? 342 TYR C N   1 
ATOM   6942  C CA  . TYR C 1 344 ? 114.973 45.538  79.956  1.00 20.06 ? 342 TYR C CA  1 
ATOM   6943  C C   . TYR C 1 344 ? 115.491 46.765  80.682  1.00 34.07 ? 342 TYR C C   1 
ATOM   6944  O O   . TYR C 1 344 ? 115.012 47.100  81.762  1.00 32.12 ? 342 TYR C O   1 
ATOM   6945  C CB  . TYR C 1 344 ? 113.569 45.819  79.367  1.00 42.33 ? 342 TYR C CB  1 
ATOM   6946  C CG  . TYR C 1 344 ? 113.445 47.155  78.629  1.00 22.88 ? 342 TYR C CG  1 
ATOM   6947  C CD1 . TYR C 1 344 ? 113.672 47.262  77.252  1.00 27.68 ? 342 TYR C CD1 1 
ATOM   6948  C CD2 . TYR C 1 344 ? 113.138 48.329  79.331  1.00 27.14 ? 342 TYR C CD2 1 
ATOM   6949  C CE1 . TYR C 1 344 ? 113.597 48.523  76.601  1.00 26.93 ? 342 TYR C CE1 1 
ATOM   6950  C CE2 . TYR C 1 344 ? 113.065 49.584  78.695  1.00 15.42 ? 342 TYR C CE2 1 
ATOM   6951  C CZ  . TYR C 1 344 ? 113.296 49.678  77.345  1.00 28.96 ? 342 TYR C CZ  1 
ATOM   6952  O OH  . TYR C 1 344 ? 113.260 50.936  76.779  1.00 42.40 ? 342 TYR C OH  1 
ATOM   6953  N N   . VAL C 1 345 ? 116.475 47.427  80.081  1.00 46.23 ? 343 VAL C N   1 
ATOM   6954  C CA  . VAL C 1 345 ? 117.064 48.623  80.669  1.00 63.98 ? 343 VAL C CA  1 
ATOM   6955  C C   . VAL C 1 345 ? 116.614 49.854  79.917  1.00 61.09 ? 343 VAL C C   1 
ATOM   6956  O O   . VAL C 1 345 ? 116.528 49.842  78.689  1.00 62.19 ? 343 VAL C O   1 
ATOM   6957  C CB  . VAL C 1 345 ? 118.591 48.580  80.610  1.00 43.31 ? 343 VAL C CB  1 
ATOM   6958  C CG1 . VAL C 1 345 ? 119.173 49.806  81.300  1.00 25.53 ? 343 VAL C CG1 1 
ATOM   6959  C CG2 . VAL C 1 345 ? 119.086 47.304  81.244  1.00 16.31 ? 343 VAL C CG2 1 
ATOM   6960  N N   . HIS C 1 346 ? 116.328 50.926  80.642  1.00 81.69 ? 344 HIS C N   1 
ATOM   6961  C CA  . HIS C 1 346 ? 115.903 52.123  79.960  1.00 81.69 ? 344 HIS C CA  1 
ATOM   6962  C C   . HIS C 1 346 ? 117.066 52.783  79.252  1.00 81.69 ? 344 HIS C C   1 
ATOM   6963  O O   . HIS C 1 346 ? 117.033 52.961  78.033  1.00 81.69 ? 344 HIS C O   1 
ATOM   6964  C CB  . HIS C 1 346 ? 115.298 53.142  80.914  1.00 91.32 ? 344 HIS C CB  1 
ATOM   6965  C CG  . HIS C 1 346 ? 115.014 54.457  80.255  1.00 91.32 ? 344 HIS C CG  1 
ATOM   6966  N ND1 . HIS C 1 346 ? 116.007 55.242  79.711  1.00 91.32 ? 344 HIS C ND1 1 
ATOM   6967  C CD2 . HIS C 1 346 ? 113.847 55.085  79.978  1.00 91.32 ? 344 HIS C CD2 1 
ATOM   6968  C CE1 . HIS C 1 346 ? 115.467 56.294  79.123  1.00 91.32 ? 344 HIS C CE1 1 
ATOM   6969  N NE2 . HIS C 1 346 ? 114.156 56.222  79.270  1.00 91.32 ? 344 HIS C NE2 1 
ATOM   6970  N N   . THR C 1 347 ? 118.088 53.133  80.034  1.00 92.42 ? 345 THR C N   1 
ATOM   6971  C CA  . THR C 1 347 ? 119.292 53.840  79.564  1.00 92.42 ? 345 THR C CA  1 
ATOM   6972  C C   . THR C 1 347 ? 118.948 55.334  79.555  1.00 92.42 ? 345 THR C C   1 
ATOM   6973  O O   . THR C 1 347 ? 119.061 55.959  80.634  1.00 92.42 ? 345 THR C O   1 
ATOM   6974  C CB  . THR C 1 347 ? 119.754 53.417  78.111  1.00 92.08 ? 345 THR C CB  1 
ATOM   6975  O OG1 . THR C 1 347 ? 120.319 52.099  78.138  1.00 92.08 ? 345 THR C OG1 1 
ATOM   6976  C CG2 . THR C 1 347 ? 120.811 54.387  77.572  1.00 92.08 ? 345 THR C CG2 1 
ATOM   6977  N N   . ALA D 1 8   ? 88.659  51.716  106.495 1.00 63.06 ? 6   ALA D N   1 
ATOM   6978  C CA  . ALA D 1 8   ? 88.783  50.255  106.783 1.00 61.57 ? 6   ALA D CA  1 
ATOM   6979  C C   . ALA D 1 8   ? 90.130  49.977  107.437 1.00 64.78 ? 6   ALA D C   1 
ATOM   6980  O O   . ALA D 1 8   ? 90.702  50.850  108.096 1.00 64.78 ? 6   ALA D O   1 
ATOM   6981  C CB  . ALA D 1 8   ? 88.646  49.429  105.479 1.00 24.91 ? 6   ALA D CB  1 
ATOM   6982  N N   . LEU D 1 9   ? 90.627  48.756  107.252 1.00 67.13 ? 7   LEU D N   1 
ATOM   6983  C CA  . LEU D 1 9   ? 91.910  48.354  107.811 1.00 68.59 ? 7   LEU D CA  1 
ATOM   6984  C C   . LEU D 1 9   ? 92.968  49.391  107.505 1.00 70.21 ? 7   LEU D C   1 
ATOM   6985  O O   . LEU D 1 9   ? 93.005  49.958  106.414 1.00 71.34 ? 7   LEU D O   1 
ATOM   6986  C CB  . LEU D 1 9   ? 92.358  47.012  107.229 1.00 6.69  ? 7   LEU D CB  1 
ATOM   6987  C CG  . LEU D 1 9   ? 91.606  45.758  107.671 1.00 27.69 ? 7   LEU D CG  1 
ATOM   6988  C CD1 . LEU D 1 9   ? 91.997  44.593  106.790 1.00 36.35 ? 7   LEU D CD1 1 
ATOM   6989  C CD2 . LEU D 1 9   ? 91.912  45.459  109.130 1.00 6.49  ? 7   LEU D CD2 1 
ATOM   6990  N N   . THR D 1 10  ? 93.831  49.633  108.479 1.00 81.01 ? 8   THR D N   1 
ATOM   6991  C CA  . THR D 1 10  ? 94.912  50.588  108.321 1.00 80.91 ? 8   THR D CA  1 
ATOM   6992  C C   . THR D 1 10  ? 96.160  49.838  107.888 1.00 84.86 ? 8   THR D C   1 
ATOM   6993  O O   . THR D 1 10  ? 96.239  48.614  108.028 1.00 84.68 ? 8   THR D O   1 
ATOM   6994  C CB  . THR D 1 10  ? 95.211  51.291  109.640 1.00 52.24 ? 8   THR D CB  1 
ATOM   6995  O OG1 . THR D 1 10  ? 95.278  50.315  110.689 1.00 53.22 ? 8   THR D OG1 1 
ATOM   6996  C CG2 . THR D 1 10  ? 94.133  52.304  109.954 1.00 38.38 ? 8   THR D CG2 1 
ATOM   6997  N N   . GLN D 1 11  ? 97.138  50.568  107.366 1.00 65.85 ? 9   GLN D N   1 
ATOM   6998  C CA  . GLN D 1 11  ? 98.368  49.929  106.935 1.00 65.85 ? 9   GLN D CA  1 
ATOM   6999  C C   . GLN D 1 11  ? 98.940  49.097  108.084 1.00 65.85 ? 9   GLN D C   1 
ATOM   7000  O O   . GLN D 1 11  ? 99.429  47.978  107.884 1.00 65.85 ? 9   GLN D O   1 
ATOM   7001  C CB  . GLN D 1 11  ? 99.387  50.979  106.488 1.00 92.42 ? 9   GLN D CB  1 
ATOM   7002  C CG  . GLN D 1 11  ? 100.602 50.371  105.794 1.00 92.42 ? 9   GLN D CG  1 
ATOM   7003  C CD  . GLN D 1 11  ? 100.246 49.611  104.511 1.00 92.42 ? 9   GLN D CD  1 
ATOM   7004  O OE1 . GLN D 1 11  ? 100.991 48.726  104.074 1.00 92.42 ? 9   GLN D OE1 1 
ATOM   7005  N NE2 . GLN D 1 11  ? 99.116  49.965  103.899 1.00 92.42 ? 9   GLN D NE2 1 
ATOM   7006  N N   . GLU D 1 12  ? 98.860  49.644  109.292 1.00 47.81 ? 10  GLU D N   1 
ATOM   7007  C CA  . GLU D 1 12  ? 99.378  48.954  110.457 1.00 47.81 ? 10  GLU D CA  1 
ATOM   7008  C C   . GLU D 1 12  ? 98.614  47.682  110.778 1.00 47.81 ? 10  GLU D C   1 
ATOM   7009  O O   . GLU D 1 12  ? 99.221  46.665  111.109 1.00 47.81 ? 10  GLU D O   1 
ATOM   7010  C CB  . GLU D 1 12  ? 99.361  49.866  111.675 1.00 80.40 ? 10  GLU D CB  1 
ATOM   7011  C CG  . GLU D 1 12  ? 99.702  49.116  112.936 1.00 80.40 ? 10  GLU D CG  1 
ATOM   7012  C CD  . GLU D 1 12  ? 99.639  49.984  114.166 1.00 80.40 ? 10  GLU D CD  1 
ATOM   7013  O OE1 . GLU D 1 12  ? 98.680  50.784  114.284 1.00 80.40 ? 10  GLU D OE1 1 
ATOM   7014  O OE2 . GLU D 1 12  ? 100.546 49.854  115.019 1.00 80.40 ? 10  GLU D OE2 1 
ATOM   7015  N N   . GLN D 1 13  ? 97.286  47.741  110.692 1.00 58.31 ? 11  GLN D N   1 
ATOM   7016  C CA  . GLN D 1 13  ? 96.434  46.580  110.980 1.00 58.31 ? 11  GLN D CA  1 
ATOM   7017  C C   . GLN D 1 13  ? 96.701  45.417  110.035 1.00 58.31 ? 11  GLN D C   1 
ATOM   7018  O O   . GLN D 1 13  ? 96.680  44.250  110.435 1.00 58.31 ? 11  GLN D O   1 
ATOM   7019  C CB  . GLN D 1 13  ? 94.962  46.970  110.890 1.00 69.60 ? 11  GLN D CB  1 
ATOM   7020  C CG  . GLN D 1 13  ? 94.390  47.502  112.173 1.00 69.60 ? 11  GLN D CG  1 
ATOM   7021  C CD  . GLN D 1 13  ? 92.927  47.839  112.047 1.00 69.60 ? 11  GLN D CD  1 
ATOM   7022  O OE1 . GLN D 1 13  ? 92.563  48.926  111.590 1.00 69.60 ? 11  GLN D OE1 1 
ATOM   7023  N NE2 . GLN D 1 13  ? 92.069  46.897  112.437 1.00 69.60 ? 11  GLN D NE2 1 
ATOM   7024  N N   . LYS D 1 14  ? 96.931  45.750  108.771 1.00 63.06 ? 12  LYS D N   1 
ATOM   7025  C CA  . LYS D 1 14  ? 97.225  44.746  107.767 1.00 63.06 ? 12  LYS D CA  1 
ATOM   7026  C C   . LYS D 1 14  ? 98.546  44.120  108.152 1.00 63.06 ? 12  LYS D C   1 
ATOM   7027  O O   . LYS D 1 14  ? 98.640  42.912  108.358 1.00 63.06 ? 12  LYS D O   1 
ATOM   7028  C CB  . LYS D 1 14  ? 97.362  45.396  106.397 1.00 51.29 ? 12  LYS D CB  1 
ATOM   7029  C CG  . LYS D 1 14  ? 96.108  46.069  105.901 1.00 51.29 ? 12  LYS D CG  1 
ATOM   7030  C CD  . LYS D 1 14  ? 96.360  46.722  104.564 1.00 51.29 ? 12  LYS D CD  1 
ATOM   7031  C CE  . LYS D 1 14  ? 95.126  47.412  104.056 1.00 51.29 ? 12  LYS D CE  1 
ATOM   7032  N NZ  . LYS D 1 14  ? 95.456  48.207  102.854 1.00 51.29 ? 12  LYS D NZ  1 
ATOM   7033  N N   . LYS D 1 15  ? 99.563  44.970  108.242 1.00 41.00 ? 13  LYS D N   1 
ATOM   7034  C CA  . LYS D 1 15  ? 100.907 44.556  108.605 1.00 41.00 ? 13  LYS D CA  1 
ATOM   7035  C C   . LYS D 1 15  ? 100.927 43.447  109.659 1.00 41.00 ? 13  LYS D C   1 
ATOM   7036  O O   . LYS D 1 15  ? 101.752 42.527  109.572 1.00 41.00 ? 13  LYS D O   1 
ATOM   7037  C CB  . LYS D 1 15  ? 101.687 45.769  109.112 1.00 61.68 ? 13  LYS D CB  1 
ATOM   7038  C CG  . LYS D 1 15  ? 103.077 45.464  109.638 1.00 61.68 ? 13  LYS D CG  1 
ATOM   7039  C CD  . LYS D 1 15  ? 103.642 46.706  110.269 1.00 61.68 ? 13  LYS D CD  1 
ATOM   7040  C CE  . LYS D 1 15  ? 104.913 46.431  111.020 1.00 61.68 ? 13  LYS D CE  1 
ATOM   7041  N NZ  . LYS D 1 15  ? 105.275 47.624  111.842 1.00 61.68 ? 13  LYS D NZ  1 
ATOM   7042  N N   . GLU D 1 16  ? 100.029 43.541  110.649 1.00 67.95 ? 14  GLU D N   1 
ATOM   7043  C CA  . GLU D 1 16  ? 99.933  42.543  111.728 1.00 67.95 ? 14  GLU D CA  1 
ATOM   7044  C C   . GLU D 1 16  ? 99.216  41.268  111.292 1.00 67.95 ? 14  GLU D C   1 
ATOM   7045  O O   . GLU D 1 16  ? 99.535  40.172  111.763 1.00 67.95 ? 14  GLU D O   1 
ATOM   7046  C CB  . GLU D 1 16  ? 99.214  43.113  112.956 1.00 51.21 ? 14  GLU D CB  1 
ATOM   7047  C CG  . GLU D 1 16  ? 98.520  42.029  113.785 1.00 51.21 ? 14  GLU D CG  1 
ATOM   7048  C CD  . GLU D 1 16  ? 97.997  42.532  115.118 1.00 51.21 ? 14  GLU D CD  1 
ATOM   7049  O OE1 . GLU D 1 16  ? 97.690  43.741  115.230 1.00 51.21 ? 14  GLU D OE1 1 
ATOM   7050  O OE2 . GLU D 1 16  ? 97.882  41.711  116.056 1.00 51.21 ? 14  GLU D OE2 1 
ATOM   7051  N N   . LEU D 1 17  ? 98.225  41.423  110.415 1.00 39.71 ? 15  LEU D N   1 
ATOM   7052  C CA  . LEU D 1 17  ? 97.494  40.278  109.901 1.00 39.71 ? 15  LEU D CA  1 
ATOM   7053  C C   . LEU D 1 17  ? 98.457  39.566  108.948 1.00 39.71 ? 15  LEU D C   1 
ATOM   7054  O O   . LEU D 1 17  ? 98.531  38.330  108.933 1.00 39.71 ? 15  LEU D O   1 
ATOM   7055  C CB  . LEU D 1 17  ? 96.213  40.748  109.201 1.00 20.73 ? 15  LEU D CB  1 
ATOM   7056  C CG  . LEU D 1 17  ? 95.197  41.380  110.169 1.00 20.73 ? 15  LEU D CG  1 
ATOM   7057  C CD1 . LEU D 1 17  ? 94.166  42.177  109.422 1.00 20.73 ? 15  LEU D CD1 1 
ATOM   7058  C CD2 . LEU D 1 17  ? 94.522  40.301  110.980 1.00 20.73 ? 15  LEU D CD2 1 
ATOM   7059  N N   . SER D 1 18  ? 99.209  40.356  108.174 1.00 41.55 ? 16  SER D N   1 
ATOM   7060  C CA  . SER D 1 18  ? 100.219 39.815  107.258 1.00 41.55 ? 16  SER D CA  1 
ATOM   7061  C C   . SER D 1 18  ? 101.104 38.925  108.120 1.00 41.55 ? 16  SER D C   1 
ATOM   7062  O O   . SER D 1 18  ? 101.229 37.716  107.875 1.00 41.55 ? 16  SER D O   1 
ATOM   7063  C CB  . SER D 1 18  ? 101.090 40.937  106.676 1.00 35.14 ? 16  SER D CB  1 
ATOM   7064  O OG  . SER D 1 18  ? 100.382 41.739  105.751 1.00 35.14 ? 16  SER D OG  1 
ATOM   7065  N N   . GLU D 1 19  ? 101.706 39.563  109.131 1.00 44.93 ? 17  GLU D N   1 
ATOM   7066  C CA  . GLU D 1 19  ? 102.589 38.923  110.102 1.00 44.93 ? 17  GLU D CA  1 
ATOM   7067  C C   . GLU D 1 19  ? 102.067 37.568  110.553 1.00 44.93 ? 17  GLU D C   1 
ATOM   7068  O O   . GLU D 1 19  ? 102.657 36.534  110.236 1.00 44.93 ? 17  GLU D O   1 
ATOM   7069  C CB  . GLU D 1 19  ? 102.740 39.794  111.350 1.00 52.34 ? 17  GLU D CB  1 
ATOM   7070  C CG  . GLU D 1 19  ? 103.867 40.807  111.342 1.00 52.34 ? 17  GLU D CG  1 
ATOM   7071  C CD  . GLU D 1 19  ? 104.337 41.152  112.762 1.00 52.34 ? 17  GLU D CD  1 
ATOM   7072  O OE1 . GLU D 1 19  ? 104.826 40.233  113.462 1.00 52.34 ? 17  GLU D OE1 1 
ATOM   7073  O OE2 . GLU D 1 19  ? 104.215 42.334  113.173 1.00 52.34 ? 17  GLU D OE2 1 
ATOM   7074  N N   . ILE D 1 20  ? 100.961 37.600  111.305 1.00 35.89 ? 18  ILE D N   1 
ATOM   7075  C CA  . ILE D 1 20  ? 100.321 36.407  111.857 1.00 35.89 ? 18  ILE D CA  1 
ATOM   7076  C C   . ILE D 1 20  ? 99.986  35.380  110.798 1.00 35.89 ? 18  ILE D C   1 
ATOM   7077  O O   . ILE D 1 20  ? 100.138 34.173  111.013 1.00 35.89 ? 18  ILE D O   1 
ATOM   7078  C CB  . ILE D 1 20  ? 99.013  36.749  112.540 1.00 10.85 ? 18  ILE D CB  1 
ATOM   7079  C CG1 . ILE D 1 20  ? 99.208  37.942  113.474 1.00 10.85 ? 18  ILE D CG1 1 
ATOM   7080  C CG2 . ILE D 1 20  ? 98.500  35.529  113.258 1.00 10.85 ? 18  ILE D CG2 1 
ATOM   7081  C CD1 . ILE D 1 20  ? 97.963  38.323  114.299 1.00 10.85 ? 18  ILE D CD1 1 
ATOM   7082  N N   . ALA D 1 21  ? 99.515  35.881  109.661 1.00 44.38 ? 19  ALA D N   1 
ATOM   7083  C CA  . ALA D 1 21  ? 99.120  35.048  108.545 1.00 46.59 ? 19  ALA D CA  1 
ATOM   7084  C C   . ALA D 1 21  ? 100.266 34.222  108.012 1.00 42.52 ? 19  ALA D C   1 
ATOM   7085  O O   . ALA D 1 21  ? 100.228 32.994  108.068 1.00 46.14 ? 19  ALA D O   1 
ATOM   7086  C CB  . ALA D 1 21  ? 98.555  35.908  107.444 1.00 92.42 ? 19  ALA D CB  1 
ATOM   7087  N N   . GLN D 1 22  ? 101.282 34.896  107.484 1.00 44.57 ? 20  GLN D N   1 
ATOM   7088  C CA  . GLN D 1 22  ? 102.438 34.207  106.920 1.00 49.16 ? 20  GLN D CA  1 
ATOM   7089  C C   . GLN D 1 22  ? 103.100 33.372  108.007 1.00 55.10 ? 20  GLN D C   1 
ATOM   7090  O O   . GLN D 1 22  ? 103.358 32.184  107.822 1.00 58.15 ? 20  GLN D O   1 
ATOM   7091  C CB  . GLN D 1 22  ? 103.426 35.232  106.348 1.00 23.43 ? 20  GLN D CB  1 
ATOM   7092  C CG  . GLN D 1 22  ? 102.860 36.079  105.188 1.00 37.96 ? 20  GLN D CG  1 
ATOM   7093  C CD  . GLN D 1 22  ? 103.697 37.310  104.858 1.00 44.02 ? 20  GLN D CD  1 
ATOM   7094  O OE1 . GLN D 1 22  ? 104.833 37.201  104.425 1.00 70.41 ? 20  GLN D OE1 1 
ATOM   7095  N NE2 . GLN D 1 22  ? 103.124 38.485  105.062 1.00 68.08 ? 20  GLN D NE2 1 
ATOM   7096  N N   . SER D 1 23  ? 103.333 34.005  109.154 1.00 27.46 ? 21  SER D N   1 
ATOM   7097  C CA  . SER D 1 23  ? 103.971 33.380  110.316 1.00 28.55 ? 21  SER D CA  1 
ATOM   7098  C C   . SER D 1 23  ? 103.478 31.977  110.698 1.00 28.49 ? 21  SER D C   1 
ATOM   7099  O O   . SER D 1 23  ? 104.153 31.259  111.441 1.00 39.80 ? 21  SER D O   1 
ATOM   7100  C CB  . SER D 1 23  ? 103.803 34.287  111.534 1.00 18.90 ? 21  SER D CB  1 
ATOM   7101  O OG  . SER D 1 23  ? 102.440 34.307  111.939 1.00 24.96 ? 21  SER D OG  1 
ATOM   7102  N N   . ILE D 1 24  ? 102.310 31.586  110.209 1.00 37.01 ? 22  ILE D N   1 
ATOM   7103  C CA  . ILE D 1 24  ? 101.779 30.286  110.572 1.00 37.94 ? 22  ILE D CA  1 
ATOM   7104  C C   . ILE D 1 24  ? 102.232 29.151  109.661 1.00 48.92 ? 22  ILE D C   1 
ATOM   7105  O O   . ILE D 1 24  ? 102.306 27.999  110.090 1.00 47.28 ? 22  ILE D O   1 
ATOM   7106  C CB  . ILE D 1 24  ? 100.232 30.334  110.646 1.00 27.71 ? 22  ILE D CB  1 
ATOM   7107  C CG1 . ILE D 1 24  ? 99.810  31.457  111.600 1.00 32.32 ? 22  ILE D CG1 1 
ATOM   7108  C CG2 . ILE D 1 24  ? 99.677  28.982  111.135 1.00 17.26 ? 22  ILE D CG2 1 
ATOM   7109  C CD1 . ILE D 1 24  ? 98.320  31.546  111.833 1.00 28.68 ? 22  ILE D CD1 1 
ATOM   7110  N N   . VAL D 1 25  ? 102.538 29.471  108.410 1.00 63.65 ? 23  VAL D N   1 
ATOM   7111  C CA  . VAL D 1 25  ? 102.993 28.458  107.462 1.00 59.22 ? 23  VAL D CA  1 
ATOM   7112  C C   . VAL D 1 25  ? 104.473 28.662  107.169 1.00 72.64 ? 23  VAL D C   1 
ATOM   7113  O O   . VAL D 1 25  ? 105.151 27.779  106.647 1.00 70.63 ? 23  VAL D O   1 
ATOM   7114  C CB  . VAL D 1 25  ? 102.178 28.520  106.161 1.00 62.31 ? 23  VAL D CB  1 
ATOM   7115  C CG1 . VAL D 1 25  ? 100.840 27.839  106.370 1.00 54.10 ? 23  VAL D CG1 1 
ATOM   7116  C CG2 . VAL D 1 25  ? 101.944 29.961  105.768 1.00 40.36 ? 23  VAL D CG2 1 
ATOM   7117  N N   . ALA D 1 26  ? 104.945 29.844  107.546 1.00 79.32 ? 24  ALA D N   1 
ATOM   7118  C CA  . ALA D 1 26  ? 106.324 30.288  107.398 1.00 79.32 ? 24  ALA D CA  1 
ATOM   7119  C C   . ALA D 1 26  ? 107.296 29.389  106.645 1.00 79.32 ? 24  ALA D C   1 
ATOM   7120  O O   . ALA D 1 26  ? 107.780 29.745  105.556 1.00 79.32 ? 24  ALA D O   1 
ATOM   7121  C CB  . ALA D 1 26  ? 106.885 30.594  108.771 1.00 83.26 ? 24  ALA D CB  1 
ATOM   7122  N N   . ASN D 1 27  ? 107.605 28.238  107.233 1.00 32.75 ? 25  ASN D N   1 
ATOM   7123  C CA  . ASN D 1 27  ? 108.552 27.323  106.608 1.00 24.82 ? 25  ASN D CA  1 
ATOM   7124  C C   . ASN D 1 27  ? 108.067 25.880  106.662 1.00 34.80 ? 25  ASN D C   1 
ATOM   7125  O O   . ASN D 1 27  ? 108.599 25.051  107.398 1.00 38.22 ? 25  ASN D O   1 
ATOM   7126  C CB  . ASN D 1 27  ? 109.926 27.435  107.289 1.00 42.07 ? 25  ASN D CB  1 
ATOM   7127  C CG  . ASN D 1 27  ? 110.325 28.879  107.588 1.00 51.93 ? 25  ASN D CG  1 
ATOM   7128  O OD1 . ASN D 1 27  ? 109.952 29.441  108.620 1.00 78.56 ? 25  ASN D OD1 1 
ATOM   7129  N ND2 . ASN D 1 27  ? 111.078 29.485  106.682 1.00 43.59 ? 25  ASN D ND2 1 
ATOM   7130  N N   . GLY D 1 28  ? 107.055 25.579  105.866 1.00 65.71 ? 26  GLY D N   1 
ATOM   7131  C CA  . GLY D 1 28  ? 106.533 24.232  105.854 1.00 64.43 ? 26  GLY D CA  1 
ATOM   7132  C C   . GLY D 1 28  ? 105.852 23.928  107.164 1.00 60.90 ? 26  GLY D C   1 
ATOM   7133  O O   . GLY D 1 28  ? 105.549 22.771  107.466 1.00 70.14 ? 26  GLY D O   1 
ATOM   7134  N N   . LYS D 1 29  ? 105.627 24.971  107.955 1.00 47.97 ? 27  LYS D N   1 
ATOM   7135  C CA  . LYS D 1 29  ? 104.956 24.792  109.230 1.00 49.14 ? 27  LYS D CA  1 
ATOM   7136  C C   . LYS D 1 29  ? 103.469 24.616  108.948 1.00 50.00 ? 27  LYS D C   1 
ATOM   7137  O O   . LYS D 1 29  ? 102.998 24.942  107.854 1.00 57.06 ? 27  LYS D O   1 
ATOM   7138  C CB  . LYS D 1 29  ? 105.195 25.997  110.145 1.00 32.23 ? 27  LYS D CB  1 
ATOM   7139  C CG  . LYS D 1 29  ? 106.602 26.085  110.690 1.00 44.46 ? 27  LYS D CG  1 
ATOM   7140  C CD  . LYS D 1 29  ? 106.682 26.900  111.988 1.00 28.19 ? 27  LYS D CD  1 
ATOM   7141  C CE  . LYS D 1 29  ? 106.882 28.407  111.747 1.00 28.80 ? 27  LYS D CE  1 
ATOM   7142  N NZ  . LYS D 1 29  ? 107.078 29.162  113.033 1.00 48.14 ? 27  LYS D NZ  1 
ATOM   7143  N N   . GLY D 1 30  ? 102.745 24.082  109.925 1.00 61.94 ? 28  GLY D N   1 
ATOM   7144  C CA  . GLY D 1 30  ? 101.324 23.865  109.755 1.00 61.94 ? 28  GLY D CA  1 
ATOM   7145  C C   . GLY D 1 30  ? 100.582 24.138  111.043 1.00 61.94 ? 28  GLY D C   1 
ATOM   7146  O O   . GLY D 1 30  ? 101.200 24.498  112.044 1.00 61.94 ? 28  GLY D O   1 
ATOM   7147  N N   . ILE D 1 31  ? 99.267  23.947  111.032 1.00 43.89 ? 29  ILE D N   1 
ATOM   7148  C CA  . ILE D 1 31  ? 98.457  24.209  112.211 1.00 43.89 ? 29  ILE D CA  1 
ATOM   7149  C C   . ILE D 1 31  ? 97.989  22.969  112.945 1.00 43.89 ? 29  ILE D C   1 
ATOM   7150  O O   . ILE D 1 31  ? 97.397  22.081  112.343 1.00 43.89 ? 29  ILE D O   1 
ATOM   7151  C CB  . ILE D 1 31  ? 97.198  25.017  111.850 1.00 18.10 ? 29  ILE D CB  1 
ATOM   7152  C CG1 . ILE D 1 31  ? 97.599  26.308  111.144 1.00 18.10 ? 29  ILE D CG1 1 
ATOM   7153  C CG2 . ILE D 1 31  ? 96.410  25.340  113.109 1.00 18.10 ? 29  ILE D CG2 1 
ATOM   7154  C CD1 . ILE D 1 31  ? 96.444  27.247  110.858 1.00 18.10 ? 29  ILE D CD1 1 
ATOM   7155  N N   . LEU D 1 32  ? 98.253  22.907  114.247 1.00 72.72 ? 30  LEU D N   1 
ATOM   7156  C CA  . LEU D 1 32  ? 97.782  21.778  115.036 1.00 72.72 ? 30  LEU D CA  1 
ATOM   7157  C C   . LEU D 1 32  ? 96.429  22.182  115.569 1.00 72.72 ? 30  LEU D C   1 
ATOM   7158  O O   . LEU D 1 32  ? 96.327  23.078  116.408 1.00 72.72 ? 30  LEU D O   1 
ATOM   7159  C CB  . LEU D 1 32  ? 98.674  21.485  116.237 1.00 58.58 ? 30  LEU D CB  1 
ATOM   7160  C CG  . LEU D 1 32  ? 97.953  20.604  117.276 1.00 58.58 ? 30  LEU D CG  1 
ATOM   7161  C CD1 . LEU D 1 32  ? 97.822  19.175  116.751 1.00 58.58 ? 30  LEU D CD1 1 
ATOM   7162  C CD2 . LEU D 1 32  ? 98.710  20.631  118.593 1.00 58.58 ? 30  LEU D CD2 1 
ATOM   7163  N N   . ALA D 1 33  ? 95.386  21.531  115.077 1.00 67.90 ? 31  ALA D N   1 
ATOM   7164  C CA  . ALA D 1 33  ? 94.051  21.833  115.542 1.00 67.90 ? 31  ALA D CA  1 
ATOM   7165  C C   . ALA D 1 33  ? 93.781  20.915  116.711 1.00 67.90 ? 31  ALA D C   1 
ATOM   7166  O O   . ALA D 1 33  ? 93.579  19.715  116.526 1.00 67.90 ? 31  ALA D O   1 
ATOM   7167  C CB  . ALA D 1 33  ? 93.038  21.584  114.443 1.00 84.40 ? 31  ALA D CB  1 
ATOM   7168  N N   . ALA D 1 34  ? 93.831  21.480  117.914 1.00 69.93 ? 32  ALA D N   1 
ATOM   7169  C CA  . ALA D 1 34  ? 93.544  20.747  119.143 1.00 69.93 ? 32  ALA D CA  1 
ATOM   7170  C C   . ALA D 1 34  ? 92.455  21.583  119.797 1.00 69.93 ? 32  ALA D C   1 
ATOM   7171  O O   . ALA D 1 34  ? 92.655  22.215  120.832 1.00 69.93 ? 32  ALA D O   1 
ATOM   7172  C CB  . ALA D 1 34  ? 94.776  20.669  120.032 1.00 19.56 ? 32  ALA D CB  1 
ATOM   7173  N N   . ASP D 1 35  ? 91.303  21.598  119.143 1.00 80.39 ? 33  ASP D N   1 
ATOM   7174  C CA  . ASP D 1 35  ? 90.156  22.359  119.593 1.00 80.39 ? 33  ASP D CA  1 
ATOM   7175  C C   . ASP D 1 35  ? 88.932  21.460  119.604 1.00 80.39 ? 33  ASP D C   1 
ATOM   7176  O O   . ASP D 1 35  ? 87.805  21.929  119.443 1.00 80.39 ? 33  ASP D O   1 
ATOM   7177  C CB  . ASP D 1 35  ? 89.935  23.555  118.655 1.00 88.59 ? 33  ASP D CB  1 
ATOM   7178  C CG  . ASP D 1 35  ? 89.797  23.143  117.184 1.00 88.59 ? 33  ASP D CG  1 
ATOM   7179  O OD1 . ASP D 1 35  ? 90.363  22.101  116.786 1.00 88.59 ? 33  ASP D OD1 1 
ATOM   7180  O OD2 . ASP D 1 35  ? 89.134  23.877  116.415 1.00 88.59 ? 33  ASP D OD2 1 
ATOM   7181  N N   . GLU D 1 36  ? 89.156  20.162  119.793 1.00 79.30 ? 34  GLU D N   1 
ATOM   7182  C CA  . GLU D 1 36  ? 88.052  19.216  119.821 1.00 79.30 ? 34  GLU D CA  1 
ATOM   7183  C C   . GLU D 1 36  ? 87.124  19.560  120.977 1.00 79.30 ? 34  GLU D C   1 
ATOM   7184  O O   . GLU D 1 36  ? 87.559  19.692  122.127 1.00 79.30 ? 34  GLU D O   1 
ATOM   7185  C CB  . GLU D 1 36  ? 88.555  17.778  119.983 1.00 81.37 ? 34  GLU D CB  1 
ATOM   7186  C CG  . GLU D 1 36  ? 89.723  17.416  119.091 1.00 81.37 ? 34  GLU D CG  1 
ATOM   7187  C CD  . GLU D 1 36  ? 91.053  17.695  119.759 1.00 81.37 ? 34  GLU D CD  1 
ATOM   7188  O OE1 . GLU D 1 36  ? 91.290  18.854  120.173 1.00 81.37 ? 34  GLU D OE1 1 
ATOM   7189  O OE2 . GLU D 1 36  ? 91.862  16.749  119.876 1.00 81.37 ? 34  GLU D OE2 1 
ATOM   7190  N N   . SER D 1 37  ? 85.844  19.725  120.655 1.00 92.42 ? 35  SER D N   1 
ATOM   7191  C CA  . SER D 1 37  ? 84.824  20.040  121.648 1.00 92.42 ? 35  SER D CA  1 
ATOM   7192  C C   . SER D 1 37  ? 84.750  18.894  122.655 1.00 92.42 ? 35  SER D C   1 
ATOM   7193  O O   . SER D 1 37  ? 85.251  17.792  122.389 1.00 92.42 ? 35  SER D O   1 
ATOM   7194  C CB  . SER D 1 37  ? 83.467  20.230  120.959 1.00 72.47 ? 35  SER D CB  1 
ATOM   7195  O OG  . SER D 1 37  ? 83.200  19.196  120.019 1.00 68.66 ? 35  SER D OG  1 
ATOM   7196  N N   . VAL D 1 38  ? 84.130  19.145  123.806 1.00 81.64 ? 36  VAL D N   1 
ATOM   7197  C CA  . VAL D 1 38  ? 84.019  18.113  124.835 1.00 79.29 ? 36  VAL D CA  1 
ATOM   7198  C C   . VAL D 1 38  ? 83.600  16.786  124.197 1.00 79.99 ? 36  VAL D C   1 
ATOM   7199  O O   . VAL D 1 38  ? 84.335  15.798  124.254 1.00 83.08 ? 36  VAL D O   1 
ATOM   7200  C CB  . VAL D 1 38  ? 82.990  18.507  125.912 1.00 56.73 ? 36  VAL D CB  1 
ATOM   7201  C CG1 . VAL D 1 38  ? 83.341  17.821  127.218 1.00 53.38 ? 36  VAL D CG1 1 
ATOM   7202  C CG2 . VAL D 1 38  ? 82.957  20.025  126.083 1.00 51.91 ? 36  VAL D CG2 1 
ATOM   7203  N N   . GLY D 1 39  ? 82.427  16.785  123.567 1.00 92.42 ? 37  GLY D N   1 
ATOM   7204  C CA  . GLY D 1 39  ? 81.927  15.586  122.916 1.00 92.42 ? 37  GLY D CA  1 
ATOM   7205  C C   . GLY D 1 39  ? 82.905  14.929  121.955 1.00 92.42 ? 37  GLY D C   1 
ATOM   7206  O O   . GLY D 1 39  ? 83.262  13.761  122.127 1.00 92.42 ? 37  GLY D O   1 
ATOM   7207  N N   . THR D 1 40  ? 83.336  15.675  120.941 1.00 91.15 ? 38  THR D N   1 
ATOM   7208  C CA  . THR D 1 40  ? 84.270  15.152  119.945 1.00 91.15 ? 38  THR D CA  1 
ATOM   7209  C C   . THR D 1 40  ? 85.483  14.527  120.615 1.00 91.15 ? 38  THR D C   1 
ATOM   7210  O O   . THR D 1 40  ? 85.931  13.445  120.232 1.00 91.15 ? 38  THR D O   1 
ATOM   7211  C CB  . THR D 1 40  ? 84.778  16.256  118.985 1.00 92.42 ? 38  THR D CB  1 
ATOM   7212  O OG1 . THR D 1 40  ? 83.678  16.832  118.264 1.00 92.42 ? 38  THR D OG1 1 
ATOM   7213  C CG2 . THR D 1 40  ? 85.764  15.659  117.988 1.00 92.42 ? 38  THR D CG2 1 
ATOM   7214  N N   . MET D 1 41  ? 86.020  15.219  121.612 1.00 83.77 ? 39  MET D N   1 
ATOM   7215  C CA  . MET D 1 41  ? 87.178  14.716  122.329 1.00 89.20 ? 39  MET D CA  1 
ATOM   7216  C C   . MET D 1 41  ? 86.781  13.432  123.049 1.00 91.73 ? 39  MET D C   1 
ATOM   7217  O O   . MET D 1 41  ? 87.567  12.480  123.132 1.00 91.73 ? 39  MET D O   1 
ATOM   7218  C CB  . MET D 1 41  ? 87.671  15.753  123.343 1.00 92.42 ? 39  MET D CB  1 
ATOM   7219  C CG  . MET D 1 41  ? 88.982  15.364  124.011 1.00 92.42 ? 39  MET D CG  1 
ATOM   7220  S SD  . MET D 1 41  ? 90.296  15.044  122.793 1.00 92.42 ? 39  MET D SD  1 
ATOM   7221  C CE  . MET D 1 41  ? 91.782  15.498  123.730 1.00 92.42 ? 39  MET D CE  1 
ATOM   7222  N N   . GLY D 1 42  ? 85.550  13.418  123.559 1.00 83.92 ? 40  GLY D N   1 
ATOM   7223  C CA  . GLY D 1 42  ? 85.044  12.254  124.267 1.00 83.92 ? 40  GLY D CA  1 
ATOM   7224  C C   . GLY D 1 42  ? 85.125  11.016  123.401 1.00 83.92 ? 40  GLY D C   1 
ATOM   7225  O O   . GLY D 1 42  ? 85.397  9.913   123.886 1.00 83.92 ? 40  GLY D O   1 
ATOM   7226  N N   . ASN D 1 43  ? 84.888  11.210  122.107 1.00 92.42 ? 41  ASN D N   1 
ATOM   7227  C CA  . ASN D 1 43  ? 84.942  10.127  121.137 1.00 92.42 ? 41  ASN D CA  1 
ATOM   7228  C C   . ASN D 1 43  ? 86.349  9.527   121.097 1.00 92.42 ? 41  ASN D C   1 
ATOM   7229  O O   . ASN D 1 43  ? 86.524  8.322   121.291 1.00 92.42 ? 41  ASN D O   1 
ATOM   7230  C CB  . ASN D 1 43  ? 84.582  10.648  119.743 1.00 92.42 ? 41  ASN D CB  1 
ATOM   7231  C CG  . ASN D 1 43  ? 84.464  9.531   118.713 1.00 92.42 ? 41  ASN D CG  1 
ATOM   7232  O OD1 . ASN D 1 43  ? 84.630  9.758   117.507 1.00 92.42 ? 41  ASN D OD1 1 
ATOM   7233  N ND2 . ASN D 1 43  ? 84.160  8.319   119.183 1.00 92.42 ? 41  ASN D ND2 1 
ATOM   7234  N N   . ARG D 1 44  ? 87.343  10.381  120.845 1.00 92.42 ? 42  ARG D N   1 
ATOM   7235  C CA  . ARG D 1 44  ? 88.750  9.973   120.762 1.00 92.42 ? 42  ARG D CA  1 
ATOM   7236  C C   . ARG D 1 44  ? 89.216  9.281   122.045 1.00 92.42 ? 42  ARG D C   1 
ATOM   7237  O O   . ARG D 1 44  ? 90.008  8.337   121.998 1.00 92.42 ? 42  ARG D O   1 
ATOM   7238  C CB  . ARG D 1 44  ? 89.635  11.198  120.500 1.00 92.42 ? 42  ARG D CB  1 
ATOM   7239  C CG  . ARG D 1 44  ? 88.986  12.269  119.625 1.00 92.42 ? 42  ARG D CG  1 
ATOM   7240  C CD  . ARG D 1 44  ? 88.650  11.762  118.221 1.00 92.42 ? 42  ARG D CD  1 
ATOM   7241  N NE  . ARG D 1 44  ? 87.805  12.710  117.495 1.00 92.42 ? 42  ARG D NE  1 
ATOM   7242  C CZ  . ARG D 1 44  ? 87.495  12.616  116.204 1.00 92.42 ? 42  ARG D CZ  1 
ATOM   7243  N NH1 . ARG D 1 44  ? 87.958  11.614  115.469 1.00 92.42 ? 42  ARG D NH1 1 
ATOM   7244  N NH2 . ARG D 1 44  ? 86.715  13.531  115.649 1.00 92.42 ? 42  ARG D NH2 1 
ATOM   7245  N N   . LEU D 1 45  ? 88.714  9.763   123.182 1.00 92.42 ? 43  LEU D N   1 
ATOM   7246  C CA  . LEU D 1 45  ? 89.053  9.221   124.502 1.00 92.42 ? 43  LEU D CA  1 
ATOM   7247  C C   . LEU D 1 45  ? 88.551  7.792   124.729 1.00 92.42 ? 43  LEU D C   1 
ATOM   7248  O O   . LEU D 1 45  ? 89.282  6.931   125.246 1.00 92.42 ? 43  LEU D O   1 
ATOM   7249  C CB  . LEU D 1 45  ? 88.502  10.150  125.586 1.00 76.73 ? 43  LEU D CB  1 
ATOM   7250  C CG  . LEU D 1 45  ? 89.294  11.455  125.707 1.00 76.73 ? 43  LEU D CG  1 
ATOM   7251  C CD1 . LEU D 1 45  ? 88.559  12.458  126.579 1.00 76.73 ? 43  LEU D CD1 1 
ATOM   7252  C CD2 . LEU D 1 45  ? 90.671  11.132  126.279 1.00 70.52 ? 43  LEU D CD2 1 
ATOM   7253  N N   . GLN D 1 46  ? 87.296  7.552   124.357 1.00 92.42 ? 44  GLN D N   1 
ATOM   7254  C CA  . GLN D 1 46  ? 86.708  6.223   124.486 1.00 92.42 ? 44  GLN D CA  1 
ATOM   7255  C C   . GLN D 1 46  ? 87.635  5.234   123.787 1.00 92.42 ? 44  GLN D C   1 
ATOM   7256  O O   . GLN D 1 46  ? 87.886  4.135   124.285 1.00 92.42 ? 44  GLN D O   1 
ATOM   7257  C CB  . GLN D 1 46  ? 85.341  6.158   123.792 1.00 92.42 ? 44  GLN D CB  1 
ATOM   7258  C CG  . GLN D 1 46  ? 84.247  7.040   124.381 1.00 92.42 ? 44  GLN D CG  1 
ATOM   7259  C CD  . GLN D 1 46  ? 82.985  7.051   123.521 1.00 92.42 ? 44  GLN D CD  1 
ATOM   7260  O OE1 . GLN D 1 46  ? 81.971  7.650   123.891 1.00 92.42 ? 44  GLN D OE1 1 
ATOM   7261  N NE2 . GLN D 1 46  ? 83.048  6.390   122.363 1.00 92.42 ? 44  GLN D NE2 1 
ATOM   7262  N N   . ARG D 1 47  ? 88.139  5.648   122.627 1.00 73.23 ? 45  ARG D N   1 
ATOM   7263  C CA  . ARG D 1 47  ? 89.019  4.824   121.812 1.00 78.18 ? 45  ARG D CA  1 
ATOM   7264  C C   . ARG D 1 47  ? 90.280  4.316   122.518 1.00 80.87 ? 45  ARG D C   1 
ATOM   7265  O O   . ARG D 1 47  ? 90.704  3.180   122.280 1.00 85.44 ? 45  ARG D O   1 
ATOM   7266  C CB  . ARG D 1 47  ? 89.411  5.591   120.546 1.00 81.95 ? 45  ARG D CB  1 
ATOM   7267  C CG  . ARG D 1 47  ? 88.234  6.197   119.791 1.00 83.99 ? 45  ARG D CG  1 
ATOM   7268  C CD  . ARG D 1 47  ? 88.662  6.735   118.427 1.00 83.99 ? 45  ARG D CD  1 
ATOM   7269  N NE  . ARG D 1 47  ? 87.619  7.539   117.790 1.00 83.99 ? 45  ARG D NE  1 
ATOM   7270  C CZ  . ARG D 1 47  ? 87.662  7.953   116.527 1.00 83.99 ? 45  ARG D CZ  1 
ATOM   7271  N NH1 . ARG D 1 47  ? 88.695  7.634   115.762 1.00 83.99 ? 45  ARG D NH1 1 
ATOM   7272  N NH2 . ARG D 1 47  ? 86.676  8.688   116.030 1.00 83.99 ? 45  ARG D NH2 1 
ATOM   7273  N N   . ILE D 1 48  ? 90.880  5.140   123.379 1.00 92.42 ? 46  ILE D N   1 
ATOM   7274  C CA  . ILE D 1 48  ? 92.101  4.742   124.093 1.00 92.42 ? 46  ILE D CA  1 
ATOM   7275  C C   . ILE D 1 48  ? 91.880  4.324   125.545 1.00 92.42 ? 46  ILE D C   1 
ATOM   7276  O O   . ILE D 1 48  ? 92.848  4.144   126.292 1.00 92.42 ? 46  ILE D O   1 
ATOM   7277  C CB  . ILE D 1 48  ? 93.159  5.867   124.120 1.00 92.42 ? 46  ILE D CB  1 
ATOM   7278  C CG1 . ILE D 1 48  ? 92.522  7.152   124.666 1.00 92.42 ? 46  ILE D CG1 1 
ATOM   7279  C CG2 . ILE D 1 48  ? 93.783  6.033   122.737 1.00 92.42 ? 46  ILE D CG2 1 
ATOM   7280  C CD1 . ILE D 1 48  ? 93.518  8.205   125.116 1.00 92.42 ? 46  ILE D CD1 1 
ATOM   7281  N N   . LYS D 1 49  ? 90.617  4.189   125.948 1.00 92.42 ? 47  LYS D N   1 
ATOM   7282  C CA  . LYS D 1 49  ? 90.289  3.781   127.315 1.00 92.42 ? 47  LYS D CA  1 
ATOM   7283  C C   . LYS D 1 49  ? 90.518  4.871   128.351 1.00 92.42 ? 47  LYS D C   1 
ATOM   7284  O O   . LYS D 1 49  ? 91.219  4.652   129.338 1.00 92.42 ? 47  LYS D O   1 
ATOM   7285  C CB  . LYS D 1 49  ? 91.103  2.544   127.722 1.00 88.38 ? 47  LYS D CB  1 
ATOM   7286  C CG  . LYS D 1 49  ? 90.491  1.214   127.325 1.00 88.38 ? 47  LYS D CG  1 
ATOM   7287  C CD  . LYS D 1 49  ? 91.251  0.067   127.967 1.00 88.38 ? 47  LYS D CD  1 
ATOM   7288  C CE  . LYS D 1 49  ? 90.403  -1.189  127.999 1.00 88.38 ? 47  LYS D CE  1 
ATOM   7289  N NZ  . LYS D 1 49  ? 91.048  -2.270  128.786 1.00 88.38 ? 47  LYS D NZ  1 
ATOM   7290  N N   . VAL D 1 50  ? 89.936  6.044   128.127 1.00 92.42 ? 48  VAL D N   1 
ATOM   7291  C CA  . VAL D 1 50  ? 90.080  7.151   129.070 1.00 92.42 ? 48  VAL D CA  1 
ATOM   7292  C C   . VAL D 1 50  ? 88.771  7.920   129.124 1.00 92.42 ? 48  VAL D C   1 
ATOM   7293  O O   . VAL D 1 50  ? 88.236  8.335   128.094 1.00 92.42 ? 48  VAL D O   1 
ATOM   7294  C CB  . VAL D 1 50  ? 91.206  8.133   128.657 1.00 92.42 ? 48  VAL D CB  1 
ATOM   7295  C CG1 . VAL D 1 50  ? 91.317  9.247   129.691 1.00 92.42 ? 48  VAL D CG1 1 
ATOM   7296  C CG2 . VAL D 1 50  ? 92.537  7.392   128.515 1.00 92.42 ? 48  VAL D CG2 1 
ATOM   7297  N N   . GLU D 1 51  ? 88.248  8.100   130.329 1.00 90.26 ? 49  GLU D N   1 
ATOM   7298  C CA  . GLU D 1 51  ? 86.999  8.821   130.494 1.00 90.26 ? 49  GLU D CA  1 
ATOM   7299  C C   . GLU D 1 51  ? 87.177  10.289  130.167 1.00 90.26 ? 49  GLU D C   1 
ATOM   7300  O O   . GLU D 1 51  ? 88.202  10.896  130.484 1.00 90.26 ? 49  GLU D O   1 
ATOM   7301  C CB  . GLU D 1 51  ? 86.471  8.650   131.918 1.00 92.42 ? 49  GLU D CB  1 
ATOM   7302  C CG  . GLU D 1 51  ? 85.608  7.404   132.093 1.00 92.42 ? 49  GLU D CG  1 
ATOM   7303  C CD  . GLU D 1 51  ? 85.405  7.037   133.552 1.00 92.42 ? 49  GLU D CD  1 
ATOM   7304  O OE1 . GLU D 1 51  ? 85.275  7.972   134.380 1.00 92.42 ? 49  GLU D OE1 1 
ATOM   7305  O OE2 . GLU D 1 51  ? 85.366  5.819   133.865 1.00 92.42 ? 49  GLU D OE2 1 
ATOM   7306  N N   . ASN D 1 52  ? 86.170  10.852  129.518 1.00 63.88 ? 50  ASN D N   1 
ATOM   7307  C CA  . ASN D 1 52  ? 86.218  12.247  129.136 1.00 67.77 ? 50  ASN D CA  1 
ATOM   7308  C C   . ASN D 1 52  ? 85.965  13.197  130.310 1.00 71.37 ? 50  ASN D C   1 
ATOM   7309  O O   . ASN D 1 52  ? 84.832  13.625  130.549 1.00 77.49 ? 50  ASN D O   1 
ATOM   7310  C CB  . ASN D 1 52  ? 85.208  12.505  128.016 1.00 92.42 ? 50  ASN D CB  1 
ATOM   7311  C CG  . ASN D 1 52  ? 85.339  13.896  127.422 1.00 92.42 ? 50  ASN D CG  1 
ATOM   7312  O OD1 . ASN D 1 52  ? 84.617  14.253  126.487 1.00 92.42 ? 50  ASN D OD1 1 
ATOM   7313  N ND2 . ASN D 1 52  ? 86.264  14.691  127.961 1.00 92.42 ? 50  ASN D ND2 1 
ATOM   7314  N N   . THR D 1 53  ? 87.029  13.523  131.040 1.00 88.60 ? 51  THR D N   1 
ATOM   7315  C CA  . THR D 1 53  ? 86.930  14.442  132.167 1.00 88.60 ? 51  THR D CA  1 
ATOM   7316  C C   . THR D 1 53  ? 87.680  15.720  131.793 1.00 88.60 ? 51  THR D C   1 
ATOM   7317  O O   . THR D 1 53  ? 88.540  15.694  130.914 1.00 88.60 ? 51  THR D O   1 
ATOM   7318  C CB  . THR D 1 53  ? 87.554  13.843  133.450 1.00 86.58 ? 51  THR D CB  1 
ATOM   7319  O OG1 . THR D 1 53  ? 86.957  14.462  134.597 1.00 86.58 ? 51  THR D OG1 1 
ATOM   7320  C CG2 . THR D 1 53  ? 89.050  14.098  133.497 1.00 86.58 ? 51  THR D CG2 1 
ATOM   7321  N N   . GLU D 1 54  ? 87.363  16.836  132.448 1.00 90.12 ? 52  GLU D N   1 
ATOM   7322  C CA  . GLU D 1 54  ? 88.042  18.088  132.132 1.00 90.12 ? 52  GLU D CA  1 
ATOM   7323  C C   . GLU D 1 54  ? 89.520  17.898  132.399 1.00 90.12 ? 52  GLU D C   1 
ATOM   7324  O O   . GLU D 1 54  ? 90.362  18.283  131.587 1.00 90.12 ? 52  GLU D O   1 
ATOM   7325  C CB  . GLU D 1 54  ? 87.530  19.247  132.989 1.00 70.93 ? 52  GLU D CB  1 
ATOM   7326  C CG  . GLU D 1 54  ? 87.527  20.586  132.246 1.00 82.23 ? 52  GLU D CG  1 
ATOM   7327  C CD  . GLU D 1 54  ? 87.877  21.777  133.131 1.00 82.23 ? 52  GLU D CD  1 
ATOM   7328  O OE1 . GLU D 1 54  ? 87.405  21.838  134.293 1.00 82.23 ? 52  GLU D OE1 1 
ATOM   7329  O OE2 . GLU D 1 54  ? 88.619  22.664  132.652 1.00 82.23 ? 52  GLU D OE2 1 
ATOM   7330  N N   . GLU D 1 55  ? 89.834  17.293  133.540 1.00 92.42 ? 53  GLU D N   1 
ATOM   7331  C CA  . GLU D 1 55  ? 91.221  17.054  133.904 1.00 92.42 ? 53  GLU D CA  1 
ATOM   7332  C C   . GLU D 1 55  ? 91.974  16.300  132.801 1.00 92.42 ? 53  GLU D C   1 
ATOM   7333  O O   . GLU D 1 55  ? 92.901  16.848  132.207 1.00 92.42 ? 53  GLU D O   1 
ATOM   7334  C CB  . GLU D 1 55  ? 91.298  16.291  135.227 1.00 79.29 ? 53  GLU D CB  1 
ATOM   7335  C CG  . GLU D 1 55  ? 92.719  16.073  135.734 1.00 79.29 ? 53  GLU D CG  1 
ATOM   7336  C CD  . GLU D 1 55  ? 93.584  17.317  135.620 1.00 79.29 ? 53  GLU D CD  1 
ATOM   7337  O OE1 . GLU D 1 55  ? 93.118  18.408  136.027 1.00 79.29 ? 53  GLU D OE1 1 
ATOM   7338  O OE2 . GLU D 1 55  ? 94.732  17.195  135.127 1.00 79.29 ? 53  GLU D OE2 1 
ATOM   7339  N N   . ASN D 1 56  ? 91.578  15.059  132.515 1.00 92.42 ? 54  ASN D N   1 
ATOM   7340  C CA  . ASN D 1 56  ? 92.235  14.263  131.470 1.00 92.42 ? 54  ASN D CA  1 
ATOM   7341  C C   . ASN D 1 56  ? 92.511  15.074  130.204 1.00 92.42 ? 54  ASN D C   1 
ATOM   7342  O O   . ASN D 1 56  ? 93.587  14.959  129.609 1.00 92.42 ? 54  ASN D O   1 
ATOM   7343  C CB  . ASN D 1 56  ? 91.388  13.035  131.122 1.00 92.42 ? 54  ASN D CB  1 
ATOM   7344  C CG  . ASN D 1 56  ? 91.371  12.010  132.239 1.00 92.42 ? 54  ASN D CG  1 
ATOM   7345  O OD1 . ASN D 1 56  ? 92.420  11.530  132.669 1.00 92.42 ? 54  ASN D OD1 1 
ATOM   7346  N ND2 . ASN D 1 56  ? 90.180  11.670  132.716 1.00 92.42 ? 54  ASN D ND2 1 
ATOM   7347  N N   . ARG D 1 57  ? 91.537  15.884  129.792 1.00 92.42 ? 55  ARG D N   1 
ATOM   7348  C CA  . ARG D 1 57  ? 91.710  16.724  128.616 1.00 92.42 ? 55  ARG D CA  1 
ATOM   7349  C C   . ARG D 1 57  ? 92.875  17.666  128.898 1.00 92.42 ? 55  ARG D C   1 
ATOM   7350  O O   . ARG D 1 57  ? 93.847  17.700  128.143 1.00 92.42 ? 55  ARG D O   1 
ATOM   7351  C CB  . ARG D 1 57  ? 90.433  17.520  128.320 1.00 68.47 ? 55  ARG D CB  1 
ATOM   7352  C CG  . ARG D 1 57  ? 89.236  16.636  127.984 1.00 68.47 ? 55  ARG D CG  1 
ATOM   7353  C CD  . ARG D 1 57  ? 88.215  17.352  127.101 1.00 68.47 ? 55  ARG D CD  1 
ATOM   7354  N NE  . ARG D 1 57  ? 87.502  18.431  127.780 1.00 68.47 ? 55  ARG D NE  1 
ATOM   7355  C CZ  . ARG D 1 57  ? 86.641  18.249  128.776 1.00 68.47 ? 55  ARG D CZ  1 
ATOM   7356  N NH1 . ARG D 1 57  ? 86.381  17.027  129.221 1.00 68.47 ? 55  ARG D NH1 1 
ATOM   7357  N NH2 . ARG D 1 57  ? 86.027  19.290  129.321 1.00 68.47 ? 55  ARG D NH2 1 
ATOM   7358  N N   . ARG D 1 58  ? 92.784  18.412  129.995 1.00 65.00 ? 56  ARG D N   1 
ATOM   7359  C CA  . ARG D 1 58  ? 93.845  19.336  130.378 1.00 65.00 ? 56  ARG D CA  1 
ATOM   7360  C C   . ARG D 1 58  ? 95.173  18.582  130.508 1.00 65.00 ? 56  ARG D C   1 
ATOM   7361  O O   . ARG D 1 58  ? 96.232  19.094  130.139 1.00 65.00 ? 56  ARG D O   1 
ATOM   7362  C CB  . ARG D 1 58  ? 93.510  19.996  131.719 1.00 65.27 ? 56  ARG D CB  1 
ATOM   7363  C CG  . ARG D 1 58  ? 94.391  21.193  132.087 1.00 65.27 ? 56  ARG D CG  1 
ATOM   7364  C CD  . ARG D 1 58  ? 94.287  21.543  133.577 1.00 65.27 ? 56  ARG D CD  1 
ATOM   7365  N NE  . ARG D 1 58  ? 94.859  20.492  134.424 1.00 65.27 ? 56  ARG D NE  1 
ATOM   7366  C CZ  . ARG D 1 58  ? 96.152  20.173  134.459 1.00 65.27 ? 56  ARG D CZ  1 
ATOM   7367  N NH1 . ARG D 1 58  ? 97.017  20.823  133.697 1.00 65.27 ? 56  ARG D NH1 1 
ATOM   7368  N NH2 . ARG D 1 58  ? 96.589  19.202  135.250 1.00 65.27 ? 56  ARG D NH2 1 
ATOM   7369  N N   . GLN D 1 59  ? 95.107  17.355  131.016 1.00 87.13 ? 57  GLN D N   1 
ATOM   7370  C CA  . GLN D 1 59  ? 96.297  16.533  131.225 1.00 87.13 ? 57  GLN D CA  1 
ATOM   7371  C C   . GLN D 1 59  ? 96.966  16.024  129.949 1.00 87.13 ? 57  GLN D C   1 
ATOM   7372  O O   . GLN D 1 59  ? 98.185  15.870  129.914 1.00 87.13 ? 57  GLN D O   1 
ATOM   7373  C CB  . GLN D 1 59  ? 95.966  15.343  132.128 1.00 92.42 ? 57  GLN D CB  1 
ATOM   7374  C CG  . GLN D 1 59  ? 97.186  14.723  132.795 1.00 92.42 ? 57  GLN D CG  1 
ATOM   7375  C CD  . GLN D 1 59  ? 96.854  13.464  133.590 1.00 92.42 ? 57  GLN D CD  1 
ATOM   7376  O OE1 . GLN D 1 59  ? 96.665  12.383  133.024 1.00 92.42 ? 57  GLN D OE1 1 
ATOM   7377  N NE2 . GLN D 1 59  ? 96.775  13.604  134.911 1.00 92.42 ? 57  GLN D NE2 1 
ATOM   7378  N N   . PHE D 1 60  ? 96.186  15.748  128.908 1.00 92.27 ? 58  PHE D N   1 
ATOM   7379  C CA  . PHE D 1 60  ? 96.773  15.273  127.653 1.00 92.27 ? 58  PHE D CA  1 
ATOM   7380  C C   . PHE D 1 60  ? 97.286  16.436  126.800 1.00 92.27 ? 58  PHE D C   1 
ATOM   7381  O O   . PHE D 1 60  ? 98.370  16.363  126.218 1.00 92.27 ? 58  PHE D O   1 
ATOM   7382  C CB  . PHE D 1 60  ? 95.759  14.461  126.840 1.00 54.37 ? 58  PHE D CB  1 
ATOM   7383  C CG  . PHE D 1 60  ? 96.258  14.074  125.472 1.00 54.37 ? 58  PHE D CG  1 
ATOM   7384  C CD1 . PHE D 1 60  ? 97.348  13.218  125.329 1.00 54.37 ? 58  PHE D CD1 1 
ATOM   7385  C CD2 . PHE D 1 60  ? 95.658  14.592  124.327 1.00 54.37 ? 58  PHE D CD2 1 
ATOM   7386  C CE1 . PHE D 1 60  ? 97.836  12.887  124.068 1.00 54.37 ? 58  PHE D CE1 1 
ATOM   7387  C CE2 . PHE D 1 60  ? 96.140  14.265  123.060 1.00 54.37 ? 58  PHE D CE2 1 
ATOM   7388  C CZ  . PHE D 1 60  ? 97.233  13.410  122.932 1.00 54.37 ? 58  PHE D CZ  1 
ATOM   7389  N N   . ARG D 1 61  ? 96.496  17.501  126.718 1.00 57.81 ? 59  ARG D N   1 
ATOM   7390  C CA  . ARG D 1 61  ? 96.886  18.670  125.950 1.00 57.81 ? 59  ARG D CA  1 
ATOM   7391  C C   . ARG D 1 61  ? 98.100  19.322  126.575 1.00 57.81 ? 59  ARG D C   1 
ATOM   7392  O O   . ARG D 1 61  ? 98.870  19.994  125.881 1.00 57.81 ? 59  ARG D O   1 
ATOM   7393  C CB  . ARG D 1 61  ? 95.729  19.655  125.880 1.00 73.52 ? 59  ARG D CB  1 
ATOM   7394  C CG  . ARG D 1 61  ? 94.654  19.164  124.961 1.00 73.52 ? 59  ARG D CG  1 
ATOM   7395  C CD  . ARG D 1 61  ? 93.370  19.928  125.076 1.00 73.52 ? 59  ARG D CD  1 
ATOM   7396  N NE  . ARG D 1 61  ? 92.417  19.395  124.111 1.00 73.52 ? 59  ARG D NE  1 
ATOM   7397  C CZ  . ARG D 1 61  ? 91.102  19.494  124.235 1.00 73.52 ? 59  ARG D CZ  1 
ATOM   7398  N NH1 . ARG D 1 61  ? 90.589  20.110  125.294 1.00 73.52 ? 59  ARG D NH1 1 
ATOM   7399  N NH2 . ARG D 1 61  ? 90.306  18.980  123.303 1.00 73.52 ? 59  ARG D NH2 1 
ATOM   7400  N N   . GLU D 1 62  ? 98.263  19.121  127.885 1.00 69.68 ? 60  GLU D N   1 
ATOM   7401  C CA  . GLU D 1 62  ? 99.406  19.663  128.622 1.00 69.68 ? 60  GLU D CA  1 
ATOM   7402  C C   . GLU D 1 62  ? 100.675 18.987  128.109 1.00 69.68 ? 60  GLU D C   1 
ATOM   7403  O O   . GLU D 1 62  ? 101.726 19.618  127.967 1.00 69.68 ? 60  GLU D O   1 
ATOM   7404  C CB  . GLU D 1 62  ? 99.263  19.403  130.128 1.00 57.88 ? 60  GLU D CB  1 
ATOM   7405  C CG  . GLU D 1 62  ? 100.375 20.059  130.955 1.00 57.88 ? 60  GLU D CG  1 
ATOM   7406  C CD  . GLU D 1 62  ? 100.225 19.866  132.461 1.00 57.88 ? 60  GLU D CD  1 
ATOM   7407  O OE1 . GLU D 1 62  ? 100.997 20.498  133.220 1.00 57.88 ? 60  GLU D OE1 1 
ATOM   7408  O OE2 . GLU D 1 62  ? 99.344  19.082  132.880 1.00 57.88 ? 60  GLU D OE2 1 
ATOM   7409  N N   . ILE D 1 63  ? 100.549 17.696  127.823 1.00 89.43 ? 61  ILE D N   1 
ATOM   7410  C CA  . ILE D 1 63  ? 101.645 16.886  127.316 1.00 89.43 ? 61  ILE D CA  1 
ATOM   7411  C C   . ILE D 1 63  ? 102.093 17.374  125.943 1.00 89.43 ? 61  ILE D C   1 
ATOM   7412  O O   . ILE D 1 63  ? 103.280 17.367  125.627 1.00 89.43 ? 61  ILE D O   1 
ATOM   7413  C CB  . ILE D 1 63  ? 101.211 15.417  127.199 1.00 63.29 ? 61  ILE D CB  1 
ATOM   7414  C CG1 . ILE D 1 63  ? 100.685 14.937  128.548 1.00 63.29 ? 61  ILE D CG1 1 
ATOM   7415  C CG2 . ILE D 1 63  ? 102.376 14.559  126.729 1.00 63.29 ? 61  ILE D CG2 1 
ATOM   7416  C CD1 . ILE D 1 63  ? 100.186 13.525  128.526 1.00 63.29 ? 61  ILE D CD1 1 
ATOM   7417  N N   . LEU D 1 64  ? 101.134 17.792  125.129 1.00 62.17 ? 62  LEU D N   1 
ATOM   7418  C CA  . LEU D 1 64  ? 101.437 18.278  123.797 1.00 61.30 ? 62  LEU D CA  1 
ATOM   7419  C C   . LEU D 1 64  ? 102.140 19.617  123.875 1.00 63.52 ? 62  LEU D C   1 
ATOM   7420  O O   . LEU D 1 64  ? 103.277 19.745  123.438 1.00 60.06 ? 62  LEU D O   1 
ATOM   7421  C CB  . LEU D 1 64  ? 100.155 18.430  122.972 1.00 59.27 ? 62  LEU D CB  1 
ATOM   7422  C CG  . LEU D 1 64  ? 99.313  17.181  122.701 1.00 67.80 ? 62  LEU D CG  1 
ATOM   7423  C CD1 . LEU D 1 64  ? 98.056  17.581  121.969 1.00 63.57 ? 62  LEU D CD1 1 
ATOM   7424  C CD2 . LEU D 1 64  ? 100.108 16.170  121.886 1.00 58.75 ? 62  LEU D CD2 1 
ATOM   7425  N N   . PHE D 1 65  ? 101.467 20.609  124.447 1.00 55.97 ? 63  PHE D N   1 
ATOM   7426  C CA  . PHE D 1 65  ? 102.022 21.955  124.546 1.00 58.68 ? 63  PHE D CA  1 
ATOM   7427  C C   . PHE D 1 65  ? 103.345 22.057  125.295 1.00 62.52 ? 63  PHE D C   1 
ATOM   7428  O O   . PHE D 1 65  ? 104.153 22.943  125.007 1.00 62.15 ? 63  PHE D O   1 
ATOM   7429  C CB  . PHE D 1 65  ? 101.024 22.895  125.209 1.00 40.24 ? 63  PHE D CB  1 
ATOM   7430  C CG  . PHE D 1 65  ? 99.672  22.904  124.571 1.00 49.19 ? 63  PHE D CG  1 
ATOM   7431  C CD1 . PHE D 1 65  ? 98.669  23.714  125.079 1.00 49.32 ? 63  PHE D CD1 1 
ATOM   7432  C CD2 . PHE D 1 65  ? 99.389  22.102  123.488 1.00 47.16 ? 63  PHE D CD2 1 
ATOM   7433  C CE1 . PHE D 1 65  ? 97.398  23.728  124.523 1.00 45.56 ? 63  PHE D CE1 1 
ATOM   7434  C CE2 . PHE D 1 65  ? 98.128  22.108  122.924 1.00 36.85 ? 63  PHE D CE2 1 
ATOM   7435  C CZ  . PHE D 1 65  ? 97.126  22.928  123.448 1.00 40.54 ? 63  PHE D CZ  1 
ATOM   7436  N N   . SER D 1 66  ? 103.562 21.169  126.261 1.00 51.00 ? 64  SER D N   1 
ATOM   7437  C CA  . SER D 1 66  ? 104.800 21.184  127.042 1.00 61.20 ? 64  SER D CA  1 
ATOM   7438  C C   . SER D 1 66  ? 105.951 20.526  126.298 1.00 66.09 ? 64  SER D C   1 
ATOM   7439  O O   . SER D 1 66  ? 107.033 20.370  126.846 1.00 67.17 ? 64  SER D O   1 
ATOM   7440  C CB  . SER D 1 66  ? 104.616 20.436  128.357 1.00 56.14 ? 64  SER D CB  1 
ATOM   7441  O OG  . SER D 1 66  ? 105.025 19.083  128.205 1.00 69.32 ? 64  SER D OG  1 
ATOM   7442  N N   . VAL D 1 67  ? 105.717 20.125  125.057 1.00 57.13 ? 65  VAL D N   1 
ATOM   7443  C CA  . VAL D 1 67  ? 106.759 19.469  124.284 1.00 49.75 ? 65  VAL D CA  1 
ATOM   7444  C C   . VAL D 1 67  ? 107.890 20.446  123.942 1.00 54.41 ? 65  VAL D C   1 
ATOM   7445  O O   . VAL D 1 67  ? 107.702 21.662  123.934 1.00 47.57 ? 65  VAL D O   1 
ATOM   7446  C CB  . VAL D 1 67  ? 106.181 18.854  122.974 1.00 53.44 ? 65  VAL D CB  1 
ATOM   7447  C CG1 . VAL D 1 67  ? 106.014 19.932  121.911 1.00 40.45 ? 65  VAL D CG1 1 
ATOM   7448  C CG2 . VAL D 1 67  ? 107.077 17.730  122.478 1.00 45.80 ? 65  VAL D CG2 1 
ATOM   7449  N N   . ASP D 1 68  ? 109.067 19.889  123.680 1.00 73.33 ? 66  ASP D N   1 
ATOM   7450  C CA  . ASP D 1 68  ? 110.253 20.653  123.311 1.00 73.33 ? 66  ASP D CA  1 
ATOM   7451  C C   . ASP D 1 68  ? 109.872 21.865  122.450 1.00 73.33 ? 66  ASP D C   1 
ATOM   7452  O O   . ASP D 1 68  ? 108.889 21.814  121.715 1.00 73.33 ? 66  ASP D O   1 
ATOM   7453  C CB  . ASP D 1 68  ? 111.189 19.727  122.538 1.00 50.62 ? 66  ASP D CB  1 
ATOM   7454  C CG  . ASP D 1 68  ? 112.520 20.354  122.252 1.00 65.88 ? 66  ASP D CG  1 
ATOM   7455  O OD1 . ASP D 1 68  ? 112.542 21.444  121.650 1.00 73.83 ? 66  ASP D OD1 1 
ATOM   7456  O OD2 . ASP D 1 68  ? 113.547 19.751  122.627 1.00 73.83 ? 66  ASP D OD2 1 
ATOM   7457  N N   . SER D 1 69  ? 110.642 22.948  122.531 1.00 39.48 ? 67  SER D N   1 
ATOM   7458  C CA  . SER D 1 69  ? 110.341 24.152  121.751 1.00 44.16 ? 67  SER D CA  1 
ATOM   7459  C C   . SER D 1 69  ? 110.686 24.027  120.264 1.00 43.55 ? 67  SER D C   1 
ATOM   7460  O O   . SER D 1 69  ? 110.311 24.891  119.467 1.00 38.89 ? 67  SER D O   1 
ATOM   7461  C CB  . SER D 1 69  ? 111.094 25.349  122.304 1.00 15.85 ? 67  SER D CB  1 
ATOM   7462  O OG  . SER D 1 69  ? 112.434 25.354  121.827 1.00 52.41 ? 67  SER D OG  1 
ATOM   7463  N N   . SER D 1 70  ? 111.408 22.966  119.899 1.00 67.02 ? 68  SER D N   1 
ATOM   7464  C CA  . SER D 1 70  ? 111.806 22.729  118.508 1.00 73.58 ? 68  SER D CA  1 
ATOM   7465  C C   . SER D 1 70  ? 110.571 22.479  117.655 1.00 74.25 ? 68  SER D C   1 
ATOM   7466  O O   . SER D 1 70  ? 110.627 22.477  116.433 1.00 67.02 ? 68  SER D O   1 
ATOM   7467  C CB  . SER D 1 70  ? 112.727 21.513  118.413 1.00 64.09 ? 68  SER D CB  1 
ATOM   7468  O OG  . SER D 1 70  ? 111.996 20.314  118.626 1.00 75.93 ? 68  SER D OG  1 
ATOM   7469  N N   . ILE D 1 71  ? 109.450 22.251  118.312 1.00 48.30 ? 69  ILE D N   1 
ATOM   7470  C CA  . ILE D 1 71  ? 108.222 22.012  117.598 1.00 52.74 ? 69  ILE D CA  1 
ATOM   7471  C C   . ILE D 1 71  ? 107.801 23.277  116.859 1.00 52.82 ? 69  ILE D C   1 
ATOM   7472  O O   . ILE D 1 71  ? 107.109 23.194  115.843 1.00 49.55 ? 69  ILE D O   1 
ATOM   7473  C CB  . ILE D 1 71  ? 107.108 21.596  118.557 1.00 56.49 ? 69  ILE D CB  1 
ATOM   7474  C CG1 . ILE D 1 71  ? 105.881 21.174  117.763 1.00 43.94 ? 69  ILE D CG1 1 
ATOM   7475  C CG2 . ILE D 1 71  ? 106.749 22.748  119.476 1.00 46.32 ? 69  ILE D CG2 1 
ATOM   7476  C CD1 . ILE D 1 71  ? 104.795 20.607  118.616 1.00 57.00 ? 69  ILE D CD1 1 
ATOM   7477  N N   . ASN D 1 72  ? 108.217 24.442  117.366 1.00 48.37 ? 70  ASN D N   1 
ATOM   7478  C CA  . ASN D 1 72  ? 107.879 25.730  116.742 1.00 48.01 ? 70  ASN D CA  1 
ATOM   7479  C C   . ASN D 1 72  ? 108.442 25.761  115.324 1.00 57.17 ? 70  ASN D C   1 
ATOM   7480  O O   . ASN D 1 72  ? 108.258 26.721  114.574 1.00 59.92 ? 70  ASN D O   1 
ATOM   7481  C CB  . ASN D 1 72  ? 108.445 26.889  117.567 1.00 36.91 ? 70  ASN D CB  1 
ATOM   7482  C CG  . ASN D 1 72  ? 109.951 26.975  117.494 1.00 49.03 ? 70  ASN D CG  1 
ATOM   7483  O OD1 . ASN D 1 72  ? 110.617 26.016  117.117 1.00 51.42 ? 70  ASN D OD1 1 
ATOM   7484  N ND2 . ASN D 1 72  ? 110.499 28.124  117.867 1.00 48.54 ? 70  ASN D ND2 1 
ATOM   7485  N N   . GLN D 1 73  ? 109.144 24.684  114.989 1.00 44.55 ? 71  GLN D N   1 
ATOM   7486  C CA  . GLN D 1 73  ? 109.729 24.479  113.680 1.00 55.50 ? 71  GLN D CA  1 
ATOM   7487  C C   . GLN D 1 73  ? 108.671 23.754  112.868 1.00 57.05 ? 71  GLN D C   1 
ATOM   7488  O O   . GLN D 1 73  ? 108.436 24.071  111.709 1.00 54.26 ? 71  GLN D O   1 
ATOM   7489  C CB  . GLN D 1 73  ? 110.948 23.564  113.766 1.00 18.38 ? 71  GLN D CB  1 
ATOM   7490  C CG  . GLN D 1 73  ? 112.271 24.206  114.125 1.00 40.71 ? 71  GLN D CG  1 
ATOM   7491  C CD  . GLN D 1 73  ? 113.353 23.158  114.287 1.00 61.09 ? 71  GLN D CD  1 
ATOM   7492  O OE1 . GLN D 1 73  ? 113.498 22.279  113.443 1.00 51.71 ? 71  GLN D OE1 1 
ATOM   7493  N NE2 . GLN D 1 73  ? 114.112 23.239  115.377 1.00 41.58 ? 71  GLN D NE2 1 
ATOM   7494  N N   . SER D 1 74  ? 108.041 22.763  113.483 1.00 27.11 ? 72  SER D N   1 
ATOM   7495  C CA  . SER D 1 74  ? 107.026 21.992  112.793 1.00 36.28 ? 72  SER D CA  1 
ATOM   7496  C C   . SER D 1 74  ? 105.574 22.408  113.066 1.00 38.63 ? 72  SER D C   1 
ATOM   7497  O O   . SER D 1 74  ? 104.650 21.835  112.505 1.00 37.29 ? 72  SER D O   1 
ATOM   7498  C CB  . SER D 1 74  ? 107.230 20.501  113.084 1.00 25.27 ? 72  SER D CB  1 
ATOM   7499  O OG  . SER D 1 74  ? 108.434 20.025  112.498 1.00 39.81 ? 72  SER D OG  1 
ATOM   7500  N N   . ILE D 1 75  ? 105.354 23.395  113.923 1.00 47.24 ? 73  ILE D N   1 
ATOM   7501  C CA  . ILE D 1 75  ? 103.990 23.859  114.169 1.00 47.24 ? 73  ILE D CA  1 
ATOM   7502  C C   . ILE D 1 75  ? 103.993 25.376  114.242 1.00 47.24 ? 73  ILE D C   1 
ATOM   7503  O O   . ILE D 1 75  ? 104.828 25.981  114.912 1.00 47.24 ? 73  ILE D O   1 
ATOM   7504  C CB  . ILE D 1 75  ? 103.404 23.307  115.471 1.00 28.37 ? 73  ILE D CB  1 
ATOM   7505  C CG1 . ILE D 1 75  ? 103.342 21.774  115.420 1.00 28.37 ? 73  ILE D CG1 1 
ATOM   7506  C CG2 . ILE D 1 75  ? 102.022 23.900  115.687 1.00 28.37 ? 73  ILE D CG2 1 
ATOM   7507  C CD1 . ILE D 1 75  ? 102.375 21.222  114.406 1.00 28.37 ? 73  ILE D CD1 1 
ATOM   7508  N N   . GLY D 1 76  ? 103.051 25.997  113.554 1.00 34.17 ? 74  GLY D N   1 
ATOM   7509  C CA  . GLY D 1 76  ? 103.016 27.444  113.544 1.00 34.17 ? 74  GLY D CA  1 
ATOM   7510  C C   . GLY D 1 76  ? 101.851 28.073  114.263 1.00 34.17 ? 74  GLY D C   1 
ATOM   7511  O O   . GLY D 1 76  ? 101.772 29.285  114.375 1.00 34.17 ? 74  GLY D O   1 
ATOM   7512  N N   . GLY D 1 77  ? 100.936 27.266  114.757 1.00 48.80 ? 75  GLY D N   1 
ATOM   7513  C CA  . GLY D 1 77  ? 99.813  27.845  115.453 1.00 48.80 ? 75  GLY D CA  1 
ATOM   7514  C C   . GLY D 1 77  ? 98.923  26.765  115.998 1.00 48.80 ? 75  GLY D C   1 
ATOM   7515  O O   . GLY D 1 77  ? 98.853  25.664  115.448 1.00 48.80 ? 75  GLY D O   1 
ATOM   7516  N N   . VAL D 1 78  ? 98.250  27.059  117.096 1.00 35.51 ? 76  VAL D N   1 
ATOM   7517  C CA  . VAL D 1 78  ? 97.351  26.076  117.657 1.00 35.51 ? 76  VAL D CA  1 
ATOM   7518  C C   . VAL D 1 78  ? 95.986  26.693  117.887 1.00 35.51 ? 76  VAL D C   1 
ATOM   7519  O O   . VAL D 1 78  ? 95.881  27.788  118.430 1.00 35.51 ? 76  VAL D O   1 
ATOM   7520  C CB  . VAL D 1 78  ? 97.898  25.508  118.972 1.00 31.48 ? 76  VAL D CB  1 
ATOM   7521  C CG1 . VAL D 1 78  ? 96.851  24.637  119.643 1.00 31.48 ? 76  VAL D CG1 1 
ATOM   7522  C CG2 . VAL D 1 78  ? 99.118  24.685  118.685 1.00 31.48 ? 76  VAL D CG2 1 
ATOM   7523  N N   . ILE D 1 79  ? 94.942  26.007  117.439 1.00 80.07 ? 77  ILE D N   1 
ATOM   7524  C CA  . ILE D 1 79  ? 93.601  26.512  117.655 1.00 80.07 ? 77  ILE D CA  1 
ATOM   7525  C C   . ILE D 1 79  ? 93.099  25.739  118.854 1.00 80.07 ? 77  ILE D C   1 
ATOM   7526  O O   . ILE D 1 79  ? 93.227  24.515  118.909 1.00 80.07 ? 77  ILE D O   1 
ATOM   7527  C CB  . ILE D 1 79  ? 92.666  26.246  116.471 1.00 57.06 ? 77  ILE D CB  1 
ATOM   7528  C CG1 . ILE D 1 79  ? 93.464  26.210  115.161 1.00 57.06 ? 77  ILE D CG1 1 
ATOM   7529  C CG2 . ILE D 1 79  ? 91.609  27.350  116.423 1.00 57.06 ? 77  ILE D CG2 1 
ATOM   7530  C CD1 . ILE D 1 79  ? 92.648  25.826  113.907 1.00 57.06 ? 77  ILE D CD1 1 
ATOM   7531  N N   . LEU D 1 80  ? 92.546  26.456  119.821 1.00 51.46 ? 78  LEU D N   1 
ATOM   7532  C CA  . LEU D 1 80  ? 92.042  25.838  121.038 1.00 51.46 ? 78  LEU D CA  1 
ATOM   7533  C C   . LEU D 1 80  ? 90.523  26.022  121.127 1.00 51.46 ? 78  LEU D C   1 
ATOM   7534  O O   . LEU D 1 80  ? 89.932  26.791  120.363 1.00 51.46 ? 78  LEU D O   1 
ATOM   7535  C CB  . LEU D 1 80  ? 92.710  26.491  122.261 1.00 31.64 ? 78  LEU D CB  1 
ATOM   7536  C CG  . LEU D 1 80  ? 94.238  26.584  122.410 1.00 31.64 ? 78  LEU D CG  1 
ATOM   7537  C CD1 . LEU D 1 80  ? 94.577  27.650  123.441 1.00 31.64 ? 78  LEU D CD1 1 
ATOM   7538  C CD2 . LEU D 1 80  ? 94.823  25.225  122.808 1.00 31.64 ? 78  LEU D CD2 1 
ATOM   7539  N N   . PHE D 1 81  ? 89.896  25.302  122.050 1.00 85.45 ? 79  PHE D N   1 
ATOM   7540  C CA  . PHE D 1 81  ? 88.462  25.435  122.250 1.00 85.45 ? 79  PHE D CA  1 
ATOM   7541  C C   . PHE D 1 81  ? 88.267  26.373  123.442 1.00 85.45 ? 79  PHE D C   1 
ATOM   7542  O O   . PHE D 1 81  ? 89.164  26.491  124.274 1.00 85.45 ? 79  PHE D O   1 
ATOM   7543  C CB  . PHE D 1 81  ? 87.827  24.079  122.540 1.00 88.86 ? 79  PHE D CB  1 
ATOM   7544  C CG  . PHE D 1 81  ? 86.353  24.156  122.800 1.00 88.86 ? 79  PHE D CG  1 
ATOM   7545  C CD1 . PHE D 1 81  ? 85.519  24.853  121.923 1.00 88.86 ? 79  PHE D CD1 1 
ATOM   7546  C CD2 . PHE D 1 81  ? 85.798  23.552  123.923 1.00 88.86 ? 79  PHE D CD2 1 
ATOM   7547  C CE1 . PHE D 1 81  ? 84.159  24.948  122.158 1.00 88.86 ? 79  PHE D CE1 1 
ATOM   7548  C CE2 . PHE D 1 81  ? 84.436  23.640  124.170 1.00 88.86 ? 79  PHE D CE2 1 
ATOM   7549  C CZ  . PHE D 1 81  ? 83.612  24.342  123.285 1.00 88.86 ? 79  PHE D CZ  1 
ATOM   7550  N N   . HIS D 1 82  ? 87.111  27.031  123.535 1.00 63.48 ? 80  HIS D N   1 
ATOM   7551  C CA  . HIS D 1 82  ? 86.856  27.976  124.629 1.00 63.48 ? 80  HIS D CA  1 
ATOM   7552  C C   . HIS D 1 82  ? 87.368  27.488  125.984 1.00 63.48 ? 80  HIS D C   1 
ATOM   7553  O O   . HIS D 1 82  ? 87.759  28.292  126.831 1.00 63.48 ? 80  HIS D O   1 
ATOM   7554  C CB  . HIS D 1 82  ? 85.361  28.301  124.733 1.00 92.42 ? 80  HIS D CB  1 
ATOM   7555  C CG  . HIS D 1 82  ? 85.058  29.503  125.582 1.00 92.42 ? 80  HIS D CG  1 
ATOM   7556  N ND1 . HIS D 1 82  ? 83.771  29.931  125.837 1.00 92.42 ? 80  HIS D ND1 1 
ATOM   7557  C CD2 . HIS D 1 82  ? 85.875  30.373  126.225 1.00 92.42 ? 80  HIS D CD2 1 
ATOM   7558  C CE1 . HIS D 1 82  ? 83.808  31.010  126.599 1.00 92.42 ? 80  HIS D CE1 1 
ATOM   7559  N NE2 . HIS D 1 82  ? 85.073  31.299  126.849 1.00 92.42 ? 80  HIS D NE2 1 
ATOM   7560  N N   . GLU D 1 83  ? 87.365  26.173  126.185 1.00 92.42 ? 81  GLU D N   1 
ATOM   7561  C CA  . GLU D 1 83  ? 87.848  25.579  127.433 1.00 92.42 ? 81  GLU D CA  1 
ATOM   7562  C C   . GLU D 1 83  ? 89.372  25.700  127.556 1.00 92.42 ? 81  GLU D C   1 
ATOM   7563  O O   . GLU D 1 83  ? 89.891  26.477  128.364 1.00 92.42 ? 81  GLU D O   1 
ATOM   7564  C CB  . GLU D 1 83  ? 87.468  24.094  127.499 1.00 86.02 ? 81  GLU D CB  1 
ATOM   7565  C CG  . GLU D 1 83  ? 88.168  23.337  128.625 1.00 86.02 ? 81  GLU D CG  1 
ATOM   7566  C CD  . GLU D 1 83  ? 88.266  21.840  128.368 1.00 86.02 ? 81  GLU D CD  1 
ATOM   7567  O OE1 . GLU D 1 83  ? 87.209  21.183  128.270 1.00 86.02 ? 81  GLU D OE1 1 
ATOM   7568  O OE2 . GLU D 1 83  ? 89.405  21.321  128.266 1.00 86.02 ? 81  GLU D OE2 1 
ATOM   7569  N N   . THR D 1 84  ? 90.075  24.915  126.740 1.00 54.25 ? 82  THR D N   1 
ATOM   7570  C CA  . THR D 1 84  ? 91.528  24.873  126.730 1.00 54.25 ? 82  THR D CA  1 
ATOM   7571  C C   . THR D 1 84  ? 92.169  26.248  126.889 1.00 54.25 ? 82  THR D C   1 
ATOM   7572  O O   . THR D 1 84  ? 93.044  26.415  127.727 1.00 54.25 ? 82  THR D O   1 
ATOM   7573  C CB  . THR D 1 84  ? 92.056  24.221  125.433 1.00 63.09 ? 82  THR D CB  1 
ATOM   7574  O OG1 . THR D 1 84  ? 91.074  23.318  124.911 1.00 63.09 ? 82  THR D OG1 1 
ATOM   7575  C CG2 . THR D 1 84  ? 93.332  23.434  125.715 1.00 63.09 ? 82  THR D CG2 1 
ATOM   7576  N N   . LEU D 1 85  ? 91.735  27.231  126.105 1.00 37.88 ? 83  LEU D N   1 
ATOM   7577  C CA  . LEU D 1 85  ? 92.309  28.579  126.188 1.00 37.88 ? 83  LEU D CA  1 
ATOM   7578  C C   . LEU D 1 85  ? 92.497  29.054  127.626 1.00 37.88 ? 83  LEU D C   1 
ATOM   7579  O O   . LEU D 1 85  ? 93.371  29.882  127.913 1.00 37.88 ? 83  LEU D O   1 
ATOM   7580  C CB  . LEU D 1 85  ? 91.434  29.611  125.447 1.00 31.60 ? 83  LEU D CB  1 
ATOM   7581  C CG  . LEU D 1 85  ? 91.846  31.089  125.623 1.00 31.60 ? 83  LEU D CG  1 
ATOM   7582  C CD1 . LEU D 1 85  ? 93.203  31.321  124.970 1.00 31.60 ? 83  LEU D CD1 1 
ATOM   7583  C CD2 . LEU D 1 85  ? 90.792  32.024  125.024 1.00 31.60 ? 83  LEU D CD2 1 
ATOM   7584  N N   . TYR D 1 86  ? 91.687  28.526  128.538 1.00 51.67 ? 84  TYR D N   1 
ATOM   7585  C CA  . TYR D 1 86  ? 91.778  28.953  129.923 1.00 51.67 ? 84  TYR D CA  1 
ATOM   7586  C C   . TYR D 1 86  ? 92.389  27.959  130.901 1.00 51.67 ? 84  TYR D C   1 
ATOM   7587  O O   . TYR D 1 86  ? 92.447  28.229  132.097 1.00 51.67 ? 84  TYR D O   1 
ATOM   7588  C CB  . TYR D 1 86  ? 90.397  29.424  130.399 1.00 54.08 ? 84  TYR D CB  1 
ATOM   7589  C CG  . TYR D 1 86  ? 89.930  30.660  129.648 1.00 54.08 ? 84  TYR D CG  1 
ATOM   7590  C CD1 . TYR D 1 86  ? 89.097  30.559  128.528 1.00 54.08 ? 84  TYR D CD1 1 
ATOM   7591  C CD2 . TYR D 1 86  ? 90.404  31.924  129.998 1.00 54.08 ? 84  TYR D CD2 1 
ATOM   7592  C CE1 . TYR D 1 86  ? 88.759  31.691  127.773 1.00 54.08 ? 84  TYR D CE1 1 
ATOM   7593  C CE2 . TYR D 1 86  ? 90.073  33.055  129.253 1.00 54.08 ? 84  TYR D CE2 1 
ATOM   7594  C CZ  . TYR D 1 86  ? 89.256  32.935  128.143 1.00 54.08 ? 84  TYR D CZ  1 
ATOM   7595  O OH  . TYR D 1 86  ? 88.961  34.061  127.403 1.00 54.08 ? 84  TYR D OH  1 
ATOM   7596  N N   . GLN D 1 87  ? 92.863  26.823  130.397 1.00 47.68 ? 85  GLN D N   1 
ATOM   7597  C CA  . GLN D 1 87  ? 93.503  25.822  131.250 1.00 47.68 ? 85  GLN D CA  1 
ATOM   7598  C C   . GLN D 1 87  ? 94.960  26.204  131.576 1.00 47.68 ? 85  GLN D C   1 
ATOM   7599  O O   . GLN D 1 87  ? 95.625  26.922  130.812 1.00 47.68 ? 85  GLN D O   1 
ATOM   7600  C CB  . GLN D 1 87  ? 93.482  24.439  130.578 1.00 92.42 ? 85  GLN D CB  1 
ATOM   7601  C CG  . GLN D 1 87  ? 92.081  23.892  130.305 1.00 92.42 ? 85  GLN D CG  1 
ATOM   7602  C CD  . GLN D 1 87  ? 92.077  22.418  129.894 1.00 92.42 ? 85  GLN D CD  1 
ATOM   7603  O OE1 . GLN D 1 87  ? 92.756  22.015  128.948 1.00 92.42 ? 85  GLN D OE1 1 
ATOM   7604  N NE2 . GLN D 1 87  ? 91.300  21.611  130.605 1.00 92.42 ? 85  GLN D NE2 1 
ATOM   7605  N N   . LYS D 1 88  ? 95.440  25.722  132.721 1.00 51.42 ? 86  LYS D N   1 
ATOM   7606  C CA  . LYS D 1 88  ? 96.810  25.964  133.171 1.00 51.42 ? 86  LYS D CA  1 
ATOM   7607  C C   . LYS D 1 88  ? 97.521  24.617  133.338 1.00 51.42 ? 86  LYS D C   1 
ATOM   7608  O O   . LYS D 1 88  ? 96.865  23.599  133.574 1.00 51.42 ? 86  LYS D O   1 
ATOM   7609  C CB  . LYS D 1 88  ? 96.820  26.678  134.523 1.00 76.02 ? 86  LYS D CB  1 
ATOM   7610  C CG  . LYS D 1 88  ? 96.329  28.110  134.536 1.00 76.02 ? 86  LYS D CG  1 
ATOM   7611  C CD  . LYS D 1 88  ? 96.474  28.677  135.947 1.00 76.02 ? 86  LYS D CD  1 
ATOM   7612  C CE  . LYS D 1 88  ? 95.927  30.087  136.059 1.00 76.02 ? 86  LYS D CE  1 
ATOM   7613  N NZ  . LYS D 1 88  ? 95.943  30.568  137.468 1.00 76.02 ? 86  LYS D NZ  1 
ATOM   7614  N N   . ASP D 1 89  ? 98.850  24.612  133.222 1.00 52.62 ? 87  ASP D N   1 
ATOM   7615  C CA  . ASP D 1 89  ? 99.629  23.386  133.379 1.00 56.38 ? 87  ASP D CA  1 
ATOM   7616  C C   . ASP D 1 89  ? 99.944  23.134  134.854 1.00 55.22 ? 87  ASP D C   1 
ATOM   7617  O O   . ASP D 1 89  ? 99.615  23.944  135.727 1.00 51.51 ? 87  ASP D O   1 
ATOM   7618  C CB  . ASP D 1 89  ? 100.936 23.466  132.583 1.00 33.92 ? 87  ASP D CB  1 
ATOM   7619  C CG  . ASP D 1 89  ? 101.889 24.512  133.126 1.00 48.15 ? 87  ASP D CG  1 
ATOM   7620  O OD1 . ASP D 1 89  ? 102.984 24.704  132.547 1.00 45.74 ? 87  ASP D OD1 1 
ATOM   7621  O OD2 . ASP D 1 89  ? 101.540 25.145  134.141 1.00 39.39 ? 87  ASP D OD2 1 
ATOM   7622  N N   . SER D 1 90  ? 100.599 22.014  135.129 1.00 80.22 ? 88  SER D N   1 
ATOM   7623  C CA  . SER D 1 90  ? 100.944 21.648  136.495 1.00 80.22 ? 88  SER D CA  1 
ATOM   7624  C C   . SER D 1 90  ? 101.619 22.751  137.298 1.00 80.22 ? 88  SER D C   1 
ATOM   7625  O O   . SER D 1 90  ? 101.692 22.663  138.517 1.00 80.22 ? 88  SER D O   1 
ATOM   7626  C CB  . SER D 1 90  ? 101.828 20.407  136.488 1.00 57.07 ? 88  SER D CB  1 
ATOM   7627  O OG  . SER D 1 90  ? 101.161 19.343  135.833 1.00 73.92 ? 88  SER D OG  1 
ATOM   7628  N N   . GLN D 1 91  ? 102.116 23.784  136.627 1.00 63.08 ? 89  GLN D N   1 
ATOM   7629  C CA  . GLN D 1 91  ? 102.761 24.887  137.327 1.00 57.37 ? 89  GLN D CA  1 
ATOM   7630  C C   . GLN D 1 91  ? 101.906 26.146  137.342 1.00 61.59 ? 89  GLN D C   1 
ATOM   7631  O O   . GLN D 1 91  ? 102.422 27.239  137.578 1.00 62.40 ? 89  GLN D O   1 
ATOM   7632  C CB  . GLN D 1 91  ? 104.123 25.221  136.702 1.00 71.43 ? 89  GLN D CB  1 
ATOM   7633  C CG  . GLN D 1 91  ? 105.259 24.379  137.217 1.00 76.22 ? 89  GLN D CG  1 
ATOM   7634  C CD  . GLN D 1 91  ? 105.050 22.931  136.907 1.00 76.22 ? 89  GLN D CD  1 
ATOM   7635  O OE1 . GLN D 1 91  ? 105.035 22.540  135.745 1.00 76.22 ? 89  GLN D OE1 1 
ATOM   7636  N NE2 . GLN D 1 91  ? 104.873 22.119  137.941 1.00 76.22 ? 89  GLN D NE2 1 
ATOM   7637  N N   . GLY D 1 92  ? 100.606 26.002  137.104 1.00 57.07 ? 90  GLY D N   1 
ATOM   7638  C CA  . GLY D 1 92  ? 99.746  27.174  137.096 1.00 45.10 ? 90  GLY D CA  1 
ATOM   7639  C C   . GLY D 1 92  ? 100.130 28.107  135.960 1.00 41.07 ? 90  GLY D C   1 
ATOM   7640  O O   . GLY D 1 92  ? 99.896  29.324  136.017 1.00 58.01 ? 90  GLY D O   1 
ATOM   7641  N N   . LYS D 1 93  ? 100.736 27.513  134.931 1.00 43.41 ? 91  LYS D N   1 
ATOM   7642  C CA  . LYS D 1 93  ? 101.191 28.223  133.736 1.00 48.68 ? 91  LYS D CA  1 
ATOM   7643  C C   . LYS D 1 93  ? 100.100 28.054  132.699 1.00 52.96 ? 91  LYS D C   1 
ATOM   7644  O O   . LYS D 1 93  ? 99.679  26.933  132.413 1.00 38.46 ? 91  LYS D O   1 
ATOM   7645  C CB  . LYS D 1 93  ? 102.500 27.601  133.217 1.00 47.44 ? 91  LYS D CB  1 
ATOM   7646  C CG  . LYS D 1 93  ? 103.097 28.227  131.961 1.00 62.26 ? 91  LYS D CG  1 
ATOM   7647  C CD  . LYS D 1 93  ? 103.953 29.447  132.276 1.00 69.79 ? 91  LYS D CD  1 
ATOM   7648  C CE  . LYS D 1 93  ? 104.726 29.914  131.042 1.00 68.97 ? 91  LYS D CE  1 
ATOM   7649  N NZ  . LYS D 1 93  ? 105.715 30.990  131.348 1.00 80.39 ? 91  LYS D NZ  1 
ATOM   7650  N N   . LEU D 1 94  ? 99.639  29.164  132.139 1.00 50.98 ? 92  LEU D N   1 
ATOM   7651  C CA  . LEU D 1 94  ? 98.587  29.100  131.140 1.00 50.98 ? 92  LEU D CA  1 
ATOM   7652  C C   . LEU D 1 94  ? 99.043  28.411  129.864 1.00 50.98 ? 92  LEU D C   1 
ATOM   7653  O O   . LEU D 1 94  ? 100.073 28.783  129.299 1.00 50.98 ? 92  LEU D O   1 
ATOM   7654  C CB  . LEU D 1 94  ? 98.101  30.506  130.822 1.00 50.12 ? 92  LEU D CB  1 
ATOM   7655  C CG  . LEU D 1 94  ? 96.928  30.948  131.685 1.00 50.12 ? 92  LEU D CG  1 
ATOM   7656  C CD1 . LEU D 1 94  ? 96.678  32.435  131.493 1.00 50.12 ? 92  LEU D CD1 1 
ATOM   7657  C CD2 . LEU D 1 94  ? 95.699  30.114  131.311 1.00 50.12 ? 92  LEU D CD2 1 
ATOM   7658  N N   . PHE D 1 95  ? 98.290  27.405  129.413 1.00 32.18 ? 93  PHE D N   1 
ATOM   7659  C CA  . PHE D 1 95  ? 98.636  26.696  128.175 1.00 32.18 ? 93  PHE D CA  1 
ATOM   7660  C C   . PHE D 1 95  ? 98.810  27.740  127.082 1.00 32.18 ? 93  PHE D C   1 
ATOM   7661  O O   . PHE D 1 95  ? 99.662  27.623  126.205 1.00 32.18 ? 93  PHE D O   1 
ATOM   7662  C CB  . PHE D 1 95  ? 97.528  25.727  127.783 1.00 65.67 ? 93  PHE D CB  1 
ATOM   7663  C CG  . PHE D 1 95  ? 97.549  24.455  128.553 1.00 65.67 ? 93  PHE D CG  1 
ATOM   7664  C CD1 . PHE D 1 95  ? 97.611  24.468  129.930 1.00 65.67 ? 93  PHE D CD1 1 
ATOM   7665  C CD2 . PHE D 1 95  ? 97.478  23.241  127.906 1.00 65.67 ? 93  PHE D CD2 1 
ATOM   7666  C CE1 . PHE D 1 95  ? 97.606  23.287  130.644 1.00 65.67 ? 93  PHE D CE1 1 
ATOM   7667  C CE2 . PHE D 1 95  ? 97.471  22.063  128.614 1.00 65.67 ? 93  PHE D CE2 1 
ATOM   7668  C CZ  . PHE D 1 95  ? 97.531  22.084  129.983 1.00 65.67 ? 93  PHE D CZ  1 
ATOM   7669  N N   . ARG D 1 96  ? 97.986  28.776  127.155 1.00 34.62 ? 94  ARG D N   1 
ATOM   7670  C CA  . ARG D 1 96  ? 98.049  29.878  126.212 1.00 34.62 ? 94  ARG D CA  1 
ATOM   7671  C C   . ARG D 1 96  ? 99.495  30.404  126.097 1.00 34.62 ? 94  ARG D C   1 
ATOM   7672  O O   . ARG D 1 96  ? 100.049 30.474  125.000 1.00 34.62 ? 94  ARG D O   1 
ATOM   7673  C CB  . ARG D 1 96  ? 97.123  30.984  126.696 1.00 43.58 ? 94  ARG D CB  1 
ATOM   7674  C CG  . ARG D 1 96  ? 96.887  32.062  125.699 1.00 43.58 ? 94  ARG D CG  1 
ATOM   7675  C CD  . ARG D 1 96  ? 96.490  33.317  126.412 1.00 43.58 ? 94  ARG D CD  1 
ATOM   7676  N NE  . ARG D 1 96  ? 95.568  33.034  127.500 1.00 43.58 ? 94  ARG D NE  1 
ATOM   7677  C CZ  . ARG D 1 96  ? 95.024  33.964  128.274 1.00 43.58 ? 94  ARG D CZ  1 
ATOM   7678  N NH1 . ARG D 1 96  ? 95.305  35.248  128.076 1.00 43.58 ? 94  ARG D NH1 1 
ATOM   7679  N NH2 . ARG D 1 96  ? 94.211  33.605  129.257 1.00 43.58 ? 94  ARG D NH2 1 
ATOM   7680  N N   . ASN D 1 97  ? 100.100 30.746  127.239 1.00 32.80 ? 95  ASN D N   1 
ATOM   7681  C CA  . ASN D 1 97  ? 101.468 31.275  127.303 1.00 32.80 ? 95  ASN D CA  1 
ATOM   7682  C C   . ASN D 1 97  ? 102.554 30.274  126.959 1.00 32.80 ? 95  ASN D C   1 
ATOM   7683  O O   . ASN D 1 97  ? 103.544 30.624  126.311 1.00 32.80 ? 95  ASN D O   1 
ATOM   7684  C CB  . ASN D 1 97  ? 101.750 31.836  128.686 1.00 59.69 ? 95  ASN D CB  1 
ATOM   7685  C CG  . ASN D 1 97  ? 100.716 32.833  129.113 1.00 59.69 ? 95  ASN D CG  1 
ATOM   7686  O OD1 . ASN D 1 97  ? 100.359 33.731  128.347 1.00 59.69 ? 95  ASN D OD1 1 
ATOM   7687  N ND2 . ASN D 1 97  ? 100.220 32.690  130.343 1.00 59.69 ? 95  ASN D ND2 1 
ATOM   7688  N N   . ILE D 1 98  ? 102.375 29.039  127.411 1.00 71.99 ? 96  ILE D N   1 
ATOM   7689  C CA  . ILE D 1 98  ? 103.327 27.978  127.124 1.00 71.99 ? 96  ILE D CA  1 
ATOM   7690  C C   . ILE D 1 98  ? 103.611 27.985  125.636 1.00 71.99 ? 96  ILE D C   1 
ATOM   7691  O O   . ILE D 1 98  ? 104.710 27.654  125.191 1.00 71.99 ? 96  ILE D O   1 
ATOM   7692  C CB  . ILE D 1 98  ? 102.747 26.607  127.472 1.00 31.03 ? 96  ILE D CB  1 
ATOM   7693  C CG1 . ILE D 1 98  ? 102.614 26.481  128.986 1.00 31.03 ? 96  ILE D CG1 1 
ATOM   7694  C CG2 . ILE D 1 98  ? 103.608 25.502  126.879 1.00 31.03 ? 96  ILE D CG2 1 
ATOM   7695  C CD1 . ILE D 1 98  ? 102.403 25.043  129.492 1.00 31.03 ? 96  ILE D CD1 1 
ATOM   7696  N N   . LEU D 1 99  ? 102.594 28.363  124.874 1.00 37.96 ? 97  LEU D N   1 
ATOM   7697  C CA  . LEU D 1 99  ? 102.684 28.418  123.431 1.00 37.96 ? 97  LEU D CA  1 
ATOM   7698  C C   . LEU D 1 99  ? 103.280 29.740  122.992 1.00 37.96 ? 97  LEU D C   1 
ATOM   7699  O O   . LEU D 1 99  ? 104.194 29.763  122.175 1.00 37.96 ? 97  LEU D O   1 
ATOM   7700  C CB  . LEU D 1 99  ? 101.294 28.239  122.830 1.00 21.40 ? 97  LEU D CB  1 
ATOM   7701  C CG  . LEU D 1 99  ? 100.587 26.949  123.233 1.00 21.40 ? 97  LEU D CG  1 
ATOM   7702  C CD1 . LEU D 1 99  ? 99.215  26.921  122.610 1.00 21.40 ? 97  LEU D CD1 1 
ATOM   7703  C CD2 . LEU D 1 99  ? 101.410 25.741  122.804 1.00 21.40 ? 97  LEU D CD2 1 
ATOM   7704  N N   . LYS D 1 100 ? 102.763 30.841  123.527 1.00 50.32 ? 98  LYS D N   1 
ATOM   7705  C CA  . LYS D 1 100 ? 103.289 32.149  123.166 1.00 50.32 ? 98  LYS D CA  1 
ATOM   7706  C C   . LYS D 1 100 ? 104.791 32.164  123.410 1.00 50.32 ? 98  LYS D C   1 
ATOM   7707  O O   . LYS D 1 100 ? 105.551 32.790  122.665 1.00 50.32 ? 98  LYS D O   1 
ATOM   7708  C CB  . LYS D 1 100 ? 102.641 33.255  123.993 1.00 64.75 ? 98  LYS D CB  1 
ATOM   7709  C CG  . LYS D 1 100 ? 103.359 34.595  123.860 1.00 64.75 ? 98  LYS D CG  1 
ATOM   7710  C CD  . LYS D 1 100 ? 102.824 35.643  124.827 1.00 64.75 ? 98  LYS D CD  1 
ATOM   7711  C CE  . LYS D 1 100 ? 101.505 36.256  124.353 1.00 64.75 ? 98  LYS D CE  1 
ATOM   7712  N NZ  . LYS D 1 100 ? 101.653 37.140  123.158 1.00 64.75 ? 98  LYS D NZ  1 
ATOM   7713  N N   . GLU D 1 101 ? 105.222 31.478  124.463 1.00 72.16 ? 99  GLU D N   1 
ATOM   7714  C CA  . GLU D 1 101 ? 106.644 31.418  124.774 1.00 72.16 ? 99  GLU D CA  1 
ATOM   7715  C C   . GLU D 1 101 ? 107.346 30.790  123.567 1.00 72.16 ? 99  GLU D C   1 
ATOM   7716  O O   . GLU D 1 101 ? 108.193 31.417  122.938 1.00 72.16 ? 99  GLU D O   1 
ATOM   7717  C CB  . GLU D 1 101 ? 106.876 30.569  126.032 1.00 63.58 ? 99  GLU D CB  1 
ATOM   7718  C CG  . GLU D 1 101 ? 107.990 31.080  126.938 1.00 63.58 ? 99  GLU D CG  1 
ATOM   7719  C CD  . GLU D 1 101 ? 109.385 30.857  126.368 1.00 63.58 ? 99  GLU D CD  1 
ATOM   7720  O OE1 . GLU D 1 101 ? 109.602 31.187  125.184 1.00 63.58 ? 99  GLU D OE1 1 
ATOM   7721  O OE2 . GLU D 1 101 ? 110.270 30.365  127.106 1.00 63.58 ? 99  GLU D OE2 1 
ATOM   7722  N N   . LYS D 1 102 ? 106.956 29.561  123.240 1.00 32.46 ? 100 LYS D N   1 
ATOM   7723  C CA  . LYS D 1 102 ? 107.522 28.813  122.129 1.00 32.46 ? 100 LYS D CA  1 
ATOM   7724  C C   . LYS D 1 102 ? 107.216 29.416  120.770 1.00 32.46 ? 100 LYS D C   1 
ATOM   7725  O O   . LYS D 1 102 ? 107.352 28.736  119.754 1.00 32.46 ? 100 LYS D O   1 
ATOM   7726  C CB  . LYS D 1 102 ? 106.993 27.382  122.124 1.00 31.43 ? 100 LYS D CB  1 
ATOM   7727  C CG  . LYS D 1 102 ? 107.297 26.569  123.357 1.00 31.43 ? 100 LYS D CG  1 
ATOM   7728  C CD  . LYS D 1 102 ? 106.744 25.169  123.193 1.00 31.43 ? 100 LYS D CD  1 
ATOM   7729  C CE  . LYS D 1 102 ? 106.991 24.341  124.433 1.00 31.43 ? 100 LYS D CE  1 
ATOM   7730  N NZ  . LYS D 1 102 ? 106.453 24.985  125.669 1.00 31.43 ? 100 LYS D NZ  1 
ATOM   7731  N N   . GLY D 1 103 ? 106.779 30.668  120.725 1.00 44.13 ? 101 GLY D N   1 
ATOM   7732  C CA  . GLY D 1 103 ? 106.494 31.275  119.434 1.00 44.13 ? 101 GLY D CA  1 
ATOM   7733  C C   . GLY D 1 103 ? 105.489 30.571  118.524 1.00 44.13 ? 101 GLY D C   1 
ATOM   7734  O O   . GLY D 1 103 ? 105.512 30.772  117.306 1.00 44.13 ? 101 GLY D O   1 
ATOM   7735  N N   . ILE D 1 104 ? 104.633 29.720  119.088 1.00 13.40 ? 102 ILE D N   1 
ATOM   7736  C CA  . ILE D 1 104 ? 103.583 29.074  118.298 1.00 13.40 ? 102 ILE D CA  1 
ATOM   7737  C C   . ILE D 1 104 ? 102.381 29.996  118.511 1.00 13.40 ? 102 ILE D C   1 
ATOM   7738  O O   . ILE D 1 104 ? 101.999 30.259  119.651 1.00 13.40 ? 102 ILE D O   1 
ATOM   7739  C CB  . ILE D 1 104 ? 103.214 27.668  118.824 1.00 27.12 ? 102 ILE D CB  1 
ATOM   7740  C CG1 . ILE D 1 104 ? 104.391 26.710  118.678 1.00 27.12 ? 102 ILE D CG1 1 
ATOM   7741  C CG2 . ILE D 1 104 ? 102.069 27.105  118.021 1.00 27.12 ? 102 ILE D CG2 1 
ATOM   7742  C CD1 . ILE D 1 104 ? 104.091 25.333  119.189 1.00 27.12 ? 102 ILE D CD1 1 
ATOM   7743  N N   . VAL D 1 105 ? 101.800 30.518  117.436 1.00 38.96 ? 103 VAL D N   1 
ATOM   7744  C CA  . VAL D 1 105 ? 100.653 31.415  117.584 1.00 38.96 ? 103 VAL D CA  1 
ATOM   7745  C C   . VAL D 1 105 ? 99.437  30.653  118.099 1.00 38.96 ? 103 VAL D C   1 
ATOM   7746  O O   . VAL D 1 105 ? 99.265  29.463  117.816 1.00 38.96 ? 103 VAL D O   1 
ATOM   7747  C CB  . VAL D 1 105 ? 100.269 32.079  116.253 1.00 22.28 ? 103 VAL D CB  1 
ATOM   7748  C CG1 . VAL D 1 105 ? 99.573  33.387  116.525 1.00 22.28 ? 103 VAL D CG1 1 
ATOM   7749  C CG2 . VAL D 1 105 ? 101.498 32.306  115.408 1.00 22.28 ? 103 VAL D CG2 1 
ATOM   7750  N N   . VAL D 1 106 ? 98.585  31.336  118.849 1.00 40.95 ? 104 VAL D N   1 
ATOM   7751  C CA  . VAL D 1 106 ? 97.398  30.685  119.384 1.00 40.95 ? 104 VAL D CA  1 
ATOM   7752  C C   . VAL D 1 106 ? 96.099  31.116  118.702 1.00 40.95 ? 104 VAL D C   1 
ATOM   7753  O O   . VAL D 1 106 ? 95.858  32.309  118.519 1.00 40.95 ? 104 VAL D O   1 
ATOM   7754  C CB  . VAL D 1 106 ? 97.285  30.940  120.884 1.00 40.47 ? 104 VAL D CB  1 
ATOM   7755  C CG1 . VAL D 1 106 ? 96.055  30.242  121.437 1.00 40.47 ? 104 VAL D CG1 1 
ATOM   7756  C CG2 . VAL D 1 106 ? 98.535  30.428  121.572 1.00 40.47 ? 104 VAL D CG2 1 
ATOM   7757  N N   . GLY D 1 107 ? 95.272  30.132  118.337 1.00 37.65 ? 105 GLY D N   1 
ATOM   7758  C CA  . GLY D 1 107 ? 93.992  30.396  117.678 1.00 37.65 ? 105 GLY D CA  1 
ATOM   7759  C C   . GLY D 1 107 ? 92.767  29.959  118.464 1.00 37.65 ? 105 GLY D C   1 
ATOM   7760  O O   . GLY D 1 107 ? 92.890  29.194  119.411 1.00 37.65 ? 105 GLY D O   1 
ATOM   7761  N N   . ILE D 1 108 ? 91.580  30.415  118.075 1.00 57.18 ? 106 ILE D N   1 
ATOM   7762  C CA  . ILE D 1 108 ? 90.381  30.040  118.831 1.00 48.96 ? 106 ILE D CA  1 
ATOM   7763  C C   . ILE D 1 108 ? 89.087  29.725  118.072 1.00 54.90 ? 106 ILE D C   1 
ATOM   7764  O O   . ILE D 1 108 ? 88.582  30.550  117.310 1.00 55.03 ? 106 ILE D O   1 
ATOM   7765  C CB  . ILE D 1 108 ? 90.037  31.126  119.888 1.00 58.04 ? 106 ILE D CB  1 
ATOM   7766  C CG1 . ILE D 1 108 ? 89.086  30.539  120.935 1.00 53.69 ? 106 ILE D CG1 1 
ATOM   7767  C CG2 . ILE D 1 108 ? 89.388  32.345  119.219 1.00 51.37 ? 106 ILE D CG2 1 
ATOM   7768  C CD1 . ILE D 1 108 ? 89.669  29.357  121.716 1.00 62.19 ? 106 ILE D CD1 1 
ATOM   7769  N N   . LYS D 1 109 ? 88.545  28.532  118.317 1.00 68.82 ? 107 LYS D N   1 
ATOM   7770  C CA  . LYS D 1 109 ? 87.291  28.095  117.695 1.00 68.82 ? 107 LYS D CA  1 
ATOM   7771  C C   . LYS D 1 109 ? 86.149  29.021  118.101 1.00 68.82 ? 107 LYS D C   1 
ATOM   7772  O O   . LYS D 1 109 ? 85.588  28.886  119.184 1.00 68.82 ? 107 LYS D O   1 
ATOM   7773  C CB  . LYS D 1 109 ? 86.954  26.659  118.122 1.00 64.02 ? 107 LYS D CB  1 
ATOM   7774  C CG  . LYS D 1 109 ? 85.469  26.316  118.031 1.00 68.68 ? 107 LYS D CG  1 
ATOM   7775  C CD  . LYS D 1 109 ? 85.200  24.840  118.272 1.00 65.30 ? 107 LYS D CD  1 
ATOM   7776  C CE  . LYS D 1 109 ? 85.575  24.008  117.057 1.00 68.96 ? 107 LYS D CE  1 
ATOM   7777  N NZ  . LYS D 1 109 ? 85.244  22.569  117.242 1.00 68.96 ? 107 LYS D NZ  1 
ATOM   7778  N N   . LEU D 1 110 ? 85.792  29.952  117.229 1.00 69.92 ? 108 LEU D N   1 
ATOM   7779  C CA  . LEU D 1 110 ? 84.730  30.889  117.555 1.00 66.27 ? 108 LEU D CA  1 
ATOM   7780  C C   . LEU D 1 110 ? 83.323  30.299  117.447 1.00 65.59 ? 108 LEU D C   1 
ATOM   7781  O O   . LEU D 1 110 ? 82.336  31.004  117.682 1.00 69.92 ? 108 LEU D O   1 
ATOM   7782  C CB  . LEU D 1 110 ? 84.845  32.131  116.674 1.00 6.89  ? 108 LEU D CB  1 
ATOM   7783  C CG  . LEU D 1 110 ? 86.100  32.964  116.876 1.00 22.54 ? 108 LEU D CG  1 
ATOM   7784  C CD1 . LEU D 1 110 ? 86.243  34.008  115.807 1.00 9.12  ? 108 LEU D CD1 1 
ATOM   7785  C CD2 . LEU D 1 110 ? 86.006  33.611  118.206 1.00 16.61 ? 108 LEU D CD2 1 
ATOM   7786  N N   . ASP D 1 111 ? 83.224  29.014  117.098 1.00 73.79 ? 109 ASP D N   1 
ATOM   7787  C CA  . ASP D 1 111 ? 81.918  28.354  116.983 1.00 73.79 ? 109 ASP D CA  1 
ATOM   7788  C C   . ASP D 1 111 ? 81.382  27.932  118.349 1.00 73.79 ? 109 ASP D C   1 
ATOM   7789  O O   . ASP D 1 111 ? 81.456  26.761  118.727 1.00 73.79 ? 109 ASP D O   1 
ATOM   7790  C CB  . ASP D 1 111 ? 81.999  27.122  116.070 1.00 92.42 ? 109 ASP D CB  1 
ATOM   7791  C CG  . ASP D 1 111 ? 82.074  27.488  114.593 1.00 92.42 ? 109 ASP D CG  1 
ATOM   7792  O OD1 . ASP D 1 111 ? 81.390  28.457  114.181 1.00 92.42 ? 109 ASP D OD1 1 
ATOM   7793  O OD2 . ASP D 1 111 ? 82.800  26.794  113.841 1.00 92.42 ? 109 ASP D OD2 1 
ATOM   7794  N N   . ASP D 1 130 ? 76.717  38.318  114.867 1.00 91.58 ? 128 ASP D N   1 
ATOM   7795  C CA  . ASP D 1 130 ? 76.838  39.511  115.704 1.00 91.58 ? 128 ASP D CA  1 
ATOM   7796  C C   . ASP D 1 130 ? 77.269  39.062  117.099 1.00 91.58 ? 128 ASP D C   1 
ATOM   7797  O O   . ASP D 1 130 ? 76.988  37.924  117.499 1.00 91.58 ? 128 ASP D O   1 
ATOM   7798  C CB  . ASP D 1 130 ? 75.492  40.258  115.781 1.00 92.42 ? 128 ASP D CB  1 
ATOM   7799  C CG  . ASP D 1 130 ? 75.634  41.699  116.299 1.00 92.42 ? 128 ASP D CG  1 
ATOM   7800  O OD1 . ASP D 1 130 ? 74.598  42.401  116.420 1.00 92.42 ? 128 ASP D OD1 1 
ATOM   7801  O OD2 . ASP D 1 130 ? 76.779  42.132  116.578 1.00 92.42 ? 128 ASP D OD2 1 
ATOM   7802  N N   . GLY D 1 131 ? 77.938  39.956  117.834 1.00 84.19 ? 129 GLY D N   1 
ATOM   7803  C CA  . GLY D 1 131 ? 78.425  39.628  119.166 1.00 84.19 ? 129 GLY D CA  1 
ATOM   7804  C C   . GLY D 1 131 ? 79.823  39.073  118.999 1.00 84.19 ? 129 GLY D C   1 
ATOM   7805  O O   . GLY D 1 131 ? 80.686  39.238  119.857 1.00 84.19 ? 129 GLY D O   1 
ATOM   7806  N N   . LEU D 1 132 ? 80.025  38.407  117.864 1.00 53.00 ? 130 LEU D N   1 
ATOM   7807  C CA  . LEU D 1 132 ? 81.302  37.812  117.489 1.00 54.29 ? 130 LEU D CA  1 
ATOM   7808  C C   . LEU D 1 132 ? 82.311  38.937  117.464 1.00 49.04 ? 130 LEU D C   1 
ATOM   7809  O O   . LEU D 1 132 ? 83.449  38.776  117.877 1.00 52.59 ? 130 LEU D O   1 
ATOM   7810  C CB  . LEU D 1 132 ? 81.207  37.201  116.092 1.00 33.86 ? 130 LEU D CB  1 
ATOM   7811  C CG  . LEU D 1 132 ? 82.404  36.398  115.588 1.00 39.39 ? 130 LEU D CG  1 
ATOM   7812  C CD1 . LEU D 1 132 ? 82.554  35.128  116.412 1.00 21.22 ? 130 LEU D CD1 1 
ATOM   7813  C CD2 . LEU D 1 132 ? 82.195  36.050  114.127 1.00 24.46 ? 130 LEU D CD2 1 
ATOM   7814  N N   . SER D 1 133 ? 81.878  40.084  116.966 1.00 62.76 ? 131 SER D N   1 
ATOM   7815  C CA  . SER D 1 133 ? 82.750  41.232  116.909 1.00 62.76 ? 131 SER D CA  1 
ATOM   7816  C C   . SER D 1 133 ? 83.309  41.534  118.292 1.00 62.76 ? 131 SER D C   1 
ATOM   7817  O O   . SER D 1 133 ? 84.404  42.081  118.415 1.00 62.76 ? 131 SER D O   1 
ATOM   7818  C CB  . SER D 1 133 ? 81.990  42.451  116.402 1.00 44.45 ? 131 SER D CB  1 
ATOM   7819  O OG  . SER D 1 133 ? 82.787  43.619  116.536 1.00 44.45 ? 131 SER D OG  1 
ATOM   7820  N N   . GLU D 1 134 ? 82.570  41.174  119.336 1.00 69.74 ? 132 GLU D N   1 
ATOM   7821  C CA  . GLU D 1 134 ? 83.040  41.459  120.685 1.00 69.74 ? 132 GLU D CA  1 
ATOM   7822  C C   . GLU D 1 134 ? 83.875  40.339  121.293 1.00 69.74 ? 132 GLU D C   1 
ATOM   7823  O O   . GLU D 1 134 ? 84.846  40.605  121.999 1.00 69.74 ? 132 GLU D O   1 
ATOM   7824  C CB  . GLU D 1 134 ? 81.862  41.797  121.604 1.00 92.42 ? 132 GLU D CB  1 
ATOM   7825  C CG  . GLU D 1 134 ? 82.278  42.601  122.831 1.00 92.42 ? 132 GLU D CG  1 
ATOM   7826  C CD  . GLU D 1 134 ? 83.002  43.894  122.462 1.00 92.42 ? 132 GLU D CD  1 
ATOM   7827  O OE1 . GLU D 1 134 ? 83.546  44.565  123.369 1.00 92.42 ? 132 GLU D OE1 1 
ATOM   7828  O OE2 . GLU D 1 134 ? 83.022  44.239  121.262 1.00 92.42 ? 132 GLU D OE2 1 
ATOM   7829  N N   . ARG D 1 135 ? 83.499  39.090  121.030 1.00 49.65 ? 133 ARG D N   1 
ATOM   7830  C CA  . ARG D 1 135 ? 84.263  37.955  121.550 1.00 49.65 ? 133 ARG D CA  1 
ATOM   7831  C C   . ARG D 1 135 ? 85.692  38.092  121.020 1.00 49.65 ? 133 ARG D C   1 
ATOM   7832  O O   . ARG D 1 135 ? 86.671  37.926  121.752 1.00 49.65 ? 133 ARG D O   1 
ATOM   7833  C CB  . ARG D 1 135 ? 83.685  36.628  121.051 1.00 90.18 ? 133 ARG D CB  1 
ATOM   7834  C CG  . ARG D 1 135 ? 82.223  36.401  121.352 1.00 90.18 ? 133 ARG D CG  1 
ATOM   7835  C CD  . ARG D 1 135 ? 81.749  35.095  120.721 1.00 90.18 ? 133 ARG D CD  1 
ATOM   7836  N NE  . ARG D 1 135 ? 82.450  33.929  121.266 1.00 90.18 ? 133 ARG D NE  1 
ATOM   7837  C CZ  . ARG D 1 135 ? 82.243  32.671  120.874 1.00 90.18 ? 133 ARG D CZ  1 
ATOM   7838  N NH1 . ARG D 1 135 ? 81.353  32.402  119.924 1.00 90.18 ? 133 ARG D NH1 1 
ATOM   7839  N NH2 . ARG D 1 135 ? 82.919  31.677  121.441 1.00 90.18 ? 133 ARG D NH2 1 
ATOM   7840  N N   . CYS D 1 136 ? 85.795  38.387  119.729 1.00 58.82 ? 134 CYS D N   1 
ATOM   7841  C CA  . CYS D 1 136 ? 87.086  38.552  119.094 1.00 58.82 ? 134 CYS D CA  1 
ATOM   7842  C C   . CYS D 1 136 ? 87.861  39.614  119.858 1.00 58.82 ? 134 CYS D C   1 
ATOM   7843  O O   . CYS D 1 136 ? 88.844  39.300  120.528 1.00 58.82 ? 134 CYS D O   1 
ATOM   7844  C CB  . CYS D 1 136 ? 86.906  38.931  117.617 1.00 36.43 ? 134 CYS D CB  1 
ATOM   7845  S SG  . CYS D 1 136 ? 86.315  37.525  116.585 1.00 36.43 ? 134 CYS D SG  1 
ATOM   7846  N N   . ALA D 1 137 ? 87.410  40.861  119.783 1.00 43.76 ? 135 ALA D N   1 
ATOM   7847  C CA  . ALA D 1 137 ? 88.081  41.948  120.491 1.00 43.76 ? 135 ALA D CA  1 
ATOM   7848  C C   . ALA D 1 137 ? 88.580  41.478  121.863 1.00 43.76 ? 135 ALA D C   1 
ATOM   7849  O O   . ALA D 1 137 ? 89.641  41.894  122.326 1.00 43.76 ? 135 ALA D O   1 
ATOM   7850  C CB  . ALA D 1 137 ? 87.128  43.121  120.653 1.00 92.42 ? 135 ALA D CB  1 
ATOM   7851  N N   . GLN D 1 138 ? 87.801  40.609  122.505 1.00 70.81 ? 136 GLN D N   1 
ATOM   7852  C CA  . GLN D 1 138 ? 88.152  40.060  123.813 1.00 70.81 ? 136 GLN D CA  1 
ATOM   7853  C C   . GLN D 1 138 ? 89.282  39.047  123.679 1.00 70.81 ? 136 GLN D C   1 
ATOM   7854  O O   . GLN D 1 138 ? 90.352  39.221  124.257 1.00 70.81 ? 136 GLN D O   1 
ATOM   7855  C CB  . GLN D 1 138 ? 86.940  39.376  124.443 1.00 64.95 ? 136 GLN D CB  1 
ATOM   7856  C CG  . GLN D 1 138 ? 87.268  38.562  125.685 1.00 64.95 ? 136 GLN D CG  1 
ATOM   7857  C CD  . GLN D 1 138 ? 87.754  39.410  126.848 1.00 64.95 ? 136 GLN D CD  1 
ATOM   7858  O OE1 . GLN D 1 138 ? 88.055  38.888  127.917 1.00 64.95 ? 136 GLN D OE1 1 
ATOM   7859  N NE2 . GLN D 1 138 ? 87.832  40.723  126.644 1.00 64.95 ? 136 GLN D NE2 1 
ATOM   7860  N N   . TYR D 1 139 ? 89.022  37.980  122.929 1.00 59.31 ? 137 TYR D N   1 
ATOM   7861  C CA  . TYR D 1 139 ? 90.015  36.943  122.688 1.00 59.31 ? 137 TYR D CA  1 
ATOM   7862  C C   . TYR D 1 139 ? 91.340  37.585  122.304 1.00 59.31 ? 137 TYR D C   1 
ATOM   7863  O O   . TYR D 1 139 ? 92.404  37.089  122.671 1.00 59.31 ? 137 TYR D O   1 
ATOM   7864  C CB  . TYR D 1 139 ? 89.553  36.036  121.556 1.00 45.43 ? 137 TYR D CB  1 
ATOM   7865  C CG  . TYR D 1 139 ? 88.557  34.987  121.967 1.00 45.43 ? 137 TYR D CG  1 
ATOM   7866  C CD1 . TYR D 1 139 ? 88.981  33.775  122.506 1.00 45.43 ? 137 TYR D CD1 1 
ATOM   7867  C CD2 . TYR D 1 139 ? 87.192  35.185  121.786 1.00 45.43 ? 137 TYR D CD2 1 
ATOM   7868  C CE1 . TYR D 1 139 ? 88.069  32.782  122.847 1.00 45.43 ? 137 TYR D CE1 1 
ATOM   7869  C CE2 . TYR D 1 139 ? 86.273  34.198  122.124 1.00 45.43 ? 137 TYR D CE2 1 
ATOM   7870  C CZ  . TYR D 1 139 ? 86.720  32.998  122.651 1.00 45.43 ? 137 TYR D CZ  1 
ATOM   7871  O OH  . TYR D 1 139 ? 85.826  32.005  122.969 1.00 45.43 ? 137 TYR D OH  1 
ATOM   7872  N N   . LYS D 1 140 ? 91.271  38.683  121.555 1.00 54.48 ? 138 LYS D N   1 
ATOM   7873  C CA  . LYS D 1 140 ? 92.474  39.392  121.137 1.00 54.48 ? 138 LYS D CA  1 
ATOM   7874  C C   . LYS D 1 140 ? 93.273  39.723  122.385 1.00 54.48 ? 138 LYS D C   1 
ATOM   7875  O O   . LYS D 1 140 ? 94.426  39.306  122.525 1.00 54.48 ? 138 LYS D O   1 
ATOM   7876  C CB  . LYS D 1 140 ? 92.111  40.684  120.405 1.00 62.09 ? 138 LYS D CB  1 
ATOM   7877  C CG  . LYS D 1 140 ? 93.315  41.432  119.832 1.00 62.09 ? 138 LYS D CG  1 
ATOM   7878  C CD  . LYS D 1 140 ? 94.084  40.559  118.833 1.00 62.09 ? 138 LYS D CD  1 
ATOM   7879  C CE  . LYS D 1 140 ? 95.265  41.282  118.190 1.00 62.09 ? 138 LYS D CE  1 
ATOM   7880  N NZ  . LYS D 1 140 ? 96.017  40.364  117.281 1.00 62.09 ? 138 LYS D NZ  1 
ATOM   7881  N N   . LYS D 1 141 ? 92.645  40.472  123.290 1.00 62.72 ? 139 LYS D N   1 
ATOM   7882  C CA  . LYS D 1 141 ? 93.267  40.856  124.552 1.00 62.72 ? 139 LYS D CA  1 
ATOM   7883  C C   . LYS D 1 141 ? 93.804  39.629  125.283 1.00 62.72 ? 139 LYS D C   1 
ATOM   7884  O O   . LYS D 1 141 ? 94.819  39.700  125.965 1.00 62.72 ? 139 LYS D O   1 
ATOM   7885  C CB  . LYS D 1 141 ? 92.257  41.569  125.456 1.00 57.89 ? 139 LYS D CB  1 
ATOM   7886  C CG  . LYS D 1 141 ? 92.298  43.084  125.384 1.00 57.89 ? 139 LYS D CG  1 
ATOM   7887  C CD  . LYS D 1 141 ? 91.342  43.702  126.414 1.00 57.89 ? 139 LYS D CD  1 
ATOM   7888  C CE  . LYS D 1 141 ? 91.349  45.236  126.389 1.00 57.89 ? 139 LYS D CE  1 
ATOM   7889  N NZ  . LYS D 1 141 ? 90.295  45.827  127.278 1.00 57.89 ? 139 LYS D NZ  1 
ATOM   7890  N N   . ASP D 1 142 ? 93.126  38.501  125.131 1.00 31.88 ? 140 ASP D N   1 
ATOM   7891  C CA  . ASP D 1 142 ? 93.540  37.285  125.806 1.00 31.88 ? 140 ASP D CA  1 
ATOM   7892  C C   . ASP D 1 142 ? 94.650  36.513  125.113 1.00 31.88 ? 140 ASP D C   1 
ATOM   7893  O O   . ASP D 1 142 ? 94.874  35.341  125.418 1.00 31.88 ? 140 ASP D O   1 
ATOM   7894  C CB  . ASP D 1 142 ? 92.328  36.380  126.034 1.00 92.42 ? 140 ASP D CB  1 
ATOM   7895  C CG  . ASP D 1 142 ? 91.446  36.872  127.174 1.00 92.42 ? 140 ASP D CG  1 
ATOM   7896  O OD1 . ASP D 1 142 ? 91.216  38.099  127.261 1.00 92.42 ? 140 ASP D OD1 1 
ATOM   7897  O OD2 . ASP D 1 142 ? 90.977  36.036  127.979 1.00 92.42 ? 140 ASP D OD2 1 
ATOM   7898  N N   . GLY D 1 143 ? 95.336  37.165  124.177 1.00 80.17 ? 141 GLY D N   1 
ATOM   7899  C CA  . GLY D 1 143 ? 96.452  36.535  123.489 1.00 80.17 ? 141 GLY D CA  1 
ATOM   7900  C C   . GLY D 1 143 ? 96.175  35.660  122.288 1.00 80.17 ? 141 GLY D C   1 
ATOM   7901  O O   . GLY D 1 143 ? 97.011  34.820  121.935 1.00 80.17 ? 141 GLY D O   1 
ATOM   7902  N N   . VAL D 1 144 ? 95.016  35.835  121.659 1.00 60.96 ? 142 VAL D N   1 
ATOM   7903  C CA  . VAL D 1 144 ? 94.683  35.039  120.477 1.00 60.96 ? 142 VAL D CA  1 
ATOM   7904  C C   . VAL D 1 144 ? 94.989  35.900  119.257 1.00 60.96 ? 142 VAL D C   1 
ATOM   7905  O O   . VAL D 1 144 ? 94.798  37.117  119.293 1.00 60.96 ? 142 VAL D O   1 
ATOM   7906  C CB  . VAL D 1 144 ? 93.176  34.631  120.435 1.00 62.59 ? 142 VAL D CB  1 
ATOM   7907  C CG1 . VAL D 1 144 ? 92.944  33.608  119.327 1.00 62.59 ? 142 VAL D CG1 1 
ATOM   7908  C CG2 . VAL D 1 144 ? 92.739  34.050  121.763 1.00 62.59 ? 142 VAL D CG2 1 
ATOM   7909  N N   . ASP D 1 145 ? 95.468  35.274  118.185 1.00 45.85 ? 143 ASP D N   1 
ATOM   7910  C CA  . ASP D 1 145 ? 95.793  36.017  116.975 1.00 45.85 ? 143 ASP D CA  1 
ATOM   7911  C C   . ASP D 1 145 ? 94.980  35.616  115.740 1.00 45.85 ? 143 ASP D C   1 
ATOM   7912  O O   . ASP D 1 145 ? 94.937  36.362  114.760 1.00 45.85 ? 143 ASP D O   1 
ATOM   7913  C CB  . ASP D 1 145 ? 97.296  35.925  116.689 1.00 34.68 ? 143 ASP D CB  1 
ATOM   7914  C CG  . ASP D 1 145 ? 98.134  36.583  117.776 1.00 34.68 ? 143 ASP D CG  1 
ATOM   7915  O OD1 . ASP D 1 145 ? 98.895  35.861  118.448 1.00 34.68 ? 143 ASP D OD1 1 
ATOM   7916  O OD2 . ASP D 1 145 ? 98.031  37.818  117.965 1.00 34.68 ? 143 ASP D OD2 1 
ATOM   7917  N N   . PHE D 1 146 ? 94.337  34.451  115.770 1.00 46.74 ? 144 PHE D N   1 
ATOM   7918  C CA  . PHE D 1 146 ? 93.513  34.046  114.634 1.00 46.74 ? 144 PHE D CA  1 
ATOM   7919  C C   . PHE D 1 146 ? 92.281  33.258  115.053 1.00 46.74 ? 144 PHE D C   1 
ATOM   7920  O O   . PHE D 1 146 ? 92.268  32.627  116.118 1.00 46.74 ? 144 PHE D O   1 
ATOM   7921  C CB  . PHE D 1 146 ? 94.335  33.248  113.623 1.00 23.73 ? 144 PHE D CB  1 
ATOM   7922  C CG  . PHE D 1 146 ? 94.695  31.868  114.069 1.00 23.73 ? 144 PHE D CG  1 
ATOM   7923  C CD1 . PHE D 1 146 ? 94.156  30.754  113.420 1.00 23.73 ? 144 PHE D CD1 1 
ATOM   7924  C CD2 . PHE D 1 146 ? 95.622  31.673  115.077 1.00 23.73 ? 144 PHE D CD2 1 
ATOM   7925  C CE1 . PHE D 1 146 ? 94.542  29.466  113.763 1.00 23.73 ? 144 PHE D CE1 1 
ATOM   7926  C CE2 . PHE D 1 146 ? 96.014  30.387  115.428 1.00 23.73 ? 144 PHE D CE2 1 
ATOM   7927  C CZ  . PHE D 1 146 ? 95.472  29.280  114.766 1.00 23.73 ? 144 PHE D CZ  1 
ATOM   7928  N N   . GLY D 1 147 ? 91.246  33.307  114.212 1.00 80.16 ? 145 GLY D N   1 
ATOM   7929  C CA  . GLY D 1 147 ? 89.998  32.617  114.504 1.00 80.16 ? 145 GLY D CA  1 
ATOM   7930  C C   . GLY D 1 147 ? 89.577  31.548  113.511 1.00 80.16 ? 145 GLY D C   1 
ATOM   7931  O O   . GLY D 1 147 ? 90.100  31.466  112.400 1.00 80.16 ? 145 GLY D O   1 
ATOM   7932  N N   . LYS D 1 148 ? 88.623  30.723  113.926 1.00 52.18 ? 146 LYS D N   1 
ATOM   7933  C CA  . LYS D 1 148 ? 88.105  29.638  113.097 1.00 51.62 ? 146 LYS D CA  1 
ATOM   7934  C C   . LYS D 1 148 ? 86.588  29.708  113.144 1.00 58.69 ? 146 LYS D C   1 
ATOM   7935  O O   . LYS D 1 148 ? 86.013  30.057  114.178 1.00 61.79 ? 146 LYS D O   1 
ATOM   7936  C CB  . LYS D 1 148 ? 88.571  28.292  113.648 1.00 46.88 ? 146 LYS D CB  1 
ATOM   7937  C CG  . LYS D 1 148 ? 88.110  27.061  112.882 1.00 48.49 ? 146 LYS D CG  1 
ATOM   7938  C CD  . LYS D 1 148 ? 88.510  25.809  113.675 1.00 48.47 ? 146 LYS D CD  1 
ATOM   7939  C CE  . LYS D 1 148 ? 88.457  24.520  112.853 1.00 58.70 ? 146 LYS D CE  1 
ATOM   7940  N NZ  . LYS D 1 148 ? 88.980  23.333  113.611 1.00 54.42 ? 146 LYS D NZ  1 
ATOM   7941  N N   . TRP D 1 149 ? 85.945  29.370  112.027 1.00 92.42 ? 147 TRP D N   1 
ATOM   7942  C CA  . TRP D 1 149 ? 84.483  29.408  111.933 1.00 92.42 ? 147 TRP D CA  1 
ATOM   7943  C C   . TRP D 1 149 ? 83.920  28.616  110.747 1.00 92.42 ? 147 TRP D C   1 
ATOM   7944  O O   . TRP D 1 149 ? 84.451  28.658  109.630 1.00 92.42 ? 147 TRP D O   1 
ATOM   7945  C CB  . TRP D 1 149 ? 84.010  30.871  111.855 1.00 92.42 ? 147 TRP D CB  1 
ATOM   7946  C CG  . TRP D 1 149 ? 82.543  31.072  111.563 1.00 92.42 ? 147 TRP D CG  1 
ATOM   7947  C CD1 . TRP D 1 149 ? 81.854  30.662  110.451 1.00 92.42 ? 147 TRP D CD1 1 
ATOM   7948  C CD2 . TRP D 1 149 ? 81.608  31.790  112.366 1.00 92.42 ? 147 TRP D CD2 1 
ATOM   7949  N NE1 . TRP D 1 149 ? 80.548  31.084  110.513 1.00 92.42 ? 147 TRP D NE1 1 
ATOM   7950  C CE2 . TRP D 1 149 ? 80.368  31.781  111.677 1.00 92.42 ? 147 TRP D CE2 1 
ATOM   7951  C CE3 . TRP D 1 149 ? 81.695  32.444  113.599 1.00 92.42 ? 147 TRP D CE3 1 
ATOM   7952  C CZ2 . TRP D 1 149 ? 79.226  32.402  112.180 1.00 92.42 ? 147 TRP D CZ2 1 
ATOM   7953  C CZ3 . TRP D 1 149 ? 80.562  33.061  114.101 1.00 92.42 ? 147 TRP D CZ3 1 
ATOM   7954  C CH2 . TRP D 1 149 ? 79.337  33.036  113.388 1.00 92.42 ? 147 TRP D CH2 1 
ATOM   7955  N N   . ARG D 1 150 ? 82.835  27.897  111.014 1.00 92.42 ? 148 ARG D N   1 
ATOM   7956  C CA  . ARG D 1 150 ? 82.144  27.110  110.003 1.00 92.42 ? 148 ARG D CA  1 
ATOM   7957  C C   . ARG D 1 150 ? 80.673  27.567  110.032 1.00 92.42 ? 148 ARG D C   1 
ATOM   7958  O O   . ARG D 1 150 ? 80.084  27.742  111.107 1.00 92.42 ? 148 ARG D O   1 
ATOM   7959  C CB  . ARG D 1 150 ? 82.276  25.617  110.327 1.00 89.29 ? 148 ARG D CB  1 
ATOM   7960  C CG  . ARG D 1 150 ? 83.716  25.198  110.604 1.00 89.29 ? 148 ARG D CG  1 
ATOM   7961  C CD  . ARG D 1 150 ? 83.871  23.699  110.878 1.00 89.29 ? 148 ARG D CD  1 
ATOM   7962  N NE  . ARG D 1 150 ? 84.476  23.437  112.189 1.00 89.29 ? 148 ARG D NE  1 
ATOM   7963  C CZ  . ARG D 1 150 ? 85.201  22.360  112.487 1.00 89.29 ? 148 ARG D CZ  1 
ATOM   7964  N NH1 . ARG D 1 150 ? 85.425  21.430  111.566 1.00 89.29 ? 148 ARG D NH1 1 
ATOM   7965  N NH2 . ARG D 1 150 ? 85.696  22.210  113.712 1.00 89.29 ? 148 ARG D NH2 1 
ATOM   7966  N N   . PRO D 1 151 ? 80.068  27.781  108.848 1.00 92.42 ? 149 PRO D N   1 
ATOM   7967  C CA  . PRO D 1 151 ? 78.673  28.226  108.729 1.00 92.42 ? 149 PRO D CA  1 
ATOM   7968  C C   . PRO D 1 151 ? 77.662  27.331  109.439 1.00 92.42 ? 149 PRO D C   1 
ATOM   7969  O O   . PRO D 1 151 ? 76.460  27.612  109.437 1.00 92.42 ? 149 PRO D O   1 
ATOM   7970  C CB  . PRO D 1 151 ? 78.456  28.262  107.220 1.00 83.98 ? 149 PRO D CB  1 
ATOM   7971  C CG  . PRO D 1 151 ? 79.346  27.157  106.733 1.00 83.98 ? 149 PRO D CG  1 
ATOM   7972  C CD  . PRO D 1 151 ? 80.604  27.402  107.527 1.00 83.98 ? 149 PRO D CD  1 
ATOM   7973  N N   . PRO D 1 160 ? 73.903  21.214  97.104  1.00 92.42 ? 158 PRO D N   1 
ATOM   7974  C CA  . PRO D 1 160 ? 74.489  22.444  96.555  1.00 92.42 ? 158 PRO D CA  1 
ATOM   7975  C C   . PRO D 1 160 ? 73.460  23.368  95.902  1.00 92.42 ? 158 PRO D C   1 
ATOM   7976  O O   . PRO D 1 160 ? 73.084  23.167  94.745  1.00 92.42 ? 158 PRO D O   1 
ATOM   7977  C CB  . PRO D 1 160 ? 75.510  21.918  95.543  1.00 92.42 ? 158 PRO D CB  1 
ATOM   7978  C CG  . PRO D 1 160 ? 75.970  20.643  96.181  1.00 92.42 ? 158 PRO D CG  1 
ATOM   7979  C CD  . PRO D 1 160 ? 74.671  20.030  96.674  1.00 92.42 ? 158 PRO D CD  1 
ATOM   7980  N N   . SER D 1 161 ? 73.003  24.375  96.645  1.00 62.49 ? 159 SER D N   1 
ATOM   7981  C CA  . SER D 1 161 ? 72.030  25.327  96.107  1.00 51.74 ? 159 SER D CA  1 
ATOM   7982  C C   . SER D 1 161 ? 72.746  26.585  95.669  1.00 57.95 ? 159 SER D C   1 
ATOM   7983  O O   . SER D 1 161 ? 73.659  27.066  96.341  1.00 68.53 ? 159 SER D O   1 
ATOM   7984  C CB  . SER D 1 161 ? 70.959  25.698  97.153  1.00 61.80 ? 159 SER D CB  1 
ATOM   7985  O OG  . SER D 1 161 ? 70.078  26.710  96.667  1.00 64.71 ? 159 SER D OG  1 
ATOM   7986  N N   . SER D 1 162 ? 72.327  27.119  94.536  1.00 60.80 ? 160 SER D N   1 
ATOM   7987  C CA  . SER D 1 162 ? 72.936  28.330  94.043  1.00 64.71 ? 160 SER D CA  1 
ATOM   7988  C C   . SER D 1 162 ? 72.744  29.437  95.083  1.00 64.28 ? 160 SER D C   1 
ATOM   7989  O O   . SER D 1 162 ? 73.187  30.566  94.875  1.00 73.19 ? 160 SER D O   1 
ATOM   7990  C CB  . SER D 1 162 ? 72.312  28.713  92.701  1.00 92.42 ? 160 SER D CB  1 
ATOM   7991  O OG  . SER D 1 162 ? 72.348  27.612  91.800  1.00 92.42 ? 160 SER D OG  1 
ATOM   7992  N N   . LEU D 1 163 ? 72.072  29.117  96.192  1.00 48.53 ? 161 LEU D N   1 
ATOM   7993  C CA  . LEU D 1 163 ? 71.875  30.091  97.266  1.00 48.53 ? 161 LEU D CA  1 
ATOM   7994  C C   . LEU D 1 163 ? 72.453  29.537  98.559  1.00 48.53 ? 161 LEU D C   1 
ATOM   7995  O O   . LEU D 1 163 ? 72.686  30.274  99.511  1.00 48.53 ? 161 LEU D O   1 
ATOM   7996  C CB  . LEU D 1 163 ? 70.400  30.425  97.493  1.00 57.11 ? 161 LEU D CB  1 
ATOM   7997  C CG  . LEU D 1 163 ? 70.219  31.561  98.514  1.00 57.11 ? 161 LEU D CG  1 
ATOM   7998  C CD1 . LEU D 1 163 ? 70.656  32.881  97.880  1.00 57.11 ? 161 LEU D CD1 1 
ATOM   7999  C CD2 . LEU D 1 163 ? 68.776  31.640  98.976  1.00 57.11 ? 161 LEU D CD2 1 
ATOM   8000  N N   . ALA D 1 164 ? 72.660  28.230  98.612  1.00 67.53 ? 162 ALA D N   1 
ATOM   8001  C CA  . ALA D 1 164 ? 73.257  27.649  99.803  1.00 67.53 ? 162 ALA D CA  1 
ATOM   8002  C C   . ALA D 1 164 ? 74.662  28.247  99.806  1.00 67.53 ? 162 ALA D C   1 
ATOM   8003  O O   . ALA D 1 164 ? 75.079  28.921  100.755 1.00 67.53 ? 162 ALA D O   1 
ATOM   8004  C CB  . ALA D 1 164 ? 73.322  26.125  99.677  1.00 46.43 ? 162 ALA D CB  1 
ATOM   8005  N N   . ILE D 1 165 ? 75.364  28.010  98.702  1.00 72.67 ? 163 ILE D N   1 
ATOM   8006  C CA  . ILE D 1 165 ? 76.717  28.497  98.493  1.00 72.67 ? 163 ILE D CA  1 
ATOM   8007  C C   . ILE D 1 165 ? 76.776  30.014  98.669  1.00 72.67 ? 163 ILE D C   1 
ATOM   8008  O O   . ILE D 1 165 ? 77.634  30.538  99.381  1.00 72.67 ? 163 ILE D O   1 
ATOM   8009  C CB  . ILE D 1 165 ? 77.185  28.103  97.088  1.00 37.49 ? 163 ILE D CB  1 
ATOM   8010  C CG1 . ILE D 1 165 ? 77.286  26.581  97.008  1.00 37.49 ? 163 ILE D CG1 1 
ATOM   8011  C CG2 . ILE D 1 165 ? 78.524  28.742  96.773  1.00 37.49 ? 163 ILE D CG2 1 
ATOM   8012  C CD1 . ILE D 1 165 ? 77.601  26.066  95.634  1.00 37.49 ? 163 ILE D CD1 1 
ATOM   8013  N N   . GLN D 1 166 ? 75.860  30.708  98.008  1.00 34.02 ? 164 GLN D N   1 
ATOM   8014  C CA  . GLN D 1 166 ? 75.759  32.161  98.093  1.00 34.02 ? 164 GLN D CA  1 
ATOM   8015  C C   . GLN D 1 166 ? 75.794  32.603  99.558  1.00 34.02 ? 164 GLN D C   1 
ATOM   8016  O O   . GLN D 1 166 ? 76.808  33.109  100.042 1.00 34.02 ? 164 GLN D O   1 
ATOM   8017  C CB  . GLN D 1 166 ? 74.444  32.592  97.443  1.00 80.01 ? 164 GLN D CB  1 
ATOM   8018  C CG  . GLN D 1 166 ? 73.941  33.970  97.810  1.00 80.01 ? 164 GLN D CG  1 
ATOM   8019  C CD  . GLN D 1 166 ? 74.723  35.064  97.148  1.00 80.01 ? 164 GLN D CD  1 
ATOM   8020  O OE1 . GLN D 1 166 ? 74.978  35.019  95.946  1.00 80.01 ? 164 GLN D OE1 1 
ATOM   8021  N NE2 . GLN D 1 166 ? 75.099  36.068  97.922  1.00 80.01 ? 164 GLN D NE2 1 
ATOM   8022  N N   . GLU D 1 167 ? 74.678  32.394  100.256 1.00 60.25 ? 165 GLU D N   1 
ATOM   8023  C CA  . GLU D 1 167 ? 74.538  32.756  101.666 1.00 60.25 ? 165 GLU D CA  1 
ATOM   8024  C C   . GLU D 1 167 ? 75.771  32.362  102.471 1.00 60.25 ? 165 GLU D C   1 
ATOM   8025  O O   . GLU D 1 167 ? 76.397  33.215  103.102 1.00 60.25 ? 165 GLU D O   1 
ATOM   8026  C CB  . GLU D 1 167 ? 73.300  32.081  102.275 1.00 83.50 ? 165 GLU D CB  1 
ATOM   8027  C CG  . GLU D 1 167 ? 71.948  32.561  101.743 1.00 83.50 ? 165 GLU D CG  1 
ATOM   8028  C CD  . GLU D 1 167 ? 71.635  33.998  102.120 1.00 83.50 ? 165 GLU D CD  1 
ATOM   8029  O OE1 . GLU D 1 167 ? 70.497  34.443  101.854 1.00 83.50 ? 165 GLU D OE1 1 
ATOM   8030  O OE2 . GLU D 1 167 ? 72.524  34.685  102.675 1.00 83.50 ? 165 GLU D OE2 1 
ATOM   8031  N N   . ASN D 1 168 ? 76.105  31.072  102.458 1.00 42.02 ? 166 ASN D N   1 
ATOM   8032  C CA  . ASN D 1 168 ? 77.282  30.556  103.176 1.00 42.02 ? 166 ASN D CA  1 
ATOM   8033  C C   . ASN D 1 168 ? 78.500  31.461  102.972 1.00 42.02 ? 166 ASN D C   1 
ATOM   8034  O O   . ASN D 1 168 ? 79.079  31.988  103.926 1.00 42.02 ? 166 ASN D O   1 
ATOM   8035  C CB  . ASN D 1 168 ? 77.633  29.144  102.675 1.00 89.82 ? 166 ASN D CB  1 
ATOM   8036  C CG  . ASN D 1 168 ? 79.111  28.788  102.881 1.00 89.82 ? 166 ASN D CG  1 
ATOM   8037  O OD1 . ASN D 1 168 ? 79.516  28.376  103.969 1.00 89.82 ? 166 ASN D OD1 1 
ATOM   8038  N ND2 . ASN D 1 168 ? 79.918  28.960  101.830 1.00 89.82 ? 166 ASN D ND2 1 
ATOM   8039  N N   . ALA D 1 169 ? 78.884  31.609  101.709 1.00 47.38 ? 167 ALA D N   1 
ATOM   8040  C CA  . ALA D 1 169 ? 80.011  32.430  101.345 1.00 47.38 ? 167 ALA D CA  1 
ATOM   8041  C C   . ALA D 1 169 ? 79.939  33.732  102.109 1.00 47.38 ? 167 ALA D C   1 
ATOM   8042  O O   . ALA D 1 169 ? 80.846  34.051  102.878 1.00 47.38 ? 167 ALA D O   1 
ATOM   8043  C CB  . ALA D 1 169 ? 79.985  32.697  99.877  1.00 19.87 ? 167 ALA D CB  1 
ATOM   8044  N N   . ASN D 1 170 ? 78.855  34.478  101.901 1.00 43.86 ? 168 ASN D N   1 
ATOM   8045  C CA  . ASN D 1 170 ? 78.668  35.758  102.583 1.00 43.86 ? 168 ASN D CA  1 
ATOM   8046  C C   . ASN D 1 170 ? 78.885  35.652  104.093 1.00 43.86 ? 168 ASN D C   1 
ATOM   8047  O O   . ASN D 1 170 ? 79.390  36.583  104.717 1.00 43.86 ? 168 ASN D O   1 
ATOM   8048  C CB  . ASN D 1 170 ? 77.270  36.310  102.318 1.00 82.42 ? 168 ASN D CB  1 
ATOM   8049  C CG  . ASN D 1 170 ? 76.972  36.436  100.852 1.00 82.42 ? 168 ASN D CG  1 
ATOM   8050  O OD1 . ASN D 1 170 ? 77.796  36.938  100.082 1.00 82.42 ? 168 ASN D OD1 1 
ATOM   8051  N ND2 . ASN D 1 170 ? 75.785  35.987  100.449 1.00 82.42 ? 168 ASN D ND2 1 
ATOM   8052  N N   . ALA D 1 171 ? 78.499  34.529  104.690 1.00 64.15 ? 169 ALA D N   1 
ATOM   8053  C CA  . ALA D 1 171 ? 78.693  34.353  106.127 1.00 64.15 ? 169 ALA D CA  1 
ATOM   8054  C C   . ALA D 1 171 ? 80.185  34.431  106.420 1.00 64.15 ? 169 ALA D C   1 
ATOM   8055  O O   . ALA D 1 171 ? 80.634  35.254  107.220 1.00 64.15 ? 169 ALA D O   1 
ATOM   8056  C CB  . ALA D 1 171 ? 78.149  33.013  106.573 1.00 77.30 ? 169 ALA D CB  1 
ATOM   8057  N N   . LEU D 1 172 ? 80.946  33.555  105.766 1.00 36.94 ? 170 LEU D N   1 
ATOM   8058  C CA  . LEU D 1 172 ? 82.388  33.527  105.925 1.00 36.94 ? 170 LEU D CA  1 
ATOM   8059  C C   . LEU D 1 172 ? 82.809  34.951  105.719 1.00 36.94 ? 170 LEU D C   1 
ATOM   8060  O O   . LEU D 1 172 ? 83.204  35.620  106.654 1.00 36.94 ? 170 LEU D O   1 
ATOM   8061  C CB  . LEU D 1 172 ? 83.017  32.639  104.861 1.00 31.16 ? 170 LEU D CB  1 
ATOM   8062  C CG  . LEU D 1 172 ? 82.470  31.210  104.894 1.00 31.16 ? 170 LEU D CG  1 
ATOM   8063  C CD1 . LEU D 1 172 ? 82.989  30.401  103.712 1.00 31.16 ? 170 LEU D CD1 1 
ATOM   8064  C CD2 . LEU D 1 172 ? 82.866  30.562  106.204 1.00 31.16 ? 170 LEU D CD2 1 
ATOM   8065  N N   . ALA D 1 173 ? 82.671  35.426  104.492 1.00 20.25 ? 171 ALA D N   1 
ATOM   8066  C CA  . ALA D 1 173 ? 83.044  36.796  104.156 1.00 20.25 ? 171 ALA D CA  1 
ATOM   8067  C C   . ALA D 1 173 ? 82.780  37.852  105.239 1.00 20.25 ? 171 ALA D C   1 
ATOM   8068  O O   . ALA D 1 173 ? 83.606  38.743  105.426 1.00 20.25 ? 171 ALA D O   1 
ATOM   8069  C CB  . ALA D 1 173 ? 82.366  37.216  102.854 1.00 44.59 ? 171 ALA D CB  1 
ATOM   8070  N N   . ARG D 1 174 ? 81.649  37.773  105.940 1.00 35.35 ? 172 ARG D N   1 
ATOM   8071  C CA  . ARG D 1 174 ? 81.341  38.757  106.980 1.00 35.35 ? 172 ARG D CA  1 
ATOM   8072  C C   . ARG D 1 174 ? 82.096  38.465  108.270 1.00 35.35 ? 172 ARG D C   1 
ATOM   8073  O O   . ARG D 1 174 ? 82.679  39.365  108.874 1.00 35.35 ? 172 ARG D O   1 
ATOM   8074  C CB  . ARG D 1 174 ? 79.834  38.799  107.262 1.00 68.94 ? 172 ARG D CB  1 
ATOM   8075  C CG  . ARG D 1 174 ? 79.018  39.475  106.171 1.00 68.94 ? 172 ARG D CG  1 
ATOM   8076  C CD  . ARG D 1 174 ? 77.590  39.750  106.622 1.00 68.94 ? 172 ARG D CD  1 
ATOM   8077  N NE  . ARG D 1 174 ? 76.602  38.875  105.991 1.00 68.94 ? 172 ARG D NE  1 
ATOM   8078  C CZ  . ARG D 1 174 ? 76.552  37.555  106.147 1.00 68.94 ? 172 ARG D CZ  1 
ATOM   8079  N NH1 . ARG D 1 174 ? 77.440  36.943  106.916 1.00 68.94 ? 172 ARG D NH1 1 
ATOM   8080  N NH2 . ARG D 1 174 ? 75.611  36.844  105.535 1.00 68.94 ? 172 ARG D NH2 1 
ATOM   8081  N N   . TYR D 1 175 ? 82.074  37.203  108.689 1.00 65.05 ? 173 TYR D N   1 
ATOM   8082  C CA  . TYR D 1 175 ? 82.764  36.781  109.902 1.00 65.05 ? 173 TYR D CA  1 
ATOM   8083  C C   . TYR D 1 175 ? 84.230  37.144  109.737 1.00 65.05 ? 173 TYR D C   1 
ATOM   8084  O O   . TYR D 1 175 ? 84.885  37.574  110.682 1.00 65.05 ? 173 TYR D O   1 
ATOM   8085  C CB  . TYR D 1 175 ? 82.573  35.266  110.109 1.00 66.52 ? 173 TYR D CB  1 
ATOM   8086  C CG  . TYR D 1 175 ? 83.838  34.445  110.221 1.00 66.52 ? 173 TYR D CG  1 
ATOM   8087  C CD1 . TYR D 1 175 ? 84.739  34.647  111.262 1.00 66.52 ? 173 TYR D CD1 1 
ATOM   8088  C CD2 . TYR D 1 175 ? 84.123  33.453  109.292 1.00 66.52 ? 173 TYR D CD2 1 
ATOM   8089  C CE1 . TYR D 1 175 ? 85.892  33.882  111.376 1.00 66.52 ? 173 TYR D CE1 1 
ATOM   8090  C CE2 . TYR D 1 175 ? 85.273  32.680  109.396 1.00 66.52 ? 173 TYR D CE2 1 
ATOM   8091  C CZ  . TYR D 1 175 ? 86.152  32.901  110.440 1.00 66.52 ? 173 TYR D CZ  1 
ATOM   8092  O OH  . TYR D 1 175 ? 87.287  32.130  110.547 1.00 66.52 ? 173 TYR D OH  1 
ATOM   8093  N N   . ALA D 1 176 ? 84.728  36.977  108.518 1.00 58.74 ? 174 ALA D N   1 
ATOM   8094  C CA  . ALA D 1 176 ? 86.108  37.291  108.194 1.00 58.74 ? 174 ALA D CA  1 
ATOM   8095  C C   . ALA D 1 176 ? 86.364  38.741  108.542 1.00 58.74 ? 174 ALA D C   1 
ATOM   8096  O O   . ALA D 1 176 ? 86.975  39.044  109.560 1.00 58.74 ? 174 ALA D O   1 
ATOM   8097  C CB  . ALA D 1 176 ? 86.361  37.061  106.716 1.00 66.55 ? 174 ALA D CB  1 
ATOM   8098  N N   . SER D 1 177 ? 85.879  39.634  107.691 1.00 38.53 ? 175 SER D N   1 
ATOM   8099  C CA  . SER D 1 177 ? 86.048  41.071  107.884 1.00 38.53 ? 175 SER D CA  1 
ATOM   8100  C C   . SER D 1 177 ? 86.120  41.486  109.358 1.00 38.53 ? 175 SER D C   1 
ATOM   8101  O O   . SER D 1 177 ? 86.933  42.337  109.745 1.00 38.53 ? 175 SER D O   1 
ATOM   8102  C CB  . SER D 1 177 ? 84.907  41.818  107.191 1.00 36.54 ? 175 SER D CB  1 
ATOM   8103  O OG  . SER D 1 177 ? 85.167  43.211  107.136 1.00 36.54 ? 175 SER D OG  1 
ATOM   8104  N N   . ILE D 1 178 ? 85.272  40.879  110.181 1.00 64.03 ? 176 ILE D N   1 
ATOM   8105  C CA  . ILE D 1 178 ? 85.239  41.183  111.605 1.00 64.03 ? 176 ILE D CA  1 
ATOM   8106  C C   . ILE D 1 178 ? 86.567  40.861  112.274 1.00 64.03 ? 176 ILE D C   1 
ATOM   8107  O O   . ILE D 1 178 ? 87.207  41.734  112.848 1.00 64.03 ? 176 ILE D O   1 
ATOM   8108  C CB  . ILE D 1 178 ? 84.134  40.387  112.299 1.00 39.45 ? 176 ILE D CB  1 
ATOM   8109  C CG1 . ILE D 1 178 ? 82.785  40.772  111.703 1.00 39.45 ? 176 ILE D CG1 1 
ATOM   8110  C CG2 . ILE D 1 178 ? 84.157  40.640  113.798 1.00 39.45 ? 176 ILE D CG2 1 
ATOM   8111  C CD1 . ILE D 1 178 ? 81.632  40.087  112.377 1.00 39.45 ? 176 ILE D CD1 1 
ATOM   8112  N N   . CYS D 1 179 ? 86.973  39.602  112.200 1.00 54.10 ? 177 CYS D N   1 
ATOM   8113  C CA  . CYS D 1 179 ? 88.223  39.179  112.802 1.00 54.10 ? 177 CYS D CA  1 
ATOM   8114  C C   . CYS D 1 179 ? 89.349  40.156  112.504 1.00 54.10 ? 177 CYS D C   1 
ATOM   8115  O O   . CYS D 1 179 ? 90.044  40.603  113.419 1.00 54.10 ? 177 CYS D O   1 
ATOM   8116  C CB  . CYS D 1 179 ? 88.620  37.803  112.285 1.00 40.34 ? 177 CYS D CB  1 
ATOM   8117  S SG  . CYS D 1 179 ? 87.339  36.557  112.444 1.00 40.34 ? 177 CYS D SG  1 
ATOM   8118  N N   . GLN D 1 180 ? 89.535  40.485  111.227 1.00 60.05 ? 178 GLN D N   1 
ATOM   8119  C CA  . GLN D 1 180 ? 90.602  41.401  110.835 1.00 60.05 ? 178 GLN D CA  1 
ATOM   8120  C C   . GLN D 1 180 ? 90.386  42.753  111.505 1.00 60.05 ? 178 GLN D C   1 
ATOM   8121  O O   . GLN D 1 180 ? 91.339  43.502  111.748 1.00 60.05 ? 178 GLN D O   1 
ATOM   8122  C CB  . GLN D 1 180 ? 90.659  41.551  109.305 1.00 36.79 ? 178 GLN D CB  1 
ATOM   8123  C CG  . GLN D 1 180 ? 90.743  40.220  108.531 1.00 36.79 ? 178 GLN D CG  1 
ATOM   8124  C CD  . GLN D 1 180 ? 91.138  40.399  107.057 1.00 36.79 ? 178 GLN D CD  1 
ATOM   8125  O OE1 . GLN D 1 180 ? 90.863  41.435  106.446 1.00 36.79 ? 178 GLN D OE1 1 
ATOM   8126  N NE2 . GLN D 1 180 ? 91.772  39.376  106.482 1.00 36.79 ? 178 GLN D NE2 1 
ATOM   8127  N N   . GLN D 1 181 ? 89.130  43.061  111.811 1.00 54.07 ? 179 GLN D N   1 
ATOM   8128  C CA  . GLN D 1 181 ? 88.814  44.315  112.483 1.00 54.07 ? 179 GLN D CA  1 
ATOM   8129  C C   . GLN D 1 181 ? 89.269  44.264  113.938 1.00 54.07 ? 179 GLN D C   1 
ATOM   8130  O O   . GLN D 1 181 ? 89.478  45.307  114.567 1.00 54.07 ? 179 GLN D O   1 
ATOM   8131  C CB  . GLN D 1 181 ? 87.315  44.602  112.411 1.00 45.68 ? 179 GLN D CB  1 
ATOM   8132  C CG  . GLN D 1 181 ? 86.872  45.125  111.053 1.00 45.68 ? 179 GLN D CG  1 
ATOM   8133  C CD  . GLN D 1 181 ? 87.489  46.481  110.711 1.00 45.68 ? 179 GLN D CD  1 
ATOM   8134  O OE1 . GLN D 1 181 ? 87.465  46.913  109.553 1.00 45.68 ? 179 GLN D OE1 1 
ATOM   8135  N NE2 . GLN D 1 181 ? 88.039  47.159  111.722 1.00 45.68 ? 179 GLN D NE2 1 
ATOM   8136  N N   . ASN D 1 182 ? 89.419  43.043  114.456 1.00 37.13 ? 180 ASN D N   1 
ATOM   8137  C CA  . ASN D 1 182 ? 89.873  42.800  115.828 1.00 37.13 ? 180 ASN D CA  1 
ATOM   8138  C C   . ASN D 1 182 ? 91.266  42.152  115.854 1.00 37.13 ? 180 ASN D C   1 
ATOM   8139  O O   . ASN D 1 182 ? 91.590  41.365  116.748 1.00 37.13 ? 180 ASN D O   1 
ATOM   8140  C CB  . ASN D 1 182 ? 88.874  41.905  116.571 1.00 58.13 ? 180 ASN D CB  1 
ATOM   8141  C CG  . ASN D 1 182 ? 87.575  42.617  116.885 1.00 58.13 ? 180 ASN D CG  1 
ATOM   8142  O OD1 . ASN D 1 182 ? 87.561  43.644  117.565 1.00 58.13 ? 180 ASN D OD1 1 
ATOM   8143  N ND2 . ASN D 1 182 ? 86.475  42.070  116.394 1.00 58.13 ? 180 ASN D ND2 1 
ATOM   8144  N N   . GLY D 1 183 ? 92.076  42.480  114.854 1.00 36.66 ? 181 GLY D N   1 
ATOM   8145  C CA  . GLY D 1 183 ? 93.425  41.956  114.788 1.00 36.66 ? 181 GLY D CA  1 
ATOM   8146  C C   . GLY D 1 183 ? 93.543  40.450  114.771 1.00 36.66 ? 181 GLY D C   1 
ATOM   8147  O O   . GLY D 1 183 ? 94.601  39.907  115.092 1.00 36.66 ? 181 GLY D O   1 
ATOM   8148  N N   . LEU D 1 184 ? 92.466  39.767  114.404 1.00 49.79 ? 182 LEU D N   1 
ATOM   8149  C CA  . LEU D 1 184 ? 92.486  38.309  114.334 1.00 49.79 ? 182 LEU D CA  1 
ATOM   8150  C C   . LEU D 1 184 ? 92.622  37.838  112.883 1.00 49.79 ? 182 LEU D C   1 
ATOM   8151  O O   . LEU D 1 184 ? 92.104  38.469  111.961 1.00 49.79 ? 182 LEU D O   1 
ATOM   8152  C CB  . LEU D 1 184 ? 91.212  37.719  114.958 1.00 64.50 ? 182 LEU D CB  1 
ATOM   8153  C CG  . LEU D 1 184 ? 91.100  37.569  116.483 1.00 64.50 ? 182 LEU D CG  1 
ATOM   8154  C CD1 . LEU D 1 184 ? 89.707  37.101  116.851 1.00 64.50 ? 182 LEU D CD1 1 
ATOM   8155  C CD2 . LEU D 1 184 ? 92.116  36.562  116.977 1.00 64.50 ? 182 LEU D CD2 1 
ATOM   8156  N N   . VAL D 1 185 ? 93.332  36.734  112.682 1.00 36.46 ? 183 VAL D N   1 
ATOM   8157  C CA  . VAL D 1 185 ? 93.526  36.190  111.344 1.00 36.46 ? 183 VAL D CA  1 
ATOM   8158  C C   . VAL D 1 185 ? 92.509  35.082  111.095 1.00 36.46 ? 183 VAL D C   1 
ATOM   8159  O O   . VAL D 1 185 ? 92.663  33.963  111.578 1.00 36.46 ? 183 VAL D O   1 
ATOM   8160  C CB  . VAL D 1 185 ? 94.965  35.646  111.171 1.00 38.01 ? 183 VAL D CB  1 
ATOM   8161  C CG1 . VAL D 1 185 ? 95.037  34.691  110.002 1.00 38.01 ? 183 VAL D CG1 1 
ATOM   8162  C CG2 . VAL D 1 185 ? 95.928  36.811  110.958 1.00 38.01 ? 183 VAL D CG2 1 
ATOM   8163  N N   . PRO D 1 186 ? 91.453  35.389  110.323 1.00 8.62  ? 184 PRO D N   1 
ATOM   8164  C CA  . PRO D 1 186 ? 90.362  34.482  109.963 1.00 8.62  ? 184 PRO D CA  1 
ATOM   8165  C C   . PRO D 1 186 ? 90.748  33.266  109.149 1.00 8.62  ? 184 PRO D C   1 
ATOM   8166  O O   . PRO D 1 186 ? 91.194  33.418  108.024 1.00 8.62  ? 184 PRO D O   1 
ATOM   8167  C CB  . PRO D 1 186 ? 89.427  35.388  109.172 1.00 22.97 ? 184 PRO D CB  1 
ATOM   8168  C CG  . PRO D 1 186 ? 90.377  36.298  108.470 1.00 22.97 ? 184 PRO D CG  1 
ATOM   8169  C CD  . PRO D 1 186 ? 91.305  36.668  109.600 1.00 22.97 ? 184 PRO D CD  1 
ATOM   8170  N N   . ILE D 1 187 ? 90.586  32.068  109.698 1.00 27.45 ? 185 ILE D N   1 
ATOM   8171  C CA  . ILE D 1 187 ? 90.882  30.873  108.924 1.00 27.45 ? 185 ILE D CA  1 
ATOM   8172  C C   . ILE D 1 187 ? 89.584  30.594  108.170 1.00 27.45 ? 185 ILE D C   1 
ATOM   8173  O O   . ILE D 1 187 ? 88.647  30.024  108.729 1.00 27.45 ? 185 ILE D O   1 
ATOM   8174  C CB  . ILE D 1 187 ? 91.219  29.652  109.821 1.00 32.02 ? 185 ILE D CB  1 
ATOM   8175  C CG1 . ILE D 1 187 ? 92.654  29.751  110.343 1.00 32.02 ? 185 ILE D CG1 1 
ATOM   8176  C CG2 . ILE D 1 187 ? 91.054  28.350  109.037 1.00 32.02 ? 185 ILE D CG2 1 
ATOM   8177  C CD1 . ILE D 1 187 ? 93.138  28.474  111.037 1.00 32.02 ? 185 ILE D CD1 1 
ATOM   8178  N N   . VAL D 1 188 ? 89.506  31.018  106.913 1.00 35.70 ? 186 VAL D N   1 
ATOM   8179  C CA  . VAL D 1 188 ? 88.299  30.798  106.118 1.00 35.70 ? 186 VAL D CA  1 
ATOM   8180  C C   . VAL D 1 188 ? 88.109  29.310  105.794 1.00 35.70 ? 186 VAL D C   1 
ATOM   8181  O O   . VAL D 1 188 ? 89.001  28.649  105.240 1.00 35.70 ? 186 VAL D O   1 
ATOM   8182  C CB  . VAL D 1 188 ? 88.354  31.570  104.794 1.00 24.97 ? 186 VAL D CB  1 
ATOM   8183  C CG1 . VAL D 1 188 ? 87.042  31.430  104.078 1.00 24.97 ? 186 VAL D CG1 1 
ATOM   8184  C CG2 . VAL D 1 188 ? 88.665  33.030  105.041 1.00 24.97 ? 186 VAL D CG2 1 
ATOM   8185  N N   . GLU D 1 189 ? 86.937  28.784  106.130 1.00 90.34 ? 187 GLU D N   1 
ATOM   8186  C CA  . GLU D 1 189 ? 86.646  27.377  105.878 1.00 90.34 ? 187 GLU D CA  1 
ATOM   8187  C C   . GLU D 1 189 ? 85.321  27.231  105.122 1.00 90.34 ? 187 GLU D C   1 
ATOM   8188  O O   . GLU D 1 189 ? 84.269  27.643  105.614 1.00 90.34 ? 187 GLU D O   1 
ATOM   8189  C CB  . GLU D 1 189 ? 86.601  26.643  107.216 1.00 56.25 ? 187 GLU D CB  1 
ATOM   8190  C CG  . GLU D 1 189 ? 86.413  25.145  107.144 1.00 60.48 ? 187 GLU D CG  1 
ATOM   8191  C CD  . GLU D 1 189 ? 86.774  24.483  108.462 1.00 74.67 ? 187 GLU D CD  1 
ATOM   8192  O OE1 . GLU D 1 189 ? 86.500  25.082  109.522 1.00 67.23 ? 187 GLU D OE1 1 
ATOM   8193  O OE2 . GLU D 1 189 ? 87.327  23.366  108.446 1.00 74.67 ? 187 GLU D OE2 1 
ATOM   8194  N N   . PRO D 1 190 ? 85.362  26.670  103.897 1.00 92.42 ? 188 PRO D N   1 
ATOM   8195  C CA  . PRO D 1 190 ? 84.176  26.463  103.052 1.00 92.42 ? 188 PRO D CA  1 
ATOM   8196  C C   . PRO D 1 190 ? 83.200  25.393  103.568 1.00 92.42 ? 188 PRO D C   1 
ATOM   8197  O O   . PRO D 1 190 ? 82.347  25.688  104.409 1.00 92.42 ? 188 PRO D O   1 
ATOM   8198  C CB  . PRO D 1 190 ? 84.783  26.095  101.699 1.00 71.18 ? 188 PRO D CB  1 
ATOM   8199  C CG  . PRO D 1 190 ? 86.078  26.832  101.706 1.00 71.18 ? 188 PRO D CG  1 
ATOM   8200  C CD  . PRO D 1 190 ? 86.586  26.518  103.093 1.00 71.18 ? 188 PRO D CD  1 
ATOM   8201  N N   . GLU D 1 191 ? 83.319  24.168  103.049 1.00 73.01 ? 189 GLU D N   1 
ATOM   8202  C CA  . GLU D 1 191 ? 82.469  23.042  103.456 1.00 73.01 ? 189 GLU D CA  1 
ATOM   8203  C C   . GLU D 1 191 ? 82.440  21.939  102.402 1.00 73.01 ? 189 GLU D C   1 
ATOM   8204  O O   . GLU D 1 191 ? 82.067  20.799  102.692 1.00 73.01 ? 189 GLU D O   1 
ATOM   8205  C CB  . GLU D 1 191 ? 81.030  23.504  103.748 1.00 92.42 ? 189 GLU D CB  1 
ATOM   8206  C CG  . GLU D 1 191 ? 80.083  22.377  104.214 1.00 92.42 ? 189 GLU D CG  1 
ATOM   8207  C CD  . GLU D 1 191 ? 78.885  22.881  105.033 1.00 92.42 ? 189 GLU D CD  1 
ATOM   8208  O OE1 . GLU D 1 191 ? 77.941  22.086  105.270 1.00 92.42 ? 189 GLU D OE1 1 
ATOM   8209  O OE2 . GLU D 1 191 ? 78.893  24.063  105.450 1.00 92.42 ? 189 GLU D OE2 1 
ATOM   8210  N N   . ASP D 1 199 ? 82.231  9.842   91.554  1.00 92.42 ? 197 ASP D N   1 
ATOM   8211  C CA  . ASP D 1 199 ? 83.393  10.209  90.748  1.00 92.42 ? 197 ASP D CA  1 
ATOM   8212  C C   . ASP D 1 199 ? 84.153  11.407  91.351  1.00 92.42 ? 197 ASP D C   1 
ATOM   8213  O O   . ASP D 1 199 ? 83.551  12.286  91.977  1.00 92.42 ? 197 ASP D O   1 
ATOM   8214  C CB  . ASP D 1 199 ? 82.952  10.497  89.297  1.00 92.42 ? 197 ASP D CB  1 
ATOM   8215  C CG  . ASP D 1 199 ? 81.758  11.449  89.214  1.00 92.42 ? 197 ASP D CG  1 
ATOM   8216  O OD1 . ASP D 1 199 ? 81.931  12.648  89.511  1.00 92.42 ? 197 ASP D OD1 1 
ATOM   8217  O OD2 . ASP D 1 199 ? 80.644  11.001  88.854  1.00 92.42 ? 197 ASP D OD2 1 
ATOM   8218  N N   . LEU D 1 200 ? 85.476  11.424  91.166  1.00 84.99 ? 198 LEU D N   1 
ATOM   8219  C CA  . LEU D 1 200 ? 86.349  12.480  91.693  1.00 84.99 ? 198 LEU D CA  1 
ATOM   8220  C C   . LEU D 1 200 ? 86.080  13.838  91.036  1.00 84.99 ? 198 LEU D C   1 
ATOM   8221  O O   . LEU D 1 200 ? 86.252  14.892  91.663  1.00 84.99 ? 198 LEU D O   1 
ATOM   8222  C CB  . LEU D 1 200 ? 87.817  12.083  91.480  1.00 54.77 ? 198 LEU D CB  1 
ATOM   8223  C CG  . LEU D 1 200 ? 88.908  12.759  92.315  1.00 58.16 ? 198 LEU D CG  1 
ATOM   8224  C CD1 . LEU D 1 200 ? 88.697  12.412  93.770  1.00 44.90 ? 198 LEU D CD1 1 
ATOM   8225  C CD2 . LEU D 1 200 ? 90.288  12.294  91.872  1.00 46.70 ? 198 LEU D CD2 1 
ATOM   8226  N N   . GLU D 1 201 ? 85.668  13.799  89.769  1.00 66.44 ? 199 GLU D N   1 
ATOM   8227  C CA  . GLU D 1 201 ? 85.360  15.005  89.000  1.00 65.46 ? 199 GLU D CA  1 
ATOM   8228  C C   . GLU D 1 201 ? 84.308  15.796  89.776  1.00 70.52 ? 199 GLU D C   1 
ATOM   8229  O O   . GLU D 1 201 ? 84.381  17.024  89.880  1.00 62.68 ? 199 GLU D O   1 
ATOM   8230  C CB  . GLU D 1 201 ? 84.782  14.619  87.638  1.00 92.42 ? 199 GLU D CB  1 
ATOM   8231  C CG  . GLU D 1 201 ? 85.194  13.239  87.125  1.00 92.42 ? 199 GLU D CG  1 
ATOM   8232  C CD  . GLU D 1 201 ? 86.467  13.266  86.295  1.00 92.42 ? 199 GLU D CD  1 
ATOM   8233  O OE1 . GLU D 1 201 ? 87.566  13.421  86.872  1.00 92.42 ? 199 GLU D OE1 1 
ATOM   8234  O OE2 . GLU D 1 201 ? 86.361  13.138  85.053  1.00 92.42 ? 199 GLU D OE2 1 
ATOM   8235  N N   . HIS D 1 202 ? 83.332  15.047  90.300  1.00 88.94 ? 200 HIS D N   1 
ATOM   8236  C CA  . HIS D 1 202 ? 82.196  15.535  91.100  1.00 88.94 ? 200 HIS D CA  1 
ATOM   8237  C C   . HIS D 1 202 ? 82.685  16.557  92.118  1.00 88.94 ? 200 HIS D C   1 
ATOM   8238  O O   . HIS D 1 202 ? 82.343  17.739  92.070  1.00 88.94 ? 200 HIS D O   1 
ATOM   8239  C CB  . HIS D 1 202 ? 81.573  14.344  91.850  1.00 92.42 ? 200 HIS D CB  1 
ATOM   8240  C CG  . HIS D 1 202 ? 80.072  14.306  91.833  1.00 92.42 ? 200 HIS D CG  1 
ATOM   8241  N ND1 . HIS D 1 202 ? 79.331  14.420  90.673  1.00 92.42 ? 200 HIS D ND1 1 
ATOM   8242  C CD2 . HIS D 1 202 ? 79.177  14.088  92.829  1.00 92.42 ? 200 HIS D CD2 1 
ATOM   8243  C CE1 . HIS D 1 202 ? 78.048  14.272  90.955  1.00 92.42 ? 200 HIS D CE1 1 
ATOM   8244  N NE2 . HIS D 1 202 ? 77.927  14.069  92.256  1.00 92.42 ? 200 HIS D NE2 1 
ATOM   8245  N N   . CYS D 1 203 ? 83.491  16.055  93.044  1.00 92.36 ? 201 CYS D N   1 
ATOM   8246  C CA  . CYS D 1 203 ? 84.090  16.837  94.108  1.00 92.36 ? 201 CYS D CA  1 
ATOM   8247  C C   . CYS D 1 203 ? 84.879  18.042  93.566  1.00 92.36 ? 201 CYS D C   1 
ATOM   8248  O O   . CYS D 1 203 ? 84.674  19.170  94.031  1.00 92.36 ? 201 CYS D O   1 
ATOM   8249  C CB  . CYS D 1 203 ? 84.999  15.915  94.930  1.00 79.25 ? 201 CYS D CB  1 
ATOM   8250  S SG  . CYS D 1 203 ? 85.832  16.669  96.325  1.00 79.25 ? 201 CYS D SG  1 
ATOM   8251  N N   . GLN D 1 204 ? 85.760  17.813  92.583  1.00 54.34 ? 202 GLN D N   1 
ATOM   8252  C CA  . GLN D 1 204 ? 86.567  18.903  92.014  1.00 54.34 ? 202 GLN D CA  1 
ATOM   8253  C C   . GLN D 1 204 ? 85.752  20.072  91.498  1.00 54.34 ? 202 GLN D C   1 
ATOM   8254  O O   . GLN D 1 204 ? 86.111  21.235  91.716  1.00 54.34 ? 202 GLN D O   1 
ATOM   8255  C CB  . GLN D 1 204 ? 87.463  18.413  90.880  1.00 54.84 ? 202 GLN D CB  1 
ATOM   8256  C CG  . GLN D 1 204 ? 88.111  19.570  90.109  1.00 54.84 ? 202 GLN D CG  1 
ATOM   8257  C CD  . GLN D 1 204 ? 89.191  19.115  89.132  1.00 54.84 ? 202 GLN D CD  1 
ATOM   8258  O OE1 . GLN D 1 204 ? 89.529  19.832  88.177  1.00 54.84 ? 202 GLN D OE1 1 
ATOM   8259  N NE2 . GLN D 1 204 ? 89.746  17.923  89.371  1.00 54.84 ? 202 GLN D NE2 1 
ATOM   8260  N N   . TYR D 1 205 ? 84.667  19.758  90.797  1.00 74.67 ? 203 TYR D N   1 
ATOM   8261  C CA  . TYR D 1 205 ? 83.787  20.784  90.254  1.00 74.67 ? 203 TYR D CA  1 
ATOM   8262  C C   . TYR D 1 205 ? 83.059  21.501  91.379  1.00 74.67 ? 203 TYR D C   1 
ATOM   8263  O O   . TYR D 1 205 ? 82.936  22.727  91.371  1.00 74.67 ? 203 TYR D O   1 
ATOM   8264  C CB  . TYR D 1 205 ? 82.766  20.174  89.288  1.00 79.94 ? 203 TYR D CB  1 
ATOM   8265  C CG  . TYR D 1 205 ? 81.686  21.149  88.872  1.00 79.94 ? 203 TYR D CG  1 
ATOM   8266  C CD1 . TYR D 1 205 ? 82.003  22.456  88.496  1.00 79.94 ? 203 TYR D CD1 1 
ATOM   8267  C CD2 . TYR D 1 205 ? 80.349  20.773  88.869  1.00 79.94 ? 203 TYR D CD2 1 
ATOM   8268  C CE1 . TYR D 1 205 ? 81.014  23.365  88.130  1.00 79.94 ? 203 TYR D CE1 1 
ATOM   8269  C CE2 . TYR D 1 205 ? 79.351  21.672  88.503  1.00 79.94 ? 203 TYR D CE2 1 
ATOM   8270  C CZ  . TYR D 1 205 ? 79.689  22.965  88.136  1.00 79.94 ? 203 TYR D CZ  1 
ATOM   8271  O OH  . TYR D 1 205 ? 78.698  23.851  87.777  1.00 79.94 ? 203 TYR D OH  1 
ATOM   8272  N N   . VAL D 1 206 ? 82.570  20.733  92.344  1.00 76.09 ? 204 VAL D N   1 
ATOM   8273  C CA  . VAL D 1 206 ? 81.868  21.319  93.470  1.00 76.09 ? 204 VAL D CA  1 
ATOM   8274  C C   . VAL D 1 206 ? 82.810  22.282  94.195  1.00 76.09 ? 204 VAL D C   1 
ATOM   8275  O O   . VAL D 1 206 ? 82.515  23.477  94.327  1.00 76.09 ? 204 VAL D O   1 
ATOM   8276  C CB  . VAL D 1 206 ? 81.404  20.238  94.465  1.00 81.73 ? 204 VAL D CB  1 
ATOM   8277  C CG1 . VAL D 1 206 ? 80.418  20.839  95.449  1.00 81.73 ? 204 VAL D CG1 1 
ATOM   8278  C CG2 . VAL D 1 206 ? 80.778  19.071  93.723  1.00 81.73 ? 204 VAL D CG2 1 
ATOM   8279  N N   . THR D 1 207 ? 83.944  21.750  94.652  1.00 51.30 ? 205 THR D N   1 
ATOM   8280  C CA  . THR D 1 207 ? 84.955  22.528  95.365  1.00 51.30 ? 205 THR D CA  1 
ATOM   8281  C C   . THR D 1 207 ? 85.237  23.857  94.683  1.00 51.30 ? 205 THR D C   1 
ATOM   8282  O O   . THR D 1 207 ? 85.208  24.920  95.314  1.00 51.30 ? 205 THR D O   1 
ATOM   8283  C CB  . THR D 1 207 ? 86.272  21.780  95.425  1.00 33.79 ? 205 THR D CB  1 
ATOM   8284  O OG1 . THR D 1 207 ? 86.050  20.469  95.954  1.00 33.79 ? 205 THR D OG1 1 
ATOM   8285  C CG2 . THR D 1 207 ? 87.255  22.531  96.298  1.00 33.79 ? 205 THR D CG2 1 
ATOM   8286  N N   . GLU D 1 208 ? 85.531  23.777  93.389  1.00 46.78 ? 206 GLU D N   1 
ATOM   8287  C CA  . GLU D 1 208 ? 85.817  24.957  92.594  1.00 46.78 ? 206 GLU D CA  1 
ATOM   8288  C C   . GLU D 1 208 ? 84.736  26.041  92.702  1.00 46.78 ? 206 GLU D C   1 
ATOM   8289  O O   . GLU D 1 208 ? 85.054  27.205  92.964  1.00 46.78 ? 206 GLU D O   1 
ATOM   8290  C CB  . GLU D 1 208 ? 86.007  24.559  91.133  1.00 44.71 ? 206 GLU D CB  1 
ATOM   8291  C CG  . GLU D 1 208 ? 87.307  23.846  90.853  1.00 44.71 ? 206 GLU D CG  1 
ATOM   8292  C CD  . GLU D 1 208 ? 87.466  23.464  89.388  1.00 44.71 ? 206 GLU D CD  1 
ATOM   8293  O OE1 . GLU D 1 208 ? 86.970  24.212  88.512  1.00 44.71 ? 206 GLU D OE1 1 
ATOM   8294  O OE2 . GLU D 1 208 ? 88.101  22.422  89.111  1.00 44.71 ? 206 GLU D OE2 1 
ATOM   8295  N N   . LYS D 1 209 ? 83.468  25.664  92.509  1.00 62.62 ? 207 LYS D N   1 
ATOM   8296  C CA  . LYS D 1 209 ? 82.366  26.628  92.577  1.00 62.62 ? 207 LYS D CA  1 
ATOM   8297  C C   . LYS D 1 209 ? 82.240  27.262  93.953  1.00 62.62 ? 207 LYS D C   1 
ATOM   8298  O O   . LYS D 1 209 ? 82.202  28.491  94.089  1.00 62.62 ? 207 LYS D O   1 
ATOM   8299  C CB  . LYS D 1 209 ? 81.034  25.975  92.215  1.00 49.14 ? 207 LYS D CB  1 
ATOM   8300  C CG  . LYS D 1 209 ? 79.912  26.992  92.194  1.00 49.14 ? 207 LYS D CG  1 
ATOM   8301  C CD  . LYS D 1 209 ? 78.609  26.453  91.616  1.00 49.14 ? 207 LYS D CD  1 
ATOM   8302  C CE  . LYS D 1 209 ? 77.863  25.542  92.585  1.00 49.14 ? 207 LYS D CE  1 
ATOM   8303  N NZ  . LYS D 1 209 ? 76.421  25.386  92.220  1.00 49.14 ? 207 LYS D NZ  1 
ATOM   8304  N N   . VAL D 1 210 ? 82.158  26.407  94.969  1.00 40.18 ? 208 VAL D N   1 
ATOM   8305  C CA  . VAL D 1 210 ? 82.050  26.847  96.356  1.00 40.18 ? 208 VAL D CA  1 
ATOM   8306  C C   . VAL D 1 210 ? 83.128  27.889  96.593  1.00 40.18 ? 208 VAL D C   1 
ATOM   8307  O O   . VAL D 1 210 ? 82.855  29.011  97.027  1.00 40.18 ? 208 VAL D O   1 
ATOM   8308  C CB  . VAL D 1 210 ? 82.334  25.687  97.319  1.00 18.27 ? 208 VAL D CB  1 
ATOM   8309  C CG1 . VAL D 1 210 ? 82.077  26.129  98.728  1.00 18.27 ? 208 VAL D CG1 1 
ATOM   8310  C CG2 . VAL D 1 210 ? 81.511  24.473  96.948  1.00 18.27 ? 208 VAL D CG2 1 
ATOM   8311  N N   . LEU D 1 211 ? 84.357  27.463  96.287  1.00 58.69 ? 209 LEU D N   1 
ATOM   8312  C CA  . LEU D 1 211 ? 85.584  28.244  96.427  1.00 58.69 ? 209 LEU D CA  1 
ATOM   8313  C C   . LEU D 1 211 ? 85.580  29.583  95.714  1.00 58.69 ? 209 LEU D C   1 
ATOM   8314  O O   . LEU D 1 211 ? 85.768  30.640  96.336  1.00 58.69 ? 209 LEU D O   1 
ATOM   8315  C CB  . LEU D 1 211 ? 86.765  27.417  95.926  1.00 23.17 ? 209 LEU D CB  1 
ATOM   8316  C CG  . LEU D 1 211 ? 87.503  26.656  97.021  1.00 23.17 ? 209 LEU D CG  1 
ATOM   8317  C CD1 . LEU D 1 211 ? 88.437  25.611  96.436  1.00 23.17 ? 209 LEU D CD1 1 
ATOM   8318  C CD2 . LEU D 1 211 ? 88.282  27.658  97.838  1.00 23.17 ? 209 LEU D CD2 1 
ATOM   8319  N N   . ALA D 1 212 ? 85.384  29.531  94.402  1.00 48.95 ? 210 ALA D N   1 
ATOM   8320  C CA  . ALA D 1 212 ? 85.362  30.744  93.608  1.00 48.95 ? 210 ALA D CA  1 
ATOM   8321  C C   . ALA D 1 212 ? 84.191  31.617  94.032  1.00 48.95 ? 210 ALA D C   1 
ATOM   8322  O O   . ALA D 1 212 ? 84.134  32.801  93.698  1.00 48.95 ? 210 ALA D O   1 
ATOM   8323  C CB  . ALA D 1 212 ? 85.259  30.404  92.155  1.00 4.86  ? 210 ALA D CB  1 
ATOM   8324  N N   . ALA D 1 213 ? 83.262  31.022  94.775  1.00 54.28 ? 211 ALA D N   1 
ATOM   8325  C CA  . ALA D 1 213 ? 82.086  31.733  95.266  1.00 54.28 ? 211 ALA D CA  1 
ATOM   8326  C C   . ALA D 1 213 ? 82.406  32.396  96.596  1.00 54.28 ? 211 ALA D C   1 
ATOM   8327  O O   . ALA D 1 213 ? 81.759  33.356  96.998  1.00 54.28 ? 211 ALA D O   1 
ATOM   8328  C CB  . ALA D 1 213 ? 80.934  30.764  95.440  1.00 86.77 ? 211 ALA D CB  1 
ATOM   8329  N N   . VAL D 1 214 ? 83.411  31.864  97.276  1.00 48.64 ? 212 VAL D N   1 
ATOM   8330  C CA  . VAL D 1 214 ? 83.825  32.398  98.560  1.00 48.64 ? 212 VAL D CA  1 
ATOM   8331  C C   . VAL D 1 214 ? 84.723  33.608  98.390  1.00 48.64 ? 212 VAL D C   1 
ATOM   8332  O O   . VAL D 1 214 ? 84.432  34.679  98.926  1.00 48.64 ? 212 VAL D O   1 
ATOM   8333  C CB  . VAL D 1 214 ? 84.607  31.357  99.385  1.00 34.54 ? 212 VAL D CB  1 
ATOM   8334  C CG1 . VAL D 1 214 ? 85.164  32.011  100.645 1.00 34.54 ? 212 VAL D CG1 1 
ATOM   8335  C CG2 . VAL D 1 214 ? 83.707  30.173  99.735  1.00 34.54 ? 212 VAL D CG2 1 
ATOM   8336  N N   . TYR D 1 215 ? 85.816  33.445  97.645  1.00 43.15 ? 213 TYR D N   1 
ATOM   8337  C CA  . TYR D 1 215 ? 86.733  34.563  97.476  1.00 43.15 ? 213 TYR D CA  1 
ATOM   8338  C C   . TYR D 1 215 ? 86.059  35.709  96.767  1.00 43.15 ? 213 TYR D C   1 
ATOM   8339  O O   . TYR D 1 215 ? 86.541  36.844  96.807  1.00 43.15 ? 213 TYR D O   1 
ATOM   8340  C CB  . TYR D 1 215 ? 88.026  34.123  96.763  1.00 38.51 ? 213 TYR D CB  1 
ATOM   8341  C CG  . TYR D 1 215 ? 88.949  33.354  97.695  1.00 38.51 ? 213 TYR D CG  1 
ATOM   8342  C CD1 . TYR D 1 215 ? 89.483  33.970  98.839  1.00 38.51 ? 213 TYR D CD1 1 
ATOM   8343  C CD2 . TYR D 1 215 ? 89.173  31.983  97.522  1.00 38.51 ? 213 TYR D CD2 1 
ATOM   8344  C CE1 . TYR D 1 215 ? 90.194  33.235  99.791  1.00 38.51 ? 213 TYR D CE1 1 
ATOM   8345  C CE2 . TYR D 1 215 ? 89.886  31.239  98.469  1.00 38.51 ? 213 TYR D CE2 1 
ATOM   8346  C CZ  . TYR D 1 215 ? 90.388  31.867  99.603  1.00 38.51 ? 213 TYR D CZ  1 
ATOM   8347  O OH  . TYR D 1 215 ? 91.049  31.127  100.570 1.00 38.51 ? 213 TYR D OH  1 
ATOM   8348  N N   . LYS D 1 216 ? 84.926  35.414  96.138  1.00 51.21 ? 214 LYS D N   1 
ATOM   8349  C CA  . LYS D 1 216 ? 84.173  36.449  95.452  1.00 51.21 ? 214 LYS D CA  1 
ATOM   8350  C C   . LYS D 1 216 ? 83.469  37.233  96.548  1.00 51.21 ? 214 LYS D C   1 
ATOM   8351  O O   . LYS D 1 216 ? 83.570  38.463  96.606  1.00 51.21 ? 214 LYS D O   1 
ATOM   8352  C CB  . LYS D 1 216 ? 83.132  35.842  94.512  1.00 12.05 ? 214 LYS D CB  1 
ATOM   8353  C CG  . LYS D 1 216 ? 82.576  36.799  93.427  1.00 12.05 ? 214 LYS D CG  1 
ATOM   8354  C CD  . LYS D 1 216 ? 82.113  38.134  93.995  1.00 12.05 ? 214 LYS D CD  1 
ATOM   8355  C CE  . LYS D 1 216 ? 81.515  39.035  92.927  1.00 12.05 ? 214 LYS D CE  1 
ATOM   8356  N NZ  . LYS D 1 216 ? 82.459  39.275  91.805  1.00 12.05 ? 214 LYS D NZ  1 
ATOM   8357  N N   . ALA D 1 217 ? 82.753  36.513  97.414  1.00 26.89 ? 215 ALA D N   1 
ATOM   8358  C CA  . ALA D 1 217 ? 82.040  37.136  98.525  1.00 26.89 ? 215 ALA D CA  1 
ATOM   8359  C C   . ALA D 1 217 ? 83.057  37.951  99.312  1.00 26.89 ? 215 ALA D C   1 
ATOM   8360  O O   . ALA D 1 217 ? 82.838  39.131  99.618  1.00 26.89 ? 215 ALA D O   1 
ATOM   8361  C CB  . ALA D 1 217 ? 81.419  36.070  99.412  1.00 78.79 ? 215 ALA D CB  1 
ATOM   8362  N N   . LEU D 1 218 ? 84.184  37.305  99.610  1.00 41.88 ? 216 LEU D N   1 
ATOM   8363  C CA  . LEU D 1 218 ? 85.289  37.924  100.345 1.00 41.88 ? 216 LEU D CA  1 
ATOM   8364  C C   . LEU D 1 218 ? 85.755  39.195  99.660  1.00 41.88 ? 216 LEU D C   1 
ATOM   8365  O O   . LEU D 1 218 ? 85.884  40.247  100.292 1.00 41.88 ? 216 LEU D O   1 
ATOM   8366  C CB  . LEU D 1 218 ? 86.452  36.942  100.452 1.00 31.11 ? 216 LEU D CB  1 
ATOM   8367  C CG  . LEU D 1 218 ? 86.339  35.974  101.631 1.00 31.11 ? 216 LEU D CG  1 
ATOM   8368  C CD1 . LEU D 1 218 ? 87.027  34.657  101.297 1.00 31.11 ? 216 LEU D CD1 1 
ATOM   8369  C CD2 . LEU D 1 218 ? 86.932  36.625  102.877 1.00 31.11 ? 216 LEU D CD2 1 
ATOM   8370  N N   . ASN D 1 219 ? 86.005  39.091  98.363  1.00 29.02 ? 217 ASN D N   1 
ATOM   8371  C CA  . ASN D 1 219 ? 86.438  40.245  97.603  1.00 29.02 ? 217 ASN D CA  1 
ATOM   8372  C C   . ASN D 1 219 ? 85.421  41.376  97.683  1.00 29.02 ? 217 ASN D C   1 
ATOM   8373  O O   . ASN D 1 219 ? 85.809  42.553  97.648  1.00 29.02 ? 217 ASN D O   1 
ATOM   8374  C CB  . ASN D 1 219 ? 86.664  39.889  96.136  1.00 28.92 ? 217 ASN D CB  1 
ATOM   8375  C CG  . ASN D 1 219 ? 87.122  41.078  95.326  1.00 28.92 ? 217 ASN D CG  1 
ATOM   8376  O OD1 . ASN D 1 219 ? 86.405  42.065  95.204  1.00 28.92 ? 217 ASN D OD1 1 
ATOM   8377  N ND2 . ASN D 1 219 ? 88.328  40.996  94.779  1.00 28.92 ? 217 ASN D ND2 1 
ATOM   8378  N N   . ASP D 1 220 ? 84.130  41.030  97.785  1.00 42.20 ? 218 ASP D N   1 
ATOM   8379  C CA  . ASP D 1 220 ? 83.068  42.038  97.863  1.00 42.20 ? 218 ASP D CA  1 
ATOM   8380  C C   . ASP D 1 220 ? 83.006  42.668  99.228  1.00 42.20 ? 218 ASP D C   1 
ATOM   8381  O O   . ASP D 1 220 ? 82.607  43.820  99.372  1.00 42.20 ? 218 ASP D O   1 
ATOM   8382  C CB  . ASP D 1 220 ? 81.706  41.439  97.567  1.00 72.23 ? 218 ASP D CB  1 
ATOM   8383  C CG  . ASP D 1 220 ? 81.657  40.773  96.239  1.00 72.23 ? 218 ASP D CG  1 
ATOM   8384  O OD1 . ASP D 1 220 ? 82.192  41.350  95.266  1.00 72.23 ? 218 ASP D OD1 1 
ATOM   8385  O OD2 . ASP D 1 220 ? 81.074  39.674  96.175  1.00 72.23 ? 218 ASP D OD2 1 
ATOM   8386  N N   . HIS D 1 221 ? 83.386  41.895  100.235 1.00 65.37 ? 219 HIS D N   1 
ATOM   8387  C CA  . HIS D 1 221 ? 83.379  42.388  101.598 1.00 65.37 ? 219 HIS D CA  1 
ATOM   8388  C C   . HIS D 1 221 ? 84.707  43.078  101.921 1.00 65.37 ? 219 HIS D C   1 
ATOM   8389  O O   . HIS D 1 221 ? 84.957  43.494  103.057 1.00 65.37 ? 219 HIS D O   1 
ATOM   8390  C CB  . HIS D 1 221 ? 83.078  41.229  102.556 1.00 78.10 ? 219 HIS D CB  1 
ATOM   8391  C CG  . HIS D 1 221 ? 81.622  40.878  102.625 1.00 78.10 ? 219 HIS D CG  1 
ATOM   8392  N ND1 . HIS D 1 221 ? 80.690  41.689  103.240 1.00 78.10 ? 219 HIS D ND1 1 
ATOM   8393  C CD2 . HIS D 1 221 ? 80.932  39.821  102.137 1.00 78.10 ? 219 HIS D CD2 1 
ATOM   8394  C CE1 . HIS D 1 221 ? 79.492  41.146  103.130 1.00 78.10 ? 219 HIS D CE1 1 
ATOM   8395  N NE2 . HIS D 1 221 ? 79.611  40.011  102.464 1.00 78.10 ? 219 HIS D NE2 1 
ATOM   8396  N N   . HIS D 1 222 ? 85.545  43.195  100.893 1.00 42.42 ? 220 HIS D N   1 
ATOM   8397  C CA  . HIS D 1 222 ? 86.837  43.855  100.999 1.00 42.42 ? 220 HIS D CA  1 
ATOM   8398  C C   . HIS D 1 222 ? 87.772  43.225  102.032 1.00 42.42 ? 220 HIS D C   1 
ATOM   8399  O O   . HIS D 1 222 ? 88.600  43.908  102.629 1.00 42.42 ? 220 HIS D O   1 
ATOM   8400  C CB  . HIS D 1 222 ? 86.615  45.339  101.307 1.00 62.34 ? 220 HIS D CB  1 
ATOM   8401  C CG  . HIS D 1 222 ? 87.744  46.226  100.878 1.00 62.34 ? 220 HIS D CG  1 
ATOM   8402  N ND1 . HIS D 1 222 ? 88.437  46.033  99.701  1.00 62.34 ? 220 HIS D ND1 1 
ATOM   8403  C CD2 . HIS D 1 222 ? 88.255  47.351  101.434 1.00 62.34 ? 220 HIS D CD2 1 
ATOM   8404  C CE1 . HIS D 1 222 ? 89.324  47.002  99.549  1.00 62.34 ? 220 HIS D CE1 1 
ATOM   8405  N NE2 . HIS D 1 222 ? 89.233  47.816  100.587 1.00 62.34 ? 220 HIS D NE2 1 
ATOM   8406  N N   . VAL D 1 223 ? 87.635  41.923  102.251 1.00 32.74 ? 221 VAL D N   1 
ATOM   8407  C CA  . VAL D 1 223 ? 88.511  41.237  103.187 1.00 32.74 ? 221 VAL D CA  1 
ATOM   8408  C C   . VAL D 1 223 ? 89.924  41.400  102.634 1.00 32.74 ? 221 VAL D C   1 
ATOM   8409  O O   . VAL D 1 223 ? 90.108  41.533  101.418 1.00 32.74 ? 221 VAL D O   1 
ATOM   8410  C CB  . VAL D 1 223 ? 88.153  39.729  103.288 1.00 27.16 ? 221 VAL D CB  1 
ATOM   8411  C CG1 . VAL D 1 223 ? 89.224  38.969  104.050 1.00 27.16 ? 221 VAL D CG1 1 
ATOM   8412  C CG2 . VAL D 1 223 ? 86.812  39.570  103.993 1.00 27.16 ? 221 VAL D CG2 1 
ATOM   8413  N N   . TYR D 1 224 ? 90.903  41.412  103.539 1.00 60.75 ? 222 TYR D N   1 
ATOM   8414  C CA  . TYR D 1 224 ? 92.335  41.547  103.228 1.00 60.75 ? 222 TYR D CA  1 
ATOM   8415  C C   . TYR D 1 224 ? 92.891  40.116  103.158 1.00 60.75 ? 222 TYR D C   1 
ATOM   8416  O O   . TYR D 1 224 ? 93.364  39.579  104.159 1.00 60.75 ? 222 TYR D O   1 
ATOM   8417  C CB  . TYR D 1 224 ? 93.001  42.327  104.373 1.00 35.99 ? 222 TYR D CB  1 
ATOM   8418  C CG  . TYR D 1 224 ? 94.471  42.634  104.218 1.00 35.99 ? 222 TYR D CG  1 
ATOM   8419  C CD1 . TYR D 1 224 ? 94.902  43.628  103.353 1.00 35.99 ? 222 TYR D CD1 1 
ATOM   8420  C CD2 . TYR D 1 224 ? 95.434  41.920  104.936 1.00 35.99 ? 222 TYR D CD2 1 
ATOM   8421  C CE1 . TYR D 1 224 ? 96.252  43.908  103.196 1.00 35.99 ? 222 TYR D CE1 1 
ATOM   8422  C CE2 . TYR D 1 224 ? 96.791  42.187  104.786 1.00 35.99 ? 222 TYR D CE2 1 
ATOM   8423  C CZ  . TYR D 1 224 ? 97.193  43.181  103.909 1.00 35.99 ? 222 TYR D CZ  1 
ATOM   8424  O OH  . TYR D 1 224 ? 98.535  43.430  103.695 1.00 35.99 ? 222 TYR D OH  1 
ATOM   8425  N N   . LEU D 1 225 ? 92.819  39.490  101.989 1.00 74.00 ? 223 LEU D N   1 
ATOM   8426  C CA  . LEU D 1 225 ? 93.288  38.113  101.862 1.00 74.00 ? 223 LEU D CA  1 
ATOM   8427  C C   . LEU D 1 225 ? 94.714  37.967  102.377 1.00 74.00 ? 223 LEU D C   1 
ATOM   8428  O O   . LEU D 1 225 ? 95.023  37.000  103.073 1.00 74.00 ? 223 LEU D O   1 
ATOM   8429  C CB  . LEU D 1 225 ? 93.227  37.630  100.404 1.00 30.05 ? 223 LEU D CB  1 
ATOM   8430  C CG  . LEU D 1 225 ? 92.124  38.080  99.429  1.00 30.05 ? 223 LEU D CG  1 
ATOM   8431  C CD1 . LEU D 1 225 ? 92.455  37.491  98.078  1.00 30.05 ? 223 LEU D CD1 1 
ATOM   8432  C CD2 . LEU D 1 225 ? 90.716  37.656  99.874  1.00 30.05 ? 223 LEU D CD2 1 
ATOM   8433  N N   . GLU D 1 226 ? 95.576  38.926  102.033 1.00 53.64 ? 224 GLU D N   1 
ATOM   8434  C CA  . GLU D 1 226 ? 96.981  38.903  102.457 1.00 53.64 ? 224 GLU D CA  1 
ATOM   8435  C C   . GLU D 1 226 ? 97.135  38.475  103.914 1.00 53.64 ? 224 GLU D C   1 
ATOM   8436  O O   . GLU D 1 226 ? 98.133  37.849  104.279 1.00 53.64 ? 224 GLU D O   1 
ATOM   8437  C CB  . GLU D 1 226 ? 97.630  40.282  102.277 1.00 44.14 ? 224 GLU D CB  1 
ATOM   8438  C CG  . GLU D 1 226 ? 98.119  40.632  100.858 1.00 44.14 ? 224 GLU D CG  1 
ATOM   8439  C CD  . GLU D 1 226 ? 96.997  40.858  99.873  1.00 44.14 ? 224 GLU D CD  1 
ATOM   8440  O OE1 . GLU D 1 226 ? 95.858  41.111  100.317 1.00 44.14 ? 224 GLU D OE1 1 
ATOM   8441  O OE2 . GLU D 1 226 ? 97.257  40.799  98.656  1.00 44.14 ? 224 GLU D OE2 1 
ATOM   8442  N N   . GLY D 1 227 ? 96.148  38.838  104.734 1.00 29.67 ? 225 GLY D N   1 
ATOM   8443  C CA  . GLY D 1 227 ? 96.148  38.482  106.146 1.00 17.70 ? 225 GLY D CA  1 
ATOM   8444  C C   . GLY D 1 227 ? 94.950  37.593  106.370 1.00 30.27 ? 225 GLY D C   1 
ATOM   8445  O O   . GLY D 1 227 ? 93.964  38.001  106.963 1.00 32.66 ? 225 GLY D O   1 
ATOM   8446  N N   . THR D 1 228 ? 95.062  36.357  105.900 1.00 32.66 ? 226 THR D N   1 
ATOM   8447  C CA  . THR D 1 228 ? 93.978  35.384  105.949 1.00 37.74 ? 226 THR D CA  1 
ATOM   8448  C C   . THR D 1 228 ? 94.581  34.018  105.728 1.00 41.75 ? 226 THR D C   1 
ATOM   8449  O O   . THR D 1 228 ? 95.754  33.911  105.428 1.00 38.84 ? 226 THR D O   1 
ATOM   8450  C CB  . THR D 1 228 ? 93.011  35.676  104.780 1.00 30.96 ? 226 THR D CB  1 
ATOM   8451  O OG1 . THR D 1 228 ? 92.092  36.700  105.178 1.00 45.04 ? 226 THR D OG1 1 
ATOM   8452  C CG2 . THR D 1 228 ? 92.288  34.424  104.306 1.00 26.05 ? 226 THR D CG2 1 
ATOM   8453  N N   . LEU D 1 229 ? 93.784  32.973  105.878 1.00 21.85 ? 227 LEU D N   1 
ATOM   8454  C CA  . LEU D 1 229 ? 94.251  31.625  105.610 1.00 20.97 ? 227 LEU D CA  1 
ATOM   8455  C C   . LEU D 1 229 ? 93.089  30.840  105.028 1.00 30.66 ? 227 LEU D C   1 
ATOM   8456  O O   . LEU D 1 229 ? 91.993  31.361  104.909 1.00 24.46 ? 227 LEU D O   1 
ATOM   8457  C CB  . LEU D 1 229 ? 94.775  30.962  106.876 1.00 22.16 ? 227 LEU D CB  1 
ATOM   8458  C CG  . LEU D 1 229 ? 96.213  31.333  107.271 1.00 33.32 ? 227 LEU D CG  1 
ATOM   8459  C CD1 . LEU D 1 229 ? 96.653  30.524  108.497 1.00 15.67 ? 227 LEU D CD1 1 
ATOM   8460  C CD2 . LEU D 1 229 ? 97.143  31.063  106.106 1.00 16.92 ? 227 LEU D CD2 1 
ATOM   8461  N N   . LEU D 1 230 ? 93.333  29.603  104.625 1.00 31.46 ? 228 LEU D N   1 
ATOM   8462  C CA  . LEU D 1 230 ? 92.274  28.769  104.059 1.00 27.55 ? 228 LEU D CA  1 
ATOM   8463  C C   . LEU D 1 230 ? 92.409  27.363  104.573 1.00 44.39 ? 228 LEU D C   1 
ATOM   8464  O O   . LEU D 1 230 ? 93.487  26.781  104.517 1.00 42.94 ? 228 LEU D O   1 
ATOM   8465  C CB  . LEU D 1 230 ? 92.328  28.738  102.519 1.00 32.51 ? 228 LEU D CB  1 
ATOM   8466  C CG  . LEU D 1 230 ? 91.403  27.730  101.810 1.00 43.82 ? 228 LEU D CG  1 
ATOM   8467  C CD1 . LEU D 1 230 ? 89.970  27.924  102.245 1.00 26.35 ? 228 LEU D CD1 1 
ATOM   8468  C CD2 . LEU D 1 230 ? 91.483  27.910  100.325 1.00 27.69 ? 228 LEU D CD2 1 
ATOM   8469  N N   . LYS D 1 231 ? 91.307  26.827  105.083 1.00 54.31 ? 229 LYS D N   1 
ATOM   8470  C CA  . LYS D 1 231 ? 91.279  25.467  105.603 1.00 51.11 ? 229 LYS D CA  1 
ATOM   8471  C C   . LYS D 1 231 ? 90.315  24.715  104.709 1.00 56.73 ? 229 LYS D C   1 
ATOM   8472  O O   . LYS D 1 231 ? 89.131  24.585  105.018 1.00 58.73 ? 229 LYS D O   1 
ATOM   8473  C CB  . LYS D 1 231 ? 90.783  25.452  107.056 1.00 53.34 ? 229 LYS D CB  1 
ATOM   8474  C CG  . LYS D 1 231 ? 90.962  24.124  107.794 1.00 43.79 ? 229 LYS D CG  1 
ATOM   8475  C CD  . LYS D 1 231 ? 90.652  24.301  109.272 1.00 52.76 ? 229 LYS D CD  1 
ATOM   8476  C CE  . LYS D 1 231 ? 91.036  23.072  110.083 1.00 48.88 ? 229 LYS D CE  1 
ATOM   8477  N NZ  . LYS D 1 231 ? 90.896  23.338  111.547 1.00 58.89 ? 229 LYS D NZ  1 
ATOM   8478  N N   . PRO D 1 232 ? 90.802  24.254  103.555 1.00 52.41 ? 230 PRO D N   1 
ATOM   8479  C CA  . PRO D 1 232 ? 89.916  23.525  102.662 1.00 52.20 ? 230 PRO D CA  1 
ATOM   8480  C C   . PRO D 1 232 ? 90.077  22.043  102.872 1.00 54.43 ? 230 PRO D C   1 
ATOM   8481  O O   . PRO D 1 232 ? 91.000  21.580  103.538 1.00 61.96 ? 230 PRO D O   1 
ATOM   8482  C CB  . PRO D 1 232 ? 90.396  23.953  101.292 1.00 47.23 ? 230 PRO D CB  1 
ATOM   8483  C CG  . PRO D 1 232 ? 91.864  23.977  101.481 1.00 59.87 ? 230 PRO D CG  1 
ATOM   8484  C CD  . PRO D 1 232 ? 92.029  24.655  102.843 1.00 60.08 ? 230 PRO D CD  1 
ATOM   8485  N N   . ASN D 1 233 ? 89.140  21.307  102.312 1.00 49.07 ? 231 ASN D N   1 
ATOM   8486  C CA  . ASN D 1 233 ? 89.150  19.866  102.380 1.00 50.44 ? 231 ASN D CA  1 
ATOM   8487  C C   . ASN D 1 233 ? 90.090  19.563  101.240 1.00 59.54 ? 231 ASN D C   1 
ATOM   8488  O O   . ASN D 1 233 ? 90.414  20.463  100.464 1.00 50.17 ? 231 ASN D O   1 
ATOM   8489  C CB  . ASN D 1 233 ? 87.745  19.362  102.066 1.00 82.74 ? 231 ASN D CB  1 
ATOM   8490  C CG  . ASN D 1 233 ? 87.079  20.168  100.943 1.00 82.74 ? 231 ASN D CG  1 
ATOM   8491  O OD1 . ASN D 1 233 ? 87.272  19.890  99.755  1.00 82.74 ? 231 ASN D OD1 1 
ATOM   8492  N ND2 . ASN D 1 233 ? 86.314  21.191  101.324 1.00 82.74 ? 231 ASN D ND2 1 
ATOM   8493  N N   . MET D 1 234 ? 90.572  18.334  101.144 1.00 63.33 ? 232 MET D N   1 
ATOM   8494  C CA  . MET D 1 234 ? 91.415  18.028  100.009 1.00 59.32 ? 232 MET D CA  1 
ATOM   8495  C C   . MET D 1 234 ? 90.370  17.701  98.957  1.00 61.93 ? 232 MET D C   1 
ATOM   8496  O O   . MET D 1 234 ? 89.204  18.049  99.125  1.00 67.22 ? 232 MET D O   1 
ATOM   8497  C CB  . MET D 1 234 ? 92.314  16.822  100.277 1.00 63.98 ? 232 MET D CB  1 
ATOM   8498  C CG  . MET D 1 234 ? 93.382  17.057  101.330 1.00 62.42 ? 232 MET D CG  1 
ATOM   8499  S SD  . MET D 1 234 ? 94.568  15.708  101.379 1.00 71.37 ? 232 MET D SD  1 
ATOM   8500  C CE  . MET D 1 234 ? 96.087  16.600  101.490 1.00 65.37 ? 232 MET D CE  1 
ATOM   8501  N N   . VAL D 1 235 ? 90.761  17.047  97.876  1.00 67.31 ? 233 VAL D N   1 
ATOM   8502  C CA  . VAL D 1 235 ? 89.797  16.697  96.845  1.00 61.09 ? 233 VAL D CA  1 
ATOM   8503  C C   . VAL D 1 235 ? 89.882  15.194  96.594  1.00 62.49 ? 233 VAL D C   1 
ATOM   8504  O O   . VAL D 1 235 ? 90.823  14.714  95.965  1.00 73.40 ? 233 VAL D O   1 
ATOM   8505  C CB  . VAL D 1 235 ? 90.080  17.484  95.553  1.00 32.58 ? 233 VAL D CB  1 
ATOM   8506  C CG1 . VAL D 1 235 ? 89.315  16.874  94.400  1.00 20.70 ? 233 VAL D CG1 1 
ATOM   8507  C CG2 . VAL D 1 235 ? 89.686  18.949  95.741  1.00 26.78 ? 233 VAL D CG2 1 
ATOM   8508  N N   . THR D 1 236 ? 88.900  14.453  97.103  1.00 63.69 ? 234 THR D N   1 
ATOM   8509  C CA  . THR D 1 236 ? 88.877  12.998  96.955  1.00 65.99 ? 234 THR D CA  1 
ATOM   8510  C C   . THR D 1 236 ? 87.468  12.437  96.730  1.00 74.35 ? 234 THR D C   1 
ATOM   8511  O O   . THR D 1 236 ? 86.463  13.106  96.978  1.00 74.35 ? 234 THR D O   1 
ATOM   8512  C CB  . THR D 1 236 ? 89.474  12.320  98.201  1.00 63.30 ? 234 THR D CB  1 
ATOM   8513  O OG1 . THR D 1 236 ? 88.632  12.578  99.329  1.00 59.30 ? 234 THR D OG1 1 
ATOM   8514  C CG2 . THR D 1 236 ? 90.854  12.877  98.503  1.00 50.12 ? 234 THR D CG2 1 
ATOM   8515  N N   . TYR D 1 245 ? 91.670  7.371   95.241  1.00 83.64 ? 243 TYR D N   1 
ATOM   8516  C CA  . TYR D 1 245 ? 92.560  7.418   94.083  1.00 83.64 ? 243 TYR D CA  1 
ATOM   8517  C C   . TYR D 1 245 ? 93.991  7.625   94.569  1.00 83.64 ? 243 TYR D C   1 
ATOM   8518  O O   . TYR D 1 245 ? 94.214  7.892   95.753  1.00 83.64 ? 243 TYR D O   1 
ATOM   8519  C CB  . TYR D 1 245 ? 92.184  8.576   93.148  1.00 86.12 ? 243 TYR D CB  1 
ATOM   8520  C CG  . TYR D 1 245 ? 90.705  8.707   92.849  1.00 86.12 ? 243 TYR D CG  1 
ATOM   8521  C CD1 . TYR D 1 245 ? 89.801  9.084   93.846  1.00 86.12 ? 243 TYR D CD1 1 
ATOM   8522  C CD2 . TYR D 1 245 ? 90.210  8.472   91.566  1.00 86.12 ? 243 TYR D CD2 1 
ATOM   8523  C CE1 . TYR D 1 245 ? 88.447  9.224   93.574  1.00 86.12 ? 243 TYR D CE1 1 
ATOM   8524  C CE2 . TYR D 1 245 ? 88.854  8.611   91.282  1.00 86.12 ? 243 TYR D CE2 1 
ATOM   8525  C CZ  . TYR D 1 245 ? 87.981  8.988   92.292  1.00 86.12 ? 243 TYR D CZ  1 
ATOM   8526  O OH  . TYR D 1 245 ? 86.646  9.148   92.017  1.00 86.12 ? 243 TYR D OH  1 
ATOM   8527  N N   . THR D 1 246 ? 94.956  7.511   93.656  1.00 90.03 ? 244 THR D N   1 
ATOM   8528  C CA  . THR D 1 246 ? 96.362  7.690   94.012  1.00 90.03 ? 244 THR D CA  1 
ATOM   8529  C C   . THR D 1 246 ? 96.583  9.125   94.471  1.00 90.03 ? 244 THR D C   1 
ATOM   8530  O O   . THR D 1 246 ? 95.854  10.039  94.069  1.00 90.03 ? 244 THR D O   1 
ATOM   8531  C CB  . THR D 1 246 ? 97.305  7.416   92.819  1.00 82.91 ? 244 THR D CB  1 
ATOM   8532  O OG1 . THR D 1 246 ? 97.379  8.580   91.987  1.00 82.91 ? 244 THR D OG1 1 
ATOM   8533  C CG2 . THR D 1 246 ? 96.796  6.242   91.993  1.00 71.86 ? 244 THR D CG2 1 
ATOM   8534  N N   . PRO D 1 247 ? 97.600  9.343   95.319  1.00 91.80 ? 245 PRO D N   1 
ATOM   8535  C CA  . PRO D 1 247 ? 97.939  10.668  95.855  1.00 91.80 ? 245 PRO D CA  1 
ATOM   8536  C C   . PRO D 1 247 ? 98.107  11.799  94.823  1.00 91.80 ? 245 PRO D C   1 
ATOM   8537  O O   . PRO D 1 247 ? 97.632  12.916  95.034  1.00 91.80 ? 245 PRO D O   1 
ATOM   8538  C CB  . PRO D 1 247 ? 99.222  10.392  96.646  1.00 75.29 ? 245 PRO D CB  1 
ATOM   8539  C CG  . PRO D 1 247 ? 99.006  8.983   97.148  1.00 74.90 ? 245 PRO D CG  1 
ATOM   8540  C CD  . PRO D 1 247 ? 98.470  8.301   95.903  1.00 77.45 ? 245 PRO D CD  1 
ATOM   8541  N N   . GLU D 1 248 ? 98.778  11.504  93.714  1.00 69.89 ? 246 GLU D N   1 
ATOM   8542  C CA  . GLU D 1 248 ? 99.026  12.490  92.662  1.00 69.89 ? 246 GLU D CA  1 
ATOM   8543  C C   . GLU D 1 248 ? 97.719  12.921  92.040  1.00 69.89 ? 246 GLU D C   1 
ATOM   8544  O O   . GLU D 1 248 ? 97.571  14.067  91.624  1.00 69.89 ? 246 GLU D O   1 
ATOM   8545  C CB  . GLU D 1 248 ? 99.919  11.897  91.574  1.00 92.42 ? 246 GLU D CB  1 
ATOM   8546  C CG  . GLU D 1 248 ? 101.131 11.171  92.108  1.00 92.42 ? 246 GLU D CG  1 
ATOM   8547  C CD  . GLU D 1 248 ? 100.756 10.130  93.147  1.00 92.42 ? 246 GLU D CD  1 
ATOM   8548  O OE1 . GLU D 1 248 ? 99.817  9.344   92.888  1.00 92.42 ? 246 GLU D OE1 1 
ATOM   8549  O OE2 . GLU D 1 248 ? 101.393 10.100  94.225  1.00 92.42 ? 246 GLU D OE2 1 
ATOM   8550  N N   . GLN D 1 249 ? 96.780  11.982  91.969  1.00 92.42 ? 247 GLN D N   1 
ATOM   8551  C CA  . GLN D 1 249 ? 95.461  12.237  91.406  1.00 92.42 ? 247 GLN D CA  1 
ATOM   8552  C C   . GLN D 1 249 ? 94.677  13.086  92.400  1.00 92.42 ? 247 GLN D C   1 
ATOM   8553  O O   . GLN D 1 249 ? 93.982  14.035  92.014  1.00 92.42 ? 247 GLN D O   1 
ATOM   8554  C CB  . GLN D 1 249 ? 94.736  10.916  91.151  1.00 92.42 ? 247 GLN D CB  1 
ATOM   8555  C CG  . GLN D 1 249 ? 95.513  9.959   90.245  1.00 92.42 ? 247 GLN D CG  1 
ATOM   8556  C CD  . GLN D 1 249 ? 94.809  8.619   90.036  1.00 92.42 ? 247 GLN D CD  1 
ATOM   8557  O OE1 . GLN D 1 249 ? 94.464  7.918   90.998  1.00 92.42 ? 247 GLN D OE1 1 
ATOM   8558  N NE2 . GLN D 1 249 ? 94.600  8.256   88.773  1.00 92.42 ? 247 GLN D NE2 1 
ATOM   8559  N N   . VAL D 1 250 ? 94.794  12.740  93.682  1.00 68.72 ? 248 VAL D N   1 
ATOM   8560  C CA  . VAL D 1 250 ? 94.119  13.496  94.737  1.00 68.72 ? 248 VAL D CA  1 
ATOM   8561  C C   . VAL D 1 250 ? 94.716  14.893  94.724  1.00 68.72 ? 248 VAL D C   1 
ATOM   8562  O O   . VAL D 1 250 ? 94.004  15.892  94.664  1.00 68.72 ? 248 VAL D O   1 
ATOM   8563  C CB  . VAL D 1 250 ? 94.365  12.885  96.124  1.00 75.01 ? 248 VAL D CB  1 
ATOM   8564  C CG1 . VAL D 1 250 ? 93.557  13.642  97.163  1.00 75.01 ? 248 VAL D CG1 1 
ATOM   8565  C CG2 . VAL D 1 250 ? 94.005  11.406  96.115  1.00 75.01 ? 248 VAL D CG2 1 
ATOM   8566  N N   . ALA D 1 251 ? 96.044  14.929  94.768  1.00 58.30 ? 249 ALA D N   1 
ATOM   8567  C CA  . ALA D 1 251 ? 96.801  16.168  94.743  1.00 58.30 ? 249 ALA D CA  1 
ATOM   8568  C C   . ALA D 1 251 ? 96.499  16.939  93.460  1.00 58.30 ? 249 ALA D C   1 
ATOM   8569  O O   . ALA D 1 251 ? 96.374  18.165  93.475  1.00 58.30 ? 249 ALA D O   1 
ATOM   8570  C CB  . ALA D 1 251 ? 98.291  15.861  94.830  1.00 68.02 ? 249 ALA D CB  1 
ATOM   8571  N N   . MET D 1 252 ? 96.375  16.211  92.354  1.00 69.77 ? 250 MET D N   1 
ATOM   8572  C CA  . MET D 1 252 ? 96.096  16.823  91.062  1.00 69.77 ? 250 MET D CA  1 
ATOM   8573  C C   . MET D 1 252 ? 94.771  17.577  91.043  1.00 69.77 ? 250 MET D C   1 
ATOM   8574  O O   . MET D 1 252 ? 94.745  18.783  90.802  1.00 69.77 ? 250 MET D O   1 
ATOM   8575  C CB  . MET D 1 252 ? 96.100  15.759  89.967  1.00 62.02 ? 250 MET D CB  1 
ATOM   8576  C CG  . MET D 1 252 ? 95.926  16.310  88.567  1.00 62.02 ? 250 MET D CG  1 
ATOM   8577  S SD  . MET D 1 252 ? 97.141  17.572  88.155  1.00 62.02 ? 250 MET D SD  1 
ATOM   8578  C CE  . MET D 1 252 ? 96.182  18.632  87.037  1.00 62.02 ? 250 MET D CE  1 
ATOM   8579  N N   . ALA D 1 253 ? 93.670  16.874  91.293  1.00 92.42 ? 251 ALA D N   1 
ATOM   8580  C CA  . ALA D 1 253 ? 92.358  17.519  91.300  1.00 92.42 ? 251 ALA D CA  1 
ATOM   8581  C C   . ALA D 1 253 ? 92.336  18.626  92.352  1.00 92.42 ? 251 ALA D C   1 
ATOM   8582  O O   . ALA D 1 253 ? 91.805  19.719  92.122  1.00 92.42 ? 251 ALA D O   1 
ATOM   8583  C CB  . ALA D 1 253 ? 91.272  16.495  91.599  1.00 90.87 ? 251 ALA D CB  1 
ATOM   8584  N N   . THR D 1 254 ? 92.930  18.325  93.503  1.00 62.58 ? 252 THR D N   1 
ATOM   8585  C CA  . THR D 1 254 ? 93.005  19.249  94.624  1.00 62.58 ? 252 THR D CA  1 
ATOM   8586  C C   . THR D 1 254 ? 93.673  20.579  94.276  1.00 62.58 ? 252 THR D C   1 
ATOM   8587  O O   . THR D 1 254 ? 93.083  21.645  94.464  1.00 62.58 ? 252 THR D O   1 
ATOM   8588  C CB  . THR D 1 254 ? 93.761  18.604  95.777  1.00 44.07 ? 252 THR D CB  1 
ATOM   8589  O OG1 . THR D 1 254 ? 93.136  17.356  96.116  1.00 44.07 ? 252 THR D OG1 1 
ATOM   8590  C CG2 . THR D 1 254 ? 93.758  19.523  96.983  1.00 44.07 ? 252 THR D CG2 1 
ATOM   8591  N N   . VAL D 1 255 ? 94.907  20.519  93.783  1.00 66.87 ? 253 VAL D N   1 
ATOM   8592  C CA  . VAL D 1 255 ? 95.629  21.732  93.406  1.00 66.87 ? 253 VAL D CA  1 
ATOM   8593  C C   . VAL D 1 255 ? 94.942  22.346  92.202  1.00 66.87 ? 253 VAL D C   1 
ATOM   8594  O O   . VAL D 1 255 ? 94.733  23.558  92.135  1.00 66.87 ? 253 VAL D O   1 
ATOM   8595  C CB  . VAL D 1 255 ? 97.100  21.426  93.041  1.00 28.43 ? 253 VAL D CB  1 
ATOM   8596  C CG1 . VAL D 1 255 ? 97.776  22.654  92.448  1.00 28.43 ? 253 VAL D CG1 1 
ATOM   8597  C CG2 . VAL D 1 255 ? 97.845  20.982  94.282  1.00 28.43 ? 253 VAL D CG2 1 
ATOM   8598  N N   . THR D 1 256 ? 94.593  21.492  91.251  1.00 84.53 ? 254 THR D N   1 
ATOM   8599  C CA  . THR D 1 256 ? 93.921  21.929  90.041  1.00 84.53 ? 254 THR D CA  1 
ATOM   8600  C C   . THR D 1 256 ? 92.856  22.975  90.371  1.00 84.53 ? 254 THR D C   1 
ATOM   8601  O O   . THR D 1 256 ? 92.963  24.143  89.983  1.00 84.53 ? 254 THR D O   1 
ATOM   8602  C CB  . THR D 1 256 ? 93.281  20.723  89.331  1.00 51.49 ? 254 THR D CB  1 
ATOM   8603  O OG1 . THR D 1 256 ? 94.297  19.995  88.631  1.00 51.49 ? 254 THR D OG1 1 
ATOM   8604  C CG2 . THR D 1 256 ? 92.222  21.171  88.352  1.00 51.49 ? 254 THR D CG2 1 
ATOM   8605  N N   . ALA D 1 257 ? 91.834  22.545  91.099  1.00 69.58 ? 255 ALA D N   1 
ATOM   8606  C CA  . ALA D 1 257 ? 90.747  23.424  91.503  1.00 69.58 ? 255 ALA D CA  1 
ATOM   8607  C C   . ALA D 1 257 ? 91.302  24.693  92.122  1.00 69.58 ? 255 ALA D C   1 
ATOM   8608  O O   . ALA D 1 257 ? 91.150  25.794  91.593  1.00 69.58 ? 255 ALA D O   1 
ATOM   8609  C CB  . ALA D 1 257 ? 89.908  22.719  92.507  1.00 11.00 ? 255 ALA D CB  1 
ATOM   8610  N N   . LEU D 1 258 ? 91.937  24.499  93.270  1.00 43.49 ? 256 LEU D N   1 
ATOM   8611  C CA  . LEU D 1 258 ? 92.558  25.560  94.042  1.00 43.49 ? 256 LEU D CA  1 
ATOM   8612  C C   . LEU D 1 258 ? 93.305  26.630  93.265  1.00 43.49 ? 256 LEU D C   1 
ATOM   8613  O O   . LEU D 1 258 ? 93.252  27.809  93.626  1.00 43.49 ? 256 LEU D O   1 
ATOM   8614  C CB  . LEU D 1 258 ? 93.515  24.947  95.060  1.00 15.84 ? 256 LEU D CB  1 
ATOM   8615  C CG  . LEU D 1 258 ? 92.828  24.535  96.360  1.00 15.84 ? 256 LEU D CG  1 
ATOM   8616  C CD1 . LEU D 1 258 ? 93.755  23.698  97.229  1.00 15.84 ? 256 LEU D CD1 1 
ATOM   8617  C CD2 . LEU D 1 258 ? 92.382  25.801  97.099  1.00 15.84 ? 256 LEU D CD2 1 
ATOM   8618  N N   . HIS D 1 259 ? 93.994  26.235  92.198  1.00 54.83 ? 257 HIS D N   1 
ATOM   8619  C CA  . HIS D 1 259 ? 94.777  27.212  91.465  1.00 54.83 ? 257 HIS D CA  1 
ATOM   8620  C C   . HIS D 1 259 ? 93.982  28.085  90.502  1.00 54.83 ? 257 HIS D C   1 
ATOM   8621  O O   . HIS D 1 259 ? 94.512  29.055  89.946  1.00 54.83 ? 257 HIS D O   1 
ATOM   8622  C CB  . HIS D 1 259 ? 95.994  26.520  90.799  1.00 54.43 ? 257 HIS D CB  1 
ATOM   8623  C CG  . HIS D 1 259 ? 95.829  26.207  89.346  1.00 54.43 ? 257 HIS D CG  1 
ATOM   8624  N ND1 . HIS D 1 259 ? 94.879  25.329  88.873  1.00 54.43 ? 257 HIS D ND1 1 
ATOM   8625  C CD2 . HIS D 1 259 ? 96.524  26.631  88.265  1.00 54.43 ? 257 HIS D CD2 1 
ATOM   8626  C CE1 . HIS D 1 259 ? 94.995  25.227  87.561  1.00 54.43 ? 257 HIS D CE1 1 
ATOM   8627  N NE2 . HIS D 1 259 ? 95.986  26.007  87.168  1.00 54.43 ? 257 HIS D NE2 1 
ATOM   8628  N N   . ARG D 1 260 ? 92.700  27.766  90.343  1.00 62.22 ? 258 ARG D N   1 
ATOM   8629  C CA  . ARG D 1 260 ? 91.817  28.548  89.479  1.00 62.22 ? 258 ARG D CA  1 
ATOM   8630  C C   . ARG D 1 260 ? 90.678  29.151  90.265  1.00 62.22 ? 258 ARG D C   1 
ATOM   8631  O O   . ARG D 1 260 ? 89.851  29.874  89.721  1.00 62.22 ? 258 ARG D O   1 
ATOM   8632  C CB  . ARG D 1 260 ? 91.244  27.694  88.360  1.00 37.01 ? 258 ARG D CB  1 
ATOM   8633  C CG  . ARG D 1 260 ? 90.914  26.240  88.699  1.00 37.01 ? 258 ARG D CG  1 
ATOM   8634  C CD  . ARG D 1 260 ? 90.643  25.571  87.368  1.00 37.01 ? 258 ARG D CD  1 
ATOM   8635  N NE  . ARG D 1 260 ? 90.459  24.131  87.413  1.00 37.01 ? 258 ARG D NE  1 
ATOM   8636  C CZ  . ARG D 1 260 ? 90.384  23.391  86.310  1.00 37.01 ? 258 ARG D CZ  1 
ATOM   8637  N NH1 . ARG D 1 260 ? 90.483  23.973  85.117  1.00 37.01 ? 258 ARG D NH1 1 
ATOM   8638  N NH2 . ARG D 1 260 ? 90.201  22.080  86.390  1.00 37.01 ? 258 ARG D NH2 1 
ATOM   8639  N N   . THR D 1 261 ? 90.651  28.832  91.555  1.00 29.32 ? 259 THR D N   1 
ATOM   8640  C CA  . THR D 1 261 ? 89.638  29.317  92.478  1.00 29.32 ? 259 THR D CA  1 
ATOM   8641  C C   . THR D 1 261 ? 90.294  30.315  93.417  1.00 29.32 ? 259 THR D C   1 
ATOM   8642  O O   . THR D 1 261 ? 89.892  31.474  93.497  1.00 29.32 ? 259 THR D O   1 
ATOM   8643  C CB  . THR D 1 261 ? 89.077  28.147  93.311  1.00 52.52 ? 259 THR D CB  1 
ATOM   8644  O OG1 . THR D 1 261 ? 90.162  27.423  93.901  1.00 52.52 ? 259 THR D OG1 1 
ATOM   8645  C CG2 . THR D 1 261 ? 88.297  27.185  92.435  1.00 52.52 ? 259 THR D CG2 1 
ATOM   8646  N N   . VAL D 1 262 ? 91.339  29.841  94.090  1.00 46.84 ? 260 VAL D N   1 
ATOM   8647  C CA  . VAL D 1 262 ? 92.103  30.602  95.079  1.00 46.84 ? 260 VAL D CA  1 
ATOM   8648  C C   . VAL D 1 262 ? 93.208  31.522  94.532  1.00 46.84 ? 260 VAL D C   1 
ATOM   8649  O O   . VAL D 1 262 ? 94.077  31.077  93.785  1.00 46.84 ? 260 VAL D O   1 
ATOM   8650  C CB  . VAL D 1 262 ? 92.743  29.632  96.096  1.00 32.94 ? 260 VAL D CB  1 
ATOM   8651  C CG1 . VAL D 1 262 ? 93.502  30.406  97.126  1.00 32.94 ? 260 VAL D CG1 1 
ATOM   8652  C CG2 . VAL D 1 262 ? 91.680  28.790  96.764  1.00 32.94 ? 260 VAL D CG2 1 
ATOM   8653  N N   . PRO D 1 263 ? 93.188  32.815  94.924  1.00 23.97 ? 261 PRO D N   1 
ATOM   8654  C CA  . PRO D 1 263 ? 94.111  33.907  94.564  1.00 23.97 ? 261 PRO D CA  1 
ATOM   8655  C C   . PRO D 1 263 ? 95.549  33.845  95.120  1.00 23.97 ? 261 PRO D C   1 
ATOM   8656  O O   . PRO D 1 263 ? 95.776  33.559  96.302  1.00 23.97 ? 261 PRO D O   1 
ATOM   8657  C CB  . PRO D 1 263 ? 93.374  35.156  95.053  1.00 29.73 ? 261 PRO D CB  1 
ATOM   8658  C CG  . PRO D 1 263 ? 91.964  34.764  94.963  1.00 29.73 ? 261 PRO D CG  1 
ATOM   8659  C CD  . PRO D 1 263 ? 91.981  33.378  95.545  1.00 29.73 ? 261 PRO D CD  1 
ATOM   8660  N N   . ALA D 1 264 ? 96.525  34.149  94.272  1.00 60.98 ? 262 ALA D N   1 
ATOM   8661  C CA  . ALA D 1 264 ? 97.920  34.105  94.697  1.00 60.98 ? 262 ALA D CA  1 
ATOM   8662  C C   . ALA D 1 264 ? 98.224  35.164  95.756  1.00 60.98 ? 262 ALA D C   1 
ATOM   8663  O O   . ALA D 1 264 ? 99.384  35.455  96.046  1.00 60.98 ? 262 ALA D O   1 
ATOM   8664  C CB  . ALA D 1 264 ? 98.834  34.288  93.491  1.00 7.54  ? 262 ALA D CB  1 
ATOM   8665  N N   . ALA D 1 265 ? 97.177  35.734  96.338  1.00 28.67 ? 263 ALA D N   1 
ATOM   8666  C CA  . ALA D 1 265 ? 97.346  36.764  97.346  1.00 28.67 ? 263 ALA D CA  1 
ATOM   8667  C C   . ALA D 1 265 ? 97.018  36.225  98.722  1.00 28.67 ? 263 ALA D C   1 
ATOM   8668  O O   . ALA D 1 265 ? 97.040  36.954  99.718  1.00 28.67 ? 263 ALA D O   1 
ATOM   8669  C CB  . ALA D 1 265 ? 96.464  37.931  97.026  1.00 8.44  ? 263 ALA D CB  1 
ATOM   8670  N N   . VAL D 1 266 ? 96.699  34.938  98.771  1.00 33.42 ? 264 VAL D N   1 
ATOM   8671  C CA  . VAL D 1 266 ? 96.393  34.295  100.033 1.00 33.42 ? 264 VAL D CA  1 
ATOM   8672  C C   . VAL D 1 266 ? 97.669  33.598  100.464 1.00 33.42 ? 264 VAL D C   1 
ATOM   8673  O O   . VAL D 1 266 ? 98.105  32.656  99.820  1.00 33.42 ? 264 VAL D O   1 
ATOM   8674  C CB  . VAL D 1 266 ? 95.246  33.303  99.868  1.00 11.58 ? 264 VAL D CB  1 
ATOM   8675  C CG1 . VAL D 1 266 ? 95.420  32.141  100.811 1.00 11.58 ? 264 VAL D CG1 1 
ATOM   8676  C CG2 . VAL D 1 266 ? 93.926  34.022  100.141 1.00 11.58 ? 264 VAL D CG2 1 
ATOM   8677  N N   . PRO D 1 267 ? 98.288  34.069  101.559 1.00 41.00 ? 265 PRO D N   1 
ATOM   8678  C CA  . PRO D 1 267 ? 99.529  33.540  102.121 1.00 41.00 ? 265 PRO D CA  1 
ATOM   8679  C C   . PRO D 1 267 ? 99.586  32.046  102.376 1.00 41.00 ? 265 PRO D C   1 
ATOM   8680  O O   . PRO D 1 267 ? 100.651 31.439  102.292 1.00 41.00 ? 265 PRO D O   1 
ATOM   8681  C CB  . PRO D 1 267 ? 99.691  34.348  103.400 1.00 26.43 ? 265 PRO D CB  1 
ATOM   8682  C CG  . PRO D 1 267 ? 98.307  34.588  103.811 1.00 26.43 ? 265 PRO D CG  1 
ATOM   8683  C CD  . PRO D 1 267 ? 97.681  35.015  102.510 1.00 26.43 ? 265 PRO D CD  1 
ATOM   8684  N N   . GLY D 1 268 ? 98.455  31.440  102.685 1.00 46.33 ? 266 GLY D N   1 
ATOM   8685  C CA  . GLY D 1 268 ? 98.510  30.021  102.942 1.00 46.33 ? 266 GLY D CA  1 
ATOM   8686  C C   . GLY D 1 268 ? 97.211  29.263  102.837 1.00 46.33 ? 266 GLY D C   1 
ATOM   8687  O O   . GLY D 1 268 ? 96.127  29.822  102.973 1.00 46.33 ? 266 GLY D O   1 
ATOM   8688  N N   . ILE D 1 269 ? 97.346  27.966  102.601 1.00 24.88 ? 267 ILE D N   1 
ATOM   8689  C CA  . ILE D 1 269 ? 96.225  27.061  102.467 1.00 24.88 ? 267 ILE D CA  1 
ATOM   8690  C C   . ILE D 1 269 ? 96.574  25.842  103.302 1.00 24.88 ? 267 ILE D C   1 
ATOM   8691  O O   . ILE D 1 269 ? 97.488  25.098  102.965 1.00 24.88 ? 267 ILE D O   1 
ATOM   8692  C CB  . ILE D 1 269 ? 96.041  26.635  100.987 1.00 49.54 ? 267 ILE D CB  1 
ATOM   8693  C CG1 . ILE D 1 269 ? 95.479  27.808  100.181 1.00 49.54 ? 267 ILE D CG1 1 
ATOM   8694  C CG2 . ILE D 1 269 ? 95.139  25.405  100.885 1.00 49.54 ? 267 ILE D CG2 1 
ATOM   8695  C CD1 . ILE D 1 269 ? 95.507  27.583  98.686  1.00 49.54 ? 267 ILE D CD1 1 
ATOM   8696  N N   . CYS D 1 270 ? 95.860  25.640  104.399 1.00 26.89 ? 268 CYS D N   1 
ATOM   8697  C CA  . CYS D 1 270 ? 96.128  24.489  105.238 1.00 26.89 ? 268 CYS D CA  1 
ATOM   8698  C C   . CYS D 1 270 ? 94.993  23.488  105.152 1.00 26.89 ? 268 CYS D C   1 
ATOM   8699  O O   . CYS D 1 270 ? 93.866  23.780  105.536 1.00 26.89 ? 268 CYS D O   1 
ATOM   8700  C CB  . CYS D 1 270 ? 96.345  24.941  106.674 1.00 73.79 ? 268 CYS D CB  1 
ATOM   8701  S SG  . CYS D 1 270 ? 97.669  26.152  106.806 1.00 73.79 ? 268 CYS D SG  1 
ATOM   8702  N N   . PHE D 1 271 ? 95.301  22.310  104.619 1.00 59.80 ? 269 PHE D N   1 
ATOM   8703  C CA  . PHE D 1 271 ? 94.315  21.247  104.474 1.00 59.80 ? 269 PHE D CA  1 
ATOM   8704  C C   . PHE D 1 271 ? 94.026  20.615  105.818 1.00 59.80 ? 269 PHE D C   1 
ATOM   8705  O O   . PHE D 1 271 ? 94.700  20.919  106.800 1.00 59.80 ? 269 PHE D O   1 
ATOM   8706  C CB  . PHE D 1 271 ? 94.820  20.171  103.515 1.00 40.57 ? 269 PHE D CB  1 
ATOM   8707  C CG  . PHE D 1 271 ? 94.947  20.635  102.101 1.00 40.57 ? 269 PHE D CG  1 
ATOM   8708  C CD1 . PHE D 1 271 ? 96.176  21.038  101.595 1.00 40.57 ? 269 PHE D CD1 1 
ATOM   8709  C CD2 . PHE D 1 271 ? 93.831  20.687  101.278 1.00 40.57 ? 269 PHE D CD2 1 
ATOM   8710  C CE1 . PHE D 1 271 ? 96.294  21.486  100.281 1.00 40.57 ? 269 PHE D CE1 1 
ATOM   8711  C CE2 . PHE D 1 271 ? 93.932  21.131  99.972  1.00 40.57 ? 269 PHE D CE2 1 
ATOM   8712  C CZ  . PHE D 1 271 ? 95.169  21.534  99.468  1.00 40.57 ? 269 PHE D CZ  1 
ATOM   8713  N N   . LEU D 1 272 ? 93.026  19.738  105.863 1.00 48.00 ? 270 LEU D N   1 
ATOM   8714  C CA  . LEU D 1 272 ? 92.661  19.063  107.106 1.00 48.00 ? 270 LEU D CA  1 
ATOM   8715  C C   . LEU D 1 272 ? 92.536  17.552  106.890 1.00 48.00 ? 270 LEU D C   1 
ATOM   8716  O O   . LEU D 1 272 ? 91.897  17.108  105.946 1.00 48.00 ? 270 LEU D O   1 
ATOM   8717  C CB  . LEU D 1 272 ? 91.356  19.657  107.645 1.00 56.62 ? 270 LEU D CB  1 
ATOM   8718  C CG  . LEU D 1 272 ? 90.110  19.526  106.775 1.00 56.62 ? 270 LEU D CG  1 
ATOM   8719  C CD1 . LEU D 1 272 ? 89.377  18.239  107.147 1.00 56.62 ? 270 LEU D CD1 1 
ATOM   8720  C CD2 . LEU D 1 272 ? 89.212  20.723  106.993 1.00 56.62 ? 270 LEU D CD2 1 
ATOM   8721  N N   . SER D 1 273 ? 93.158  16.768  107.766 1.00 85.90 ? 271 SER D N   1 
ATOM   8722  C CA  . SER D 1 273 ? 93.139  15.309  107.647 1.00 85.90 ? 271 SER D CA  1 
ATOM   8723  C C   . SER D 1 273 ? 91.752  14.770  107.335 1.00 85.90 ? 271 SER D C   1 
ATOM   8724  O O   . SER D 1 273 ? 91.606  13.870  106.508 1.00 85.90 ? 271 SER D O   1 
ATOM   8725  C CB  . SER D 1 273 ? 93.652  14.650  108.935 1.00 92.42 ? 271 SER D CB  1 
ATOM   8726  O OG  . SER D 1 273 ? 92.587  14.319  109.814 1.00 92.42 ? 271 SER D OG  1 
ATOM   8727  N N   . GLY D 1 274 ? 90.744  15.321  108.011 1.00 81.87 ? 272 GLY D N   1 
ATOM   8728  C CA  . GLY D 1 274 ? 89.371  14.896  107.807 1.00 81.87 ? 272 GLY D CA  1 
ATOM   8729  C C   . GLY D 1 274 ? 89.188  13.398  107.643 1.00 81.87 ? 272 GLY D C   1 
ATOM   8730  O O   . GLY D 1 274 ? 88.893  12.919  106.547 1.00 81.87 ? 272 GLY D O   1 
ATOM   8731  N N   . GLY D 1 275 ? 89.370  12.655  108.730 1.00 78.59 ? 273 GLY D N   1 
ATOM   8732  C CA  . GLY D 1 275 ? 89.202  11.212  108.676 1.00 78.59 ? 273 GLY D CA  1 
ATOM   8733  C C   . GLY D 1 275 ? 90.215  10.458  107.829 1.00 78.59 ? 273 GLY D C   1 
ATOM   8734  O O   . GLY D 1 275 ? 89.885  9.460   107.188 1.00 78.59 ? 273 GLY D O   1 
ATOM   8735  N N   . MET D 1 276 ? 91.452  10.936  107.819 1.00 74.58 ? 274 MET D N   1 
ATOM   8736  C CA  . MET D 1 276 ? 92.508  10.287  107.060 1.00 74.58 ? 274 MET D CA  1 
ATOM   8737  C C   . MET D 1 276 ? 93.485  9.641   108.017 1.00 74.58 ? 274 MET D C   1 
ATOM   8738  O O   . MET D 1 276 ? 93.772  10.192  109.079 1.00 74.58 ? 274 MET D O   1 
ATOM   8739  C CB  . MET D 1 276 ? 93.275  11.299  106.206 1.00 80.42 ? 274 MET D CB  1 
ATOM   8740  C CG  . MET D 1 276 ? 92.628  11.640  104.890 1.00 80.42 ? 274 MET D CG  1 
ATOM   8741  S SD  . MET D 1 276 ? 93.755  12.535  103.806 1.00 80.42 ? 274 MET D SD  1 
ATOM   8742  C CE  . MET D 1 276 ? 93.216  14.221  104.065 1.00 80.42 ? 274 MET D CE  1 
ATOM   8743  N N   . SER D 1 277 ? 93.985  8.465   107.654 1.00 78.67 ? 275 SER D N   1 
ATOM   8744  C CA  . SER D 1 277 ? 94.974  7.796   108.485 1.00 78.67 ? 275 SER D CA  1 
ATOM   8745  C C   . SER D 1 277 ? 96.133  8.782   108.496 1.00 78.67 ? 275 SER D C   1 
ATOM   8746  O O   . SER D 1 277 ? 96.475  9.337   107.449 1.00 78.67 ? 275 SER D O   1 
ATOM   8747  C CB  . SER D 1 277 ? 95.397  6.488   107.833 1.00 75.67 ? 275 SER D CB  1 
ATOM   8748  O OG  . SER D 1 277 ? 95.587  6.679   106.444 1.00 75.67 ? 275 SER D OG  1 
ATOM   8749  N N   . GLU D 1 278 ? 96.723  9.022   109.662 1.00 92.42 ? 276 GLU D N   1 
ATOM   8750  C CA  . GLU D 1 278 ? 97.821  9.979   109.742 1.00 92.42 ? 276 GLU D CA  1 
ATOM   8751  C C   . GLU D 1 278 ? 98.740  9.859   108.526 1.00 92.42 ? 276 GLU D C   1 
ATOM   8752  O O   . GLU D 1 278 ? 99.207  10.873  108.000 1.00 92.42 ? 276 GLU D O   1 
ATOM   8753  C CB  . GLU D 1 278 ? 98.639  9.786   111.028 1.00 67.40 ? 276 GLU D CB  1 
ATOM   8754  C CG  . GLU D 1 278 ? 97.862  9.974   112.327 1.00 67.40 ? 276 GLU D CG  1 
ATOM   8755  C CD  . GLU D 1 278 ? 98.758  9.918   113.563 1.00 67.40 ? 276 GLU D CD  1 
ATOM   8756  O OE1 . GLU D 1 278 ? 99.563  8.969   113.679 1.00 67.40 ? 276 GLU D OE1 1 
ATOM   8757  O OE2 . GLU D 1 278 ? 98.653  10.819  114.424 1.00 67.40 ? 276 GLU D OE2 1 
ATOM   8758  N N   . GLU D 1 279 ? 98.976  8.627   108.068 1.00 82.45 ? 277 GLU D N   1 
ATOM   8759  C CA  . GLU D 1 279 ? 99.856  8.382   106.922 1.00 82.45 ? 277 GLU D CA  1 
ATOM   8760  C C   . GLU D 1 279 ? 99.358  8.956   105.592 1.00 82.45 ? 277 GLU D C   1 
ATOM   8761  O O   . GLU D 1 279 ? 100.117 9.626   104.884 1.00 82.45 ? 277 GLU D O   1 
ATOM   8762  C CB  . GLU D 1 279 ? 100.119 6.883   106.759 1.00 74.47 ? 277 GLU D CB  1 
ATOM   8763  C CG  . GLU D 1 279 ? 101.055 6.556   105.603 1.00 74.47 ? 277 GLU D CG  1 
ATOM   8764  C CD  . GLU D 1 279 ? 102.451 7.145   105.784 1.00 74.47 ? 277 GLU D CD  1 
ATOM   8765  O OE1 . GLU D 1 279 ? 102.559 8.317   106.220 1.00 74.47 ? 277 GLU D OE1 1 
ATOM   8766  O OE2 . GLU D 1 279 ? 103.441 6.437   105.476 1.00 74.47 ? 277 GLU D OE2 1 
ATOM   8767  N N   . ASP D 1 280 ? 98.098  8.684   105.248 1.00 92.42 ? 278 ASP D N   1 
ATOM   8768  C CA  . ASP D 1 280 ? 97.513  9.193   104.003 1.00 92.42 ? 278 ASP D CA  1 
ATOM   8769  C C   . ASP D 1 280 ? 97.510  10.719  104.035 1.00 92.42 ? 278 ASP D C   1 
ATOM   8770  O O   . ASP D 1 280 ? 97.638  11.370  102.997 1.00 92.42 ? 278 ASP D O   1 
ATOM   8771  C CB  . ASP D 1 280 ? 96.064  8.701   103.816 1.00 82.22 ? 278 ASP D CB  1 
ATOM   8772  C CG  . ASP D 1 280 ? 95.973  7.219   103.470 1.00 82.22 ? 278 ASP D CG  1 
ATOM   8773  O OD1 . ASP D 1 280 ? 96.685  6.763   102.549 1.00 82.22 ? 278 ASP D OD1 1 
ATOM   8774  O OD2 . ASP D 1 280 ? 95.167  6.514   104.112 1.00 82.22 ? 278 ASP D OD2 1 
ATOM   8775  N N   . ALA D 1 281 ? 97.355  11.277  105.234 1.00 72.79 ? 279 ALA D N   1 
ATOM   8776  C CA  . ALA D 1 281 ? 97.335  12.722  105.419 1.00 72.79 ? 279 ALA D CA  1 
ATOM   8777  C C   . ALA D 1 281 ? 98.662  13.340  104.999 1.00 72.79 ? 279 ALA D C   1 
ATOM   8778  O O   . ALA D 1 281 ? 98.701  14.396  104.361 1.00 72.79 ? 279 ALA D O   1 
ATOM   8779  C CB  . ALA D 1 281 ? 97.055  13.043  106.859 1.00 7.77  ? 279 ALA D CB  1 
ATOM   8780  N N   . THR D 1 282 ? 99.752  12.679  105.368 1.00 58.48 ? 280 THR D N   1 
ATOM   8781  C CA  . THR D 1 282 ? 101.083 13.152  105.021 1.00 58.48 ? 280 THR D CA  1 
ATOM   8782  C C   . THR D 1 282 ? 101.310 13.034  103.523 1.00 58.48 ? 280 THR D C   1 
ATOM   8783  O O   . THR D 1 282 ? 101.522 14.028  102.830 1.00 58.48 ? 280 THR D O   1 
ATOM   8784  C CB  . THR D 1 282 ? 102.168 12.326  105.718 1.00 48.58 ? 280 THR D CB  1 
ATOM   8785  O OG1 . THR D 1 282 ? 102.012 12.431  107.137 1.00 48.58 ? 280 THR D OG1 1 
ATOM   8786  C CG2 . THR D 1 282 ? 103.547 12.831  105.319 1.00 48.58 ? 280 THR D CG2 1 
ATOM   8787  N N   . LEU D 1 283 ? 101.272 11.798  103.039 1.00 54.19 ? 281 LEU D N   1 
ATOM   8788  C CA  . LEU D 1 283 ? 101.472 11.498  101.628 1.00 54.19 ? 281 LEU D CA  1 
ATOM   8789  C C   . LEU D 1 283 ? 100.641 12.421  100.743 1.00 54.19 ? 281 LEU D C   1 
ATOM   8790  O O   . LEU D 1 283 ? 101.164 13.025  99.808  1.00 54.19 ? 281 LEU D O   1 
ATOM   8791  C CB  . LEU D 1 283 ? 101.103 10.040  101.375 1.00 68.77 ? 281 LEU D CB  1 
ATOM   8792  C CG  . LEU D 1 283 ? 101.796 9.070   102.337 1.00 68.77 ? 281 LEU D CG  1 
ATOM   8793  C CD1 . LEU D 1 283 ? 101.011 7.777   102.424 1.00 68.77 ? 281 LEU D CD1 1 
ATOM   8794  C CD2 . LEU D 1 283 ? 103.221 8.826   101.885 1.00 68.77 ? 281 LEU D CD2 1 
ATOM   8795  N N   . ASN D 1 284 ? 99.347  12.522  101.042 1.00 65.56 ? 282 ASN D N   1 
ATOM   8796  C CA  . ASN D 1 284 ? 98.454  13.392  100.282 1.00 65.56 ? 282 ASN D CA  1 
ATOM   8797  C C   . ASN D 1 284 ? 98.977  14.831  100.329 1.00 65.56 ? 282 ASN D C   1 
ATOM   8798  O O   . ASN D 1 284 ? 98.935  15.556  99.333  1.00 65.56 ? 282 ASN D O   1 
ATOM   8799  C CB  . ASN D 1 284 ? 97.024  13.332  100.844 1.00 70.45 ? 282 ASN D CB  1 
ATOM   8800  C CG  . ASN D 1 284 ? 96.237  12.143  100.319 1.00 70.45 ? 282 ASN D CG  1 
ATOM   8801  O OD1 . ASN D 1 284 ? 96.770  11.304  99.594  1.00 70.45 ? 282 ASN D OD1 1 
ATOM   8802  N ND2 . ASN D 1 284 ? 94.960  12.068  100.684 1.00 70.45 ? 282 ASN D ND2 1 
ATOM   8803  N N   . LEU D 1 285 ? 99.474  15.249  101.487 1.00 53.03 ? 283 LEU D N   1 
ATOM   8804  C CA  . LEU D 1 285 ? 100.010 16.596  101.591 1.00 53.03 ? 283 LEU D CA  1 
ATOM   8805  C C   . LEU D 1 285 ? 101.292 16.663  100.778 1.00 53.03 ? 283 LEU D C   1 
ATOM   8806  O O   . LEU D 1 285 ? 101.403 17.474  99.866  1.00 53.03 ? 283 LEU D O   1 
ATOM   8807  C CB  . LEU D 1 285 ? 100.280 16.970  103.054 1.00 28.94 ? 283 LEU D CB  1 
ATOM   8808  C CG  . LEU D 1 285 ? 100.977 18.315  103.312 1.00 28.94 ? 283 LEU D CG  1 
ATOM   8809  C CD1 . LEU D 1 285 ? 100.654 19.334  102.238 1.00 28.94 ? 283 LEU D CD1 1 
ATOM   8810  C CD2 . LEU D 1 285 ? 100.544 18.830  104.664 1.00 28.94 ? 283 LEU D CD2 1 
ATOM   8811  N N   . ASN D 1 286 ? 102.249 15.796  101.097 1.00 79.32 ? 284 ASN D N   1 
ATOM   8812  C CA  . ASN D 1 286 ? 103.521 15.778  100.385 1.00 79.32 ? 284 ASN D CA  1 
ATOM   8813  C C   . ASN D 1 286 ? 103.269 15.813  98.884  1.00 79.32 ? 284 ASN D C   1 
ATOM   8814  O O   . ASN D 1 286 ? 103.867 16.610  98.155  1.00 79.32 ? 284 ASN D O   1 
ATOM   8815  C CB  . ASN D 1 286 ? 104.323 14.527  100.736 1.00 83.86 ? 284 ASN D CB  1 
ATOM   8816  C CG  . ASN D 1 286 ? 105.752 14.601  100.233 1.00 83.86 ? 284 ASN D CG  1 
ATOM   8817  O OD1 . ASN D 1 286 ? 106.528 15.449  100.671 1.00 83.86 ? 284 ASN D OD1 1 
ATOM   8818  N ND2 . ASN D 1 286 ? 106.104 13.723  99.301  1.00 83.86 ? 284 ASN D ND2 1 
ATOM   8819  N N   . ALA D 1 287 ? 102.381 14.940  98.424  1.00 66.88 ? 285 ALA D N   1 
ATOM   8820  C CA  . ALA D 1 287 ? 102.042 14.897  97.013  1.00 66.88 ? 285 ALA D CA  1 
ATOM   8821  C C   . ALA D 1 287 ? 101.696 16.313  96.569  1.00 66.88 ? 285 ALA D C   1 
ATOM   8822  O O   . ALA D 1 287 ? 102.439 16.920  95.816  1.00 66.88 ? 285 ALA D O   1 
ATOM   8823  C CB  . ALA D 1 287 ? 100.859 13.968  96.783  1.00 33.01 ? 285 ALA D CB  1 
ATOM   8824  N N   . ILE D 1 288 ? 100.580 16.838  97.065  1.00 36.35 ? 286 ILE D N   1 
ATOM   8825  C CA  . ILE D 1 288 ? 100.123 18.181  96.718  1.00 36.35 ? 286 ILE D CA  1 
ATOM   8826  C C   . ILE D 1 288 ? 101.233 19.218  96.520  1.00 36.35 ? 286 ILE D C   1 
ATOM   8827  O O   . ILE D 1 288 ? 101.097 20.105  95.679  1.00 36.35 ? 286 ILE D O   1 
ATOM   8828  C CB  . ILE D 1 288 ? 99.127  18.727  97.784  1.00 34.42 ? 286 ILE D CB  1 
ATOM   8829  C CG1 . ILE D 1 288 ? 97.901  17.823  97.864  1.00 34.42 ? 286 ILE D CG1 1 
ATOM   8830  C CG2 . ILE D 1 288 ? 98.669  20.135  97.426  1.00 34.42 ? 286 ILE D CG2 1 
ATOM   8831  C CD1 . ILE D 1 288 ? 96.946  18.192  98.964  1.00 34.42 ? 286 ILE D CD1 1 
ATOM   8832  N N   . ASN D 1 289 ? 102.326 19.124  97.276  1.00 67.33 ? 287 ASN D N   1 
ATOM   8833  C CA  . ASN D 1 289 ? 103.410 20.100  97.128  1.00 67.33 ? 287 ASN D CA  1 
ATOM   8834  C C   . ASN D 1 289 ? 104.339 19.783  95.965  1.00 67.33 ? 287 ASN D C   1 
ATOM   8835  O O   . ASN D 1 289 ? 105.205 20.585  95.614  1.00 67.33 ? 287 ASN D O   1 
ATOM   8836  C CB  . ASN D 1 289 ? 104.215 20.216  98.424  1.00 41.78 ? 287 ASN D CB  1 
ATOM   8837  C CG  . ASN D 1 289 ? 103.602 21.210  99.408  1.00 41.78 ? 287 ASN D CG  1 
ATOM   8838  O OD1 . ASN D 1 289 ? 103.490 20.935  100.603 1.00 41.78 ? 287 ASN D OD1 1 
ATOM   8839  N ND2 . ASN D 1 289 ? 103.215 22.377  98.907  1.00 41.78 ? 287 ASN D ND2 1 
ATOM   8840  N N   . LEU D 1 290 ? 104.152 18.607  95.376  1.00 81.96 ? 288 LEU D N   1 
ATOM   8841  C CA  . LEU D 1 290 ? 104.936 18.173  94.224  1.00 81.96 ? 288 LEU D CA  1 
ATOM   8842  C C   . LEU D 1 290 ? 104.101 18.273  92.939  1.00 81.96 ? 288 LEU D C   1 
ATOM   8843  O O   . LEU D 1 290 ? 104.646 18.414  91.845  1.00 81.96 ? 288 LEU D O   1 
ATOM   8844  C CB  . LEU D 1 290 ? 105.411 16.728  94.405  1.00 52.12 ? 288 LEU D CB  1 
ATOM   8845  C CG  . LEU D 1 290 ? 106.567 16.441  95.363  1.00 52.12 ? 288 LEU D CG  1 
ATOM   8846  C CD1 . LEU D 1 290 ? 106.891 14.951  95.335  1.00 52.12 ? 288 LEU D CD1 1 
ATOM   8847  C CD2 . LEU D 1 290 ? 107.792 17.238  94.956  1.00 52.12 ? 288 LEU D CD2 1 
ATOM   8848  N N   . CYS D 1 291 ? 102.781 18.204  93.086  1.00 44.94 ? 289 CYS D N   1 
ATOM   8849  C CA  . CYS D 1 291 ? 101.848 18.269  91.962  1.00 44.94 ? 289 CYS D CA  1 
ATOM   8850  C C   . CYS D 1 291 ? 102.256 19.327  90.954  1.00 44.94 ? 289 CYS D C   1 
ATOM   8851  O O   . CYS D 1 291 ? 102.187 20.520  91.222  1.00 44.94 ? 289 CYS D O   1 
ATOM   8852  C CB  . CYS D 1 291 ? 100.438 18.560  92.467  1.00 63.96 ? 289 CYS D CB  1 
ATOM   8853  S SG  . CYS D 1 291 ? 99.191  18.510  91.187  1.00 63.96 ? 289 CYS D SG  1 
ATOM   8854  N N   . PRO D 1 292 ? 102.674 18.891  89.767  1.00 41.98 ? 290 PRO D N   1 
ATOM   8855  C CA  . PRO D 1 292 ? 103.122 19.729  88.652  1.00 41.98 ? 290 PRO D CA  1 
ATOM   8856  C C   . PRO D 1 292 ? 102.120 20.752  88.148  1.00 41.98 ? 290 PRO D C   1 
ATOM   8857  O O   . PRO D 1 292 ? 101.621 20.619  87.036  1.00 41.98 ? 290 PRO D O   1 
ATOM   8858  C CB  . PRO D 1 292 ? 103.473 18.704  87.575  1.00 39.37 ? 290 PRO D CB  1 
ATOM   8859  C CG  . PRO D 1 292 ? 102.551 17.565  87.878  1.00 39.37 ? 290 PRO D CG  1 
ATOM   8860  C CD  . PRO D 1 292 ? 102.631 17.473  89.375  1.00 39.37 ? 290 PRO D CD  1 
ATOM   8861  N N   . LEU D 1 293 ? 101.853 21.787  88.938  1.00 38.80 ? 291 LEU D N   1 
ATOM   8862  C CA  . LEU D 1 293 ? 100.888 22.817  88.559  1.00 38.80 ? 291 LEU D CA  1 
ATOM   8863  C C   . LEU D 1 293 ? 101.158 24.040  89.420  1.00 38.80 ? 291 LEU D C   1 
ATOM   8864  O O   . LEU D 1 293 ? 101.576 23.898  90.570  1.00 38.80 ? 291 LEU D O   1 
ATOM   8865  C CB  . LEU D 1 293 ? 99.472  22.306  88.843  1.00 42.56 ? 291 LEU D CB  1 
ATOM   8866  C CG  . LEU D 1 293 ? 98.397  22.184  87.758  1.00 42.56 ? 291 LEU D CG  1 
ATOM   8867  C CD1 . LEU D 1 293 ? 98.843  21.298  86.601  1.00 42.56 ? 291 LEU D CD1 1 
ATOM   8868  C CD2 . LEU D 1 293 ? 97.162  21.593  88.410  1.00 42.56 ? 291 LEU D CD2 1 
ATOM   8869  N N   . PRO D 1 294 ? 100.912 25.254  88.893  1.00 51.89 ? 292 PRO D N   1 
ATOM   8870  C CA  . PRO D 1 294 ? 101.133 26.508  89.633  1.00 51.89 ? 292 PRO D CA  1 
ATOM   8871  C C   . PRO D 1 294 ? 100.641 26.428  91.086  1.00 51.89 ? 292 PRO D C   1 
ATOM   8872  O O   . PRO D 1 294 ? 99.548  25.907  91.339  1.00 51.89 ? 292 PRO D O   1 
ATOM   8873  C CB  . PRO D 1 294 ? 100.353 27.529  88.807  1.00 21.34 ? 292 PRO D CB  1 
ATOM   8874  C CG  . PRO D 1 294 ? 100.568 27.044  87.427  1.00 21.34 ? 292 PRO D CG  1 
ATOM   8875  C CD  . PRO D 1 294 ? 100.348 25.536  87.563  1.00 21.34 ? 292 PRO D CD  1 
ATOM   8876  N N   . LYS D 1 295 ? 101.427 26.952  92.033  1.00 23.97 ? 293 LYS D N   1 
ATOM   8877  C CA  . LYS D 1 295 ? 101.045 26.880  93.445  1.00 24.84 ? 293 LYS D CA  1 
ATOM   8878  C C   . LYS D 1 295 ? 101.415 28.077  94.321  1.00 24.34 ? 293 LYS D C   1 
ATOM   8879  O O   . LYS D 1 295 ? 101.899 27.888  95.425  1.00 26.93 ? 293 LYS D O   1 
ATOM   8880  C CB  . LYS D 1 295 ? 101.655 25.615  94.059  1.00 13.31 ? 293 LYS D CB  1 
ATOM   8881  C CG  . LYS D 1 295 ? 101.083 24.314  93.507  1.00 31.01 ? 293 LYS D CG  1 
ATOM   8882  C CD  . LYS D 1 295 ? 101.907 23.112  93.932  1.00 19.63 ? 293 LYS D CD  1 
ATOM   8883  C CE  . LYS D 1 295 ? 103.260 23.100  93.230  1.00 30.40 ? 293 LYS D CE  1 
ATOM   8884  N NZ  . LYS D 1 295 ? 104.117 21.954  93.649  1.00 44.71 ? 293 LYS D NZ  1 
ATOM   8885  N N   . PRO D 1 296 ? 101.139 29.314  93.874  1.00 39.07 ? 294 PRO D N   1 
ATOM   8886  C CA  . PRO D 1 296 ? 101.446 30.559  94.597  1.00 31.60 ? 294 PRO D CA  1 
ATOM   8887  C C   . PRO D 1 296 ? 101.259 30.692  96.114  1.00 40.62 ? 294 PRO D C   1 
ATOM   8888  O O   . PRO D 1 296 ? 101.680 31.695  96.696  1.00 42.04 ? 294 PRO D O   1 
ATOM   8889  C CB  . PRO D 1 296 ? 100.636 31.608  93.836  1.00 27.94 ? 294 PRO D CB  1 
ATOM   8890  C CG  . PRO D 1 296 ? 99.520  30.830  93.273  1.00 32.48 ? 294 PRO D CG  1 
ATOM   8891  C CD  . PRO D 1 296 ? 100.225 29.603  92.763  1.00 24.61 ? 294 PRO D CD  1 
ATOM   8892  N N   . TRP D 1 297 ? 100.645 29.714  96.770  1.00 31.18 ? 295 TRP D N   1 
ATOM   8893  C CA  . TRP D 1 297 ? 100.441 29.813  98.224  1.00 29.07 ? 295 TRP D CA  1 
ATOM   8894  C C   . TRP D 1 297 ? 100.910 28.579  98.986  1.00 30.33 ? 295 TRP D C   1 
ATOM   8895  O O   . TRP D 1 297 ? 100.912 27.461  98.466  1.00 36.15 ? 295 TRP D O   1 
ATOM   8896  C CB  . TRP D 1 297 ? 98.954  30.085  98.566  1.00 24.06 ? 295 TRP D CB  1 
ATOM   8897  C CG  . TRP D 1 297 ? 98.018  29.993  97.385  1.00 34.25 ? 295 TRP D CG  1 
ATOM   8898  C CD1 . TRP D 1 297 ? 97.302  31.010  96.813  1.00 38.22 ? 295 TRP D CD1 1 
ATOM   8899  C CD2 . TRP D 1 297 ? 97.822  28.849  96.559  1.00 35.51 ? 295 TRP D CD2 1 
ATOM   8900  N NE1 . TRP D 1 297 ? 96.687  30.566  95.669  1.00 27.63 ? 295 TRP D NE1 1 
ATOM   8901  C CE2 . TRP D 1 297 ? 96.993  29.244  95.489  1.00 40.16 ? 295 TRP D CE2 1 
ATOM   8902  C CE3 . TRP D 1 297 ? 98.275  27.526  96.616  1.00 39.35 ? 295 TRP D CE3 1 
ATOM   8903  C CZ2 . TRP D 1 297 ? 96.612  28.365  94.482  1.00 32.94 ? 295 TRP D CZ2 1 
ATOM   8904  C CZ3 . TRP D 1 297 ? 97.899  26.655  95.623  1.00 38.75 ? 295 TRP D CZ3 1 
ATOM   8905  C CH2 . TRP D 1 297 ? 97.075  27.076  94.563  1.00 34.68 ? 295 TRP D CH2 1 
ATOM   8906  N N   . LYS D 1 298 ? 101.302 28.786  100.233 1.00 27.70 ? 296 LYS D N   1 
ATOM   8907  C CA  . LYS D 1 298 ? 101.773 27.688  101.040 1.00 28.78 ? 296 LYS D CA  1 
ATOM   8908  C C   . LYS D 1 298 ? 100.679 26.650  101.112 1.00 29.47 ? 296 LYS D C   1 
ATOM   8909  O O   . LYS D 1 298 ? 99.529  26.986  101.377 1.00 34.54 ? 296 LYS D O   1 
ATOM   8910  C CB  . LYS D 1 298 ? 102.133 28.195  102.431 1.00 28.11 ? 296 LYS D CB  1 
ATOM   8911  C CG  . LYS D 1 298 ? 103.346 29.122  102.445 1.00 19.86 ? 296 LYS D CG  1 
ATOM   8912  C CD  . LYS D 1 298 ? 104.635 28.359  102.224 1.00 31.82 ? 296 LYS D CD  1 
ATOM   8913  C CE  . LYS D 1 298 ? 105.850 29.256  102.430 1.00 40.26 ? 296 LYS D CE  1 
ATOM   8914  N NZ  . LYS D 1 298 ? 107.153 28.516  102.567 1.00 49.28 ? 296 LYS D NZ  1 
ATOM   8915  N N   . LEU D 1 299 ? 101.036 25.397  100.839 1.00 43.69 ? 297 LEU D N   1 
ATOM   8916  C CA  . LEU D 1 299 ? 100.081 24.292  100.896 1.00 30.62 ? 297 LEU D CA  1 
ATOM   8917  C C   . LEU D 1 299 ? 100.404 23.439  102.130 1.00 40.27 ? 297 LEU D C   1 
ATOM   8918  O O   . LEU D 1 299 ? 101.030 22.381  102.040 1.00 47.17 ? 297 LEU D O   1 
ATOM   8919  C CB  . LEU D 1 299 ? 100.147 23.463  99.602  1.00 67.56 ? 297 LEU D CB  1 
ATOM   8920  C CG  . LEU D 1 299 ? 99.519  24.107  98.346  1.00 79.33 ? 297 LEU D CG  1 
ATOM   8921  C CD1 . LEU D 1 299 ? 100.182 23.556  97.098  1.00 69.37 ? 297 LEU D CD1 1 
ATOM   8922  C CD2 . LEU D 1 299 ? 98.012  23.857  98.299  1.00 64.16 ? 297 LEU D CD2 1 
ATOM   8923  N N   . SER D 1 300 ? 99.956  23.927  103.284 1.00 39.40 ? 298 SER D N   1 
ATOM   8924  C CA  . SER D 1 300 ? 100.202 23.291  104.574 1.00 36.90 ? 298 SER D CA  1 
ATOM   8925  C C   . SER D 1 300 ? 99.097  22.362  105.052 1.00 45.33 ? 298 SER D C   1 
ATOM   8926  O O   . SER D 1 300 ? 98.328  21.830  104.249 1.00 52.43 ? 298 SER D O   1 
ATOM   8927  C CB  . SER D 1 300 ? 100.440 24.372  105.638 1.00 58.47 ? 298 SER D CB  1 
ATOM   8928  O OG  . SER D 1 300 ? 100.786 23.801  106.886 1.00 66.54 ? 298 SER D OG  1 
ATOM   8929  N N   . PHE D 1 301 ? 99.035  22.191  106.375 1.00 52.13 ? 299 PHE D N   1 
ATOM   8930  C CA  . PHE D 1 301 ? 98.052  21.339  107.037 1.00 61.92 ? 299 PHE D CA  1 
ATOM   8931  C C   . PHE D 1 301 ? 97.437  22.025  108.249 1.00 65.63 ? 299 PHE D C   1 
ATOM   8932  O O   . PHE D 1 301 ? 97.905  23.069  108.698 1.00 71.66 ? 299 PHE D O   1 
ATOM   8933  C CB  . PHE D 1 301 ? 98.710  20.046  107.520 1.00 44.95 ? 299 PHE D CB  1 
ATOM   8934  C CG  . PHE D 1 301 ? 99.874  20.271  108.450 1.00 50.25 ? 299 PHE D CG  1 
ATOM   8935  C CD1 . PHE D 1 301 ? 101.164 20.442  107.946 1.00 43.45 ? 299 PHE D CD1 1 
ATOM   8936  C CD2 . PHE D 1 301 ? 99.682  20.328  109.830 1.00 39.44 ? 299 PHE D CD2 1 
ATOM   8937  C CE1 . PHE D 1 301 ? 102.252 20.667  108.799 1.00 47.35 ? 299 PHE D CE1 1 
ATOM   8938  C CE2 . PHE D 1 301 ? 100.763 20.554  110.692 1.00 45.76 ? 299 PHE D CE2 1 
ATOM   8939  C CZ  . PHE D 1 301 ? 102.053 20.722  110.170 1.00 45.57 ? 299 PHE D CZ  1 
ATOM   8940  N N   . SER D 1 302 ? 96.384  21.404  108.771 1.00 52.14 ? 300 SER D N   1 
ATOM   8941  C CA  . SER D 1 302 ? 95.668  21.863  109.959 1.00 56.59 ? 300 SER D CA  1 
ATOM   8942  C C   . SER D 1 302 ? 95.015  20.620  110.511 1.00 56.67 ? 300 SER D C   1 
ATOM   8943  O O   . SER D 1 302 ? 93.819  20.591  110.793 1.00 60.22 ? 300 SER D O   1 
ATOM   8944  C CB  . SER D 1 302 ? 94.587  22.870  109.615 1.00 39.81 ? 300 SER D CB  1 
ATOM   8945  O OG  . SER D 1 302 ? 93.908  23.257  110.794 1.00 45.34 ? 300 SER D OG  1 
ATOM   8946  N N   . TYR D 1 303 ? 95.832  19.584  110.631 1.00 34.98 ? 301 TYR D N   1 
ATOM   8947  C CA  . TYR D 1 303 ? 95.413  18.293  111.122 1.00 34.98 ? 301 TYR D CA  1 
ATOM   8948  C C   . TYR D 1 303 ? 95.246  18.287  112.620 1.00 37.60 ? 301 TYR D C   1 
ATOM   8949  O O   . TYR D 1 303 ? 95.801  19.126  113.325 1.00 43.47 ? 301 TYR D O   1 
ATOM   8950  C CB  . TYR D 1 303 ? 96.452  17.254  110.755 1.00 35.94 ? 301 TYR D CB  1 
ATOM   8951  C CG  . TYR D 1 303 ? 96.771  17.205  109.286 1.00 40.81 ? 301 TYR D CG  1 
ATOM   8952  C CD1 . TYR D 1 303 ? 97.812  16.416  108.812 1.00 44.71 ? 301 TYR D CD1 1 
ATOM   8953  C CD2 . TYR D 1 303 ? 96.010  17.910  108.364 1.00 37.35 ? 301 TYR D CD2 1 
ATOM   8954  C CE1 . TYR D 1 303 ? 98.083  16.324  107.464 1.00 38.98 ? 301 TYR D CE1 1 
ATOM   8955  C CE2 . TYR D 1 303 ? 96.274  17.823  107.007 1.00 40.27 ? 301 TYR D CE2 1 
ATOM   8956  C CZ  . TYR D 1 303 ? 97.310  17.026  106.565 1.00 37.04 ? 301 TYR D CZ  1 
ATOM   8957  O OH  . TYR D 1 303 ? 97.562  16.916  105.218 1.00 43.63 ? 301 TYR D OH  1 
ATOM   8958  N N   . GLY D 1 304 ? 94.475  17.316  113.092 1.00 88.41 ? 302 GLY D N   1 
ATOM   8959  C CA  . GLY D 1 304 ? 94.236  17.158  114.509 1.00 87.21 ? 302 GLY D CA  1 
ATOM   8960  C C   . GLY D 1 304 ? 94.391  15.683  114.811 1.00 88.41 ? 302 GLY D C   1 
ATOM   8961  O O   . GLY D 1 304 ? 95.272  15.274  115.570 1.00 88.41 ? 302 GLY D O   1 
ATOM   8962  N N   . ARG D 1 305 ? 93.541  14.875  114.190 1.00 50.58 ? 303 ARG D N   1 
ATOM   8963  C CA  . ARG D 1 305 ? 93.588  13.442  114.402 1.00 58.65 ? 303 ARG D CA  1 
ATOM   8964  C C   . ARG D 1 305 ? 94.885  12.910  113.826 1.00 56.74 ? 303 ARG D C   1 
ATOM   8965  O O   . ARG D 1 305 ? 95.463  11.975  114.364 1.00 64.20 ? 303 ARG D O   1 
ATOM   8966  C CB  . ARG D 1 305 ? 92.394  12.740  113.731 1.00 47.83 ? 303 ARG D CB  1 
ATOM   8967  C CG  . ARG D 1 305 ? 91.176  13.628  113.489 1.00 61.09 ? 303 ARG D CG  1 
ATOM   8968  C CD  . ARG D 1 305 ? 91.396  14.501  112.252 1.00 59.00 ? 303 ARG D CD  1 
ATOM   8969  N NE  . ARG D 1 305 ? 90.303  15.430  111.975 1.00 72.42 ? 303 ARG D NE  1 
ATOM   8970  C CZ  . ARG D 1 305 ? 90.069  16.537  112.668 1.00 73.03 ? 303 ARG D CZ  1 
ATOM   8971  N NH1 . ARG D 1 305 ? 90.851  16.859  113.687 1.00 60.56 ? 303 ARG D NH1 1 
ATOM   8972  N NH2 . ARG D 1 305 ? 89.060  17.326  112.337 1.00 73.03 ? 303 ARG D NH2 1 
ATOM   8973  N N   . ALA D 1 306 ? 95.360  13.516  112.746 1.00 52.65 ? 304 ALA D N   1 
ATOM   8974  C CA  . ALA D 1 306 ? 96.588  13.042  112.119 1.00 50.76 ? 304 ALA D CA  1 
ATOM   8975  C C   . ALA D 1 306 ? 97.867  13.401  112.880 1.00 55.38 ? 304 ALA D C   1 
ATOM   8976  O O   . ALA D 1 306 ? 98.966  12.970  112.504 1.00 58.21 ? 304 ALA D O   1 
ATOM   8977  C CB  . ALA D 1 306 ? 96.670  13.553  110.690 1.00 24.05 ? 304 ALA D CB  1 
ATOM   8978  N N   . LEU D 1 307 ? 97.727  14.187  113.944 1.00 80.65 ? 305 LEU D N   1 
ATOM   8979  C CA  . LEU D 1 307 ? 98.878  14.592  114.750 1.00 74.28 ? 305 LEU D CA  1 
ATOM   8980  C C   . LEU D 1 307 ? 98.769  14.051  116.164 1.00 82.17 ? 305 LEU D C   1 
ATOM   8981  O O   . LEU D 1 307 ? 99.773  13.722  116.799 1.00 86.16 ? 305 LEU D O   1 
ATOM   8982  C CB  . LEU D 1 307 ? 98.983  16.122  114.813 1.00 50.75 ? 305 LEU D CB  1 
ATOM   8983  C CG  . LEU D 1 307 ? 99.415  16.864  113.542 1.00 65.65 ? 305 LEU D CG  1 
ATOM   8984  C CD1 . LEU D 1 307 ? 99.317  18.375  113.757 1.00 61.32 ? 305 LEU D CD1 1 
ATOM   8985  C CD2 . LEU D 1 307 ? 100.845 16.448  113.174 1.00 55.96 ? 305 LEU D CD2 1 
ATOM   8986  N N   . GLN D 1 308 ? 97.536  13.960  116.650 1.00 92.42 ? 306 GLN D N   1 
ATOM   8987  C CA  . GLN D 1 308 ? 97.275  13.488  118.002 1.00 92.42 ? 306 GLN D CA  1 
ATOM   8988  C C   . GLN D 1 308 ? 97.055  11.978  118.114 1.00 92.42 ? 306 GLN D C   1 
ATOM   8989  O O   . GLN D 1 308 ? 97.213  11.404  119.190 1.00 92.42 ? 306 GLN D O   1 
ATOM   8990  C CB  . GLN D 1 308 ? 96.069  14.244  118.571 1.00 54.06 ? 306 GLN D CB  1 
ATOM   8991  C CG  . GLN D 1 308 ? 96.304  15.743  118.657 1.00 54.06 ? 306 GLN D CG  1 
ATOM   8992  C CD  . GLN D 1 308 ? 95.127  16.524  119.221 1.00 54.06 ? 306 GLN D CD  1 
ATOM   8993  O OE1 . GLN D 1 308 ? 94.746  16.368  120.389 1.00 54.06 ? 306 GLN D OE1 1 
ATOM   8994  N NE2 . GLN D 1 308 ? 94.551  17.383  118.391 1.00 54.06 ? 306 GLN D NE2 1 
ATOM   8995  N N   . ALA D 1 309 ? 96.714  11.336  117.001 1.00 75.92 ? 307 ALA D N   1 
ATOM   8996  C CA  . ALA D 1 309 ? 96.448  9.901   116.987 1.00 75.92 ? 307 ALA D CA  1 
ATOM   8997  C C   . ALA D 1 309 ? 97.431  9.071   117.789 1.00 75.92 ? 307 ALA D C   1 
ATOM   8998  O O   . ALA D 1 309 ? 97.159  8.703   118.929 1.00 75.92 ? 307 ALA D O   1 
ATOM   8999  C CB  . ALA D 1 309 ? 96.405  9.395   115.560 1.00 85.48 ? 307 ALA D CB  1 
ATOM   9000  N N   . SER D 1 310 ? 98.570  8.769   117.180 1.00 85.90 ? 308 SER D N   1 
ATOM   9001  C CA  . SER D 1 310 ? 99.602  7.960   117.818 1.00 85.90 ? 308 SER D CA  1 
ATOM   9002  C C   . SER D 1 310 ? 100.077 8.499   119.171 1.00 85.90 ? 308 SER D C   1 
ATOM   9003  O O   . SER D 1 310 ? 100.306 7.726   120.112 1.00 85.90 ? 308 SER D O   1 
ATOM   9004  C CB  . SER D 1 310 ? 100.782 7.812   116.858 1.00 56.67 ? 308 SER D CB  1 
ATOM   9005  O OG  . SER D 1 310 ? 100.836 8.927   115.985 1.00 56.67 ? 308 SER D OG  1 
ATOM   9006  N N   . ALA D 1 311 ? 100.227 9.820   119.265 1.00 76.29 ? 309 ALA D N   1 
ATOM   9007  C CA  . ALA D 1 311 ? 100.667 10.452  120.507 1.00 76.29 ? 309 ALA D CA  1 
ATOM   9008  C C   . ALA D 1 311 ? 99.694  10.076  121.611 1.00 76.29 ? 309 ALA D C   1 
ATOM   9009  O O   . ALA D 1 311 ? 100.081 9.555   122.655 1.00 76.29 ? 309 ALA D O   1 
ATOM   9010  C CB  . ALA D 1 311 ? 100.705 11.964  120.334 1.00 92.42 ? 309 ALA D CB  1 
ATOM   9011  N N   . LEU D 1 312 ? 98.423  10.349  121.353 1.00 78.37 ? 310 LEU D N   1 
ATOM   9012  C CA  . LEU D 1 312 ? 97.346  10.051  122.278 1.00 78.37 ? 310 LEU D CA  1 
ATOM   9013  C C   . LEU D 1 312 ? 97.382  8.586   122.707 1.00 78.37 ? 310 LEU D C   1 
ATOM   9014  O O   . LEU D 1 312 ? 97.429  8.286   123.901 1.00 78.37 ? 310 LEU D O   1 
ATOM   9015  C CB  . LEU D 1 312 ? 96.019  10.373  121.603 1.00 59.90 ? 310 LEU D CB  1 
ATOM   9016  C CG  . LEU D 1 312 ? 94.717  10.073  122.331 1.00 59.90 ? 310 LEU D CG  1 
ATOM   9017  C CD1 . LEU D 1 312 ? 93.955  11.377  122.581 1.00 59.90 ? 310 LEU D CD1 1 
ATOM   9018  C CD2 . LEU D 1 312 ? 93.895  9.109   121.476 1.00 59.90 ? 310 LEU D CD2 1 
ATOM   9019  N N   . ALA D 1 313 ? 97.359  7.676   121.736 1.00 79.45 ? 311 ALA D N   1 
ATOM   9020  C CA  . ALA D 1 313 ? 97.399  6.248   122.035 1.00 79.45 ? 311 ALA D CA  1 
ATOM   9021  C C   . ALA D 1 313 ? 98.636  5.918   122.856 1.00 79.45 ? 311 ALA D C   1 
ATOM   9022  O O   . ALA D 1 313 ? 98.553  5.159   123.814 1.00 79.45 ? 311 ALA D O   1 
ATOM   9023  C CB  . ALA D 1 313 ? 97.395  5.440   120.760 1.00 34.20 ? 311 ALA D CB  1 
ATOM   9024  N N   . ALA D 1 314 ? 99.780  6.489   122.490 1.00 68.10 ? 312 ALA D N   1 
ATOM   9025  C CA  . ALA D 1 314 ? 101.018 6.248   123.232 1.00 68.10 ? 312 ALA D CA  1 
ATOM   9026  C C   . ALA D 1 314 ? 100.907 6.729   124.692 1.00 68.10 ? 312 ALA D C   1 
ATOM   9027  O O   . ALA D 1 314 ? 101.832 6.556   125.488 1.00 68.10 ? 312 ALA D O   1 
ATOM   9028  C CB  . ALA D 1 314 ? 102.184 6.938   122.534 1.00 56.82 ? 312 ALA D CB  1 
ATOM   9029  N N   . TRP D 1 315 ? 99.767  7.337   125.021 1.00 80.70 ? 313 TRP D N   1 
ATOM   9030  C CA  . TRP D 1 315 ? 99.481  7.835   126.365 1.00 80.70 ? 313 TRP D CA  1 
ATOM   9031  C C   . TRP D 1 315 ? 98.423  6.930   126.974 1.00 80.70 ? 313 TRP D C   1 
ATOM   9032  O O   . TRP D 1 315 ? 98.661  6.258   127.976 1.00 80.70 ? 313 TRP D O   1 
ATOM   9033  C CB  . TRP D 1 315 ? 98.925  9.260   126.309 1.00 78.38 ? 313 TRP D CB  1 
ATOM   9034  C CG  . TRP D 1 315 ? 98.619  9.867   127.663 1.00 78.38 ? 313 TRP D CG  1 
ATOM   9035  C CD1 . TRP D 1 315 ? 99.504  10.088  128.683 1.00 78.38 ? 313 TRP D CD1 1 
ATOM   9036  C CD2 . TRP D 1 315 ? 97.353  10.376  128.117 1.00 78.38 ? 313 TRP D CD2 1 
ATOM   9037  N NE1 . TRP D 1 315 ? 98.871  10.706  129.737 1.00 78.38 ? 313 TRP D NE1 1 
ATOM   9038  C CE2 . TRP D 1 315 ? 97.553  10.895  129.417 1.00 78.38 ? 313 TRP D CE2 1 
ATOM   9039  C CE3 . TRP D 1 315 ? 96.073  10.448  127.549 1.00 78.38 ? 313 TRP D CE3 1 
ATOM   9040  C CZ2 . TRP D 1 315 ? 96.518  11.479  130.159 1.00 78.38 ? 313 TRP D CZ2 1 
ATOM   9041  C CZ3 . TRP D 1 315 ? 95.041  11.031  128.290 1.00 78.38 ? 313 TRP D CZ3 1 
ATOM   9042  C CH2 . TRP D 1 315 ? 95.273  11.538  129.580 1.00 78.38 ? 313 TRP D CH2 1 
ATOM   9043  N N   . GLY D 1 316 ? 97.249  6.928   126.351 1.00 80.41 ? 314 GLY D N   1 
ATOM   9044  C CA  . GLY D 1 316 ? 96.147  6.111   126.823 1.00 80.41 ? 314 GLY D CA  1 
ATOM   9045  C C   . GLY D 1 316 ? 95.871  6.290   128.301 1.00 80.41 ? 314 GLY D C   1 
ATOM   9046  O O   . GLY D 1 316 ? 95.399  5.370   128.961 1.00 80.41 ? 314 GLY D O   1 
ATOM   9047  N N   . GLY D 1 317 ? 96.165  7.477   128.821 1.00 69.05 ? 315 GLY D N   1 
ATOM   9048  C CA  . GLY D 1 317 ? 95.940  7.739   130.232 1.00 69.05 ? 315 GLY D CA  1 
ATOM   9049  C C   . GLY D 1 317 ? 97.220  7.734   131.050 1.00 69.05 ? 315 GLY D C   1 
ATOM   9050  O O   . GLY D 1 317 ? 97.393  8.575   131.931 1.00 69.05 ? 315 GLY D O   1 
ATOM   9051  N N   . LYS D 1 318 ? 98.112  6.787   130.751 1.00 90.84 ? 316 LYS D N   1 
ATOM   9052  C CA  . LYS D 1 318 ? 99.403  6.641   131.439 1.00 90.84 ? 316 LYS D CA  1 
ATOM   9053  C C   . LYS D 1 318 ? 100.241 7.932   131.397 1.00 90.84 ? 316 LYS D C   1 
ATOM   9054  O O   . LYS D 1 318 ? 100.945 8.185   130.412 1.00 90.84 ? 316 LYS D O   1 
ATOM   9055  C CB  . LYS D 1 318 ? 100.242 5.525   130.788 1.00 87.82 ? 316 LYS D CB  1 
ATOM   9056  C CG  . LYS D 1 318 ? 99.637  4.105   130.707 1.00 87.82 ? 316 LYS D CG  1 
ATOM   9057  C CD  . LYS D 1 318 ? 100.624 3.133   129.995 1.00 87.82 ? 316 LYS D CD  1 
ATOM   9058  C CE  . LYS D 1 318 ? 100.089 1.707   129.849 1.00 87.82 ? 316 LYS D CE  1 
ATOM   9059  N NZ  . LYS D 1 318 ? 101.061 0.817   129.155 1.00 87.82 ? 316 LYS D NZ  1 
ATOM   9060  N N   . ALA D 1 319 ? 100.180 8.736   132.458 1.00 90.71 ? 317 ALA D N   1 
ATOM   9061  C CA  . ALA D 1 319 ? 100.949 9.981   132.511 1.00 90.71 ? 317 ALA D CA  1 
ATOM   9062  C C   . ALA D 1 319 ? 102.422 9.631   132.538 1.00 90.71 ? 317 ALA D C   1 
ATOM   9063  O O   . ALA D 1 319 ? 103.277 10.454  132.213 1.00 90.71 ? 317 ALA D O   1 
ATOM   9064  C CB  . ALA D 1 319 ? 100.590 10.776  133.740 1.00 11.51 ? 317 ALA D CB  1 
ATOM   9065  N N   . ALA D 1 320 ? 102.708 8.400   132.942 1.00 76.58 ? 318 ALA D N   1 
ATOM   9066  C CA  . ALA D 1 320 ? 104.076 7.923   132.989 1.00 76.58 ? 318 ALA D CA  1 
ATOM   9067  C C   . ALA D 1 320 ? 104.541 7.840   131.543 1.00 76.58 ? 318 ALA D C   1 
ATOM   9068  O O   . ALA D 1 320 ? 105.735 7.881   131.250 1.00 76.58 ? 318 ALA D O   1 
ATOM   9069  C CB  . ALA D 1 320 ? 104.124 6.551   133.642 1.00 90.59 ? 318 ALA D CB  1 
ATOM   9070  N N   . ASN D 1 321 ? 103.571 7.735   130.643 1.00 92.42 ? 319 ASN D N   1 
ATOM   9071  C CA  . ASN D 1 321 ? 103.840 7.641   129.215 1.00 92.42 ? 319 ASN D CA  1 
ATOM   9072  C C   . ASN D 1 321 ? 104.111 9.005   128.574 1.00 92.42 ? 319 ASN D C   1 
ATOM   9073  O O   . ASN D 1 321 ? 103.901 9.189   127.369 1.00 92.42 ? 319 ASN D O   1 
ATOM   9074  C CB  . ASN D 1 321 ? 102.658 6.959   128.511 1.00 92.42 ? 319 ASN D CB  1 
ATOM   9075  C CG  . ASN D 1 321 ? 102.616 5.460   128.759 1.00 92.42 ? 319 ASN D CG  1 
ATOM   9076  O OD1 . ASN D 1 321 ? 102.870 4.996   129.871 1.00 92.42 ? 319 ASN D OD1 1 
ATOM   9077  N ND2 . ASN D 1 321 ? 102.284 4.696   127.722 1.00 92.42 ? 319 ASN D ND2 1 
ATOM   9078  N N   . LYS D 1 322 ? 104.584 9.955   129.376 1.00 84.71 ? 320 LYS D N   1 
ATOM   9079  C CA  . LYS D 1 322 ? 104.882 11.293  128.880 1.00 84.71 ? 320 LYS D CA  1 
ATOM   9080  C C   . LYS D 1 322 ? 105.661 11.237  127.562 1.00 84.71 ? 320 LYS D C   1 
ATOM   9081  O O   . LYS D 1 322 ? 105.137 11.607  126.510 1.00 84.71 ? 320 LYS D O   1 
ATOM   9082  C CB  . LYS D 1 322 ? 105.684 12.070  129.923 1.00 64.64 ? 320 LYS D CB  1 
ATOM   9083  C CG  . LYS D 1 322 ? 105.864 13.541  129.597 1.00 64.64 ? 320 LYS D CG  1 
ATOM   9084  C CD  . LYS D 1 322 ? 106.727 14.232  130.642 1.00 64.64 ? 320 LYS D CD  1 
ATOM   9085  C CE  . LYS D 1 322 ? 106.795 15.736  130.406 1.00 64.64 ? 320 LYS D CE  1 
ATOM   9086  N NZ  . LYS D 1 322 ? 105.457 16.389  130.497 1.00 64.64 ? 320 LYS D NZ  1 
ATOM   9087  N N   . GLU D 1 323 ? 106.905 10.765  127.619 1.00 74.17 ? 321 GLU D N   1 
ATOM   9088  C CA  . GLU D 1 323 ? 107.742 10.672  126.421 1.00 74.17 ? 321 GLU D CA  1 
ATOM   9089  C C   . GLU D 1 323 ? 107.012 10.011  125.272 1.00 74.17 ? 321 GLU D C   1 
ATOM   9090  O O   . GLU D 1 323 ? 106.918 10.567  124.181 1.00 74.17 ? 321 GLU D O   1 
ATOM   9091  C CB  . GLU D 1 323 ? 109.011 9.866   126.684 1.00 92.42 ? 321 GLU D CB  1 
ATOM   9092  C CG  . GLU D 1 323 ? 109.987 10.483  127.655 1.00 92.42 ? 321 GLU D CG  1 
ATOM   9093  C CD  . GLU D 1 323 ? 111.350 9.828   127.558 1.00 92.42 ? 321 GLU D CD  1 
ATOM   9094  O OE1 . GLU D 1 323 ? 111.991 9.987   126.493 1.00 92.42 ? 321 GLU D OE1 1 
ATOM   9095  O OE2 . GLU D 1 323 ? 111.773 9.152   128.528 1.00 92.42 ? 321 GLU D OE2 1 
ATOM   9096  N N   . ALA D 1 324 ? 106.517 8.805   125.522 1.00 92.42 ? 322 ALA D N   1 
ATOM   9097  C CA  . ALA D 1 324 ? 105.793 8.050   124.509 1.00 92.42 ? 322 ALA D CA  1 
ATOM   9098  C C   . ALA D 1 324 ? 104.869 8.982   123.728 1.00 92.42 ? 322 ALA D C   1 
ATOM   9099  O O   . ALA D 1 324 ? 104.945 9.075   122.497 1.00 92.42 ? 322 ALA D O   1 
ATOM   9100  C CB  . ALA D 1 324 ? 104.978 6.928   125.172 1.00 76.94 ? 322 ALA D CB  1 
ATOM   9101  N N   . THR D 1 325 ? 104.010 9.679   124.464 1.00 77.15 ? 323 THR D N   1 
ATOM   9102  C CA  . THR D 1 325 ? 103.059 10.601  123.874 1.00 77.15 ? 323 THR D CA  1 
ATOM   9103  C C   . THR D 1 325 ? 103.733 11.741  123.126 1.00 77.15 ? 323 THR D C   1 
ATOM   9104  O O   . THR D 1 325 ? 103.273 12.154  122.065 1.00 77.15 ? 323 THR D O   1 
ATOM   9105  C CB  . THR D 1 325 ? 102.145 11.165  124.960 1.00 65.79 ? 323 THR D CB  1 
ATOM   9106  O OG1 . THR D 1 325 ? 101.369 10.092  125.503 1.00 65.79 ? 323 THR D OG1 1 
ATOM   9107  C CG2 . THR D 1 325 ? 101.228 12.248  124.402 1.00 65.79 ? 323 THR D CG2 1 
ATOM   9108  N N   . GLN D 1 326 ? 104.836 12.237  123.667 1.00 61.60 ? 324 GLN D N   1 
ATOM   9109  C CA  . GLN D 1 326 ? 105.539 13.339  123.031 1.00 61.60 ? 324 GLN D CA  1 
ATOM   9110  C C   . GLN D 1 326 ? 106.448 12.924  121.881 1.00 61.60 ? 324 GLN D C   1 
ATOM   9111  O O   . GLN D 1 326 ? 106.825 13.757  121.063 1.00 61.60 ? 324 GLN D O   1 
ATOM   9112  C CB  . GLN D 1 326 ? 106.327 14.119  124.081 1.00 58.64 ? 324 GLN D CB  1 
ATOM   9113  C CG  . GLN D 1 326 ? 105.423 14.704  125.141 1.00 58.64 ? 324 GLN D CG  1 
ATOM   9114  C CD  . GLN D 1 326 ? 106.167 15.512  126.163 1.00 58.64 ? 324 GLN D CD  1 
ATOM   9115  O OE1 . GLN D 1 326 ? 107.061 15.001  126.838 1.00 58.64 ? 324 GLN D OE1 1 
ATOM   9116  N NE2 . GLN D 1 326 ? 105.805 16.787  126.292 1.00 58.64 ? 324 GLN D NE2 1 
ATOM   9117  N N   . GLU D 1 327 ? 106.793 11.642  121.816 1.00 40.76 ? 325 GLU D N   1 
ATOM   9118  C CA  . GLU D 1 327 ? 107.655 11.127  120.750 1.00 40.76 ? 325 GLU D CA  1 
ATOM   9119  C C   . GLU D 1 327 ? 106.833 11.070  119.472 1.00 40.76 ? 325 GLU D C   1 
ATOM   9120  O O   . GLU D 1 327 ? 107.309 11.393  118.381 1.00 40.76 ? 325 GLU D O   1 
ATOM   9121  C CB  . GLU D 1 327 ? 108.142 9.712   121.096 1.00 88.79 ? 325 GLU D CB  1 
ATOM   9122  C CG  . GLU D 1 327 ? 109.029 9.637   122.326 1.00 88.79 ? 325 GLU D CG  1 
ATOM   9123  C CD  . GLU D 1 327 ? 110.434 10.139  122.058 1.00 88.79 ? 325 GLU D CD  1 
ATOM   9124  O OE1 . GLU D 1 327 ? 110.617 10.881  121.066 1.00 88.79 ? 325 GLU D OE1 1 
ATOM   9125  O OE2 . GLU D 1 327 ? 111.348 9.798   122.844 1.00 88.79 ? 325 GLU D OE2 1 
ATOM   9126  N N   . ALA D 1 328 ? 105.584 10.648  119.639 1.00 71.73 ? 326 ALA D N   1 
ATOM   9127  C CA  . ALA D 1 328 ? 104.649 10.507  118.539 1.00 71.73 ? 326 ALA D CA  1 
ATOM   9128  C C   . ALA D 1 328 ? 104.228 11.860  118.023 1.00 71.73 ? 326 ALA D C   1 
ATOM   9129  O O   . ALA D 1 328 ? 104.279 12.109  116.826 1.00 71.73 ? 326 ALA D O   1 
ATOM   9130  C CB  . ALA D 1 328 ? 103.439 9.726   118.990 1.00 92.00 ? 326 ALA D CB  1 
ATOM   9131  N N   . PHE D 1 329 ? 103.805 12.735  118.924 1.00 47.82 ? 327 PHE D N   1 
ATOM   9132  C CA  . PHE D 1 329 ? 103.389 14.076  118.522 1.00 47.82 ? 327 PHE D CA  1 
ATOM   9133  C C   . PHE D 1 329 ? 104.560 14.801  117.866 1.00 47.82 ? 327 PHE D C   1 
ATOM   9134  O O   . PHE D 1 329 ? 104.403 15.456  116.839 1.00 47.82 ? 327 PHE D O   1 
ATOM   9135  C CB  . PHE D 1 329 ? 102.909 14.869  119.734 1.00 60.15 ? 327 PHE D CB  1 
ATOM   9136  C CG  . PHE D 1 329 ? 102.570 16.289  119.426 1.00 60.15 ? 327 PHE D CG  1 
ATOM   9137  C CD1 . PHE D 1 329 ? 101.688 16.597  118.398 1.00 60.15 ? 327 PHE D CD1 1 
ATOM   9138  C CD2 . PHE D 1 329 ? 103.111 17.320  120.177 1.00 60.15 ? 327 PHE D CD2 1 
ATOM   9139  C CE1 . PHE D 1 329 ? 101.346 17.921  118.125 1.00 60.15 ? 327 PHE D CE1 1 
ATOM   9140  C CE2 . PHE D 1 329 ? 102.777 18.638  119.913 1.00 60.15 ? 327 PHE D CE2 1 
ATOM   9141  C CZ  . PHE D 1 329 ? 101.891 18.941  118.884 1.00 60.15 ? 327 PHE D CZ  1 
ATOM   9142  N N   . MET D 1 330 ? 105.732 14.673  118.476 1.00 51.38 ? 328 MET D N   1 
ATOM   9143  C CA  . MET D 1 330 ? 106.941 15.286  117.962 1.00 51.38 ? 328 MET D CA  1 
ATOM   9144  C C   . MET D 1 330 ? 107.264 14.668  116.618 1.00 51.38 ? 328 MET D C   1 
ATOM   9145  O O   . MET D 1 330 ? 107.915 15.294  115.792 1.00 51.38 ? 328 MET D O   1 
ATOM   9146  C CB  . MET D 1 330 ? 108.109 15.051  118.923 1.00 92.42 ? 328 MET D CB  1 
ATOM   9147  C CG  . MET D 1 330 ? 108.568 16.279  119.693 1.00 92.42 ? 328 MET D CG  1 
ATOM   9148  S SD  . MET D 1 330 ? 109.417 17.452  118.624 1.00 92.42 ? 328 MET D SD  1 
ATOM   9149  C CE  . MET D 1 330 ? 111.096 16.786  118.636 1.00 92.42 ? 328 MET D CE  1 
ATOM   9150  N N   . LYS D 1 331 ? 106.807 13.438  116.401 1.00 91.63 ? 329 LYS D N   1 
ATOM   9151  C CA  . LYS D 1 331 ? 107.060 12.732  115.140 1.00 91.63 ? 329 LYS D CA  1 
ATOM   9152  C C   . LYS D 1 331 ? 106.174 13.206  113.981 1.00 91.63 ? 329 LYS D C   1 
ATOM   9153  O O   . LYS D 1 331 ? 106.674 13.610  112.929 1.00 91.63 ? 329 LYS D O   1 
ATOM   9154  C CB  . LYS D 1 331 ? 106.869 11.219  115.329 1.00 84.47 ? 329 LYS D CB  1 
ATOM   9155  C CG  . LYS D 1 331 ? 107.039 10.399  114.043 1.00 84.47 ? 329 LYS D CG  1 
ATOM   9156  C CD  . LYS D 1 331 ? 106.600 8.945   114.234 1.00 84.47 ? 329 LYS D CD  1 
ATOM   9157  C CE  . LYS D 1 331 ? 106.716 8.138   112.945 1.00 84.47 ? 329 LYS D CE  1 
ATOM   9158  N NZ  . LYS D 1 331 ? 106.187 6.752   113.089 1.00 84.47 ? 329 LYS D NZ  1 
ATOM   9159  N N   . ARG D 1 332 ? 104.860 13.145  114.178 1.00 62.29 ? 330 ARG D N   1 
ATOM   9160  C CA  . ARG D 1 332 ? 103.910 13.551  113.153 1.00 62.29 ? 330 ARG D CA  1 
ATOM   9161  C C   . ARG D 1 332 ? 104.085 14.982  112.688 1.00 62.29 ? 330 ARG D C   1 
ATOM   9162  O O   . ARG D 1 332 ? 104.355 15.203  111.517 1.00 62.29 ? 330 ARG D O   1 
ATOM   9163  C CB  . ARG D 1 332 ? 102.476 13.337  113.642 1.00 92.42 ? 330 ARG D CB  1 
ATOM   9164  C CG  . ARG D 1 332 ? 102.172 11.885  113.967 1.00 92.42 ? 330 ARG D CG  1 
ATOM   9165  C CD  . ARG D 1 332 ? 102.570 10.999  112.802 1.00 92.42 ? 330 ARG D CD  1 
ATOM   9166  N NE  . ARG D 1 332 ? 101.871 11.403  111.588 1.00 92.42 ? 330 ARG D NE  1 
ATOM   9167  C CZ  . ARG D 1 332 ? 102.304 11.157  110.358 1.00 92.42 ? 330 ARG D CZ  1 
ATOM   9168  N NH1 . ARG D 1 332 ? 103.444 10.505  110.165 1.00 92.42 ? 330 ARG D NH1 1 
ATOM   9169  N NH2 . ARG D 1 332 ? 101.594 11.569  109.320 1.00 92.42 ? 330 ARG D NH2 1 
ATOM   9170  N N   . ALA D 1 333 ? 103.941 15.952  113.591 1.00 54.12 ? 331 ALA D N   1 
ATOM   9171  C CA  . ALA D 1 333 ? 104.087 17.358  113.209 1.00 54.12 ? 331 ALA D CA  1 
ATOM   9172  C C   . ALA D 1 333 ? 105.427 17.626  112.553 1.00 54.12 ? 331 ALA D C   1 
ATOM   9173  O O   . ALA D 1 333 ? 105.624 18.666  111.942 1.00 54.12 ? 331 ALA D O   1 
ATOM   9174  C CB  . ALA D 1 333 ? 103.915 18.268  114.407 1.00 30.69 ? 331 ALA D CB  1 
ATOM   9175  N N   . MET D 1 334 ? 106.352 16.688  112.675 1.00 73.64 ? 332 MET D N   1 
ATOM   9176  C CA  . MET D 1 334 ? 107.647 16.868  112.049 1.00 73.64 ? 332 MET D CA  1 
ATOM   9177  C C   . MET D 1 334 ? 107.554 16.337  110.614 1.00 73.64 ? 332 MET D C   1 
ATOM   9178  O O   . MET D 1 334 ? 108.157 16.887  109.692 1.00 73.64 ? 332 MET D O   1 
ATOM   9179  C CB  . MET D 1 334 ? 108.709 16.113  112.835 1.00 61.99 ? 332 MET D CB  1 
ATOM   9180  C CG  . MET D 1 334 ? 110.101 16.665  112.656 1.00 61.99 ? 332 MET D CG  1 
ATOM   9181  S SD  . MET D 1 334 ? 111.244 15.901  113.807 1.00 61.99 ? 332 MET D SD  1 
ATOM   9182  C CE  . MET D 1 334 ? 110.769 16.720  115.353 1.00 61.99 ? 332 MET D CE  1 
ATOM   9183  N N   . ALA D 1 335 ? 106.776 15.274  110.436 1.00 46.93 ? 333 ALA D N   1 
ATOM   9184  C CA  . ALA D 1 335 ? 106.578 14.657  109.128 1.00 46.93 ? 333 ALA D CA  1 
ATOM   9185  C C   . ALA D 1 335 ? 105.772 15.566  108.206 1.00 46.93 ? 333 ALA D C   1 
ATOM   9186  O O   . ALA D 1 335 ? 106.107 15.736  107.040 1.00 46.93 ? 333 ALA D O   1 
ATOM   9187  C CB  . ALA D 1 335 ? 105.865 13.322  109.291 1.00 91.13 ? 333 ALA D CB  1 
ATOM   9188  N N   . ASN D 1 336 ? 104.695 16.134  108.733 1.00 48.56 ? 334 ASN D N   1 
ATOM   9189  C CA  . ASN D 1 336 ? 103.839 17.040  107.973 1.00 48.56 ? 334 ASN D CA  1 
ATOM   9190  C C   . ASN D 1 336 ? 104.562 18.337  107.638 1.00 48.56 ? 334 ASN D C   1 
ATOM   9191  O O   . ASN D 1 336 ? 104.265 18.966  106.631 1.00 48.56 ? 334 ASN D O   1 
ATOM   9192  C CB  . ASN D 1 336 ? 102.562 17.326  108.754 1.00 46.89 ? 334 ASN D CB  1 
ATOM   9193  C CG  . ASN D 1 336 ? 101.647 16.132  108.793 1.00 46.89 ? 334 ASN D CG  1 
ATOM   9194  O OD1 . ASN D 1 336 ? 100.993 15.823  107.806 1.00 46.89 ? 334 ASN D OD1 1 
ATOM   9195  N ND2 . ASN D 1 336 ? 101.613 15.435  109.923 1.00 46.89 ? 334 ASN D ND2 1 
ATOM   9196  N N   . CYS D 1 337 ? 105.500 18.753  108.483 1.00 58.85 ? 335 CYS D N   1 
ATOM   9197  C CA  . CYS D 1 337 ? 106.264 19.954  108.180 1.00 58.85 ? 335 CYS D CA  1 
ATOM   9198  C C   . CYS D 1 337 ? 107.082 19.574  106.957 1.00 58.85 ? 335 CYS D C   1 
ATOM   9199  O O   . CYS D 1 337 ? 107.397 20.405  106.100 1.00 58.85 ? 335 CYS D O   1 
ATOM   9200  C CB  . CYS D 1 337 ? 107.219 20.297  109.310 1.00 73.21 ? 335 CYS D CB  1 
ATOM   9201  S SG  . CYS D 1 337 ? 108.491 21.451  108.782 1.00 73.21 ? 335 CYS D SG  1 
ATOM   9202  N N   . GLN D 1 338 ? 107.425 18.289  106.908 1.00 34.24 ? 336 GLN D N   1 
ATOM   9203  C CA  . GLN D 1 338 ? 108.191 17.715  105.818 1.00 34.24 ? 336 GLN D CA  1 
ATOM   9204  C C   . GLN D 1 338 ? 107.261 17.618  104.619 1.00 34.24 ? 336 GLN D C   1 
ATOM   9205  O O   . GLN D 1 338 ? 107.595 18.056  103.522 1.00 34.24 ? 336 GLN D O   1 
ATOM   9206  C CB  . GLN D 1 338 ? 108.684 16.322  106.218 1.00 90.06 ? 336 GLN D CB  1 
ATOM   9207  C CG  . GLN D 1 338 ? 110.021 15.950  105.636 1.00 90.06 ? 336 GLN D CG  1 
ATOM   9208  C CD  . GLN D 1 338 ? 111.005 17.099  105.726 1.00 90.06 ? 336 GLN D CD  1 
ATOM   9209  O OE1 . GLN D 1 338 ? 111.136 17.742  106.769 1.00 90.06 ? 336 GLN D OE1 1 
ATOM   9210  N NE2 . GLN D 1 338 ? 111.702 17.365  104.629 1.00 90.06 ? 336 GLN D NE2 1 
ATOM   9211  N N   . ALA D 1 339 ? 106.082 17.047  104.842 1.00 32.50 ? 337 ALA D N   1 
ATOM   9212  C CA  . ALA D 1 339 ? 105.088 16.896  103.785 1.00 32.50 ? 337 ALA D CA  1 
ATOM   9213  C C   . ALA D 1 339 ? 104.704 18.268  103.264 1.00 32.50 ? 337 ALA D C   1 
ATOM   9214  O O   . ALA D 1 339 ? 104.438 18.436  102.082 1.00 32.50 ? 337 ALA D O   1 
ATOM   9215  C CB  . ALA D 1 339 ? 103.865 16.172  104.316 1.00 84.11 ? 337 ALA D CB  1 
ATOM   9216  N N   . ALA D 1 340 ? 104.689 19.246  104.162 1.00 30.61 ? 338 ALA D N   1 
ATOM   9217  C CA  . ALA D 1 340 ? 104.362 20.621  103.822 1.00 30.61 ? 338 ALA D CA  1 
ATOM   9218  C C   . ALA D 1 340 ? 105.431 21.181  102.892 1.00 30.61 ? 338 ALA D C   1 
ATOM   9219  O O   . ALA D 1 340 ? 105.125 21.935  101.979 1.00 30.61 ? 338 ALA D O   1 
ATOM   9220  C CB  . ALA D 1 340 ? 104.278 21.460  105.084 1.00 86.12 ? 338 ALA D CB  1 
ATOM   9221  N N   . LYS D 1 341 ? 106.692 20.837  103.136 1.00 45.17 ? 339 LYS D N   1 
ATOM   9222  C CA  . LYS D 1 341 ? 107.767 21.308  102.266 1.00 45.17 ? 339 LYS D CA  1 
ATOM   9223  C C   . LYS D 1 341 ? 107.605 20.587  100.924 1.00 45.17 ? 339 LYS D C   1 
ATOM   9224  O O   . LYS D 1 341 ? 107.603 21.208  99.859  1.00 45.17 ? 339 LYS D O   1 
ATOM   9225  C CB  . LYS D 1 341 ? 109.145 20.980  102.865 1.00 67.96 ? 339 LYS D CB  1 
ATOM   9226  C CG  . LYS D 1 341 ? 109.579 21.850  104.037 1.00 67.96 ? 339 LYS D CG  1 
ATOM   9227  C CD  . LYS D 1 341 ? 109.937 23.253  103.576 1.00 67.96 ? 339 LYS D CD  1 
ATOM   9228  C CE  . LYS D 1 341 ? 110.307 24.145  104.751 1.00 67.96 ? 339 LYS D CE  1 
ATOM   9229  N NZ  . LYS D 1 341 ? 110.461 25.572  104.353 1.00 67.96 ? 339 LYS D NZ  1 
ATOM   9230  N N   . GLY D 1 342 ? 107.459 19.265  100.992 1.00 56.66 ? 340 GLY D N   1 
ATOM   9231  C CA  . GLY D 1 342 ? 107.292 18.473  99.790  1.00 56.66 ? 340 GLY D CA  1 
ATOM   9232  C C   . GLY D 1 342 ? 108.335 17.390  99.622  1.00 56.66 ? 340 GLY D C   1 
ATOM   9233  O O   . GLY D 1 342 ? 108.840 17.186  98.519  1.00 56.66 ? 340 GLY D O   1 
ATOM   9234  N N   . GLN D 1 343 ? 108.676 16.708  100.713 1.00 54.09 ? 341 GLN D N   1 
ATOM   9235  C CA  . GLN D 1 343 ? 109.657 15.625  100.660 1.00 54.09 ? 341 GLN D CA  1 
ATOM   9236  C C   . GLN D 1 343 ? 109.541 14.616  101.787 1.00 54.09 ? 341 GLN D C   1 
ATOM   9237  O O   . GLN D 1 343 ? 110.471 14.464  102.570 1.00 54.09 ? 341 GLN D O   1 
ATOM   9238  C CB  . GLN D 1 343 ? 111.080 16.169  100.661 1.00 59.75 ? 341 GLN D CB  1 
ATOM   9239  C CG  . GLN D 1 343 ? 111.361 17.112  101.786 1.00 59.75 ? 341 GLN D CG  1 
ATOM   9240  C CD  . GLN D 1 343 ? 111.071 18.534  101.399 1.00 59.75 ? 341 GLN D CD  1 
ATOM   9241  O OE1 . GLN D 1 343 ? 109.974 18.858  100.959 1.00 59.75 ? 341 GLN D OE1 1 
ATOM   9242  N NE2 . GLN D 1 343 ? 112.063 19.400  101.552 1.00 59.75 ? 341 GLN D NE2 1 
ATOM   9243  N N   . TYR D 1 344 ? 108.409 13.927  101.874 1.00 59.91 ? 342 TYR D N   1 
ATOM   9244  C CA  . TYR D 1 344 ? 108.228 12.915  102.903 1.00 59.91 ? 342 TYR D CA  1 
ATOM   9245  C C   . TYR D 1 344 ? 108.971 11.649  102.440 1.00 59.91 ? 342 TYR D C   1 
ATOM   9246  O O   . TYR D 1 344 ? 108.314 10.648  102.092 1.00 59.91 ? 342 TYR D O   1 
ATOM   9247  C CB  . TYR D 1 344 ? 106.737 12.623  103.107 1.00 70.50 ? 342 TYR D CB  1 
ATOM   9248  C CG  . TYR D 1 344 ? 106.444 11.587  104.179 1.00 70.50 ? 342 TYR D CG  1 
ATOM   9249  C CD1 . TYR D 1 344 ? 106.571 11.895  105.535 1.00 70.50 ? 342 TYR D CD1 1 
ATOM   9250  C CD2 . TYR D 1 344 ? 106.051 10.291  103.835 1.00 70.50 ? 342 TYR D CD2 1 
ATOM   9251  C CE1 . TYR D 1 344 ? 106.311 10.935  106.524 1.00 70.50 ? 342 TYR D CE1 1 
ATOM   9252  C CE2 . TYR D 1 344 ? 105.795 9.326   104.813 1.00 70.50 ? 342 TYR D CE2 1 
ATOM   9253  C CZ  . TYR D 1 344 ? 105.926 9.655   106.152 1.00 70.50 ? 342 TYR D CZ  1 
ATOM   9254  O OH  . TYR D 1 344 ? 105.675 8.702   107.114 1.00 70.50 ? 342 TYR D OH  1 
ATOM   9255  N N   . ALA E 1 8   ? 25.300  -11.499 -14.540 1.00 60.09 ? 6   ALA W N   1 
ATOM   9256  C CA  . ALA E 1 8   ? 26.691  -11.971 -14.257 1.00 54.70 ? 6   ALA W CA  1 
ATOM   9257  C C   . ALA E 1 8   ? 26.861  -13.443 -14.632 1.00 57.48 ? 6   ALA W C   1 
ATOM   9258  O O   . ALA E 1 8   ? 25.889  -14.135 -14.963 1.00 63.54 ? 6   ALA W O   1 
ATOM   9259  C CB  . ALA E 1 8   ? 27.059  -11.756 -12.761 1.00 37.15 ? 6   ALA W CB  1 
ATOM   9260  N N   . LEU E 1 9   ? 28.108  -13.907 -14.566 1.00 59.41 ? 7   LEU W N   1 
ATOM   9261  C CA  . LEU E 1 9   ? 28.460  -15.277 -14.910 1.00 60.66 ? 7   LEU W CA  1 
ATOM   9262  C C   . LEU E 1 9   ? 27.416  -16.309 -14.546 1.00 64.79 ? 7   LEU W C   1 
ATOM   9263  O O   . LEU E 1 9   ? 26.939  -16.370 -13.415 1.00 69.18 ? 7   LEU W O   1 
ATOM   9264  C CB  . LEU E 1 9   ? 29.798  -15.653 -14.275 1.00 9.44  ? 7   LEU W CB  1 
ATOM   9265  C CG  . LEU E 1 9   ? 31.004  -14.995 -14.952 1.00 12.89 ? 7   LEU W CG  1 
ATOM   9266  C CD1 . LEU E 1 9   ? 32.267  -15.328 -14.182 1.00 21.60 ? 7   LEU W CD1 1 
ATOM   9267  C CD2 . LEU E 1 9   ? 31.116  -15.461 -16.394 1.00 10.85 ? 7   LEU W CD2 1 
ATOM   9268  N N   . THR E 1 10  ? 27.075  -17.119 -15.537 1.00 90.69 ? 8   THR W N   1 
ATOM   9269  C CA  . THR E 1 10  ? 26.100  -18.184 -15.394 1.00 90.69 ? 8   THR W CA  1 
ATOM   9270  C C   . THR E 1 10  ? 26.849  -19.452 -15.007 1.00 90.69 ? 8   THR W C   1 
ATOM   9271  O O   . THR E 1 10  ? 28.079  -19.501 -15.121 1.00 90.69 ? 8   THR W O   1 
ATOM   9272  C CB  . THR E 1 10  ? 25.379  -18.411 -16.717 1.00 67.28 ? 8   THR W CB  1 
ATOM   9273  O OG1 . THR E 1 10  ? 26.350  -18.477 -17.771 1.00 68.85 ? 8   THR W OG1 1 
ATOM   9274  C CG2 . THR E 1 10  ? 24.414  -17.269 -16.994 1.00 52.69 ? 8   THR W CG2 1 
ATOM   9275  N N   . GLN E 1 11  ? 26.118  -20.475 -14.562 1.00 65.17 ? 9   GLN W N   1 
ATOM   9276  C CA  . GLN E 1 11  ? 26.756  -21.722 -14.154 1.00 65.17 ? 9   GLN W CA  1 
ATOM   9277  C C   . GLN E 1 11  ? 27.582  -22.292 -15.297 1.00 65.17 ? 9   GLN W C   1 
ATOM   9278  O O   . GLN E 1 11  ? 28.698  -22.779 -15.096 1.00 65.17 ? 9   GLN W O   1 
ATOM   9279  C CB  . GLN E 1 11  ? 25.713  -22.744 -13.706 1.00 82.16 ? 9   GLN W CB  1 
ATOM   9280  C CG  . GLN E 1 11  ? 26.329  -23.957 -13.019 1.00 82.16 ? 9   GLN W CG  1 
ATOM   9281  C CD  . GLN E 1 11  ? 27.082  -23.607 -11.728 1.00 82.16 ? 9   GLN W CD  1 
ATOM   9282  O OE1 . GLN E 1 11  ? 27.964  -24.353 -11.289 1.00 82.16 ? 9   GLN W OE1 1 
ATOM   9283  N NE2 . GLN E 1 11  ? 26.726  -22.483 -11.111 1.00 82.16 ? 9   GLN W NE2 1 
ATOM   9284  N N   . GLU E 1 12  ? 27.035  -22.210 -16.503 1.00 48.34 ? 10  GLU W N   1 
ATOM   9285  C CA  . GLU E 1 12  ? 27.729  -22.716 -17.674 1.00 48.34 ? 10  GLU W CA  1 
ATOM   9286  C C   . GLU E 1 12  ? 29.005  -21.948 -17.986 1.00 48.34 ? 10  GLU W C   1 
ATOM   9287  O O   . GLU E 1 12  ? 30.025  -22.551 -18.310 1.00 48.34 ? 10  GLU W O   1 
ATOM   9288  C CB  . GLU E 1 12  ? 26.818  -22.680 -18.893 1.00 71.98 ? 10  GLU W CB  1 
ATOM   9289  C CG  . GLU E 1 12  ? 27.566  -23.016 -20.157 1.00 71.98 ? 10  GLU W CG  1 
ATOM   9290  C CD  . GLU E 1 12  ? 26.696  -22.946 -21.386 1.00 71.98 ? 10  GLU W CD  1 
ATOM   9291  O OE1 . GLU E 1 12  ? 25.904  -21.982 -21.503 1.00 71.98 ? 10  GLU W OE1 1 
ATOM   9292  O OE2 . GLU E 1 12  ? 26.816  -23.852 -22.241 1.00 71.98 ? 10  GLU W OE2 1 
ATOM   9293  N N   . GLN E 1 13  ? 28.941  -20.622 -17.900 1.00 48.05 ? 11  GLN W N   1 
ATOM   9294  C CA  . GLN E 1 13  ? 30.096  -19.769 -18.178 1.00 48.05 ? 11  GLN W CA  1 
ATOM   9295  C C   . GLN E 1 13  ? 31.261  -20.041 -17.238 1.00 48.05 ? 11  GLN W C   1 
ATOM   9296  O O   . GLN E 1 13  ? 32.427  -20.016 -17.641 1.00 48.05 ? 11  GLN W O   1 
ATOM   9297  C CB  . GLN E 1 13  ? 29.697  -18.302 -18.074 1.00 60.43 ? 11  GLN W CB  1 
ATOM   9298  C CG  . GLN E 1 13  ? 29.166  -17.724 -19.356 1.00 60.43 ? 11  GLN W CG  1 
ATOM   9299  C CD  . GLN E 1 13  ? 28.834  -16.262 -19.229 1.00 60.43 ? 11  GLN W CD  1 
ATOM   9300  O OE1 . GLN E 1 13  ? 27.750  -15.896 -18.771 1.00 60.43 ? 11  GLN W OE1 1 
ATOM   9301  N NE2 . GLN E 1 13  ? 29.779  -15.407 -19.618 1.00 60.43 ? 11  GLN W NE2 1 
ATOM   9302  N N   . LYS E 1 14  ? 30.930  -20.277 -15.975 1.00 68.57 ? 12  LYS W N   1 
ATOM   9303  C CA  . LYS E 1 14  ? 31.935  -20.575 -14.971 1.00 68.57 ? 12  LYS W CA  1 
ATOM   9304  C C   . LYS E 1 14  ? 32.560  -21.897 -15.363 1.00 68.57 ? 12  LYS W C   1 
ATOM   9305  O O   . LYS E 1 14  ? 33.768  -21.994 -15.572 1.00 68.57 ? 12  LYS W O   1 
ATOM   9306  C CB  . LYS E 1 14  ? 31.287  -20.717 -13.600 1.00 66.96 ? 12  LYS W CB  1 
ATOM   9307  C CG  . LYS E 1 14  ? 30.615  -19.466 -13.102 1.00 66.96 ? 12  LYS W CG  1 
ATOM   9308  C CD  . LYS E 1 14  ? 29.941  -19.731 -11.775 1.00 66.96 ? 12  LYS W CD  1 
ATOM   9309  C CE  . LYS E 1 14  ? 29.237  -18.497 -11.262 1.00 66.96 ? 12  LYS W CE  1 
ATOM   9310  N NZ  . LYS E 1 14  ? 28.450  -18.832 -10.054 1.00 66.96 ? 12  LYS W NZ  1 
ATOM   9311  N N   . LYS E 1 15  ? 31.708  -22.912 -15.457 1.00 37.15 ? 13  LYS W N   1 
ATOM   9312  C CA  . LYS E 1 15  ? 32.127  -24.251 -15.827 1.00 37.15 ? 13  LYS W CA  1 
ATOM   9313  C C   . LYS E 1 15  ? 33.239  -24.269 -16.876 1.00 37.15 ? 13  LYS W C   1 
ATOM   9314  O O   . LYS E 1 15  ? 34.155  -25.095 -16.784 1.00 37.15 ? 13  LYS W O   1 
ATOM   9315  C CB  . LYS E 1 15  ? 30.919  -25.029 -16.344 1.00 57.87 ? 13  LYS W CB  1 
ATOM   9316  C CG  . LYS E 1 15  ? 31.226  -26.417 -16.874 1.00 57.87 ? 13  LYS W CG  1 
ATOM   9317  C CD  . LYS E 1 15  ? 29.979  -26.990 -17.496 1.00 57.87 ? 13  LYS W CD  1 
ATOM   9318  C CE  . LYS E 1 15  ? 30.260  -28.263 -18.248 1.00 57.87 ? 13  LYS W CE  1 
ATOM   9319  N NZ  . LYS E 1 15  ? 29.079  -28.608 -19.094 1.00 57.87 ? 13  LYS W NZ  1 
ATOM   9320  N N   . GLU E 1 16  ? 33.149  -23.368 -17.865 1.00 54.83 ? 14  GLU W N   1 
ATOM   9321  C CA  . GLU E 1 16  ? 34.147  -23.265 -18.948 1.00 54.83 ? 14  GLU W CA  1 
ATOM   9322  C C   . GLU E 1 16  ? 35.422  -22.550 -18.505 1.00 54.83 ? 14  GLU W C   1 
ATOM   9323  O O   . GLU E 1 16  ? 36.521  -22.867 -18.976 1.00 54.83 ? 14  GLU W O   1 
ATOM   9324  C CB  . GLU E 1 16  ? 33.575  -22.533 -20.169 1.00 43.98 ? 14  GLU W CB  1 
ATOM   9325  C CG  . GLU E 1 16  ? 34.658  -21.826 -20.991 1.00 43.98 ? 14  GLU W CG  1 
ATOM   9326  C CD  . GLU E 1 16  ? 34.159  -21.288 -22.319 1.00 43.98 ? 14  GLU W CD  1 
ATOM   9327  O OE1 . GLU E 1 16  ? 32.955  -20.966 -22.420 1.00 43.98 ? 14  GLU W OE1 1 
ATOM   9328  O OE2 . GLU E 1 16  ? 34.980  -21.176 -23.260 1.00 43.98 ? 14  GLU W OE2 1 
ATOM   9329  N N   . LEU E 1 17  ? 35.263  -21.569 -17.621 1.00 35.02 ? 15  LEU W N   1 
ATOM   9330  C CA  . LEU E 1 17  ? 36.403  -20.836 -17.105 1.00 35.02 ? 15  LEU W CA  1 
ATOM   9331  C C   . LEU E 1 17  ? 37.114  -21.794 -16.159 1.00 35.02 ? 15  LEU W C   1 
ATOM   9332  O O   . LEU E 1 17  ? 38.343  -21.857 -16.143 1.00 35.02 ? 15  LEU W O   1 
ATOM   9333  C CB  . LEU E 1 17  ? 35.932  -19.552 -16.404 1.00 22.23 ? 15  LEU W CB  1 
ATOM   9334  C CG  . LEU E 1 17  ? 35.302  -18.529 -17.368 1.00 22.23 ? 15  LEU W CG  1 
ATOM   9335  C CD1 . LEU E 1 17  ? 34.516  -17.493 -16.606 1.00 22.23 ? 15  LEU W CD1 1 
ATOM   9336  C CD2 . LEU E 1 17  ? 36.377  -17.853 -18.183 1.00 22.23 ? 15  LEU W CD2 1 
ATOM   9337  N N   . SER E 1 18  ? 36.328  -22.551 -15.391 1.00 34.13 ? 16  SER W N   1 
ATOM   9338  C CA  . SER E 1 18  ? 36.871  -23.563 -14.478 1.00 34.13 ? 16  SER W CA  1 
ATOM   9339  C C   . SER E 1 18  ? 37.759  -24.444 -15.346 1.00 34.13 ? 16  SER W C   1 
ATOM   9340  O O   . SER E 1 18  ? 38.961  -24.575 -15.096 1.00 34.13 ? 16  SER W O   1 
ATOM   9341  C CB  . SER E 1 18  ? 35.753  -24.442 -13.895 1.00 44.31 ? 16  SER W CB  1 
ATOM   9342  O OG  . SER E 1 18  ? 34.933  -23.737 -12.983 1.00 44.31 ? 16  SER W OG  1 
ATOM   9343  N N   . GLU E 1 19  ? 37.127  -25.033 -16.369 1.00 33.00 ? 17  GLU W N   1 
ATOM   9344  C CA  . GLU E 1 19  ? 37.770  -25.915 -17.339 1.00 33.00 ? 17  GLU W CA  1 
ATOM   9345  C C   . GLU E 1 19  ? 39.122  -25.395 -17.787 1.00 33.00 ? 17  GLU W C   1 
ATOM   9346  O O   . GLU E 1 19  ? 40.159  -25.988 -17.482 1.00 33.00 ? 17  GLU W O   1 
ATOM   9347  C CB  . GLU E 1 19  ? 36.899  -26.068 -18.585 1.00 50.45 ? 17  GLU W CB  1 
ATOM   9348  C CG  . GLU E 1 19  ? 35.897  -27.205 -18.570 1.00 50.45 ? 17  GLU W CG  1 
ATOM   9349  C CD  . GLU E 1 19  ? 35.546  -27.665 -19.982 1.00 50.45 ? 17  GLU W CD  1 
ATOM   9350  O OE1 . GLU E 1 19  ? 36.469  -28.137 -20.687 1.00 50.45 ? 17  GLU W OE1 1 
ATOM   9351  O OE2 . GLU E 1 19  ? 34.358  -27.548 -20.380 1.00 50.45 ? 17  GLU W OE2 1 
ATOM   9352  N N   . ILE E 1 20  ? 39.086  -24.287 -18.528 1.00 42.20 ? 18  ILE W N   1 
ATOM   9353  C CA  . ILE E 1 20  ? 40.278  -23.642 -19.075 1.00 42.20 ? 18  ILE W CA  1 
ATOM   9354  C C   . ILE E 1 20  ? 41.310  -23.310 -18.015 1.00 42.20 ? 18  ILE W C   1 
ATOM   9355  O O   . ILE E 1 20  ? 42.515  -23.461 -18.233 1.00 42.20 ? 18  ILE W O   1 
ATOM   9356  C CB  . ILE E 1 20  ? 39.932  -22.330 -19.753 1.00 11.60 ? 18  ILE W CB  1 
ATOM   9357  C CG1 . ILE E 1 20  ? 38.732  -22.521 -20.684 1.00 11.60 ? 18  ILE W CG1 1 
ATOM   9358  C CG2 . ILE E 1 20  ? 41.147  -21.818 -20.476 1.00 11.60 ? 18  ILE W CG2 1 
ATOM   9359  C CD1 . ILE E 1 20  ? 38.342  -21.280 -21.506 1.00 11.60 ? 18  ILE W CD1 1 
ATOM   9360  N N   . ALA E 1 21  ? 40.815  -22.835 -16.875 1.00 31.26 ? 19  ALA W N   1 
ATOM   9361  C CA  . ALA E 1 21  ? 41.651  -22.445 -15.755 1.00 36.54 ? 19  ALA W CA  1 
ATOM   9362  C C   . ALA E 1 21  ? 42.472  -23.597 -15.227 1.00 36.00 ? 19  ALA W C   1 
ATOM   9363  O O   . ALA E 1 21  ? 43.697  -23.559 -15.285 1.00 39.53 ? 19  ALA W O   1 
ATOM   9364  C CB  . ALA E 1 21  ? 40.792  -21.888 -14.654 1.00 52.35 ? 19  ALA W CB  1 
ATOM   9365  N N   . GLN E 1 22  ? 41.798  -24.617 -14.704 1.00 36.84 ? 20  GLN W N   1 
ATOM   9366  C CA  . GLN E 1 22  ? 42.479  -25.784 -14.151 1.00 44.26 ? 20  GLN W CA  1 
ATOM   9367  C C   . GLN E 1 22  ? 43.312  -26.437 -15.247 1.00 51.26 ? 20  GLN W C   1 
ATOM   9368  O O   . GLN E 1 22  ? 44.501  -26.697 -15.071 1.00 53.04 ? 20  GLN W O   1 
ATOM   9369  C CB  . GLN E 1 22  ? 41.449  -26.775 -13.590 1.00 22.66 ? 20  GLN W CB  1 
ATOM   9370  C CG  . GLN E 1 22  ? 40.624  -26.222 -12.413 1.00 40.42 ? 20  GLN W CG  1 
ATOM   9371  C CD  . GLN E 1 22  ? 39.394  -27.054 -12.087 1.00 44.83 ? 20  GLN W CD  1 
ATOM   9372  O OE1 . GLN E 1 22  ? 39.504  -28.193 -11.661 1.00 72.29 ? 20  GLN W OE1 1 
ATOM   9373  N NE2 . GLN E 1 22  ? 38.213  -26.476 -12.286 1.00 69.69 ? 20  GLN W NE2 1 
ATOM   9374  N N   . SER E 1 23  ? 42.676  -26.665 -16.390 1.00 29.30 ? 21  SER W N   1 
ATOM   9375  C CA  . SER E 1 23  ? 43.305  -27.283 -17.556 1.00 33.07 ? 21  SER W CA  1 
ATOM   9376  C C   . SER E 1 23  ? 44.704  -26.787 -17.939 1.00 32.05 ? 21  SER W C   1 
ATOM   9377  O O   . SER E 1 23  ? 45.415  -27.449 -18.691 1.00 40.95 ? 21  SER W O   1 
ATOM   9378  C CB  . SER E 1 23  ? 42.400  -27.097 -18.767 1.00 16.44 ? 21  SER W CB  1 
ATOM   9379  O OG  . SER E 1 23  ? 42.379  -25.732 -19.157 1.00 28.76 ? 21  SER W OG  1 
ATOM   9380  N N   . ILE E 1 24  ? 45.099  -25.626 -17.443 1.00 38.85 ? 22  ILE W N   1 
ATOM   9381  C CA  . ILE E 1 24  ? 46.397  -25.094 -17.804 1.00 36.14 ? 22  ILE W CA  1 
ATOM   9382  C C   . ILE E 1 24  ? 47.530  -25.553 -16.893 1.00 44.14 ? 22  ILE W C   1 
ATOM   9383  O O   . ILE E 1 24  ? 48.685  -25.625 -17.326 1.00 43.61 ? 22  ILE W O   1 
ATOM   9384  C CB  . ILE E 1 24  ? 46.345  -23.549 -17.861 1.00 36.08 ? 22  ILE W CB  1 
ATOM   9385  C CG1 . ILE E 1 24  ? 45.225  -23.124 -18.815 1.00 39.34 ? 22  ILE W CG1 1 
ATOM   9386  C CG2 . ILE E 1 24  ? 47.694  -22.982 -18.328 1.00 29.51 ? 22  ILE W CG2 1 
ATOM   9387  C CD1 . ILE E 1 24  ? 45.131  -21.637 -19.026 1.00 37.29 ? 22  ILE W CD1 1 
ATOM   9388  N N   . VAL E 1 25  ? 47.210  -25.862 -15.640 1.00 55.11 ? 23  VAL W N   1 
ATOM   9389  C CA  . VAL E 1 25  ? 48.222  -26.326 -14.689 1.00 51.52 ? 23  VAL W CA  1 
ATOM   9390  C C   . VAL E 1 25  ? 48.024  -27.811 -14.400 1.00 63.97 ? 23  VAL W C   1 
ATOM   9391  O O   . VAL E 1 25  ? 48.909  -28.493 -13.883 1.00 57.62 ? 23  VAL W O   1 
ATOM   9392  C CB  . VAL E 1 25  ? 48.159  -25.519 -13.386 1.00 54.41 ? 23  VAL W CB  1 
ATOM   9393  C CG1 . VAL E 1 25  ? 48.860  -24.184 -13.584 1.00 42.28 ? 23  VAL W CG1 1 
ATOM   9394  C CG2 . VAL E 1 25  ? 46.712  -25.279 -12.998 1.00 42.70 ? 23  VAL W CG2 1 
ATOM   9395  N N   . ALA E 1 26  ? 46.843  -28.282 -14.778 1.00 81.54 ? 24  ALA W N   1 
ATOM   9396  C CA  . ALA E 1 26  ? 46.402  -29.663 -14.638 1.00 81.54 ? 24  ALA W CA  1 
ATOM   9397  C C   . ALA E 1 26  ? 47.305  -30.637 -13.889 1.00 81.54 ? 24  ALA W C   1 
ATOM   9398  O O   . ALA E 1 26  ? 46.952  -31.119 -12.803 1.00 81.54 ? 24  ALA W O   1 
ATOM   9399  C CB  . ALA E 1 26  ? 46.089  -30.221 -16.021 1.00 88.17 ? 24  ALA W CB  1 
ATOM   9400  N N   . ASN E 1 27  ? 48.458  -30.945 -14.476 1.00 32.66 ? 25  ASN W N   1 
ATOM   9401  C CA  . ASN E 1 27  ? 49.371  -31.895 -13.859 1.00 29.26 ? 25  ASN W CA  1 
ATOM   9402  C C   . ASN E 1 27  ? 50.811  -31.405 -13.912 1.00 37.62 ? 25  ASN W C   1 
ATOM   9403  O O   . ASN E 1 27  ? 51.641  -31.937 -14.650 1.00 42.94 ? 25  ASN W O   1 
ATOM   9404  C CB  . ASN E 1 27  ? 49.262  -33.259 -14.555 1.00 54.94 ? 25  ASN W CB  1 
ATOM   9405  C CG  . ASN E 1 27  ? 47.819  -33.657 -14.865 1.00 64.93 ? 25  ASN W CG  1 
ATOM   9406  O OD1 . ASN E 1 27  ? 47.265  -33.278 -15.896 1.00 80.41 ? 25  ASN W OD1 1 
ATOM   9407  N ND2 . ASN E 1 27  ? 47.206  -34.415 -13.968 1.00 54.43 ? 25  ASN W ND2 1 
ATOM   9408  N N   . GLY E 1 28  ? 51.111  -30.389 -13.117 1.00 78.59 ? 26  GLY W N   1 
ATOM   9409  C CA  . GLY E 1 28  ? 52.459  -29.861 -13.102 1.00 77.57 ? 26  GLY W CA  1 
ATOM   9410  C C   . GLY E 1 28  ? 52.760  -29.168 -14.407 1.00 73.53 ? 26  GLY W C   1 
ATOM   9411  O O   . GLY E 1 28  ? 53.911  -28.849 -14.705 1.00 78.59 ? 26  GLY W O   1 
ATOM   9412  N N   . LYS E 1 29  ? 51.720  -28.948 -15.202 1.00 75.51 ? 27  LYS W N   1 
ATOM   9413  C CA  . LYS E 1 29  ? 51.900  -28.269 -16.470 1.00 79.67 ? 27  LYS W CA  1 
ATOM   9414  C C   . LYS E 1 29  ? 52.076  -26.789 -16.167 1.00 80.32 ? 27  LYS W C   1 
ATOM   9415  O O   . LYS E 1 29  ? 51.737  -26.328 -15.078 1.00 80.32 ? 27  LYS W O   1 
ATOM   9416  C CB  . LYS E 1 29  ? 50.696  -28.497 -17.389 1.00 28.43 ? 27  LYS W CB  1 
ATOM   9417  C CG  . LYS E 1 29  ? 50.615  -29.901 -17.954 1.00 41.04 ? 27  LYS W CG  1 
ATOM   9418  C CD  . LYS E 1 29  ? 49.790  -29.979 -19.248 1.00 27.45 ? 27  LYS W CD  1 
ATOM   9419  C CE  . LYS E 1 29  ? 48.287  -30.211 -19.004 1.00 29.61 ? 27  LYS W CE  1 
ATOM   9420  N NZ  . LYS E 1 29  ? 47.544  -30.428 -20.293 1.00 45.40 ? 27  LYS W NZ  1 
ATOM   9421  N N   . GLY E 1 30  ? 52.625  -26.051 -17.120 1.00 52.81 ? 28  GLY W N   1 
ATOM   9422  C CA  . GLY E 1 30  ? 52.845  -24.636 -16.919 1.00 52.81 ? 28  GLY W CA  1 
ATOM   9423  C C   . GLY E 1 30  ? 52.582  -23.898 -18.208 1.00 52.81 ? 28  GLY W C   1 
ATOM   9424  O O   . GLY E 1 30  ? 52.231  -24.524 -19.207 1.00 52.81 ? 28  GLY W O   1 
ATOM   9425  N N   . ILE E 1 31  ? 52.767  -22.580 -18.200 1.00 47.42 ? 29  ILE W N   1 
ATOM   9426  C CA  . ILE E 1 31  ? 52.509  -21.780 -19.386 1.00 47.42 ? 29  ILE W CA  1 
ATOM   9427  C C   . ILE E 1 31  ? 53.746  -21.307 -20.125 1.00 47.42 ? 29  ILE W C   1 
ATOM   9428  O O   . ILE E 1 31  ? 54.625  -20.699 -19.528 1.00 47.42 ? 29  ILE W O   1 
ATOM   9429  C CB  . ILE E 1 31  ? 51.702  -20.538 -19.036 1.00 17.79 ? 29  ILE W CB  1 
ATOM   9430  C CG1 . ILE E 1 31  ? 50.412  -20.936 -18.327 1.00 17.79 ? 29  ILE W CG1 1 
ATOM   9431  C CG2 . ILE E 1 31  ? 51.384  -19.769 -20.300 1.00 17.79 ? 29  ILE W CG2 1 
ATOM   9432  C CD1 . ILE E 1 31  ? 49.465  -19.773 -18.045 1.00 17.79 ? 29  ILE W CD1 1 
ATOM   9433  N N   . LEU E 1 32  ? 53.816  -21.581 -21.425 1.00 57.74 ? 30  LEU W N   1 
ATOM   9434  C CA  . LEU E 1 32  ? 54.947  -21.112 -22.213 1.00 57.74 ? 30  LEU W CA  1 
ATOM   9435  C C   . LEU E 1 32  ? 54.540  -19.767 -22.750 1.00 57.74 ? 30  LEU W C   1 
ATOM   9436  O O   . LEU E 1 32  ? 53.643  -19.678 -23.586 1.00 57.74 ? 30  LEU W O   1 
ATOM   9437  C CB  . LEU E 1 32  ? 55.245  -22.007 -23.412 1.00 51.48 ? 30  LEU W CB  1 
ATOM   9438  C CG  . LEU E 1 32  ? 56.127  -21.294 -24.456 1.00 51.48 ? 30  LEU W CG  1 
ATOM   9439  C CD1 . LEU E 1 32  ? 57.552  -21.166 -23.939 1.00 51.48 ? 30  LEU W CD1 1 
ATOM   9440  C CD2 . LEU E 1 32  ? 56.107  -22.061 -25.763 1.00 51.48 ? 30  LEU W CD2 1 
ATOM   9441  N N   . ALA E 1 33  ? 55.190  -18.719 -22.265 1.00 64.82 ? 31  ALA W N   1 
ATOM   9442  C CA  . ALA E 1 33  ? 54.891  -17.379 -22.732 1.00 64.82 ? 31  ALA W CA  1 
ATOM   9443  C C   . ALA E 1 33  ? 55.808  -17.111 -23.903 1.00 64.82 ? 31  ALA W C   1 
ATOM   9444  O O   . ALA E 1 33  ? 57.007  -16.912 -23.721 1.00 64.82 ? 31  ALA W O   1 
ATOM   9445  C CB  . ALA E 1 33  ? 55.142  -16.364 -21.635 1.00 87.75 ? 31  ALA W CB  1 
ATOM   9446  N N   . ALA E 1 34  ? 55.243  -17.159 -25.104 1.00 65.81 ? 32  ALA W N   1 
ATOM   9447  C CA  . ALA E 1 34  ? 55.977  -16.882 -26.331 1.00 65.81 ? 32  ALA W CA  1 
ATOM   9448  C C   . ALA E 1 34  ? 55.141  -15.799 -26.983 1.00 65.81 ? 32  ALA W C   1 
ATOM   9449  O O   . ALA E 1 34  ? 54.499  -16.003 -28.011 1.00 65.81 ? 32  ALA W O   1 
ATOM   9450  C CB  . ALA E 1 34  ? 56.045  -18.118 -27.214 1.00 21.22 ? 32  ALA W CB  1 
ATOM   9451  N N   . ASP E 1 35  ? 55.136  -14.644 -26.336 1.00 83.95 ? 33  ASP W N   1 
ATOM   9452  C CA  . ASP E 1 35  ? 54.376  -13.499 -26.791 1.00 83.95 ? 33  ASP W CA  1 
ATOM   9453  C C   . ASP E 1 35  ? 55.276  -12.277 -26.807 1.00 83.95 ? 33  ASP W C   1 
ATOM   9454  O O   . ASP E 1 35  ? 54.807  -11.151 -26.652 1.00 83.95 ? 33  ASP W O   1 
ATOM   9455  C CB  . ASP E 1 35  ? 53.182  -13.274 -25.851 1.00 82.95 ? 33  ASP W CB  1 
ATOM   9456  C CG  . ASP E 1 35  ? 53.597  -13.133 -24.382 1.00 82.95 ? 33  ASP W CG  1 
ATOM   9457  O OD1 . ASP E 1 35  ? 54.639  -13.697 -23.983 1.00 82.95 ? 33  ASP W OD1 1 
ATOM   9458  O OD2 . ASP E 1 35  ? 52.865  -12.470 -23.615 1.00 82.95 ? 33  ASP W OD2 1 
ATOM   9459  N N   . GLU E 1 36  ? 56.574  -12.503 -26.992 1.00 59.59 ? 34  GLU W N   1 
ATOM   9460  C CA  . GLU E 1 36  ? 57.523  -11.401 -27.022 1.00 59.59 ? 34  GLU W CA  1 
ATOM   9461  C C   . GLU E 1 36  ? 57.175  -10.476 -28.179 1.00 59.59 ? 34  GLU W C   1 
ATOM   9462  O O   . GLU E 1 36  ? 57.038  -10.916 -29.327 1.00 59.59 ? 34  GLU W O   1 
ATOM   9463  C CB  . GLU E 1 36  ? 58.956  -11.908 -27.193 1.00 74.66 ? 34  GLU W CB  1 
ATOM   9464  C CG  . GLU E 1 36  ? 59.322  -13.072 -26.300 1.00 74.66 ? 34  GLU W CG  1 
ATOM   9465  C CD  . GLU E 1 36  ? 59.040  -14.407 -26.960 1.00 74.66 ? 34  GLU W CD  1 
ATOM   9466  O OE1 . GLU E 1 36  ? 57.879  -14.642 -27.367 1.00 74.66 ? 34  GLU W OE1 1 
ATOM   9467  O OE2 . GLU E 1 36  ? 59.982  -15.222 -27.075 1.00 74.66 ? 34  GLU W OE2 1 
ATOM   9468  N N   . SER E 1 37  ? 57.015  -9.193  -27.864 1.00 92.42 ? 35  SER W N   1 
ATOM   9469  C CA  . SER E 1 37  ? 56.696  -8.178  -28.863 1.00 92.42 ? 35  SER W CA  1 
ATOM   9470  C C   . SER E 1 37  ? 57.840  -8.111  -29.871 1.00 92.42 ? 35  SER W C   1 
ATOM   9471  O O   . SER E 1 37  ? 58.937  -8.614  -29.605 1.00 92.42 ? 35  SER W O   1 
ATOM   9472  C CB  . SER E 1 37  ? 56.509  -6.818  -28.180 1.00 89.03 ? 35  SER W CB  1 
ATOM   9473  O OG  . SER E 1 37  ? 57.553  -6.542  -27.252 1.00 89.03 ? 35  SER W OG  1 
ATOM   9474  N N   . VAL E 1 38  ? 57.591  -7.494  -31.022 1.00 72.65 ? 36  VAL W N   1 
ATOM   9475  C CA  . VAL E 1 38  ? 58.625  -7.386  -32.050 1.00 71.09 ? 36  VAL W CA  1 
ATOM   9476  C C   . VAL E 1 38  ? 59.951  -6.961  -31.419 1.00 69.85 ? 36  VAL W C   1 
ATOM   9477  O O   . VAL E 1 38  ? 60.942  -7.688  -31.486 1.00 71.72 ? 36  VAL W O   1 
ATOM   9478  C CB  . VAL E 1 38  ? 58.238  -6.363  -33.130 1.00 70.81 ? 36  VAL W CB  1 
ATOM   9479  C CG1 . VAL E 1 38  ? 58.928  -6.725  -34.436 1.00 63.63 ? 36  VAL W CG1 1 
ATOM   9480  C CG2 . VAL E 1 38  ? 56.721  -6.319  -33.303 1.00 64.66 ? 36  VAL W CG2 1 
ATOM   9481  N N   . GLY E 1 39  ? 59.951  -5.789  -30.789 1.00 79.43 ? 37  GLY W N   1 
ATOM   9482  C CA  . GLY E 1 39  ? 61.152  -5.288  -30.144 1.00 74.85 ? 37  GLY W CA  1 
ATOM   9483  C C   . GLY E 1 39  ? 61.811  -6.263  -29.181 1.00 79.43 ? 37  GLY W C   1 
ATOM   9484  O O   . GLY E 1 39  ? 62.982  -6.617  -29.359 1.00 79.43 ? 37  GLY W O   1 
ATOM   9485  N N   . THR E 1 40  ? 61.067  -6.693  -28.162 1.00 92.42 ? 38  THR W N   1 
ATOM   9486  C CA  . THR E 1 40  ? 61.587  -7.628  -27.162 1.00 92.42 ? 38  THR W CA  1 
ATOM   9487  C C   . THR E 1 40  ? 62.216  -8.847  -27.828 1.00 92.42 ? 38  THR W C   1 
ATOM   9488  O O   . THR E 1 40  ? 63.301  -9.293  -27.445 1.00 92.42 ? 38  THR W O   1 
ATOM   9489  C CB  . THR E 1 40  ? 60.482  -8.134  -26.201 1.00 92.42 ? 38  THR W CB  1 
ATOM   9490  O OG1 . THR E 1 40  ? 59.901  -7.035  -25.486 1.00 92.42 ? 38  THR W OG1 1 
ATOM   9491  C CG2 . THR E 1 40  ? 61.077  -9.109  -25.198 1.00 92.42 ? 38  THR W CG2 1 
ATOM   9492  N N   . MET E 1 41  ? 61.521  -9.389  -28.822 1.00 74.28 ? 39  MET W N   1 
ATOM   9493  C CA  . MET E 1 41  ? 62.019  -10.549 -29.539 1.00 77.68 ? 39  MET W CA  1 
ATOM   9494  C C   . MET E 1 41  ? 63.303  -10.151 -30.261 1.00 82.68 ? 39  MET W C   1 
ATOM   9495  O O   . MET E 1 41  ? 64.254  -10.934 -30.343 1.00 82.68 ? 39  MET W O   1 
ATOM   9496  C CB  . MET E 1 41  ? 60.973  -11.036 -30.547 1.00 89.11 ? 39  MET W CB  1 
ATOM   9497  C CG  . MET E 1 41  ? 61.346  -12.347 -31.213 1.00 89.11 ? 39  MET W CG  1 
ATOM   9498  S SD  . MET E 1 41  ? 61.662  -13.647 -29.995 1.00 89.11 ? 39  MET W SD  1 
ATOM   9499  C CE  . MET E 1 41  ? 61.234  -15.139 -30.937 1.00 89.11 ? 39  MET W CE  1 
ATOM   9500  N N   . GLY E 1 42  ? 63.319  -8.922  -30.774 1.00 86.48 ? 40  GLY W N   1 
ATOM   9501  C CA  . GLY E 1 42  ? 64.481  -8.418  -31.485 1.00 86.48 ? 40  GLY W CA  1 
ATOM   9502  C C   . GLY E 1 42  ? 65.716  -8.494  -30.617 1.00 86.48 ? 40  GLY W C   1 
ATOM   9503  O O   . GLY E 1 42  ? 66.818  -8.756  -31.104 1.00 86.48 ? 40  GLY W O   1 
ATOM   9504  N N   . ASN E 1 43  ? 65.521  -8.264  -29.322 1.00 92.42 ? 41  ASN W N   1 
ATOM   9505  C CA  . ASN E 1 43  ? 66.608  -8.314  -28.355 1.00 92.42 ? 41  ASN W CA  1 
ATOM   9506  C C   . ASN E 1 43  ? 67.209  -9.721  -28.312 1.00 92.42 ? 41  ASN W C   1 
ATOM   9507  O O   . ASN E 1 43  ? 68.416  -9.900  -28.508 1.00 92.42 ? 41  ASN W O   1 
ATOM   9508  C CB  . ASN E 1 43  ? 66.091  -7.948  -26.961 1.00 92.42 ? 41  ASN W CB  1 
ATOM   9509  C CG  . ASN E 1 43  ? 67.210  -7.826  -25.934 1.00 92.42 ? 41  ASN W CG  1 
ATOM   9510  O OD1 . ASN E 1 43  ? 66.985  -7.992  -24.729 1.00 92.42 ? 41  ASN W OD1 1 
ATOM   9511  N ND2 . ASN E 1 43  ? 68.424  -7.519  -26.406 1.00 92.42 ? 41  ASN W ND2 1 
ATOM   9512  N N   . ARG E 1 44  ? 66.355  -10.714 -28.054 1.00 92.42 ? 42  ARG W N   1 
ATOM   9513  C CA  . ARG E 1 44  ? 66.768  -12.118 -27.965 1.00 92.42 ? 42  ARG W CA  1 
ATOM   9514  C C   . ARG E 1 44  ? 67.463  -12.587 -29.248 1.00 92.42 ? 42  ARG W C   1 
ATOM   9515  O O   . ARG E 1 44  ? 68.412  -13.371 -29.197 1.00 92.42 ? 42  ARG W O   1 
ATOM   9516  C CB  . ARG E 1 44  ? 65.545  -13.003 -27.696 1.00 92.42 ? 42  ARG W CB  1 
ATOM   9517  C CG  . ARG E 1 44  ? 64.470  -12.348 -26.830 1.00 92.42 ? 42  ARG W CG  1 
ATOM   9518  C CD  . ARG E 1 44  ? 64.975  -12.009 -25.428 1.00 92.42 ? 42  ARG W CD  1 
ATOM   9519  N NE  . ARG E 1 44  ? 64.027  -11.160 -24.703 1.00 92.42 ? 42  ARG W NE  1 
ATOM   9520  C CZ  . ARG E 1 44  ? 64.117  -10.850 -23.411 1.00 92.42 ? 42  ARG W CZ  1 
ATOM   9521  N NH1 . ARG E 1 44  ? 65.116  -11.318 -22.670 1.00 92.42 ? 42  ARG W NH1 1 
ATOM   9522  N NH2 . ARG E 1 44  ? 63.204  -10.067 -22.858 1.00 92.42 ? 42  ARG W NH2 1 
ATOM   9523  N N   . LEU E 1 45  ? 66.977  -12.096 -30.390 1.00 92.42 ? 43  LEU W N   1 
ATOM   9524  C CA  . LEU E 1 45  ? 67.518  -12.441 -31.710 1.00 92.42 ? 43  LEU W CA  1 
ATOM   9525  C C   . LEU E 1 45  ? 68.942  -11.938 -31.940 1.00 92.42 ? 43  LEU W C   1 
ATOM   9526  O O   . LEU E 1 45  ? 69.798  -12.667 -32.460 1.00 92.42 ? 43  LEU W O   1 
ATOM   9527  C CB  . LEU E 1 45  ? 66.589  -11.895 -32.797 1.00 66.59 ? 43  LEU W CB  1 
ATOM   9528  C CG  . LEU E 1 45  ? 65.278  -12.675 -32.912 1.00 68.45 ? 43  LEU W CG  1 
ATOM   9529  C CD1 . LEU E 1 45  ? 64.279  -11.933 -33.787 1.00 62.96 ? 43  LEU W CD1 1 
ATOM   9530  C CD2 . LEU E 1 45  ? 65.593  -14.059 -33.479 1.00 58.11 ? 43  LEU W CD2 1 
ATOM   9531  N N   . GLN E 1 46  ? 69.185  -10.685 -31.566 1.00 92.42 ? 44  GLN W N   1 
ATOM   9532  C CA  . GLN E 1 46  ? 70.513  -10.095 -31.700 1.00 92.42 ? 44  GLN W CA  1 
ATOM   9533  C C   . GLN E 1 46  ? 71.498  -11.020 -30.998 1.00 92.42 ? 44  GLN W C   1 
ATOM   9534  O O   . GLN E 1 46  ? 72.593  -11.278 -31.496 1.00 92.42 ? 44  GLN W O   1 
ATOM   9535  C CB  . GLN E 1 46  ? 70.578  -8.725  -31.012 1.00 92.42 ? 44  GLN W CB  1 
ATOM   9536  C CG  . GLN E 1 46  ? 69.701  -7.630  -31.604 1.00 92.42 ? 44  GLN W CG  1 
ATOM   9537  C CD  . GLN E 1 46  ? 69.695  -6.368  -30.747 1.00 92.42 ? 44  GLN W CD  1 
ATOM   9538  O OE1 . GLN E 1 46  ? 69.102  -5.353  -31.120 1.00 92.42 ? 44  GLN W OE1 1 
ATOM   9539  N NE2 . GLN E 1 46  ? 70.350  -6.432  -29.587 1.00 92.42 ? 44  GLN W NE2 1 
ATOM   9540  N N   . ARG E 1 47  ? 71.085  -11.512 -29.833 1.00 63.23 ? 45  ARG W N   1 
ATOM   9541  C CA  . ARG E 1 47  ? 71.912  -12.392 -29.022 1.00 67.69 ? 45  ARG W CA  1 
ATOM   9542  C C   . ARG E 1 47  ? 72.416  -13.660 -29.728 1.00 69.35 ? 45  ARG W C   1 
ATOM   9543  O O   . ARG E 1 47  ? 73.547  -14.088 -29.488 1.00 78.46 ? 45  ARG W O   1 
ATOM   9544  C CB  . ARG E 1 47  ? 71.152  -12.777 -27.751 1.00 92.42 ? 45  ARG W CB  1 
ATOM   9545  C CG  . ARG E 1 47  ? 70.546  -11.596 -27.003 1.00 92.42 ? 45  ARG W CG  1 
ATOM   9546  C CD  . ARG E 1 47  ? 70.012  -12.020 -25.636 1.00 92.42 ? 45  ARG W CD  1 
ATOM   9547  N NE  . ARG E 1 47  ? 69.214  -10.973 -24.997 1.00 92.42 ? 45  ARG W NE  1 
ATOM   9548  C CZ  . ARG E 1 47  ? 68.794  -11.018 -23.735 1.00 92.42 ? 45  ARG W CZ  1 
ATOM   9549  N NH1 . ARG E 1 47  ? 69.098  -12.058 -22.971 1.00 92.42 ? 45  ARG W NH1 1 
ATOM   9550  N NH2 . ARG E 1 47  ? 68.066  -10.026 -23.238 1.00 92.42 ? 45  ARG W NH2 1 
ATOM   9551  N N   . ILE E 1 48  ? 71.590  -14.256 -30.590 1.00 92.42 ? 46  ILE W N   1 
ATOM   9552  C CA  . ILE E 1 48  ? 71.983  -15.482 -31.300 1.00 92.42 ? 46  ILE W CA  1 
ATOM   9553  C C   . ILE E 1 48  ? 72.401  -15.269 -32.751 1.00 92.42 ? 46  ILE W C   1 
ATOM   9554  O O   . ILE E 1 48  ? 72.579  -16.241 -33.494 1.00 92.42 ? 46  ILE W O   1 
ATOM   9555  C CB  . ILE E 1 48  ? 70.850  -16.540 -31.323 1.00 92.42 ? 46  ILE W CB  1 
ATOM   9556  C CG1 . ILE E 1 48  ? 69.568  -15.900 -31.872 1.00 92.42 ? 46  ILE W CG1 1 
ATOM   9557  C CG2 . ILE E 1 48  ? 70.678  -17.163 -29.934 1.00 92.42 ? 46  ILE W CG2 1 
ATOM   9558  C CD1 . ILE E 1 48  ? 68.519  -16.895 -32.324 1.00 92.42 ? 46  ILE W CD1 1 
ATOM   9559  N N   . LYS E 1 49  ? 72.540  -14.009 -33.157 1.00 90.03 ? 47  LYS W N   1 
ATOM   9560  C CA  . LYS E 1 49  ? 72.947  -13.686 -34.524 1.00 90.03 ? 47  LYS W CA  1 
ATOM   9561  C C   . LYS E 1 49  ? 71.854  -13.920 -35.559 1.00 90.03 ? 47  LYS W C   1 
ATOM   9562  O O   . LYS E 1 49  ? 72.071  -14.623 -36.545 1.00 90.03 ? 47  LYS W O   1 
ATOM   9563  C CB  . LYS E 1 49  ? 74.180  -14.501 -34.931 1.00 90.83 ? 47  LYS W CB  1 
ATOM   9564  C CG  . LYS E 1 49  ? 75.509  -13.893 -34.542 1.00 90.83 ? 47  LYS W CG  1 
ATOM   9565  C CD  . LYS E 1 49  ? 76.652  -14.664 -35.183 1.00 90.83 ? 47  LYS W CD  1 
ATOM   9566  C CE  . LYS E 1 49  ? 77.914  -13.825 -35.217 1.00 90.83 ? 47  LYS W CE  1 
ATOM   9567  N NZ  . LYS E 1 49  ? 78.998  -14.470 -36.006 1.00 90.83 ? 47  LYS W NZ  1 
ATOM   9568  N N   . VAL E 1 50  ? 70.681  -13.339 -35.336 1.00 92.42 ? 48  VAL W N   1 
ATOM   9569  C CA  . VAL E 1 50  ? 69.574  -13.482 -36.277 1.00 92.42 ? 48  VAL W CA  1 
ATOM   9570  C C   . VAL E 1 50  ? 68.811  -12.170 -36.332 1.00 92.42 ? 48  VAL W C   1 
ATOM   9571  O O   . VAL E 1 50  ? 68.406  -11.632 -35.300 1.00 92.42 ? 48  VAL W O   1 
ATOM   9572  C CB  . VAL E 1 50  ? 68.591  -14.603 -35.859 1.00 86.50 ? 48  VAL W CB  1 
ATOM   9573  C CG1 . VAL E 1 50  ? 67.473  -14.718 -36.892 1.00 86.50 ? 48  VAL W CG1 1 
ATOM   9574  C CG2 . VAL E 1 50  ? 69.332  -15.931 -35.712 1.00 86.50 ? 48  VAL W CG2 1 
ATOM   9575  N N   . GLU E 1 51  ? 68.628  -11.650 -37.538 1.00 92.42 ? 49  GLU W N   1 
ATOM   9576  C CA  . GLU E 1 51  ? 67.911  -10.396 -37.710 1.00 92.42 ? 49  GLU W CA  1 
ATOM   9577  C C   . GLU E 1 51  ? 66.438  -10.570 -37.378 1.00 92.42 ? 49  GLU W C   1 
ATOM   9578  O O   . GLU E 1 51  ? 65.824  -11.593 -37.693 1.00 92.42 ? 49  GLU W O   1 
ATOM   9579  C CB  . GLU E 1 51  ? 68.082  -9.877  -39.139 1.00 92.42 ? 49  GLU W CB  1 
ATOM   9580  C CG  . GLU E 1 51  ? 69.324  -9.018  -39.323 1.00 92.42 ? 49  GLU W CG  1 
ATOM   9581  C CD  . GLU E 1 51  ? 69.688  -8.827  -40.781 1.00 92.42 ? 49  GLU W CD  1 
ATOM   9582  O OE1 . GLU E 1 51  ? 68.757  -8.707  -41.608 1.00 92.42 ? 49  GLU W OE1 1 
ATOM   9583  O OE2 . GLU E 1 51  ? 70.902  -8.788  -41.097 1.00 92.42 ? 49  GLU W OE2 1 
ATOM   9584  N N   . ASN E 1 52  ? 65.877  -9.562  -36.727 1.00 72.67 ? 50  ASN W N   1 
ATOM   9585  C CA  . ASN E 1 52  ? 64.486  -9.614  -36.342 1.00 78.68 ? 50  ASN W CA  1 
ATOM   9586  C C   . ASN E 1 52  ? 63.540  -9.365  -37.519 1.00 80.26 ? 50  ASN W C   1 
ATOM   9587  O O   . ASN E 1 52  ? 63.120  -8.232  -37.765 1.00 81.53 ? 50  ASN W O   1 
ATOM   9588  C CB  . ASN E 1 52  ? 64.231  -8.600  -35.227 1.00 92.42 ? 50  ASN W CB  1 
ATOM   9589  C CG  . ASN E 1 52  ? 62.839  -8.725  -34.634 1.00 92.42 ? 50  ASN W CG  1 
ATOM   9590  O OD1 . ASN E 1 52  ? 62.483  -8.000  -33.701 1.00 92.42 ? 50  ASN W OD1 1 
ATOM   9591  N ND2 . ASN E 1 52  ? 62.040  -9.648  -35.174 1.00 92.42 ? 50  ASN W ND2 1 
ATOM   9592  N N   . THR E 1 53  ? 63.213  -10.430 -38.246 1.00 85.63 ? 51  THR W N   1 
ATOM   9593  C CA  . THR E 1 53  ? 62.296  -10.327 -39.376 1.00 85.63 ? 51  THR W CA  1 
ATOM   9594  C C   . THR E 1 53  ? 61.014  -11.070 -39.003 1.00 85.63 ? 51  THR W C   1 
ATOM   9595  O O   . THR E 1 53  ? 61.037  -11.932 -38.124 1.00 85.63 ? 51  THR W O   1 
ATOM   9596  C CB  . THR E 1 53  ? 62.897  -10.953 -40.654 1.00 83.41 ? 51  THR W CB  1 
ATOM   9597  O OG1 . THR E 1 53  ? 62.287  -10.355 -41.802 1.00 83.41 ? 51  THR W OG1 1 
ATOM   9598  C CG2 . THR E 1 53  ? 62.632  -12.441 -40.703 1.00 83.41 ? 51  THR W CG2 1 
ATOM   9599  N N   . GLU E 1 54  ? 59.899  -10.743 -39.654 1.00 90.25 ? 52  GLU W N   1 
ATOM   9600  C CA  . GLU E 1 54  ? 58.645  -11.420 -39.337 1.00 90.25 ? 52  GLU W CA  1 
ATOM   9601  C C   . GLU E 1 54  ? 58.828  -12.905 -39.605 1.00 90.25 ? 52  GLU W C   1 
ATOM   9602  O O   . GLU E 1 54  ? 58.446  -13.748 -38.790 1.00 90.25 ? 52  GLU W O   1 
ATOM   9603  C CB  . GLU E 1 54  ? 57.486  -10.896 -40.192 1.00 43.21 ? 52  GLU W CB  1 
ATOM   9604  C CG  . GLU E 1 54  ? 56.140  -10.887 -39.453 1.00 59.73 ? 52  GLU W CG  1 
ATOM   9605  C CD  . GLU E 1 54  ? 54.952  -11.249 -40.341 1.00 70.32 ? 52  GLU W CD  1 
ATOM   9606  O OE1 . GLU E 1 54  ? 54.892  -10.784 -41.502 1.00 70.32 ? 52  GLU W OE1 1 
ATOM   9607  O OE2 . GLU E 1 54  ? 54.067  -11.995 -39.864 1.00 70.32 ? 52  GLU W OE2 1 
ATOM   9608  N N   . GLU E 1 55  ? 59.424  -13.220 -40.750 1.00 92.42 ? 53  GLU W N   1 
ATOM   9609  C CA  . GLU E 1 55  ? 59.655  -14.607 -41.111 1.00 92.42 ? 53  GLU W CA  1 
ATOM   9610  C C   . GLU E 1 55  ? 60.416  -15.346 -40.008 1.00 92.42 ? 53  GLU W C   1 
ATOM   9611  O O   . GLU E 1 55  ? 59.878  -16.272 -39.394 1.00 92.42 ? 53  GLU W O   1 
ATOM   9612  C CB  . GLU E 1 55  ? 60.417  -14.688 -42.436 1.00 83.61 ? 53  GLU W CB  1 
ATOM   9613  C CG  . GLU E 1 55  ? 60.640  -16.113 -42.940 1.00 83.61 ? 53  GLU W CG  1 
ATOM   9614  C CD  . GLU E 1 55  ? 59.398  -16.980 -42.818 1.00 83.61 ? 53  GLU W CD  1 
ATOM   9615  O OE1 . GLU E 1 55  ? 58.308  -16.522 -43.233 1.00 83.61 ? 53  GLU W OE1 1 
ATOM   9616  O OE2 . GLU E 1 55  ? 59.519  -18.120 -42.309 1.00 83.61 ? 53  GLU W OE2 1 
ATOM   9617  N N   . ASN E 1 56  ? 61.654  -14.935 -39.747 1.00 92.42 ? 54  ASN W N   1 
ATOM   9618  C CA  . ASN E 1 56  ? 62.458  -15.581 -38.712 1.00 92.42 ? 54  ASN W CA  1 
ATOM   9619  C C   . ASN E 1 56  ? 61.641  -15.847 -37.454 1.00 92.42 ? 54  ASN W C   1 
ATOM   9620  O O   . ASN E 1 56  ? 61.741  -16.925 -36.863 1.00 92.42 ? 54  ASN W O   1 
ATOM   9621  C CB  . ASN E 1 56  ? 63.684  -14.731 -38.369 1.00 92.42 ? 54  ASN W CB  1 
ATOM   9622  C CG  . ASN E 1 56  ? 64.705  -14.716 -39.488 1.00 92.42 ? 54  ASN W CG  1 
ATOM   9623  O OD1 . ASN E 1 56  ? 65.185  -15.769 -39.915 1.00 92.42 ? 54  ASN W OD1 1 
ATOM   9624  N ND2 . ASN E 1 56  ? 65.044  -13.524 -39.971 1.00 92.42 ? 54  ASN W ND2 1 
ATOM   9625  N N   . ARG E 1 57  ? 60.835  -14.869 -37.045 1.00 89.20 ? 55  ARG W N   1 
ATOM   9626  C CA  . ARG E 1 57  ? 59.998  -15.048 -35.867 1.00 89.20 ? 55  ARG W CA  1 
ATOM   9627  C C   . ARG E 1 57  ? 59.056  -16.216 -36.142 1.00 89.20 ? 55  ARG W C   1 
ATOM   9628  O O   . ARG E 1 57  ? 59.021  -17.184 -35.382 1.00 89.20 ? 55  ARG W O   1 
ATOM   9629  C CB  . ARG E 1 57  ? 59.203  -13.771 -35.566 1.00 63.74 ? 55  ARG W CB  1 
ATOM   9630  C CG  . ARG E 1 57  ? 60.087  -12.574 -35.235 1.00 63.74 ? 55  ARG W CG  1 
ATOM   9631  C CD  . ARG E 1 57  ? 59.380  -11.560 -34.345 1.00 63.74 ? 55  ARG W CD  1 
ATOM   9632  N NE  . ARG E 1 57  ? 58.297  -10.849 -35.015 1.00 63.74 ? 55  ARG W NE  1 
ATOM   9633  C CZ  . ARG E 1 57  ? 58.474  -9.986  -36.008 1.00 63.74 ? 55  ARG W CZ  1 
ATOM   9634  N NH1 . ARG E 1 57  ? 59.696  -9.727  -36.454 1.00 63.74 ? 55  ARG W NH1 1 
ATOM   9635  N NH2 . ARG E 1 57  ? 57.431  -9.372  -36.549 1.00 63.74 ? 55  ARG W NH2 1 
ATOM   9636  N N   . ARG E 1 58  ? 58.311  -16.130 -37.240 1.00 75.06 ? 56  ARG W N   1 
ATOM   9637  C CA  . ARG E 1 58  ? 57.384  -17.189 -37.619 1.00 75.06 ? 56  ARG W CA  1 
ATOM   9638  C C   . ARG E 1 58  ? 58.135  -18.515 -37.751 1.00 75.06 ? 56  ARG W C   1 
ATOM   9639  O O   . ARG E 1 58  ? 57.620  -19.573 -37.384 1.00 75.06 ? 56  ARG W O   1 
ATOM   9640  C CB  . ARG E 1 58  ? 56.721  -16.854 -38.957 1.00 73.60 ? 56  ARG W CB  1 
ATOM   9641  C CG  . ARG E 1 58  ? 55.535  -17.744 -39.323 1.00 73.60 ? 56  ARG W CG  1 
ATOM   9642  C CD  . ARG E 1 58  ? 55.181  -17.633 -40.808 1.00 73.60 ? 56  ARG W CD  1 
ATOM   9643  N NE  . ARG E 1 58  ? 56.226  -18.206 -41.658 1.00 73.60 ? 56  ARG W NE  1 
ATOM   9644  C CZ  . ARG E 1 58  ? 56.537  -19.500 -41.696 1.00 73.60 ? 56  ARG W CZ  1 
ATOM   9645  N NH1 . ARG E 1 58  ? 55.883  -20.359 -40.933 1.00 73.60 ? 56  ARG W NH1 1 
ATOM   9646  N NH2 . ARG E 1 58  ? 57.501  -19.943 -42.494 1.00 73.60 ? 56  ARG W NH2 1 
ATOM   9647  N N   . GLN E 1 59  ? 59.363  -18.446 -38.258 1.00 92.42 ? 57  GLN W N   1 
ATOM   9648  C CA  . GLN E 1 59  ? 60.184  -19.635 -38.471 1.00 92.42 ? 57  GLN W CA  1 
ATOM   9649  C C   . GLN E 1 59  ? 60.694  -20.305 -37.195 1.00 92.42 ? 57  GLN W C   1 
ATOM   9650  O O   . GLN E 1 59  ? 60.842  -21.525 -37.160 1.00 92.42 ? 57  GLN W O   1 
ATOM   9651  C CB  . GLN E 1 59  ? 61.372  -19.302 -39.381 1.00 91.58 ? 57  GLN W CB  1 
ATOM   9652  C CG  . GLN E 1 59  ? 61.993  -20.522 -40.058 1.00 91.58 ? 57  GLN W CG  1 
ATOM   9653  C CD  . GLN E 1 59  ? 63.248  -20.189 -40.861 1.00 91.58 ? 57  GLN W CD  1 
ATOM   9654  O OE1 . GLN E 1 59  ? 64.334  -20.002 -40.302 1.00 91.58 ? 57  GLN W OE1 1 
ATOM   9655  N NE2 . GLN E 1 59  ? 63.100  -20.108 -42.179 1.00 91.58 ? 57  GLN W NE2 1 
ATOM   9656  N N   . PHE E 1 60  ? 60.975  -19.528 -36.155 1.00 62.22 ? 58  PHE W N   1 
ATOM   9657  C CA  . PHE E 1 60  ? 61.455  -20.120 -34.906 1.00 62.22 ? 58  PHE W CA  1 
ATOM   9658  C C   . PHE E 1 60  ? 60.297  -20.631 -34.052 1.00 62.22 ? 58  PHE W C   1 
ATOM   9659  O O   . PHE E 1 60  ? 60.372  -21.711 -33.471 1.00 62.22 ? 58  PHE W O   1 
ATOM   9660  C CB  . PHE E 1 60  ? 62.269  -19.111 -34.093 1.00 59.01 ? 58  PHE W CB  1 
ATOM   9661  C CG  . PHE E 1 60  ? 62.657  -19.610 -32.726 1.00 59.01 ? 58  PHE W CG  1 
ATOM   9662  C CD1 . PHE E 1 60  ? 63.512  -20.702 -32.585 1.00 59.01 ? 58  PHE W CD1 1 
ATOM   9663  C CD2 . PHE E 1 60  ? 62.145  -19.006 -31.579 1.00 59.01 ? 58  PHE W CD2 1 
ATOM   9664  C CE1 . PHE E 1 60  ? 63.849  -21.189 -31.326 1.00 59.01 ? 58  PHE W CE1 1 
ATOM   9665  C CE2 . PHE E 1 60  ? 62.475  -19.485 -30.313 1.00 59.01 ? 58  PHE W CE2 1 
ATOM   9666  C CZ  . PHE E 1 60  ? 63.330  -20.582 -30.186 1.00 59.01 ? 58  PHE W CZ  1 
ATOM   9667  N N   . ARG E 1 61  ? 59.231  -19.845 -33.972 1.00 58.96 ? 59  ARG W N   1 
ATOM   9668  C CA  . ARG E 1 61  ? 58.064  -20.232 -33.196 1.00 58.96 ? 59  ARG W CA  1 
ATOM   9669  C C   . ARG E 1 61  ? 57.411  -21.445 -33.817 1.00 58.96 ? 59  ARG W C   1 
ATOM   9670  O O   . ARG E 1 61  ? 56.743  -22.216 -33.119 1.00 58.96 ? 59  ARG W O   1 
ATOM   9671  C CB  . ARG E 1 61  ? 57.076  -19.072 -33.121 1.00 67.05 ? 59  ARG W CB  1 
ATOM   9672  C CG  . ARG E 1 61  ? 57.562  -17.996 -32.199 1.00 67.05 ? 59  ARG W CG  1 
ATOM   9673  C CD  . ARG E 1 61  ? 56.798  -16.716 -32.318 1.00 67.05 ? 59  ARG W CD  1 
ATOM   9674  N NE  . ARG E 1 61  ? 57.326  -15.755 -31.356 1.00 67.05 ? 59  ARG W NE  1 
ATOM   9675  C CZ  . ARG E 1 61  ? 57.222  -14.437 -31.477 1.00 67.05 ? 59  ARG W CZ  1 
ATOM   9676  N NH1 . ARG E 1 61  ? 56.603  -13.920 -32.532 1.00 67.05 ? 59  ARG W NH1 1 
ATOM   9677  N NH2 . ARG E 1 61  ? 57.737  -13.639 -30.547 1.00 67.05 ? 59  ARG W NH2 1 
ATOM   9678  N N   . GLU E 1 62  ? 57.605  -21.607 -35.129 1.00 65.06 ? 60  GLU W N   1 
ATOM   9679  C CA  . GLU E 1 62  ? 57.059  -22.753 -35.861 1.00 65.06 ? 60  GLU W CA  1 
ATOM   9680  C C   . GLU E 1 62  ? 57.741  -24.020 -35.348 1.00 65.06 ? 60  GLU W C   1 
ATOM   9681  O O   . GLU E 1 62  ? 57.113  -25.069 -35.199 1.00 65.06 ? 60  GLU W O   1 
ATOM   9682  C CB  . GLU E 1 62  ? 57.313  -22.613 -37.369 1.00 73.15 ? 60  GLU W CB  1 
ATOM   9683  C CG  . GLU E 1 62  ? 56.664  -23.726 -38.197 1.00 73.15 ? 60  GLU W CG  1 
ATOM   9684  C CD  . GLU E 1 62  ? 56.856  -23.570 -39.700 1.00 73.15 ? 60  GLU W CD  1 
ATOM   9685  O OE1 . GLU E 1 62  ? 56.225  -24.338 -40.460 1.00 73.15 ? 60  GLU W OE1 1 
ATOM   9686  O OE2 . GLU E 1 62  ? 57.636  -22.687 -40.121 1.00 73.15 ? 60  GLU W OE2 1 
ATOM   9687  N N   . ILE E 1 63  ? 59.035  -23.892 -35.071 1.00 73.44 ? 61  ILE W N   1 
ATOM   9688  C CA  . ILE E 1 63  ? 59.846  -24.986 -34.568 1.00 73.44 ? 61  ILE W CA  1 
ATOM   9689  C C   . ILE E 1 63  ? 59.359  -25.434 -33.198 1.00 73.44 ? 61  ILE W C   1 
ATOM   9690  O O   . ILE E 1 63  ? 59.356  -26.622 -32.890 1.00 73.44 ? 61  ILE W O   1 
ATOM   9691  C CB  . ILE E 1 63  ? 61.309  -24.553 -34.451 1.00 56.57 ? 61  ILE W CB  1 
ATOM   9692  C CG1 . ILE E 1 63  ? 61.789  -24.026 -35.801 1.00 56.57 ? 61  ILE W CG1 1 
ATOM   9693  C CG2 . ILE E 1 63  ? 62.164  -25.720 -33.983 1.00 56.57 ? 61  ILE W CG2 1 
ATOM   9694  C CD1 . ILE E 1 63  ? 63.203  -23.519 -35.789 1.00 56.57 ? 61  ILE W CD1 1 
ATOM   9695  N N   . LEU E 1 64  ? 58.950  -24.475 -32.376 1.00 73.12 ? 62  LEU W N   1 
ATOM   9696  C CA  . LEU E 1 64  ? 58.465  -24.783 -31.038 1.00 72.25 ? 62  LEU W CA  1 
ATOM   9697  C C   . LEU E 1 64  ? 57.125  -25.490 -31.109 1.00 74.47 ? 62  LEU W C   1 
ATOM   9698  O O   . LEU E 1 64  ? 57.002  -26.633 -30.677 1.00 71.01 ? 62  LEU W O   1 
ATOM   9699  C CB  . LEU E 1 64  ? 58.315  -23.503 -30.205 1.00 48.46 ? 62  LEU W CB  1 
ATOM   9700  C CG  . LEU E 1 64  ? 59.566  -22.656 -29.945 1.00 56.99 ? 62  LEU W CG  1 
ATOM   9701  C CD1 . LEU E 1 64  ? 59.171  -21.391 -29.215 1.00 52.76 ? 62  LEU W CD1 1 
ATOM   9702  C CD2 . LEU E 1 64  ? 60.587  -23.449 -29.139 1.00 47.94 ? 62  LEU W CD2 1 
ATOM   9703  N N   . PHE E 1 65  ? 56.128  -24.813 -31.670 1.00 54.92 ? 63  PHE W N   1 
ATOM   9704  C CA  . PHE E 1 65  ? 54.782  -25.367 -31.772 1.00 57.63 ? 63  PHE W CA  1 
ATOM   9705  C C   . PHE E 1 65  ? 54.686  -26.698 -32.515 1.00 61.47 ? 63  PHE W C   1 
ATOM   9706  O O   . PHE E 1 65  ? 53.815  -27.519 -32.209 1.00 61.10 ? 63  PHE W O   1 
ATOM   9707  C CB  . PHE E 1 65  ? 53.852  -24.365 -32.446 1.00 31.98 ? 63  PHE W CB  1 
ATOM   9708  C CG  . PHE E 1 65  ? 53.842  -23.017 -31.806 1.00 40.93 ? 63  PHE W CG  1 
ATOM   9709  C CD1 . PHE E 1 65  ? 53.027  -22.012 -32.311 1.00 41.06 ? 63  PHE W CD1 1 
ATOM   9710  C CD2 . PHE E 1 65  ? 54.643  -22.737 -30.722 1.00 38.90 ? 63  PHE W CD2 1 
ATOM   9711  C CE1 . PHE E 1 65  ? 53.005  -20.738 -31.750 1.00 37.30 ? 63  PHE W CE1 1 
ATOM   9712  C CE2 . PHE E 1 65  ? 54.632  -21.474 -30.152 1.00 28.59 ? 63  PHE W CE2 1 
ATOM   9713  C CZ  . PHE E 1 65  ? 53.804  -20.468 -30.674 1.00 32.28 ? 63  PHE W CZ  1 
ATOM   9714  N N   . SER E 1 66  ? 55.565  -26.906 -33.495 1.00 49.92 ? 64  SER W N   1 
ATOM   9715  C CA  . SER E 1 66  ? 55.562  -28.143 -34.277 1.00 60.12 ? 64  SER W CA  1 
ATOM   9716  C C   . SER E 1 66  ? 56.224  -29.299 -33.533 1.00 65.01 ? 64  SER W C   1 
ATOM   9717  O O   . SER E 1 66  ? 56.382  -30.387 -34.078 1.00 66.09 ? 64  SER W O   1 
ATOM   9718  C CB  . SER E 1 66  ? 56.308  -27.948 -35.593 1.00 57.42 ? 64  SER W CB  1 
ATOM   9719  O OG  . SER E 1 66  ? 57.663  -28.338 -35.446 1.00 70.60 ? 64  SER W OG  1 
ATOM   9720  N N   . VAL E 1 67  ? 56.620  -29.064 -32.290 1.00 51.58 ? 65  VAL W N   1 
ATOM   9721  C CA  . VAL E 1 67  ? 57.276  -30.104 -31.520 1.00 44.20 ? 65  VAL W CA  1 
ATOM   9722  C C   . VAL E 1 67  ? 56.300  -31.229 -31.183 1.00 48.86 ? 65  VAL W C   1 
ATOM   9723  O O   . VAL E 1 67  ? 55.086  -31.033 -31.181 1.00 42.02 ? 65  VAL W O   1 
ATOM   9724  C CB  . VAL E 1 67  ? 57.890  -29.528 -30.213 1.00 54.81 ? 65  VAL W CB  1 
ATOM   9725  C CG1 . VAL E 1 67  ? 56.814  -29.368 -29.151 1.00 41.82 ? 65  VAL W CG1 1 
ATOM   9726  C CG2 . VAL E 1 67  ? 59.021  -30.425 -29.722 1.00 47.17 ? 65  VAL W CG2 1 
ATOM   9727  N N   . ASP E 1 68  ? 56.854  -32.408 -30.922 1.00 91.30 ? 66  ASP W N   1 
ATOM   9728  C CA  . ASP E 1 68  ? 56.097  -33.601 -30.557 1.00 91.30 ? 66  ASP W CA  1 
ATOM   9729  C C   . ASP E 1 68  ? 54.888  -33.225 -29.690 1.00 91.30 ? 66  ASP W C   1 
ATOM   9730  O O   . ASP E 1 68  ? 54.945  -32.245 -28.951 1.00 91.30 ? 66  ASP W O   1 
ATOM   9731  C CB  . ASP E 1 68  ? 57.027  -34.534 -29.788 1.00 68.33 ? 66  ASP W CB  1 
ATOM   9732  C CG  . ASP E 1 68  ? 56.407  -35.862 -29.499 1.00 77.64 ? 66  ASP W CG  1 
ATOM   9733  O OD1 . ASP E 1 68  ? 55.317  -35.885 -28.895 1.00 77.64 ? 66  ASP W OD1 1 
ATOM   9734  O OD2 . ASP E 1 68  ? 57.015  -36.885 -29.873 1.00 77.64 ? 66  ASP W OD2 1 
ATOM   9735  N N   . SER E 1 69  ? 53.806  -33.999 -29.767 1.00 39.02 ? 67  SER W N   1 
ATOM   9736  C CA  . SER E 1 69  ? 52.605  -33.698 -28.982 1.00 43.70 ? 67  SER W CA  1 
ATOM   9737  C C   . SER E 1 69  ? 52.738  -34.038 -27.497 1.00 43.09 ? 67  SER W C   1 
ATOM   9738  O O   . SER E 1 69  ? 51.887  -33.651 -26.696 1.00 38.43 ? 67  SER W O   1 
ATOM   9739  C CB  . SER E 1 69  ? 51.402  -34.452 -29.535 1.00 19.81 ? 67  SER W CB  1 
ATOM   9740  O OG  . SER E 1 69  ? 51.399  -35.794 -29.071 1.00 56.37 ? 67  SER W OG  1 
ATOM   9741  N N   . SER E 1 70  ? 53.796  -34.763 -27.135 1.00 65.64 ? 68  SER W N   1 
ATOM   9742  C CA  . SER E 1 70  ? 54.037  -35.157 -25.744 1.00 65.64 ? 68  SER W CA  1 
ATOM   9743  C C   . SER E 1 70  ? 54.284  -33.925 -24.890 1.00 65.64 ? 68  SER W C   1 
ATOM   9744  O O   . SER E 1 70  ? 54.280  -33.984 -23.667 1.00 65.64 ? 68  SER W O   1 
ATOM   9745  C CB  . SER E 1 70  ? 55.255  -36.081 -25.647 1.00 63.76 ? 68  SER W CB  1 
ATOM   9746  O OG  . SER E 1 70  ? 56.461  -35.361 -25.865 1.00 75.60 ? 68  SER W OG  1 
ATOM   9747  N N   . ILE E 1 71  ? 54.517  -32.802 -25.546 1.00 55.66 ? 69  ILE W N   1 
ATOM   9748  C CA  . ILE E 1 71  ? 54.754  -31.572 -24.831 1.00 60.10 ? 69  ILE W CA  1 
ATOM   9749  C C   . ILE E 1 71  ? 53.486  -31.152 -24.094 1.00 60.18 ? 69  ILE W C   1 
ATOM   9750  O O   . ILE E 1 71  ? 53.565  -30.462 -23.077 1.00 56.91 ? 69  ILE W O   1 
ATOM   9751  C CB  . ILE E 1 71  ? 55.167  -30.456 -25.789 1.00 58.27 ? 69  ILE W CB  1 
ATOM   9752  C CG1 . ILE E 1 71  ? 55.584  -29.227 -24.993 1.00 45.72 ? 69  ILE W CG1 1 
ATOM   9753  C CG2 . ILE E 1 71  ? 54.007  -30.096 -26.700 1.00 48.10 ? 69  ILE W CG2 1 
ATOM   9754  C CD1 . ILE E 1 71  ? 56.165  -28.143 -25.845 1.00 58.78 ? 69  ILE W CD1 1 
ATOM   9755  N N   . ASN E 1 72  ? 52.322  -31.566 -24.605 1.00 42.83 ? 70  ASN W N   1 
ATOM   9756  C CA  . ASN E 1 72  ? 51.040  -31.227 -23.978 1.00 42.47 ? 70  ASN W CA  1 
ATOM   9757  C C   . ASN E 1 72  ? 51.017  -31.787 -22.559 1.00 51.63 ? 70  ASN W C   1 
ATOM   9758  O O   . ASN E 1 72  ? 50.057  -31.595 -21.807 1.00 54.38 ? 70  ASN W O   1 
ATOM   9759  C CB  . ASN E 1 72  ? 49.880  -31.795 -24.795 1.00 30.37 ? 70  ASN W CB  1 
ATOM   9760  C CG  . ASN E 1 72  ? 49.798  -33.306 -24.719 1.00 42.49 ? 70  ASN W CG  1 
ATOM   9761  O OD1 . ASN E 1 72  ? 50.758  -33.964 -24.333 1.00 44.88 ? 70  ASN W OD1 1 
ATOM   9762  N ND2 . ASN E 1 72  ? 48.653  -33.863 -25.098 1.00 42.00 ? 70  ASN W ND2 1 
ATOM   9763  N N   . GLN E 1 73  ? 52.094  -32.494 -22.226 1.00 54.52 ? 71  GLN W N   1 
ATOM   9764  C CA  . GLN E 1 73  ? 52.299  -33.077 -20.911 1.00 65.47 ? 71  GLN W CA  1 
ATOM   9765  C C   . GLN E 1 73  ? 53.010  -32.012 -20.088 1.00 67.02 ? 71  GLN W C   1 
ATOM   9766  O O   . GLN E 1 73  ? 52.701  -31.790 -18.924 1.00 64.23 ? 71  GLN W O   1 
ATOM   9767  C CB  . GLN E 1 73  ? 53.219  -34.295 -20.987 1.00 40.52 ? 71  GLN W CB  1 
ATOM   9768  C CG  . GLN E 1 73  ? 52.575  -35.611 -21.364 1.00 62.85 ? 71  GLN W CG  1 
ATOM   9769  C CD  . GLN E 1 73  ? 53.620  -36.701 -21.527 1.00 80.57 ? 71  GLN W CD  1 
ATOM   9770  O OE1 . GLN E 1 73  ? 54.504  -36.849 -20.684 1.00 73.85 ? 71  GLN W OE1 1 
ATOM   9771  N NE2 . GLN E 1 73  ? 53.530  -37.465 -22.614 1.00 63.72 ? 71  GLN W NE2 1 
ATOM   9772  N N   . SER E 1 74  ? 53.970  -31.346 -20.706 1.00 22.01 ? 72  SER W N   1 
ATOM   9773  C CA  . SER E 1 74  ? 54.725  -30.331 -20.005 1.00 31.18 ? 72  SER W CA  1 
ATOM   9774  C C   . SER E 1 74  ? 54.310  -28.879 -20.279 1.00 33.53 ? 72  SER W C   1 
ATOM   9775  O O   . SER E 1 74  ? 54.888  -27.955 -19.724 1.00 32.19 ? 72  SER W O   1 
ATOM   9776  C CB  . SER E 1 74  ? 56.216  -30.535 -20.288 1.00 32.84 ? 72  SER W CB  1 
ATOM   9777  O OG  . SER E 1 74  ? 56.683  -31.747 -19.713 1.00 47.38 ? 72  SER W OG  1 
ATOM   9778  N N   . ILE E 1 75  ? 53.319  -28.664 -21.131 1.00 57.02 ? 73  ILE W N   1 
ATOM   9779  C CA  . ILE E 1 75  ? 52.856  -27.306 -21.387 1.00 57.02 ? 73  ILE W CA  1 
ATOM   9780  C C   . ILE E 1 75  ? 51.336  -27.310 -21.460 1.00 57.02 ? 73  ILE W C   1 
ATOM   9781  O O   . ILE E 1 75  ? 50.736  -28.141 -22.140 1.00 57.02 ? 73  ILE W O   1 
ATOM   9782  C CB  . ILE E 1 75  ? 53.413  -26.734 -22.696 1.00 40.68 ? 73  ILE W CB  1 
ATOM   9783  C CG1 . ILE E 1 75  ? 54.939  -26.670 -22.633 1.00 40.68 ? 73  ILE W CG1 1 
ATOM   9784  C CG2 . ILE E 1 75  ? 52.840  -25.336 -22.923 1.00 40.68 ? 73  ILE W CG2 1 
ATOM   9785  C CD1 . ILE E 1 75  ? 55.470  -25.678 -21.620 1.00 40.68 ? 73  ILE W CD1 1 
ATOM   9786  N N   . GLY E 1 76  ? 50.709  -26.375 -20.759 1.00 45.54 ? 74  GLY W N   1 
ATOM   9787  C CA  . GLY E 1 76  ? 49.261  -26.329 -20.751 1.00 45.54 ? 74  GLY W CA  1 
ATOM   9788  C C   . GLY E 1 76  ? 48.640  -25.158 -21.472 1.00 45.54 ? 74  GLY W C   1 
ATOM   9789  O O   . GLY E 1 76  ? 47.426  -25.071 -21.578 1.00 45.54 ? 74  GLY W O   1 
ATOM   9790  N N   . GLY E 1 77  ? 49.455  -24.249 -21.973 1.00 57.41 ? 75  GLY W N   1 
ATOM   9791  C CA  . GLY E 1 77  ? 48.889  -23.119 -22.673 1.00 57.41 ? 75  GLY W CA  1 
ATOM   9792  C C   . GLY E 1 77  ? 49.973  -22.227 -23.214 1.00 57.41 ? 75  GLY W C   1 
ATOM   9793  O O   . GLY E 1 77  ? 51.072  -22.160 -22.661 1.00 57.41 ? 75  GLY W O   1 
ATOM   9794  N N   . VAL E 1 78  ? 49.683  -21.547 -24.310 1.00 39.82 ? 76  VAL W N   1 
ATOM   9795  C CA  . VAL E 1 78  ? 50.665  -20.648 -24.870 1.00 39.82 ? 76  VAL W CA  1 
ATOM   9796  C C   . VAL E 1 78  ? 50.048  -19.289 -25.108 1.00 39.82 ? 76  VAL W C   1 
ATOM   9797  O O   . VAL E 1 78  ? 48.964  -19.187 -25.669 1.00 39.82 ? 76  VAL W O   1 
ATOM   9798  C CB  . VAL E 1 78  ? 51.224  -21.195 -26.179 1.00 36.73 ? 76  VAL W CB  1 
ATOM   9799  C CG1 . VAL E 1 78  ? 52.095  -20.150 -26.853 1.00 36.73 ? 76  VAL W CG1 1 
ATOM   9800  C CG2 . VAL E 1 78  ? 52.036  -22.430 -25.893 1.00 36.73 ? 76  VAL W CG2 1 
ATOM   9801  N N   . ILE E 1 79  ? 50.722  -18.243 -24.647 1.00 71.94 ? 77  ILE W N   1 
ATOM   9802  C CA  . ILE E 1 79  ? 50.219  -16.902 -24.867 1.00 71.94 ? 77  ILE W CA  1 
ATOM   9803  C C   . ILE E 1 79  ? 50.997  -16.395 -26.067 1.00 71.94 ? 77  ILE W C   1 
ATOM   9804  O O   . ILE E 1 79  ? 52.224  -16.511 -26.115 1.00 71.94 ? 77  ILE W O   1 
ATOM   9805  C CB  . ILE E 1 79  ? 50.485  -15.969 -23.687 1.00 68.48 ? 77  ILE W CB  1 
ATOM   9806  C CG1 . ILE E 1 79  ? 50.519  -16.769 -22.378 1.00 68.48 ? 77  ILE W CG1 1 
ATOM   9807  C CG2 . ILE E 1 79  ? 49.391  -14.902 -23.648 1.00 68.48 ? 77  ILE W CG2 1 
ATOM   9808  C CD1 . ILE E 1 79  ? 50.900  -15.957 -21.117 1.00 68.48 ? 77  ILE W CD1 1 
ATOM   9809  N N   . LEU E 1 80  ? 50.279  -15.851 -27.041 1.00 50.43 ? 78  LEU W N   1 
ATOM   9810  C CA  . LEU E 1 80  ? 50.901  -15.345 -28.256 1.00 50.43 ? 78  LEU W CA  1 
ATOM   9811  C C   . LEU E 1 80  ? 50.715  -13.826 -28.349 1.00 50.43 ? 78  LEU W C   1 
ATOM   9812  O O   . LEU E 1 80  ? 49.928  -13.235 -27.600 1.00 50.43 ? 78  LEU W O   1 
ATOM   9813  C CB  . LEU E 1 80  ? 50.254  -16.012 -29.478 1.00 37.59 ? 78  LEU W CB  1 
ATOM   9814  C CG  . LEU E 1 80  ? 50.158  -17.540 -29.617 1.00 37.59 ? 78  LEU W CG  1 
ATOM   9815  C CD1 . LEU E 1 80  ? 49.079  -17.887 -30.643 1.00 37.59 ? 78  LEU W CD1 1 
ATOM   9816  C CD2 . LEU E 1 80  ? 51.519  -18.128 -30.020 1.00 37.59 ? 78  LEU W CD2 1 
ATOM   9817  N N   . PHE E 1 81  ? 51.448  -13.196 -29.261 1.00 76.39 ? 79  PHE W N   1 
ATOM   9818  C CA  . PHE E 1 81  ? 51.316  -11.763 -29.461 1.00 76.39 ? 79  PHE W CA  1 
ATOM   9819  C C   . PHE E 1 81  ? 50.386  -11.565 -30.655 1.00 76.39 ? 79  PHE W C   1 
ATOM   9820  O O   . PHE E 1 81  ? 50.277  -12.458 -31.490 1.00 76.39 ? 79  PHE W O   1 
ATOM   9821  C CB  . PHE E 1 81  ? 52.672  -11.131 -29.743 1.00 92.42 ? 79  PHE W CB  1 
ATOM   9822  C CG  . PHE E 1 81  ? 52.595  -9.657  -30.002 1.00 92.42 ? 79  PHE W CG  1 
ATOM   9823  C CD1 . PHE E 1 81  ? 51.897  -8.823  -29.126 1.00 92.42 ? 79  PHE W CD1 1 
ATOM   9824  C CD2 . PHE E 1 81  ? 53.200  -9.101  -31.128 1.00 92.42 ? 79  PHE W CD2 1 
ATOM   9825  C CE1 . PHE E 1 81  ? 51.799  -7.462  -29.366 1.00 92.42 ? 79  PHE W CE1 1 
ATOM   9826  C CE2 . PHE E 1 81  ? 53.110  -7.737  -31.379 1.00 92.42 ? 79  PHE W CE2 1 
ATOM   9827  C CZ  . PHE E 1 81  ? 52.406  -6.915  -30.495 1.00 92.42 ? 79  PHE W CZ  1 
ATOM   9828  N N   . HIS E 1 82  ? 49.726  -10.410 -30.748 1.00 50.90 ? 80  HIS W N   1 
ATOM   9829  C CA  . HIS E 1 82  ? 48.785  -10.154 -31.845 1.00 50.90 ? 80  HIS W CA  1 
ATOM   9830  C C   . HIS E 1 82  ? 49.276  -10.659 -33.203 1.00 50.90 ? 80  HIS W C   1 
ATOM   9831  O O   . HIS E 1 82  ? 48.473  -11.038 -34.057 1.00 50.90 ? 80  HIS W O   1 
ATOM   9832  C CB  . HIS E 1 82  ? 48.456  -8.660  -31.945 1.00 92.42 ? 80  HIS W CB  1 
ATOM   9833  C CG  . HIS E 1 82  ? 47.255  -8.356  -32.797 1.00 92.42 ? 80  HIS W CG  1 
ATOM   9834  N ND1 . HIS E 1 82  ? 46.826  -7.069  -33.051 1.00 92.42 ? 80  HIS W ND1 1 
ATOM   9835  C CD2 . HIS E 1 82  ? 46.389  -9.173  -33.447 1.00 92.42 ? 80  HIS W CD2 1 
ATOM   9836  C CE1 . HIS E 1 82  ? 45.751  -7.107  -33.821 1.00 92.42 ? 80  HIS W CE1 1 
ATOM   9837  N NE2 . HIS E 1 82  ? 45.465  -8.371  -34.075 1.00 92.42 ? 80  HIS W NE2 1 
ATOM   9838  N N   . GLU E 1 83  ? 50.592  -10.665 -33.400 1.00 85.77 ? 81  GLU W N   1 
ATOM   9839  C CA  . GLU E 1 83  ? 51.180  -11.144 -34.651 1.00 85.77 ? 81  GLU W CA  1 
ATOM   9840  C C   . GLU E 1 83  ? 51.060  -12.668 -34.773 1.00 85.77 ? 81  GLU W C   1 
ATOM   9841  O O   . GLU E 1 83  ? 50.289  -13.187 -35.587 1.00 85.77 ? 81  GLU W O   1 
ATOM   9842  C CB  . GLU E 1 83  ? 52.663  -10.766 -34.721 1.00 74.88 ? 81  GLU W CB  1 
ATOM   9843  C CG  . GLU E 1 83  ? 53.422  -11.471 -35.844 1.00 74.88 ? 81  GLU W CG  1 
ATOM   9844  C CD  . GLU E 1 83  ? 54.916  -11.573 -35.584 1.00 74.88 ? 81  GLU W CD  1 
ATOM   9845  O OE1 . GLU E 1 83  ? 55.573  -10.519 -35.480 1.00 74.88 ? 81  GLU W OE1 1 
ATOM   9846  O OE2 . GLU E 1 83  ? 55.435  -12.709 -35.483 1.00 74.88 ? 81  GLU W OE2 1 
ATOM   9847  N N   . THR E 1 84  ? 51.836  -13.370 -33.949 1.00 52.77 ? 82  THR W N   1 
ATOM   9848  C CA  . THR E 1 84  ? 51.876  -14.825 -33.942 1.00 52.77 ? 82  THR W CA  1 
ATOM   9849  C C   . THR E 1 84  ? 50.502  -15.466 -34.108 1.00 52.77 ? 82  THR W C   1 
ATOM   9850  O O   . THR E 1 84  ? 50.338  -16.341 -34.946 1.00 52.77 ? 82  THR W O   1 
ATOM   9851  C CB  . THR E 1 84  ? 52.523  -15.356 -32.642 1.00 61.70 ? 82  THR W CB  1 
ATOM   9852  O OG1 . THR E 1 84  ? 53.426  -14.377 -32.120 1.00 61.70 ? 82  THR W OG1 1 
ATOM   9853  C CG2 . THR E 1 84  ? 53.307  -16.635 -32.920 1.00 61.70 ? 82  THR W CG2 1 
ATOM   9854  N N   . LEU E 1 85  ? 49.517  -15.029 -33.326 1.00 33.96 ? 83  LEU W N   1 
ATOM   9855  C CA  . LEU E 1 85  ? 48.171  -15.600 -33.406 1.00 33.96 ? 83  LEU W CA  1 
ATOM   9856  C C   . LEU E 1 85  ? 47.699  -15.786 -34.842 1.00 33.96 ? 83  LEU W C   1 
ATOM   9857  O O   . LEU E 1 85  ? 46.861  -16.653 -35.127 1.00 33.96 ? 83  LEU W O   1 
ATOM   9858  C CB  . LEU E 1 85  ? 47.144  -14.722 -32.668 1.00 33.62 ? 83  LEU W CB  1 
ATOM   9859  C CG  . LEU E 1 85  ? 45.662  -15.125 -32.847 1.00 33.62 ? 83  LEU W CG  1 
ATOM   9860  C CD1 . LEU E 1 85  ? 45.424  -16.480 -32.190 1.00 33.62 ? 83  LEU W CD1 1 
ATOM   9861  C CD2 . LEU E 1 85  ? 44.720  -14.069 -32.253 1.00 33.62 ? 83  LEU W CD2 1 
ATOM   9862  N N   . TYR E 1 86  ? 48.239  -14.985 -35.756 1.00 45.51 ? 84  TYR W N   1 
ATOM   9863  C CA  . TYR E 1 86  ? 47.811  -15.078 -37.144 1.00 45.51 ? 84  TYR W CA  1 
ATOM   9864  C C   . TYR E 1 86  ? 48.810  -15.688 -38.118 1.00 45.51 ? 84  TYR W C   1 
ATOM   9865  O O   . TYR E 1 86  ? 48.550  -15.741 -39.315 1.00 45.51 ? 84  TYR W O   1 
ATOM   9866  C CB  . TYR E 1 86  ? 47.338  -13.695 -37.626 1.00 61.84 ? 84  TYR W CB  1 
ATOM   9867  C CG  . TYR E 1 86  ? 46.099  -13.220 -36.882 1.00 61.84 ? 84  TYR W CG  1 
ATOM   9868  C CD1 . TYR E 1 86  ? 46.199  -12.393 -35.758 1.00 61.84 ? 84  TYR W CD1 1 
ATOM   9869  C CD2 . TYR E 1 86  ? 44.834  -13.691 -37.236 1.00 61.84 ? 84  TYR W CD2 1 
ATOM   9870  C CE1 . TYR E 1 86  ? 45.067  -12.061 -35.003 1.00 61.84 ? 84  TYR W CE1 1 
ATOM   9871  C CE2 . TYR E 1 86  ? 43.702  -13.365 -36.489 1.00 61.84 ? 84  TYR W CE2 1 
ATOM   9872  C CZ  . TYR E 1 86  ? 43.824  -12.556 -35.375 1.00 61.84 ? 84  TYR W CZ  1 
ATOM   9873  O OH  . TYR E 1 86  ? 42.703  -12.272 -34.628 1.00 61.84 ? 84  TYR W OH  1 
ATOM   9874  N N   . GLN E 1 87  ? 49.939  -16.166 -37.607 1.00 58.31 ? 85  GLN W N   1 
ATOM   9875  C CA  . GLN E 1 87  ? 50.943  -16.803 -38.460 1.00 58.31 ? 85  GLN W CA  1 
ATOM   9876  C C   . GLN E 1 87  ? 50.554  -18.254 -38.791 1.00 58.31 ? 85  GLN W C   1 
ATOM   9877  O O   . GLN E 1 87  ? 49.812  -18.900 -38.036 1.00 58.31 ? 85  GLN W O   1 
ATOM   9878  C CB  . GLN E 1 87  ? 52.326  -16.786 -37.786 1.00 92.42 ? 85  GLN W CB  1 
ATOM   9879  C CG  . GLN E 1 87  ? 52.875  -15.386 -37.519 1.00 92.42 ? 85  GLN W CG  1 
ATOM   9880  C CD  . GLN E 1 87  ? 54.344  -15.383 -37.107 1.00 92.42 ? 85  GLN W CD  1 
ATOM   9881  O OE1 . GLN E 1 87  ? 54.743  -16.064 -36.163 1.00 92.42 ? 85  GLN W OE1 1 
ATOM   9882  N NE2 . GLN E 1 87  ? 55.151  -14.605 -37.813 1.00 92.42 ? 85  GLN W NE2 1 
ATOM   9883  N N   . LYS E 1 88  ? 51.048  -18.745 -39.929 1.00 49.07 ? 86  LYS W N   1 
ATOM   9884  C CA  . LYS E 1 88  ? 50.800  -20.116 -40.383 1.00 49.07 ? 86  LYS W CA  1 
ATOM   9885  C C   . LYS E 1 88  ? 52.148  -20.823 -40.547 1.00 49.07 ? 86  LYS W C   1 
ATOM   9886  O O   . LYS E 1 88  ? 53.172  -20.164 -40.772 1.00 49.07 ? 86  LYS W O   1 
ATOM   9887  C CB  . LYS E 1 88  ? 50.089  -20.128 -41.738 1.00 63.30 ? 86  LYS W CB  1 
ATOM   9888  C CG  . LYS E 1 88  ? 48.661  -19.634 -41.756 1.00 63.30 ? 86  LYS W CG  1 
ATOM   9889  C CD  . LYS E 1 88  ? 48.100  -19.780 -43.167 1.00 63.30 ? 86  LYS W CD  1 
ATOM   9890  C CE  . LYS E 1 88  ? 46.692  -19.227 -43.286 1.00 63.30 ? 86  LYS W CE  1 
ATOM   9891  N NZ  . LYS E 1 88  ? 46.218  -19.235 -44.700 1.00 63.30 ? 86  LYS W NZ  1 
ATOM   9892  N N   . ASP E 1 89  ? 52.150  -22.153 -40.438 1.00 58.85 ? 87  ASP W N   1 
ATOM   9893  C CA  . ASP E 1 89  ? 53.380  -22.931 -40.588 1.00 62.61 ? 87  ASP W CA  1 
ATOM   9894  C C   . ASP E 1 89  ? 53.645  -23.245 -42.053 1.00 61.45 ? 87  ASP W C   1 
ATOM   9895  O O   . ASP E 1 89  ? 52.839  -22.923 -42.932 1.00 57.74 ? 87  ASP W O   1 
ATOM   9896  C CB  . ASP E 1 89  ? 53.306  -24.241 -39.800 1.00 26.29 ? 87  ASP W CB  1 
ATOM   9897  C CG  . ASP E 1 89  ? 52.268  -25.199 -40.350 1.00 40.52 ? 87  ASP W CG  1 
ATOM   9898  O OD1 . ASP E 1 89  ? 52.073  -26.288 -39.767 1.00 38.11 ? 87  ASP W OD1 1 
ATOM   9899  O OD2 . ASP E 1 89  ? 51.645  -24.864 -41.373 1.00 31.76 ? 87  ASP W OD2 1 
ATOM   9900  N N   . SER E 1 90  ? 54.775  -23.888 -42.313 1.00 66.40 ? 88  SER W N   1 
ATOM   9901  C CA  . SER E 1 90  ? 55.150  -24.232 -43.674 1.00 67.17 ? 88  SER W CA  1 
ATOM   9902  C C   . SER E 1 90  ? 54.049  -24.905 -44.484 1.00 56.46 ? 88  SER W C   1 
ATOM   9903  O O   . SER E 1 90  ? 54.138  -24.973 -45.705 1.00 70.74 ? 88  SER W O   1 
ATOM   9904  C CB  . SER E 1 90  ? 56.388  -25.114 -43.653 1.00 92.42 ? 88  SER W CB  1 
ATOM   9905  O OG  . SER E 1 90  ? 57.439  -24.440 -42.991 1.00 92.42 ? 88  SER W OG  1 
ATOM   9906  N N   . GLN E 1 91  ? 53.016  -25.405 -43.816 1.00 74.83 ? 89  GLN W N   1 
ATOM   9907  C CA  . GLN E 1 91  ? 51.912  -26.048 -44.521 1.00 69.12 ? 89  GLN W CA  1 
ATOM   9908  C C   . GLN E 1 91  ? 50.651  -25.197 -44.539 1.00 73.34 ? 89  GLN W C   1 
ATOM   9909  O O   . GLN E 1 91  ? 49.561  -25.715 -44.773 1.00 74.15 ? 89  GLN W O   1 
ATOM   9910  C CB  . GLN E 1 91  ? 51.577  -27.409 -43.902 1.00 85.08 ? 89  GLN W CB  1 
ATOM   9911  C CG  . GLN E 1 91  ? 52.433  -28.542 -44.411 1.00 85.08 ? 89  GLN W CG  1 
ATOM   9912  C CD  . GLN E 1 91  ? 53.887  -28.326 -44.095 1.00 85.08 ? 89  GLN W CD  1 
ATOM   9913  O OE1 . GLN E 1 91  ? 54.279  -28.301 -42.931 1.00 85.08 ? 89  GLN W OE1 1 
ATOM   9914  N NE2 . GLN E 1 91  ? 54.699  -28.155 -45.127 1.00 85.08 ? 89  GLN W NE2 1 
ATOM   9915  N N   . GLY E 1 92  ? 50.787  -23.896 -44.303 1.00 57.93 ? 90  GLY W N   1 
ATOM   9916  C CA  . GLY E 1 92  ? 49.610  -23.040 -44.304 1.00 45.96 ? 90  GLY W CA  1 
ATOM   9917  C C   . GLY E 1 92  ? 48.674  -23.424 -43.173 1.00 41.93 ? 90  GLY W C   1 
ATOM   9918  O O   . GLY E 1 92  ? 47.466  -23.183 -43.232 1.00 58.87 ? 90  GLY W O   1 
ATOM   9919  N N   . LYS E 1 93  ? 49.259  -24.039 -42.146 1.00 45.47 ? 91  LYS W N   1 
ATOM   9920  C CA  . LYS E 1 93  ? 48.551  -24.487 -40.951 1.00 50.74 ? 91  LYS W CA  1 
ATOM   9921  C C   . LYS E 1 93  ? 48.717  -23.389 -39.913 1.00 55.02 ? 91  LYS W C   1 
ATOM   9922  O O   . LYS E 1 93  ? 49.838  -22.957 -39.624 1.00 40.52 ? 91  LYS W O   1 
ATOM   9923  C CB  . LYS E 1 93  ? 49.177  -25.789 -40.427 1.00 45.78 ? 91  LYS W CB  1 
ATOM   9924  C CG  . LYS E 1 93  ? 48.549  -26.384 -39.169 1.00 60.60 ? 91  LYS W CG  1 
ATOM   9925  C CD  . LYS E 1 93  ? 47.332  -27.244 -39.488 1.00 68.13 ? 91  LYS W CD  1 
ATOM   9926  C CE  . LYS E 1 93  ? 46.855  -28.011 -38.258 1.00 67.31 ? 91  LYS W CE  1 
ATOM   9927  N NZ  . LYS E 1 93  ? 45.786  -29.005 -38.580 1.00 81.66 ? 91  LYS W NZ  1 
ATOM   9928  N N   . LEU E 1 94  ? 47.604  -22.932 -39.356 1.00 41.87 ? 92  LEU W N   1 
ATOM   9929  C CA  . LEU E 1 94  ? 47.664  -21.879 -38.361 1.00 41.87 ? 92  LEU W CA  1 
ATOM   9930  C C   . LEU E 1 94  ? 48.347  -22.334 -37.079 1.00 41.87 ? 92  LEU W C   1 
ATOM   9931  O O   . LEU E 1 94  ? 47.972  -23.360 -36.518 1.00 41.87 ? 92  LEU W O   1 
ATOM   9932  C CB  . LEU E 1 94  ? 46.255  -21.394 -38.058 1.00 53.85 ? 92  LEU W CB  1 
ATOM   9933  C CG  . LEU E 1 94  ? 45.814  -20.216 -38.916 1.00 53.85 ? 92  LEU W CG  1 
ATOM   9934  C CD1 . LEU E 1 94  ? 44.328  -19.964 -38.729 1.00 53.85 ? 92  LEU W CD1 1 
ATOM   9935  C CD2 . LEU E 1 94  ? 46.643  -18.991 -38.525 1.00 53.85 ? 92  LEU W CD2 1 
ATOM   9936  N N   . PHE E 1 95  ? 49.351  -21.585 -36.619 1.00 28.96 ? 93  PHE W N   1 
ATOM   9937  C CA  . PHE E 1 95  ? 50.057  -21.927 -35.377 1.00 28.96 ? 93  PHE W CA  1 
ATOM   9938  C C   . PHE E 1 95  ? 49.009  -22.096 -34.292 1.00 28.96 ? 93  PHE W C   1 
ATOM   9939  O O   . PHE E 1 95  ? 49.128  -22.941 -33.407 1.00 28.96 ? 93  PHE W O   1 
ATOM   9940  C CB  . PHE E 1 95  ? 51.022  -20.817 -34.976 1.00 67.96 ? 93  PHE W CB  1 
ATOM   9941  C CG  . PHE E 1 95  ? 52.298  -20.824 -35.744 1.00 67.96 ? 93  PHE W CG  1 
ATOM   9942  C CD1 . PHE E 1 95  ? 52.293  -20.891 -37.121 1.00 67.96 ? 93  PHE W CD1 1 
ATOM   9943  C CD2 . PHE E 1 95  ? 53.510  -20.749 -35.093 1.00 67.96 ? 93  PHE W CD2 1 
ATOM   9944  C CE1 . PHE E 1 95  ? 53.481  -20.875 -37.834 1.00 67.96 ? 93  PHE W CE1 1 
ATOM   9945  C CE2 . PHE E 1 95  ? 54.698  -20.734 -35.800 1.00 67.96 ? 93  PHE W CE2 1 
ATOM   9946  C CZ  . PHE E 1 95  ? 54.683  -20.799 -37.169 1.00 67.96 ? 93  PHE W CZ  1 
ATOM   9947  N N   . ARG E 1 96  ? 47.972  -21.274 -34.373 1.00 31.68 ? 94  ARG W N   1 
ATOM   9948  C CA  . ARG E 1 96  ? 46.869  -21.339 -33.432 1.00 31.68 ? 94  ARG W CA  1 
ATOM   9949  C C   . ARG E 1 96  ? 46.348  -22.796 -33.316 1.00 31.68 ? 94  ARG W C   1 
ATOM   9950  O O   . ARG E 1 96  ? 46.290  -23.356 -32.216 1.00 31.68 ? 94  ARG W O   1 
ATOM   9951  C CB  . ARG E 1 96  ? 45.759  -20.415 -33.918 1.00 48.96 ? 94  ARG W CB  1 
ATOM   9952  C CG  . ARG E 1 96  ? 44.666  -20.189 -32.928 1.00 48.96 ? 94  ARG W CG  1 
ATOM   9953  C CD  . ARG E 1 96  ? 43.413  -19.792 -33.643 1.00 48.96 ? 94  ARG W CD  1 
ATOM   9954  N NE  . ARG E 1 96  ? 43.701  -18.867 -34.724 1.00 48.96 ? 94  ARG W NE  1 
ATOM   9955  C CZ  . ARG E 1 96  ? 42.776  -18.324 -35.506 1.00 48.96 ? 94  ARG W CZ  1 
ATOM   9956  N NH1 . ARG E 1 96  ? 41.490  -18.610 -35.319 1.00 48.96 ? 94  ARG W NH1 1 
ATOM   9957  N NH2 . ARG E 1 96  ? 43.140  -17.510 -36.494 1.00 48.96 ? 94  ARG W NH2 1 
ATOM   9958  N N   . ASN E 1 97  ? 45.996  -23.400 -34.454 1.00 45.45 ? 95  ASN W N   1 
ATOM   9959  C CA  . ASN E 1 97  ? 45.468  -24.768 -34.520 1.00 45.45 ? 95  ASN W CA  1 
ATOM   9960  C C   . ASN E 1 97  ? 46.474  -25.855 -34.172 1.00 45.45 ? 95  ASN W C   1 
ATOM   9961  O O   . ASN E 1 97  ? 46.123  -26.850 -33.529 1.00 45.45 ? 95  ASN W O   1 
ATOM   9962  C CB  . ASN E 1 97  ? 44.917  -25.046 -35.912 1.00 39.46 ? 95  ASN W CB  1 
ATOM   9963  C CG  . ASN E 1 97  ? 43.940  -23.997 -36.354 1.00 39.46 ? 95  ASN W CG  1 
ATOM   9964  O OD1 . ASN E 1 97  ? 43.054  -23.613 -35.591 1.00 39.46 ? 95  ASN W OD1 1 
ATOM   9965  N ND2 . ASN E 1 97  ? 44.090  -23.518 -37.593 1.00 39.46 ? 95  ASN W ND2 1 
ATOM   9966  N N   . ILE E 1 98  ? 47.713  -25.673 -34.619 1.00 58.27 ? 96  ILE W N   1 
ATOM   9967  C CA  . ILE E 1 98  ? 48.778  -26.621 -34.334 1.00 58.27 ? 96  ILE W CA  1 
ATOM   9968  C C   . ILE E 1 98  ? 48.768  -26.907 -32.844 1.00 58.27 ? 96  ILE W C   1 
ATOM   9969  O O   . ILE E 1 98  ? 49.103  -28.000 -32.392 1.00 58.27 ? 96  ILE W O   1 
ATOM   9970  C CB  . ILE E 1 98  ? 50.150  -26.036 -34.682 1.00 43.15 ? 96  ILE W CB  1 
ATOM   9971  C CG1 . ILE E 1 98  ? 50.286  -25.910 -36.199 1.00 43.15 ? 96  ILE W CG1 1 
ATOM   9972  C CG2 . ILE E 1 98  ? 51.255  -26.896 -34.090 1.00 43.15 ? 96  ILE W CG2 1 
ATOM   9973  C CD1 . ILE E 1 98  ? 51.727  -25.682 -36.700 1.00 43.15 ? 96  ILE W CD1 1 
ATOM   9974  N N   . LEU E 1 99  ? 48.381  -25.895 -32.086 1.00 38.73 ? 97  LEU W N   1 
ATOM   9975  C CA  . LEU E 1 99  ? 48.319  -25.987 -30.647 1.00 38.73 ? 97  LEU W CA  1 
ATOM   9976  C C   . LEU E 1 99  ? 46.990  -26.581 -30.224 1.00 38.73 ? 97  LEU W C   1 
ATOM   9977  O O   . LEU E 1 99  ? 46.953  -27.497 -29.413 1.00 38.73 ? 97  LEU W O   1 
ATOM   9978  C CB  . LEU E 1 99  ? 48.490  -24.593 -30.048 1.00 30.59 ? 97  LEU W CB  1 
ATOM   9979  C CG  . LEU E 1 99  ? 49.779  -23.872 -30.446 1.00 30.59 ? 97  LEU W CG  1 
ATOM   9980  C CD1 . LEU E 1 99  ? 49.799  -22.499 -29.821 1.00 30.59 ? 97  LEU W CD1 1 
ATOM   9981  C CD2 . LEU E 1 99  ? 50.987  -24.691 -30.013 1.00 30.59 ? 97  LEU W CD2 1 
ATOM   9982  N N   . LYS E 1 100 ? 45.896  -26.059 -30.763 1.00 43.59 ? 98  LYS W N   1 
ATOM   9983  C CA  . LYS E 1 100 ? 44.589  -26.587 -30.405 1.00 43.59 ? 98  LYS W CA  1 
ATOM   9984  C C   . LYS E 1 100 ? 44.584  -28.088 -30.645 1.00 43.59 ? 98  LYS W C   1 
ATOM   9985  O O   . LYS E 1 100 ? 43.968  -28.849 -29.897 1.00 43.59 ? 98  LYS W O   1 
ATOM   9986  C CB  . LYS E 1 100 ? 43.481  -25.938 -31.236 1.00 51.36 ? 98  LYS W CB  1 
ATOM   9987  C CG  . LYS E 1 100 ? 42.137  -26.654 -31.106 1.00 51.36 ? 98  LYS W CG  1 
ATOM   9988  C CD  . LYS E 1 100 ? 41.094  -26.124 -32.081 1.00 51.36 ? 98  LYS W CD  1 
ATOM   9989  C CE  . LYS E 1 100 ? 40.474  -24.813 -31.610 1.00 51.36 ? 98  LYS W CE  1 
ATOM   9990  N NZ  . LYS E 1 100 ? 39.591  -24.970 -30.416 1.00 51.36 ? 98  LYS W NZ  1 
ATOM   9991  N N   . GLU E 1 101 ? 45.272  -28.516 -31.697 1.00 56.94 ? 99  GLU W N   1 
ATOM   9992  C CA  . GLU E 1 101 ? 45.332  -29.939 -32.004 1.00 56.94 ? 99  GLU W CA  1 
ATOM   9993  C C   . GLU E 1 101 ? 45.950  -30.643 -30.792 1.00 56.94 ? 99  GLU W C   1 
ATOM   9994  O O   . GLU E 1 101 ? 45.317  -31.492 -30.163 1.00 56.94 ? 99  GLU W O   1 
ATOM   9995  C CB  . GLU E 1 101 ? 46.185  -30.173 -33.258 1.00 85.61 ? 99  GLU W CB  1 
ATOM   9996  C CG  . GLU E 1 101 ? 45.677  -31.289 -34.173 1.00 85.61 ? 99  GLU W CG  1 
ATOM   9997  C CD  . GLU E 1 101 ? 45.894  -32.688 -33.604 1.00 85.61 ? 99  GLU W CD  1 
ATOM   9998  O OE1 . GLU E 1 101 ? 45.553  -32.909 -32.424 1.00 85.61 ? 99  GLU W OE1 1 
ATOM   9999  O OE2 . GLU E 1 101 ? 46.392  -33.571 -34.340 1.00 85.61 ? 99  GLU W OE2 1 
ATOM   10000 N N   . LYS E 1 102 ? 47.180  -30.255 -30.464 1.00 31.83 ? 100 LYS W N   1 
ATOM   10001 C CA  . LYS E 1 102 ? 47.924  -30.813 -29.348 1.00 31.83 ? 100 LYS W CA  1 
ATOM   10002 C C   . LYS E 1 102 ? 47.308  -30.512 -27.986 1.00 31.83 ? 100 LYS W C   1 
ATOM   10003 O O   . LYS E 1 102 ? 47.980  -30.651 -26.958 1.00 31.83 ? 100 LYS W O   1 
ATOM   10004 C CB  . LYS E 1 102 ? 49.347  -30.267 -29.344 1.00 27.21 ? 100 LYS W CB  1 
ATOM   10005 C CG  . LYS E 1 102 ? 50.159  -30.566 -30.575 1.00 27.21 ? 100 LYS W CG  1 
ATOM   10006 C CD  . LYS E 1 102 ? 51.567  -30.035 -30.397 1.00 27.21 ? 100 LYS W CD  1 
ATOM   10007 C CE  . LYS E 1 102 ? 52.406  -30.282 -31.632 1.00 27.21 ? 100 LYS W CE  1 
ATOM   10008 N NZ  . LYS E 1 102 ? 51.769  -29.741 -32.877 1.00 27.21 ? 100 LYS W NZ  1 
ATOM   10009 N N   . GLY E 1 103 ? 46.054  -30.075 -27.954 1.00 49.61 ? 101 GLY W N   1 
ATOM   10010 C CA  . GLY E 1 103 ? 45.431  -29.793 -26.670 1.00 49.61 ? 101 GLY W CA  1 
ATOM   10011 C C   . GLY E 1 103 ? 46.124  -28.784 -25.760 1.00 49.61 ? 101 GLY W C   1 
ATOM   10012 O O   . GLY E 1 103 ? 45.902  -28.804 -24.545 1.00 49.61 ? 101 GLY W O   1 
ATOM   10013 N N   . ILE E 1 104 ? 46.979  -27.924 -26.318 1.00 13.80 ? 102 ILE W N   1 
ATOM   10014 C CA  . ILE E 1 104 ? 47.623  -26.876 -25.523 1.00 13.80 ? 102 ILE W CA  1 
ATOM   10015 C C   . ILE E 1 104 ? 46.710  -25.675 -25.736 1.00 13.80 ? 102 ILE W C   1 
ATOM   10016 O O   . ILE E 1 104 ? 46.467  -25.281 -26.873 1.00 13.80 ? 102 ILE W O   1 
ATOM   10017 C CB  . ILE E 1 104 ? 49.038  -26.508 -26.030 1.00 15.60 ? 102 ILE W CB  1 
ATOM   10018 C CG1 . ILE E 1 104 ? 49.995  -27.678 -25.868 1.00 15.60 ? 102 ILE W CG1 1 
ATOM   10019 C CG2 . ILE E 1 104 ? 49.601  -25.382 -25.205 1.00 15.60 ? 102 ILE W CG2 1 
ATOM   10020 C CD1 . ILE E 1 104 ? 51.374  -27.372 -26.384 1.00 15.60 ? 102 ILE W CD1 1 
ATOM   10021 N N   . VAL E 1 105 ? 46.174  -25.108 -24.663 1.00 39.41 ? 103 VAL W N   1 
ATOM   10022 C CA  . VAL E 1 105 ? 45.286  -23.956 -24.815 1.00 39.41 ? 103 VAL W CA  1 
ATOM   10023 C C   . VAL E 1 105 ? 46.055  -22.735 -25.320 1.00 39.41 ? 103 VAL W C   1 
ATOM   10024 O O   . VAL E 1 105 ? 47.242  -22.561 -25.028 1.00 39.41 ? 103 VAL W O   1 
ATOM   10025 C CB  . VAL E 1 105 ? 44.607  -23.582 -23.489 1.00 22.74 ? 103 VAL W CB  1 
ATOM   10026 C CG1 . VAL E 1 105 ? 43.296  -22.891 -23.772 1.00 22.74 ? 103 VAL W CG1 1 
ATOM   10027 C CG2 . VAL E 1 105 ? 44.382  -24.811 -22.653 1.00 22.74 ? 103 VAL W CG2 1 
ATOM   10028 N N   . VAL E 1 106 ? 45.377  -21.879 -26.072 1.00 44.51 ? 104 VAL W N   1 
ATOM   10029 C CA  . VAL E 1 106 ? 46.032  -20.693 -26.604 1.00 44.51 ? 104 VAL W CA  1 
ATOM   10030 C C   . VAL E 1 106 ? 45.590  -19.409 -25.924 1.00 44.51 ? 104 VAL W C   1 
ATOM   10031 O O   . VAL E 1 106 ? 44.395  -19.178 -25.748 1.00 44.51 ? 104 VAL W O   1 
ATOM   10032 C CB  . VAL E 1 106 ? 45.784  -20.575 -28.109 1.00 32.72 ? 104 VAL W CB  1 
ATOM   10033 C CG1 . VAL E 1 106 ? 46.479  -19.355 -28.656 1.00 32.72 ? 104 VAL W CG1 1 
ATOM   10034 C CG2 . VAL E 1 106 ? 46.304  -21.819 -28.801 1.00 32.72 ? 104 VAL W CG2 1 
ATOM   10035 N N   . GLY E 1 107 ? 46.567  -18.582 -25.551 1.00 40.20 ? 105 GLY W N   1 
ATOM   10036 C CA  . GLY E 1 107 ? 46.297  -17.310 -24.890 1.00 40.20 ? 105 GLY W CA  1 
ATOM   10037 C C   . GLY E 1 107 ? 46.732  -16.095 -25.683 1.00 40.20 ? 105 GLY W C   1 
ATOM   10038 O O   . GLY E 1 107 ? 47.507  -16.210 -26.628 1.00 40.20 ? 105 GLY W O   1 
ATOM   10039 N N   . ILE E 1 108 ? 46.261  -14.917 -25.303 1.00 60.59 ? 106 ILE W N   1 
ATOM   10040 C CA  . ILE E 1 108 ? 46.643  -13.754 -26.079 1.00 60.59 ? 106 ILE W CA  1 
ATOM   10041 C C   . ILE E 1 108 ? 46.979  -12.475 -25.319 1.00 60.59 ? 106 ILE W C   1 
ATOM   10042 O O   . ILE E 1 108 ? 46.185  -11.983 -24.509 1.00 60.59 ? 106 ILE W O   1 
ATOM   10043 C CB  . ILE E 1 108 ? 45.553  -13.446 -27.140 1.00 68.36 ? 106 ILE W CB  1 
ATOM   10044 C CG1 . ILE E 1 108 ? 46.121  -12.488 -28.192 1.00 68.36 ? 106 ILE W CG1 1 
ATOM   10045 C CG2 . ILE E 1 108 ? 44.289  -12.888 -26.466 1.00 68.36 ? 106 ILE W CG2 1 
ATOM   10046 C CD1 . ILE E 1 108 ? 47.288  -13.063 -29.000 1.00 68.36 ? 106 ILE W CD1 1 
ATOM   10047 N N   . LYS E 1 109 ? 48.167  -11.941 -25.611 1.00 69.52 ? 107 LYS W N   1 
ATOM   10048 C CA  . LYS E 1 109 ? 48.656  -10.702 -25.006 1.00 68.51 ? 107 LYS W CA  1 
ATOM   10049 C C   . LYS E 1 109 ? 47.790  -9.498  -25.379 1.00 70.72 ? 107 LYS W C   1 
ATOM   10050 O O   . LYS E 1 109 ? 48.011  -8.860  -26.408 1.00 73.88 ? 107 LYS W O   1 
ATOM   10051 C CB  . LYS E 1 109 ? 50.111  -10.440 -25.437 1.00 68.06 ? 107 LYS W CB  1 
ATOM   10052 C CG  . LYS E 1 109 ? 50.516  -8.961  -25.465 1.00 68.77 ? 107 LYS W CG  1 
ATOM   10053 C CD  . LYS E 1 109 ? 52.025  -8.755  -25.508 1.00 68.51 ? 107 LYS W CD  1 
ATOM   10054 C CE  . LYS E 1 109 ? 52.618  -8.845  -24.108 1.00 68.77 ? 107 LYS W CE  1 
ATOM   10055 N NZ  . LYS E 1 109 ? 54.062  -8.502  -24.074 1.00 68.77 ? 107 LYS W NZ  1 
ATOM   10056 N N   . LEU E 1 110 ? 46.798  -9.195  -24.549 1.00 53.58 ? 108 LEU W N   1 
ATOM   10057 C CA  . LEU E 1 110 ? 45.932  -8.052  -24.808 1.00 52.44 ? 108 LEU W CA  1 
ATOM   10058 C C   . LEU E 1 110 ? 46.725  -6.771  -24.498 1.00 48.59 ? 108 LEU W C   1 
ATOM   10059 O O   . LEU E 1 110 ? 46.197  -5.659  -24.537 1.00 56.13 ? 108 LEU W O   1 
ATOM   10060 C CB  . LEU E 1 110 ? 44.687  -8.125  -23.924 1.00 24.39 ? 108 LEU W CB  1 
ATOM   10061 C CG  . LEU E 1 110 ? 43.847  -9.391  -23.989 1.00 40.31 ? 108 LEU W CG  1 
ATOM   10062 C CD1 . LEU E 1 110 ? 42.703  -9.303  -23.018 1.00 22.14 ? 108 LEU W CD1 1 
ATOM   10063 C CD2 . LEU E 1 110 ? 43.310  -9.547  -25.374 1.00 30.32 ? 108 LEU W CD2 1 
ATOM   10064 N N   . GLY E 1 131 ? 37.553  -0.626  -24.951 1.00 69.28 ? 129 GLY W N   1 
ATOM   10065 C CA  . GLY E 1 131 ? 37.272  -1.383  -26.160 1.00 63.36 ? 129 GLY W CA  1 
ATOM   10066 C C   . GLY E 1 131 ? 37.776  -2.806  -26.055 1.00 69.28 ? 129 GLY W C   1 
ATOM   10067 O O   . GLY E 1 131 ? 37.664  -3.591  -26.991 1.00 69.28 ? 129 GLY W O   1 
ATOM   10068 N N   . LEU E 1 132 ? 38.337  -3.129  -24.897 1.00 58.59 ? 130 LEU W N   1 
ATOM   10069 C CA  . LEU E 1 132 ? 38.876  -4.456  -24.612 1.00 57.73 ? 130 LEU W CA  1 
ATOM   10070 C C   . LEU E 1 132 ? 37.777  -5.501  -24.653 1.00 49.61 ? 130 LEU W C   1 
ATOM   10071 O O   . LEU E 1 132 ? 37.966  -6.602  -25.157 1.00 57.84 ? 130 LEU W O   1 
ATOM   10072 C CB  . LEU E 1 132 ? 39.503  -4.468  -23.224 1.00 39.93 ? 130 LEU W CB  1 
ATOM   10073 C CG  . LEU E 1 132 ? 40.101  -5.779  -22.748 1.00 48.99 ? 130 LEU W CG  1 
ATOM   10074 C CD1 . LEU E 1 132 ? 41.469  -5.966  -23.352 1.00 29.66 ? 130 LEU W CD1 1 
ATOM   10075 C CD2 . LEU E 1 132 ? 40.209  -5.736  -21.255 1.00 35.42 ? 130 LEU W CD2 1 
ATOM   10076 N N   . SER E 1 133 ? 36.625  -5.146  -24.103 1.00 66.97 ? 131 SER W N   1 
ATOM   10077 C CA  . SER E 1 133 ? 35.506  -6.063  -24.078 1.00 66.97 ? 131 SER W CA  1 
ATOM   10078 C C   . SER E 1 133 ? 35.145  -6.571  -25.454 1.00 66.97 ? 131 SER W C   1 
ATOM   10079 O O   . SER E 1 133 ? 34.472  -7.591  -25.576 1.00 66.97 ? 131 SER W O   1 
ATOM   10080 C CB  . SER E 1 133 ? 34.279  -5.404  -23.485 1.00 39.51 ? 131 SER W CB  1 
ATOM   10081 O OG  . SER E 1 133 ? 33.170  -6.265  -23.660 1.00 39.51 ? 131 SER W OG  1 
ATOM   10082 N N   . GLU E 1 134 ? 35.566  -5.860  -26.494 1.00 61.40 ? 132 GLU W N   1 
ATOM   10083 C CA  . GLU E 1 134 ? 35.253  -6.303  -27.845 1.00 61.40 ? 132 GLU W CA  1 
ATOM   10084 C C   . GLU E 1 134 ? 36.370  -7.138  -28.457 1.00 61.40 ? 132 GLU W C   1 
ATOM   10085 O O   . GLU E 1 134 ? 36.098  -8.099  -29.173 1.00 61.40 ? 132 GLU W O   1 
ATOM   10086 C CB  . GLU E 1 134 ? 34.930  -5.115  -28.748 1.00 92.42 ? 132 GLU W CB  1 
ATOM   10087 C CG  . GLU E 1 134 ? 34.125  -5.520  -29.979 1.00 92.42 ? 132 GLU W CG  1 
ATOM   10088 C CD  . GLU E 1 134 ? 32.826  -6.244  -29.619 1.00 92.42 ? 132 GLU W CD  1 
ATOM   10089 O OE1 . GLU E 1 134 ? 32.153  -6.772  -30.535 1.00 92.42 ? 132 GLU W OE1 1 
ATOM   10090 O OE2 . GLU E 1 134 ? 32.476  -6.282  -28.419 1.00 92.42 ? 132 GLU W OE2 1 
ATOM   10091 N N   . ARG E 1 135 ? 37.623  -6.777  -28.183 1.00 39.83 ? 133 ARG W N   1 
ATOM   10092 C CA  . ARG E 1 135 ? 38.759  -7.544  -28.702 1.00 39.83 ? 133 ARG W CA  1 
ATOM   10093 C C   . ARG E 1 135 ? 38.620  -8.976  -28.183 1.00 39.83 ? 133 ARG W C   1 
ATOM   10094 O O   . ARG E 1 135 ? 38.786  -9.952  -28.918 1.00 39.83 ? 133 ARG W O   1 
ATOM   10095 C CB  . ARG E 1 135 ? 40.087  -6.973  -28.198 1.00 88.28 ? 133 ARG W CB  1 
ATOM   10096 C CG  . ARG E 1 135 ? 40.320  -5.506  -28.488 1.00 88.28 ? 133 ARG W CG  1 
ATOM   10097 C CD  . ARG E 1 135 ? 41.628  -5.042  -27.855 1.00 88.28 ? 133 ARG W CD  1 
ATOM   10098 N NE  . ARG E 1 135 ? 42.789  -5.737  -28.415 1.00 88.28 ? 133 ARG W NE  1 
ATOM   10099 C CZ  . ARG E 1 135 ? 44.045  -5.544  -28.015 1.00 88.28 ? 133 ARG W CZ  1 
ATOM   10100 N NH1 . ARG E 1 135 ? 44.310  -4.677  -27.042 1.00 88.28 ? 133 ARG W NH1 1 
ATOM   10101 N NH2 . ARG E 1 135 ? 45.039  -6.207  -28.598 1.00 88.28 ? 133 ARG W NH2 1 
ATOM   10102 N N   . CYS E 1 136 ? 38.320  -9.084  -26.894 1.00 46.98 ? 134 CYS W N   1 
ATOM   10103 C CA  . CYS E 1 136 ? 38.140  -10.375 -26.265 1.00 46.98 ? 134 CYS W CA  1 
ATOM   10104 C C   . CYS E 1 136 ? 37.079  -11.131 -27.043 1.00 46.98 ? 134 CYS W C   1 
ATOM   10105 O O   . CYS E 1 136 ? 37.396  -12.091 -27.732 1.00 46.98 ? 134 CYS W O   1 
ATOM   10106 C CB  . CYS E 1 136 ? 37.742  -10.201 -24.793 1.00 35.38 ? 134 CYS W CB  1 
ATOM   10107 S SG  . CYS E 1 136 ? 39.126  -9.611  -23.736 1.00 35.38 ? 134 CYS W SG  1 
ATOM   10108 N N   . ALA E 1 137 ? 35.832  -10.687 -26.958 1.00 47.39 ? 135 ALA W N   1 
ATOM   10109 C CA  . ALA E 1 137 ? 34.747  -11.342 -27.682 1.00 47.39 ? 135 ALA W CA  1 
ATOM   10110 C C   . ALA E 1 137 ? 35.217  -11.837 -29.056 1.00 47.39 ? 135 ALA W C   1 
ATOM   10111 O O   . ALA E 1 137 ? 34.800  -12.902 -29.524 1.00 47.39 ? 135 ALA W O   1 
ATOM   10112 C CB  . ALA E 1 137 ? 33.580  -10.376 -27.844 1.00 89.68 ? 135 ALA W CB  1 
ATOM   10113 N N   . GLN E 1 138 ? 36.086  -11.054 -29.695 1.00 55.97 ? 136 GLN W N   1 
ATOM   10114 C CA  . GLN E 1 138 ? 36.636  -11.395 -31.006 1.00 55.97 ? 136 GLN W CA  1 
ATOM   10115 C C   . GLN E 1 138 ? 37.642  -12.531 -30.885 1.00 55.97 ? 136 GLN W C   1 
ATOM   10116 O O   . GLN E 1 138 ? 37.459  -13.592 -31.476 1.00 55.97 ? 136 GLN W O   1 
ATOM   10117 C CB  . GLN E 1 138 ? 37.327  -10.183 -31.623 1.00 56.05 ? 136 GLN W CB  1 
ATOM   10118 C CG  . GLN E 1 138 ? 38.138  -10.510 -32.866 1.00 56.05 ? 136 GLN W CG  1 
ATOM   10119 C CD  . GLN E 1 138 ? 37.284  -10.977 -34.033 1.00 56.05 ? 136 GLN W CD  1 
ATOM   10120 O OE1 . GLN E 1 138 ? 37.805  -11.274 -35.103 1.00 56.05 ? 136 GLN W OE1 1 
ATOM   10121 N NE2 . GLN E 1 138 ? 35.971  -11.042 -33.834 1.00 56.05 ? 136 GLN W NE2 1 
ATOM   10122 N N   . TYR E 1 139 ? 38.710  -12.289 -30.128 1.00 57.74 ? 137 TYR W N   1 
ATOM   10123 C CA  . TYR E 1 139 ? 39.744  -13.291 -29.892 1.00 57.74 ? 137 TYR W CA  1 
ATOM   10124 C C   . TYR E 1 139 ? 39.101  -14.620 -29.518 1.00 57.74 ? 137 TYR W C   1 
ATOM   10125 O O   . TYR E 1 139 ? 39.596  -15.682 -29.886 1.00 57.74 ? 137 TYR W O   1 
ATOM   10126 C CB  . TYR E 1 139 ? 40.653  -12.842 -28.757 1.00 49.62 ? 137 TYR W CB  1 
ATOM   10127 C CG  . TYR E 1 139 ? 41.709  -11.846 -29.156 1.00 49.62 ? 137 TYR W CG  1 
ATOM   10128 C CD1 . TYR E 1 139 ? 42.918  -12.270 -29.698 1.00 49.62 ? 137 TYR W CD1 1 
ATOM   10129 C CD2 . TYR E 1 139 ? 41.518  -10.482 -28.961 1.00 49.62 ? 137 TYR W CD2 1 
ATOM   10130 C CE1 . TYR E 1 139 ? 43.915  -11.361 -30.027 1.00 49.62 ? 137 TYR W CE1 1 
ATOM   10131 C CE2 . TYR E 1 139 ? 42.512  -9.564  -29.289 1.00 49.62 ? 137 TYR W CE2 1 
ATOM   10132 C CZ  . TYR E 1 139 ? 43.708  -10.015 -29.818 1.00 49.62 ? 137 TYR W CZ  1 
ATOM   10133 O OH  . TYR E 1 139 ? 44.708  -9.130  -30.120 1.00 49.62 ? 137 TYR W OH  1 
ATOM   10134 N N   . LYS E 1 140 ? 38.001  -14.552 -28.771 1.00 52.80 ? 138 LYS W N   1 
ATOM   10135 C CA  . LYS E 1 140 ? 37.281  -15.750 -28.362 1.00 52.80 ? 138 LYS W CA  1 
ATOM   10136 C C   . LYS E 1 140 ? 36.951  -16.525 -29.625 1.00 52.80 ? 138 LYS W C   1 
ATOM   10137 O O   . LYS E 1 140 ? 37.376  -17.670 -29.791 1.00 52.80 ? 138 LYS W O   1 
ATOM   10138 C CB  . LYS E 1 140 ? 35.987  -15.383 -27.633 1.00 49.43 ? 138 LYS W CB  1 
ATOM   10139 C CG  . LYS E 1 140 ? 35.230  -16.586 -27.071 1.00 49.43 ? 138 LYS W CG  1 
ATOM   10140 C CD  . LYS E 1 140 ? 36.094  -17.365 -26.070 1.00 49.43 ? 138 LYS W CD  1 
ATOM   10141 C CE  . LYS E 1 140 ? 35.365  -18.550 -25.445 1.00 49.43 ? 138 LYS W CE  1 
ATOM   10142 N NZ  . LYS E 1 140 ? 36.271  -19.313 -24.535 1.00 49.43 ? 138 LYS W NZ  1 
ATOM   10143 N N   . LYS E 1 141 ? 36.196  -15.887 -30.516 1.00 60.03 ? 139 LYS W N   1 
ATOM   10144 C CA  . LYS E 1 141 ? 35.817  -16.496 -31.785 1.00 60.03 ? 139 LYS W CA  1 
ATOM   10145 C C   . LYS E 1 141 ? 37.034  -17.044 -32.519 1.00 60.03 ? 139 LYS W C   1 
ATOM   10146 O O   . LYS E 1 141 ? 36.950  -18.051 -33.210 1.00 60.03 ? 139 LYS W O   1 
ATOM   10147 C CB  . LYS E 1 141 ? 35.117  -15.473 -32.685 1.00 53.26 ? 139 LYS W CB  1 
ATOM   10148 C CG  . LYS E 1 141 ? 33.599  -15.498 -32.612 1.00 53.26 ? 139 LYS W CG  1 
ATOM   10149 C CD  . LYS E 1 141 ? 32.980  -14.531 -33.630 1.00 53.26 ? 139 LYS W CD  1 
ATOM   10150 C CE  . LYS E 1 141 ? 31.442  -14.547 -33.598 1.00 53.26 ? 139 LYS W CE  1 
ATOM   10151 N NZ  . LYS E 1 141 ? 30.826  -13.500 -34.475 1.00 53.26 ? 139 LYS W NZ  1 
ATOM   10152 N N   . ASP E 1 142 ? 38.170  -16.380 -32.357 1.00 35.09 ? 140 ASP W N   1 
ATOM   10153 C CA  . ASP E 1 142 ? 39.395  -16.791 -33.032 1.00 35.09 ? 140 ASP W CA  1 
ATOM   10154 C C   . ASP E 1 142 ? 40.165  -17.913 -32.349 1.00 35.09 ? 140 ASP W C   1 
ATOM   10155 O O   . ASP E 1 142 ? 41.338  -18.144 -32.657 1.00 35.09 ? 140 ASP W O   1 
ATOM   10156 C CB  . ASP E 1 142 ? 40.307  -15.576 -33.247 1.00 92.42 ? 140 ASP W CB  1 
ATOM   10157 C CG  . ASP E 1 142 ? 39.822  -14.681 -34.382 1.00 92.42 ? 140 ASP W CG  1 
ATOM   10158 O OD1 . ASP E 1 142 ? 38.594  -14.442 -34.471 1.00 92.42 ? 140 ASP W OD1 1 
ATOM   10159 O OD2 . ASP E 1 142 ? 40.668  -14.213 -35.181 1.00 92.42 ? 140 ASP W OD2 1 
ATOM   10160 N N   . GLY E 1 143 ? 39.503  -18.603 -31.422 1.00 91.24 ? 141 GLY W N   1 
ATOM   10161 C CA  . GLY E 1 143 ? 40.122  -19.727 -30.739 1.00 91.24 ? 141 GLY W CA  1 
ATOM   10162 C C   . GLY E 1 143 ? 40.999  -19.460 -29.533 1.00 91.24 ? 141 GLY W C   1 
ATOM   10163 O O   . GLY E 1 143 ? 41.834  -20.301 -29.180 1.00 91.24 ? 141 GLY W O   1 
ATOM   10164 N N   . VAL E 1 144 ? 40.830  -18.305 -28.896 1.00 68.48 ? 142 VAL W N   1 
ATOM   10165 C CA  . VAL E 1 144 ? 41.628  -17.990 -27.713 1.00 68.48 ? 142 VAL W CA  1 
ATOM   10166 C C   . VAL E 1 144 ? 40.764  -18.307 -26.501 1.00 68.48 ? 142 VAL W C   1 
ATOM   10167 O O   . VAL E 1 144 ? 39.546  -18.130 -26.542 1.00 68.48 ? 142 VAL W O   1 
ATOM   10168 C CB  . VAL E 1 144 ? 42.038  -16.486 -27.656 1.00 66.19 ? 142 VAL W CB  1 
ATOM   10169 C CG1 . VAL E 1 144 ? 43.049  -16.262 -26.539 1.00 66.19 ? 142 VAL W CG1 1 
ATOM   10170 C CG2 . VAL E 1 144 ? 42.628  -16.040 -28.985 1.00 66.19 ? 142 VAL W CG2 1 
ATOM   10171 N N   . ASP E 1 145 ? 41.387  -18.788 -25.430 1.00 47.32 ? 143 ASP W N   1 
ATOM   10172 C CA  . ASP E 1 145 ? 40.639  -19.113 -24.227 1.00 47.32 ? 143 ASP W CA  1 
ATOM   10173 C C   . ASP E 1 145 ? 41.047  -18.294 -22.998 1.00 47.32 ? 143 ASP W C   1 
ATOM   10174 O O   . ASP E 1 145 ? 40.317  -18.266 -22.003 1.00 47.32 ? 143 ASP W O   1 
ATOM   10175 C CB  . ASP E 1 145 ? 40.728  -20.612 -23.950 1.00 46.48 ? 143 ASP W CB  1 
ATOM   10176 C CG  . ASP E 1 145 ? 40.072  -21.441 -25.045 1.00 46.48 ? 143 ASP W CG  1 
ATOM   10177 O OD1 . ASP E 1 145 ? 40.785  -22.211 -25.720 1.00 46.48 ? 143 ASP W OD1 1 
ATOM   10178 O OD2 . ASP E 1 145 ? 38.843  -21.319 -25.236 1.00 46.48 ? 143 ASP W OD2 1 
ATOM   10179 N N   . PHE E 1 146 ? 42.193  -17.614 -23.070 1.00 45.01 ? 144 PHE W N   1 
ATOM   10180 C CA  . PHE E 1 146 ? 42.639  -16.767 -21.960 1.00 45.01 ? 144 PHE W CA  1 
ATOM   10181 C C   . PHE E 1 146 ? 43.459  -15.555 -22.376 1.00 45.01 ? 144 PHE W C   1 
ATOM   10182 O O   . PHE E 1 146 ? 44.012  -15.514 -23.481 1.00 45.01 ? 144 PHE W O   1 
ATOM   10183 C CB  . PHE E 1 146 ? 43.420  -17.578 -20.922 1.00 22.24 ? 144 PHE W CB  1 
ATOM   10184 C CG  . PHE E 1 146 ? 44.802  -17.967 -21.343 1.00 22.24 ? 144 PHE W CG  1 
ATOM   10185 C CD1 . PHE E 1 146 ? 45.911  -17.496 -20.640 1.00 22.24 ? 144 PHE W CD1 1 
ATOM   10186 C CD2 . PHE E 1 146 ? 44.999  -18.867 -22.377 1.00 22.24 ? 144 PHE W CD2 1 
ATOM   10187 C CE1 . PHE E 1 146 ? 47.196  -17.925 -20.958 1.00 22.24 ? 144 PHE W CE1 1 
ATOM   10188 C CE2 . PHE E 1 146 ? 46.283  -19.297 -22.697 1.00 22.24 ? 144 PHE W CE2 1 
ATOM   10189 C CZ  . PHE E 1 146 ? 47.383  -18.824 -21.983 1.00 22.24 ? 144 PHE W CZ  1 
ATOM   10190 N N   . GLY E 1 147 ? 43.531  -14.571 -21.476 1.00 64.93 ? 145 GLY W N   1 
ATOM   10191 C CA  . GLY E 1 147 ? 44.266  -13.346 -21.758 1.00 57.87 ? 145 GLY W CA  1 
ATOM   10192 C C   . GLY E 1 147 ? 45.188  -12.838 -20.662 1.00 62.56 ? 145 GLY W C   1 
ATOM   10193 O O   . GLY E 1 147 ? 44.936  -13.030 -19.477 1.00 67.15 ? 145 GLY W O   1 
ATOM   10194 N N   . LYS E 1 148 ? 46.266  -12.180 -21.078 1.00 70.90 ? 146 LYS W N   1 
ATOM   10195 C CA  . LYS E 1 148 ? 47.269  -11.606 -20.180 1.00 71.65 ? 146 LYS W CA  1 
ATOM   10196 C C   . LYS E 1 148 ? 47.023  -10.106 -20.148 1.00 77.29 ? 146 LYS W C   1 
ATOM   10197 O O   . LYS E 1 148 ? 46.187  -9.601  -20.899 1.00 76.33 ? 146 LYS W O   1 
ATOM   10198 C CB  . LYS E 1 148 ? 48.662  -11.882 -20.735 1.00 61.34 ? 146 LYS W CB  1 
ATOM   10199 C CG  . LYS E 1 148 ? 49.838  -11.360 -19.949 1.00 64.80 ? 146 LYS W CG  1 
ATOM   10200 C CD  . LYS E 1 148 ? 51.093  -11.668 -20.762 1.00 63.57 ? 146 LYS W CD  1 
ATOM   10201 C CE  . LYS E 1 148 ? 52.330  -11.871 -19.901 1.00 75.52 ? 146 LYS W CE  1 
ATOM   10202 N NZ  . LYS E 1 148 ? 53.505  -12.337 -20.714 1.00 70.80 ? 146 LYS W NZ  1 
ATOM   10203 N N   . TRP E 1 149 ? 47.746  -9.398  -19.285 1.00 92.42 ? 147 TRP W N   1 
ATOM   10204 C CA  . TRP E 1 149 ? 47.599  -7.942  -19.155 1.00 92.42 ? 147 TRP W CA  1 
ATOM   10205 C C   . TRP E 1 149 ? 48.353  -7.358  -17.955 1.00 92.42 ? 147 TRP W C   1 
ATOM   10206 O O   . TRP E 1 149 ? 48.297  -7.888  -16.839 1.00 92.42 ? 147 TRP W O   1 
ATOM   10207 C CB  . TRP E 1 149 ? 46.108  -7.550  -19.043 1.00 90.39 ? 147 TRP W CB  1 
ATOM   10208 C CG  . TRP E 1 149 ? 45.852  -6.075  -18.741 1.00 90.39 ? 147 TRP W CG  1 
ATOM   10209 C CD1 . TRP E 1 149 ? 46.240  -5.374  -17.626 1.00 90.39 ? 147 TRP W CD1 1 
ATOM   10210 C CD2 . TRP E 1 149 ? 45.158  -5.141  -19.571 1.00 90.39 ? 147 TRP W CD2 1 
ATOM   10211 N NE1 . TRP E 1 149 ? 45.833  -4.066  -17.716 1.00 90.39 ? 147 TRP W NE1 1 
ATOM   10212 C CE2 . TRP E 1 149 ? 45.166  -3.894  -18.898 1.00 90.39 ? 147 TRP W CE2 1 
ATOM   10213 C CE3 . TRP E 1 149 ? 44.529  -5.235  -20.819 1.00 90.39 ? 147 TRP W CE3 1 
ATOM   10214 C CZ2 . TRP E 1 149 ? 44.570  -2.751  -19.432 1.00 90.39 ? 147 TRP W CZ2 1 
ATOM   10215 C CZ3 . TRP E 1 149 ? 43.936  -4.099  -21.352 1.00 90.39 ? 147 TRP W CZ3 1 
ATOM   10216 C CH2 . TRP E 1 149 ? 43.962  -2.870  -20.655 1.00 90.39 ? 147 TRP W CH2 1 
ATOM   10217 N N   . ARG E 1 150 ? 49.040  -6.248  -18.204 1.00 92.42 ? 148 ARG W N   1 
ATOM   10218 C CA  . ARG E 1 150 ? 49.787  -5.531  -17.179 1.00 92.42 ? 148 ARG W CA  1 
ATOM   10219 C C   . ARG E 1 150 ? 49.235  -4.087  -17.214 1.00 92.42 ? 148 ARG W C   1 
ATOM   10220 O O   . ARG E 1 150 ? 48.977  -3.538  -18.290 1.00 92.42 ? 148 ARG W O   1 
ATOM   10221 C CB  . ARG E 1 150 ? 51.288  -5.590  -17.499 1.00 92.42 ? 148 ARG W CB  1 
ATOM   10222 C CG  . ARG E 1 150 ? 51.620  -6.357  -18.798 1.00 92.42 ? 148 ARG W CG  1 
ATOM   10223 C CD  . ARG E 1 150 ? 52.743  -7.390  -18.603 1.00 92.42 ? 148 ARG W CD  1 
ATOM   10224 N NE  . ARG E 1 150 ? 53.305  -7.879  -19.868 1.00 92.42 ? 148 ARG W NE  1 
ATOM   10225 C CZ  . ARG E 1 150 ? 54.251  -8.813  -19.956 1.00 92.42 ? 148 ARG W CZ  1 
ATOM   10226 N NH1 . ARG E 1 150 ? 54.743  -9.370  -18.853 1.00 92.42 ? 148 ARG W NH1 1 
ATOM   10227 N NH2 . ARG E 1 150 ? 54.718  -9.182  -21.144 1.00 92.42 ? 148 ARG W NH2 1 
ATOM   10228 N N   . PRO E 1 151 ? 49.021  -3.468  -16.035 1.00 92.42 ? 149 PRO W N   1 
ATOM   10229 C CA  . PRO E 1 151 ? 48.492  -2.101  -15.888 1.00 92.42 ? 149 PRO W CA  1 
ATOM   10230 C C   . PRO E 1 151 ? 49.312  -0.995  -16.562 1.00 92.42 ? 149 PRO W C   1 
ATOM   10231 O O   . PRO E 1 151 ? 48.943  0.188   -16.520 1.00 92.42 ? 149 PRO W O   1 
ATOM   10232 C CB  . PRO E 1 151 ? 48.427  -1.928  -14.375 1.00 90.57 ? 149 PRO W CB  1 
ATOM   10233 C CG  . PRO E 1 151 ? 49.606  -2.724  -13.915 1.00 90.57 ? 149 PRO W CG  1 
ATOM   10234 C CD  . PRO E 1 151 ? 49.466  -3.989  -14.729 1.00 90.57 ? 149 PRO W CD  1 
ATOM   10235 N N   . PRO E 1 160 ? 55.589  2.938   -4.974  1.00 92.42 ? 158 PRO W N   1 
ATOM   10236 C CA  . PRO E 1 160 ? 54.641  2.336   -4.027  1.00 92.42 ? 158 PRO W CA  1 
ATOM   10237 C C   . PRO E 1 160 ? 53.728  3.371   -3.363  1.00 92.42 ? 158 PRO W C   1 
ATOM   10238 O O   . PRO E 1 160 ? 54.022  3.851   -2.267  1.00 92.42 ? 158 PRO W O   1 
ATOM   10239 C CB  . PRO E 1 160 ? 55.558  1.642   -3.019  1.00 85.61 ? 158 PRO W CB  1 
ATOM   10240 C CG  . PRO E 1 160 ? 56.722  1.227   -3.873  1.00 85.61 ? 158 PRO W CG  1 
ATOM   10241 C CD  . PRO E 1 160 ? 56.961  2.455   -4.727  1.00 85.61 ? 158 PRO W CD  1 
ATOM   10242 N N   . SER E 1 161 ? 52.627  3.713   -4.031  1.00 77.12 ? 159 SER W N   1 
ATOM   10243 C CA  . SER E 1 161 ? 51.668  4.691   -3.503  1.00 72.26 ? 159 SER W CA  1 
ATOM   10244 C C   . SER E 1 161 ? 50.380  3.998   -3.092  1.00 77.32 ? 159 SER W C   1 
ATOM   10245 O O   . SER E 1 161 ? 49.913  3.078   -3.766  1.00 82.76 ? 159 SER W O   1 
ATOM   10246 C CB  . SER E 1 161 ? 51.355  5.774   -4.551  1.00 65.14 ? 159 SER W CB  1 
ATOM   10247 O OG  . SER E 1 161 ? 50.421  6.725   -4.059  1.00 79.57 ? 159 SER W OG  1 
ATOM   10248 N N   . SER E 1 162 ? 49.804  4.449   -1.986  1.00 58.70 ? 160 SER W N   1 
ATOM   10249 C CA  . SER E 1 162 ? 48.572  3.860   -1.484  1.00 57.58 ? 160 SER W CA  1 
ATOM   10250 C C   . SER E 1 162 ? 47.441  3.929   -2.508  1.00 55.70 ? 160 SER W C   1 
ATOM   10251 O O   . SER E 1 162 ? 46.430  3.240   -2.375  1.00 65.78 ? 160 SER W O   1 
ATOM   10252 C CB  . SER E 1 162 ? 48.155  4.547   -0.180  1.00 92.42 ? 160 SER W CB  1 
ATOM   10253 O OG  . SER E 1 162 ? 49.154  4.393   0.821   1.00 92.42 ? 160 SER W OG  1 
ATOM   10254 N N   . LEU E 1 163 ? 47.616  4.759   -3.531  1.00 49.07 ? 161 LEU W N   1 
ATOM   10255 C CA  . LEU E 1 163 ? 46.612  4.900   -4.580  1.00 49.07 ? 161 LEU W CA  1 
ATOM   10256 C C   . LEU E 1 163 ? 47.158  4.317   -5.873  1.00 49.07 ? 161 LEU W C   1 
ATOM   10257 O O   . LEU E 1 163 ? 46.416  4.089   -6.827  1.00 49.07 ? 161 LEU W O   1 
ATOM   10258 C CB  . LEU E 1 163 ? 46.247  6.366   -4.811  1.00 66.49 ? 161 LEU W CB  1 
ATOM   10259 C CG  . LEU E 1 163 ? 45.111  6.545   -5.825  1.00 66.49 ? 161 LEU W CG  1 
ATOM   10260 C CD1 . LEU E 1 163 ? 43.800  6.117   -5.184  1.00 66.49 ? 161 LEU W CD1 1 
ATOM   10261 C CD2 . LEU E 1 163 ? 45.035  7.989   -6.285  1.00 66.49 ? 161 LEU W CD2 1 
ATOM   10262 N N   . ALA E 1 164 ? 48.467  4.104   -5.924  1.00 86.21 ? 162 ALA W N   1 
ATOM   10263 C CA  . ALA E 1 164 ? 49.047  3.503   -7.114  1.00 86.21 ? 162 ALA W CA  1 
ATOM   10264 C C   . ALA E 1 164 ? 48.450  2.099   -7.112  1.00 86.21 ? 162 ALA W C   1 
ATOM   10265 O O   . ALA E 1 164 ? 47.774  1.676   -8.057  1.00 86.21 ? 162 ALA W O   1 
ATOM   10266 C CB  . ALA E 1 164 ? 50.569  3.436   -6.991  1.00 28.74 ? 162 ALA W CB  1 
ATOM   10267 N N   . ILE E 1 165 ? 48.691  1.405   -6.006  1.00 70.41 ? 163 ILE W N   1 
ATOM   10268 C CA  . ILE E 1 165 ? 48.208  0.053   -5.788  1.00 70.41 ? 163 ILE W CA  1 
ATOM   10269 C C   . ILE E 1 165 ? 46.697  -0.005  -5.962  1.00 70.41 ? 163 ILE W C   1 
ATOM   10270 O O   . ILE E 1 165 ? 46.176  -0.863  -6.671  1.00 70.41 ? 163 ILE W O   1 
ATOM   10271 C CB  . ILE E 1 165 ? 48.604  -0.411  -4.378  1.00 30.35 ? 163 ILE W CB  1 
ATOM   10272 C CG1 . ILE E 1 165 ? 50.128  -0.519  -4.295  1.00 30.35 ? 163 ILE W CG1 1 
ATOM   10273 C CG2 . ILE E 1 165 ? 47.975  -1.745  -4.061  1.00 30.35 ? 163 ILE W CG2 1 
ATOM   10274 C CD1 . ILE E 1 165 ? 50.637  -0.836  -2.928  1.00 30.35 ? 163 ILE W CD1 1 
ATOM   10275 N N   . GLN E 1 166 ? 46.004  0.915   -5.305  1.00 48.95 ? 164 GLN W N   1 
ATOM   10276 C CA  . GLN E 1 166 ? 44.547  1.015   -5.386  1.00 48.95 ? 164 GLN W CA  1 
ATOM   10277 C C   . GLN E 1 166 ? 44.091  0.972   -6.851  1.00 48.95 ? 164 GLN W C   1 
ATOM   10278 O O   . GLN E 1 166 ? 43.577  -0.043  -7.324  1.00 48.95 ? 164 GLN W O   1 
ATOM   10279 C CB  . GLN E 1 166 ? 44.115  2.329   -4.733  1.00 82.38 ? 164 GLN W CB  1 
ATOM   10280 C CG  . GLN E 1 166 ? 42.739  2.823   -5.101  1.00 82.38 ? 164 GLN W CG  1 
ATOM   10281 C CD  . GLN E 1 166 ? 41.650  2.041   -4.434  1.00 82.38 ? 164 GLN W CD  1 
ATOM   10282 O OE1 . GLN E 1 166 ? 41.698  1.794   -3.228  1.00 82.38 ? 164 GLN W OE1 1 
ATOM   10283 N NE2 . GLN E 1 166 ? 40.644  1.656   -5.208  1.00 82.38 ? 164 GLN W NE2 1 
ATOM   10284 N N   . GLU E 1 167 ? 44.299  2.082   -7.557  1.00 47.41 ? 165 GLU W N   1 
ATOM   10285 C CA  . GLU E 1 167 ? 43.934  2.217   -8.965  1.00 47.41 ? 165 GLU W CA  1 
ATOM   10286 C C   . GLU E 1 167 ? 44.331  0.983   -9.766  1.00 47.41 ? 165 GLU W C   1 
ATOM   10287 O O   . GLU E 1 167 ? 43.481  0.358   -10.393 1.00 47.41 ? 165 GLU W O   1 
ATOM   10288 C CB  . GLU E 1 167 ? 44.610  3.454   -9.578  1.00 78.94 ? 165 GLU W CB  1 
ATOM   10289 C CG  . GLU E 1 167 ? 44.129  4.809   -9.051  1.00 78.94 ? 165 GLU W CG  1 
ATOM   10290 C CD  . GLU E 1 167 ? 42.686  5.117   -9.422  1.00 78.94 ? 165 GLU W CD  1 
ATOM   10291 O OE1 . GLU E 1 167 ? 42.235  6.251   -9.157  1.00 78.94 ? 165 GLU W OE1 1 
ATOM   10292 O OE2 . GLU E 1 167 ? 42.001  4.226   -9.972  1.00 78.94 ? 165 GLU W OE2 1 
ATOM   10293 N N   . ASN E 1 168 ? 45.622  0.648   -9.753  1.00 40.57 ? 166 ASN W N   1 
ATOM   10294 C CA  . ASN E 1 168 ? 46.139  -0.532  -10.467 1.00 40.57 ? 166 ASN W CA  1 
ATOM   10295 C C   . ASN E 1 168 ? 45.242  -1.751  -10.257 1.00 40.57 ? 166 ASN W C   1 
ATOM   10296 O O   . ASN E 1 168 ? 44.719  -2.336  -11.202 1.00 40.57 ? 166 ASN W O   1 
ATOM   10297 C CB  . ASN E 1 168 ? 47.550  -0.878  -9.966  1.00 90.00 ? 166 ASN W CB  1 
ATOM   10298 C CG  . ASN E 1 168 ? 47.906  -2.358  -10.165 1.00 90.00 ? 166 ASN W CG  1 
ATOM   10299 O OD1 . ASN E 1 168 ? 48.319  -2.769  -11.250 1.00 90.00 ? 166 ASN W OD1 1 
ATOM   10300 N ND2 . ASN E 1 168 ? 47.736  -3.159  -9.111  1.00 90.00 ? 166 ASN W ND2 1 
ATOM   10301 N N   . ALA E 1 169 ? 45.099  -2.135  -8.996  1.00 46.05 ? 167 ALA W N   1 
ATOM   10302 C CA  . ALA E 1 169 ? 44.277  -3.261  -8.630  1.00 46.05 ? 167 ALA W CA  1 
ATOM   10303 C C   . ALA E 1 169 ? 42.962  -3.192  -9.390  1.00 46.05 ? 167 ALA W C   1 
ATOM   10304 O O   . ALA E 1 169 ? 42.634  -4.097  -10.158 1.00 46.05 ? 167 ALA W O   1 
ATOM   10305 C CB  . ALA E 1 169 ? 44.023  -3.231  -7.151  1.00 16.93 ? 167 ALA W CB  1 
ATOM   10306 N N   . ASN E 1 170 ? 42.216  -2.113  -9.179  1.00 48.59 ? 168 ASN W N   1 
ATOM   10307 C CA  . ASN E 1 170 ? 40.937  -1.935  -9.853  1.00 48.59 ? 168 ASN W CA  1 
ATOM   10308 C C   . ASN E 1 170 ? 41.038  -2.166  -11.356 1.00 48.59 ? 168 ASN W C   1 
ATOM   10309 O O   . ASN E 1 170 ? 40.115  -2.694  -11.962 1.00 48.59 ? 168 ASN W O   1 
ATOM   10310 C CB  . ASN E 1 170 ? 40.388  -0.535  -9.593  1.00 75.57 ? 168 ASN W CB  1 
ATOM   10311 C CG  . ASN E 1 170 ? 40.265  -0.234  -8.126  1.00 75.57 ? 168 ASN W CG  1 
ATOM   10312 O OD1 . ASN E 1 170 ? 39.759  -1.055  -7.357  1.00 75.57 ? 168 ASN W OD1 1 
ATOM   10313 N ND2 . ASN E 1 170 ? 40.724  0.949   -7.720  1.00 75.57 ? 168 ASN W ND2 1 
ATOM   10314 N N   . ALA E 1 171 ? 42.149  -1.765  -11.966 1.00 57.11 ? 169 ALA W N   1 
ATOM   10315 C CA  . ALA E 1 171 ? 42.324  -1.962  -13.403 1.00 57.11 ? 169 ALA W CA  1 
ATOM   10316 C C   . ALA E 1 171 ? 42.256  -3.454  -13.691 1.00 57.11 ? 169 ALA W C   1 
ATOM   10317 O O   . ALA E 1 171 ? 41.442  -3.906  -14.496 1.00 57.11 ? 169 ALA W O   1 
ATOM   10318 C CB  . ALA E 1 171 ? 43.663  -1.407  -13.853 1.00 81.23 ? 169 ALA W CB  1 
ATOM   10319 N N   . LEU E 1 172 ? 43.128  -4.210  -13.025 1.00 35.08 ? 170 LEU W N   1 
ATOM   10320 C CA  . LEU E 1 172 ? 43.167  -5.650  -13.183 1.00 35.08 ? 170 LEU W CA  1 
ATOM   10321 C C   . LEU E 1 172 ? 41.741  -6.068  -12.970 1.00 35.08 ? 170 LEU W C   1 
ATOM   10322 O O   . LEU E 1 172 ? 41.066  -6.474  -13.901 1.00 35.08 ? 170 LEU W O   1 
ATOM   10323 C CB  . LEU E 1 172 ? 44.060  -6.272  -12.118 1.00 39.33 ? 170 LEU W CB  1 
ATOM   10324 C CG  . LEU E 1 172 ? 45.489  -5.724  -12.160 1.00 39.33 ? 170 LEU W CG  1 
ATOM   10325 C CD1 . LEU E 1 172 ? 46.302  -6.241  -10.979 1.00 39.33 ? 170 LEU W CD1 1 
ATOM   10326 C CD2 . LEU E 1 172 ? 46.141  -6.123  -13.486 1.00 39.33 ? 170 LEU W CD2 1 
ATOM   10327 N N   . ALA E 1 173 ? 41.270  -5.912  -11.746 1.00 18.09 ? 171 ALA W N   1 
ATOM   10328 C CA  . ALA E 1 173 ? 39.908  -6.287  -11.405 1.00 18.09 ? 171 ALA W CA  1 
ATOM   10329 C C   . ALA E 1 173 ? 38.844  -6.031  -12.486 1.00 18.09 ? 171 ALA W C   1 
ATOM   10330 O O   . ALA E 1 173 ? 37.936  -6.844  -12.659 1.00 18.09 ? 171 ALA W O   1 
ATOM   10331 C CB  . ALA E 1 173 ? 39.499  -5.605  -10.107 1.00 45.19 ? 171 ALA W CB  1 
ATOM   10332 N N   . ARG E 1 174 ? 38.932  -4.918  -13.208 1.00 30.98 ? 172 ARG W N   1 
ATOM   10333 C CA  . ARG E 1 174 ? 37.937  -4.626  -14.243 1.00 30.98 ? 172 ARG W CA  1 
ATOM   10334 C C   . ARG E 1 174 ? 38.234  -5.386  -15.528 1.00 30.98 ? 172 ARG W C   1 
ATOM   10335 O O   . ARG E 1 174 ? 37.341  -5.985  -16.126 1.00 30.98 ? 172 ARG W O   1 
ATOM   10336 C CB  . ARG E 1 174 ? 37.877  -3.122  -14.533 1.00 78.02 ? 172 ARG W CB  1 
ATOM   10337 C CG  . ARG E 1 174 ? 37.206  -2.301  -13.440 1.00 78.02 ? 172 ARG W CG  1 
ATOM   10338 C CD  . ARG E 1 174 ? 36.939  -0.869  -13.902 1.00 78.02 ? 172 ARG W CD  1 
ATOM   10339 N NE  . ARG E 1 174 ? 37.814  0.125   -13.275 1.00 78.02 ? 172 ARG W NE  1 
ATOM   10340 C CZ  . ARG E 1 174 ? 39.135  0.184   -13.430 1.00 78.02 ? 172 ARG W CZ  1 
ATOM   10341 N NH1 . ARG E 1 174 ? 39.756  -0.700  -14.197 1.00 78.02 ? 172 ARG W NH1 1 
ATOM   10342 N NH2 . ARG E 1 174 ? 39.840  1.131   -12.817 1.00 78.02 ? 172 ARG W NH2 1 
ATOM   10343 N N   . TYR E 1 175 ? 39.494  -5.357  -15.951 1.00 59.42 ? 173 TYR W N   1 
ATOM   10344 C CA  . TYR E 1 175 ? 39.915  -6.056  -17.159 1.00 59.42 ? 173 TYR W CA  1 
ATOM   10345 C C   . TYR E 1 175 ? 39.561  -7.522  -16.985 1.00 59.42 ? 173 TYR W C   1 
ATOM   10346 O O   . TYR E 1 175 ? 39.130  -8.182  -17.925 1.00 59.42 ? 173 TYR W O   1 
ATOM   10347 C CB  . TYR E 1 175 ? 41.425  -5.864  -17.368 1.00 65.99 ? 173 TYR W CB  1 
ATOM   10348 C CG  . TYR E 1 175 ? 42.241  -7.127  -17.478 1.00 65.99 ? 173 TYR W CG  1 
ATOM   10349 C CD1 . TYR E 1 175 ? 42.034  -8.034  -18.513 1.00 65.99 ? 173 TYR W CD1 1 
ATOM   10350 C CD2 . TYR E 1 175 ? 43.240  -7.405  -16.553 1.00 65.99 ? 173 TYR W CD2 1 
ATOM   10351 C CE1 . TYR E 1 175 ? 42.801  -9.187  -18.625 1.00 65.99 ? 173 TYR W CE1 1 
ATOM   10352 C CE2 . TYR E 1 175 ? 44.015  -8.557  -16.655 1.00 65.99 ? 173 TYR W CE2 1 
ATOM   10353 C CZ  . TYR E 1 175 ? 43.788  -9.442  -17.695 1.00 65.99 ? 173 TYR W CZ  1 
ATOM   10354 O OH  . TYR E 1 175 ? 44.549  -10.578 -17.799 1.00 65.99 ? 173 TYR W OH  1 
ATOM   10355 N N   . ALA E 1 176 ? 39.738  -8.015  -15.766 1.00 45.34 ? 174 ALA W N   1 
ATOM   10356 C CA  . ALA E 1 176 ? 39.422  -9.392  -15.433 1.00 45.34 ? 174 ALA W CA  1 
ATOM   10357 C C   . ALA E 1 176 ? 37.968  -9.648  -15.780 1.00 45.34 ? 174 ALA W C   1 
ATOM   10358 O O   . ALA E 1 176 ? 37.666  -10.253 -16.801 1.00 45.34 ? 174 ALA W O   1 
ATOM   10359 C CB  . ALA E 1 176 ? 39.653  -9.635  -13.950 1.00 42.90 ? 174 ALA W CB  1 
ATOM   10360 N N   . SER E 1 177 ? 37.074  -9.169  -14.925 1.00 50.10 ? 175 SER W N   1 
ATOM   10361 C CA  . SER E 1 177 ? 35.635  -9.336  -15.112 1.00 50.10 ? 175 SER W CA  1 
ATOM   10362 C C   . SER E 1 177 ? 35.218  -9.418  -16.587 1.00 50.10 ? 175 SER W C   1 
ATOM   10363 O O   . SER E 1 177 ? 34.372  -10.238 -16.969 1.00 50.10 ? 175 SER W O   1 
ATOM   10364 C CB  . SER E 1 177 ? 34.891  -8.184  -14.422 1.00 45.59 ? 175 SER W CB  1 
ATOM   10365 O OG  . SER E 1 177 ? 33.493  -8.424  -14.378 1.00 45.59 ? 175 SER W OG  1 
ATOM   10366 N N   . ILE E 1 178 ? 35.819  -8.568  -17.414 1.00 77.74 ? 176 ILE W N   1 
ATOM   10367 C CA  . ILE E 1 178 ? 35.514  -8.542  -18.838 1.00 77.74 ? 176 ILE W CA  1 
ATOM   10368 C C   . ILE E 1 178 ? 35.838  -9.873  -19.501 1.00 77.74 ? 176 ILE W C   1 
ATOM   10369 O O   . ILE E 1 178 ? 34.965  -10.517 -20.075 1.00 77.74 ? 176 ILE W O   1 
ATOM   10370 C CB  . ILE E 1 178 ? 36.307  -7.436  -19.536 1.00 51.67 ? 176 ILE W CB  1 
ATOM   10371 C CG1 . ILE E 1 178 ? 35.920  -6.087  -18.947 1.00 51.67 ? 176 ILE W CG1 1 
ATOM   10372 C CG2 . ILE E 1 178 ? 36.042  -7.459  -21.027 1.00 51.67 ? 176 ILE W CG2 1 
ATOM   10373 C CD1 . ILE E 1 178 ? 36.589  -4.940  -19.634 1.00 51.67 ? 176 ILE W CD1 1 
ATOM   10374 N N   . CYS E 1 179 ? 37.099  -10.279 -19.425 1.00 69.11 ? 177 CYS W N   1 
ATOM   10375 C CA  . CYS E 1 179 ? 37.520  -11.533 -20.020 1.00 69.11 ? 177 CYS W CA  1 
ATOM   10376 C C   . CYS E 1 179 ? 36.542  -12.660 -19.718 1.00 69.11 ? 177 CYS W C   1 
ATOM   10377 O O   . CYS E 1 179 ? 36.097  -13.362 -20.630 1.00 69.11 ? 177 CYS W O   1 
ATOM   10378 C CB  . CYS E 1 179 ? 38.890  -11.933 -19.496 1.00 41.25 ? 177 CYS W CB  1 
ATOM   10379 S SG  . CYS E 1 179 ? 40.112  -10.658 -19.612 1.00 41.25 ? 177 CYS W SG  1 
ATOM   10380 N N   . GLN E 1 180 ? 36.210  -12.841 -18.441 1.00 44.62 ? 178 GLN W N   1 
ATOM   10381 C CA  . GLN E 1 180 ? 35.300  -13.912 -18.049 1.00 44.62 ? 178 GLN W CA  1 
ATOM   10382 C C   . GLN E 1 180 ? 33.946  -13.710 -18.720 1.00 44.62 ? 178 GLN W C   1 
ATOM   10383 O O   . GLN E 1 180 ? 33.205  -14.671 -18.961 1.00 44.62 ? 178 GLN W O   1 
ATOM   10384 C CB  . GLN E 1 180 ? 35.154  -13.968 -16.520 1.00 47.70 ? 178 GLN W CB  1 
ATOM   10385 C CG  . GLN E 1 180 ? 36.489  -14.048 -15.756 1.00 47.70 ? 178 GLN W CG  1 
ATOM   10386 C CD  . GLN E 1 180 ? 36.323  -14.433 -14.281 1.00 47.70 ? 178 GLN W CD  1 
ATOM   10387 O OE1 . GLN E 1 180 ? 35.290  -14.148 -13.665 1.00 47.70 ? 178 GLN W OE1 1 
ATOM   10388 N NE2 . GLN E 1 180 ? 37.352  -15.067 -13.708 1.00 47.70 ? 178 GLN W NE2 1 
ATOM   10389 N N   . GLN E 1 181 ? 33.630  -12.456 -19.031 1.00 57.57 ? 179 GLN W N   1 
ATOM   10390 C CA  . GLN E 1 181 ? 32.372  -12.141 -19.700 1.00 57.57 ? 179 GLN W CA  1 
ATOM   10391 C C   . GLN E 1 181 ? 32.432  -12.598 -21.152 1.00 57.57 ? 179 GLN W C   1 
ATOM   10392 O O   . GLN E 1 181 ? 31.397  -12.814 -21.782 1.00 57.57 ? 179 GLN W O   1 
ATOM   10393 C CB  . GLN E 1 181 ? 32.083  -10.639 -19.632 1.00 52.25 ? 179 GLN W CB  1 
ATOM   10394 C CG  . GLN E 1 181 ? 31.573  -10.186 -18.274 1.00 52.25 ? 179 GLN W CG  1 
ATOM   10395 C CD  . GLN E 1 181 ? 30.235  -10.813 -17.921 1.00 52.25 ? 179 GLN W CD  1 
ATOM   10396 O OE1 . GLN E 1 181 ? 29.811  -10.794 -16.762 1.00 52.25 ? 179 GLN W OE1 1 
ATOM   10397 N NE2 . GLN E 1 181 ? 29.558  -11.365 -18.924 1.00 52.25 ? 179 GLN W NE2 1 
ATOM   10398 N N   . ASN E 1 182 ? 33.653  -12.739 -21.671 1.00 41.09 ? 180 ASN W N   1 
ATOM   10399 C CA  . ASN E 1 182 ? 33.893  -13.199 -23.042 1.00 41.09 ? 180 ASN W CA  1 
ATOM   10400 C C   . ASN E 1 182 ? 34.547  -14.593 -23.068 1.00 41.09 ? 180 ASN W C   1 
ATOM   10401 O O   . ASN E 1 182 ? 35.334  -14.917 -23.961 1.00 41.09 ? 180 ASN W O   1 
ATOM   10402 C CB  . ASN E 1 182 ? 34.778  -12.200 -23.790 1.00 53.97 ? 180 ASN W CB  1 
ATOM   10403 C CG  . ASN E 1 182 ? 34.060  -10.911 -24.098 1.00 53.97 ? 180 ASN W CG  1 
ATOM   10404 O OD1 . ASN E 1 182 ? 33.029  -10.906 -24.769 1.00 53.97 ? 180 ASN W OD1 1 
ATOM   10405 N ND2 . ASN E 1 182 ? 34.602  -9.806  -23.613 1.00 53.97 ? 180 ASN W ND2 1 
ATOM   10406 N N   . GLY E 1 183 ? 34.221  -15.406 -22.071 1.00 35.49 ? 181 GLY W N   1 
ATOM   10407 C CA  . GLY E 1 183 ? 34.752  -16.750 -22.012 1.00 35.49 ? 181 GLY W CA  1 
ATOM   10408 C C   . GLY E 1 183 ? 36.258  -16.853 -21.991 1.00 35.49 ? 181 GLY W C   1 
ATOM   10409 O O   . GLY E 1 183 ? 36.809  -17.900 -22.313 1.00 35.49 ? 181 GLY W O   1 
ATOM   10410 N N   . LEU E 1 184 ? 36.934  -15.775 -21.622 1.00 37.92 ? 182 LEU W N   1 
ATOM   10411 C CA  . LEU E 1 184 ? 38.392  -15.796 -21.554 1.00 37.92 ? 182 LEU W CA  1 
ATOM   10412 C C   . LEU E 1 184 ? 38.867  -15.930 -20.098 1.00 37.92 ? 182 LEU W C   1 
ATOM   10413 O O   . LEU E 1 184 ? 38.235  -15.415 -19.174 1.00 37.92 ? 182 LEU W O   1 
ATOM   10414 C CB  . LEU E 1 184 ? 38.975  -14.523 -22.182 1.00 49.39 ? 182 LEU W CB  1 
ATOM   10415 C CG  . LEU E 1 184 ? 39.126  -14.418 -23.706 1.00 49.39 ? 182 LEU W CG  1 
ATOM   10416 C CD1 . LEU E 1 184 ? 39.586  -13.031 -24.080 1.00 49.39 ? 182 LEU W CD1 1 
ATOM   10417 C CD2 . LEU E 1 184 ? 40.146  -15.425 -24.195 1.00 49.39 ? 182 LEU W CD2 1 
ATOM   10418 N N   . VAL E 1 185 ? 39.975  -16.635 -19.896 1.00 32.72 ? 183 VAL W N   1 
ATOM   10419 C CA  . VAL E 1 185 ? 40.522  -16.826 -18.557 1.00 32.72 ? 183 VAL W CA  1 
ATOM   10420 C C   . VAL E 1 185 ? 41.628  -15.804 -18.321 1.00 32.72 ? 183 VAL W C   1 
ATOM   10421 O O   . VAL E 1 185 ? 42.735  -15.948 -18.818 1.00 32.72 ? 183 VAL W O   1 
ATOM   10422 C CB  . VAL E 1 185 ? 41.069  -18.267 -18.392 1.00 32.47 ? 183 VAL W CB  1 
ATOM   10423 C CG1 . VAL E 1 185 ? 42.030  -18.344 -17.228 1.00 32.47 ? 183 VAL W CG1 1 
ATOM   10424 C CG2 . VAL E 1 185 ? 39.909  -19.233 -18.183 1.00 32.47 ? 183 VAL W CG2 1 
ATOM   10425 N N   . PRO E 1 186 ? 41.333  -14.757 -17.543 1.00 9.02  ? 184 PRO W N   1 
ATOM   10426 C CA  . PRO E 1 186 ? 42.239  -13.659 -17.198 1.00 9.02  ? 184 PRO W CA  1 
ATOM   10427 C C   . PRO E 1 186 ? 43.450  -14.034 -16.383 1.00 9.02  ? 184 PRO W C   1 
ATOM   10428 O O   . PRO E 1 186 ? 43.307  -14.483 -15.263 1.00 9.02  ? 184 PRO W O   1 
ATOM   10429 C CB  . PRO E 1 186 ? 41.333  -12.710 -16.425 1.00 40.50 ? 184 PRO W CB  1 
ATOM   10430 C CG  . PRO E 1 186 ? 40.417  -13.656 -15.704 1.00 40.50 ? 184 PRO W CG  1 
ATOM   10431 C CD  . PRO E 1 186 ? 40.057  -14.615 -16.815 1.00 40.50 ? 184 PRO W CD  1 
ATOM   10432 N N   . ILE E 1 187 ? 44.642  -13.858 -16.933 1.00 30.55 ? 185 ILE W N   1 
ATOM   10433 C CA  . ILE E 1 187 ? 45.840  -14.154 -16.167 1.00 30.55 ? 185 ILE W CA  1 
ATOM   10434 C C   . ILE E 1 187 ? 46.129  -12.863 -15.407 1.00 30.55 ? 185 ILE W C   1 
ATOM   10435 O O   . ILE E 1 187 ? 46.711  -11.918 -15.951 1.00 30.55 ? 185 ILE W O   1 
ATOM   10436 C CB  . ILE E 1 187 ? 47.059  -14.497 -17.070 1.00 41.12 ? 185 ILE W CB  1 
ATOM   10437 C CG1 . ILE E 1 187 ? 46.960  -15.936 -17.583 1.00 41.12 ? 185 ILE W CG1 1 
ATOM   10438 C CG2 . ILE E 1 187 ? 48.369  -14.340 -16.288 1.00 41.12 ? 185 ILE W CG2 1 
ATOM   10439 C CD1 . ILE E 1 187 ? 48.240  -16.416 -18.280 1.00 41.12 ? 185 ILE W CD1 1 
ATOM   10440 N N   . VAL E 1 188 ? 45.699  -12.814 -14.152 1.00 48.75 ? 186 VAL W N   1 
ATOM   10441 C CA  . VAL E 1 188 ? 45.906  -11.640 -13.317 1.00 48.75 ? 186 VAL W CA  1 
ATOM   10442 C C   . VAL E 1 188 ? 47.387  -11.436 -13.008 1.00 48.75 ? 186 VAL W C   1 
ATOM   10443 O O   . VAL E 1 188 ? 48.037  -12.309 -12.427 1.00 48.75 ? 186 VAL W O   1 
ATOM   10444 C CB  . VAL E 1 188 ? 45.150  -11.787 -11.997 1.00 33.30 ? 186 VAL W CB  1 
ATOM   10445 C CG1 . VAL E 1 188 ? 45.565  -10.701 -11.052 1.00 33.30 ? 186 VAL W CG1 1 
ATOM   10446 C CG2 . VAL E 1 188 ? 43.648  -11.723 -12.243 1.00 33.30 ? 186 VAL W CG2 1 
ATOM   10447 N N   . GLU E 1 189 ? 47.926  -10.278 -13.371 1.00 92.42 ? 187 GLU W N   1 
ATOM   10448 C CA  . GLU E 1 189 ? 49.340  -10.022 -13.116 1.00 92.42 ? 187 GLU W CA  1 
ATOM   10449 C C   . GLU E 1 189 ? 49.621  -8.666  -12.460 1.00 92.42 ? 187 GLU W C   1 
ATOM   10450 O O   . GLU E 1 189 ? 49.409  -7.616  -13.069 1.00 92.42 ? 187 GLU W O   1 
ATOM   10451 C CB  . GLU E 1 189 ? 50.112  -10.154 -14.431 1.00 51.74 ? 187 GLU W CB  1 
ATOM   10452 C CG  . GLU E 1 189 ? 51.571  -9.747  -14.389 1.00 55.80 ? 187 GLU W CG  1 
ATOM   10453 C CD  . GLU E 1 189 ? 52.224  -9.867  -15.760 1.00 71.02 ? 187 GLU W CD  1 
ATOM   10454 O OE1 . GLU E 1 189 ? 51.568  -9.506  -16.763 1.00 63.86 ? 187 GLU W OE1 1 
ATOM   10455 O OE2 . GLU E 1 189 ? 53.390  -10.312 -15.837 1.00 70.33 ? 187 GLU W OE2 1 
ATOM   10456 N N   . PRO E 1 190 ? 50.069  -8.676  -11.189 1.00 92.42 ? 188 PRO W N   1 
ATOM   10457 C CA  . PRO E 1 190 ? 50.392  -7.461  -10.429 1.00 92.42 ? 188 PRO W CA  1 
ATOM   10458 C C   . PRO E 1 190 ? 51.826  -7.033  -10.736 1.00 92.42 ? 188 PRO W C   1 
ATOM   10459 O O   . PRO E 1 190 ? 52.680  -7.876  -11.031 1.00 92.42 ? 188 PRO W O   1 
ATOM   10460 C CB  . PRO E 1 190 ? 50.235  -7.904  -8.972  1.00 85.19 ? 188 PRO W CB  1 
ATOM   10461 C CG  . PRO E 1 190 ? 49.305  -9.071  -9.055  1.00 85.19 ? 188 PRO W CG  1 
ATOM   10462 C CD  . PRO E 1 190 ? 49.844  -9.795  -10.261 1.00 85.19 ? 188 PRO W CD  1 
ATOM   10463 N N   . GLU E 1 191 ? 52.089  -5.730  -10.652 1.00 92.42 ? 189 GLU W N   1 
ATOM   10464 C CA  . GLU E 1 191 ? 53.419  -5.188  -10.947 1.00 92.42 ? 189 GLU W CA  1 
ATOM   10465 C C   . GLU E 1 191 ? 54.550  -5.538  -9.972  1.00 92.42 ? 189 GLU W C   1 
ATOM   10466 O O   . GLU E 1 191 ? 54.449  -6.477  -9.171  1.00 92.42 ? 189 GLU W O   1 
ATOM   10467 C CB  . GLU E 1 191 ? 53.349  -3.660  -11.091 1.00 92.42 ? 189 GLU W CB  1 
ATOM   10468 C CG  . GLU E 1 191 ? 52.708  -3.171  -12.384 1.00 92.42 ? 189 GLU W CG  1 
ATOM   10469 C CD  . GLU E 1 191 ? 53.378  -1.914  -12.933 1.00 92.42 ? 189 GLU W CD  1 
ATOM   10470 O OE1 . GLU E 1 191 ? 52.904  -1.399  -13.973 1.00 92.42 ? 189 GLU W OE1 1 
ATOM   10471 O OE2 . GLU E 1 191 ? 54.379  -1.448  -12.330 1.00 92.42 ? 189 GLU W OE2 1 
ATOM   10472 N N   . VAL E 1 192 ? 55.629  -4.758  -10.068 1.00 92.42 ? 190 VAL W N   1 
ATOM   10473 C CA  . VAL E 1 192 ? 56.825  -4.919  -9.238  1.00 92.42 ? 190 VAL W CA  1 
ATOM   10474 C C   . VAL E 1 192 ? 56.682  -4.152  -7.916  1.00 92.42 ? 190 VAL W C   1 
ATOM   10475 O O   . VAL E 1 192 ? 57.674  -3.820  -7.256  1.00 92.42 ? 190 VAL W O   1 
ATOM   10476 C CB  . VAL E 1 192 ? 58.089  -4.397  -9.984  1.00 81.09 ? 190 VAL W CB  1 
ATOM   10477 C CG1 . VAL E 1 192 ? 59.359  -4.891  -9.283  1.00 81.09 ? 190 VAL W CG1 1 
ATOM   10478 C CG2 . VAL E 1 192 ? 58.051  -4.832  -11.451 1.00 81.09 ? 190 VAL W CG2 1 
ATOM   10479 N N   . HIS E 1 198 ? 67.312  -3.724  -1.990  1.00 92.42 ? 196 HIS W N   1 
ATOM   10480 C CA  . HIS E 1 198 ? 66.491  -3.869  -0.791  1.00 92.42 ? 196 HIS W CA  1 
ATOM   10481 C C   . HIS E 1 198 ? 66.620  -5.315  -0.302  1.00 92.42 ? 196 HIS W C   1 
ATOM   10482 O O   . HIS E 1 198 ? 67.085  -6.184  -1.048  1.00 92.42 ? 196 HIS W O   1 
ATOM   10483 C CB  . HIS E 1 198 ? 65.011  -3.566  -1.091  1.00 92.42 ? 196 HIS W CB  1 
ATOM   10484 C CG  . HIS E 1 198 ? 64.785  -2.555  -2.181  1.00 92.42 ? 196 HIS W CG  1 
ATOM   10485 N ND1 . HIS E 1 198 ? 63.556  -1.963  -2.393  1.00 92.42 ? 196 HIS W ND1 1 
ATOM   10486 C CD2 . HIS E 1 198 ? 65.602  -2.078  -3.154  1.00 92.42 ? 196 HIS W CD2 1 
ATOM   10487 C CE1 . HIS E 1 198 ? 63.626  -1.169  -3.448  1.00 92.42 ? 196 HIS W CE1 1 
ATOM   10488 N NE2 . HIS E 1 198 ? 64.857  -1.221  -3.929  1.00 92.42 ? 196 HIS W NE2 1 
ATOM   10489 N N   . ASP E 1 199 ? 66.215  -5.572  0.942   1.00 92.42 ? 197 ASP W N   1 
ATOM   10490 C CA  . ASP E 1 199 ? 66.286  -6.924  1.512   1.00 92.42 ? 197 ASP W CA  1 
ATOM   10491 C C   . ASP E 1 199 ? 65.077  -7.806  1.142   1.00 92.42 ? 197 ASP W C   1 
ATOM   10492 O O   . ASP E 1 199 ? 63.983  -7.304  0.879   1.00 92.42 ? 197 ASP W O   1 
ATOM   10493 C CB  . ASP E 1 199 ? 66.447  -6.862  3.045   1.00 92.42 ? 197 ASP W CB  1 
ATOM   10494 C CG  . ASP E 1 199 ? 65.510  -5.851  3.710   1.00 92.42 ? 197 ASP W CG  1 
ATOM   10495 O OD1 . ASP E 1 199 ? 65.287  -5.976  4.937   1.00 92.42 ? 197 ASP W OD1 1 
ATOM   10496 O OD2 . ASP E 1 199 ? 65.014  -4.927  3.023   1.00 92.42 ? 197 ASP W OD2 1 
ATOM   10497 N N   . LEU E 1 200 ? 65.292  -9.121  1.119   1.00 76.97 ? 198 LEU W N   1 
ATOM   10498 C CA  . LEU E 1 200 ? 64.256  -10.094 0.765   1.00 76.97 ? 198 LEU W CA  1 
ATOM   10499 C C   . LEU E 1 200 ? 62.897  -9.757  1.386   1.00 76.97 ? 198 LEU W C   1 
ATOM   10500 O O   . LEU E 1 200 ? 61.862  -9.744  0.710   1.00 76.89 ? 198 LEU W O   1 
ATOM   10501 C CB  . LEU E 1 200 ? 64.699  -11.489 1.219   1.00 57.15 ? 198 LEU W CB  1 
ATOM   10502 C CG  . LEU E 1 200 ? 63.976  -12.726 0.686   1.00 66.69 ? 198 LEU W CG  1 
ATOM   10503 C CD1 . LEU E 1 200 ? 64.223  -12.844 -0.808  1.00 52.04 ? 198 LEU W CD1 1 
ATOM   10504 C CD2 . LEU E 1 200 ? 64.481  -13.967 1.407   1.00 53.43 ? 198 LEU W CD2 1 
ATOM   10505 N N   . GLU E 1 201 ? 62.925  -9.491  2.686   1.00 63.16 ? 199 GLU W N   1 
ATOM   10506 C CA  . GLU E 1 201 ? 61.744  -9.152  3.477   1.00 62.00 ? 199 GLU W CA  1 
ATOM   10507 C C   . GLU E 1 201 ? 61.064  -7.877  2.978   1.00 64.14 ? 199 GLU W C   1 
ATOM   10508 O O   . GLU E 1 201 ? 59.842  -7.741  3.053   1.00 63.02 ? 199 GLU W O   1 
ATOM   10509 C CB  . GLU E 1 201 ? 62.186  -9.003  4.929   1.00 92.42 ? 199 GLU W CB  1 
ATOM   10510 C CG  . GLU E 1 201 ? 63.695  -8.753  5.035   1.00 92.42 ? 199 GLU W CG  1 
ATOM   10511 C CD  . GLU E 1 201 ? 64.361  -9.549  6.144   1.00 92.42 ? 199 GLU W CD  1 
ATOM   10512 O OE1 . GLU E 1 201 ? 65.599  -9.744  6.071   1.00 92.42 ? 199 GLU W OE1 1 
ATOM   10513 O OE2 . GLU E 1 201 ? 63.651  -9.969  7.087   1.00 92.42 ? 199 GLU W OE2 1 
ATOM   10514 N N   . HIS E 1 202 ? 61.888  -6.960  2.471   1.00 78.69 ? 200 HIS W N   1 
ATOM   10515 C CA  . HIS E 1 202 ? 61.479  -5.665  1.914   1.00 78.69 ? 200 HIS W CA  1 
ATOM   10516 C C   . HIS E 1 202 ? 60.419  -5.917  0.836   1.00 78.69 ? 200 HIS W C   1 
ATOM   10517 O O   . HIS E 1 202 ? 59.326  -5.344  0.850   1.00 78.69 ? 200 HIS W O   1 
ATOM   10518 C CB  . HIS E 1 202 ? 62.719  -5.008  1.289   1.00 92.42 ? 200 HIS W CB  1 
ATOM   10519 C CG  . HIS E 1 202 ? 62.685  -3.510  1.239   1.00 92.42 ? 200 HIS W CG  1 
ATOM   10520 N ND1 . HIS E 1 202 ? 61.791  -2.805  0.459   1.00 92.42 ? 200 HIS W ND1 1 
ATOM   10521 C CD2 . HIS E 1 202 ? 63.498  -2.585  1.807   1.00 92.42 ? 200 HIS W CD2 1 
ATOM   10522 C CE1 . HIS E 1 202 ? 62.058  -1.513  0.545   1.00 92.42 ? 200 HIS W CE1 1 
ATOM   10523 N NE2 . HIS E 1 202 ? 63.090  -1.352  1.356   1.00 92.42 ? 200 HIS W NE2 1 
ATOM   10524 N N   . CYS E 1 203 ? 60.776  -6.790  -0.098  1.00 91.91 ? 201 CYS W N   1 
ATOM   10525 C CA  . CYS E 1 203 ? 59.911  -7.183  -1.200  1.00 91.91 ? 201 CYS W CA  1 
ATOM   10526 C C   . CYS E 1 203 ? 58.691  -7.968  -0.699  1.00 91.91 ? 201 CYS W C   1 
ATOM   10527 O O   . CYS E 1 203 ? 57.560  -7.675  -1.092  1.00 91.91 ? 201 CYS W O   1 
ATOM   10528 C CB  . CYS E 1 203 ? 60.722  -8.033  -2.192  1.00 92.42 ? 201 CYS W CB  1 
ATOM   10529 S SG  . CYS E 1 203 ? 59.765  -8.964  -3.420  1.00 92.42 ? 201 CYS W SG  1 
ATOM   10530 N N   . GLN E 1 204 ? 58.926  -8.954  0.172   1.00 54.80 ? 202 GLN W N   1 
ATOM   10531 C CA  . GLN E 1 204 ? 57.844  -9.783  0.704   1.00 54.80 ? 202 GLN W CA  1 
ATOM   10532 C C   . GLN E 1 204 ? 56.684  -8.981  1.280   1.00 54.80 ? 202 GLN W C   1 
ATOM   10533 O O   . GLN E 1 204 ? 55.513  -9.329  1.089   1.00 54.80 ? 202 GLN W O   1 
ATOM   10534 C CB  . GLN E 1 204 ? 58.369  -10.738 1.771   1.00 56.43 ? 202 GLN W CB  1 
ATOM   10535 C CG  . GLN E 1 204 ? 57.256  -11.546 2.421   1.00 56.43 ? 202 GLN W CG  1 
ATOM   10536 C CD  . GLN E 1 204 ? 57.760  -12.438 3.534   1.00 56.43 ? 202 GLN W CD  1 
ATOM   10537 O OE1 . GLN E 1 204 ? 56.985  -12.883 4.389   1.00 56.43 ? 202 GLN W OE1 1 
ATOM   10538 N NE2 . GLN E 1 204 ? 59.070  -12.708 3.532   1.00 56.43 ? 202 GLN W NE2 1 
ATOM   10539 N N   . TYR E 1 205 ? 57.010  -7.913  1.997   1.00 84.37 ? 203 TYR W N   1 
ATOM   10540 C CA  . TYR E 1 205 ? 55.977  -7.063  2.567   1.00 84.37 ? 203 TYR W CA  1 
ATOM   10541 C C   . TYR E 1 205 ? 55.232  -6.377  1.429   1.00 84.37 ? 203 TYR W C   1 
ATOM   10542 O O   . TYR E 1 205 ? 54.002  -6.339  1.403   1.00 84.37 ? 203 TYR W O   1 
ATOM   10543 C CB  . TYR E 1 205 ? 56.587  -6.008  3.495   1.00 81.26 ? 203 TYR W CB  1 
ATOM   10544 C CG  . TYR E 1 205 ? 55.624  -4.894  3.851   1.00 81.26 ? 203 TYR W CG  1 
ATOM   10545 C CD1 . TYR E 1 205 ? 54.339  -5.178  4.324   1.00 81.26 ? 203 TYR W CD1 1 
ATOM   10546 C CD2 . TYR E 1 205 ? 55.987  -3.557  3.694   1.00 81.26 ? 203 TYR W CD2 1 
ATOM   10547 C CE1 . TYR E 1 205 ? 53.441  -4.160  4.627   1.00 81.26 ? 203 TYR W CE1 1 
ATOM   10548 C CE2 . TYR E 1 205 ? 55.096  -2.530  3.994   1.00 81.26 ? 203 TYR W CE2 1 
ATOM   10549 C CZ  . TYR E 1 205 ? 53.828  -2.840  4.459   1.00 81.26 ? 203 TYR W CZ  1 
ATOM   10550 O OH  . TYR E 1 205 ? 52.949  -1.826  4.752   1.00 81.26 ? 203 TYR W OH  1 
ATOM   10551 N N   . VAL E 1 206 ? 55.988  -5.839  0.483   1.00 74.19 ? 204 VAL W N   1 
ATOM   10552 C CA  . VAL E 1 206 ? 55.387  -5.162  -0.651  1.00 74.19 ? 204 VAL W CA  1 
ATOM   10553 C C   . VAL E 1 206 ? 54.421  -6.108  -1.371  1.00 74.19 ? 204 VAL W C   1 
ATOM   10554 O O   . VAL E 1 206 ? 53.227  -5.819  -1.498  1.00 74.19 ? 204 VAL W O   1 
ATOM   10555 C CB  . VAL E 1 206 ? 56.466  -4.706  -1.643  1.00 73.29 ? 204 VAL W CB  1 
ATOM   10556 C CG1 . VAL E 1 206 ? 55.868  -3.725  -2.637  1.00 73.29 ? 204 VAL W CG1 1 
ATOM   10557 C CG2 . VAL E 1 206 ? 57.635  -4.088  -0.894  1.00 73.29 ? 204 VAL W CG2 1 
ATOM   10558 N N   . THR E 1 207 ? 54.955  -7.241  -1.828  1.00 52.65 ? 205 THR W N   1 
ATOM   10559 C CA  . THR E 1 207 ? 54.184  -8.256  -2.536  1.00 52.65 ? 205 THR W CA  1 
ATOM   10560 C C   . THR E 1 207 ? 52.860  -8.532  -1.856  1.00 52.65 ? 205 THR W C   1 
ATOM   10561 O O   . THR E 1 207 ? 51.799  -8.515  -2.489  1.00 52.65 ? 205 THR W O   1 
ATOM   10562 C CB  . THR E 1 207 ? 54.932  -9.575  -2.586  1.00 36.72 ? 205 THR W CB  1 
ATOM   10563 O OG1 . THR E 1 207 ? 56.244  -9.365  -3.111  1.00 36.72 ? 205 THR W OG1 1 
ATOM   10564 C CG2 . THR E 1 207 ? 54.190  -10.552 -3.460  1.00 36.72 ? 205 THR W CG2 1 
ATOM   10565 N N   . GLU E 1 208 ? 52.940  -8.801  -0.558  1.00 45.79 ? 206 GLU W N   1 
ATOM   10566 C CA  . GLU E 1 208 ? 51.759  -9.090  0.235   1.00 45.79 ? 206 GLU W CA  1 
ATOM   10567 C C   . GLU E 1 208 ? 50.669  -8.023  0.127   1.00 45.79 ? 206 GLU W C   1 
ATOM   10568 O O   . GLU E 1 208 ? 49.504  -8.349  -0.117  1.00 45.79 ? 206 GLU W O   1 
ATOM   10569 C CB  . GLU E 1 208 ? 52.150  -9.282  1.698   1.00 52.62 ? 206 GLU W CB  1 
ATOM   10570 C CG  . GLU E 1 208 ? 52.853  -10.591 1.979   1.00 52.62 ? 206 GLU W CG  1 
ATOM   10571 C CD  . GLU E 1 208 ? 53.227  -10.755 3.446   1.00 52.62 ? 206 GLU W CD  1 
ATOM   10572 O OE1 . GLU E 1 208 ? 52.471  -10.253 4.315   1.00 52.62 ? 206 GLU W OE1 1 
ATOM   10573 O OE2 . GLU E 1 208 ? 54.270  -11.399 3.726   1.00 52.62 ? 206 GLU W OE2 1 
ATOM   10574 N N   . LYS E 1 209 ? 51.044  -6.756  0.299   1.00 57.12 ? 207 LYS W N   1 
ATOM   10575 C CA  . LYS E 1 209 ? 50.076  -5.662  0.232   1.00 57.12 ? 207 LYS W CA  1 
ATOM   10576 C C   . LYS E 1 209 ? 49.449  -5.541  -1.145  1.00 57.12 ? 207 LYS W C   1 
ATOM   10577 O O   . LYS E 1 209 ? 48.224  -5.506  -1.284  1.00 57.12 ? 207 LYS W O   1 
ATOM   10578 C CB  . LYS E 1 209 ? 50.725  -4.328  0.594   1.00 65.88 ? 207 LYS W CB  1 
ATOM   10579 C CG  . LYS E 1 209 ? 49.713  -3.202  0.616   1.00 65.88 ? 207 LYS W CG  1 
ATOM   10580 C CD  . LYS E 1 209 ? 50.263  -1.905  1.194   1.00 65.88 ? 207 LYS W CD  1 
ATOM   10581 C CE  . LYS E 1 209 ? 51.179  -1.168  0.226   1.00 65.88 ? 207 LYS W CE  1 
ATOM   10582 N NZ  . LYS E 1 209 ? 51.316  0.282   0.589   1.00 65.88 ? 207 LYS W NZ  1 
ATOM   10583 N N   . VAL E 1 210 ? 50.305  -5.457  -2.159  1.00 46.42 ? 208 VAL W N   1 
ATOM   10584 C CA  . VAL E 1 210 ? 49.861  -5.353  -3.548  1.00 46.42 ? 208 VAL W CA  1 
ATOM   10585 C C   . VAL E 1 210 ? 48.818  -6.439  -3.781  1.00 46.42 ? 208 VAL W C   1 
ATOM   10586 O O   . VAL E 1 210 ? 47.688  -6.174  -4.207  1.00 46.42 ? 208 VAL W O   1 
ATOM   10587 C CB  . VAL E 1 210 ? 51.013  -5.637  -4.513  1.00 15.22 ? 208 VAL W CB  1 
ATOM   10588 C CG1 . VAL E 1 210 ? 50.573  -5.361  -5.907  1.00 15.22 ? 208 VAL W CG1 1 
ATOM   10589 C CG2 . VAL E 1 210 ? 52.230  -4.829  -4.145  1.00 15.22 ? 208 VAL W CG2 1 
ATOM   10590 N N   . LEU E 1 211 ? 49.251  -7.666  -3.485  1.00 63.90 ? 209 LEU W N   1 
ATOM   10591 C CA  . LEU E 1 211 ? 48.470  -8.889  -3.620  1.00 63.90 ? 209 LEU W CA  1 
ATOM   10592 C C   . LEU E 1 211 ? 47.136  -8.880  -2.896  1.00 63.90 ? 209 LEU W C   1 
ATOM   10593 O O   . LEU E 1 211 ? 46.079  -9.062  -3.514  1.00 63.90 ? 209 LEU W O   1 
ATOM   10594 C CB  . LEU E 1 211 ? 49.303  -10.067 -3.124  1.00 21.14 ? 209 LEU W CB  1 
ATOM   10595 C CG  . LEU E 1 211 ? 50.081  -10.814 -4.206  1.00 21.14 ? 209 LEU W CG  1 
ATOM   10596 C CD1 . LEU E 1 211 ? 51.124  -11.753 -3.619  1.00 21.14 ? 209 LEU W CD1 1 
ATOM   10597 C CD2 . LEU E 1 211 ? 49.075  -11.585 -5.026  1.00 21.14 ? 209 LEU W CD2 1 
ATOM   10598 N N   . ALA E 1 212 ? 47.184  -8.686  -1.582  1.00 38.91 ? 210 ALA W N   1 
ATOM   10599 C CA  . ALA E 1 212 ? 45.964  -8.664  -0.791  1.00 38.91 ? 210 ALA W CA  1 
ATOM   10600 C C   . ALA E 1 212 ? 45.094  -7.499  -1.224  1.00 38.91 ? 210 ALA W C   1 
ATOM   10601 O O   . ALA E 1 212 ? 43.909  -7.450  -0.900  1.00 38.91 ? 210 ALA W O   1 
ATOM   10602 C CB  . ALA E 1 212 ? 46.289  -8.551  0.674   1.00 10.21 ? 210 ALA W CB  1 
ATOM   10603 N N   . ALA E 1 213 ? 45.694  -6.567  -1.963  1.00 53.44 ? 211 ALA W N   1 
ATOM   10604 C CA  . ALA E 1 213 ? 44.985  -5.394  -2.458  1.00 53.44 ? 211 ALA W CA  1 
ATOM   10605 C C   . ALA E 1 213 ? 44.320  -5.721  -3.782  1.00 53.44 ? 211 ALA W C   1 
ATOM   10606 O O   . ALA E 1 213 ? 43.350  -5.080  -4.183  1.00 53.44 ? 211 ALA W O   1 
ATOM   10607 C CB  . ALA E 1 213 ? 45.951  -4.247  -2.637  1.00 66.61 ? 211 ALA W CB  1 
ATOM   10608 N N   . VAL E 1 214 ? 44.857  -6.724  -4.461  1.00 52.97 ? 212 VAL W N   1 
ATOM   10609 C CA  . VAL E 1 214 ? 44.321  -7.137  -5.741  1.00 52.97 ? 212 VAL W CA  1 
ATOM   10610 C C   . VAL E 1 214 ? 43.116  -8.035  -5.568  1.00 52.97 ? 212 VAL W C   1 
ATOM   10611 O O   . VAL E 1 214 ? 42.046  -7.743  -6.102  1.00 52.97 ? 212 VAL W O   1 
ATOM   10612 C CB  . VAL E 1 214 ? 45.356  -7.913  -6.571  1.00 27.03 ? 212 VAL W CB  1 
ATOM   10613 C CG1 . VAL E 1 214 ? 44.694  -8.468  -7.831  1.00 27.03 ? 212 VAL W CG1 1 
ATOM   10614 C CG2 . VAL E 1 214 ? 46.537  -7.016  -6.915  1.00 27.03 ? 212 VAL W CG2 1 
ATOM   10615 N N   . TYR E 1 215 ? 43.278  -9.129  -4.825  1.00 44.38 ? 213 TYR W N   1 
ATOM   10616 C CA  . TYR E 1 215 ? 42.154  -10.042 -4.658  1.00 44.38 ? 213 TYR W CA  1 
ATOM   10617 C C   . TYR E 1 215 ? 41.009  -9.361  -3.950  1.00 44.38 ? 213 TYR W C   1 
ATOM   10618 O O   . TYR E 1 215 ? 39.873  -9.833  -3.998  1.00 44.38 ? 213 TYR W O   1 
ATOM   10619 C CB  . TYR E 1 215 ? 42.586  -11.335 -3.948  1.00 51.89 ? 213 TYR W CB  1 
ATOM   10620 C CG  . TYR E 1 215 ? 43.360  -12.246 -4.881  1.00 51.89 ? 213 TYR W CG  1 
ATOM   10621 C CD1 . TYR E 1 215 ? 42.747  -12.790 -6.020  1.00 51.89 ? 213 TYR W CD1 1 
ATOM   10622 C CD2 . TYR E 1 215 ? 44.734  -12.466 -4.702  1.00 51.89 ? 213 TYR W CD2 1 
ATOM   10623 C CE1 . TYR E 1 215 ? 43.482  -13.518 -6.967  1.00 51.89 ? 213 TYR W CE1 1 
ATOM   10624 C CE2 . TYR E 1 215 ? 45.486  -13.195 -5.641  1.00 51.89 ? 213 TYR W CE2 1 
ATOM   10625 C CZ  . TYR E 1 215 ? 44.856  -13.714 -6.774  1.00 51.89 ? 213 TYR W CZ  1 
ATOM   10626 O OH  . TYR E 1 215 ? 45.602  -14.397 -7.727  1.00 51.89 ? 213 TYR W OH  1 
ATOM   10627 N N   . LYS E 1 216 ? 41.309  -8.231  -3.316  1.00 50.00 ? 214 LYS W N   1 
ATOM   10628 C CA  . LYS E 1 216 ? 40.275  -7.476  -2.636  1.00 50.00 ? 214 LYS W CA  1 
ATOM   10629 C C   . LYS E 1 216 ? 39.488  -6.784  -3.733  1.00 50.00 ? 214 LYS W C   1 
ATOM   10630 O O   . LYS E 1 216 ? 38.258  -6.898  -3.790  1.00 50.00 ? 214 LYS W O   1 
ATOM   10631 C CB  . LYS E 1 216 ? 40.880  -6.424  -1.716  1.00 22.94 ? 214 LYS W CB  1 
ATOM   10632 C CG  . LYS E 1 216 ? 39.923  -5.870  -0.629  1.00 22.94 ? 214 LYS W CG  1 
ATOM   10633 C CD  . LYS E 1 216 ? 38.582  -5.391  -1.192  1.00 22.94 ? 214 LYS W CD  1 
ATOM   10634 C CE  . LYS E 1 216 ? 37.695  -4.793  -0.110  1.00 22.94 ? 214 LYS W CE  1 
ATOM   10635 N NZ  . LYS E 1 216 ? 37.464  -5.759  1.004   1.00 22.94 ? 214 LYS W NZ  1 
ATOM   10636 N N   . ALA E 1 217 ? 40.204  -6.061  -4.598  1.00 29.22 ? 215 ALA W N   1 
ATOM   10637 C CA  . ALA E 1 217 ? 39.577  -5.356  -5.718  1.00 29.22 ? 215 ALA W CA  1 
ATOM   10638 C C   . ALA E 1 217 ? 38.762  -6.381  -6.502  1.00 29.22 ? 215 ALA W C   1 
ATOM   10639 O O   . ALA E 1 217 ? 37.579  -6.170  -6.798  1.00 29.22 ? 215 ALA W O   1 
ATOM   10640 C CB  . ALA E 1 217 ? 40.642  -4.735  -6.612  1.00 83.73 ? 215 ALA W CB  1 
ATOM   10641 N N   . LEU E 1 218 ? 39.409  -7.508  -6.801  1.00 43.07 ? 216 LEU W N   1 
ATOM   10642 C CA  . LEU E 1 218 ? 38.790  -8.613  -7.532  1.00 43.07 ? 216 LEU W CA  1 
ATOM   10643 C C   . LEU E 1 218 ? 37.515  -9.076  -6.854  1.00 43.07 ? 216 LEU W C   1 
ATOM   10644 O O   . LEU E 1 218 ? 36.466  -9.216  -7.491  1.00 43.07 ? 216 LEU W O   1 
ATOM   10645 C CB  . LEU E 1 218 ? 39.772  -9.776  -7.631  1.00 17.07 ? 216 LEU W CB  1 
ATOM   10646 C CG  . LEU E 1 218 ? 40.741  -9.661  -8.809  1.00 17.07 ? 216 LEU W CG  1 
ATOM   10647 C CD1 . LEU E 1 218 ? 42.066  -10.352 -8.489  1.00 17.07 ? 216 LEU W CD1 1 
ATOM   10648 C CD2 . LEU E 1 218 ? 40.088  -10.252 -10.050 1.00 17.07 ? 216 LEU W CD2 1 
ATOM   10649 N N   . ASN E 1 219 ? 37.615  -9.312  -5.554  1.00 31.64 ? 217 ASN W N   1 
ATOM   10650 C CA  . ASN E 1 219 ? 36.463  -9.744  -4.791  1.00 31.64 ? 217 ASN W CA  1 
ATOM   10651 C C   . ASN E 1 219 ? 35.337  -8.729  -4.870  1.00 31.64 ? 217 ASN W C   1 
ATOM   10652 O O   . ASN E 1 219 ? 34.163  -9.113  -4.815  1.00 31.64 ? 217 ASN W O   1 
ATOM   10653 C CB  . ASN E 1 219 ? 36.819  -9.965  -3.324  1.00 35.57 ? 217 ASN W CB  1 
ATOM   10654 C CG  . ASN E 1 219 ? 35.626  -10.425 -2.511  1.00 35.57 ? 217 ASN W CG  1 
ATOM   10655 O OD1 . ASN E 1 219 ? 34.634  -9.712  -2.395  1.00 35.57 ? 217 ASN W OD1 1 
ATOM   10656 N ND2 . ASN E 1 219 ? 35.714  -11.627 -1.953  1.00 35.57 ? 217 ASN W ND2 1 
ATOM   10657 N N   . ASP E 1 220 ? 35.684  -7.442  -4.986  1.00 49.98 ? 218 ASP W N   1 
ATOM   10658 C CA  . ASP E 1 220 ? 34.677  -6.384  -5.063  1.00 49.98 ? 218 ASP W CA  1 
ATOM   10659 C C   . ASP E 1 220 ? 34.049  -6.333  -6.427  1.00 49.98 ? 218 ASP W C   1 
ATOM   10660 O O   . ASP E 1 220 ? 32.890  -5.951  -6.572  1.00 49.98 ? 218 ASP W O   1 
ATOM   10661 C CB  . ASP E 1 220 ? 35.276  -5.018  -4.773  1.00 79.65 ? 218 ASP W CB  1 
ATOM   10662 C CG  . ASP E 1 220 ? 35.937  -4.957  -3.439  1.00 79.65 ? 218 ASP W CG  1 
ATOM   10663 O OD1 . ASP E 1 220 ? 35.361  -5.494  -2.468  1.00 79.65 ? 218 ASP W OD1 1 
ATOM   10664 O OD2 . ASP E 1 220 ? 37.030  -4.365  -3.366  1.00 79.65 ? 218 ASP W OD2 1 
ATOM   10665 N N   . HIS E 1 221 ? 34.828  -6.707  -7.432  1.00 67.69 ? 219 HIS W N   1 
ATOM   10666 C CA  . HIS E 1 221 ? 34.339  -6.707  -8.796  1.00 67.69 ? 219 HIS W CA  1 
ATOM   10667 C C   . HIS E 1 221 ? 33.650  -8.030  -9.115  1.00 67.69 ? 219 HIS W C   1 
ATOM   10668 O O   . HIS E 1 221 ? 33.228  -8.276  -10.244 1.00 67.69 ? 219 HIS W O   1 
ATOM   10669 C CB  . HIS E 1 221 ? 35.496  -6.406  -9.753  1.00 73.88 ? 219 HIS W CB  1 
ATOM   10670 C CG  . HIS E 1 221 ? 35.843  -4.948  -9.828  1.00 73.88 ? 219 HIS W CG  1 
ATOM   10671 N ND1 . HIS E 1 221 ? 35.026  -4.019  -10.438 1.00 73.88 ? 219 HIS W ND1 1 
ATOM   10672 C CD2 . HIS E 1 221 ? 36.904  -4.256  -9.352  1.00 73.88 ? 219 HIS W CD2 1 
ATOM   10673 C CE1 . HIS E 1 221 ? 35.569  -2.820  -10.337 1.00 73.88 ? 219 HIS W CE1 1 
ATOM   10674 N NE2 . HIS E 1 221 ? 36.710  -2.936  -9.683  1.00 73.88 ? 219 HIS W NE2 1 
ATOM   10675 N N   . HIS E 1 222 ? 33.534  -8.868  -8.090  1.00 48.77 ? 220 HIS W N   1 
ATOM   10676 C CA  . HIS E 1 222 ? 32.869  -10.161 -8.191  1.00 48.77 ? 220 HIS W CA  1 
ATOM   10677 C C   . HIS E 1 222 ? 33.494  -11.097 -9.219  1.00 48.77 ? 220 HIS W C   1 
ATOM   10678 O O   . HIS E 1 222 ? 32.808  -11.930 -9.815  1.00 48.77 ? 220 HIS W O   1 
ATOM   10679 C CB  . HIS E 1 222 ? 31.382  -9.941  -8.500  1.00 69.42 ? 220 HIS W CB  1 
ATOM   10680 C CG  . HIS E 1 222 ? 30.492  -11.068 -8.068  1.00 69.42 ? 220 HIS W CG  1 
ATOM   10681 N ND1 . HIS E 1 222 ? 30.680  -11.756 -6.887  1.00 69.42 ? 220 HIS W ND1 1 
ATOM   10682 C CD2 . HIS E 1 222 ? 29.366  -11.577 -8.622  1.00 69.42 ? 220 HIS W CD2 1 
ATOM   10683 C CE1 . HIS E 1 222 ? 29.708  -12.637 -6.732  1.00 69.42 ? 220 HIS W CE1 1 
ATOM   10684 N NE2 . HIS E 1 222 ? 28.896  -12.548 -7.771  1.00 69.42 ? 220 HIS W NE2 1 
ATOM   10685 N N   . VAL E 1 223 ? 34.798  -10.958 -9.435  1.00 45.55 ? 221 VAL W N   1 
ATOM   10686 C CA  . VAL E 1 223 ? 35.482  -11.837 -10.372 1.00 45.55 ? 221 VAL W CA  1 
ATOM   10687 C C   . VAL E 1 223 ? 35.326  -13.250 -9.824  1.00 45.55 ? 221 VAL W C   1 
ATOM   10688 O O   . VAL E 1 223 ? 35.197  -13.436 -8.613  1.00 45.55 ? 221 VAL W O   1 
ATOM   10689 C CB  . VAL E 1 223 ? 36.986  -11.486 -10.482 1.00 24.00 ? 221 VAL W CB  1 
ATOM   10690 C CG1 . VAL E 1 223 ? 37.733  -12.570 -11.235 1.00 24.00 ? 221 VAL W CG1 1 
ATOM   10691 C CG2 . VAL E 1 223 ? 37.151  -10.149 -11.208 1.00 24.00 ? 221 VAL W CG2 1 
ATOM   10692 N N   . TYR E 1 224 ? 35.314  -14.228 -10.726 1.00 58.26 ? 222 TYR W N   1 
ATOM   10693 C CA  . TYR E 1 224 ? 35.178  -15.658 -10.402 1.00 58.26 ? 222 TYR W CA  1 
ATOM   10694 C C   . TYR E 1 224 ? 36.605  -16.217 -10.335 1.00 58.26 ? 222 TYR W C   1 
ATOM   10695 O O   . TYR E 1 224 ? 37.135  -16.704 -11.330 1.00 58.26 ? 222 TYR W O   1 
ATOM   10696 C CB  . TYR E 1 224 ? 34.387  -16.331 -11.536 1.00 36.86 ? 222 TYR W CB  1 
ATOM   10697 C CG  . TYR E 1 224 ? 34.086  -17.801 -11.378 1.00 36.86 ? 222 TYR W CG  1 
ATOM   10698 C CD1 . TYR E 1 224 ? 33.084  -18.230 -10.527 1.00 36.86 ? 222 TYR W CD1 1 
ATOM   10699 C CD2 . TYR E 1 224 ? 34.807  -18.763 -12.087 1.00 36.86 ? 222 TYR W CD2 1 
ATOM   10700 C CE1 . TYR E 1 224 ? 32.800  -19.582 -10.374 1.00 36.86 ? 222 TYR W CE1 1 
ATOM   10701 C CE2 . TYR E 1 224 ? 34.534  -20.122 -11.943 1.00 36.86 ? 222 TYR W CE2 1 
ATOM   10702 C CZ  . TYR E 1 224 ? 33.530  -20.524 -11.079 1.00 36.86 ? 222 TYR W CZ  1 
ATOM   10703 O OH  . TYR E 1 224 ? 33.276  -21.864 -10.874 1.00 36.86 ? 222 TYR W OH  1 
ATOM   10704 N N   . LEU E 1 225 ? 37.235  -16.132 -9.171  1.00 67.38 ? 223 LEU W N   1 
ATOM   10705 C CA  . LEU E 1 225 ? 38.608  -16.604 -9.047  1.00 67.38 ? 223 LEU W CA  1 
ATOM   10706 C C   . LEU E 1 225 ? 38.752  -18.040 -9.553  1.00 67.38 ? 223 LEU W C   1 
ATOM   10707 O O   . LEU E 1 225 ? 39.720  -18.352 -10.248 1.00 67.38 ? 223 LEU W O   1 
ATOM   10708 C CB  . LEU E 1 225 ? 39.094  -16.533 -7.593  1.00 39.54 ? 223 LEU W CB  1 
ATOM   10709 C CG  . LEU E 1 225 ? 38.640  -15.435 -6.622  1.00 39.54 ? 223 LEU W CG  1 
ATOM   10710 C CD1 . LEU E 1 225 ? 39.229  -15.775 -5.270  1.00 39.54 ? 223 LEU W CD1 1 
ATOM   10711 C CD2 . LEU E 1 225 ? 39.067  -14.028 -7.064  1.00 39.54 ? 223 LEU W CD2 1 
ATOM   10712 N N   . GLU E 1 226 ? 37.797  -18.907 -9.200  1.00 37.92 ? 224 GLU W N   1 
ATOM   10713 C CA  . GLU E 1 226 ? 37.823  -20.313 -9.617  1.00 37.92 ? 224 GLU W CA  1 
ATOM   10714 C C   . GLU E 1 226 ? 38.243  -20.459 -11.076 1.00 37.92 ? 224 GLU W C   1 
ATOM   10715 O O   . GLU E 1 226 ? 38.865  -21.449 -11.439 1.00 37.92 ? 224 GLU W O   1 
ATOM   10716 C CB  . GLU E 1 226 ? 36.447  -20.963 -9.437  1.00 46.99 ? 224 GLU W CB  1 
ATOM   10717 C CG  . GLU E 1 226 ? 36.079  -21.444 -8.027  1.00 46.99 ? 224 GLU W CG  1 
ATOM   10718 C CD  . GLU E 1 226 ? 35.850  -20.321 -7.050  1.00 46.99 ? 224 GLU W CD  1 
ATOM   10719 O OE1 . GLU E 1 226 ? 35.608  -19.182 -7.493  1.00 46.99 ? 224 GLU W OE1 1 
ATOM   10720 O OE2 . GLU E 1 226 ? 35.897  -20.580 -5.834  1.00 46.99 ? 224 GLU W OE2 1 
ATOM   10721 N N   . GLY E 1 227 ? 37.874  -19.481 -11.904 1.00 40.32 ? 225 GLY W N   1 
ATOM   10722 C CA  . GLY E 1 227 ? 38.236  -19.486 -13.318 1.00 32.34 ? 225 GLY W CA  1 
ATOM   10723 C C   . GLY E 1 227 ? 39.127  -18.282 -13.551 1.00 42.01 ? 225 GLY W C   1 
ATOM   10724 O O   . GLY E 1 227 ? 38.724  -17.294 -14.150 1.00 45.59 ? 225 GLY W O   1 
ATOM   10725 N N   . THR E 1 228 ? 40.360  -18.389 -13.075 1.00 35.36 ? 226 THR W N   1 
ATOM   10726 C CA  . THR E 1 228 ? 41.326  -17.306 -13.126 1.00 36.68 ? 226 THR W CA  1 
ATOM   10727 C C   . THR E 1 228 ? 42.700  -17.896 -12.916 1.00 40.08 ? 226 THR W C   1 
ATOM   10728 O O   . THR E 1 228 ? 42.826  -19.062 -12.569 1.00 36.37 ? 226 THR W O   1 
ATOM   10729 C CB  . THR E 1 228 ? 41.035  -16.342 -11.953 1.00 34.58 ? 226 THR W CB  1 
ATOM   10730 O OG1 . THR E 1 228 ? 40.014  -15.422 -12.348 1.00 49.40 ? 226 THR W OG1 1 
ATOM   10731 C CG2 . THR E 1 228 ? 42.287  -15.618 -11.479 1.00 22.85 ? 226 THR W CG2 1 
ATOM   10732 N N   . LEU E 1 229 ? 43.729  -17.096 -13.147 1.00 24.83 ? 227 LEU W N   1 
ATOM   10733 C CA  . LEU E 1 229 ? 45.090  -17.527 -12.898 1.00 24.29 ? 227 LEU W CA  1 
ATOM   10734 C C   . LEU E 1 229 ? 45.835  -16.382 -12.226 1.00 29.75 ? 227 LEU W C   1 
ATOM   10735 O O   . LEU E 1 229 ? 45.234  -15.383 -11.858 1.00 25.38 ? 227 LEU W O   1 
ATOM   10736 C CB  . LEU E 1 229 ? 45.775  -17.972 -14.183 1.00 35.74 ? 227 LEU W CB  1 
ATOM   10737 C CG  . LEU E 1 229 ? 45.447  -19.433 -14.541 1.00 42.28 ? 227 LEU W CG  1 
ATOM   10738 C CD1 . LEU E 1 229 ? 46.271  -19.864 -15.752 1.00 28.62 ? 227 LEU W CD1 1 
ATOM   10739 C CD2 . LEU E 1 229 ? 45.740  -20.351 -13.355 1.00 30.83 ? 227 LEU W CD2 1 
ATOM   10740 N N   . LEU E 1 230 ? 47.130  -16.537 -12.018 1.00 28.49 ? 228 LEU W N   1 
ATOM   10741 C CA  . LEU E 1 230 ? 47.908  -15.489 -11.367 1.00 29.34 ? 228 LEU W CA  1 
ATOM   10742 C C   . LEU E 1 230 ? 49.370  -15.628 -11.720 1.00 37.93 ? 228 LEU W C   1 
ATOM   10743 O O   . LEU E 1 230 ? 50.003  -16.628 -11.389 1.00 37.44 ? 228 LEU W O   1 
ATOM   10744 C CB  . LEU E 1 230 ? 47.764  -15.551 -9.840  1.00 31.48 ? 228 LEU W CB  1 
ATOM   10745 C CG  . LEU E 1 230 ? 48.791  -14.718 -9.059  1.00 41.17 ? 228 LEU W CG  1 
ATOM   10746 C CD1 . LEU E 1 230 ? 48.406  -13.257 -9.102  1.00 28.28 ? 228 LEU W CD1 1 
ATOM   10747 C CD2 . LEU E 1 230 ? 48.839  -15.159 -7.629  1.00 28.19 ? 228 LEU W CD2 1 
ATOM   10748 N N   . LYS E 1 231 ? 49.895  -14.617 -12.397 1.00 48.21 ? 229 LYS W N   1 
ATOM   10749 C CA  . LYS E 1 231 ? 51.288  -14.594 -12.806 1.00 45.44 ? 229 LYS W CA  1 
ATOM   10750 C C   . LYS E 1 231 ? 51.943  -13.628 -11.833 1.00 47.70 ? 229 LYS W C   1 
ATOM   10751 O O   . LYS E 1 231 ? 51.978  -12.417 -12.068 1.00 51.78 ? 229 LYS W O   1 
ATOM   10752 C CB  . LYS E 1 231 ? 51.380  -14.077 -14.244 1.00 47.84 ? 229 LYS W CB  1 
ATOM   10753 C CG  . LYS E 1 231 ? 52.705  -14.307 -14.952 1.00 35.55 ? 229 LYS W CG  1 
ATOM   10754 C CD  . LYS E 1 231 ? 52.613  -13.892 -16.429 1.00 46.72 ? 229 LYS W CD  1 
ATOM   10755 C CE  . LYS E 1 231 ? 53.925  -14.206 -17.151 1.00 46.28 ? 229 LYS W CE  1 
ATOM   10756 N NZ  . LYS E 1 231 ? 53.906  -13.828 -18.592 1.00 54.78 ? 229 LYS W NZ  1 
ATOM   10757 N N   . PRO E 1 232 ? 52.420  -14.147 -10.691 1.00 44.47 ? 230 PRO W N   1 
ATOM   10758 C CA  . PRO E 1 232 ? 53.057  -13.281 -9.709  1.00 45.54 ? 230 PRO W CA  1 
ATOM   10759 C C   . PRO E 1 232 ? 54.562  -13.379 -9.778  1.00 51.59 ? 230 PRO W C   1 
ATOM   10760 O O   . PRO E 1 232 ? 55.121  -14.438 -10.042 1.00 54.16 ? 230 PRO W O   1 
ATOM   10761 C CB  . PRO E 1 232 ? 52.506  -13.811 -8.396  1.00 71.98 ? 230 PRO W CB  1 
ATOM   10762 C CG  . PRO E 1 232 ? 52.540  -15.271 -8.625  1.00 83.57 ? 230 PRO W CG  1 
ATOM   10763 C CD  . PRO E 1 232 ? 52.025  -15.421 -10.059 1.00 79.36 ? 230 PRO W CD  1 
ATOM   10764 N N   . ASN E 1 233 ? 55.209  -12.246 -9.558  1.00 64.65 ? 231 ASN W N   1 
ATOM   10765 C CA  . ASN E 1 233 ? 56.657  -12.171 -9.557  1.00 64.71 ? 231 ASN W CA  1 
ATOM   10766 C C   . ASN E 1 233 ? 57.062  -13.157 -8.490  1.00 72.10 ? 231 ASN W C   1 
ATOM   10767 O O   . ASN E 1 233 ? 56.261  -13.492 -7.626  1.00 66.62 ? 231 ASN W O   1 
ATOM   10768 C CB  . ASN E 1 233 ? 57.083  -10.759 -9.155  1.00 71.60 ? 231 ASN W CB  1 
ATOM   10769 C CG  . ASN E 1 233 ? 56.287  -10.227 -7.957  1.00 76.85 ? 231 ASN W CG  1 
ATOM   10770 O OD1 . ASN E 1 233 ? 56.538  -10.599 -6.807  1.00 76.70 ? 231 ASN W OD1 1 
ATOM   10771 N ND2 . ASN E 1 233 ? 55.309  -9.366  -8.232  1.00 71.05 ? 231 ASN W ND2 1 
ATOM   10772 N N   . MET E 1 234 ? 58.284  -13.654 -8.549  1.00 62.57 ? 232 MET W N   1 
ATOM   10773 C CA  . MET E 1 234 ? 58.702  -14.565 -7.508  1.00 61.11 ? 232 MET W CA  1 
ATOM   10774 C C   . MET E 1 234 ? 59.091  -13.592 -6.396  1.00 63.27 ? 232 MET W C   1 
ATOM   10775 O O   . MET E 1 234 ? 58.813  -12.401 -6.511  1.00 64.62 ? 232 MET W O   1 
ATOM   10776 C CB  . MET E 1 234 ? 59.887  -15.398 -7.988  1.00 62.33 ? 232 MET W CB  1 
ATOM   10777 C CG  . MET E 1 234 ? 59.840  -16.848 -7.547  1.00 62.60 ? 232 MET W CG  1 
ATOM   10778 S SD  . MET E 1 234 ? 60.946  -17.846 -8.542  1.00 65.79 ? 232 MET W SD  1 
ATOM   10779 C CE  . MET E 1 234 ? 59.794  -18.593 -9.655  1.00 65.49 ? 232 MET W CE  1 
ATOM   10780 N N   . VAL E 1 235 ? 59.707  -14.063 -5.322  1.00 62.81 ? 233 VAL W N   1 
ATOM   10781 C CA  . VAL E 1 235 ? 60.091  -13.143 -4.259  1.00 62.44 ? 233 VAL W CA  1 
ATOM   10782 C C   . VAL E 1 235 ? 61.564  -13.287 -3.913  1.00 56.59 ? 233 VAL W C   1 
ATOM   10783 O O   . VAL E 1 235 ? 61.983  -14.288 -3.335  1.00 65.43 ? 233 VAL W O   1 
ATOM   10784 C CB  . VAL E 1 235 ? 59.243  -13.364 -3.003  1.00 39.27 ? 233 VAL W CB  1 
ATOM   10785 C CG1 . VAL E 1 235 ? 59.829  -12.591 -1.846  1.00 24.17 ? 233 VAL W CG1 1 
ATOM   10786 C CG2 . VAL E 1 235 ? 57.814  -12.917 -3.258  1.00 30.86 ? 233 VAL W CG2 1 
ATOM   10787 N N   . THR E 1 236 ? 62.346  -12.274 -4.274  1.00 68.47 ? 234 THR W N   1 
ATOM   10788 C CA  . THR E 1 236 ? 63.783  -12.272 -4.031  1.00 72.19 ? 234 THR W CA  1 
ATOM   10789 C C   . THR E 1 236 ? 64.282  -10.861 -3.713  1.00 74.08 ? 234 THR W C   1 
ATOM   10790 O O   . THR E 1 236 ? 64.002  -9.903  -4.440  1.00 74.08 ? 234 THR W O   1 
ATOM   10791 C CB  . THR E 1 236 ? 64.539  -12.791 -5.264  1.00 65.16 ? 234 THR W CB  1 
ATOM   10792 O OG1 . THR E 1 236 ? 64.379  -11.865 -6.343  1.00 59.36 ? 234 THR W OG1 1 
ATOM   10793 C CG2 . THR E 1 236 ? 63.981  -14.128 -5.703  1.00 51.65 ? 234 THR W CG2 1 
ATOM   10794 N N   . TYR E 1 245 ? 69.355  -14.907 -2.583  1.00 63.55 ? 243 TYR W N   1 
ATOM   10795 C CA  . TYR E 1 245 ? 69.319  -15.772 -1.408  1.00 63.55 ? 243 TYR W CA  1 
ATOM   10796 C C   . TYR E 1 245 ? 69.134  -17.208 -1.890  1.00 63.55 ? 243 TYR W C   1 
ATOM   10797 O O   . TYR E 1 245 ? 68.936  -17.435 -3.082  1.00 63.55 ? 243 TYR W O   1 
ATOM   10798 C CB  . TYR E 1 245 ? 68.150  -15.393 -0.492  1.00 88.06 ? 243 TYR W CB  1 
ATOM   10799 C CG  . TYR E 1 245 ? 68.080  -13.930 -0.089  1.00 88.06 ? 243 TYR W CG  1 
ATOM   10800 C CD1 . TYR E 1 245 ? 67.916  -12.921 -1.044  1.00 88.06 ? 243 TYR W CD1 1 
ATOM   10801 C CD2 . TYR E 1 245 ? 68.118  -13.559 1.255   1.00 88.06 ? 243 TYR W CD2 1 
ATOM   10802 C CE1 . TYR E 1 245 ? 67.785  -11.577 -0.668  1.00 88.06 ? 243 TYR W CE1 1 
ATOM   10803 C CE2 . TYR E 1 245 ? 67.989  -12.219 1.642   1.00 88.06 ? 243 TYR W CE2 1 
ATOM   10804 C CZ  . TYR E 1 245 ? 67.821  -11.236 0.676   1.00 88.06 ? 243 TYR W CZ  1 
ATOM   10805 O OH  . TYR E 1 245 ? 67.670  -9.921  1.063   1.00 88.06 ? 243 TYR W OH  1 
ATOM   10806 N N   . THR E 1 246 ? 69.186  -18.176 -0.977  1.00 67.88 ? 244 THR W N   1 
ATOM   10807 C CA  . THR E 1 246 ? 69.020  -19.575 -1.371  1.00 61.73 ? 244 THR W CA  1 
ATOM   10808 C C   . THR E 1 246 ? 67.567  -19.837 -1.760  1.00 67.88 ? 244 THR W C   1 
ATOM   10809 O O   . THR E 1 246 ? 66.650  -19.148 -1.305  1.00 67.88 ? 244 THR W O   1 
ATOM   10810 C CB  . THR E 1 246 ? 69.424  -20.572 -0.239  1.00 85.50 ? 244 THR W CB  1 
ATOM   10811 O OG1 . THR E 1 246 ? 68.317  -20.783 0.643   1.00 85.50 ? 244 THR W OG1 1 
ATOM   10812 C CG2 . THR E 1 246 ? 70.590  -20.030 0.567   1.00 85.50 ? 244 THR W CG2 1 
ATOM   10813 N N   . PRO E 1 247 ? 67.344  -20.849 -2.609  1.00 88.72 ? 245 PRO W N   1 
ATOM   10814 C CA  . PRO E 1 247 ? 66.023  -21.253 -3.104  1.00 88.72 ? 245 PRO W CA  1 
ATOM   10815 C C   . PRO E 1 247 ? 64.915  -21.404 -2.052  1.00 88.72 ? 245 PRO W C   1 
ATOM   10816 O O   . PRO E 1 247 ? 63.810  -20.900 -2.236  1.00 88.72 ? 245 PRO W O   1 
ATOM   10817 C CB  . PRO E 1 247 ? 66.323  -22.570 -3.826  1.00 73.39 ? 245 PRO W CB  1 
ATOM   10818 C CG  . PRO E 1 247 ? 67.707  -22.342 -4.357  1.00 73.98 ? 245 PRO W CG  1 
ATOM   10819 C CD  . PRO E 1 247 ? 68.394  -21.727 -3.160  1.00 75.11 ? 245 PRO W CD  1 
ATOM   10820 N N   . GLU E 1 248 ? 65.216  -22.100 -0.960  1.00 72.31 ? 246 GLU W N   1 
ATOM   10821 C CA  . GLU E 1 248 ? 64.242  -22.340 0.104   1.00 72.31 ? 246 GLU W CA  1 
ATOM   10822 C C   . GLU E 1 248 ? 63.819  -21.028 0.724   1.00 72.31 ? 246 GLU W C   1 
ATOM   10823 O O   . GLU E 1 248 ? 62.672  -20.868 1.136   1.00 72.31 ? 246 GLU W O   1 
ATOM   10824 C CB  . GLU E 1 248 ? 64.841  -23.235 1.189   1.00 78.35 ? 246 GLU W CB  1 
ATOM   10825 C CG  . GLU E 1 248 ? 65.556  -24.450 0.654   1.00 78.35 ? 246 GLU W CG  1 
ATOM   10826 C CD  . GLU E 1 248 ? 66.594  -24.079 -0.383  1.00 78.35 ? 246 GLU W CD  1 
ATOM   10827 O OE1 . GLU E 1 248 ? 67.387  -23.149 -0.120  1.00 78.35 ? 246 GLU W OE1 1 
ATOM   10828 O OE2 . GLU E 1 248 ? 66.615  -24.709 -1.463  1.00 78.35 ? 246 GLU W OE2 1 
ATOM   10829 N N   . GLN E 1 249 ? 64.763  -20.096 0.793   1.00 89.90 ? 247 GLN W N   1 
ATOM   10830 C CA  . GLN E 1 249 ? 64.505  -18.781 1.358   1.00 89.90 ? 247 GLN W CA  1 
ATOM   10831 C C   . GLN E 1 249 ? 63.652  -18.000 0.367   1.00 89.90 ? 247 GLN W C   1 
ATOM   10832 O O   . GLN E 1 249 ? 62.699  -17.317 0.754   1.00 89.90 ? 247 GLN W O   1 
ATOM   10833 C CB  . GLN E 1 249 ? 65.827  -18.054 1.616   1.00 92.42 ? 247 GLN W CB  1 
ATOM   10834 C CG  . GLN E 1 249 ? 66.788  -18.834 2.516   1.00 92.42 ? 247 GLN W CG  1 
ATOM   10835 C CD  . GLN E 1 249 ? 68.126  -18.133 2.720   1.00 92.42 ? 247 GLN W CD  1 
ATOM   10836 O OE1 . GLN E 1 249 ? 68.824  -17.790 1.758   1.00 92.42 ? 247 GLN W OE1 1 
ATOM   10837 N NE2 . GLN E 1 249 ? 68.491  -17.924 3.980   1.00 92.42 ? 247 GLN W NE2 1 
ATOM   10838 N N   . VAL E 1 250 ? 63.997  -18.110 -0.916  1.00 75.99 ? 248 VAL W N   1 
ATOM   10839 C CA  . VAL E 1 250 ? 63.242  -17.433 -1.970  1.00 75.99 ? 248 VAL W CA  1 
ATOM   10840 C C   . VAL E 1 250 ? 61.848  -18.029 -1.950  1.00 75.99 ? 248 VAL W C   1 
ATOM   10841 O O   . VAL E 1 250 ? 60.856  -17.313 -1.887  1.00 75.99 ? 248 VAL W O   1 
ATOM   10842 C CB  . VAL E 1 250 ? 63.850  -17.684 -3.363  1.00 64.02 ? 248 VAL W CB  1 
ATOM   10843 C CG1 . VAL E 1 250 ? 63.099  -16.878 -4.401  1.00 64.02 ? 248 VAL W CG1 1 
ATOM   10844 C CG2 . VAL E 1 250 ? 65.325  -17.324 -3.362  1.00 64.02 ? 248 VAL W CG2 1 
ATOM   10845 N N   . ALA E 1 251 ? 61.803  -19.357 -1.991  1.00 54.75 ? 249 ALA W N   1 
ATOM   10846 C CA  . ALA E 1 251 ? 60.563  -20.112 -1.962  1.00 54.75 ? 249 ALA W CA  1 
ATOM   10847 C C   . ALA E 1 251 ? 59.801  -19.805 -0.683  1.00 54.75 ? 249 ALA W C   1 
ATOM   10848 O O   . ALA E 1 251 ? 58.578  -19.676 -0.697  1.00 54.75 ? 249 ALA W O   1 
ATOM   10849 C CB  . ALA E 1 251 ? 60.864  -21.602 -2.041  1.00 40.34 ? 249 ALA W CB  1 
ATOM   10850 N N   . MET E 1 252 ? 60.533  -19.683 0.419   1.00 72.07 ? 250 MET W N   1 
ATOM   10851 C CA  . MET E 1 252 ? 59.927  -19.398 1.713   1.00 72.07 ? 250 MET W CA  1 
ATOM   10852 C C   . MET E 1 252 ? 59.179  -18.064 1.733   1.00 72.07 ? 250 MET W C   1 
ATOM   10853 O O   . MET E 1 252 ? 57.974  -18.028 1.979   1.00 72.07 ? 250 MET W O   1 
ATOM   10854 C CB  . MET E 1 252 ? 60.994  -19.409 2.806   1.00 61.85 ? 250 MET W CB  1 
ATOM   10855 C CG  . MET E 1 252 ? 60.451  -19.229 4.209   1.00 61.85 ? 250 MET W CG  1 
ATOM   10856 S SD  . MET E 1 252 ? 59.205  -20.452 4.648   1.00 61.85 ? 250 MET W SD  1 
ATOM   10857 C CE  . MET E 1 252 ? 58.132  -19.473 5.762   1.00 61.85 ? 250 MET W CE  1 
ATOM   10858 N N   . ALA E 1 253 ? 59.882  -16.966 1.481   1.00 91.43 ? 251 ALA W N   1 
ATOM   10859 C CA  . ALA E 1 253 ? 59.231  -15.657 1.478   1.00 91.43 ? 251 ALA W CA  1 
ATOM   10860 C C   . ALA E 1 253 ? 58.126  -15.639 0.426   1.00 91.43 ? 251 ALA W C   1 
ATOM   10861 O O   . ALA E 1 253 ? 57.038  -15.103 0.653   1.00 91.43 ? 251 ALA W O   1 
ATOM   10862 C CB  . ALA E 1 253 ? 60.250  -14.563 1.183   1.00 87.31 ? 251 ALA W CB  1 
ATOM   10863 N N   . THR E 1 254 ? 58.423  -16.240 -0.722  1.00 57.63 ? 252 THR W N   1 
ATOM   10864 C CA  . THR E 1 254 ? 57.494  -16.314 -1.844  1.00 57.63 ? 252 THR W CA  1 
ATOM   10865 C C   . THR E 1 254 ? 56.162  -16.979 -1.487  1.00 57.63 ? 252 THR W C   1 
ATOM   10866 O O   . THR E 1 254 ? 55.094  -16.386 -1.659  1.00 57.63 ? 252 THR W O   1 
ATOM   10867 C CB  . THR E 1 254 ? 58.137  -17.076 -3.017  1.00 45.95 ? 252 THR W CB  1 
ATOM   10868 O OG1 . THR E 1 254 ? 59.383  -16.456 -3.369  1.00 45.95 ? 252 THR W OG1 1 
ATOM   10869 C CG2 . THR E 1 254 ? 57.218  -17.066 -4.225  1.00 45.95 ? 252 THR W CG2 1 
ATOM   10870 N N   . VAL E 1 255 ? 56.223  -18.213 -1.005  1.00 65.62 ? 253 VAL W N   1 
ATOM   10871 C CA  . VAL E 1 255 ? 55.011  -18.927 -0.625  1.00 65.62 ? 253 VAL W CA  1 
ATOM   10872 C C   . VAL E 1 255 ? 54.400  -18.230 0.580   1.00 65.62 ? 253 VAL W C   1 
ATOM   10873 O O   . VAL E 1 255 ? 53.190  -18.010 0.649   1.00 65.62 ? 253 VAL W O   1 
ATOM   10874 C CB  . VAL E 1 255 ? 55.317  -20.402 -0.261  1.00 25.58 ? 253 VAL W CB  1 
ATOM   10875 C CG1 . VAL E 1 255 ? 54.083  -21.075 0.322   1.00 25.58 ? 253 VAL W CG1 1 
ATOM   10876 C CG2 . VAL E 1 255 ? 55.774  -21.144 -1.494  1.00 25.58 ? 253 VAL W CG2 1 
ATOM   10877 N N   . THR E 1 256 ? 55.255  -17.886 1.531   1.00 77.72 ? 254 THR W N   1 
ATOM   10878 C CA  . THR E 1 256 ? 54.823  -17.214 2.741   1.00 77.72 ? 254 THR W CA  1 
ATOM   10879 C C   . THR E 1 256 ? 53.784  -16.145 2.413   1.00 77.72 ? 254 THR W C   1 
ATOM   10880 O O   . THR E 1 256 ? 52.619  -16.248 2.805   1.00 77.72 ? 254 THR W O   1 
ATOM   10881 C CB  . THR E 1 256 ? 56.033  -16.575 3.450   1.00 58.97 ? 254 THR W CB  1 
ATOM   10882 O OG1 . THR E 1 256 ? 56.769  -17.588 4.145   1.00 58.97 ? 254 THR W OG1 1 
ATOM   10883 C CG2 . THR E 1 256 ? 55.584  -15.519 4.430   1.00 58.97 ? 254 THR W CG2 1 
ATOM   10884 N N   . ALA E 1 257 ? 54.215  -15.125 1.683   1.00 70.09 ? 255 ALA W N   1 
ATOM   10885 C CA  . ALA E 1 257 ? 53.338  -14.034 1.291   1.00 70.09 ? 255 ALA W CA  1 
ATOM   10886 C C   . ALA E 1 257 ? 52.067  -14.587 0.670   1.00 70.09 ? 255 ALA W C   1 
ATOM   10887 O O   . ALA E 1 257 ? 50.963  -14.430 1.199   1.00 70.09 ? 255 ALA W O   1 
ATOM   10888 C CB  . ALA E 1 257 ? 54.049  -13.164 0.293   1.00 12.76 ? 255 ALA W CB  1 
ATOM   10889 N N   . LEU E 1 258 ? 52.259  -15.240 -0.469  1.00 50.04 ? 256 LEU W N   1 
ATOM   10890 C CA  . LEU E 1 258 ? 51.194  -15.848 -1.242  1.00 50.04 ? 256 LEU W CA  1 
ATOM   10891 C C   . LEU E 1 258 ? 50.126  -16.591 -0.468  1.00 50.04 ? 256 LEU W C   1 
ATOM   10892 O O   . LEU E 1 258 ? 48.948  -16.543 -0.837  1.00 50.04 ? 256 LEU W O   1 
ATOM   10893 C CB  . LEU E 1 258 ? 51.798  -16.799 -2.261  1.00 14.94 ? 256 LEU W CB  1 
ATOM   10894 C CG  . LEU E 1 258 ? 52.196  -16.113 -3.560  1.00 14.94 ? 256 LEU W CG  1 
ATOM   10895 C CD1 . LEU E 1 258 ? 53.031  -17.039 -4.443  1.00 14.94 ? 256 LEU W CD1 1 
ATOM   10896 C CD2 . LEU E 1 258 ? 50.909  -15.681 -4.280  1.00 14.94 ? 256 LEU W CD2 1 
ATOM   10897 N N   . HIS E 1 259 ? 50.515  -17.275 0.605   1.00 49.82 ? 257 HIS W N   1 
ATOM   10898 C CA  . HIS E 1 259 ? 49.533  -18.055 1.337   1.00 49.82 ? 257 HIS W CA  1 
ATOM   10899 C C   . HIS E 1 259 ? 48.666  -17.259 2.304   1.00 49.82 ? 257 HIS W C   1 
ATOM   10900 O O   . HIS E 1 259 ? 47.702  -17.786 2.868   1.00 49.82 ? 257 HIS W O   1 
ATOM   10901 C CB  . HIS E 1 259 ? 50.216  -19.272 1.997   1.00 57.24 ? 257 HIS W CB  1 
ATOM   10902 C CG  . HIS E 1 259 ? 50.533  -19.105 3.445   1.00 57.24 ? 257 HIS W CG  1 
ATOM   10903 N ND1 . HIS E 1 259 ? 51.407  -18.152 3.912   1.00 57.24 ? 257 HIS W ND1 1 
ATOM   10904 C CD2 . HIS E 1 259 ? 50.113  -19.798 4.528   1.00 57.24 ? 257 HIS W CD2 1 
ATOM   10905 C CE1 . HIS E 1 259 ? 51.512  -18.263 5.224   1.00 57.24 ? 257 HIS W CE1 1 
ATOM   10906 N NE2 . HIS E 1 259 ? 50.736  -19.255 5.622   1.00 57.24 ? 257 HIS W NE2 1 
ATOM   10907 N N   . ARG E 1 260 ? 48.986  -15.976 2.454   1.00 51.64 ? 258 ARG W N   1 
ATOM   10908 C CA  . ARG E 1 260 ? 48.211  -15.086 3.314   1.00 51.64 ? 258 ARG W CA  1 
ATOM   10909 C C   . ARG E 1 260 ? 47.611  -13.947 2.524   1.00 51.64 ? 258 ARG W C   1 
ATOM   10910 O O   . ARG E 1 260 ? 46.898  -13.118 3.063   1.00 51.64 ? 258 ARG W O   1 
ATOM   10911 C CB  . ARG E 1 260 ? 49.070  -14.512 4.430   1.00 39.50 ? 258 ARG W CB  1 
ATOM   10912 C CG  . ARG E 1 260 ? 50.516  -14.183 4.093   1.00 39.50 ? 258 ARG W CG  1 
ATOM   10913 C CD  . ARG E 1 260 ? 51.188  -13.928 5.428   1.00 39.50 ? 258 ARG W CD  1 
ATOM   10914 N NE  . ARG E 1 260 ? 52.629  -13.751 5.386   1.00 39.50 ? 258 ARG W NE  1 
ATOM   10915 C CZ  . ARG E 1 260 ? 53.369  -13.670 6.489   1.00 39.50 ? 258 ARG W CZ  1 
ATOM   10916 N NH1 . ARG E 1 260 ? 52.785  -13.759 7.680   1.00 39.50 ? 258 ARG W NH1 1 
ATOM   10917 N NH2 . ARG E 1 260 ? 54.682  -13.487 6.410   1.00 39.50 ? 258 ARG W NH2 1 
ATOM   10918 N N   . THR E 1 261 ? 47.919  -13.923 1.237   1.00 25.16 ? 259 THR W N   1 
ATOM   10919 C CA  . THR E 1 261 ? 47.439  -12.905 0.319   1.00 25.16 ? 259 THR W CA  1 
ATOM   10920 C C   . THR E 1 261 ? 46.443  -13.544 -0.615  1.00 25.16 ? 259 THR W C   1 
ATOM   10921 O O   . THR E 1 261 ? 45.298  -13.114 -0.697  1.00 25.16 ? 259 THR W O   1 
ATOM   10922 C CB  . THR E 1 261 ? 48.601  -12.347 -0.522  1.00 62.50 ? 259 THR W CB  1 
ATOM   10923 O OG1 . THR E 1 261 ? 49.308  -13.431 -1.137  1.00 62.50 ? 259 THR W OG1 1 
ATOM   10924 C CG2 . THR E 1 261 ? 49.573  -11.577 0.351   1.00 62.50 ? 259 THR W CG2 1 
ATOM   10925 N N   . VAL E 1 262 ? 46.904  -14.600 -1.287  1.00 50.84 ? 260 VAL W N   1 
ATOM   10926 C CA  . VAL E 1 262 ? 46.138  -15.362 -2.276  1.00 50.84 ? 260 VAL W CA  1 
ATOM   10927 C C   . VAL E 1 262 ? 45.219  -16.468 -1.726  1.00 50.84 ? 260 VAL W C   1 
ATOM   10928 O O   . VAL E 1 262 ? 45.661  -17.334 -0.968  1.00 50.84 ? 260 VAL W O   1 
ATOM   10929 C CB  . VAL E 1 262 ? 47.100  -16.008 -3.297  1.00 32.20 ? 260 VAL W CB  1 
ATOM   10930 C CG1 . VAL E 1 262 ? 46.312  -16.770 -4.315  1.00 32.20 ? 260 VAL W CG1 1 
ATOM   10931 C CG2 . VAL E 1 262 ? 47.949  -14.954 -3.976  1.00 32.20 ? 260 VAL W CG2 1 
ATOM   10932 N N   . PRO E 1 263 ? 43.927  -16.451 -2.123  1.00 27.30 ? 261 PRO W N   1 
ATOM   10933 C CA  . PRO E 1 263 ? 42.829  -17.374 -1.763  1.00 27.30 ? 261 PRO W CA  1 
ATOM   10934 C C   . PRO E 1 263 ? 42.884  -18.812 -2.312  1.00 27.30 ? 261 PRO W C   1 
ATOM   10935 O O   . PRO E 1 263 ? 43.163  -19.043 -3.487  1.00 27.30 ? 261 PRO W O   1 
ATOM   10936 C CB  . PRO E 1 263 ? 41.581  -16.635 -2.259  1.00 28.08 ? 261 PRO W CB  1 
ATOM   10937 C CG  . PRO E 1 263 ? 41.978  -15.214 -2.160  1.00 28.08 ? 261 PRO W CG  1 
ATOM   10938 C CD  . PRO E 1 263 ? 43.367  -15.240 -2.742  1.00 28.08 ? 261 PRO W CD  1 
ATOM   10939 N N   . ALA E 1 264 ? 42.584  -19.782 -1.461  1.00 53.59 ? 262 ALA W N   1 
ATOM   10940 C CA  . ALA E 1 264 ? 42.622  -21.177 -1.883  1.00 53.59 ? 262 ALA W CA  1 
ATOM   10941 C C   . ALA E 1 264 ? 41.562  -21.482 -2.940  1.00 53.59 ? 262 ALA W C   1 
ATOM   10942 O O   . ALA E 1 264 ? 41.273  -22.647 -3.231  1.00 53.59 ? 262 ALA W O   1 
ATOM   10943 C CB  . ALA E 1 264 ? 42.439  -22.090 -0.673  1.00 30.90 ? 262 ALA W CB  1 
ATOM   10944 N N   . ALA E 1 265 ? 40.985  -20.432 -3.515  1.00 28.79 ? 263 ALA W N   1 
ATOM   10945 C CA  . ALA E 1 265 ? 39.954  -20.610 -4.529  1.00 28.79 ? 263 ALA W CA  1 
ATOM   10946 C C   . ALA E 1 265 ? 40.489  -20.279 -5.911  1.00 28.79 ? 263 ALA W C   1 
ATOM   10947 O O   . ALA E 1 265 ? 39.748  -20.299 -6.900  1.00 28.79 ? 263 ALA W O   1 
ATOM   10948 C CB  . ALA E 1 265 ? 38.757  -19.750 -4.212  1.00 2.76  ? 263 ALA W CB  1 
ATOM   10949 N N   . VAL E 1 266 ? 41.778  -19.966 -5.970  1.00 36.03 ? 264 VAL W N   1 
ATOM   10950 C CA  . VAL E 1 266 ? 42.426  -19.660 -7.229  1.00 36.03 ? 264 VAL W CA  1 
ATOM   10951 C C   . VAL E 1 266 ? 43.115  -20.941 -7.656  1.00 36.03 ? 264 VAL W C   1 
ATOM   10952 O O   . VAL E 1 266 ? 44.053  -21.388 -7.012  1.00 36.03 ? 264 VAL W O   1 
ATOM   10953 C CB  . VAL E 1 266 ? 43.430  -18.518 -7.055  1.00 7.43  ? 264 VAL W CB  1 
ATOM   10954 C CG1 . VAL E 1 266 ? 44.596  -18.687 -7.999  1.00 7.43  ? 264 VAL W CG1 1 
ATOM   10955 C CG2 . VAL E 1 266 ? 42.722  -17.194 -7.314  1.00 7.43  ? 264 VAL W CG2 1 
ATOM   10956 N N   . PRO E 1 267 ? 42.647  -21.553 -8.753  1.00 41.69 ? 265 PRO W N   1 
ATOM   10957 C CA  . PRO E 1 267 ? 43.174  -22.804 -9.309  1.00 41.69 ? 265 PRO W CA  1 
ATOM   10958 C C   . PRO E 1 267 ? 44.668  -22.866 -9.564  1.00 41.69 ? 265 PRO W C   1 
ATOM   10959 O O   . PRO E 1 267 ? 45.271  -23.937 -9.489  1.00 41.69 ? 265 PRO W O   1 
ATOM   10960 C CB  . PRO E 1 267 ? 42.366  -22.974 -10.591 1.00 31.27 ? 265 PRO W CB  1 
ATOM   10961 C CG  . PRO E 1 267 ? 42.132  -21.572 -11.016 1.00 31.27 ? 265 PRO W CG  1 
ATOM   10962 C CD  . PRO E 1 267 ? 41.721  -20.927 -9.712  1.00 31.27 ? 265 PRO W CD  1 
ATOM   10963 N N   . GLY E 1 268 ? 45.278  -21.732 -9.865  1.00 46.84 ? 266 GLY W N   1 
ATOM   10964 C CA  . GLY E 1 268 ? 46.695  -21.785 -10.127 1.00 46.84 ? 266 GLY W CA  1 
ATOM   10965 C C   . GLY E 1 268 ? 47.452  -20.485 -10.032 1.00 46.84 ? 266 GLY W C   1 
ATOM   10966 O O   . GLY E 1 268 ? 46.895  -19.406 -10.182 1.00 46.84 ? 266 GLY W O   1 
ATOM   10967 N N   . ILE E 1 269 ? 48.748  -20.617 -9.793  1.00 34.35 ? 267 ILE W N   1 
ATOM   10968 C CA  . ILE E 1 269 ? 49.658  -19.495 -9.663  1.00 34.35 ? 267 ILE W CA  1 
ATOM   10969 C C   . ILE E 1 269 ? 50.879  -19.851 -10.501 1.00 34.35 ? 267 ILE W C   1 
ATOM   10970 O O   . ILE E 1 269 ? 51.625  -20.771 -10.161 1.00 34.35 ? 267 ILE W O   1 
ATOM   10971 C CB  . ILE E 1 269 ? 50.088  -19.323 -8.192  1.00 27.28 ? 267 ILE W CB  1 
ATOM   10972 C CG1 . ILE E 1 269 ? 48.928  -18.758 -7.381  1.00 27.28 ? 267 ILE W CG1 1 
ATOM   10973 C CG2 . ILE E 1 269 ? 51.313  -18.442 -8.094  1.00 27.28 ? 267 ILE W CG2 1 
ATOM   10974 C CD1 . ILE E 1 269 ? 49.153  -18.805 -5.885  1.00 27.28 ? 267 ILE W CD1 1 
ATOM   10975 N N   . CYS E 1 270 ? 51.082  -19.140 -11.602 1.00 39.27 ? 268 CYS W N   1 
ATOM   10976 C CA  . CYS E 1 270 ? 52.227  -19.422 -12.443 1.00 39.27 ? 268 CYS W CA  1 
ATOM   10977 C C   . CYS E 1 270 ? 53.227  -18.292 -12.364 1.00 39.27 ? 268 CYS W C   1 
ATOM   10978 O O   . CYS E 1 270 ? 52.932  -17.162 -12.745 1.00 39.27 ? 268 CYS W O   1 
ATOM   10979 C CB  . CYS E 1 270 ? 51.767  -19.640 -13.874 1.00 92.42 ? 268 CYS W CB  1 
ATOM   10980 S SG  . CYS E 1 270 ? 50.572  -20.982 -13.990 1.00 92.42 ? 268 CYS W SG  1 
ATOM   10981 N N   . PHE E 1 271 ? 54.408  -18.605 -11.839 1.00 58.63 ? 269 PHE W N   1 
ATOM   10982 C CA  . PHE E 1 271 ? 55.479  -17.627 -11.696 1.00 58.63 ? 269 PHE W CA  1 
ATOM   10983 C C   . PHE E 1 271 ? 56.109  -17.342 -13.043 1.00 58.63 ? 269 PHE W C   1 
ATOM   10984 O O   . PHE E 1 271 ? 55.800  -18.015 -14.021 1.00 58.63 ? 269 PHE W O   1 
ATOM   10985 C CB  . PHE E 1 271 ? 56.555  -18.136 -10.736 1.00 49.63 ? 269 PHE W CB  1 
ATOM   10986 C CG  . PHE E 1 271 ? 56.090  -18.258 -9.318  1.00 49.63 ? 269 PHE W CG  1 
ATOM   10987 C CD1 . PHE E 1 271 ? 55.669  -19.485 -8.811  1.00 49.63 ? 269 PHE W CD1 1 
ATOM   10988 C CD2 . PHE E 1 271 ? 56.049  -17.138 -8.494  1.00 49.63 ? 269 PHE W CD2 1 
ATOM   10989 C CE1 . PHE E 1 271 ? 55.212  -19.598 -7.499  1.00 49.63 ? 269 PHE W CE1 1 
ATOM   10990 C CE2 . PHE E 1 271 ? 55.595  -17.235 -7.188  1.00 49.63 ? 269 PHE W CE2 1 
ATOM   10991 C CZ  . PHE E 1 271 ? 55.173  -18.470 -6.685  1.00 49.63 ? 269 PHE W CZ  1 
ATOM   10992 N N   . LEU E 1 272 ? 56.991  -16.348 -13.092 1.00 58.56 ? 270 LEU W N   1 
ATOM   10993 C CA  . LEU E 1 272 ? 57.660  -15.982 -14.336 1.00 58.56 ? 270 LEU W CA  1 
ATOM   10994 C C   . LEU E 1 272 ? 59.164  -15.864 -14.119 1.00 58.56 ? 270 LEU W C   1 
ATOM   10995 O O   . LEU E 1 272 ? 59.604  -15.229 -13.173 1.00 58.56 ? 270 LEU W O   1 
ATOM   10996 C CB  . LEU E 1 272 ? 57.077  -14.668 -14.866 1.00 54.54 ? 270 LEU W CB  1 
ATOM   10997 C CG  . LEU E 1 272 ? 57.216  -13.424 -13.996 1.00 54.54 ? 270 LEU W CG  1 
ATOM   10998 C CD1 . LEU E 1 272 ? 58.502  -12.704 -14.366 1.00 54.54 ? 270 LEU W CD1 1 
ATOM   10999 C CD2 . LEU E 1 272 ? 56.026  -12.512 -14.214 1.00 54.54 ? 270 LEU W CD2 1 
ATOM   11000 N N   . SER E 1 273 ? 59.946  -16.487 -14.998 1.00 92.42 ? 271 SER W N   1 
ATOM   11001 C CA  . SER E 1 273 ? 61.407  -16.468 -14.883 1.00 92.42 ? 271 SER W CA  1 
ATOM   11002 C C   . SER E 1 273 ? 61.953  -15.077 -14.575 1.00 92.42 ? 271 SER W C   1 
ATOM   11003 O O   . SER E 1 273 ? 62.863  -14.932 -13.758 1.00 92.42 ? 271 SER W O   1 
ATOM   11004 C CB  . SER E 1 273 ? 62.062  -16.989 -16.172 1.00 86.36 ? 271 SER W CB  1 
ATOM   11005 O OG  . SER E 1 273 ? 62.417  -15.933 -17.051 1.00 86.36 ? 271 SER W OG  1 
ATOM   11006 N N   . GLY E 1 274 ? 61.398  -14.064 -15.240 1.00 74.05 ? 272 GLY W N   1 
ATOM   11007 C CA  . GLY E 1 274 ? 61.831  -12.693 -15.034 1.00 74.05 ? 272 GLY W CA  1 
ATOM   11008 C C   . GLY E 1 274 ? 63.331  -12.519 -14.876 1.00 74.05 ? 272 GLY W C   1 
ATOM   11009 O O   . GLY E 1 274 ? 63.818  -12.232 -13.782 1.00 74.05 ? 272 GLY W O   1 
ATOM   11010 N N   . GLY E 1 275 ? 64.070  -12.702 -15.964 1.00 81.43 ? 273 GLY W N   1 
ATOM   11011 C CA  . GLY E 1 275 ? 65.513  -12.537 -15.912 1.00 81.43 ? 273 GLY W CA  1 
ATOM   11012 C C   . GLY E 1 275 ? 66.265  -13.549 -15.067 1.00 81.43 ? 273 GLY W C   1 
ATOM   11013 O O   . GLY E 1 275 ? 67.265  -13.219 -14.429 1.00 81.43 ? 273 GLY W O   1 
ATOM   11014 N N   . MET E 1 276 ? 65.784  -14.786 -15.058 1.00 89.13 ? 274 MET W N   1 
ATOM   11015 C CA  . MET E 1 276 ? 66.432  -15.848 -14.302 1.00 89.13 ? 274 MET W CA  1 
ATOM   11016 C C   . MET E 1 276 ? 67.076  -16.831 -15.260 1.00 89.13 ? 274 MET W C   1 
ATOM   11017 O O   . MET E 1 276 ? 66.520  -17.124 -16.316 1.00 89.13 ? 274 MET W O   1 
ATOM   11018 C CB  . MET E 1 276 ? 65.419  -16.613 -13.446 1.00 81.46 ? 274 MET W CB  1 
ATOM   11019 C CG  . MET E 1 276 ? 65.086  -15.968 -12.126 1.00 81.46 ? 274 MET W CG  1 
ATOM   11020 S SD  . MET E 1 276 ? 64.193  -17.102 -11.048 1.00 81.46 ? 274 MET W SD  1 
ATOM   11021 C CE  . MET E 1 276 ? 62.500  -16.559 -11.297 1.00 81.46 ? 274 MET W CE  1 
ATOM   11022 N N   . SER E 1 277 ? 68.253  -17.330 -14.901 1.00 74.53 ? 275 SER W N   1 
ATOM   11023 C CA  . SER E 1 277 ? 68.916  -18.322 -15.732 1.00 74.53 ? 275 SER W CA  1 
ATOM   11024 C C   . SER E 1 277 ? 67.927  -19.474 -15.740 1.00 74.53 ? 275 SER W C   1 
ATOM   11025 O O   . SER E 1 277 ? 67.363  -19.810 -14.695 1.00 74.53 ? 275 SER W O   1 
ATOM   11026 C CB  . SER E 1 277 ? 70.227  -18.752 -15.084 1.00 79.59 ? 275 SER W CB  1 
ATOM   11027 O OG  . SER E 1 277 ? 70.048  -18.940 -13.693 1.00 79.59 ? 275 SER W OG  1 
ATOM   11028 N N   . GLU E 1 278 ? 67.692  -20.068 -16.904 1.00 92.42 ? 276 GLU W N   1 
ATOM   11029 C CA  . GLU E 1 278 ? 66.730  -21.160 -16.978 1.00 92.42 ? 276 GLU W CA  1 
ATOM   11030 C C   . GLU E 1 278 ? 66.843  -22.077 -15.758 1.00 92.42 ? 276 GLU W C   1 
ATOM   11031 O O   . GLU E 1 278 ? 65.828  -22.532 -15.227 1.00 92.42 ? 276 GLU W O   1 
ATOM   11032 C CB  . GLU E 1 278 ? 66.918  -21.982 -18.262 1.00 91.72 ? 276 GLU W CB  1 
ATOM   11033 C CG  . GLU E 1 278 ? 66.722  -21.208 -19.562 1.00 91.72 ? 276 GLU W CG  1 
ATOM   11034 C CD  . GLU E 1 278 ? 66.767  -22.111 -20.794 1.00 91.72 ? 276 GLU W CD  1 
ATOM   11035 O OE1 . GLU E 1 278 ? 67.712  -22.925 -20.905 1.00 91.72 ? 276 GLU W OE1 1 
ATOM   11036 O OE2 . GLU E 1 278 ? 65.863  -22.004 -21.657 1.00 91.72 ? 276 GLU W OE2 1 
ATOM   11037 N N   . GLU E 1 279 ? 68.073  -22.321 -15.301 1.00 68.63 ? 277 GLU W N   1 
ATOM   11038 C CA  . GLU E 1 279 ? 68.315  -23.201 -14.154 1.00 68.63 ? 277 GLU W CA  1 
ATOM   11039 C C   . GLU E 1 279 ? 67.746  -22.699 -12.822 1.00 68.63 ? 277 GLU W C   1 
ATOM   11040 O O   . GLU E 1 279 ? 67.079  -23.453 -12.106 1.00 68.63 ? 277 GLU W O   1 
ATOM   11041 C CB  . GLU E 1 279 ? 69.815  -23.469 -13.996 1.00 81.26 ? 277 GLU W CB  1 
ATOM   11042 C CG  . GLU E 1 279 ? 70.144  -24.409 -12.848 1.00 81.26 ? 277 GLU W CG  1 
ATOM   11043 C CD  . GLU E 1 279 ? 69.553  -25.804 -13.037 1.00 81.26 ? 277 GLU W CD  1 
ATOM   11044 O OE1 . GLU E 1 279 ? 68.382  -25.906 -13.478 1.00 81.26 ? 277 GLU W OE1 1 
ATOM   11045 O OE2 . GLU E 1 279 ? 70.256  -26.797 -12.729 1.00 81.26 ? 277 GLU W OE2 1 
ATOM   11046 N N   . ASP E 1 280 ? 68.021  -21.438 -12.485 1.00 92.42 ? 278 ASP W N   1 
ATOM   11047 C CA  . ASP E 1 280 ? 67.519  -20.850 -11.239 1.00 92.42 ? 278 ASP W CA  1 
ATOM   11048 C C   . ASP E 1 280 ? 65.998  -20.847 -11.270 1.00 92.42 ? 278 ASP W C   1 
ATOM   11049 O O   . ASP E 1 280 ? 65.351  -20.968 -10.228 1.00 92.42 ? 278 ASP W O   1 
ATOM   11050 C CB  . ASP E 1 280 ? 68.011  -19.400 -11.053 1.00 72.66 ? 278 ASP W CB  1 
ATOM   11051 C CG  . ASP E 1 280 ? 69.494  -19.307 -10.707 1.00 72.66 ? 278 ASP W CG  1 
ATOM   11052 O OD1 . ASP E 1 280 ? 69.947  -20.011 -9.778  1.00 72.66 ? 278 ASP W OD1 1 
ATOM   11053 O OD2 . ASP E 1 280 ? 70.201  -18.510 -11.356 1.00 72.66 ? 278 ASP W OD2 1 
ATOM   11054 N N   . ALA E 1 281 ? 65.438  -20.699 -12.471 1.00 65.23 ? 279 ALA W N   1 
ATOM   11055 C CA  . ALA E 1 281 ? 63.992  -20.675 -12.661 1.00 65.23 ? 279 ALA W CA  1 
ATOM   11056 C C   . ALA E 1 281 ? 63.364  -21.989 -12.223 1.00 65.23 ? 279 ALA W C   1 
ATOM   11057 O O   . ALA E 1 281 ? 62.314  -22.011 -11.577 1.00 65.23 ? 279 ALA W O   1 
ATOM   11058 C CB  . ALA E 1 281 ? 63.675  -20.424 -14.103 1.00 5.42  ? 279 ALA W CB  1 
ATOM   11059 N N   . THR E 1 282 ? 64.015  -23.084 -12.593 1.00 54.12 ? 280 THR W N   1 
ATOM   11060 C CA  . THR E 1 282 ? 63.544  -24.417 -12.245 1.00 54.12 ? 280 THR W CA  1 
ATOM   11061 C C   . THR E 1 282 ? 63.666  -24.641 -10.750 1.00 54.12 ? 280 THR W C   1 
ATOM   11062 O O   . THR E 1 282 ? 62.671  -24.853 -10.057 1.00 54.12 ? 280 THR W O   1 
ATOM   11063 C CB  . THR E 1 282 ? 64.373  -25.510 -12.941 1.00 50.19 ? 280 THR W CB  1 
ATOM   11064 O OG1 . THR E 1 282 ? 64.273  -25.369 -14.364 1.00 50.19 ? 280 THR W OG1 1 
ATOM   11065 C CG2 . THR E 1 282 ? 63.863  -26.872 -12.542 1.00 50.19 ? 280 THR W CG2 1 
ATOM   11066 N N   . LEU E 1 283 ? 64.905  -24.595 -10.266 1.00 55.34 ? 281 LEU W N   1 
ATOM   11067 C CA  . LEU E 1 283 ? 65.209  -24.798 -8.852  1.00 55.34 ? 281 LEU W CA  1 
ATOM   11068 C C   . LEU E 1 283 ? 64.289  -23.968 -7.966  1.00 55.34 ? 281 LEU W C   1 
ATOM   11069 O O   . LEU E 1 283 ? 63.684  -24.493 -7.034  1.00 55.34 ? 281 LEU W O   1 
ATOM   11070 C CB  . LEU E 1 283 ? 66.667  -24.432 -8.598  1.00 62.26 ? 281 LEU W CB  1 
ATOM   11071 C CG  . LEU E 1 283 ? 67.630  -25.126 -9.562  1.00 62.26 ? 281 LEU W CG  1 
ATOM   11072 C CD1 . LEU E 1 283 ? 68.919  -24.335 -9.655  1.00 62.26 ? 281 LEU W CD1 1 
ATOM   11073 C CD2 . LEU E 1 283 ? 67.883  -26.554 -9.109  1.00 62.26 ? 281 LEU W CD2 1 
ATOM   11074 N N   . ASN E 1 284 ? 64.189  -22.674 -8.265  1.00 71.99 ? 282 ASN W N   1 
ATOM   11075 C CA  . ASN E 1 284 ? 63.321  -21.774 -7.509  1.00 71.99 ? 282 ASN W CA  1 
ATOM   11076 C C   . ASN E 1 284 ? 61.881  -22.292 -7.555  1.00 71.99 ? 282 ASN W C   1 
ATOM   11077 O O   . ASN E 1 284 ? 61.159  -22.248 -6.560  1.00 71.99 ? 282 ASN W O   1 
ATOM   11078 C CB  . ASN E 1 284 ? 63.391  -20.346 -8.076  1.00 77.40 ? 282 ASN W CB  1 
ATOM   11079 C CG  . ASN E 1 284 ? 64.594  -19.561 -7.558  1.00 77.40 ? 282 ASN W CG  1 
ATOM   11080 O OD1 . ASN E 1 284 ? 65.439  -20.098 -6.842  1.00 77.40 ? 282 ASN W OD1 1 
ATOM   11081 N ND2 . ASN E 1 284 ? 64.670  -18.281 -7.919  1.00 77.40 ? 282 ASN W ND2 1 
ATOM   11082 N N   . LEU E 1 285 ? 61.458  -22.787 -8.710  1.00 52.03 ? 283 LEU W N   1 
ATOM   11083 C CA  . LEU E 1 285 ? 60.111  -23.324 -8.807  1.00 52.03 ? 283 LEU W CA  1 
ATOM   11084 C C   . LEU E 1 285 ? 60.052  -24.609 -7.994  1.00 52.03 ? 283 LEU W C   1 
ATOM   11085 O O   . LEU E 1 285 ? 59.253  -24.720 -7.074  1.00 52.03 ? 283 LEU W O   1 
ATOM   11086 C CB  . LEU E 1 285 ? 59.727  -23.596 -10.268 1.00 24.42 ? 283 LEU W CB  1 
ATOM   11087 C CG  . LEU E 1 285 ? 58.386  -24.296 -10.526 1.00 24.42 ? 283 LEU W CG  1 
ATOM   11088 C CD1 . LEU E 1 285 ? 57.359  -23.976 -9.470  1.00 24.42 ? 283 LEU W CD1 1 
ATOM   11089 C CD2 . LEU E 1 285 ? 57.884  -23.866 -11.871 1.00 24.42 ? 283 LEU W CD2 1 
ATOM   11090 N N   . ASN E 1 286 ? 60.914  -25.569 -8.319  1.00 74.20 ? 284 ASN W N   1 
ATOM   11091 C CA  . ASN E 1 286 ? 60.929  -26.840 -7.607  1.00 74.20 ? 284 ASN W CA  1 
ATOM   11092 C C   . ASN E 1 286 ? 60.894  -26.590 -6.108  1.00 74.20 ? 284 ASN W C   1 
ATOM   11093 O O   . ASN E 1 286 ? 60.096  -27.189 -5.379  1.00 74.20 ? 284 ASN W O   1 
ATOM   11094 C CB  . ASN E 1 286 ? 62.177  -27.649 -7.957  1.00 70.51 ? 284 ASN W CB  1 
ATOM   11095 C CG  . ASN E 1 286 ? 62.100  -29.078 -7.442  1.00 70.51 ? 284 ASN W CG  1 
ATOM   11096 O OD1 . ASN E 1 286 ? 61.249  -29.855 -7.870  1.00 70.51 ? 284 ASN W OD1 1 
ATOM   11097 N ND2 . ASN E 1 286 ? 62.980  -29.426 -6.512  1.00 70.51 ? 284 ASN W ND2 1 
ATOM   11098 N N   . ALA E 1 287 ? 61.768  -25.701 -5.649  1.00 85.72 ? 285 ALA W N   1 
ATOM   11099 C CA  . ALA E 1 287 ? 61.816  -25.359 -4.234  1.00 85.72 ? 285 ALA W CA  1 
ATOM   11100 C C   . ALA E 1 287 ? 60.403  -25.009 -3.784  1.00 85.72 ? 285 ALA W C   1 
ATOM   11101 O O   . ALA E 1 287 ? 59.799  -25.752 -3.024  1.00 85.72 ? 285 ALA W O   1 
ATOM   11102 C CB  . ALA E 1 287 ? 62.749  -24.177 -4.009  1.00 83.65 ? 285 ALA W CB  1 
ATOM   11103 N N   . ILE E 1 288 ? 59.881  -23.891 -4.281  1.00 33.69 ? 286 ILE W N   1 
ATOM   11104 C CA  . ILE E 1 288 ? 58.540  -23.430 -3.936  1.00 33.69 ? 286 ILE W CA  1 
ATOM   11105 C C   . ILE E 1 288 ? 57.502  -24.543 -3.738  1.00 33.69 ? 286 ILE W C   1 
ATOM   11106 O O   . ILE E 1 288 ? 56.615  -24.407 -2.899  1.00 33.69 ? 286 ILE W O   1 
ATOM   11107 C CB  . ILE E 1 288 ? 57.992  -22.429 -5.005  1.00 34.76 ? 286 ILE W CB  1 
ATOM   11108 C CG1 . ILE E 1 288 ? 58.895  -21.203 -5.084  1.00 34.76 ? 286 ILE W CG1 1 
ATOM   11109 C CG2 . ILE E 1 288 ? 56.583  -21.967 -4.649  1.00 34.76 ? 286 ILE W CG2 1 
ATOM   11110 C CD1 . ILE E 1 288 ? 58.543  -20.268 -6.201  1.00 34.76 ? 286 ILE W CD1 1 
ATOM   11111 N N   . ASN E 1 289 ? 57.592  -25.638 -4.490  1.00 72.77 ? 287 ASN W N   1 
ATOM   11112 C CA  . ASN E 1 289 ? 56.610  -26.714 -4.333  1.00 72.77 ? 287 ASN W CA  1 
ATOM   11113 C C   . ASN E 1 289 ? 56.925  -27.638 -3.168  1.00 72.77 ? 287 ASN W C   1 
ATOM   11114 O O   . ASN E 1 289 ? 56.120  -28.499 -2.811  1.00 72.77 ? 287 ASN W O   1 
ATOM   11115 C CB  . ASN E 1 289 ? 56.484  -27.527 -5.622  1.00 46.95 ? 287 ASN W CB  1 
ATOM   11116 C CG  . ASN E 1 289 ? 55.501  -26.918 -6.600  1.00 46.95 ? 287 ASN W CG  1 
ATOM   11117 O OD1 . ASN E 1 289 ? 55.777  -26.815 -7.796  1.00 46.95 ? 287 ASN W OD1 1 
ATOM   11118 N ND2 . ASN E 1 289 ? 54.341  -26.520 -6.097  1.00 46.95 ? 287 ASN W ND2 1 
ATOM   11119 N N   . LEU E 1 290 ? 58.105  -27.454 -2.586  1.00 92.42 ? 288 LEU W N   1 
ATOM   11120 C CA  . LEU E 1 290 ? 58.544  -28.235 -1.435  1.00 92.42 ? 288 LEU W CA  1 
ATOM   11121 C C   . LEU E 1 290 ? 58.446  -27.402 -0.144  1.00 92.42 ? 288 LEU W C   1 
ATOM   11122 O O   . LEU E 1 290 ? 58.300  -27.952 0.948   1.00 92.42 ? 288 LEU W O   1 
ATOM   11123 C CB  . LEU E 1 290 ? 59.990  -28.710 -1.626  1.00 55.03 ? 288 LEU W CB  1 
ATOM   11124 C CG  . LEU E 1 290 ? 60.271  -29.870 -2.585  1.00 55.03 ? 288 LEU W CG  1 
ATOM   11125 C CD1 . LEU E 1 290 ? 61.754  -30.205 -2.560  1.00 55.03 ? 288 LEU W CD1 1 
ATOM   11126 C CD2 . LEU E 1 290 ? 59.465  -31.086 -2.171  1.00 55.03 ? 288 LEU W CD2 1 
ATOM   11127 N N   . CYS E 1 291 ? 58.522  -26.078 -0.284  1.00 25.26 ? 289 CYS W N   1 
ATOM   11128 C CA  . CYS E 1 291 ? 58.461  -25.143 0.837   1.00 25.26 ? 289 CYS W CA  1 
ATOM   11129 C C   . CYS E 1 291 ? 57.399  -25.552 1.841   1.00 25.26 ? 289 CYS W C   1 
ATOM   11130 O O   . CYS E 1 291 ? 56.201  -25.490 1.570   1.00 25.26 ? 289 CYS W O   1 
ATOM   11131 C CB  . CYS E 1 291 ? 58.174  -23.735 0.323   1.00 74.94 ? 289 CYS W CB  1 
ATOM   11132 S SG  . CYS E 1 291 ? 58.210  -22.465 1.589   1.00 74.94 ? 289 CYS W SG  1 
ATOM   11133 N N   . PRO E 1 292 ? 57.835  -25.965 3.026   1.00 35.04 ? 290 PRO W N   1 
ATOM   11134 C CA  . PRO E 1 292 ? 56.998  -26.416 4.141   1.00 35.04 ? 290 PRO W CA  1 
ATOM   11135 C C   . PRO E 1 292 ? 55.977  -25.421 4.647   1.00 35.04 ? 290 PRO W C   1 
ATOM   11136 O O   . PRO E 1 292 ? 56.104  -24.935 5.768   1.00 35.04 ? 290 PRO W O   1 
ATOM   11137 C CB  . PRO E 1 292 ? 58.022  -26.764 5.215   1.00 35.38 ? 290 PRO W CB  1 
ATOM   11138 C CG  . PRO E 1 292 ? 59.167  -25.848 4.898   1.00 35.38 ? 290 PRO W CG  1 
ATOM   11139 C CD  . PRO E 1 292 ? 59.254  -25.930 3.410   1.00 35.38 ? 290 PRO W CD  1 
ATOM   11140 N N   . LEU E 1 293 ? 54.950  -25.144 3.850   1.00 39.98 ? 291 LEU W N   1 
ATOM   11141 C CA  . LEU E 1 293 ? 53.920  -24.178 4.233   1.00 39.98 ? 291 LEU W CA  1 
ATOM   11142 C C   . LEU E 1 293 ? 52.692  -24.447 3.376   1.00 39.98 ? 291 LEU W C   1 
ATOM   11143 O O   . LEU E 1 293 ? 52.828  -24.867 2.226   1.00 39.98 ? 291 LEU W O   1 
ATOM   11144 C CB  . LEU E 1 293 ? 54.436  -22.763 3.948   1.00 36.28 ? 291 LEU W CB  1 
ATOM   11145 C CG  . LEU E 1 293 ? 54.561  -21.692 5.036   1.00 36.28 ? 291 LEU W CG  1 
ATOM   11146 C CD1 . LEU E 1 293 ? 55.447  -22.143 6.189   1.00 36.28 ? 291 LEU W CD1 1 
ATOM   11147 C CD2 . LEU E 1 293 ? 55.140  -20.451 4.382   1.00 36.28 ? 291 LEU W CD2 1 
ATOM   11148 N N   . PRO E 1 294 ? 51.480  -24.198 3.907   1.00 40.53 ? 292 PRO W N   1 
ATOM   11149 C CA  . PRO E 1 294 ? 50.225  -24.418 3.170   1.00 40.53 ? 292 PRO W CA  1 
ATOM   11150 C C   . PRO E 1 294 ? 50.306  -23.928 1.717   1.00 40.53 ? 292 PRO W C   1 
ATOM   11151 O O   . PRO E 1 294 ? 50.835  -22.844 1.457   1.00 40.53 ? 292 PRO W O   1 
ATOM   11152 C CB  . PRO E 1 294 ? 49.203  -23.638 3.998   1.00 26.29 ? 292 PRO W CB  1 
ATOM   11153 C CG  . PRO E 1 294 ? 49.688  -23.854 5.377   1.00 26.29 ? 292 PRO W CG  1 
ATOM   11154 C CD  . PRO E 1 294 ? 51.200  -23.638 5.240   1.00 26.29 ? 292 PRO W CD  1 
ATOM   11155 N N   . LYS E 1 295 ? 49.771  -24.710 0.775   1.00 22.00 ? 293 LYS W N   1 
ATOM   11156 C CA  . LYS E 1 295 ? 49.842  -24.337 -0.640  1.00 18.46 ? 293 LYS W CA  1 
ATOM   11157 C C   . LYS E 1 295 ? 48.644  -24.695 -1.516  1.00 19.63 ? 293 LYS W C   1 
ATOM   11158 O O   . LYS E 1 295 ? 48.834  -25.165 -2.618  1.00 24.08 ? 293 LYS W O   1 
ATOM   11159 C CB  . LYS E 1 295 ? 51.107  -24.960 -1.249  1.00 22.18 ? 293 LYS W CB  1 
ATOM   11160 C CG  . LYS E 1 295 ? 52.407  -24.383 -0.699  1.00 44.08 ? 293 LYS W CG  1 
ATOM   11161 C CD  . LYS E 1 295 ? 53.611  -25.198 -1.120  1.00 30.09 ? 293 LYS W CD  1 
ATOM   11162 C CE  . LYS E 1 295 ? 53.620  -26.549 -0.430  1.00 36.63 ? 293 LYS W CE  1 
ATOM   11163 N NZ  . LYS E 1 295 ? 54.764  -27.408 -0.849  1.00 50.14 ? 293 LYS W NZ  1 
ATOM   11164 N N   . PRO E 1 296 ? 47.407  -24.424 -1.066  1.00 48.79 ? 294 PRO W N   1 
ATOM   11165 C CA  . PRO E 1 296 ? 46.156  -24.722 -1.789  1.00 40.44 ? 294 PRO W CA  1 
ATOM   11166 C C   . PRO E 1 296 ? 46.017  -24.526 -3.307  1.00 51.58 ? 294 PRO W C   1 
ATOM   11167 O O   . PRO E 1 296 ? 45.015  -24.941 -3.886  1.00 50.93 ? 294 PRO W O   1 
ATOM   11168 C CB  . PRO E 1 296 ? 45.108  -23.916 -1.021  1.00 45.73 ? 294 PRO W CB  1 
ATOM   11169 C CG  . PRO E 1 296 ? 45.888  -22.804 -0.454  1.00 48.84 ? 294 PRO W CG  1 
ATOM   11170 C CD  . PRO E 1 296 ? 47.124  -23.513 0.049   1.00 39.29 ? 294 PRO W CD  1 
ATOM   11171 N N   . TRP E 1 297 ? 46.994  -23.910 -3.961  1.00 46.42 ? 295 TRP W N   1 
ATOM   11172 C CA  . TRP E 1 297 ? 46.899  -23.710 -5.411  1.00 41.04 ? 295 TRP W CA  1 
ATOM   11173 C C   . TRP E 1 297 ? 48.140  -24.189 -6.177  1.00 48.06 ? 295 TRP W C   1 
ATOM   11174 O O   . TRP E 1 297 ? 49.262  -24.200 -5.655  1.00 50.51 ? 295 TRP W O   1 
ATOM   11175 C CB  . TRP E 1 297 ? 46.621  -22.226 -5.751  1.00 31.87 ? 295 TRP W CB  1 
ATOM   11176 C CG  . TRP E 1 297 ? 46.721  -21.296 -4.580  1.00 44.94 ? 295 TRP W CG  1 
ATOM   11177 C CD1 . TRP E 1 297 ? 45.711  -20.570 -4.011  1.00 44.72 ? 295 TRP W CD1 1 
ATOM   11178 C CD2 . TRP E 1 297 ? 47.868  -21.103 -3.759  1.00 43.18 ? 295 TRP W CD2 1 
ATOM   11179 N NE1 . TRP E 1 297 ? 46.160  -19.947 -2.873  1.00 35.71 ? 295 TRP W NE1 1 
ATOM   11180 C CE2 . TRP E 1 297 ? 47.481  -20.260 -2.692  1.00 47.37 ? 295 TRP W CE2 1 
ATOM   11181 C CE3 . TRP E 1 297 ? 49.189  -21.570 -3.815  1.00 46.15 ? 295 TRP W CE3 1 
ATOM   11182 C CZ2 . TRP E 1 297 ? 48.363  -19.877 -1.687  1.00 33.99 ? 295 TRP W CZ2 1 
ATOM   11183 C CZ3 . TRP E 1 297 ? 50.069  -21.192 -2.819  1.00 44.00 ? 295 TRP W CZ3 1 
ATOM   11184 C CH2 . TRP E 1 297 ? 49.651  -20.351 -1.762  1.00 39.10 ? 295 TRP W CH2 1 
ATOM   11185 N N   . LYS E 1 298 ? 47.926  -24.586 -7.424  1.00 30.57 ? 296 LYS W N   1 
ATOM   11186 C CA  . LYS E 1 298 ? 49.014  -25.060 -8.241  1.00 32.04 ? 296 LYS W CA  1 
ATOM   11187 C C   . LYS E 1 298 ? 50.058  -23.968 -8.320  1.00 30.20 ? 296 LYS W C   1 
ATOM   11188 O O   . LYS E 1 298 ? 49.727  -22.820 -8.600  1.00 32.24 ? 296 LYS W O   1 
ATOM   11189 C CB  . LYS E 1 298 ? 48.491  -25.409 -9.628  1.00 25.40 ? 296 LYS W CB  1 
ATOM   11190 C CG  . LYS E 1 298 ? 47.569  -26.618 -9.640  1.00 18.52 ? 296 LYS W CG  1 
ATOM   11191 C CD  . LYS E 1 298 ? 48.338  -27.913